3SH7A

Crystal structure of fluorophore-labeled beta-lactamase penp
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
257
structure length
257
Chain Sequence
KDDFAKLEEQFDAKLGIFALDTGTNRTVAYRPDERFAFASTIKALTVGVLLQQKSIEDLNQRITYTRDDLVNYNPITEKHVDTGMTLKELADASLRYSDNAAQNLILKQIGGPESLKKELRKIGDEVTNPERFCPELNEVNPGETQDTSTARALVTSLRAFALEDKLPSEKRELLIDWMKRNTTGDALIRAGVPDGWEVADKTGAASYGTRNDIAIIWPPKGDPVVLAVLSSRDKKDAKYDDKLIAEATKVVMKALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase
publication title Increased structural flexibility at the active site of a fluorophore-conjugated beta-lactamase distinctively impacts its binding toward diverse cephalosporin antibiotics
pubmed doi rcsb
source organism Bacillus licheniformis
total genus 86
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2011-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3sh7A00
2ZLYA 4X6TA 5J8XA 4R23A 1JTDA 4GD6A 4BQMA 4KQQA 2HP9A 4E6XA 2EXBA 1BSGA 1BLCA 2X02A 1TDGA 3BFEA 3JYIA 1PI5A 5HAIA 4FH2A 5IHVA 1YMXA 1JVJA 2A49A 2WGVA 3SOIA 5CXWA 2WAEA 1WYCA 3G31A 1JWVA 1FR1A 1MWUA 4LENA 4CJNA 1O07A 1TDLA 1TVFA 1WE4A 3NI9A 5KSHA 2B5RA 4ZJ3A 2ZQDA 4KG6A 2EX9A 2Y2MA 4P85A 5CHUA 4DKIA 4E3KA 1CEFA 5JYOA 5BOHA 2ZQ7A 2PU4A 5TFQA 2ZD8A 1BTLA 4F94A 4JXSA 1DJAA 5A91A 2IWDA 3PTEA 4S2NA 2RCXA 3TSGA 3O3VA 4LV1A 3C7VA 5GHZA 4ZDXA 2CC1A 5FQ9A 2OV5A 3V39A 1W5DA 2OLVA 3ZFZA 1I2WA 3IF5A 1BZAA 4KZ9A 2JCHA 1MPLA 1MXOA 5KMWA 4LV3A 4HESA 3HLCA 4S2LA 3M6BA 1K56D 3MZDA 3NBLA 5CGSA 3IT9A 1CEGA 5E2EA 1BULA 1YT4A 3A3IA 4BLMA 4E3MA 4QY6A 4WZ5A 4Y7PA 5EECA 4JF6A 5HARA 4WYYA 4B4XA 2I72A 4UAAA 4OP8A 2DCFA 3O88A 3IWQA 3OPHA 1XP4A 1XPBA 5AQ7A 3SS5A 5CERA 1K56A 4OH0A 4FD8A 1N9BA 5D3OA 4X53A 3GV9A 4S2PA 1GHMA 2XLNA 1JWPA 3Q7VB 1GA9A 2V2FF 4S2MA 4PM5A 2HDRA 4QB8A 1ES4A 2Y2IA 1KGFA 3ZVWA 1ZKJA 3UNWA 3M6HA 3G30A 2EFXA 1SHVA 1IYPA 1E4DA 4R4RA 4N92A 4WBGA 4EBNA 2H5SA 1E25A 1KVMA 1YLJA 3UDIA 5FA7A 4OQHA 2Y2JA 1ES3A 2EX6A 1L0DA 2WKIA 4ID4A 5FQIA 3ZNTA 4A5RA 3BFCA 3ITBA 3VSLA 2OLUA 1CK3A 2H0YA 4UA9A 2Y91A 5E2FA 4D2OA 4OOMA 3CMZA 4OP5A 4E3NA 1I5QA 4KQOA 3UPPA 1FCNA 5FI2A 3IH9A 3G2ZA 4K0XA 1KDWA 3FYZA 3DTMA 3FWLA 3ZG7B 4EBPA 1QMFA 2DRWA 3G32A 2WKHA 1BLSA 4MBHA 4S2KA 4YINA 3TOIA 3S4XA 4QD4A 2VGKA 3G35A 5CHMA 1M40A 1IEMA 1PWDA 5CEDA 3SS4A 4Y0OA 4UA6A 4DE1A 3CJMA 2Y2PA 1BLPA 5GLAA 5DTKA 4R3JA 3Q7VA 3Q81A 4ZTKA 4BD0A 3BFFA 3E2KA 4DDSA 2XF3A 4S2OA 1YM1A 2UWXA 4JPMA 1WYBA 2P74A 1K4EA 2WGWA 1HZOA 3BFDA 3PAEA 3BECA 4E6WA 1DY6A 1YLTA 1S0WA 2Y2QA 1LL5A 1YLPA 1KVLA 4FCFA 4ZAMA 3AGEA 5FQKA 5EOOA 1HVBA 2XEPA 4FH4A 2JC7A 1OMEA 3SH8A 3SS3A 1L0GA 3UDXA 1PW8A 1FR6A 1LHYA 3ITAA 4OOLA 1YLZA 3WS4A 5M18A 3ZG5A 2P9VA 5HFOA 2FFYA 5EPHA 3IXDA 3WRTA 2OSUA 2WKEA 1PWGA 3PBNA 3WS1A 3WS0A 5CRFA 4RVAA 1XA7A 3GR2A 1G6AA 2WADA 5FDHA 2XGNA 3V3SA 4R3BA 3UE3A 1YQSA 2WK0A 2R9WA 2Z2LB 1G68A 1CI9A 1EROA 4P87A 5GLDA 3G4PA 3HUMA 3MZFA 4P6BA 1ESIA 1KGGA 1O7EA 1PWCA 1N4OA 4ZJ2A 4KZ7A 2ZQ9A 1RGYA 4JF4A 3FV7A 4OONA 3ZG8B 4IEDA 2ZM2A 3ZDJA 3NIAA 2Y2NA 4PM9A 3UE0A 2BG1A 2C5WB 4RX3A 4E3IA 1YMSA 2HDSA 3WWXA 4GNUA 4WELA 4DE2A 3D4FA 4E3LA 4RX2A 3PAGA 3OCLA 1PZOA 1IKGA 3NY4A 3HLFA 1ERMA 1HTZA 3VFFA 4DXCA 1BT5A 5A92A 1AXBA 3V50A 1VQQA 4HEFA 3C5AA 2ZM0A 5GHXA 3A3DA 4X55A 5CTNA 3ZCZA 3HLDA 1PW1A 4FSFA 1K54C 1PIOA 3N7WA 5M19A 1GHPA 3HLGA 5FQMA 4KQRA 5GLBA 1W79A 3MZEA 4Y0TA 4JLFA 5CECA 4OPRA 3OCNA 3UY6A 5DF8A 1LI0A 3Q1FA 3UE1A 3PBRA 3NC8A 4R0QA 3BFGA 3GRJA 2WZXA 3E2LA 4U3TA 2XFSA 1QMEA 2R9XA 3UPOA 1PZPA 2WGWB 1DJCA 2HPBA 3P98A 1ALQA 2HP5A 3ISGA 3BLSA 5E2GA 3VP0A 2ZQAA 4ZJ1A 1NY0A 3N8LA 1Q2PA 1FCOA 3BLMA 5EVIA 4OQGA 3HUOA 2H10A 3P09A 1NYYA 4Q8IA 5A93A 1I2SA 4KZ4A 3UDFA 2P9VB 4GDBA 5FAPA 2ZC7A 5CHJA 2XFTA 1K57C 3WRZA 4IBRA 4OQ0A 4S2IA 3PBTA 3W4QA 1XGIA 2WYXA 4OKPA 4O7DA 5KZHA 1BUEA 5HW3A 4OLGA 4OPYA 2C6WB 3OC2A 3Q82A 3N6IA 4PMAA 1L0FA 4U0TA 1K55C 3C4PA 2X71A 3V5MA 4L0LA 5L2FA 1DJBA 3LEZA 4C3QA 4DDYA 2A3UA 1FQGA 4HBTA 4BENA 3VSKA 3S22A 3N8SA 3PBOA 4LV0A 2XD5A 2XD1A 1XX2A 4GOGA 1XGJA 2G2UA 3UN7A 2DNSA 2ZM8A 4GD8A 5F83A 1BLHA 1K6RA 3LCEA 4N1XA 1K54A 3FKVA 4OQIA 3HUNA 4KG2A 5DF7A 3UO9A 3CZDA 5GL9A 1U60A 3BYDA 1MKIA 3DWZA 3B3XA 3GVBA 3OZHA 3Q07A 1IYQA 1S6RA 4KENB 4C6YA 1SDNA 5KSCA 1FCMA 1PI4A 2Y55A 3BEBA 3WS5A 3QHYA 3RXXA 2J8YA 3IWOA 5FI6A 3OPLA 3M2KA 5CEBA 2Y2OA 5FATA 3LY3A 4JBFA 1RCJA 5CGWA 4PM7A 4C75A 3IXBA 1SDEA 3QNBA 1TEMA 3RJUA 1E3UD 3IF6C 1KE0A 4H8RA 4EWFA 2XH9A 1ES5A 3IHBA 4QY5A 2H0TA 4R1GA 2X01A 3ZVTA 3C7UA 4WMCD 1KDSA 5FASA 2J9PA 3VP2A 1K57A 3LO7A 5FAOA 1IYOA 3I7JA 1RP5A 2Y2GA 1IKIA 4UHUA 3O87A 2JE5A 4N1HA 1H8YA 4NETA 3W4OA 3VOZA 1E3UA 4OOYA 1Q2QA 4R4SA 3MKEA 1K55A 2WAFA 2Y2LA 3CG5A 4K0WA 4BL2A 3G2YA 4WMCA 4U0XA 2XR0A 2Y59A 2ZJ9A 5CGXA 4KZ8A 1IYSA 4Y0UA 2FFFB 1SKFA 2Q9MA 4MBKA 3W8KA 1HD8A 5HL1A 1ZG4A 3BM6A 4LCMA 5EVIC 4M3KA 5FQQA 4LV2A 3O86A 5EVIB 4XUZA 3ZNYA 4KZ6A 3Q7ZA 4GN2A 2E8IA 2BLSA 3TG9A 1ZC2A 5DF9A 4DXBA 4X56A 5M1AA 1CI8A 3EQUA 3VFHA 2HDQA 4WEJA 3SH7A 5F1FA 4QU3A 2V20A 2PBYA 5I94A 1LL9A 1NXYA 1XA1A 5F1GA 1FSYA 1PYYA 3A3JA 4RA7A 2WUQA 4DE0A 1LLBA 3OPPA 2V1ZA 5AQBA 1H5XA 3C4OA 3ZG9B 4EUZA 5FSRA 3IF6A 5G18A 5HX9A 4DE3A 4JKTA 2VGJA 4LCLA 1K38A 2IWBA 1L2SA 5AQAA 4EQIA 1NJ4A 4JF5A 3N4IA 3SH9A 4XUXA 4BJPA 1MY8A 3IH8A 3M2JA 3IWIA 2EXAA 1YLWA 2J9OA 3UPNA 2RL3A 2WGIA 5EVID 5FQJA 3MXSA 3QNCA 2Q9NA 4Z9QA 2WZZA 3N8RA 2ZQ8A 4DRTA 1W8YA 3NDGA 1EI5A 4OVDA 3V3RA 4DF6A 5JYPA 3MXRA 4IBXA 4IVKA 4BL3A 5DTTA 4KZAA 4KZBA 3G34A 3PBQA 3IXHA 2QZ6A 4K91A 3VP3A 1KE4A 2XK1A 1M6KA 1NYMA 1ZG6A 3A3EA 1W8QA 1Y54A 4QJGA 5HAQA 3ZHHA 1VM1A 5EVLA 5HAPA 4MLLA 1FSWA 5FI7A 4UA7A 1JWZA 3BRMA 4P0MA 1KGEA 1W7FA 3A3FA 4JXGA 4N9LA 5DVAA 4N9KA 1SCWA 5GLCA 4GKUA 3MBZA 3GTCA 3AGDA 5EOEA 4BD1A 1JTGA 2HDUA 1MWTA 4WEKA 2GDNA 3IQAA 1NZOA 4PPRA 