1HZOA

Structure of class a cephalosporinase from proteus vulgaris k1
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
264
structure length
264
Chain Sequence
NTIEEQLNTLEKYSQGRLGVALINTEDNSQITYRGEERFAMASTSKVMAVAAVLKASEKQAGLLDKNITIKKSDLVAYSPITEKHLTTGMTLAELSAATLQYSDNTAMNKILDYLGGPAKVTQFARSINDVTYRLDRKEPELNTAIHGDPRDTTSPIAMAKSLQALTLGDALGQSQRQQLVTWLKGNTTGDNSIKAGLPKHWVVGDKTGSGDYGTTNDIAVIWPENHAPLILVVYFTQQEQNAKYRKDIIAKAAEIVTKEISNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-LACTAMASE
publication title Structure of an extended-spectrum class A beta-lactamase from Proteus vulgaris K1.
pubmed doi rcsb
source organism Proteus vulgaris
total genus 93
structure length 264
sequence length 264
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2001-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1hzoA00
1NYMA 5TR7A 3HUOA 4KQRA 2JBFA 2XH9A 4OOMA 5EECA 4BENA 2UWXA 3IT9A 2HDSA 3N6IA 2ZQDA 5DVAA 1YLPA 3SOIA 2XD5A 4OQHA 3O3VA 2XEPA 2JE5A 4ZJ2A 1CI8A 3IWQA 3OPRA 4JXWA 3W8KA 1JWVA 1KE4A 3FYZA 2J8YA 4ZAMA 3WS5A 4DXBA 1ES2A 3IXBA 1MWUA 1CI9A 3IF6A 2OV5A 5HAPA 1W79A 3A3IA 5DTSA 4OKPA 3SS3A 1U60A 5G18A 1FCNA 1NJ4A 5DF8A 3IWIA 4OQIA 5TGFA 4E3LA 2VGKA 1BLHA 1EWZA 3VFHA 2QPNA 3HLWA 1BZAA 3ZCZA 3ZVTA 1RGYA 5IHVA 4JF4A 4KZ6A 5A92A 1XGIA 4DXCA 5FQ9A 4DF6A 1YM1A 4E3MA 1GHPA 1HZOA 3TG9A 2V2FF 4FH4A 4GD6A 4NETA 2WGVA 3ZFZA 5GHYA 3UPNA 2XF3A 3VP0A 4R3BA 1JWPA 3N8LA 3RJUA 4UA6A 1MWTA 1GA0A 3WS2A 3UDXA 4BLMA 4S2NA 1E3UA 3WS4A 4DE3A 3MKFA 3IHAA 5CHJA 1KE0A 1DJCA 1ZG6A 1HTZA 4X69A 1DJAA 3A3JA 1L0GA 5CGWA 4C75A 2JCHA 4KZBA 1MPLA 2X71A 2CC1A 3FZCA 4Q8IA 2QMIA 2WYXA 1ES4A 4R4RA 3VP1A 5GHZA 4R1GA 1ONGA 4S2JA 4FSFA 4PM8A 4B4ZA 4DE2A 1NZOA 4OP8A 2XQZA 2ZC6B 3IXGA 4GB7A 1PWCA 3GV9A 3GMWA 4JPMA 5CECA 4X53A 3MXSA 2RCXA 3GSGA 2G2WA 2WADA 3TOIA 4HEFA 3ZG0A 4UA9A 3W4QA 1GHIA 2EFUA 4JBFA 3WS0A 1KGGA 4JKTA 1S6RA 5TFQA 5GLCA 4FH2A 4RX3A 1KVMA 4X6TA 3EQUA 1N4OA 5CTMA 4K91A 3C4PA 4EWFA 3M6BA 5BOHA 2WUQA 3PAGA 1KGEA 3Q7ZA 5E2FA 5HL1A 3E2LA 4DRTA 1YLZA 2JC7A 1IYPA 1L0FA 4JXGA 4C3QA 3VOZA 1KDSA 3UE0A 5E2GA 3D4FA 2EFXA 1DY6A 1LI9A 2ZD8A 3IHBA 1ONHA 4IBXA 3V39A 3A3FA 3PBOA 4B4XA 1W7FA 1JWZA 4KQQA 4MBHA 2ZLYA 5CERA 1TVFA 4N9LA 5FDHA 4S2OA 5E2EA 3VFFA 1S0WA 3BFEA 3I7JA 4S2IA 1NZUA 3LY4A 5EVIA 4PMAA 4C6YA 4K0XA 1BLSA 2RL3A 4LV3A 4UHUA 1Z6FA 1K56A 4KG2A 3IH9A 1PW8A 2Y2JA 3FKWA 1K4EA 2Q9NA 5JYPA 4IVIA 4Y0OA 2DCFA 4KENB 4DE1A 3CZDA 1SDNA 4LENA 1G6AA 2EX6A 3ZG5A 3C4OA 3SS4A 4OPRA 1G68A 1XKZA 2EX8A 3BFGA 5AQBA 3V50A 1ESUA 4PM5A 3HUMA 3P98A 4DE0A 1YT4A 3HVFA 3OC2A 5FI6A 3G2YA 2WZXA 5FI7A 3ITBA 4KG5A 1NYYA 2FFYA 3DW0A 4KZ3A 3SH8A 3Q07A 2P9VA 5J8XA 4QJGA 1XA7A 4LV1A 3C7VA 5HARA 3RXWA 3WRTA 4ZJ1A 2V20A 3N7WA 5DF9A 4GDNA 2XFSA 3SS5A 3UE1A 4KZ4A 5E2HA 2WGWA 4K0WA 1FQGA 5F1GA 4QB8A 3Q81A 3Q82A 3HLCA 4P6BA 2ZMAA 1TDGA 1XA1A 2A3UA 4E3OA 4E3NA 2DRWA 4BJPA 1ERQA 4XXRA 3MFDA 2WKHA 2Y2LA 3QNCA 5AQ7A 1PZPA 3C5AA 1PWGA 2C6WB 3C7UA 1IYQA 1K25A 2BLSA 3S4XA 1NY0A 4QU3A 3MZEA 4OPZA 3FKVA 3BFFA 3PTEA 2G2UA 1ES3A 3Q1FA 5CEDA 5CGXA 1FOFA 1SDEA 3AGFA 3HLEA 3VP3A 2ZC5B 2I72A 5F82A 3O88A 1CEGA 4LCLA 3QHYA 3V3RA 1L0EA 4PPRA 4YINA 1E4DA 3BLSA 5KSHA 1BLCA 3HBRA 4OH0A 3N8RA 5FASA 2HDUA 5KSCA 4ZDXA 2V1ZA 3BRMA 2HDRA 3O86A 3CMZA 3PAEA 2Q9MA 2IWBA 4YFMA 4OOLA 4OPYA 3BFCA 3PBSA 5FAQA 5F1FA 1PWDA 3NC8A 2J9OA 4EUZA 3WS1A 4BD0A 1YQSA 2Z2MB 1K54C 1Y54A 3TSGA 3JYIA 2B5RA 3M2JA 3ZNTA 3IQAA 1YLTA 4S2NC 3UO9A 4WMCD 1RCJA 1KDWA 4PM7A 3LY3A 2IWDA 5JYOA 5CXWA 3BECA 4O7DA 2Y4AA 4A5RA 5U47A 3RXXA 1LL5A 5CTNA 1QMEA 2FFFB 2WK0A 2ZQAA 4WZ5C 1NRFA 5CRFA 1XP4A 1IYOA 3CG5A 4N9KA 1XX2A 2Y55A 1GCEA 3M6HA 2EX2A 1MBLA 5FQMA 1O7EA 4KZ7A 5I94A 3DWZA 3GTCA 2ZQCA 3HUNA 1Q2QA 1DJBA 1XGJA 2OLVA 2WAFA 3BEBA 1IKIA 1PW1A 1YMSA 1JTGA 2ZQ8A 4GKUA 3PBTA 2BG1A 3BM6A 1VM1A 2QZ6A 5FQJA 1N9BA 2VGJA 3BYDA 2H10A 3IF6B 3ZG9B 2ZQ9A 4MBFA 1Q2PA 3Q7VA 1L2SA 4GD8A 4OVDA 5GLBA 3GVBA 2ZM2A 1H8YA 3AGDA 5EE8A 4U3TA 3AGEA 4ZBEA 1BSGA 2Y2IA 1BTLA 4XUXA 3ZGAB 4OQGA 5FSRA 1YLYA 3MZDA 1O07A 4KG6A 4N92A 2X02A 2OLUA 2X01A 3ZG7B 3ZVWA 3SH7A 4MNRA 1EI5A 1TDLA 3HLBA 2PU2A 5M18A 2WZZA 4IEDA 5FQIA 2Z2LB 2ZC7A 3WRZA 5M1AA 5HAQA 3G30A 4EBLA 1GHMA 1BUEA 4WELA 4X56A 1KGFA 1ESIA 4BQMA 2Y2HA 3GQZA 3E2KA 4HESA 3B3XA 3S1YA 1MXOA 3PBRA 1HD8A 1M6KA 4F94A 5CHUA 4GDBA 1YLWA 1H5XA 4Y0UA 5DTTA 3A3DA 1K57A 1K55C 2HP9A 3HLDA 2WKEA 2Y2GA 1W8QA 2IWCA 5HAIA 1MY8A 4JF6A 3UDFA 5E43A 4IVKA 3NBLA 3NI9A 4PM6A 2XK1A 3UN7A 2EXBA 3UE3A 2Y59A 4E6WA 3CJMA 3HLGA 5EUAA 1FSYA 4DDYA 3EQVA 1SCWA 3M2KA 3A3EA 2WGIA 1WYBA 1E3UD 4HBTA 3W4OA 1BLPA 3FV7A 5FI2A 5FQQA 3UDIA 3ZG8B 3OCNA 2Y91A 4OLDA 1CEFA 5A91A 3WWXA 5FAPA 4OP5A 2H5SA 3VP2A 2H0YA 1W8YA 2ZM0A 1SHVA 1JVJA 3NY4A 4KZ9A 4QD4A 4WEJA 4P0MA 3O87A 1AXBA 2HDQA 1ZKJA 4KZ8A 4N1HA 5CGSA 2GDNA 4R4SA 4WM9A 5KMWA 4X55A 3MXRA 5GHXA 4JF5A 3GRJA 1FCMA 4CPKA 1W5DA 4R3JA 2HP5A 4RYEA 1J9MA 3IF6C 4Z9QA 5F83A 5FATA 1HVBA 3OZHA 2PU4A 4ID4A 4HBUA 4FD8A 4OLGA 3LEZA 3UY6A 1NXYA 4R0QA 4JXSA 2HP6A 4JXVA 1KE3A 1LI0A 2XLNA 2Y2QA 4UAAA 5GLDA 3GR2A 4DDSA 3G4PA 3VP4A 5EVIB 4KQOA 4MLLA 1ZC2A 4ZJ3A 1MWSA 3N8SA 3NDGA 1ALQA 2ZC4B 3HLFA 4P87A 1K38A 2PBYA 3VSLA 1ZG4A 4M3KA 4U0TA 4BD1A 5L2FA 1BULA 1FCOA 4E3JA 3HREA 3IWOA 2Y2MA 3BLMA 1RGZA 5GL9A 4H8RA 3G31A 1WYCA 1CK3A 2ZC3B 2J9PA 2EX9A 3NDEA 4E3KA 1ES5A 3SH9A 5A93A 4WYYA 3MKEA 4OQ0A 4OOYA 3VOYA 1SKFA 1K54A 2ZM8A 3IXDA 1TEMA 5DF7A 5EVID 3MZFA 2P9VB 4QY5A 4S2LA 4EBNA 2H0TA 1K56D 3DTMA 3OPPA 2P74A 4NK3A 4RVAA 4GOGA 4MBKA 4S2KA 2WGWB 3OPLA 4WBGA 3IH8A 1H8ZA 3OPHA 1I2WA 3ITAA 4WZ5A 1IKGA 4D2OA 1EROA 3V3SA 2OSUA 5EOOA 4GN2A 1PIOA 1RP5A 4PM9A 4ZTKA 1K6RA 5CEBA 2Y2PA 4XUZA 4UA7A 3ZHHA 4KZAA 3N4IA 2R9XA 3PBQA 3UNWA 3FWLA 4LV2A 4MEZA 2EXAA 5CHMA 3PBNA 2E8IA 3IF5A 3UPPA 5DTKA 4WZ4A 5A90A 4S2PA 3HL9A 1FSWA 1PZOA 3QNBA 3LCEA 3UPOA 1IEMA 1C3BA 1LHYA 1WE4A 3LO7A 2XD1A 3MBZA 4EQIA 4IBRA 4B88A 4E6XA 5AQAA 2ZJ9A 4E3IA 3ZNYA 1FR6A 1YLJA 4LCMA 4BL2A 3ZDJA 2WAEA 1E25A 1JTDA 1XPBA 2XR0A 2HPBA 3VSKA 5EVIC 2ZQ7A 2WKIA 4S2MA 3ISGA 4GNUA 4P85A 1L0DA 3W4PA 2Y2OA 4RA7A 4WMCA 5EVLA 1XXMA 3DWKA 5KZHA 4CJNA 3BFDA 4N1XA 1PI4A 2DNSA 2J7VA 4LV0A 4DKIA 5M19A 1PI5A 5GLAA 3VMAA 3G2ZA 1MKIA 4BL3A 3OCLA 4Y7PA 1OMEA 5HW3A 3IXHA 4WEKA 4U0XA 1K57C 1M40A 1FR1A 4EV4A 1BT5A 5FA7A 1MWRA 2XFTA 3NCKA 4X68A 4EBPA 3V5MA 1LL9A 1VQQA 1LLBA 1KVLA 2R9WA 4R23A 3P09A 1QMFA 5HX9A 1K55A 1PYYA 1IYSA 1I2SA 1YMXA 3G32A 4QY6A 5EPHA 3G35A 5FQKA 4QHCA 4JLFA 2Y2NA 2C5WB 4RX2A 5FAOA 4Y0TA 1GA9A 1I5QA 5EOEA 5HFOA 2XGNA 2Y2KA 4GZBA 4OONA 5AQ9A 1ERMA 3G34A 3NIAA 4FCFA 1K6SA 4KZ5A 4L0LA 5D3OA 3S22A 1IELA 1K4FA 2A49A 2XDMA 3Q7VB 4OPQA
chains in the Genus database with same CATH superfamily