5F82A 3OPRA 2PU2A 4X69A 1J9MA 4KZ5A 1MWSA 4WM9A 1RGZA 4MBFA 4B88A 1KE3A 1MBLA 5AQ9A 1XKZA 1NZUA 2J7VA 4S2JA 1ERQA 3RXWA 2ZC4B 4KG5A 5U47A 2XDMA 2Y2HA 5E43A 1GHIA 4GB7A 4MNRA 3PBSA 4OPQA 3IHAA 5A90A 3VP4A 3GMWA 4HBUA 2G2WA 4IVIA 2JBFA 4CPKA 3WS2A 4EV4A 2ZC5B 1IELA 4YFMA 3DW0A 2Z2MB 3HVFA 5FAQA 4OPZA 2ZMAA 3HLBA 3DWKA 1NRFA 4RYEA 5TGFA 1C3BA 1H8ZA 3HREA 3EQVA 1MWRA 4QHCA 4E3JA 1ESUA 1K25A 1GA0A 1YLYA 3FZCA 4B4ZA 3IXGA 3HLWA 5GHYA 4PM6A 1EWZA 1XXMA 4ZBEA 3IF6B 1K6SA 1L0EA 2Y4AA 3VP1A 3VOYA 1Z6FA 4S2NC 4NK3A 2ZQCA 2HP6A 3AGFA 5CTMA 2ZC3B 4JXWA 5EE8A 1K4FA 1LI9A 3ZGAB 2ZC6B 4KZ3A 5EUAA 3HL9A 1FOFA 3MFDA 3HBRA 2XQZA 3VMAA 1ONHA 5E2HA 4OLDA 4PM8A 4JXVA 2IWCA 4X68A 4GDNA 3GSGA 2QPNA 3HLEA 5TR7A 1GCEA 2EFUA 2EX2A 4WZ4A 1ES2A 4GZBA 3NDEA 4EBLA 4MEZA 4WZ5C 1ONGA 3MKFA 4E3OA 3GQZA 3S1YA 2EX8A 3LY4A 2QMIA 4XXRA 5DTSA 3NCKA 3W4PA 2Y2KA 3FKWA 3ZG0A
chains in the Genus database with same CATH superfamily
1JTDA 2YKHA 4BQMA 1TDGA 3JYIA 3KSFA 2A49A 4H6JB 4MN6A 1WYCA 3G31A 2B5RA 1PFLA 4ZJ3A 5CHUA 2Y79A 2OWHA 2VV6A 4CLCB 5BOHA 1V9YA 1D7EA 1BTLA 4JXSA 4LV1A 3F1OB 2OV5A 3V39A 1BZAA 2JCHA 1MPLA 3UMDA 3HLCA 4S2LA 3M6BA 3NBLA 4Q0IA 3BQAA 3IT9A 5E2EA 1YT4A 3A3IA 4E3MA 4B93A 2M1CA 5HWVA 4B4XA 4OP8A 2JKTI 1XP4A 4R6LA 5CERA 1DRMA 1OJGA 5D3OA 4O8GA 2XLNA 1GA9A 2HDRA 1ES4A 1OT6A 1KGFA 5FEGA 4ZRRA 4Q0HA 5HD5A 1L0DA 4HI4A 4ID4A 3ZNTA 5DKLA 3VSLA 2OLUA 4ME4A 2Y91A 4OP5A 1FCNA 5FI2A 4ARZA 4DJ3A 4K0XA 3FWLA 3DTMA 3TOIA 3S4XA 4P6ZS 1G5UA 4DE1A 3IBJA 5GLAA 4HNBA 1OTEA 2GZAA 2XF3A 4G3KA 3PAEA 1K4EA 3BECA 1DY6A 1FIKA 1P9WA 1S0WA 1SKOA 1YLPA 1KVLA 3FPVA 3D72A 2XEPA 4FH4A 1OMEA 3SS3A 2JKFA 3ITAA 3D3OA 4OOLA 1YLZA 3MQ0A 5IU1A 2FFYA 3O5YA 3WS0A 5CRFA 4RVAA 1XA7A 1G6AA 2V0WA 5GLDA 4P87A 5FL3A 5HPFA 1YAXA 3IX3A 5HSQA 1PWCA 2P08A 4JF4A 3ZG8B 3S7NA 3UE0A 4RX3A 3KSHA 4BBUA 5L09A 3NECA 4I38A 4WELA 3TJZC 2PYPA 3K3CA 3D4FA 3JVVA 3T1RA 3OCLA 2JKTM 1IKGA 3LIFA 1ERMA 4ARZB 1BT5A 3V50A 5GHXA 3A3DA 3HLDA 4FSFA 1K54C 1PIOA 3T1SA 5M19A 4LRZE 3HLGA 3H9WA 4GLQA 4JLFA 5FEFA 3PBRA 5EV0A 2QJ7A 3E2LA 3MSHA 5CX7A 1DJCA 3MMHA 5AVFA 4JGRA 1SKOB 1CQAA 4ZJ1A 5AJGA 2W27A 4OQGA 4Q8IA 3UDFA 4GDBA 5CHJA 2XFTA 5HD3A 2WYXA 4O7DA 1BUEA 3TE8A 4PMAA 4NG2A 5L2FA 3V5MA 1DJBA 3LEZA 1K0KA 4ESPA 2A3UA 4HIAA 1FQGA 3S22A 4LV0A 3UN7A 1BLHA 4N1XA 2AVXA 5GL9A 3BYDA 1MKIA 3DWZA 3OZHA 4WL9A 2J3TC 1PI4A 3BEBA 2L1MA 1S1YA 3RXXA 2W1RA 3T1QB 2V1BA 1T1CA 5FI6A 3M2KA 4IJGA 1LT0A 3LY3A 4JBFA 4PM7A 4R1GA 4ETXA 3IS2B 1IYOA 3CITA 3I7JA 1RP5A 3L7HA 3P01A 4R3AA 1S67L 4N1HA 3B33A 4NETA 3W4OA 2JKGA 3JPUA 3MKEA 3CG5A 3G2YA 2FFFB 2O0YA 2E8JA 1S1ZA 3UB5P 4MBKA 3DTIA 4I5SA 1OTAA 1ZG4A 3LI8A 4LV2A 3O86A 3T4QA 3BY8A 3QP4A 5M1AA 3EQUA 5DJUA 4QU3A 2V20A 4Y2FA 4RA7A 2WUQA 1LLBA 4CLCE 2V1ZA 5AQBA 3T12B 5FSRA 3IF6A 5HX9A 4DE3A 1K38A 5AQAA 1F9IA 1ODVA 3CI6A 4XUXA 1KOUA 1YLWA 2J9OA 3UPNA 2RL3A 2WGIA 2Q9NA 2PAVP 4KZBA 3G34A 3IXHA 2QZ6A 1KE4A 1ZG6A 1AWIA 3A3EA 1VETA 3ZHHA 1VM1A 5HAPA 4CLCD 4UA7A 5J4EA 5TBMA 1KGEA 1W7FA 4N9LA 5DVAA 5GLCA 4WEKA 2GDNA 2YKFA 3NJAA 4MBFA 5HDCA 3E4QA 1KE3A 4Y13A 5AQ9A 1XKZA 1NZUA 2J7VA 4JGPA 3RXWA 4KG5A 2Y2HA 1GHIA 4GB7A 4MNRA 5A90A 3VP4A 2XRNA 3GMWA 2G2WA 4IVIA 3WS2A 3DW0A 2ZBBA 3DWKA 5TGFA 1C3BA 1H8ZA 4I39A 3EQVA 1TD5A 3V67A 1LSVA 1N9NA 2VKSA 1K25A 3IXGA 3HLWA 5GHYA 4PM6A 2W3GA 3IF6B 3VP1A 1Z6FA 3AGFA 4R38A 2ZC3B 4BBVA 5EUAA 1FOFA 5HWTA 4OLDA 4PM8A 4JXVA 2IWCA 2QPNA 1GCEA 2CMNA 4F3LA 4E3OA 3GQZA 2EX8A 3W4PA 2ZLYA 2MJ6A 4X6TA 4R23A 3F1PA 2HP9A 4E6XA 2D01A 2K2NA 1VETB 4FH2A 1YMXA 5CXWA 5TBMB 1FR1A 3E4OA 1MWUA 1O07A 2ZQDA 2PBDP 1ZHHB 1CEFA 5JYOA 2PU4A 4LGWA 4DJ2A 4F94A 5A91A 5FDSA 2IWDA 2RCXA 3TSGA 5GHZA 4ZDXA 1W5DA 3T50A 2EWWA 2OLVA 1SZVA 2KDKA 5KMWA 3MR0A 3ICYA 3JVUA 4BLMA 4QY6A 4Y7PA 4WYYA 3O88A 5AQ7A 1XPBA 2XSSA 3LR5A 4GHIB 4X53A 1OTIA 3GV9A 3NULA 2ACGA 1D1JA 5KIZA 4PAUA 4G3VA 4PM5A 3G30A 3IX8A 4CQHA 1N9OA 1SHVA 4F3LB 2VV8A 4N92A 3HCYA 2H5SA 1E25A 4EUVA 1YLJA 3UDIA 4HJ4A 5FA7A 2KX6A 1S4RA 4LRYC 3T4OA 2Y2JA 3BY9A 2EX6A 1YPRA 5FQIA 1MZUA 4OOMA 2VX8A 4E3NA 4KQOA 3UPPA 2QYBA 4L9FA 3KYQA 5HPIA 4EBPA 4HOIA 3G32A 2V8CA 2WKHA 2VGKA 3G35A 5CHMA 1M40A 1IEMA 2A24A 4UA6A 2Y2PA 1NLZA 4R3JA 4ZTKA 3Q81A 3E2KA 4S2OA 1YM1A 2OAQ1 4JPMA 1WYBA 1YLTA 5C5KA 4FCFA 2PR6A 1T18A 5AVEA 5EOOA 3CUEC 2JC7A 2QHKA 4Y15A 1OTDA 3A0RA 2P9VA 5L07A 1NWZA 5EPHA 2QJ5A 2WKEA 3BWLA 1GSVA 3WS1A 4EXOA 5FDHA 3V3SA 1YQSA 2R9WA 4MN7A 3G4PA 4EERA 4P6BA 1X0OA 4KZ7A 2ZQ9A 2ZM2A 2Y2NA 1P97A 2VV7A 4MMNA 1S66L 3EWKA 3QP1A 4E3IA 5G4ZA 1DP9A 4RX2A 3C8CA 3GECA 2VK3A 2GNXA 4II7A 2XA7M 3DBAA 4X55A 3ZCZA 4WUJA 2PT7A 2VZWA 2A24B 1GHPA 1TS8A 3UY6A 1LI0A 3UE1A 3BFGA 3LUQA 3T4TA 3UPOA 5HWWA 3P98A 4NEED 2HP5A 4LFUA 2L4RA 2ZQAA 3RH8B 2O9CA 3N8LA 1Q2PA 2PD8A 2L0WA 4FTXA 3P09A 3LICA 2PYRA 2P9VB 1EW0A 1K57C 3SZTA 3PBTA 1VEUA 1XGIA 5L8MA 1F2KA 4OPYA 4U0TA 3FC7A 1K55C 3C4PA 2HF6A 3T4KA 1DP6A 2G2UA 4NXFA 2DNSA 2ZM8A 5F83A 1LSXA 2KLIA 1K6RA 3LCEA 1K54A 4KG2A 3GVBA 3EGDC 1SDNA 1FCMA 1LL8A 3QHYA 1LSWA 5DKKA 4K08A 3LIEA 3OPLA 4IHQA 1SDEA 4NXBA 3MS6A 1XJ3A 4EWFA 2XH9A 3IHBA 3ZVTA 2O9BA 5FAOA 1OTBA 2Y2GA 1H8YA 3VOZA 1E3UA 4R4SA 2Y2LA 3QP6A 4K0WA 4BL2A 4WMCA 2XR0A 3VE3A 3MXQA 2OWJA 2Q9MA 3BM6A 4Q0JA 4UQIM 4M3KA 4KZ6A 3DTEA 1GSWA 3TG9A 1ZC2A 4DXBA 4DMZA 1VEUB 3UE6A 2PBYA 5I94A 1MKMA 1FSYA 1PYYA 5F1GA 1Z09A 2V0UA 3OPPA 1H5XA 4EUZA 3L9KA 5G18A 1FILA 2IWBA 5LBRA 1NJ4A 3IS2A 4JF5A 5EVEA 1MY8A 3IH8A 3E4PA 3CHWP 5EVID 3E0YA 5FQJA 3MXSA 2WZZA 4DRTA 4X1MA 3OLOA 5IT5A 3NDGA 5JYPA 1A0KA 3PBQA 3W2ZA 3LR0A 1M6KA 1Y54A 1YSPA 4QJGA 5HAQA 1H0MA 5FI7A 1JWZA 4P0MA 4D60A 1G6OA 4GKUA 4EEUA 3MBZA 1J3WA 5EM0A 4BD1A 3P7NA 3IQAA 4PPRA 1NZOA 2PU2A 4X69A 4KZ5A 4WM9A 3F1NB 3LEQA 4S2JA 2B02A 3BW6A 5E43A 2D02A 4OPQA 2W3DA 2GJ3A 4CPKA 3TRCA 1IELA 4YFMA 2Z2MB 3HVFA 3HLBA 3EOIA 3HREA 1MWRA 1ESUA 1GA0A 4ZBEA 1K6SA 4WLAA 4S2NC 4NK3A 2HP6A 4XT2A 5EE8A 1K4FA 1DP8A 3HL9A 3MFDA 2XQZA 5E2HA 3HLEA 2HJEA 5TR7A 1G28A 3R7WA 1ES2A 4GZBA 4WZ5C 2XROA 3S1YA 2WKPA 3ZG0A 3OOVA 3BQ8A 4NXGA 1BLCA 3BFEA 3QP5A 1JVJA 1ACFA 3SOIA 3S7PA 2WAEA 2O9AA 4LENA 4CJNA 1IOUA 3R4KA 1TDLA 4MCWA 2PD7A 1OJ5A 4KG6A 4IUHA 1N9LA 2EX9A 2Y2MA 4P85A 4JGOA 2IA2A 2HGVA 3C38A 2ZQ7A 2ZD8A 4Y17A 1DJAA 3C7VA 2CC1A 5FQ9A 3ZFZA 1I2WA 1V9ZA 1MXOA 4HESA 4DN0A 3VE4A 3MZDA 1CEGA 4MDZA 4EESA 4JF6A 5HARA 2VLGA 4LRXC 3SS5A 1K56A 4FD8A 4NKPA 4XT2B 4S2PA 2W3EA 1JWPA 2G7UA 3Q7VB 2Y2IA 3G6OA 3UNWA 4HP9A 2EFXA 2VGLM 2I9VA 3R7WB 4R4RA 1KVMA 4KQDA 4G3WA 4OQHA 1ES3A 3GDIA 4HH3A 4PKYA 1XJ2A 2WKIA 4ETZA 2ZOHA 4BWIA 2H0YA 1YKDA 5E2FA 4HJ6A 3UMEA 4FOFA 1KDWA 3FYZA 4MBHA 1TS7A 2O99A 5F69A 5CEDA 4KUKA 4GHIA 1BLPA 5DTKA 4BD0A 3BFFA 3C2WA 1UWPX 2WGWA 3LGOA 1HZOA 2EWVA 2Y2QA 1LL5A 3AGEA 5FQKA 1HVBA 1TS0A 3FG8A 3SH8A 1PW8A 2FZ0A 5M18A 5HFOA 2OSUA 3TW8A 1PWGA 5TJJA 4HJ3A 4R3BA 2WK0A 2Z2LB 1G68A 1CI9A 3HUMA 3MZFA 1ESIA 1KGGA 1N4OA 2UV0E 1RGYA 3FV7A 4OONA 3ZDJA 3NIAA 1Y4OA 1YMSA 2HDSA 3WWXA 4DE2A 3ZQ5A 3PAGA 1PZOA 2GX5A 1HTZA 2Q0OA 5A92A 1AXBA 4Y3IA 2ZM0A 1F98A 3CUEA 1PW1A 2WKRA 2HJ9C 5FQMA 5GLBA 3MZEA 4Y0TA 4HQAA 3OCNA 4OPRA 1W63Q 3NC8A 3T1XA 3S7QA 3EGXC 3GRJA 4U3TA 1XFQA 2R9XA 1PZPA 2WGWB 4BBTA 3BLSA 5E2GA 3VP0A 1FCOA 3BLMA 3BJNA 3A0SA 1I2SA 4YNRA 3WRZA 2P04A 2ZC7A 4S2IA 4OKPA 5HW3A 4OLGA 2C6WB 3OC2A 3Q82A 1L0FA 4UEYA 3MF0A 2B18A 3KO6A 5F6AA 4DDYA 4HBTA 2QWSA 3VSKA 4BENA 3PBOA 2XD5A 4GOGA 4GD8A 1TS6A 1Y28A 3FKVA 5DF7A 3HUNA 3B3XA 1S6RA 5DJTA 5CEBA 2Y2OA 2EA9A 1RCJA 5CGWA 3CPTA 4I3AA 3MJQA 1E3UD 2NUPC 4H8RA 2LB9A 1PNEA 2X01A 2VEAA 1VHMA 3C7UA 3KYEA 4WMCD 2J9PA 3VP2A 1K57A 2J3WA 4RQ9A 3UB7A 1CJFA 4UHUA 1IKIA 2M7VA 2NUTC 4OOYA 2VA0A 1K55A 2WAFA 4E04A 2PHYA 1STZA 4EQ1A 3LIAA 4U0XA 4KZ8A 4Y0UA 2J3TD 1SKFA 1HD8A 5DFXA 5FQQA 1T1AA 1VB6A 3ZNYA 3Q7ZA 2E8IA 5DF9A 3U2AA 2FH5A 3VFHA 2HDQA 3SH7A 5F1FA 5J3WA 1LL9A 4CLCC 1XA1A 1NRJA 3A3JA 3ZG9B 3K2NA 4LCLA 2Z6DA 3SH9A 2ZOIA 3LIBA 2V9AA 1ZTUA 4EEPA 4HY8A 3QNCA 2ZQ8A 2VJWA 4WF0A 1W8YA 5EM1A 1EI5A 2BASA 4IBXA 3CPTB 5DTTA 4KZAA 2R78A 2PR5A 4K91A 3VP3A 2BTFP 2P7JA 2XK1A 4GW9A 5HDSA 5EVLA 3SW1A 1FSWA 5HL6A 4N9KA 1SCWA 3GTCA 3AGDA 4GCZA 5EOEA 3RTYA 1MWTA 3C30A 5F82A 1PRQA 1J9MA 4B9OA 1RGZA 1MBLA 3NOPC 5F5YA 1ERQA 2ZC4B 5U47A 2XDMA 4O01A 2VGLS 3IHAA 5J7EA 4HBUA 1XJ4A 4O0PA 5I5LA 5FAQA 4OPZA 2ZMAA 4L9EA 4X1LA 4MN5A 3FZCA 3OBFA 5HDDA 1EWZA 1XXMA 2Y4AA 3VOYA 1F5MA 4JXWA 1LI9A 4KZ3A 1WA9A 3VMAA 4HHDA 4X68A 3GSGA 2V8FA 4EBLA 3LIDA 4MEZA 4L9GA 2QMIA 2K7SA 4XXRA 3F1NA 2Y2KA 3H7WA 5J8XA 3B47A 3PYPA 4GD6A 4KQQA 2EXBA 1BSGA 2X02A 5HAIA 5IHVA 1PI5A 5EFWA 2WGVA 4I3JA 1JWVA 1TVFA 5KSHA 1WE4A 3NI9A 3CAXA 4HP4A 4DKIA 4E3KA 1UGUA 4YOFA 2JHEA 4GJ4A 2JKRI 5TFQA 1P9RA 3UB9A 3PTEA 4S2NA 3O3VA 3IF5A 4KZ9A 4LV3A 5A8BA 2KOIA 3MQQA 4EETB 1K56D 5CGSA 2H28A 1BULA 4WZ5A 5EECA 2I72A 4UAAA 1W63M 2DCFA 3EEAA 3IWQA 3OPHA 4OH0A 1N9BA 1GHMA 2V1AA 4YWZA 4X25A 2V2FF 4S2MA 3S7OA 4QB8A 3ZVWA 1ZKJA 2QKPA 3KX0X 3M6HA 4R70A 4EU0A 2DMWA 1IYPA 1E4DA 4WBGA 4EBNA 3RFBA 2WKQA 4WN5A 3MQOA 3H7WB 3B42A 3EEHA 4A5RA 3BFCA 3ITBA 1CK3A 4UA9A 4D2OA 1P0ZA 3CMZA 5G4YA 4PKYG 1I5QA 3IH9A 3G2ZA 2OAP1 2A2LA 1YSQA 4JGQA 3ZG7B 1QMFA 2DRWA 4S2KA 4YINA 1BLSA 5K5BA 3T4JA 4QD4A 4QPRA 1PWDA 3SS4A 4Y0OA 3CJMA 3Q7VA 4FUWA 4DDSA 2UWXA 3BFDA 2P74A 4E6WA 5F68A 5MC7A 1D06A 1OT9A 1HLUP 2HV1A 4ZAMA 3NOTC 5L10A 3UDXA 1L0GA 2PRFA 1FR6A 1LHYA 3HJIA 3IBRA 4LLOB 3WS4A 3ZG5A 3IXDA 3WRTA 3PBNA 3GR2A 2JKRM 2WADA 2XGNA 4I3IA 3UE3A 1EROA 4QWOA 1O7EA 4Z1WA 4ZJ2A 2INWA 4IEDA 4PM9A 2ZMVA 2BG1A 2C5WB 2W1TA 4GNUA 4E3LA 3NY4A 3HLFA 3PHYA 3VFFA 4DXCA 3PR6A 1VQQA 3DAVA 4HEFA 3C5AA 1BYWA 1T1BA 5CTNA 2W0NA 2ZL1A 3N7WA 3U4LP 2HZ5A 4KQRA 1W79A 5CECA 3ZYTA 5DF8A 3Q1FA 2XA7S 1OPXA 4R0QA 2WZXA 2XFSA 1QMEA 2HPBA 1ALQA 3ISGA 2K31A 1NY0A 3NOUC 2B95A 5EVIA 3HUOA 2H10A 1NYYA 5A93A 4KZ4A 5FAPA 3LR4A 4IBRA 4OQ0A 3KYZA 4LPZA 3W4QA 5KZHA 4P6ZM 1IFQA 2Z6CA 3H82A 3N6IA 2X71A 4L0LA 4C3QA 1UWNX 1MC0A 3UB6A 3N8SA 2XD1A 1XX2A 1XGJA 1TF1A 3D9YA 3NHQA 4OQIA 3UO9A 3CZDA 1CF0A 1U60A 3Q07A 3IX4A 1IYQA 4KENB 4C6YA 5KSCA 3WS5A 2W1TB 2Y55A 4IUKA 2J8YA 3LI9A 1GSXA 3IWOA 5FATA 2ZMFA 3CWFA 4C75A 3IXBA 2JN7A 3QNBA 1TEMA 3RJUA 3IF6C 5IS1A 1KE0A 3HJKA 1ES5A 4QY5A 2H0TA 3LFVA 2ZL1B 1KDSA 5FASA 3LO7A 4AFIA 3QP2A 3O87A 2JE5A 1H3QA 1Q2QA 3T4LA 2LB5A 5CGXA 2Y59A 3A0VA 2ZJ9A 1IYSA 3K3DA 2Y8HA 3W8KA 5HL1A 4LCMA 5EVIC 3KSGA 5EVIB 4XUZA 4GN2A 1XFNA 2BLSA 2M7UA 4X56A 1CI8A 3H82B 4WEJA 4UQIS 1NXYA 4DE0A 1JNUA 3QP8A 3C4OA 1XJ6A 2PDRA 4PHTA 4JKTA 2VGJA 1NLYA 1L2SA 3LR3A 4EQIA 2W3FA 3N4IA 4BJPA 3M2JA 2OOLA 3IWIA 2EXAA 4Z9QA 3N8RA 4HH2A 1L3LA 4OVDA 3V3RA 4DF6A 3MXRA 4IVKA 4GS9A 4BL3A 1NYMA 1W8QA 4MLLA 4H6JA 3BRMA 3A3FA 1S4SA 4JXGA 4Y5FA 2J80A 3FPWA 1JTGA 2HDUA 3DTKA 3OPRA 4CLCA 1MWSA 3MFXA 3CLOA 4B88A 5DFYA 4BMWA 4EW7A 3F1PB 1T19A 3F1OA 3PBSA 3T4SA 2JBFA 4EV4A 2ZC5B 3VOLA 1H8MA 3E98A 1NRFA 4RYEA 4NXEA 4E3JA 4QHCA 1YLYA 3UB8A 4B4ZA 3KSIA 1L0EA 5HZHA 2ZQCA 3PXPA 3VV4A 4KUOA 5CTMA 3ZGAB 2ZC6B 3HBRA 1ONHA 3ULFA 4GDNA 3LYXA 2EFUA 2EX2A 2W3HA 4WZ4A 3NDEA 4M4XA 1ONGA 3MKFA 3LY4A 4GS9B 5DTSA 3NCKA 3FKWA
chains in the Genus database with same CATH topology