3T1QB 3E0YA 4GCZA 4OOMA 2UWXA 1YLPA 2XEPA 4K08A 1CI8A 3OPRA 3NHQA 1JWVA 5F69A 3WS5A 3IXBA 4GS9B 5HAPA 1FILA 1YAXA 5TGFA 3SS3A 4OQIA 2W27A 3HLWA 4MDZA 1RGYA 3T1SA 1H3QA 3JVUA 2B18A 2JKFA 2V2FF 2WGVA 3UPNA 2J80A 2XF3A 3VP0A 1JWPA 1NLZA 4BLMA 4S2NA 1ZTUA 5CHJA 2K2NA 5FDSA 1ZG6A 2ZOHA 2CC1A 4Q8IA 3MFXA 4R4RA 4R1GA 4FSFA 4DE2A 3LI9A 3GV9A 1S1ZA 4QWOA 2ZL1B 4HP9A 3LICA 5L09A 5HSQA 2WKQA 2EFUA 4JBFA 4JKTA 1KVMA 3EQUA 4K91A 4EWFA 3M6BA 4NXGA 1KGEA 2O99A 5HL1A 1IYPA 2IA2A 2JC7A 4JXGA 3D4FA 1ONHA 4IBXA 4B4XA 1VEUB 1W7FA 5CERA 2BTFP 3EGXC 4R3AA 1D06A 3LY4A 4K0XA 1BLSA 5HD5A 4DMZA 1L3LA 1K4EA 5JYPA 1XKZA 4PM5A 3HUMA 3P98A 4MN5A 5AJGA 4KZ3A 3TW8A 1XA7A 3C7VA 4EEUA 3SS5A 4Z1WA 5E2HA 5F1GA 4QB8A 3Q81A 4P6BA 3QP1A 2GJ3A 2DRWA 2VV7A 1PZPA 3C5AA 3C7UA 1K25A 3PTEA 1OT6A 2G2UA 1HLUP 2AVXA 1FOFA 3AGFA 2A2LA 3KSHA 3HLEA 1EW0A 3HJKA 1BLCA 2HJEA 4O8GA 5FASA 3KO6A 3LEQA 3PBSA 3DAVA 3OOVA 4GHIB 1LT0A 4BD0A 1F2KA 3TSGA 3FPVA 3LY3A 3TJZC 4A5RA 3RXXA 5K5BA 1QMEA 1IFQA 4FOFA 4WZ5C 3ZYTA 1IYOA 5TJJA 3CHWP 4N9KA 4LRZE 1GCEA 2VKSA 1MBLA 5FQMA 1G6OA 4KZ7A 5I94A 1PNEA 3B33A 1DJBA 3BEBA 2QYBA 2JKRI 2M1CA 4GKUA 3BM6A 1P0ZA 2VGJA 2V0WA 1BYWA 3Q7VA 4GD8A 3GVBA 1TD5A 5A8BA 1PFLA 1H8YA 5EE8A 4ZBEA 2Y2IA 1YLYA 4NXEA 4DN0A 1O07A 4EQ1A 4L9FA 3ZVWA 2X01A 3ZG7B 3L7HA 4IEDA 3UE6A 5M1AA 3G30A 4EBLA 1BUEA 4WELA 1MC0A 3LR3A 1KGFA 3B3XA 1MXOA 1HD8A 4F94A 2HGVA 4Y0UA 1P9RA 5DTTA 1K55C 4Y15A 2Y2GA 2IWCA 2JKRM 5E43A 2QJ7A 3UE3A 2Y59A 1SCWA 1TS0A 2WGIA 5CX7A 2QJ5A 4HBTA 4PHTA 1BLPA 3W4OA 3UMEA 3H82A 2Y91A 3WWXA 5TBMA 3VP2A 1SHVA 4I3JA 4KZ9A 3UMDA 3O87A 4WM9A 2W3EA 1P97A 1FCMA 3FPWA 5F83A 1J9MA 3OZHA 3MJQA 2VLGA 3L9KA 4FD8A 1NXYA 4R0QA 2HP6A 4UAAA 5GLDA 4LFUA 3GR2A 4IUKA 4DDSA 5I5LA 4ZJ3A 2D02A 2HV1A 1ZG4A 4M3KA 5L2FA 2W3HA 4O0PA 2PD8A 4XT2A 1CK3A 1ES5A 1K54A 5EVID 2PR5A 4QY5A 4S2LA 4EBNA 2H0TA 1K56D 3TE8A 3E4QA 4RVAA 4HIAA 4GOGA 4S2KA 3V3SA 2OSUA 1UWPX 4GN2A 3PBQA 4MEZA 3BQ8A 2E8IA 3IF5A 4FUWA 5DTKA 5A90A 1ZHHB 2B95A 5AVEA 1T1BA 4I3IA 4UQIS 3LO7A 2XD1A 2ZOIA 4EU0A 4IBRA 4E6XA 1H0MA 1YLJA 4GS9A 3LI8A 1E25A 1JTDA 1G5UA 2INWA 4GNUA 1XJ4A 3K3DA 4HJ3A 1XXMA 3RFBA 3P7NA 1VB6A 1PI4A 4G3WA 1CF0A 2J7VA 2UV0E 4DKIA 1PI5A 3VMAA 3G2ZA 4ARZA 3C30A 1M40A 1UWNX 1BT5A 3KSFA 3NCKA 4PAUA 2PAVP 3DBAA 1KVLA 3P09A 5HX9A 1PYYA 3G32A 1F9IA 4QHCA 2PYRA 2XGNA 4GZBA 4OONA 2LB5A 3G34A 1K6SA 4L0LA 2XDMA 3Q7VB 3T4OA 5EFWA 4KQRA 2K31A 2H28A 4BENA 3IT9A 3N6IA 2W1TA 1H8MA 2XD5A 3IWQA 3W8KA 1KE4A 4DXBA 4EETB 1ES2A 1T18A 1MWUA 2QHKA 3NJAA 4CLCD 3A3IA 5DTSA 5IT5A 1FCNA 5DF8A 3ICYA 4E3LA 2VGKA 2OAQ1 1BLHA 3ZCZA 5IHVA 4L9EA 4JF4A 4KZ6A 5A92A 4DXCA 4DF6A 1YM1A 1HZOA 1TF1A 4GD6A 5GHYA 4R3BA 1GA0A 2G7UA 3WS4A 4DE3A 3H82B 5HPFA 2QMIA 5GHZA 1DP9A 4PM8A 4B4ZA 1NZOA 4OP8A 2XQZA 2ZC6B 3IXGA 2ZBBA 4JPMA 1CQAA 3LIBA 2OOLA 3MXSA 3TOIA 3LR5A 2O9BA 3W4QA 4IJGA 2PYPA 3WS0A 2DMWA 5F6AA 4EERA 2PHYA 5GLCA 4RX3A 1N4OA 5CTMA 3C4PA 5BOHA 5E2FA 5FL3A 1SKOA 4C3QA 4Q0IA 3UE0A 5E2GA 4EXOA 2EFXA 2P08A 1F5MA 2ZLYA 4XT2B 3CUEC 1AWIA 4S2OA 5E2EA 3VFFA 5HDCA 1OTAA 3T50A 5EVIA 1GSWA 1ODVA 1Z6FA 1K56A 2D01A 4KG2A 3IH9A 3H7WA 3FKWA 3CAXA 4IVIA 2DCFA 4KENB 4DE1A 3CZDA 4X1MA 3ZG5A 4UQIM 1G68A 3LR4A 5FI6A 2WZXA 4KG5A 1NYYA 3DW0A 3Q07A 3CI6A 3BWLA 5HWTA 3T4QA 3O5YA 3WRTA 4KZ4A 2WGWA 3Q82A 2Z6CA 3HLCA 2ZMAA 2A3UA 5HL6A 1ERQA 2WKHA 3QNCA 5AQ7A 1IYQA 3S4XA 4QU3A 3MZEA 3C8CA 4OPZA 3BFFA 1ES3A 5CEDA 1SDEA 3VP3A 3U4LP 2I72A 5F82A 3O88A 4LCLA 1MZUA 4PPRA 3BLSA 5KSHA 5KSCA 4ZDXA 2E8JA 3BRMA 2HDRA 3O86A 3T12B 3MR0A 4OPYA 5FAQA 4ARZB 2XSSA 4EUZA 3WS1A 2Z2MB 1K54C 2KX6A 1RCJA 3GDIA 2Y4AA 4NXBA 2FFFB 5CRFA 3T4JA 1XX2A 3M6HA 1WA9A 3DWZA 1KOUA 3GTCA 2ZQCA 3BW6A 2W1TB 1JTGA 5IS1A 4ESPA 1N9BA 3BYDA 3ZG9B 5J4EA 1Q2PA 1L2SA 1LSVA 2ZM2A 4JGQA 3AGEA 3JPUA 4XUXA 4OQGA 3B47A 4R6LA 4EESA 4RQ9A 2X02A 2K7SA 4I38A 2XROA 2MJ6A 5HAQA 3UB9A 5HD3A 4BQMA 3F1OA 3E2KA 4HESA 3S1YA 4Y5FA 5CHUA 3LIEA 3EWKA 3A3DA 3UB6A 2HP9A 1Z09A 3UN7A 3HLGA 1FSYA 3EQVA 3M2KA 4LGWA 2XRNA 1Y28A 1E3UD 2O9CA 3FV7A 3OCNA 5A91A 1CEFA 2PR6A 2H0YA 1W8YA 4WL9A 3NY4A 4QD4A 3DTIA 2BASA 4KZ8A 1ZKJA 4HQAA 3K2NA 5CGSA 4R4SA 4X55A 1SKOB 4G3KA 3GRJA 4CPKA 1W5DA 3NECA 4EW7A 3IS2A 1HVBA 4OLGA 2JKGA 1KE3A 1LI0A 2XLNA 1K0KA 1LSWA 2V1BA 5EVIB 1OTIA 4KQOA 4MLLA 1ZC2A 1MWSA 1X0OA 4UEYA 2ZC4B 3HLFA 5HWWA 4GLQA 1K38A 3H7WB 4U0TA 4R70A 1BULA 3EEAA 2Y2MA 1UGUA 3BLMA 3KX0X 3G31A 2J9PA 4ETXA 4E3KA 5A93A 4OQ0A 3MQ0A 4MN6A 3IXDA 3DTMA 2J3TD 4MBKA 2WGWB 3UB5P 3R7WA 1I2WA 3ITAA 1EROA 5EOOA 4ZTKA 3BY8A 3MF0A 1YKDA 5CHMA 1P9WA 3UPPA 4GW9A 1TS6A 3F1NA 3H9WA 3LCEA 1S4SA 1C3BA 2L4RA 1N9LA 3KSIA 4EQIA 5AQAA 1OTBA 4X1LA 2WAEA 1XPBA 2Y8HA 3VSKA 5EVIC 2ZQ7A 2WKIA 3CUEA 2Y2OA 4RA7A 4YWZA 2PDRA 4R38A 4Y7PA 5HWVA 4WEKA 4U0XA 1K57C 4EV4A 5FA7A 2XFTA 4O01A 2PRFA 1QMFA 1IYSA 1I2SA 2VK3A 3T4KA 5J7EA 4JLFA 2Y2NA 2C5WB 2OWJA 2V1AA 5EOEA 5DJTA 3LFVA 4CLCB 3NULA 4FCFA 5D3OA 1IELA 1K4FA 2A49A 3D3OA 2XH9A 1XJ6A 2HDSA 4BBVA 5DVAA 3SOIA 4OQHA 2JE5A 4NG2A 2OAP1 4JXWA 3FYZA 2A24B 2J8YA 4ZAMA 3IF6A 1CI9A 1VETB 1W79A 5MC7A 1U60A 5G18A 3IWIA 3MQQA 1EWZA 1PRQA 3F1OB 2QPNA 5C5KA 2R78A 4NXFA 2YKHA 1GHPA 4Y2FA 4NETA 3RJUA 4UA6A 1N9NA 3E98A 1E3UA 2XA7S 3IHAA 1KE0A 1DJCA 2Y79A 4KUKA 3MMHA 5CGWA 4C75A 1MPLA 3FZCA 2L0WA 2WYXA 1ES4A 3A0RA 3T4TA 5CECA 3RH8B 4CLCC 2G2WA 2WADA 3CLOA 1GHIA 3IS2B 4F3LA 3KSGA 3T1XA 1XJ2A 4II7A 5DFXA 3PAGA 3E2LA 4I3AA 1KDSA 1DY6A 2ZD8A 3IHBA 3V39A 3PBOA 1JWZA 4MBHA 5DFYA 1TVFA 4N9LA 5FDHA 2WKRA 1S0WA 3BFEA 3I7JA 2I9VA 4S2IA 4PMAA 4LV3A 2LB9A 3DTKA 1V9ZA 1SZVA 2Y2JA 2ZMFA 1G28A 3JVVA 1G6AA 2J3WA 3C4OA 3SS4A 4OPRA 5AQBA 2EX8A 3R7WB 3S7QA 1ESUA 1S4RA 4DE0A 1YPRA 1YT4A 3HVFA 3G2YA 2V0UA 2FFYA 3SH8A 2P9VA 4LV1A 5DKLA 3N7WA 4GDNA 2XFSA 5L8MA 4BBUA 4K0WA 1FQGA 3F1NB 4E3OA 1XA1A 3D72A 4BJPA 3BJNA 1MKMA 3MFDA 2Y2LA 2C6WB 1TS7A 2BLSA 1NY0A 3PHYA 2Q0OA 1NWZA 2ZC5B 1CEGA 3IX3A 1L0EA 4YINA 5AVFA 1E4DA 3HBRA 4OH0A 4IHQA 2HDUA 2L1MA 3CMZA 1OTEA 1D1JA 2Q9MA 4OOLA 5F1FA 1PWDA 1S66L 3JYIA 3M2JA 3IQAA 1YLTA 3UO9A 1KDWA 4PM7A 2IWDA 3RTYA 5CXWA 2O9AA 1LL5A 5CTNA 2V8CA 4IUHA 5DJUA 2ZQAA 3LIFA 1NRFA 2P7JA 3CG5A 2EA9A 1O7EA 1Q2QA 2OLVA 1XGJA 4YNRA 2WAFA 1IKIA 1PW1A 5EM0A 1F98A 2BG1A 1VM1A 5FQJA 5HDSA 2JN7A 4KQDA 4G3VA 3IF6B 3ZQ5A 4ETZA 3G6OA 2XA7M 2FZ0A 3QP2A 4OVDA 5GLBA 1J3WA 4MN7A 3T4SA 4U3TA 5L07A 1BSGA 3VOLA 1BTLA 5FSRA 4HH2A 4KG6A 2OLUA 2QKPA 3LGOA 4MNRA 1EI5A 1TDLA 3HLBA 2PU2A 5M18A 5FQIA 5G4ZA 2Z2LB 3IX8A 1GHMA 2Y2HA 3GQZA 5EV0A 3S7OA 1YLWA 4HI4A 2P04A 1K57A 2WKEA 3KYQA 1W8QA 5HAIA 1MY8A 1S67L 2VV8A 3NBLA 3NI9A 2XK1A 2EXBA 4HJ4A 5EUAA 2HZ5A 1WYBA 1CJFA 4BBTA 3UB7A 3ZG8B 5FQQA 3UDIA 2CMNA 4F3LB 4OP5A 3MS6A 3F1PA 2ZM0A 4N1HA 2GDNA 2ACGA 5KMWA 5GHXA 1W63M 4Z9QA 3IF6C 4HJ6A 5FATA 3KYZA 2PU4A 4ID4A 4HBUA 4PKYA 3LEZA 4E04A 2EWWA 4LRXC 4JXSA 4JXVA 2Y2QA 1D7EA 5HDDA 4BWIA 3NDGA 1ALQA 4P87A 1GSVA 5KIZA 2PBYA 4WF0A 2FH5A 3VSLA 4BD1A 1FCOA 4WN5A 4DJ3A 3IWOA 4HH3A 2KDKA 3MXQA 1WYCA 2EX9A 3NDEA 3SH9A 3SZTA 4WYYA 3VOYA 2VEAA 2ZM8A 4CLCE 2P9VB 3PXPA 4LRYC 3CWFA 3OPPA 5FEGA 2P74A 4D60A 3OPLA 1T19A 2W3FA 3IH8A 4WBGA 4I5SA 5F5YA 1PIOA 3ZHHA 1TS8A 