2ZLYA 4X6TA 5J8XA 4R23A 1JTDA 4GD6A 4BQMA 4KQQA 2HP9A 4E6XA 2EXBA 1BSGA 1BLCA 2X02A 1TDGA 3BFEA 3JYIA 1PI5A 5HAIA 4FH2A 5IHVA 1YMXA 1JVJA 2A49A 2WGVA 3SOIA 5CXWA 2WAEA 1WYCA 3G31A 1JWVA 1FR1A 1MWUA 4LENA 4CJNA 1O07A 1TDLA 1TVFA 1WE4A 3NI9A 5KSHA 2B5RA 4ZJ3A 2ZQDA 4KG6A 2EX9A 2Y2MA 4P85A 5CHUA 4DKIA 4E3KA 1CEFA 5JYOA 5BOHA 2ZQ7A 2PU4A 5TFQA 2ZD8A 1BTLA 4F94A 4JXSA 1DJAA 5A91A 2IWDA 3PTEA 4S2NA 2RCXA 3TSGA 3O3VA 4LV1A 3C7VA 5GHZA 4ZDXA 2CC1A 5FQ9A 2OV5A 3V39A 1W5DA 2OLVA 3ZFZA 1I2WA 3IF5A 1BZAA 4KZ9A 2JCHA 1MPLA 1MXOA 5KMWA 4LV3A 4HESA 3HLCA 4S2LA 3M6BA 1K56D 3MZDA 3NBLA 5CGSA 3IT9A 1CEGA 5E2EA 1BULA 1YT4A 3A3IA 4BLMA 4E3MA 4QY6A 4WZ5A 4Y7PA 5EECA 4JF6A 5HARA 4WYYA 4B4XA 2I72A 4UAAA 4OP8A 2DCFA 3O88A 3IWQA 3OPHA 1XP4A 1XPBA 5AQ7A 3SS5A 5CERA 1K56A 4OH0A 4FD8A 1N9BA 5D3OA 4X53A 3GV9A 4S2PA 1GHMA 2XLNA 1JWPA 3Q7VB 1GA9A 2V2FF 4S2MA 4PM5A 2HDRA 4QB8A 1ES4A 2Y2IA 1KGFA 3ZVWA 1ZKJA 3UNWA 3M6HA 3G30A 2EFXA 1SHVA 1IYPA 1E4DA 4R4RA 4N92A 4WBGA 4EBNA 2H5SA 1E25A 1KVMA 1YLJA 3UDIA 5FA7A 4OQHA 2Y2JA 1ES3A 2EX6A 1L0DA 2WKIA 4ID4A 5FQIA 3ZNTA 4A5RA 3BFCA 3ITBA 3VSLA 2OLUA 1CK3A 2H0YA 4UA9A 2Y91A 5E2FA 4D2OA 4OOMA 3CMZA 4OP5A 4E3NA 1I5QA 4KQOA 3UPPA 1FCNA 5FI2A 3IH9A 3G2ZA 4K0XA 1KDWA 3FYZA 3DTMA 3FWLA 3ZG7B 4EBPA 1QMFA 2DRWA 3G32A 2WKHA 1BLSA 4MBHA 4S2KA 4YINA 3TOIA 3S4XA 4QD4A 2VGKA 3G35A 5CHMA 1M40A 1IEMA 1PWDA 5CEDA 3SS4A 4Y0OA 4UA6A 4DE1A 3CJMA 2Y2PA 1BLPA 5GLAA 5DTKA 4R3JA 3Q7VA 3Q81A 4ZTKA 4BD0A 3BFFA 3E2KA 4DDSA 2XF3A 4S2OA 1YM1A 2UWXA 4JPMA 1WYBA 2P74A 1K4EA 2WGWA 1HZOA 3BFDA 3PAEA 3BECA 4E6WA 1DY6A 1YLTA 1S0WA 2Y2QA 1LL5A 1YLPA 1KVLA 4FCFA 4ZAMA 3AGEA 5FQKA 5EOOA 1HVBA 2XEPA 4FH4A 2JC7A 1OMEA 3SH8A 3SS3A 1L0GA 3UDXA 1PW8A 1FR6A 1LHYA 3ITAA 4OOLA 1YLZA 3WS4A 5M18A 3ZG5A 2P9VA 5HFOA 2FFYA 5EPHA 3IXDA 3WRTA 2OSUA 2WKEA 1PWGA 3PBNA 3WS1A 3WS0A 5CRFA 4RVAA 1XA7A 3GR2A 1G6AA 2WADA 5FDHA 2XGNA 3V3SA 4R3BA 3UE3A 1YQSA 2WK0A 2R9WA 2Z2LB 1G68A 1CI9A 1EROA 4P87A 5GLDA 3G4PA 3HUMA 3MZFA 4P6BA 1ESIA 1KGGA 1O7EA 1PWCA 1N4OA 4ZJ2A 4KZ7A 2ZQ9A 1RGYA 4JF4A 3FV7A 4OONA 3ZG8B 4IEDA 2ZM2A 3ZDJA 3NIAA 2Y2NA 4PM9A 3UE0A 2BG1A 2C5WB 4RX3A 4E3IA 1YMSA 2HDSA 3WWXA 4GNUA 4WELA 4DE2A 3D4FA 4E3LA 4RX2A 3PAGA 3OCLA 1PZOA 1IKGA 3NY4A 3HLFA 1ERMA 1HTZA 3VFFA 4DXCA 1BT5A 5A92A 1AXBA 3V50A 1VQQA 4HEFA 3C5AA 2ZM0A 5GHXA 3A3DA 4X55A 5CTNA 3ZCZA 3HLDA 1PW1A 4FSFA 1K54C 1PIOA 3N7WA 5M19A 1GHPA 3HLGA 5FQMA 4KQRA 5GLBA 1W79A 3MZEA 4Y0TA 4JLFA 5CECA 4OPRA 3OCNA 3UY6A 5DF8A 1LI0A 3Q1FA 3UE1A 3PBRA 3NC8A 4R0QA 3BFGA 3GRJA 2WZXA 3E2LA 4U3TA 2XFSA 1QMEA 2R9XA 3UPOA 1PZPA 2WGWB 1DJCA 2HPBA 3P98A 1ALQA 2HP5A 3ISGA 3BLSA 5E2GA 3VP0A 2ZQAA 4ZJ1A 1NY0A 3N8LA 1Q2PA 1FCOA 3BLMA 5EVIA 4OQGA 3HUOA 2H10A 3P09A 1NYYA 4Q8IA 5A93A 1I2SA 4KZ4A 3UDFA 2P9VB 4GDBA 5FAPA 2ZC7A 5CHJA 2XFTA 1K57C 3WRZA 4IBRA 4OQ0A 4S2IA 3PBTA 3W4QA 1XGIA 2WYXA 4OKPA 4O7DA 5KZHA 1BUEA 5HW3A 4OLGA 4OPYA 2C6WB 3OC2A 3Q82A 3N6IA 4PMAA 1L0FA 4U0TA 1K55C 3C4PA 2X71A 3V5MA 4L0LA 5L2FA 1DJBA 3LEZA 4C3QA 4DDYA 2A3UA 1FQGA 4HBTA 4BENA 3VSKA 3S22A 3N8SA 3PBOA 4LV0A 2XD5A 2XD1A 1XX2A 4GOGA 1XGJA 2G2UA 3UN7A 2DNSA 2ZM8A 4GD8A 5F83A 1BLHA 1K6RA 3LCEA 4N1XA 1K54A 3FKVA 4OQIA 3HUNA 4KG2A 5DF7A 3UO9A 3CZDA 5GL9A 1U60A 3BYDA 1MKIA 3DWZA 3B3XA 3GVBA 3OZHA 3Q07A 1IYQA 1S6RA 4KENB 4C6YA 1SDNA 5KSCA 1FCMA 1PI4A 2Y55A 3BEBA 3WS5A 3QHYA 3RXXA 2J8YA 3IWOA 5FI6A 3OPLA 3M2KA 5CEBA 2Y2OA 5FATA 3LY3A 4JBFA 1RCJA 5CGWA 4PM7A 4C75A 3IXBA 1SDEA 3QNBA 1TEMA 3RJUA 1E3UD 3IF6C 1KE0A 4H8RA 4EWFA 2XH9A 1ES5A 3IHBA 4QY5A 2H0TA 4R1GA 2X01A 3ZVTA 3C7UA 4WMCD 1KDSA 5FASA 2J9PA 3VP2A 1K57A 3LO7A 5FAOA 1IYOA 3I7JA 1RP5A 2Y2GA 1IKIA 4UHUA 3O87A 2JE5A 4N1HA 1H8YA 4NETA 3W4OA 3VOZA 1E3UA 4OOYA 1Q2QA 4R4SA 3MKEA 1K55A 2WAFA 2Y2LA 3CG5A 4K0WA 4BL2A 3G2YA 4WMCA 4U0XA 2XR0A 2Y59A 2ZJ9A 5CGXA 4KZ8A 1IYSA 4Y0UA 2FFFB 1SKFA 2Q9MA 4MBKA 3W8KA 1HD8A 5HL1A 1ZG4A 3BM6A 4LCMA 5EVIC 4M3KA 5FQQA 4LV2A 3O86A 5EVIB 4XUZA 3ZNYA 4KZ6A 3Q7ZA 4GN2A 2E8IA 2BLSA 3TG9A 1ZC2A 5DF9A 4DXBA 4X56A 5M1AA 1CI8A 3EQUA 3VFHA 2HDQA 4WEJA 3SH7A 5F1FA 4QU3A 2V20A 2PBYA 5I94A 1LL9A 1NXYA 1XA1A 5F1GA 1FSYA 1PYYA 3A3JA 4RA7A 2WUQA 4DE0A 1LLBA 3OPPA 2V1ZA 5AQBA 1H5XA 3C4OA 3ZG9B 4EUZA 5FSRA 3IF6A 5G18A 5HX9A 4DE3A 4JKTA 2VGJA 4LCLA 1K38A 2IWBA 1L2SA 5AQAA 4EQIA 1NJ4A 4JF5A 3N4IA 3SH9A 4XUXA 4BJPA 1MY8A 3IH8A 3M2JA 3IWIA 2EXAA 1YLWA 2J9OA 3UPNA 2RL3A 2WGIA 5EVID 5FQJA 3MXSA 3QNCA 2Q9NA 4Z9QA 2WZZA 3N8RA 2ZQ8A 4DRTA 1W8YA 3NDGA 1EI5A 4OVDA 3V3RA 4DF6A 5JYPA 3MXRA 4IBXA 4IVKA 4BL3A 5DTTA 4KZAA 4KZBA 3G34A 3PBQA 3IXHA 2QZ6A 4K91A 3VP3A 1KE4A 2XK1A 1M6KA 1NYMA 1ZG6A 3A3EA 1W8QA 1Y54A 4QJGA 5HAQA 3ZHHA 1VM1A 5EVLA 5HAPA 4MLLA 1FSWA 5FI7A 4UA7A 1JWZA 3BRMA 4P0MA 1KGEA 1W7FA 3A3FA 4JXGA 4N9LA 5DVAA 4N9KA 1SCWA 5GLCA 4GKUA 3MBZA 3GTCA 3AGDA 5EOEA 4BD1A 1JTGA 2HDUA 1MWTA 4WEKA 2GDNA 3IQAA 1NZOA 4PPRA 5F82A 3OPRA 2PU2A 4X69A 1J9MA 4KZ5A 1MWSA 4WM9A 1RGZA 4MBFA 4B88A 1KE3A 1MBLA 5AQ9A 1XKZA 1NZUA 2J7VA 4S2JA 1ERQA 3RXWA 2ZC4B 4KG5A 5U47A 2XDMA 2Y2HA 5E43A 1GHIA 4GB7A 4MNRA 3PBSA 4OPQA 3IHAA 5A90A 3VP4A 3GMWA 4HBUA 2G2WA 4IVIA 2JBFA 4CPKA 3WS2A 4EV4A 2ZC5B 1IELA 4YFMA 3DW0A 2Z2MB 3HVFA 5FAQA 4OPZA 2ZMAA 3HLBA 3DWKA 1NRFA 4RYEA 5TGFA 1C3BA 1H8ZA 3HREA 3EQVA 1MWRA 4QHCA 4E3JA 1ESUA 1K25A 1GA0A 1YLYA 3FZCA 4B4ZA 3IXGA 3HLWA 5GHYA 4PM6A 1EWZA 1XXMA 4ZBEA 3IF6B 1K6SA 1L0EA 2Y4AA 3VP1A 3VOYA 1Z6FA 4S2NC 4NK3A 2ZQCA 2HP6A 3AGFA 5CTMA 2ZC3B 4JXWA 5EE8A 1K4FA 1LI9A 3ZGAB 2ZC6B 4KZ3A 5EUAA 3HL9A 1FOFA 3MFDA 3HBRA 2XQZA 3VMAA 1ONHA 5E2HA 4OLDA 4PM8A 4JXVA 2IWCA 4X68A 4GDNA 3GSGA 2QPNA 3HLEA 5TR7A 1GCEA 2EFUA 2EX2A 4WZ4A 1ES2A 4GZBA 3NDEA 4EBLA 4MEZA 4WZ5C 1ONGA 3MKFA 4E3OA 3GQZA 3S1YA 2EX8A 3LY4A 2QMIA 4XXRA 5DTSA 3NCKA 3W4PA 2Y2KA 3FKWA 3ZG0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZLY A;  4X6T A;  5J8X A;  4R23 A;  1JTD A;  4GD6 A;  4BQM A;  4KQQ A;  2HP9 A;  4E6X A;  2EXB A;  1BSG A;  1BLC A;  2X02 A;  1TDG A;  3BFE A;  3JYI A;  1PI5 A;  5HAI A;  4FH2 A;  5IHV A;  1YMX A;  1JVJ A;  2A49 A;  2WGV A;  3SOI A;  5CXW A;  2WAE A;  1WYC A;  3G31 A;  1JWV A;  1FR1 A;  1MWU A;  4LEN A;  4CJN A;  1O07 A;  1TDL A;  1TVF A;  1WE4 A;  3NI9 A;  5KSH A;  2B5R A;  4ZJ3 A;  2ZQD A;  4KG6 A;  2EX9 A;  2Y2M A;  4P85 A;  5CHU A;  4DKI A;  4E3K A;  1CEF A;  5JYO A;  5BOH A;  2ZQ7 A;  2PU4 A;  5TFQ A;  2ZD8 A;  1BTL A;  4F94 A;  4JXS A;  1DJA A;  5A91 A;  2IWD A;  3PTE A;  4S2N A;  2RCX A;  3TSG A;  3O3V A;  4LV1 A;  3C7V A;  5GHZ A;  4ZDX A;  2CC1 A;  5FQ9 A;  2OV5 A;  3V39 A;  1W5D A;  2OLV A;  3ZFZ A;  1I2W A;  3IF5 A;  1BZA A;  4KZ9 A;  2JCH A;  1MPL A;  1MXO A;  5KMW A;  4LV3 A;  4HES A;  3HLC A;  4S2L A;  3M6B A;  1K56 D;  3MZD A;  3NBL A;  5CGS A;  3IT9 A;  1CEG A;  5E2E A;  1BUL A;  1YT4 A;  3A3I A;  4BLM A;  4E3M A;  4QY6 A;  4WZ5 A;  4Y7P A;  5EEC A;  4JF6 A;  5HAR A;  4WYY A;  4B4X A;  2I72 A;  4UAA A;  4OP8 A;  2DCF A;  3O88 A;  3IWQ A;  3OPH A;  1XP4 A;  1XPB A;  5AQ7 A;  3SS5 A;  5CER A;  1K56 A;  4OH0 A;  4FD8 A;  1N9B A;  5D3O A;  4X53 A;  3GV9 A;  4S2P A;  1GHM A;  2XLN A;  1JWP A;  3Q7V B;  1GA9 A;  2V2F F;  4S2M A;  4PM5 A;  2HDR A;  4QB8 A;  1ES4 A;  2Y2I A;  1KGF A;  3ZVW A;  1ZKJ A;  3UNW A;  3M6H A;  3G30 A;  2EFX A;  1SHV A;  1IYP A;  1E4D A;  4R4R A;  4N92 A;  4WBG A;  4EBN A;  2H5S A;  1E25 A;  1KVM A;  1YLJ A;  3UDI A;  5FA7 A;  4OQH A;  2Y2J A;  1ES3 A;  2EX6 A;  1L0D A;  2WKI A;  4ID4 A;  5FQI A;  3ZNT A;  4A5R A;  3BFC A;  3ITB A;  3VSL A;  2OLU A;  1CK3 A;  2H0Y A;  4UA9 A;  2Y91 A;  5E2F A;  4D2O A;  4OOM A;  3CMZ A;  4OP5 A;  4E3N A;  1I5Q A;  4KQO A;  3UPP A;  1FCN A;  5FI2 A;  3IH9 A;  3G2Z A;  4K0X A;  1KDW A;  3FYZ A;  3DTM A;  3FWL A;  3ZG7 B;  4EBP A;  1QMF A;  2DRW A;  3G32 A;  2WKH A;  1BLS A;  4MBH A;  4S2K A;  4YIN A;  3TOI A;  3S4X A;  4QD4 A;  2VGK A;  3G35 A;  5CHM A;  1M40 A;  1IEM A;  1PWD A;  5CED A;  3SS4 A;  4Y0O A;  4UA6 A;  4DE1 A;  3CJM A;  2Y2P A;  1BLP A;  5GLA A;  5DTK A;  4R3J A;  3Q7V A;  3Q81 A;  4ZTK A;  4BD0 A;  3BFF A;  3E2K A;  4DDS A;  2XF3 A;  4S2O A;  1YM1 A;  2UWX A;  4JPM A;  1WYB A;  2P74 A;  1K4E A;  2WGW A;  1HZO A;  3BFD A;  3PAE A;  3BEC A;  4E6W A;  1DY6 A;  1YLT A;  1S0W A;  2Y2Q A;  1LL5 A;  1YLP A;  1KVL A;  4FCF A;  4ZAM A;  3AGE A;  5FQK A;  5EOO A;  1HVB A;  2XEP A;  4FH4 A;  2JC7 A;  1OME A;  3SH8 A;  3SS3 A;  1L0G A;  3UDX A;  1PW8 A;  1FR6 A;  1LHY A;  3ITA A;  4OOL A;  1YLZ A;  3WS4 A;  5M18 A;  3ZG5 A;  2P9V A;  5HFO A;  2FFY A;  5EPH A;  3IXD A;  3WRT A;  2OSU A;  2WKE A;  1PWG A;  3PBN A;  3WS1 A;  3WS0 A;  5CRF A;  4RVA A;  1XA7 A;  3GR2 A;  1G6A A;  2WAD A;  5FDH A;  2XGN A;  3V3S A;  4R3B A;  3UE3 A;  1YQS A;  2WK0 A;  2R9W A;  2Z2L B;  1G68 A;  1CI9 A;  1ERO A;  4P87 A;  5GLD A;  3G4P A;  3HUM A;  3MZF A;  4P6B A;  1ESI A;  1KGG A;  1O7E A;  1PWC A;  1N4O A;  4ZJ2 A;  4KZ7 A;  2ZQ9 A;  1RGY A;  4JF4 A;  3FV7 A;  4OON A;  3ZG8 B;  4IED A;  2ZM2 A;  3ZDJ A;  3NIA A;  2Y2N A;  4PM9 A;  3UE0 A;  2BG1 A;  2C5W B;  4RX3 A;  4E3I A;  1YMS A;  2HDS A;  3WWX A;  4GNU A;  4WEL A;  4DE2 A;  3D4F A;  4E3L A;  4RX2 A;  3PAG A;  3OCL A;  1PZO A;  1IKG A;  3NY4 A;  3HLF A;  1ERM A;  1HTZ A;  3VFF A;  4DXC A;  1BT5 A;  5A92 A;  1AXB A;  3V50 A;  1VQQ A;  4HEF A;  3C5A A;  2ZM0 A;  5GHX A;  3A3D A;  4X55 A;  5CTN A;  3ZCZ A;  3HLD A;  1PW1 A;  4FSF A;  1K54 C;  1PIO A;  3N7W A;  5M19 A;  1GHP A;  3HLG A;  5FQM A;  4KQR A;  5GLB A;  1W79 A;  3MZE A;  4Y0T A;  4JLF A;  5CEC A;  4OPR A;  3OCN A;  3UY6 A;  5DF8 A;  1LI0 A;  3Q1F A;  3UE1 A;  3PBR A;  3NC8 A;  4R0Q A;  3BFG A;  3GRJ A;  2WZX A;  3E2L A;  4U3T A;  2XFS A;  1QME A;  2R9X A;  3UPO A;  1PZP A;  2WGW B;  1DJC A;  2HPB A;  3P98 A;  1ALQ A;  2HP5 A;  3ISG A;  3BLS A;  5E2G A;  3VP0 A;  2ZQA A;  4ZJ1 A;  1NY0 A;  3N8L A;  1Q2P A;  1FCO A;  3BLM A;  5EVI A;  4OQG A;  3HUO A;  2H10 A;  3P09 A;  1NYY A;  4Q8I A;  5A93 A;  1I2S A;  4KZ4 A;  3UDF A;  2P9V B;  4GDB A;  5FAP A;  2ZC7 A;  5CHJ A;  2XFT A;  1K57 C;  3WRZ A;  4IBR A;  4OQ0 A;  4S2I A;  3PBT A;  3W4Q A;  1XGI A;  2WYX A;  4OKP A;  4O7D A;  5KZH A;  1BUE A;  5HW3 A;  4OLG A;  4OPY A;  2C6W B;  3OC2 A;  3Q82 A;  3N6I A;  4PMA A;  1L0F A;  4U0T A;  1K55 C;  3C4P A;  2X71 A;  3V5M A;  4L0L A;  5L2F A;  1DJB A;  3LEZ A;  4C3Q A;  4DDY A;  2A3U A;  1FQG A;  4HBT A;  4BEN A;  3VSK A;  3S22 A;  3N8S A;  3PBO A;  4LV0 A;  2XD5 A;  2XD1 A;  1XX2 A;  4GOG A;  1XGJ A;  2G2U A;  3UN7 A;  2DNS A;  2ZM8 A;  4GD8 A;  5F83 A;  1BLH A;  1K6R A;  3LCE A;  4N1X A;  1K54 A;  3FKV A;  4OQI A;  3HUN A;  4KG2 A;  5DF7 A;  3UO9 A;  3CZD A;  5GL9 A;  1U60 A;  3BYD A;  1MKI A;  3DWZ A;  3B3X A;  3GVB A;  3OZH A;  3Q07 A;  1IYQ A;  1S6R A;  4KEN B;  4C6Y A;  1SDN A;  5KSC A;  1FCM A;  1PI4 A;  2Y55 A;  3BEB A;  3WS5 A;  3QHY A;  3RXX A;  2J8Y A;  3IWO A;  5FI6 A;  3OPL A;  3M2K A;  5CEB A;  2Y2O A;  5FAT A;  3LY3 A;  4JBF A;  1RCJ A;  5CGW A;  4PM7 A;  4C75 A;  3IXB A;  1SDE A;  3QNB A;  1TEM A;  3RJU A;  1E3U D;  3IF6 C;  1KE0 A;  4H8R A;  4EWF A;  2XH9 A;  1ES5 A;  3IHB A;  4QY5 A;  2H0T A;  4R1G A;  2X01 A;  3ZVT A;  3C7U A;  4WMC D;  1KDS A;  5FAS A;  2J9P A;  3VP2 A;  1K57 A;  3LO7 A;  5FAO A;  1IYO A;  3I7J A;  1RP5 A;  2Y2G A;  1IKI A;  4UHU A;  3O87 A;  2JE5 A;  4N1H A;  1H8Y A;  4NET A;  3W4O A;  3VOZ A;  1E3U A;  4OOY A;  1Q2Q A;  4R4S A;  3MKE A;  1K55 A;  2WAF A;  2Y2L A;  3CG5 A;  4K0W A;  4BL2 A;  3G2Y A;  4WMC A;  4U0X A;  2XR0 A;  2Y59 A;  2ZJ9 A;  5CGX A;  4KZ8 A;  1IYS A;  4Y0U A;  2FFF B;  1SKF A;  2Q9M A;  4MBK A;  3W8K A;  1HD8 A;  5HL1 A;  1ZG4 A;  3BM6 A;  4LCM A;  5EVI C;  4M3K A;  5FQQ A;  4LV2 A;  3O86 A;  5EVI B;  4XUZ A;  3ZNY A;  4KZ6 A;  3Q7Z A;  4GN2 A;  2E8I A;  2BLS A;  3TG9 A;  1ZC2 A;  5DF9 A;  4DXB A;  4X56 A;  5M1A A;  1CI8 A;  3EQU A;  3VFH A;  2HDQ A;  4WEJ A;  3SH7 A;  5F1F A;  4QU3 A;  2V20 A;  2PBY A;  5I94 A;  1LL9 A;  1NXY A;  1XA1 A;  5F1G A;  1FSY A;  1PYY A;  