4KZAA 4CLCA 3N4IA 2VX8A 3UNWA 2EXAA 3PBNA 4ZRRA 1T1AA 1OPXA 3HL9A 4LLOB 1FSWA 1PZOA 3QNBA 3UPOA 1IEMA 2VZWA 3LYXA 2A24A 1OJ5A 4E3IA 1FR6A 1XFQA 1VETA 2XR0A 4S2MA 1A0KA 3ISGA 3W4PA 1S1YA 5EVLA 3KYEA 4WUJA 3DWKA 2J3TC 4N1XA 2DNSA 1XFNA 3UB8A 1JNUA 4BL3A 3OCLA 3IX4A 3IXHA 1FR1A 3EOIA 4EBPA 3V5MA 1LL9A 1VQQA 4R23A 1ACFA 3ULFA 4QY6A 4RX2A 1LL8A 4MMNA 3NIAA 3VOZA 3U2AA 1NYMA 5TR7A 3HUOA 2JBFA 4KUOA 5EECA 2ZQDA 2YKFA 2WKPA 3VV4A 1W63Q 3O3VA 3OBFA 4ZJ2A 3EGDC 2OV5A 4OKPA 1NJ4A 3LIAA 3P01A 3NOTC 3VFHA 1BZAA 3ZVTA 4Q0HA 1XGIA 5FQ9A 4B93A 4E3MA 3V67A 3TG9A 4Q0JA 4FH4A 4MCWA 3ZFZA 4H6JA 3IBRA 4B9OA 3N8LA 2B02A 4JGRA 3BY9A 1MWTA 3WS2A 3UDXA 4FTXA 3MKFA 1HTZA 4X69A 1DJAA 2Z6DA 3A3JA 1L0GA 3C2WA 2JCHA 4KZBA 2X71A 3EEHA 3QP8A 3F1PB 3VP1A 1ONGA 4S2JA 4GB7A 1PWCA 3GMWA 4X53A 3FC7A 2RCXA 3GSGA 4HEFA 5J3WA 3ZG0A 4UA9A 3T1RA 2PT7A 1KGGA 4P6ZS 4EUVA 1S6RA 5TFQA 1OT9A 4FH2A 4Y3IA 4X6TA 2WUQA 3Q7ZA 2JHEA 4DRTA 1YLZA 1L0FA 1Y4OA 3MSHA 1STZA 1LI9A 5F68A 3A3FA 4KQQA 3FG8A 2OWHA 1NZUA 3NOPC 4NEED 4C6YA 2QWSA 2RL3A 2VA0A 1YSPA 4UHUA 4ME4A 1PW8A 2Q9NA 4Y0OA 2VJWA 1SDNA 4LENA 2EX6A 1YSQA 1VHMA 3BFGA 3V50A 3HCYA 2NUTC 2ZMVA 3CITA 3OC2A 3LR0A 3QP4A 5FI7A 3ITBA 2GX5A 5J8XA 4Y17A 4QJGA 5HARA 3RXWA 5L10A 1OTDA 2V20A 5DF9A 4ZJ1A 3UE1A 3LUQA 2PBDP 1TDGA 4E3NA 3IBJA 4L9GA 4BMWA 4XXRA 1NRJA 2NUPC 1PWGA 2HF6A 1T1CA 3FKVA 3Q1FA 4HHDA 5CGXA 2EWVA 1N9OA 3PYPA 3QHYA 3V3RA 4X25A 4HNBA 3N8RA 5IU1A 5DKKA 2V1ZA 3PAEA 1NLYA 3CPTA 2IWBA 4YFMA 5G4YA 3BFCA 3NC8A 2J9OA 3S7NA 1YQSA 1Y54A 2B5RA 3ZNTA 4S2NC 4WMCD 2M7VA 1FIKA 5JYOA 4JGPA 3BECA 4O7DA 3DTEA 5U47A 4JGOA 2WK0A 1XP4A 5HZHA 4EEPA 2Y55A 2W0NA 2EX2A 1OJGA 3HUNA 1YMSA 2ZQ8A 3A0SA 3PBTA 4CQHA 4LPZA 2QZ6A 2H10A 2VGLS 2ZQ9A 4WLAA 4MBFA 3AGDA 3ZGAB 3MZDA 2W1RA 3SW1A 4N92A 3MQOA 1IOUA 3SH7A 2O0YA 2KLIA 4H6JB 2WZZA 2ZC7A 3WRZA 4X56A 4I39A 1ESIA 3PBRA 1M6KA 3K3CA 4P6ZM 4GDBA 2GZAA 1H5XA 3HLDA 4YOFA 4JF6A 3UDFA 4IVKA 4PM6A 4E6WA 3CJMA 4DDYA 3BQAA 3A3EA 5FI2A 4OLDA 5FAPA 3VE4A 2H5SA 4HY8A 1JVJA 1DP6A 4WEJA 3PR6A 4PKYG 4P0MA 2VV6A 1AXBA 2HDQA 3QP6A 5EM1A 2ZL1A 3MXRA 2W3GA 3S7PA 4JF5A 4R3JA 2HP5A 4RYEA 3UY6A 2PD7A 5HPIA 3GECA 2GNXA 1GSXA 3R4KA 3G4PA 3VP4A 2JKTI 4AFIA 4DJ2A 3N8SA 3VE3A 3A0VA 3D9YA 4E3JA 3HREA 1VEUA 3OLOA 1RGZA 5GL9A 5FEFA 1DP8A 1DRMA 3C38A 4H8RA 2ZC3B 4HP4A 5EVEA 3MKEA 4OOYA 1SKFA 5DF7A 1TEMA 3MZFA 4NK3A 1LSXA 3T4LA 3TRCA 1H8ZA 3E4PA 3OPHA 4WZ5A 1IKGA 4NKPA 4D2OA 5TBMB 1RP5A 3HJIA 4PM9A 5CEBA 1K6RA 2Y2PA 4XUZA 4UA7A 2R9XA 3FWLA 4LV2A 2V8FA 4GJ4A 2JKTM 4WZ4A 4S2PA 2W3DA 4Y13A 5LBRA 1LHYA 1WE4A 1XJ3A 3MBZA 3W2ZA 4B88A 2ZJ9A 3ZNYA 4LCMA 3CPTB 4BL2A 3ZDJA 2HJ9C 2HPBA 4P85A 2KOIA 1L0DA 1V9YA 3QP5A 4WMCA 4QPRA 4HOIA 3LIDA 5KZHA 4CJNA 3BFDA 5M19A 4LV0A 3NOUC 3B42A 5GLAA 1MKIA 1OMEA 5HW3A 2VGLM 3E4OA 1MWRA 4X68A 4GHIA 4M4XA 2V9AA 2R9WA 1LLBA 1K55A 2M7UA 1YMXA 5EPHA 3G35A 5FQKA 4Y0TA 5FAOA 1GA9A 1I5QA 5HFOA 5AQ9A 2Y2KA 1ERMA 4KZ5A 3S22A 4OPQA
chains in the Genus database with same CATH topology
1NYMA 5TR7A 3HUOA 4KQRA 2JBFA 2XH9A 4OOMA 5EECA 4BENA 2UWXA 3IT9A 2HDSA 3N6IA 2ZQDA 5DVAA 1YLPA 3SOIA 2XD5A 4OQHA 3O3VA 2XEPA 2JE5A 4ZJ2A 1CI8A 3IWQA 3OPRA 4JXWA 3W8KA 1JWVA 1KE4A 3FYZA 2J8YA 4ZAMA 3WS5A 4DXBA 1ES2A 3IXBA 1MWUA 1CI9A 3IF6A 2OV5A 5HAPA 1W79A 3A3IA 5DTSA 4OKPA 3SS3A 1U60A 5G18A 1FCNA 1NJ4A 5DF8A 3IWIA 4OQIA 5TGFA 4E3LA 2VGKA 1BLHA 1EWZA 3VFHA 2QPNA 3HLWA 1BZAA 3ZCZA 3ZVTA 1RGYA 5IHVA 4JF4A 4KZ6A 5A92A 1XGIA 4DXCA 5FQ9A 4DF6A 1YM1A 4E3MA 1GHPA 1HZOA 3TG9A 2V2FF 4FH4A 4GD6A 4NETA 2WGVA 3ZFZA 5GHYA 3UPNA 2XF3A 3VP0A 4R3BA 1JWPA 3N8LA 3RJUA 4UA6A 1MWTA 1GA0A 3WS2A 3UDXA 4BLMA 4S2NA 1E3UA 3WS4A 4DE3A 3MKFA 3IHAA 5CHJA 1KE0A 1DJCA 1ZG6A 1HTZA 4X69A 1DJAA 3A3JA 1L0GA 5CGWA 4C75A 2JCHA 4KZBA 1MPLA 2X71A 2CC1A 3FZCA 4Q8IA 2QMIA 2WYXA 1ES4A 4R4RA 3VP1A 5GHZA 4R1GA 1ONGA 4S2JA 4FSFA 4PM8A 4B4ZA 4DE2A 1NZOA 4OP8A 2XQZA 2ZC6B 3IXGA 4GB7A 1PWCA 3GV9A 3GMWA 4JPMA 5CECA 4X53A 3MXSA 2RCXA 3GSGA 2G2WA 2WADA 3TOIA 4HEFA 3ZG0A 4UA9A 3W4QA 1GHIA 2EFUA 4JBFA 3WS0A 1KGGA 4JKTA 1S6RA 5TFQA 5GLCA 4FH2A 4RX3A 1KVMA 4X6TA 3EQUA 1N4OA 5CTMA 4K91A 3C4PA 4EWFA 3M6BA 5BOHA 2WUQA 3PAGA 1KGEA 3Q7ZA 5E2FA 5HL1A 3E2LA 4DRTA 1YLZA 2JC7A 1IYPA 1L0FA 4JXGA 4C3QA 3VOZA 1KDSA 3UE0A 5E2GA 3D4FA 2EFXA 1DY6A 1LI9A 2ZD8A 3IHBA 1ONHA 4IBXA 3V39A 3A3FA 3PBOA 4B4XA 1W7FA 1JWZA 4KQQA 4MBHA 2ZLYA 5CERA 1TVFA 4N9LA 5FDHA 4S2OA 5E2EA 3VFFA 1S0WA 3BFEA 3I7JA 4S2IA 1NZUA 3LY4A 5EVIA 4PMAA 4C6YA 4K0XA 1BLSA 2RL3A 4LV3A 4UHUA 1Z6FA 1K56A 4KG2A 3IH9A 1PW8A 2Y2JA 3FKWA 1K4EA 2Q9NA 5JYPA 4IVIA 4Y0OA 2DCFA 4KENB 4DE1A 3CZDA 1SDNA 4LENA 1G6AA 2EX6A 3ZG5A 3C4OA 3SS4A 4OPRA 1G68A 1XKZA 2EX8A 3BFGA 5AQBA 3V50A 1ESUA 4PM5A 3HUMA 3P98A 4DE0A 1YT4A 3HVFA 3OC2A 5FI6A 3G2YA 2WZXA 5FI7A 3ITBA 4KG5A 1NYYA 2FFYA 3DW0A 4KZ3A 3SH8A 3Q07A 2P9VA 5J8XA 4QJGA 1XA7A 4LV1A 3C7VA 5HARA 3RXWA 3WRTA 4ZJ1A 2V20A 3N7WA 5DF9A 4GDNA 2XFSA 3SS5A 3UE1A 4KZ4A 5E2HA 2WGWA 4K0WA 1FQGA 5F1GA 4QB8A 3Q81A 3Q82A 3HLCA 4P6BA 2ZMAA 1TDGA 1XA1A 2A3UA 4E3OA 4E3NA 2DRWA 4BJPA 1ERQA 4XXRA 3MFDA 2WKHA 2Y2LA 3QNCA 5AQ7A 1PZPA 3C5AA 1PWGA 2C6WB 3C7UA 1IYQA 1K25A 2BLSA 3S4XA 1NY0A 4QU3A 3MZEA 4OPZA 3FKVA 3BFFA 3PTEA 2G2UA 1ES3A 3Q1FA 5CEDA 5CGXA 1FOFA 1SDEA 3AGFA 3HLEA 3VP3A 2ZC5B 2I72A 5F82A 3O88A 1CEGA 4LCLA 3QHYA 3V3RA 1L0EA 4PPRA 4YINA 1E4DA 3BLSA 5KSHA 1BLCA 3HBRA 4OH0A 3N8RA 5FASA 2HDUA 5KSCA 4ZDXA 2V1ZA 3BRMA 2HDRA 3O86A 3CMZA 3PAEA 2Q9MA 2IWBA 4YFMA 4OOLA 4OPYA 3BFCA 3PBSA 5FAQA 5F1FA 1PWDA 3NC8A 2J9OA 4EUZA 3WS1A 4BD0A 1YQSA 2Z2MB 1K54C 1Y54A 3TSGA 3JYIA 2B5RA 3M2JA 3ZNTA 3IQAA 1YLTA 4S2NC 3UO9A 4WMCD 1RCJA 1KDWA 4PM7A 3LY3A 2IWDA 5JYOA 5CXWA 3BECA 4O7DA 2Y4AA 4A5RA 5U47A 3RXXA 1LL5A 5CTNA 1QMEA 2FFFB 2WK0A 2ZQAA 4WZ5C 1NRFA 5CRFA 1XP4A 1IYOA 3CG5A 4N9KA 1XX2A 2Y55A 1GCEA 3M6HA 2EX2A 1MBLA 5FQMA 1O7EA 4KZ7A 5I94A 3DWZA 3GTCA 2ZQCA 3HUNA 1Q2QA 1DJBA 1XGJA 2OLVA 2WAFA 3BEBA 1IKIA 1PW1A 1YMSA 1JTGA 2ZQ8A 4GKUA 3PBTA 2BG1A 3BM6A 1VM1A 2QZ6A 5FQJA 1N9BA 2VGJA 3BYDA 2H10A 3IF6B 3ZG9B 2ZQ9A 4MBFA 1Q2PA 3Q7VA 1L2SA 4GD8A 4OVDA 5GLBA 3GVBA 2ZM2A 1H8YA 3AGDA 5EE8A 4U3TA 3AGEA 4ZBEA 1BSGA 2Y2IA 1BTLA 4XUXA 3ZGAB 4OQGA 5FSRA 1YLYA 3MZDA 1O07A 4KG6A 4N92A 2X02A 2OLUA 2X01A 3ZG7B 3ZVWA 3SH7A 4MNRA 1EI5A 1TDLA 3HLBA 2PU2A 5M18A 2WZZA 4IEDA 5FQIA 2Z2LB 2ZC7A 3WRZA 5M1AA 5HAQA 3G30A 4EBLA 1GHMA 1BUEA 4WELA 4X56A 1KGFA 1ESIA 4BQMA 2Y2HA 3GQZA 3E2KA 4HESA 3B3XA 3S1YA 1MXOA 3PBRA 1HD8A 1M6KA 4F94A 5CHUA 4GDBA 1YLWA 1H5XA 4Y0UA 5DTTA 3A3DA 1K57A 1K55C 2HP9A 3HLDA 2WKEA 2Y2GA 1W8QA 2IWCA 5HAIA 1MY8A 4JF6A 3UDFA 5E43A 4IVKA 3NBLA 3NI9A 4PM6A 2XK1A 3UN7A 2EXBA 3UE3A 2Y59A 4E6WA 3CJMA 3HLGA 5EUAA 1FSYA 4DDYA 3EQVA 1SCWA 3M2KA 3A3EA 2WGIA 1WYBA 1E3UD 4HBTA 3W4OA 1BLPA 3FV7A 5FI2A 5FQQA 3UDIA 3ZG8B 3OCNA 2Y91A 4OLDA 1CEFA 5A91A 3WWXA 5FAPA 4OP5A 2H5SA 3VP2A 2H0YA 1W8YA 2ZM0A 1SHVA 1JVJA 3NY4A 4KZ9A 4QD4A 4WEJA 4P0MA 3O87A 1AXBA 2HDQA 1ZKJA 4KZ8A 4N1HA 5CGSA 2GDNA 4R4SA 4WM9A 5KMWA 4X55A 3MXRA 5GHXA 4JF5A 3GRJA 1FCMA 4CPKA 1W5DA 4R3JA 2HP5A 4RYEA 1J9MA 3IF6C 4Z9QA 5F83A 5FATA 1HVBA 3OZHA 2PU4A 4ID4A 4HBUA 4FD8A 4OLGA 3LEZA 3UY6A 1NXYA 4R0QA 4JXSA 2HP6A 4JXVA 1KE3A 1LI0A 2XLNA 2Y2QA 4UAAA 5GLDA 3GR2A 4DDSA 3G4PA 3VP4A 5EVIB 4KQOA 4MLLA 1ZC2A 4ZJ3A 1MWSA 3N8SA 3NDGA 1ALQA 2ZC4B 3HLFA 4P87A 1K38A 2PBYA 3VSLA 1ZG4A 4M3KA 4U0TA 4BD1A 5L2FA 1BULA 1FCOA 4E3JA 3HREA 3IWOA 2Y2MA 3BLMA 1RGZA 5GL9A 4H8RA 3G31A 1WYCA 1CK3A 2ZC3B 2J9PA 2EX9A 3NDEA 4E3KA 1ES5A 3SH9A 5A93A 4WYYA 3MKEA 4OQ0A 4OOYA 3VOYA 1SKFA 1K54A 2ZM8A 3IXDA 1TEMA 5DF7A 5EVID 3MZFA 2P9VB 4QY5A 4S2LA 4EBNA 2H0TA 1K56D 3DTMA 3OPPA 2P74A 4NK3A 4RVAA 4GOGA 4MBKA 4S2KA 2WGWB 3OPLA 4WBGA 3IH8A 1H8ZA 3OPHA 1I2WA 3ITAA 4WZ5A 1IKGA 4D2OA 1EROA 3V3SA 2OSUA 5EOOA 4GN2A 1PIOA 1RP5A 4PM9A 4ZTKA 1K6RA 5CEBA 2Y2PA 4XUZA 4UA7A 3ZHHA 4KZAA 3N4IA 2R9XA 3PBQA 3UNWA 3FWLA 4LV2A 4MEZA 2EXAA 5CHMA 3PBNA 2E8IA 3IF5A 3UPPA 5DTKA 4WZ4A 5A90A 4S2PA 3HL9A 1FSWA 1PZOA 3QNBA 3LCEA 3UPOA 1IEMA 1C3BA 1LHYA 1WE4A 3LO7A 2XD1A 3MBZA 4EQIA 4IBRA 4B88A 4E6XA 5AQAA 2ZJ9A 4E3IA 3ZNYA 1FR6A 1YLJA 4LCMA 4BL2A 3ZDJA 2WAEA 1E25A 1JTDA 1XPBA 2XR0A 2HPBA 3VSKA 5EVIC 2ZQ7A 2WKIA 4S2MA 3ISGA 4GNUA 4P85A 1L0DA 3W4PA 2Y2OA 4RA7A 4WMCA 5EVLA 1XXMA 3DWKA 5KZHA 4CJNA 3BFDA 4N1XA 1PI4A 2DNSA 2J7VA 4LV0A 4DKIA 5M19A 1PI5A 5GLAA 3VMAA 3G2ZA 1MKIA 4BL3A 3OCLA 4Y7PA 1OMEA 5HW3A 3IXHA 4WEKA 4U0XA 1K57C 1M40A 1FR1A 4EV4A 1BT5A 5FA7A 1MWRA 2XFTA 3NCKA 4X68A 4EBPA 3V5MA 1LL9A 1VQQA 1LLBA 1KVLA 2R9WA 4R23A 3P09A 1QMFA 5HX9A 1K55A 1PYYA 1IYSA 1I2SA 1YMXA 3G32A 4QY6A 5EPHA 3G35A 5FQKA 4QHCA 4JLFA 2Y2NA 2C5WB 4RX2A 5FAOA 4Y0TA 1GA9A 1I5QA 5EOEA 5HFOA 2XGNA 2Y2KA 4GZBA 4OONA 5AQ9A 1ERMA 3G34A 3NIAA 4FCFA 1K6SA 4KZ5A 4L0LA 5D3OA 3S22A 1IELA 1K4FA 2A49A 2XDMA 3Q7VB 4OPQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NYM A;  5TR7 A;  3HUO A;  4KQR A;  2JBF A;  2XH9 A;  4OOM A;  5EEC A;  4BEN A;  2UWX A;  3IT9 A;  2HDS A;  3N6I A;  2ZQD A;  5DVA A;  1YLP A;  3SOI A;  2XD5 A;  4OQH A;  3O3V A;  2XEP A;  2JE5 A;  4ZJ2 A;  1CI8 A;  3IWQ A;  3OPR A;  4JXW A;  3W8K A;  1JWV A;  1KE4 A;  3FYZ A;  2J8Y A;  4ZAM A;  3WS5 A;  4DXB A;  1ES2 A;  3IXB A;  1MWU A;  1CI9 A;  3IF6 A;  2OV5 A;  5HAP A;  1W79 A;  3A3I A;  5DTS A;  4OKP A;  3SS3 A;  1U60 A;  5G18 A;  1FCN A;  1NJ4 A;  5DF8 A;  3IWI A;  4OQI A;  5TGF A;  4E3L A;  2VGK A;  1BLH A;  1EWZ A;  3VFH A;  2QPN A;  3HLW A;  1BZA A;  3ZCZ A;  3ZVT A;  1RGY A;  5IHV A;  4JF4 A;  4KZ6 A;  5A92 A;  1XGI A;  4DXC A;  5FQ9 A;  4DF6 A;  1YM1 A;  4E3M A;  1GHP A;  1HZO A;  3TG9 A;  2V2F F;  4FH4 A;  4GD6 A;  4NET A;  2WGV A;  3ZFZ A;  5GHY A;  3UPN A;  2XF3 A;  3VP0 A;  4R3B A;  1JWP A;  3N8L A;  3RJU A;  4UA6 A;  1MWT A;  1GA0 A;  3WS2 A;  3UDX A;  4BLM A;  4S2N A;  1E3U A;  3WS4 A;  4DE3 A;  3MKF A;  3IHA A;  5CHJ A;  1KE0 A;  1DJC A;  1ZG6 A;  1HTZ A;  4X69 A;  1DJA A;  3A3J A;  1L0G A;  5CGW A;  4C75 A;  2JCH A;  4KZB A;  1MPL A;  2X71 A;  2CC1 A;  3FZC A;  4Q8I A;  2QMI A;  2WYX A;  1ES4 A;  4R4R A;  3VP1 A;  5GHZ A;  4R1G A;  1ONG A;  4S2J A;  4FSF A;  4PM8 A;  4B4Z A;  4DE2 A;  1NZO A;  4OP8 A;  2XQZ A;  2ZC6 B;  3IXG A;  4GB7 A;  1PWC A;  3GV9 A;  3GMW A;  4JPM A;  5CEC A;  4X53 A;  3MXS A;  2RCX A;  3GSG A;  2G2W A;  2WAD A;  3TOI A;  4HEF A;  3ZG0 A;  4UA9 A;  3W4Q A;  1GHI A;  2EFU A;  4JBF A;  3WS0 A;  1KGG A;  4JKT A;  1S6R A;  5TFQ A;  5GLC A;  4FH2 A;  4RX3 A;  1KVM A;  4X6T A;  3EQU A;  1N4O A;  5CTM A;  4K91 A;  3C4P A;  4EWF A;  3M6B A;  5BOH A;  2WUQ A;  3PAG A;  1KGE A;  3Q7Z A;  5E2F A;  5HL1 A;  3E2L A;  4DRT A;  1YLZ A;  2JC7 A;  1IYP A;  1L0F A;  4JXG A;  4C3Q A;  3VOZ A;  1KDS A;  3UE0 A;  5E2G A;  3D4F A;  2EFX A;  1DY6 A;  1LI9 A;  2ZD8 A;  3IHB A;  1ONH A;  4IBX A;  3V39 A;  3A3F A;  3PBO A;  4B4X A;  1W7F A;  1JWZ A;  4KQQ A;  4MBH A;  2ZLY A;  5CER A;  1TVF A;  4N9L A;  5FDH A;  4S2O A;  5E2E A;  3VFF A;  1S0W A;  3BFE A;  3I7J A;  4S2I A;  1NZU A;  3LY4 A;  5EVI A;  4PMA A;  4C6Y A;  4K0X A;  1BLS A;  2RL3 A;  4LV3 A;  4UHU A;  1Z6F A;  1K56 A;  4KG2 A;  3IH9 A;  1PW8 A;  2Y2J A;  3FKW A;  1K4E A;  2Q9N A;  5JYP A;  4IVI A;  4Y0O A;  2DCF A;  4KEN B;  4DE1 A;  3CZD A;  1SDN A;  4LEN A;  1G6A A;  2EX6 A;  3ZG5 A;  3C4O A;  3SS4 A;  4OPR A;  1G68 A;  1XKZ A;  2EX8 A;  3BFG A;  5AQB A;  3V50 A;  1ESU A;  4PM5 A;  3HUM A;  3P98 A;  4DE0 A;  1YT4 A;  3HVF A;  3OC2 A;  5FI6 A;  3G2Y A;  2WZX A;  5FI7 A;  3ITB A;  4KG5 A;  1NYY A;  2FFY A;  3DW0 A;  4KZ3 A;  3SH8 A;  3Q07 A;  2P9V A;  5J8X A;  4QJG A;  1XA7 A;  4LV1 A;  3C7V A;  5HAR A;  3RXW A;  3WRT A;  4ZJ1 A;  2V20 A;  3N7W A;  5DF9 A;  4GDN A;  2XFS A;  3SS5 A;  3UE1 A;  4KZ4 A;  5E2H A;  2WGW A;  4K0W A;  1FQG A;  5F1G A;  4QB8 A;  3Q81 A;  3Q82 A;  3HLC A;  4P6B A;  2ZMA A;  1TDG A;  1XA1 A;  2A3U A;  4E3O A;  4E3N A;  2DRW A;  4BJP A;  1ERQ A;  4XXR A;  3MFD A;  2WKH A;  2Y2L A;  3QNC A;  5AQ7 A;  1PZP A;  3C5A A;  1PWG A;  2C6W B;  3C7U A;  1IYQ A;  1K25 A;  2BLS A;  3S4X A;  1NY0 A;  4QU3 A;  3MZE A;  4OPZ A;  3FKV A;  3BFF A;  3PTE A;  2G2U A;  1ES3 A;  3Q1F A;  5CED A;  5CGX A;  1FOF A;  1SDE A;  3AGF A;  3HLE A;  3VP3 A;  2ZC5 B;  2I72 A;  5F82 A;  3O88 A;  1CEG A;  4LCL A;  3QHY A;  3V3R A;  1L0E A;  4PPR A;  4YIN A;  1E4D A;  3BLS A;  5KSH A;  1BLC A;  3HBR A;  4OH0 A;  3N8R A;  5FAS A;  2HDU A;  5KSC A;  4ZDX A;  2V1Z A;  3BRM A;  2HDR A;  3O86 A;  3CMZ A;  3PAE A;  2Q9M A;  2IWB A;  4YFM A;  4OOL A;  4OPY A;  3BFC A;  3PBS A;  5FAQ A;  5F1F A;  1PWD A;  3NC8 A;  2J9O A;  4EUZ A;  3WS1 A;  4BD0 A;  1YQS A;  2Z2M B;  1K54 C;  1Y54 A;  3TSG A;  3JYI A;  2B5R A;  3M2J A;  3ZNT A;  3IQA A;  1YLT A;  4S2N C;  3UO9 A;  4WMC D;  1RCJ A;  1KDW A;  4PM7 A;  3LY3 A;  2IWD A;  5JYO A;  5CXW A;  3BEC A;  4O7D A;  2Y4A A;  4A5R A;  5U47 A;  3RXX A;  1LL5 A;  5CTN A;  1QME A;  2FFF B;  2WK0 A;  2ZQA A;  4WZ5 C;  1NRF A;  5CRF A;  1XP4 A;  1IYO A;  3CG5 A;  4N9K A;  1XX2 A;  2Y55 A;  1GCE A;  3M6H A;  2EX2 A;  1MBL A;  5FQM A;  1O7E A;  4KZ7 A;  5I94 A;  3DWZ A;  3GTC A;  2ZQC A;  3HUN A;  1Q2Q A;  1DJB A;  1XGJ A;  2OLV A;  2WAF A;  3BEB A;  1IKI A;  1PW1 A;  1YMS A;  1JTG A;  2ZQ8 A;  4GKU A;  3PBT A;  2BG1 A;  3BM6 A;  1VM1 A;  2QZ6 A;  5FQJ A;  1N9B A;  2VGJ A;  3BYD A;  2H10 A;  3IF6 B;  3ZG9 B;  2ZQ9 A;  4MBF A;  1Q2P A;  3Q7V A;  1L2S A;  4GD8 A;  4OVD A;  5GLB A;  3GVB A;  2ZM2 A;  1H8Y A;  3AGD A;  5EE8 A;  4U3T A;  3AGE A;  4ZBE A;  1BSG A;  2Y2I A;  1BTL A;  4XUX A;  3ZGA B;  4OQG A;  5FSR A;  1YLY A;  3MZD A;  1O07 A;  4KG6 A;  4N92 A;  2X02 A;  2OLU A;  2X01 A;  3ZG7 B;  3ZVW A;  3SH7 A;  4MNR A;  1EI5 A;  1TDL A;  3HLB A;  2PU2 A;  5M18 A;  2WZZ A;  4IED A;  5FQI A;  2Z2L B;  2ZC7 A;  3WRZ A;  5M1A A;  