3A3J A;  4RA7 A;  2WUQ A;  4DE0 A;  1LLB A;  3OPP A;  2V1Z A;  5AQB A;  1H5X A;  3C4O A;  3ZG9 B;  4EUZ A;  5FSR A;  3IF6 A;  5G18 A;  5HX9 A;  4DE3 A;  4JKT A;  2VGJ A;  4LCL A;  1K38 A;  2IWB A;  1L2S A;  5AQA A;  4EQI A;  1NJ4 A;  4JF5 A;  3N4I A;  3SH9 A;  4XUX A;  4BJP A;  1MY8 A;  3IH8 A;  3M2J A;  3IWI A;  2EXA A;  1YLW A;  2J9O A;  3UPN A;  2RL3 A;  2WGI A;  5EVI D;  5FQJ A;  3MXS A;  3QNC A;  2Q9N A;  4Z9Q A;  2WZZ A;  3N8R A;  2ZQ8 A;  4DRT A;  1W8Y A;  3NDG A;  1EI5 A;  4OVD A;  3V3R A;  4DF6 A;  5JYP A;  3MXR A;  4IBX A;  4IVK A;  4BL3 A;  5DTT A;  4KZA A;  4KZB A;  3G34 A;  3PBQ A;  3IXH A;  2QZ6 A;  4K91 A;  3VP3 A;  1KE4 A;  2XK1 A;  1M6K A;  1NYM A;  1ZG6 A;  3A3E A;  1W8Q A;  1Y54 A;  4QJG A;  5HAQ A;  3ZHH A;  1VM1 A;  5EVL A;  5HAP A;  4MLL A;  1FSW A;  5FI7 A;  4UA7 A;  1JWZ A;  3BRM A;  4P0M A;  1KGE A;  1W7F A;  3A3F A;  4JXG A;  4N9L A;  5DVA A;  4N9K A;  1SCW A;  5GLC A;  4GKU A;  3MBZ A;  3GTC A;  3AGD A;  5EOE A;  4BD1 A;  1JTG A;  2HDU A;  1MWT A;  4WEK A;  2GDN A;  3IQA A;  1NZO A;  4PPR A;  5F82 A;  3OPR A;  2PU2 A;  4X69 A;  1J9M A;  4KZ5 A;  1MWS A;  4WM9 A;  1RGZ A;  4MBF A;  4B88 A;  1KE3 A;  1MBL A;  5AQ9 A;  1XKZ A;  1NZU A;  2J7V A;  4S2J A;  1ERQ A;  3RXW A;  2ZC4 B;  4KG5 A;  5U47 A;  2XDM A;  2Y2H A;  5E43 A;  1GHI A;  4GB7 A;  4MNR A;  3PBS A;  4OPQ A;  3IHA A;  5A90 A;  3VP4 A;  3GMW A;  4HBU A;  2G2W A;  4IVI A;  2JBF A;  4CPK A;  3WS2 A;  4EV4 A;  2ZC5 B;  1IEL A;  4YFM A;  3DW0 A;  2Z2M B;  3HVF A;  5FAQ A;  4OPZ A;  2ZMA A;  3HLB A;  3DWK A;  1NRF A;  4RYE A;  5TGF A;  1C3B A;  1H8Z A;  3HRE A;  3EQV A;  1MWR A;  4QHC A;  4E3J A;  1ESU A;  1K25 A;  1GA0 A;  1YLY A;  3FZC A;  4B4Z A;  3IXG A;  3HLW A;  5GHY A;  4PM6 A;  1EWZ A;  1XXM A;  4ZBE A;  3IF6 B;  1K6S A;  1L0E A;  2Y4A A;  3VP1 A;  3VOY A;  1Z6F A;  4S2N C;  4NK3 A;  2ZQC A;  2HP6 A;  3AGF A;  5CTM A;  2ZC3 B;  4JXW A;  5EE8 A;  1K4F A;  1LI9 A;  3ZGA B;  2ZC6 B;  4KZ3 A;  5EUA A;  3HL9 A;  1FOF A;  3MFD A;  3HBR A;  2XQZ A;  3VMA A;  1ONH A;  5E2H A;  4OLD A;  4PM8 A;  4JXV A;  2IWC A;  4X68 A;  4GDN A;  3GSG A;  2QPN A;  3HLE A;  5TR7 A;  1GCE A;  2EFU A;  2EX2 A;  4WZ4 A;  1ES2 A;  4GZB A;  3NDE A;  4EBL A;  4MEZ A;  4WZ5 C;  1ONG A;  3MKF A;  4E3O A;  3GQZ A;  3S1Y A;  2EX8 A;  3LY4 A;  2QMI A;  4XXR A;  5DTS A;  3NCK A;  3W4P A;  2Y2K A;  3FKW A;  3ZG0 A; 
#chains in the Genus database with same CATH topology
 1JTD A;  2YKH A;  4BQM A;  1TDG A;  3JYI A;  3KSF A;  2A49 A;  4H6J B;  4MN6 A;  1WYC A;  3G31 A;  2B5R A;  1PFL A;  4ZJ3 A;  5CHU A;  2Y79 A;  2OWH A;  2VV6 A;  4CLC B;  5BOH A;  1V9Y A;  1D7E A;  1BTL A;  4JXS A;  4LV1 A;  3F1O B;  2OV5 A;  3V39 A;  1BZA A;  2JCH A;  1MPL A;  3UMD A;  3HLC A;  4S2L A;  3M6B A;  3NBL A;  4Q0I A;  3BQA A;  3IT9 A;  5E2E A;  1YT4 A;  3A3I A;  4E3M A;  4B93 A;  2M1C A;  5HWV A;  4B4X A;  4OP8 A;  2JKT I;  1XP4 A;  4R6L A;  5CER A;  1DRM A;  1OJG A;  5D3O A;  4O8G A;  2XLN A;  1GA9 A;  2HDR A;  1ES4 A;  1OT6 A;  1KGF A;  5FEG A;  4ZRR A;  4Q0H A;  5HD5 A;  1L0D A;  4HI4 A;  4ID4 A;  3ZNT A;  5DKL A;  3VSL A;  2OLU A;  4ME4 A;  2Y91 A;  4OP5 A;  1FCN A;  5FI2 A;  4ARZ A;  4DJ3 A;  4K0X A;  3FWL A;  3DTM A;  3TOI A;  3S4X A;  4P6Z S;  1G5U A;  4DE1 A;  3IBJ A;  5GLA A;  4HNB A;  1OTE A;  2GZA A;  2XF3 A;  4G3K A;  3PAE A;  1K4E A;  3BEC A;  1DY6 A;  1FIK A;  1P9W A;  1S0W A;  1SKO A;  1YLP A;  1KVL A;  3FPV A;  3D72 A;  2XEP A;  4FH4 A;  1OME A;  3SS3 A;  2JKF A;  3ITA A;  3D3O A;  4OOL A;  1YLZ A;  3MQ0 A;  5IU1 A;  2FFY A;  3O5Y A;  3WS0 A;  5CRF A;  4RVA A;  1XA7 A;  1G6A A;  2V0W A;  5GLD A;  4P87 A;  5FL3 A;  5HPF A;  1YAX A;  3IX3 A;  5HSQ A;  1PWC A;  2P08 A;  4JF4 A;  3ZG8 B;  3S7N A;  3UE0 A;  4RX3 A;  3KSH A;  4BBU A;  5L09 A;  3NEC A;  4I38 A;  4WEL A;  3TJZ C;  2PYP A;  3K3C A;  3D4F A;  3JVV A;  3T1R A;  3OCL A;  2JKT M;  1IKG A;  3LIF A;  1ERM A;  4ARZ B;  1BT5 A;  3V50 A;  5GHX A;  3A3D A;  3HLD A;  4FSF A;  1K54 C;  1PIO A;  3T1S A;  5M19 A;  4LRZ E;  3HLG A;  3H9W A;  4GLQ A;  4JLF A;  5FEF A;  3PBR A;  5EV0 A;  2QJ7 A;  3E2L A;  3MSH A;  5CX7 A;  1DJC A;  3MMH A;  5AVF A;  4JGR A;  1SKO B;  1CQA A;  4ZJ1 A;  5AJG A;  2W27 A;  4OQG A;  4Q8I A;  3UDF A;  4GDB A;  5CHJ A;  2XFT A;  5HD3 A;  2WYX A;  4O7D A;  1BUE A;  3TE8 A;  4PMA A;  4NG2 A;  5L2F A;  3V5M A;  1DJB A;  3LEZ A;  1K0K A;  4ESP A;  2A3U A;  4HIA A;  1FQG A;  3S22 A;  4LV0 A;  3UN7 A;  1BLH A;  4N1X A;  2AVX A;  5GL9 A;  3BYD A;  1MKI A;  3DWZ A;  3OZH A;  4WL9 A;  2J3T C;  1PI4 A;  3BEB A;  2L1M A;  1S1Y A;  3RXX A;  2W1R A;  3T1Q B;  2V1B A;  1T1C A;  5FI6 A;  3M2K A;  4IJG A;  1LT0 A;  3LY3 A;  4JBF A;  4PM7 A;  4R1G A;  4ETX A;  3IS2 B;  1IYO A;  3CIT A;  3I7J A;  1RP5 A;  3L7H A;  3P01 A;  4R3A A;  1S67 L;  4N1H A;  3B33 A;  4NET A;  3W4O A;  2JKG A;  3JPU A;  3MKE A;  3CG5 A;  3G2Y A;  2FFF B;  2O0Y A;  2E8J A;  1S1Z A;  3UB5 P;  4MBK A;  3DTI A;  4I5S A;  1OTA A;  1ZG4 A;  3LI8 A;  4LV2 A;  3O86 A;  3T4Q A;  3BY8 A;  3QP4 A;  5M1A A;  3EQU A;  5DJU A;  4QU3 A;  2V20 A;  4Y2F A;  4RA7 A;  2WUQ A;  1LLB A;  4CLC E;  2V1Z A;  5AQB A;  3T12 B;  5FSR A;  3IF6 A;  5HX9 A;  4DE3 A;  1K38 A;  5AQA A;  1F9I A;  1ODV A;  3CI6 A;  4XUX A;  1KOU A;  1YLW A;  2J9O A;  3UPN A;  2RL3 A;  2WGI A;  2Q9N A;  2PAV P;  4KZB A;  3G34 A;  3IXH A;  2QZ6 A;  1KE4 A;  1ZG6 A;  1AWI A;  3A3E A;  1VET A;  3ZHH A;  1VM1 A;  5HAP A;  4CLC D;  4UA7 A;  5J4E A;  5TBM A;  1KGE A;  1W7F A;  4N9L A;  5DVA A;  5GLC A;  4WEK A;  2GDN A;  2YKF A;  3NJA A;  4MBF A;  5HDC A;  3E4Q A;  1KE3 A;  4Y13 A;  5AQ9 A;  1XKZ A;  1NZU A;  2J7V A;  4JGP A;  3RXW A;  4KG5 A;  2Y2H