5HAQ A;  3G30 A;  4EBL A;  1GHM A;  1BUE A;  4WEL A;  4X56 A;  1KGF A;  1ESI A;  4BQM A;  2Y2H A;  3GQZ A;  3E2K A;  4HES A;  3B3X A;  3S1Y A;  1MXO A;  3PBR A;  1HD8 A;  1M6K A;  4F94 A;  5CHU A;  4GDB A;  1YLW A;  1H5X A;  4Y0U A;  5DTT A;  3A3D A;  1K57 A;  1K55 C;  2HP9 A;  3HLD A;  2WKE A;  2Y2G A;  1W8Q A;  2IWC A;  5HAI A;  1MY8 A;  4JF6 A;  3UDF A;  5E43 A;  4IVK A;  3NBL A;  3NI9 A;  4PM6 A;  2XK1 A;  3UN7 A;  2EXB A;  3UE3 A;  2Y59 A;  4E6W A;  3CJM A;  3HLG A;  5EUA A;  1FSY A;  4DDY A;  3EQV A;  1SCW A;  3M2K A;  3A3E A;  2WGI A;  1WYB A;  1E3U D;  4HBT A;  3W4O A;  1BLP A;  3FV7 A;  5FI2 A;  5FQQ A;  3UDI A;  3ZG8 B;  3OCN A;  2Y91 A;  4OLD A;  1CEF A;  5A91 A;  3WWX A;  5FAP A;  4OP5 A;  2H5S A;  3VP2 A;  2H0Y A;  1W8Y A;  2ZM0 A;  1SHV A;  1JVJ A;  3NY4 A;  4KZ9 A;  4QD4 A;  4WEJ A;  4P0M A;  3O87 A;  1AXB A;  2HDQ A;  1ZKJ A;  4KZ8 A;  4N1H A;  5CGS A;  2GDN A;  4R4S A;  4WM9 A;  5KMW A;  4X55 A;  3MXR A;  5GHX A;  4JF5 A;  3GRJ A;  1FCM A;  4CPK A;  1W5D A;  4R3J A;  2HP5 A;  4RYE A;  1J9M A;  3IF6 C;  4Z9Q A;  5F83 A;  5FAT A;  1HVB A;  3OZH A;  2PU4 A;  4ID4 A;  4HBU A;  4FD8 A;  4OLG A;  3LEZ A;  3UY6 A;  1NXY A;  4R0Q A;  4JXS A;  2HP6 A;  4JXV A;  1KE3 A;  1LI0 A;  2XLN A;  2Y2Q A;  4UAA A;  5GLD A;  3GR2 A;  4DDS A;  3G4P A;  3VP4 A;  5EVI B;  4KQO A;  4MLL A;  1ZC2 A;  4ZJ3 A;  1MWS A;  3N8S A;  3NDG A;  1ALQ A;  2ZC4 B;  3HLF A;  4P87 A;  1K38 A;  2PBY A;  3VSL A;  1ZG4 A;  4M3K A;  4U0T A;  4BD1 A;  5L2F A;  1BUL A;  1FCO A;  4E3J A;  3HRE A;  3IWO A;  2Y2M A;  3BLM A;  1RGZ A;  5GL9 A;  4H8R A;  3G31 A;  1WYC A;  1CK3 A;  2ZC3 B;  2J9P A;  2EX9 A;  3NDE A;  4E3K A;  1ES5 A;  3SH9 A;  5A93 A;  4WYY A;  3MKE A;  4OQ0 A;  4OOY A;  3VOY A;  1SKF A;  1K54 A;  2ZM8 A;  3IXD A;  1TEM A;  5DF7 A;  5EVI D;  3MZF A;  2P9V B;  4QY5 A;  4S2L A;  4EBN A;  2H0T A;  1K56 D;  3DTM A;  3OPP A;  2P74 A;  4NK3 A;  4RVA A;  4GOG A;  4MBK A;  4S2K A;  2WGW B;  3OPL A;  4WBG A;  3IH8 A;  1H8Z A;  3OPH A;  1I2W A;  3ITA A;  4WZ5 A;  1IKG A;  4D2O A;  1ERO A;  3V3S A;  2OSU A;  5EOO A;  4GN2 A;  1PIO A;  1RP5 A;  4PM9 A;  4ZTK A;  1K6R A;  5CEB A;  2Y2P A;  4XUZ A;  4UA7 A;  3ZHH A;  4KZA A;  3N4I A;  2R9X A;  3PBQ A;  3UNW A;  3FWL A;  4LV2 A;  4MEZ A;  2EXA A;  5CHM A;  3PBN A;  2E8I A;  3IF5 A;  3UPP A;  5DTK A;  4WZ4 A;  5A90 A;  4S2P A;  3HL9 A;  1FSW A;  1PZO A;  3QNB A;  3LCE A;  3UPO A;  1IEM A;  1C3B A;  1LHY A;  1WE4 A;  3LO7 A;  2XD1 A;  3MBZ A;  4EQI A;  4IBR A;  4B88 A;  4E6X A;  5AQA A;  2ZJ9 A;  4E3I A;  3ZNY A;  1FR6 A;  1YLJ A;  4LCM A;  4BL2 A;  3ZDJ A;  2WAE A;  1E25 A;  1JTD A;  1XPB A;  2XR0 A;  2HPB A;  3VSK A;  5EVI C;  2ZQ7 A;  2WKI A;  4S2M A;  3ISG A;  4GNU A;  4P85 A;  1L0D A;  3W4P A;  2Y2O A;  4RA7 A;  4WMC A;  5EVL A;  1XXM A;  3DWK A;  5KZH A;  4CJN A;  3BFD A;  4N1X A;  1PI4 A;  2DNS A;  2J7V A;  4LV0 A;  4DKI A;  5M19 A;  1PI5 A;  5GLA A;  3VMA A;  3G2Z A;  1MKI A;  4BL3 A;  3OCL A;  4Y7P A;  1OME A;  5HW3 A;  3IXH A;  4WEK A;  4U0X A;  1K57 C;  1M40 A;  1FR1 A;  4EV4 A;  1BT5 A;  5FA7 A;  1MWR A;  2XFT A;  3NCK A;  4X68 A;  4EBP A;  3V5M A;  1LL9 A;  1VQQ A;  1LLB A;  1KVL A;  2R9W A;  4R23 A;  3P09 A;  1QMF A;  5HX9 A;  1K55 A;  1PYY A;  1IYS A;  1I2S A;  1YMX A;  3G32 A;  4QY6 A;  5EPH A;  3G35 A;  5FQK A;  4QHC A;  4JLF A;  2Y2N A;  2C5W B;  4RX2 A;  5FAO A;  4Y0T A;  1GA9 A;  1I5Q A;  5EOE A;  5HFO A;  2XGN A;  2Y2K A;  4GZB A;  4OON A;  5AQ9 A;  1ERM A;  3G34 A;  3NIA A;  4FCF A;  1K6S A;  4KZ5 A;  4L0L A;  5D3O A;  3S22 A;  1IEL A;  1K4F A;  2A49 A;  2XDM A;  3Q7V B;  4OPQ A; 
#chains in the Genus database with same CATH topology
 3T1Q B;  3E0Y A;  4GCZ A;  4OOM A;  2UWX A;  1YLP A;  2XEP A;  4K08 A;  1CI8 A;  3OPR A;  3NHQ A;  1JWV A;  5F69 A;  3WS5 A;  3IXB A;  4GS9 B;  5HAP A;  1FIL A;  1YAX A;  5TGF A;  3SS3 A;  4OQI A;  2W27 A;  3HLW A;  4MDZ A;  1RGY A;  3T1S A;  1H3Q A;  3JVU A;  2B18 A;  2JKF A;  2V2F F;  2WGV A;  3UPN A;  2J80 A;  2XF3 A;  3VP0 A;  1JWP A;  1NLZ A;  4BLM A;  4S2N A;  1ZTU A;  5CHJ A;  2K2N A;  5FDS A;  1ZG6 A;  2ZOH A;  2CC1 A;  4Q8I A;  3MFX A;  4R4R A;  4R1G A;  4FSF A;  4DE2 A;  3LI9 A;  3GV9 A;  1S1Z A;  4QWO A;  2ZL1 B;  4HP9 A;  3LIC A;  5L09 A;  5HSQ A;  2WKQ A;  2EFU A;  4JBF A;  4JKT A;  1KVM A;  3EQU A;  4K91 A;  4EWF A;  3M6B A;  4NXG A;  1KGE A;  2O99 A;  5HL1 A;  1IYP A;  2IA2 A;  2JC7 A;  4JXG A;  3D4F A;  1ONH A;  4IBX A;  4B4X A;  1VEU B;  1W7F A;  5CER A;  2BTF P;  3EGX C;  4R3A A;  1D06 A;  3LY4 A;  4K0X A;  1BLS A;  5HD5 A;  4DMZ A;  1L3L A;  1K4E A;  5JYP A;  1XKZ A;  4PM5 A;  3HUM A;  3P98 A;  4MN5 A;  5AJG A;  4KZ3 A;  3TW8 A;  1XA7 A;  3C7V A;  4EEU A;  3SS5 A;  4Z1W A;  5E2H A;  5F1G A;  4QB8 A;  3Q81 A;  4P6B A;  3QP1 A;  2GJ3 A;  2DRW A;  2VV7 A;  1PZP A;  3C5A A;  3C7U A;  1K25 A;  3PTE A;  1OT6 A;  2G2U A;  1HLU P;  2AVX A;  1FOF A;  3AGF A;  2A2L A;  3KSH A;  3HLE A;  1EW0 A;  3HJK A;  1BLC A;  2HJE A;  4O8G A;  5FAS A;  3KO6 A;  3LEQ A;  3PBS A;  3DAV A;  3OOV A;  4GHI B;  1LT0 A;  4BD0 A;  1F2K A;  3TSG A;  3FPV A;  3LY3 A;  3TJZ C;  4A5R A;  3RXX A;  5K5B A;  1QME A;  1IFQ A;  4FOF A;  4WZ5 C;  3ZYT A;  1IYO A;  5TJJ A;  3CHW P;  4N9K A;  4LRZ E;  1GCE A;  2VKS A;  1MBL A;  5FQM A;  1G6O A;  4KZ7 A;  5I94 A;  1PNE A;  3B33 A;  1DJB A;  3BEB A;  2QYB A;  2JKR I;  2M1C A;  4GKU A;  3BM6 A;  1P0Z A;  2VGJ A;  2V0W A;  1BYW A;  3Q7V A;  4GD8 A;  3GVB A;  1TD5 A;  5A8B A;  1PFL A;  1H8Y A;  5EE8 A;  4ZBE A;  2Y2I A;  1YLY A;  4NXE A;  4DN0 A;  1O07 A;  4EQ1 A;  4L9F A;  3ZVW A;  2X01 A;  3ZG7 B;  3L7H A;  4IED A;  3UE6 A;  5M1A A;  3G30 A;  4EBL A;  1BUE A;  4WEL A;  1MC0 A;  3LR3 A;  1KGF A;  3B3X A;  1MXO A;  1HD8 A;  4F94 A;  2HGV A;  4Y0U A;  1P9R A;  5DTT A;  1K55 C;  4Y15 A;  2Y2G A;  2IWC A;  2JKR M;  5E43 A;  2QJ7 A;  3UE3 A;  2Y59 A;  1SCW A;  1TS0 A;  2WGI A;  5CX7 A;  2QJ5 A;  4HBT A;  4PHT A;  1BLP A;  3W4O A;  3UME A;  3H82 A;  2Y91 A;  3WWX A;  5TBM A;  3VP2 A;  1SHV A;  4I3J A;  4KZ9 A;  3UMD A;  3O87 A;  4WM9 A;  2W3E A;  1P97 A;  1FCM A;  3FPW A;  5F83 A;  1J9M A;  3OZH A;  3MJQ A;  2VLG A;  3L9K A;  4FD8 A;  1NXY A;  4R0Q A;  2HP6 A;  4UAA A;  5GLD A;  4LFU A;  3GR2 A;  4IUK A;  4DDS A;  5I5L A;  4ZJ3 A;  2D02 A;  2HV1 A;  1ZG4 A;  4M3K A;  5L2F A;  2W3H A;  4O0P A;  2PD8 A;  4XT2 A;  1CK3 A;  1ES5 A;  1K54 A;  5EVI D;  2PR5 A;  4QY5 A;  4S2L A;  4EBN A;  2H0T A;  1K56 D;  3TE8 A;  3E4Q A;  4RVA A;  4HIA A;  4GOG A;  4S2K A;  3V3S A;  2OSU A;  1UWP X;  4GN2 A;  3PBQ A;  4MEZ A;  3BQ8 A;  2E8I A;  3IF5 A;  4FUW A;  5DTK A;  5A90 A;  1ZHH B;  2B95 A;  5AVE A;  1T1B A;  4I3I A;  4UQI S;  3LO7 A;  2XD1 A;  2ZOI A;  4EU0 A;  4IBR A;  4E6X A;  1H0M A;  1YLJ A;  4GS9 A;  3LI8 A;  1E25 A;  1JTD A;  1G5U A;  2INW A;  4GNU A;  1XJ4 A;  3K3D A;  4HJ3 A;  1XXM A;  3RFB A;  3P7N A;  1VB6 A;  1PI4 A;  4G3W A;  1CF0 A;  2J7V A;  2UV0 E;  4DKI A;  1PI5 A;  3VMA A;  3G2Z A;  4ARZ A;  3C30 A;  1M40 A;  1UWN X;  1BT5 A;  3KSF A;  3NCK A;  4PAU A;  2PAV P;  3DBA A;  1KVL A;  3P09 A;  5HX9 A;  1PYY A;  3G32 A;  1F9I A;  4QHC A;  2PYR A;  2XGN A;  4GZB A;  4OON A;  2LB5 A;  3G34 A;  1K6S A;  4L0L A;  2XDM A;  3Q7V B;  3T4O A;  5EFW A;  4KQR A;  2K31 A;  2H28 A;  4BEN A;  3IT9 A;  3N6I A;  2W1T A;  1H8M A;  2XD5 A;  3IWQ A;  3W8K A;  1KE4 A;  4DXB A;  4EET B;  1ES2 A;  1T18 A;  1MWU A;  2QHK A;  3NJA A;  4CLC D;  3A3I A;  5DTS A;  5IT5 A;  1FCN A;  5DF8 A;  3ICY A;  4E3L A;  2VGK A;  2OAQ 1;  1BLH A;  3ZCZ A;  5IHV A;  4L9E A;  4JF4 A;  4KZ6 A;  5A92 A;  4DXC A;  4DF6 A;  1YM1 A;  1HZO A;  1TF1 A;  4GD6 A;  5GHY A;  4R3B A;  1GA0 A;  2G7U A;  3WS4 A;  4DE3 A;  3H82 B;  5HPF A;  2QMI A;  5GHZ A;  1DP9 A;  4PM8 A;  4B4Z A;  1NZO A;  4OP8 A;  2XQZ A;  2ZC6 B;  3IXG A;  2ZBB A;  4JPM A;  1CQA A;  3LIB A;  2OOL A;  3MXS A;  3TOI A;  3LR5 A;  2O9B A;  3W4Q A;  4IJG A;  2PYP A;  3WS0 A;  2DMW A;  5F6A A;  4EER A;  2PHY A;  5GLC A;  4RX3 A;  1N4O A;  5CTM A;  3C4P A;  5BOH A;  5E2F A;  5FL3 A;  1SKO A;  4C3Q A;  4Q0I A;  3UE0 A;  5E2G A;  4EXO A;  2EFX A;  2P08 A;  1F5M A;  2ZLY A;  4XT2 B;  3CUE C;  1AWI A;  4S2O A;  5E2E A;  3VFF A;  5HDC A;  1OTA A;  3T50 A;  5EVI A;  1GSW A;  1ODV A;  1Z6F A;  1K56 A;  2D01 A;  4KG2 A;  3IH9 A;  3H7W A;  3FKW A;  3CAX A;  4IVI A;  2DCF A;  4KEN B;  4DE1 A;  3CZD A;  4X1M A;  3ZG5 A;  4UQI M;  1G68 A;  3LR4 A;  5FI6 A;  2WZX A;  4KG5 A;  1NYY A;  3DW0 A;  3Q07 A;  3CI6 A;  3BWL A;  5HWT A;  3T4Q A;  3O5Y A;  3WRT A;  4KZ4 A;  2WGW A;  3Q82 A;  2Z6C A;  3HLC A;  2ZMA A;  2A3U A;  5HL6 A;  1ERQ A;  2WKH A;  3QNC A;  5AQ7 A;  1IYQ A;  3S4X A;  4QU3 A;  3MZE A;  3C8C A;  4OPZ A;  3BFF A;  1ES3 A;  5CED A;  1SDE A;  3VP3 A;  3U4L P;  2I72 A;  5F82 A;  3O88 A;  4LCL A;  1MZU A;  4PPR A;  3BLS A;  5KSH A;  5KSC A;  4ZDX A;  2E8J A;  3BRM A;  2HDR A;  3O86 A;  3T12 B;  3MR0 A;  4OPY A;  5FAQ A;  4ARZ B;  2XSS A;  4EUZ A;  3WS1 A;  2Z2M B;  1K54 C;  2KX6 A;  1RCJ A;  3GDI A;  2Y4A A;  4NXB A;  2FFF B;  5CRF A;  3T4J A;  1XX2 A;  3M6H A;  1WA9 A;  3DWZ A;  1KOU A;  3GTC A;  2ZQC A;  3BW6 A;  2W1T B;  1JTG A;  5IS1 A;  4ESP A;  1N9B A;  3BYD A;  3ZG9 B;  5J4E A;  1Q2P A;  1L2S A;  1LSV A;  2ZM2 A;  4JGQ A;  3AGE A;  3JPU A;  4XUX A;  4OQG A;  3B47 A;  4R6L A;  4EES A;  4RQ9 A;  2X02 A;  2K7S A;  4I38 A;  2XRO A;  2MJ6 A;  5HAQ A;  3UB9 A;  5HD3 A;  4BQM A;  3F1O A;  3E2K A;  4HES A;  3S1Y A;  4Y5F A;  5CHU A;  3LIE A;  3EWK A;  3A3D A;  3UB6 A;  2HP9 A;  1Z09 A;  3UN7 A;  3HLG A;  1FSY A;  3EQV A;  3M2K A;  4LGW A;  2XRN A;  1Y28 A;  1E3U D;  2O9C A;  3FV7 A;  3OCN A;  5A91 A;  1CEF A;  2PR6 A;  2H0Y A;  1W8Y A;  4WL9 A;  3NY4 A;  4QD4 A;  3DTI A;  2BAS A;  4KZ8 A;  1ZKJ A;  4HQA A;  3K2N A;  5CGS A;  4R4S A;  4X55 A;  1SKO B;  4G3K A;  3GRJ A;  4CPK A;  1W5D A;  3NEC A;  4EW7 A;  3IS2 A;  1HVB A;  4OLG A;  2JKG A;  1KE3 A;  1LI0 A;  2XLN A;  1K0K A;  1LSW A;  2V1B A;  5EVI B;  1OTI A;  4KQO A;  4MLL A;  1ZC2 A;  1MWS A;  1X0O A;  4UEY A;  2ZC4 B;  3HLF A;  5HWW A;  4GLQ A;  1K38 A;  3H7W B;  4U0T A;  4R70 A;  1BUL A;  3EEA A;  2Y2M A;  1UGU A;  3BLM A;  3KX0 X;  3G31 A;  2J9P A;  4ETX A;  4E3K A;  5A93 A;  4OQ0 A;  3MQ0 A;  4MN6 A;  3IXD A;  3DTM A;  2J3T D;  4MBK A;  2WGW B;  3UB5 P;  3R7W A;  1I2W A;  3ITA A;  1ERO A;  5EOO A;  4ZTK A;  3BY8 A;  3MF0 A;  1YKD A;  5CHM A;  1P9W A;  3UPP A;  4GW9 A;  1TS6 A;  3F1N A;  3H9W A;  3LCE A;  1S4S A;  1C3B A;  2L4R A;  1N9L A;  3KSI A;  4EQI A;  5AQA A;  1OTB A;  4X1L A;  2WAE A;  1XPB A;  2Y8H A;  3VSK A;  5EVI C;  2ZQ7 A;  2WKI A;  3CUE A;  2Y2O A;  4RA7 A;  4YWZ A;  2PDR A;  4R38 A;  4Y7P A;  5HWV A;  4WEK A;  4U0X A;  1K57 C;  4EV4 A;  5FA7 A;  2XFT A;  4O01 A;  2PRF A;  1QMF A;  1IYS A;  1I2S A;  2VK3 A;  3T4K A;  5J7E A;  4JLF A;  2Y2N A;  2C5W B;  2OWJ A;  2V1A A;  5EOE A;  5DJT A;  3LFV A;  4CLC B;  3NUL A;  4FCF A;  5D3O A;  1IEL A;  1K4F A;  2A49 A;  3D3O A;  2XH9 A;  1XJ6 A;  2HDS A;  4BBV A;  5DVA A;  3SOI A;  4OQH A;  2JE5 A;  4NG2 A;  2OAP 1;  4JXW A;  3FYZ A;  2A24 B;  2J8Y A;  4ZAM A;  3IF6 A;  1CI9 A;  1VET B;  1W79 A;  5MC7 A;  1U60 A;  5G18 A;  3IWI A;  3MQQ A;  1EWZ A;  1PRQ A;  3F1O B;  2QPN A;  5C5K A;  2R78 A;  4NXF A;  2YKH A;  1GHP A;  4Y2F A;  4NET A;  3RJU A;  4UA6 A;  1N9N A;  3E98 A;  1E3U A;  2XA7 S;  3IHA A;  1KE0 A;  1DJC A;  2Y79 A;  4KUK A;  3MMH A;  5CGW A;  4C75 A;  1MPL A;  3FZC A;  2L0W A;  2WYX A;  1ES4 A;  3A0R A;  3T4T A;  5CEC A;  3RH8 B;  4CLC C;  2G2W A;  2WAD A;  3CLO A;  1GHI A;  3IS2 B;  4F3L A;  3KSG A;  3T1X A;  1XJ2 A;  4II7 A;  5DFX A;  3PAG A;  3E2L A;  4I3A A;  1KDS A;  1DY6 A;  2ZD8 A;  3IHB A;  3V39 A;  3PBO A;  1JWZ A;  4MBH A;  5DFY A;  1TVF A;  4N9L A;  5FDH A;  2WKR A;  1S0W A;  3BFE A;  3I7J A;  2I9V A;  4S2I A;  4PMA A;  4LV3 A;  2LB9 A;  3DTK A;  1V9Z A;  1SZV A;  2Y2J A;  2ZMF A;  1G28 A;  3JVV A;  1G6A A;  2J3W A;  3C4O A;  3SS4 A;  4OPR A;  5AQB A;  2EX8 A;  3R7W B;  3S7Q A;  1ESU A;  1S4R A;  4DE0 A;  1YPR A;  1YT4 A;  3HVF A;  3G2Y A;  2V0U A;  2FFY A;  3SH8 A;  2P9V A;  4LV1 A;  5DKL A;  3N7W A;  4GDN A;  2XFS A;  5L8M A;  4BBU A;  4K0W A;  1FQG A;  3F1N B;  4E3O A;  1XA1 A;  3D72 A;  4BJP A;  3BJN A;  1MKM A;  3MFD A;  2Y2L A;  2C6W B;  1TS7 A;  2BLS A;  1NY0 A;  3PHY A;  2Q0O A;  1NWZ A;  2ZC5 B;  1CEG A;  3IX3 A;  1L0E A;  4YIN A;  5AVF A;  1E4D A;  3HBR A;  4OH0 A;  4IHQ A;  2HDU A;  2L1M A;  3CMZ A;  1OTE A;  1D1J A;  2Q9M A;  4OOL A;  5F1F A;  1PWD A;  1S66 L;  3JYI A;  3M2J A;  3IQA A;  1YLT A;  3UO9 A;  1KDW A;  4PM7 A;  2IWD A;  3RTY A;  5CXW A;  2O9A A;  1LL5 A;  5CTN A;  2V8C A;  4IUH A;  5DJU A;  2ZQA A;  3LIF A;  1NRF A;  2P7J A;  3CG5 A;  2EA9 A;  1O7E A;  1Q2Q A;  2OLV A;  1XGJ A;  4YNR A;  2WAF A;  1IKI A;  1PW1 A;  5EM0 A;  1F98 A;  2BG1 A;  1VM1 A;  5FQJ A;  5HDS A;  2JN7 A;  4KQD A;  4G3V A;  3IF6 B;  3ZQ5 A;  4ETZ A;  3G6O A;  2XA7 M;  2FZ0 A;  3QP2 A;  4OVD A;  5GLB A;  1J3W A;  4MN7 A;  3T4S A;  4U3T A;  5L07 A;  1BSG A;  3VOL A;  1BTL A;  5FSR A;  4HH2 A;  4KG6 A;  2OLU A;  2QKP A;  3LGO A;  4MNR A;  1EI5 A;  1TDL A;  3HLB A;  2PU2 A;  5M18 A;  5FQI A;  5G4Z A;  2Z2L B;  3IX8 A;  1GHM A;  2Y2H A;  3GQZ A;  5EV0 A;  3S7O A;  1YLW A;  4HI4 A;  2P04 A;  1K57 A;  2WKE A;  3KYQ A;  1W8Q A;  5HAI A;  1MY8 A;  1S67 L;  2VV8 A;  3NBL A;  3NI9 A;  2XK1 A;  2EXB A;  4HJ4 A;  5EUA A;  2HZ5 A;  1WYB A;  1CJF A;  4BBT A;  3UB7 A;  3ZG8 B;  5FQQ A;  3UDI A;  2CMN A;  4F3L B;  4OP5 A;  3MS6 A;  3F1P A;  2ZM0 A;  4N1H A;  2GDN A;  2ACG A;  5KMW A;  5GHX A;  1W63 M;  4Z9Q