A;  1GHI A;  4GB7 A;  4MNR A;  5A90 A;  3VP4 A;  2XRN A;  3GMW A;  2G2W A;  4IVI A;  3WS2 A;  3DW0 A;  2ZBB A;  3DWK A;  5TGF A;  1C3B A;  1H8Z A;  4I39 A;  3EQV A;  1TD5 A;  3V67 A;  1LSV A;  1N9N A;  2VKS A;  1K25 A;  3IXG A;  3HLW A;  5GHY A;  4PM6 A;  2W3G A;  3IF6 B;  3VP1 A;  1Z6F A;  3AGF A;  4R38 A;  2ZC3 B;  4BBV A;  5EUA A;  1FOF A;  5HWT A;  4OLD A;  4PM8 A;  4JXV A;  2IWC A;  2QPN A;  1GCE A;  2CMN A;  4F3L A;  4E3O A;  3GQZ A;  2EX8 A;  3W4P A;  2ZLY A;  2MJ6 A;  4X6T A;  4R23 A;  3F1P A;  2HP9 A;  4E6X A;  2D01 A;  2K2N A;  1VET B;  4FH2 A;  1YMX A;  5CXW A;  5TBM B;  1FR1 A;  3E4O A;  1MWU A;  1O07 A;  2ZQD A;  2PBD P;  1ZHH B;  1CEF A;  5JYO A;  2PU4 A;  4LGW A;  4DJ2 A;  4F94 A;  5A91 A;  5FDS A;  2IWD A;  2RCX A;  3TSG A;  5GHZ A;  4ZDX A;  1W5D A;  3T50 A;  2EWW A;  2OLV A;  1SZV A;  2KDK A;  5KMW A;  3MR0 A;  3ICY A;  3JVU A;  4BLM A;  4QY6 A;  4Y7P A;  4WYY A;  3O88 A;  5AQ7 A;  1XPB A;  2XSS A;  3LR5 A;  4GHI B;  4X53 A;  1OTI A;  3GV9 A;  3NUL A;  2ACG A;  1D1J A;  5KIZ A;  4PAU A;  4G3V A;  4PM5 A;  3G30 A;  3IX8 A;  4CQH A;  1N9O A;  1SHV A;  4F3L B;  2VV8 A;  4N92 A;  3HCY A;  2H5S A;  1E25 A;  4EUV A;  1YLJ A;  3UDI A;  4HJ4 A;  5FA7 A;  2KX6 A;  1S4R A;  4LRY C;  3T4O A;  2Y2J A;  3BY9 A;  2EX6 A;  1YPR A;  5FQI A;  1MZU A;  4OOM A;  2VX8 A;  4E3N A;  4KQO A;  3UPP A;  2QYB A;  4L9F A;  3KYQ A;  5HPI A;  4EBP A;  4HOI A;  3G32 A;  2V8C A;  2WKH A;  2VGK A;  3G35 A;  5CHM A;  1M40 A;  1IEM A;  2A24 A;  4UA6 A;  2Y2P A;  1NLZ A;  4R3J A;  4ZTK A;  3Q81 A;  3E2K A;  4S2O A;  1YM1 A;  2OAQ 1;  4JPM A;  1WYB A;  1YLT A;  5C5K A;  4FCF A;  2PR6 A;  1T18 A;  5AVE A;  5EOO A;  3CUE C;  2JC7 A;  2QHK A;  4Y15 A;  1OTD A;  3A0R A;  2P9V A;  5L07 A;  1NWZ A;  5EPH A;  2QJ5 A;  2WKE A;  3BWL A;  1GSV A;  3WS1 A;  4EXO A;  5FDH A;  3V3S A;  1YQS A;  2R9W A;  4MN7 A;  3G4P A;  4EER A;  4P6B A;  1X0O A;  4KZ7 A;  2ZQ9 A;  2ZM2 A;  2Y2N A;  1P97 A;  2VV7 A;  4MMN A;  1S66 L;  3EWK A;  3QP1 A;  4E3I A;  5G4Z A;  1DP9 A;  4RX2 A;  3C8C A;  3GEC A;  2VK3 A;  2GNX A;  4II7 A;  2XA7 M;  3DBA A;  4X55 A;  3ZCZ A;  4WUJ A;  2PT7 A;  2VZW A;  2A24 B;  1GHP A;  1TS8 A;  3UY6 A;  1LI0 A;  3UE1 A;  3BFG A;  3LUQ A;  3T4T A;  3UPO A;  5HWW A;  3P98 A;  4NEE D;  2HP5 A;  4LFU A;  2L4R A;  2ZQA A;  3RH8 B;  2O9C A;  3N8L A;  1Q2P A;  2PD8 A;  2L0W A;  4FTX A;  3P09 A;  3LIC A;  2PYR A;  2P9V B;  1EW0 A;  1K57 C;  3SZT A;  3PBT A;  1VEU A;  1XGI A;  5L8M A;  1F2K A;  4OPY A;  4U0T A;  3FC7 A;  1K55 C;  3C4P A;  2HF6 A;  3T4K A;  1DP6 A;  2G2U A;  4NXF A;  2DNS A;  2ZM8 A;  5F83 A;  1LSX A;  2KLI A;  1K6R A;  3LCE A;  1K54 A;  4KG2 A;  3GVB A;  3EGD C;  1SDN A;  1FCM A;  1LL8 A;  3QHY A;  1LSW A;  5DKK A;  4K08 A;  3LIE A;  3OPL A;  4IHQ A;  1SDE A;  4NXB A;  3MS6 A;  1XJ3 A;  4EWF A;  2XH9 A;  3IHB A;  3ZVT A;  2O9B A;  5FAO A;  1OTB A;  2Y2G A;  1H8Y A;  3VOZ A;  1E3U A;  4R4S A;  2Y2L A;  3QP6 A;  4K0W A;  4BL2 A;  4WMC A;  2XR0 A;  3VE3 A;  3MXQ A;  2OWJ A;  2Q9M A;  3BM6 A;  4Q0J A;  4UQI M;  4M3K A;  4KZ6 A;  3DTE A;  1GSW A;  3TG9 A;  1ZC2 A;  4DXB A;  4DMZ A;  1VEU B;  3UE6 A;  2PBY A;  5I94 A;  1MKM A;  1FSY A;  1PYY A;  5F1G A;  1Z09 A;  2V0U A;  3OPP A;  1H5X A;  4EUZ A;  3L9K A;  5G18 A;  1FIL A;  2IWB A;  5LBR A;  1NJ4 A;  3IS2 A;  4JF5 A;  5EVE A;  1MY8 A;  3IH8 A;  3E4P A;  3CHW P;  5EVI D;  3E0Y A;  5FQJ A;  3MXS A;  2WZZ A;  4DRT A;  4X1M A;  3OLO A;  5IT5 A;  3NDG A;  5JYP A;  1A0K A;  3PBQ A;  3W2Z A;  3LR0 A;  1M6K A;  1Y54 A;  1YSP A;  4QJG A;  5HAQ A;  1H0M A;  5FI7 A;  1JWZ A;  4P0M A;  4D60 A;  1G6O A;  4GKU A;  4EEU A;  3MBZ A;  1J3W A;  5EM0 A;  4BD1 A;  3P7N A;  3IQA A;  4PPR A;  1NZO A;  2PU2 A;  4X69 A;  4KZ5 A;  4WM9 A;  3F1N B;  3LEQ A;  4S2J A;  2B02 A;  3BW6 A;  5E43 A;  2D02 A;  4OPQ A;  2W3D A;  2GJ3 A;  4CPK A;  3TRC A;  1IEL A;  4YFM A;  2Z2M B;  3HVF A;  3HLB A;  3EOI A;  3HRE A;  1MWR A;  1ESU A;  1GA0 A;  4ZBE A;  1K6S A;  4WLA A;  4S2N C;  4NK3 A;  2HP6 A;  4XT2 A;  5EE8 A;  1K4F A;  1DP8 A;  3HL9 A;  3MFD A;  2XQZ A;  5E2H A;  3HLE A;  2HJE A;  5TR7 A;  1G28 A;  3R7W A;  1ES2 A;  4GZB A;  4WZ5 C;  2XRO A;  3S1Y A;  2WKP A;  3ZG0 A;  3OOV A;  3BQ8 A;  4NXG A;  1BLC A;  3BFE A;  3QP5 A;  1JVJ A;  1ACF A;  3SOI A;  3S7P A;  2WAE A;  2O9A A;  4LEN A;  4CJN A;  1IOU A;  3R4K A;  1TDL A;  4MCW A;  2PD7 A;  1OJ5 A;  4KG6 A;  4IUH A;  1N9L A;  2EX9 A;  2Y2M A;  4P85 A;  4JGO A;  2IA2 A;  2HGV A;  3C38 A;  2ZQ7 A;  2ZD8 A;  4Y17 A;  1DJA A;  3C7V A;  2CC1 A;  5FQ9 A;  3ZFZ A;  1I2W A;  1V9Z A;  1MXO A;  4HES A;  4DN0 A;  3VE4 A;  3MZD A;  1CEG A;  4MDZ A;  4EES A;  4JF6 A;  5HAR A;  2VLG A;  4LRX C;  3SS5 A;  1K56 A;  4FD8 A;  4NKP A;  4XT2 B;  4S2P A;  2W3E A;  1JWP A;  2G7U A;  3Q7V B;  2Y2I A;  3G6O A;  3UNW A;  4HP9 A;  2EFX A;  2VGL M;  2I9V A;  3R7W B;  4R4R A;  1KVM A;  4KQD A;  4G3W A;  4OQH A;  1ES3 A;  3GDI A;  4HH3 A;  4PKY A;  1XJ2 A;  2WKI A;  4ETZ A;  2ZOH A;  4BWI A;  2H0Y A;  1YKD A;  5E2F A;  4HJ6 A;  3UME A;  4FOF A;  1KDW A;  3FYZ A;  4MBH A;  1TS7 A;  2O99 A;  5F69 A;  5CED A;  4KUK A;  4GHI A;  1BLP A;  5DTK A;  4BD0 A;  3BFF A;  3C2W A;  1UWP X;  2WGW A;  3LGO A;  1HZO A;  2EWV A;  2Y2Q A;  1LL5 A;  3AGE A;  5FQK A;  1HVB A;  1TS0 A;  3FG8 A;  3SH8 A;  1PW8 A;  2FZ0 A;  5M18 A;  5HFO A;  2OSU A;  3TW8 A;  1PWG A;  5TJJ A;  4HJ3 A;  4R3B A;  2WK0 A;  2Z2L B;  1G68 A;  1CI9 A;  3HUM A;  3MZF A;  1ESI A;  1KGG A;  1N4O A;  2UV0 E;  1RGY A;  3FV7 A;  4OON A;  3ZDJ A;  3NIA A;  1Y4O A;  1YMS A;  2HDS A;  3WWX A;  4DE2 A;  3ZQ5 A;  3PAG A;  1PZO A;  2GX5 A;  1HTZ A;  2Q0O A;  5A92 A;  1AXB A;  4Y3I A;  2ZM0 A;  1F98 