A;  3IF6 C;  4HJ6 A;  5FAT A;  3KYZ A;  2PU4 A;  4ID4 A;  4HBU A;  4PKY A;  3LEZ A;  4E04 A;  2EWW A;  4LRX C;  4JXS A;  4JXV A;  2Y2Q A;  1D7E A;  5HDD A;  4BWI A;  3NDG A;  1ALQ A;  4P87 A;  1GSV A;  5KIZ A;  2PBY A;  4WF0 A;  2FH5 A;  3VSL A;  4BD1 A;  1FCO A;  4WN5 A;  4DJ3 A;  3IWO A;  4HH3 A;  2KDK A;  3MXQ A;  1WYC A;  2EX9 A;  3NDE A;  3SH9 A;  3SZT A;  4WYY A;  3VOY A;  2VEA A;  2ZM8 A;  4CLC E;  2P9V B;  3PXP A;  4LRY C;  3CWF A;  3OPP A;  5FEG A;  2P74 A;  4D60 A;  3OPL A;  1T19 A;  2W3F A;  3IH8 A;  4WBG A;  4I5S A;  5F5Y A;  1PIO A;  3ZHH A;  1TS8 A;  4KZA A;  4CLC A;  3N4I A;  2VX8 A;  3UNW A;  2EXA A;  3PBN A;  4ZRR A;  1T1A A;  1OPX A;  3HL9 A;  4LLO B;  1FSW A;  1PZO A;  3QNB A;  3UPO A;  1IEM A;  2VZW A;  3LYX A;  2A24 A;  1OJ5 A;  4E3I A;  1FR6 A;  1XFQ A;  1VET A;  2XR0 A;  4S2M A;  1A0K A;  3ISG A;  3W4P A;  1S1Y A;  5EVL A;  3KYE A;  4WUJ A;  3DWK A;  2J3T C;  4N1X A;  2DNS A;  1XFN A;  3UB8 A;  1JNU A;  4BL3 A;  3OCL A;  3IX4 A;  3IXH A;  1FR1 A;  3EOI A;  4EBP A;  3V5M A;  1LL9 A;  1VQQ A;  4R23 A;  1ACF A;  3ULF A;  4QY6 A;  4RX2 A;  1LL8 A;  4MMN A;  3NIA A;  3VOZ A;  3U2A A;  1NYM A;  5TR7 A;  3HUO A;  2JBF A;  4KUO A;  5EEC A;  2ZQD A;  2YKF A;  2WKP A;  3VV4 A;  1W63 Q;  3O3V A;  3OBF A;  4ZJ2 A;  3EGD C;  2OV5 A;  4OKP A;  1NJ4 A;  3LIA A;  3P01 A;  3NOT C;  3VFH A;  1BZA A;  3ZVT A;  4Q0H A;  1XGI A;  5FQ9 A;  4B93 A;  4E3M A;  3V67 A;  3TG9 A;  4Q0J A;  4FH4 A;  4MCW A;  3ZFZ A;  4H6J A;  3IBR A;  4B9O A;  3N8L A;  2B02 A;  4JGR A;  3BY9 A;  1MWT A;  3WS2 A;  3UDX A;  4FTX A;  3MKF A;  1HTZ A;  4X69 A;  1DJA A;  2Z6D A;  3A3J A;  1L0G A;  3C2W A;  2JCH A;  4KZB A;  2X71 A;  3EEH A;  3QP8 A;  3F1P B;  3VP1 A;  1ONG A;  4S2J A;  4GB7 A;  1PWC A;  3GMW A;  4X53 A;  3FC7 A;  2RCX A;  3GSG A;  4HEF A;  5J3W A;  3ZG0 A;  4UA9 A;  3T1R A;  2PT7 A;  1KGG A;  4P6Z S;  4EUV A;  1S6R A;  5TFQ A;  1OT9 A;  4FH2 A;  4Y3I A;  4X6T A;  2WUQ A;  3Q7Z A;  2JHE A;  4DRT A;  1YLZ A;  1L0F A;  1Y4O A;  3MSH A;  1STZ A;  1LI9 A;  5F68 A;  3A3F A;  4KQQ A;  3FG8 A;  2OWH A;  1NZU A;  3NOP C;  4NEE D;  4C6Y A;  2QWS A;  2RL3 A;  2VA0 A;  1YSP A;  4UHU A;  4ME4 A;  1PW8 A;  2Q9N A;  4Y0O A;  2VJW A;  1SDN A;  4LEN A;  2EX6 A;  1YSQ A;  1VHM A;  3BFG A;  3V50 A;  3HCY A;  2NUT C;  2ZMV A;  3CIT A;  3OC2 A;  3LR0 A;  3QP4 A;  5FI7 A;  3ITB A;  2GX5 A;  5J8X A;  4Y17 A;  4QJG A;  5HAR A;  3RXW A;  5L10 A;  1OTD A;  2V20 A;  5DF9 A;  4ZJ1 A;  3UE1 A;  3LUQ A;  2PBD P;  1TDG A;  4E3N A;  3IBJ A;  4L9G A;  4BMW A;  4XXR A;  1NRJ A;  2NUP C;  1PWG A;  2HF6 A;  1T1C A;  3FKV A;  3Q1F A;  4HHD A;  5CGX A;  2EWV A;  1N9O A;  3PYP A;  3QHY A;  3V3R A;  4X25 A;  4HNB A;  3N8R A;  5IU1 A;  5DKK A;  2V1Z A;  3PAE A;  1NLY A;  3CPT A;  2IWB A;  4YFM A;  5G4Y A;  3BFC A;  3NC8 A;  2J9O A;  3S7N A;  1YQS A;  1Y54 A;  2B5R A;  3ZNT A;  4S2N C;  4WMC D;  2M7V A;  1FIK A;  5JYO A;  4JGP A;  3BEC A;  4O7D A;  3DTE A;  5U47 A;  4JGO A;  2WK0 A;  1XP4 A;  5HZH A;  4EEP A;  2Y55 A;  2W0N A;  2EX2 A;  1OJG A;  3HUN A;  1YMS A;  2ZQ8 A;  3A0S A;  3PBT A;  4CQH A;  4LPZ A;  2QZ6 A;  2H10 A;  2VGL S;  2ZQ9 A;  4WLA A;  4MBF A;  3AGD A;  3ZGA B;  3MZD A;  2W1R A;  3SW1 A;  4N92 A;  3MQO A;  1IOU A;  3SH7 A;  2O0Y A;  2KLI A;  4H6J B;  2WZZ A;  2ZC7 A;  3WRZ A;  4X56 A;  4I39 A;  1ESI A;  3PBR A;  1M6K A;  3K3C A;  4P6Z M;  4GDB A;  2GZA A;  1H5X A;  3HLD A;  4YOF A;  4JF6 A;  3UDF A;  4IVK A;  4PM6 A;  4E6W A;  3CJM A;  4DDY A;  3BQA A;  3A3E A;  5FI2 A;  4OLD A;  5FAP A;  3VE4 A;  2H5S A;  4HY8 A;  1JVJ A;  1DP6 A;  4WEJ A;  3PR6 A;  4PKY G;  4P0M A;  2VV6 A;  1AXB A;  2HDQ A;  3QP6 A;  5EM1 A;  2ZL1 A;  3MXR A;  2W3G A;  3S7P A;  4JF5 A;  4R3J A;  2HP5 A;  4RYE A;  3UY6 A;  2PD7 A;  5HPI A;  3GEC A;  2GNX A;  1GSX A;  3R4K A;  3G4P A;  3VP4 A;  2JKT I;  4AFI A;  4DJ2 A;  3N8S A;  3VE3 A;  3A0V A;  3D9Y A;  4E3J A;  3HRE A;  1VEU A;  3OLO A;  1RGZ A;  5GL9 A;  5FEF A;  1DP8 A;  1DRM A;  3C38 A;  4H8R A;  2ZC3 B;  4HP4 A;  5EVE A;  3MKE A;  4OOY A;  1SKF A;  5DF7 A;  1TEM A;  3MZF A;  4NK3 A;  1LSX A;  3T4L A;  3TRC A;  1H8Z A;  3E4P A;  3OPH A;  4WZ5 A;  1IKG A;  4NKP A;  4D2O A;  5TBM B;  1RP5 A;  3HJI A;  4PM9 A;  5CEB A;  1K6R A;  2Y2P A;  4XUZ A;  4UA7 A;  2R9X A;  3FWL A;  4LV2 A;  2V8F A;  4GJ4 A;  2JKT M;  4WZ4 A;  4S2P A;  2W3D A;  4Y13 A;  5LBR A;  1LHY A;  1WE4 A;  1XJ3 A;  3MBZ A;  3W2Z A;  4B88 A;  2ZJ9 A;  3ZNY A;  4LCM A;  3CPT B;  4BL2 A;  3ZDJ A;  2HJ9 C;  2HPB A;  4P85 A;  2KOI A;  1L0D A;  1V9Y A;  3QP5 A;  4WMC A;  4QPR A;  4HOI A;  3LID A;  5KZH A;  4CJN A;  3BFD A;  5M19 A;  4LV0 A;  3NOU C;  3B42 A;  5GLA A;  1MKI A;  1OME A;  5HW3 A;  2VGL M;  3E4O A;  1MWR A;  4X68 A;  4GHI A;  4M4X A;  2V9A A;  2R9W A;  1LLB A;  1K55 A;  2M7U A;  1YMX A;  5EPH A;  3G35 A;  5FQK A;  4Y0T A;  5FAO A;  1GA9 A;  1I5Q A;  5HFO A;  5AQ9 A;  2Y2K A;  1ERM A;  4KZ5 A;  3S22 A;  4OPQ A; 
#chains in the Genus database with same CATH homology
 1NYM A;  5TR7 A;  3HUO A;  4KQR A;  2JBF A;  2XH9 A;  4OOM A;  5EEC A;  4BEN A;  2UWX A;  3IT9 A;  2HDS A;  3N6I A;  2ZQD A;  5DVA A;  1YLP A;  3SOI A;  2XD5 A;  4OQH A;  3O3V A;  2XEP A;  2JE5 A;  4ZJ2 A;  1CI8 A;  3IWQ A;  3OPR A;  4JXW A;  3W8K A;  1JWV A;  1KE4 A;  3FYZ A;  2J8Y A;  4ZAM A;  3WS5 A;  4DXB A;  1ES2 A;  3IXB A;  1MWU A;  1CI9 A;  3IF6 A;  2OV5 A;  5HAP A;  1W79 A;  3A3I A;  5DTS A;  4OKP A;  3SS3 A;  1U60 A;  5G18 A;  1FCN A;  1NJ4 A;  5DF8 A;  3IWI A;  4OQI A;  5TGF A;  4E3L A;  2VGK A;  1BLH A;  1EWZ A;  3VFH A;  2QPN A;  3HLW A;  1BZA A;  3ZCZ A;  3ZVT A;  1RGY A;  5IHV A;  4JF4 A;  4KZ6 A;  5A92 A;  1XGI A;  4DXC A;  5FQ9 A;  4DF6 A;  1YM1 A;  4E3M A;  1GHP A;  1HZO A;  3TG9 A;  2V2F F;  4FH4 A;  4GD6 A;  4NET A;  2WGV A;  3ZFZ A;  5GHY A;  3UPN A;  2XF3 A;  3VP0 A;  4R3B A;  1JWP A;  3N8L A;  3RJU A;  4UA6 A;  1MWT A;  1GA0 A;  3WS2 A;  3UDX A;  4BLM A;  4S2N A;  1E3U A;  3WS4 A;  4DE3 A;  3MKF A;  3IHA A;  5CHJ A;  1KE0 A;  1DJC A;  1ZG6 A;  1HTZ A;  4X69 A;  1DJA A;  3A3J A;  1L0G A;  5CGW A;  4C75 A;  2JCH A;  4KZB A;  1MPL A;  2X71 A;  2CC1 A;  3FZC A;  4Q8I A;  2QMI A;  2WYX A;  1ES4 A;  4R4R A;  3VP1 A;  5GHZ A;  4R1G A;  1ONG A;  4S2J A;  4FSF A;  4PM8 A;  4B4Z A;  4DE2 A;  1NZO A;  4OP8 A;  2XQZ A;  2ZC6 B;  3IXG A;  4GB7 A;  1PWC A;  3GV9 A;  3GMW A;  4JPM A;  5CEC A;  4X53 A;  3MXS A;  2RCX A;  3GSG A;  2G2W A;  2WAD A;  3TOI A;  4HEF A;  3ZG0 A;  4UA9 A;  3W4Q A;  1GHI A;  2EFU A;  4JBF A;  3WS0 A;  1KGG A;  4JKT A;  1S6R A;  5TFQ A;  5GLC A;  4FH2 A;  4RX3 A;  1KVM A;  4X6T A;  3EQU A;  1N4O A;  5CTM A;  4K91 A;  3C4P A;  4EWF A;  3M6B A;  5BOH A;  2WUQ A;  3PAG A;  1KGE A;  3Q7Z A;  5E2F A;  5HL1 A;  3E2L A;  4DRT A;  1YLZ A;  2JC7 A;  1IYP A;  1L0F A;  4JXG A;  4C3Q A;  3VOZ A;  1KDS A;  3UE0 A;  5E2G A;  3D4F A;  2EFX A;  1DY6 A;  1LI9 A;  2ZD8 A;  3IHB A;  1ONH A;  4IBX A;  3V39 A;  3A3F A;  3PBO A;  4B4X A;  1W7F A;  1JWZ A;  4KQQ A;  4MBH A;  2ZLY A;  5CER A;  1TVF A;  4N9L A;  5FDH A;  4S2O A;  5E2E A;  3VFF A;  1S0W A;  3BFE A;  3I7J A;  4S2I A;  1NZU A;  3LY4 A;  5EVI A;  4PMA A;  4C6Y A;  4K0X A;  1BLS A;  2RL3 A;  4LV3 A;  4UHU A;  1Z6F A;  1K56 A;  4KG2 A;  3IH9 A;  1PW8 A;  2Y2J A;  3FKW A;  1K4E A;  2Q9N A;  5JYP A;  4IVI A;  4Y0O A;  2DCF A;  4KEN B;  4DE1 A;  3CZD A;  1SDN A;  4LEN A;  1G6A A;  2EX6 A;  3ZG5 A;  3C4O A;  3SS4 A;  4OPR A;  1G68 A;  1XKZ A;  2EX8 A;  3BFG A;  5AQB A;  3V50 A;  1ESU A;  4PM5 A;  3HUM A;  3P98 A;  4DE0 A;  1YT4 A;  3HVF A;  3OC2 A;  5FI6 A;  3G2Y A;  2WZX A;  5FI7 A;  3ITB A;  4KG5 A;  1NYY A;  2FFY A;  3DW0 A;  4KZ3 A;  3SH8 A;  3Q07 A;  2P9V A;  5J8X A;  4QJG A;  1XA7 A;  4LV1 A;  3C7V A;  5HAR A;  3RXW A;  3WRT A;  4ZJ1 A;  2V20 A;  3N7W A;  5DF9 A;  4GDN A;  2XFS A;  3SS5 A;  3UE1 A;  4KZ4 A;  5E2H A;  2WGW A;  4K0W A;  1FQG A;  5F1G A;  4QB8 A;  3Q81 A;  3Q82 A;  3HLC A;  4P6B A;  2ZMA A;  1TDG A;  1XA1 A;  2A3U A;  4E3O A;  4E3N A;  2DRW A;  4BJP A;  1ERQ A;  4XXR A;  3MFD A;  2WKH A;  2Y2L A;  3QNC A;  5AQ7 A;  1PZP A;  3C5A A;  1PWG A;  2C6W B;  3C7U A;  1IYQ A;  1K25 A;  2BLS A;  3S4X A;  1NY0 A;  4QU3 A;  3MZE A;  4OPZ A;  3FKV A;  3BFF A;  3PTE A;  2G2U A;  1ES3 A;  3Q1F A;  5CED A;  5CGX A;  1FOF A;  1SDE A;  3AGF A;  3HLE A;  3VP3 A;  2ZC5 B;  2I72 A;  5F82 A;  3O88 A;  1CEG A;  4LCL A;  3QHY A;  3V3R A;  1L0E A;  4PPR A;  4YIN A;  1E4D A;  3BLS A;  5KSH A;  1BLC A;  3HBR A;  4OH0 A;  3N8R A;  5FAS A;  2HDU A;  5KSC A;  4ZDX A;  2V1Z A;  3BRM A;  2HDR A;  3O86 A;  3CMZ A;  3PAE A;  2Q9M A;  2IWB A;  4YFM A;  4OOL A;  4OPY A;  3BFC A;  3PBS A;  5FAQ A;  5F1F A;  1PWD A;  3NC8 A;  2J9O A;  4EUZ A;  3WS1 A;  4BD0 A;  1YQS A;  2Z2M B;  1K54 C;  1Y54 A;  3TSG A;  3JYI A;  2B5R A;  3M2J A;  3ZNT A;  3IQA A;  1YLT A;  4S2N C;  3UO9 A;  4WMC D;  1RCJ A;  1KDW A;  4PM7 A;  3LY3 A;  2IWD A;  5JYO A;  5CXW A;  3BEC A;  4O7D A;  2Y4A A;  4A5R A;  5U47 A;  3RXX A;  1LL5 A;  5CTN A;  1QME A;  2FFF B;  2WK0 A;  2ZQA A;  4WZ5 C;  1NRF A;  5CRF A;  1XP4 A;  1IYO A;  3CG5 A;  4N9K A;  1XX2 A;  2Y55 A;  1GCE A;  3M6H A;  2EX2 A;  1MBL A;  5FQM A;  1O7E A;  4KZ7 A;  5I94 A;  3DWZ A;  3GTC A;  2ZQC A;  3HUN A;  1Q2Q A;  1DJB A;  1XGJ A;  2OLV A;  2WAF A;  3BEB A;  1IKI A;  1PW1 A;  1YMS A;  1JTG A;  2ZQ8 A;  4GKU A;  3PBT A;  2BG1 A;  3BM6 A;  1VM1 A;  2QZ6 A;  5FQJ A;  1N9B A;  2VGJ A;  3BYD A;  2H10 A;  3IF6 B;  3ZG9 B;  2ZQ9 A;  4MBF A;  1Q2P A;  3Q7V A;  1L2S A;  4GD8 A;  4OVD A;  5GLB A;  3GVB A;  2ZM2 A;  1H8Y A;  3AGD A;  5EE8 A;  4U3T A;  3AGE A;  4ZBE A;  1BSG A;  2Y2I A;  1BTL A;  4XUX A;  3ZGA B;  4OQG A;  5FSR A;  1YLY A;  3MZD A;  1O07 A;  4KG6 A;  4N92 A;  2X02 A;  2OLU A;  2X01 A;  3ZG7 B;  3ZVW A;  3SH7 A;  4MNR A;  1EI5 A;  1TDL A;  3HLB A;  2PU2 A;  5M18 A;  2WZZ A;  4IED A;  5FQI A;  2Z2L B;  2ZC7 A;  3WRZ A;  5M1A A;  5HAQ A;  3G30 A;  4EBL A;  1GHM A;  1BUE A;  4WEL A;  4X56 A;  1KGF A;  1ESI A;  4BQM A;  2Y2H A;  3GQZ A;  3E2K A;  4HES A;  3B3X A;  3S1Y A;  1MXO A;  3PBR A;  1HD8 A;  1M6K A;  4F94 A;  5CHU A;  4GDB A;  1YLW A;  1H5X A;  4Y0U A;  5DTT A;  3A3D A;  1K57 A;  1K55 C;  2HP9 A;  3HLD A;  2WKE A;  2Y2G A;  1W8Q A;  2IWC A;  5HAI A;  1MY8 A;  4JF6 A;  3UDF A;  5E43 A;  4IVK A;  3NBL A;  3NI9 A;  4PM6 A;  2XK1 A;  3UN7 A;  2EXB A;  3UE3 A;  2Y59 A;  4E6W A;  3CJM A;  3HLG A;  5EUA A;  1FSY A;  4DDY A;  3EQV A;  1SCW A;  3M2K A;  3A3E A;  2WGI A;  1WYB A;  1E3U D;  4HBT A;  3W4O A;  1BLP A;  3FV7 A;  5FI2 A;  5FQQ A;  3UDI A;  3ZG8 B;  3OCN A;  2Y91 A;  4OLD A;  1CEF A;  5A91 A;  3WWX A;  5FAP A;  4OP5 A;  2H5S A;  3VP2 A;  2H0Y A;  1W8Y A;  2ZM0 A;  1SHV A;  1JVJ A;  3NY4 A;  4KZ9 A;  4QD4 A;  4WEJ A;  4P0M A;  3O87 A;  1AXB A;  2HDQ A;  1ZKJ A;  4KZ8 A;  4N1H A;  5CGS A;  2GDN A;  4R4S A;  4WM9 A;  5KMW A;  4X55 A;  3MXR A;  5GHX A;  4JF5 A;  3GRJ A;  1FCM A;  4CPK A;  1W5D A;  4R3J A;  2HP5 A;  4RYE A;  1J9M A;  3IF6 C;  4Z9Q A;  5F83 A;  5FAT A;  1HVB A;  3OZH A;  2PU4 A;  4ID4 A;  4HBU A;  4FD8 A;  4OLG A;  3LEZ A;  3UY6 A;  1NXY A;  4R0Q A;  4JXS A;  2HP6 A;  4JXV A;  1KE3 A;  1LI0 A;  2XLN A;  2Y2Q A;  4UAA A;  5GLD A;  3GR2 A;  4DDS A;  3G4P A;  3VP4 A;  5EVI B;  4KQO A;  4MLL A;  1ZC2 A;  4ZJ3 A;  1MWS A;  3N8S A;  3NDG A;  1ALQ A;  2ZC4 B;  3HLF A;  4P87 A;  1K38 A;  2PBY A;  3VSL A;  1ZG4 A;  4M3K A;  4U0T A;  4BD1 A;  5L2F A;  1BUL A;  1FCO A;  4E3J A;  3HRE A;  3IWO A;  2Y2M A;  3BLM A;  1RGZ A;  5GL9 A;  4H8R A;  3G31 A;  1WYC A;  1CK3 A;  2ZC3 B;  2J9P A;  2EX9 A;  3NDE A;  4E3K A;  1ES5 A;  3SH9 A;  5A93 A;  4WYY A;  3MKE A;  4OQ0 A;  4OOY A;  3VOY A;  1SKF A;  1K54 A;  2ZM8 A;  3IXD A;  1TEM A;  5DF7 A;  5EVI D;  3MZF A;  2P9V B;  4QY5 A;  4S2L A;  4EBN A;  2H0T A;  1K56 D;  3DTM A;  3OPP A;  2P74 A;  4NK3 A;  4RVA A;  4GOG A;  4MBK A;  4S2K A;  2WGW B;  3OPL A;  4WBG A;  3IH8 A;  1H8Z A;  3OPH A;  1I2W A;  3ITA A;  4WZ5 A;  1IKG A;  4D2O A;  1ERO A;  3V3S A;  2OSU A;  5EOO A;  4GN2 A;  1PIO A;  1RP5 A;  4PM9 A;  4ZTK A;  1K6R A;  5CEB A;  2Y2P A;  4XUZ A;  4UA7 A;  3ZHH A;  4KZA A;  3N4I A;  2R9X A;  3PBQ A;  3UNW A;  3FWL A;  4LV2 A;  4MEZ A;  2EXA A;  5CHM A;  3PBN A;  2E8I A;  3IF5 A;  3UPP A;  5DTK A;  4WZ4 A;  5A90 A;  4S2P A;  3HL9 A;  1FSW A;  1PZO A;  3QNB A;  3LCE A;  3UPO A;  1IEM A;  1C3B A;  1LHY A;  1WE4 A;  3LO7 A;  2XD1 A;  3MBZ A;  4EQI A;  4IBR A;  4B88 A;  4E6X A;  5AQA A;  2ZJ9 A;  4E3I A;  3ZNY A;  1FR6 A;  1YLJ A;  4LCM A;  4BL2 A;  3ZDJ A;  2WAE A;  1E25 A;  1JTD A;  1XPB A;  2XR0 A;  2HPB A;  3VSK A;  5EVI C;  2ZQ7 A;  2WKI A;  4S2M A;  3ISG A;  4GNU A;  4P85 A;  1L0D A;  3W4P A;  2Y2O A;  4RA7 A;  4WMC A;  5EVL A;  1XXM A;  3DWK A;  5KZH A;  4CJN A;  3BFD A;  4N1X A;  1PI4 A;  2DNS A;  2J7V A;  4LV0 A;  4DKI A;  5M19 A;  1PI5 A;  5GLA A;  3VMA A;  3G2Z A;  1MKI A;  4BL3 A;  3OCL A;  4Y7P A;  1OME A;  5HW3 A;  3IXH A;  4WEK A;  4U0X A;  1K57 C;  1M40 A;  1FR1 A;  4EV4 A;  1BT5 A;  5FA7 A;  1MWR A;  2XFT A;  3NCK A;  4X68 A;  4EBP A;  3V5M A;  1LL9 A;  1VQQ A;  1LLB A;  1KVL A;  2R9W A;  4R23 A;  3P09 A;  1QMF A;  5HX9 A;  1K55 A;  1PYY A;  1IYS A;  1I2S A;  1YMX A;  3G32 A;  4QY6 A;  5EPH A;  3G35 A;  5FQK A;  4QHC A;  4JLF A;  2Y2N A;  2C5W B;  4RX2 A;  5FAO A;  4Y0T A;  1GA9 A;  1I5Q A;  5EOE A;  5HFO A;  2XGN A;  2Y2K A;  4GZB A;  4OON A;  5AQ9 A;  1ERM A;  3G34 A;  3NIA A;  4FCF A;  1K6S A;  4KZ5 A;  4L0L A;  5D3O A;  3S22 A;  1IEL A;  1K4F A;  2A49 A;  2XDM A;  3Q7V B;  4OPQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...