A;  3CUE A;  1PW1 A;  2WKR A;  2HJ9 C;  5FQM A;  5GLB A;  3MZE A;  4Y0T A;  4HQA A;  3OCN A;  4OPR A;  1W63 Q;  3NC8 A;  3T1X A;  3S7Q A;  3EGX C;  3GRJ A;  4U3T A;  1XFQ A;  2R9X A;  1PZP A;  2WGW B;  4BBT A;  3BLS A;  5E2G A;  3VP0 A;  1FCO A;  3BLM A;  3BJN A;  3A0S A;  1I2S A;  4YNR A;  3WRZ A;  2P04 A;  2ZC7 A;  4S2I A;  4OKP A;  5HW3 A;  4OLG A;  2C6W B;  3OC2 A;  3Q82 A;  1L0F A;  4UEY A;  3MF0 A;  2B18 A;  3KO6 A;  5F6A A;  4DDY A;  4HBT A;  2QWS A;  3VSK A;  4BEN A;  3PBO A;  2XD5 A;  4GOG A;  4GD8 A;  1TS6 A;  1Y28 A;  3FKV A;  5DF7 A;  3HUN A;  3B3X A;  1S6R A;  5DJT A;  5CEB A;  2Y2O A;  2EA9 A;  1RCJ A;  5CGW A;  3CPT A;  4I3A A;  3MJQ A;  1E3U D;  2NUP C;  4H8R A;  2LB9 A;  1PNE A;  2X01 A;  2VEA A;  1VHM A;  3C7U A;  3KYE A;  4WMC D;  2J9P A;  3VP2 A;  1K57 A;  2J3W A;  4RQ9 A;  3UB7 A;  1CJF A;  4UHU A;  1IKI A;  2M7V A;  2NUT C;  4OOY A;  2VA0 A;  1K55 A;  2WAF A;  4E04 A;  2PHY A;  1STZ A;  4EQ1 A;  3LIA A;  4U0X A;  4KZ8 A;  4Y0U A;  2J3T D;  1SKF A;  1HD8 A;  5DFX A;  5FQQ A;  1T1A A;  1VB6 A;  3ZNY A;  3Q7Z A;  2E8I A;  5DF9 A;  3U2A A;  2FH5 A;  3VFH A;  2HDQ A;  3SH7 A;  5F1F A;  5J3W A;  1LL9 A;  4CLC C;  1XA1 A;  1NRJ A;  3A3J A;  3ZG9 B;  3K2N A;  4LCL A;  2Z6D A;  3SH9 A;  2ZOI A;  3LIB A;  2V9A A;  1ZTU A;  4EEP A;  4HY8 A;  3QNC A;  2ZQ8 A;  2VJW A;  4WF0 A;  1W8Y A;  5EM1 A;  1EI5 A;  2BAS A;  4IBX A;  3CPT B;  5DTT A;  4KZA A;  2R78 A;  2PR5 A;  4K91 A;  3VP3 A;  2BTF P;  2P7J A;  2XK1 A;  4GW9 A;  5HDS A;  5EVL A;  3SW1 A;  1FSW A;  5HL6 A;  4N9K A;  1SCW A;  3GTC A;  3AGD A;  4GCZ A;  5EOE A;  3RTY A;  1MWT A;  3C30 A;  5F82 A;  1PRQ A;  1J9M A;  4B9O A;  1RGZ A;  1MBL A;  3NOP C;  5F5Y A;  1ERQ A;  2ZC4 B;  5U47 A;  2XDM A;  4O01 A;  2VGL S;  3IHA A;  5J7E A;  4HBU A;  1XJ4 A;  4O0P A;  5I5L A;  5FAQ A;  4OPZ A;  2ZMA A;  4L9E A;  4X1L A;  4MN5 A;  3FZC A;  3OBF A;  5HDD A;  1EWZ A;  1XXM A;  2Y4A A;  3VOY A;  1F5M A;  4JXW A;  1LI9 A;  4KZ3 A;  1WA9 A;  3VMA A;  4HHD A;  4X68 A;  3GSG A;  2V8F A;  4EBL A;  3LID A;  4MEZ A;  4L9G A;  2QMI A;  2K7S A;  4XXR A;  3F1N A;  2Y2K A;  3H7W A;  5J8X A;  3B47 A;  3PYP A;  4GD6 A;  4KQQ A;  2EXB A;  1BSG A;  2X02 A;  5HAI A;  5IHV A;  1PI5 A;  5EFW A;  2WGV A;  4I3J A;  1JWV A;  1TVF A;  5KSH A;  1WE4 A;  3NI9 A;  3CAX A;  4HP4 A;  4DKI A;  4E3K A;  1UGU A;  4YOF A;  2JHE A;  4GJ4 A;  2JKR I;  5TFQ A;  1P9R A;  3UB9 A;  3PTE A;  4S2N A;  3O3V A;  3IF5 A;  4KZ9 A;  4LV3 A;  5A8B A;  2KOI A;  3MQQ A;  4EET B;  1K56 D;  5CGS A;  2H28 A;  1BUL A;  4WZ5 A;  5EEC A;  2I72 A;  4UAA A;  1W63 M;  2DCF A;  3EEA A;  3IWQ A;  3OPH A;  4OH0 A;  1N9B A;  1GHM A;  2V1A A;  4YWZ A;  4X25 A;  2V2F F;  4S2M A;  3S7O A;  4QB8 A;  3ZVW A;  1ZKJ A;  2QKP A;  3KX0 X;  3M6H A;  4R70 A;  4EU0 A;  2DMW A;  1IYP A;  1E4D A;  4WBG A;  4EBN A;  3RFB A;  2WKQ A;  4WN5 A;  3MQO A;  3H7W B;  3B42 A;  3EEH A;  4A5R A;  3BFC A;  3ITB A;  1CK3 A;  4UA9 A;  4D2O A;  1P0Z A;  3CMZ A;  5G4Y A;  4PKY G;  1I5Q A;  3IH9 A;  3G2Z A;  2OAP 1;  2A2L A;  1YSQ A;  4JGQ A;  3ZG7 B;  1QMF A;  2DRW A;  4S2K A;  4YIN A;  1BLS A;  5K5B A;  3T4J A;  4QD4 A;  4QPR A;  1PWD A;  3SS4 A;  4Y0O A;  3CJM A;  3Q7V A;  4FUW A;  4DDS A;  2UWX A;  3BFD A;  2P74 A;  4E6W A;  5F68 A;  5MC7 A;  1D06 A;  1OT9 A;  1HLU P;  2HV1 A;  4ZAM A;  3NOT C;  5L10 A;  3UDX A;  1L0G A;  2PRF A;  1FR6 A;  1LHY A;  3HJI A;  3IBR A;  4LLO B;  3WS4 A;  3ZG5 A;  3IXD A;  3WRT A;  3PBN A;  3GR2 A;  2JKR M;  2WAD A;  2XGN A;  4I3I A;  3UE3 A;  1ERO A;  4QWO A;  1O7E A;  4Z1W A;  4ZJ2 A;  2INW A;  4IED A;  4PM9 A;  2ZMV A;  2BG1 A;  2C5W B;  2W1T A;  4GNU A;  4E3L A;  3NY4 A;  3HLF A;  3PHY A;  3VFF A;  4DXC A;  3PR6 A;  1VQQ A;  3DAV A;  4HEF A;  3C5A A;  1BYW A;  1T1B A;  5CTN A;  2W0N A;  2ZL1 A;  3N7W A;  3U4L P;  2HZ5 A;  4KQR A;  1W79 A;  5CEC A;  3ZYT A;  5DF8 A;  3Q1F A;  2XA7 S;  1OPX A;  4R0Q A;  2WZX A;  2XFS A;  1QME A;  2HPB A;  1ALQ A;  3ISG A;  2K31 A;  1NY0 A;  3NOU C;  2B95 A;  5EVI A;  3HUO A;  2H10 A;  1NYY A;  5A93 A;  4KZ4 A;  5FAP A;  3LR4 A;  4IBR A;  4OQ0 A;  3KYZ A;  4LPZ A;  3W4Q A;  5KZH A;  4P6Z M;  1IFQ A;  2Z6C A;  3H82 A;  3N6I A;  2X71 A;  4L0L A;  4C3Q A;  1UWN X;  1MC0 A;  3UB6 A;  3N8S A;  2XD1 A;  1XX2 A;  1XGJ A;  1TF1 A;  3D9Y A;  3NHQ A;  4OQI A;  3UO9 A;  3CZD A;  1CF0 A;  1U60 A;  3Q07 A;  3IX4 A;  1IYQ A;  4KEN B;  4C6Y A;  5KSC A;  3WS5 A;  2W1T B;  2Y55 A;  4IUK A;  2J8Y A;  3LI9 A;  1GSX A;  3IWO A;  5FAT A;  2ZMF A;  3CWF A;  4C75 A;  3IXB A;  2JN7 A;  3QNB A;  1TEM A;  3RJU A;  3IF6 C;  5IS1 A;  1KE0 A;  3HJK A;  1ES5 A;  4QY5 A;  2H0T A;  3LFV A;  2ZL1 B;  1KDS A;  5FAS A;  3LO7 A;  4AFI A;  3QP2 A;  3O87 A;  2JE5 A;  1H3Q A;  1Q2Q A;  3T4L A;  2LB5 A;  5CGX A;  2Y59 A;  3A0V A;  2ZJ9 A;  1IYS A;  3K3D A;  2Y8H A;  3W8K A;  5HL1 A;  4LCM A;  5EVI C;  3KSG A;  5EVI B;  4XUZ A;  4GN2 A;  1XFN A;  2BLS A;  2M7U A;  4X56 A;  1CI8 A;  3H82 B;  4WEJ A;  4UQI S;  1NXY A;  4DE0 A;  1JNU A;  3QP8 A;  3C4O A;  1XJ6 A;  2PDR A;  4PHT A;  4JKT A;  2VGJ A;  1NLY A;  1L2S A;  3LR3 A;  4EQI A;  2W3F A;  3N4I A;  4BJP A;  3M2J A;  2OOL A;  3IWI A;  2EXA A;  4Z9Q A;  3N8R A;  4HH2 A;  1L3L A;  4OVD A;  3V3R A;  4DF6 A;  3MXR A;  4IVK A;  4GS9 A;  4BL3 A;  1NYM A;  1W8Q A;  4MLL A;  4H6J A;  3BRM A;  3A3F A;  1S4S A;  4JXG A;  4Y5F A;  2J80 A;  3FPW A;  1JTG A;  2HDU A;  3DTK A;  3OPR A;  4CLC A;  1MWS A;  3MFX A;  3CLO A;  4B88 A;  5DFY A;  4BMW A;  4EW7 A;  3F1P B;  1T19 A;  3F1O A;  3PBS A;  3T4S A;  2JBF A;  4EV4 A;  2ZC5 B;  3VOL A;  1H8M A;  3E98 A;  1NRF A;  4RYE A;  4NXE A;  4E3J A;  4QHC A;  1YLY A;  3UB8 A;  4B4Z A;  3KSI A;  1L0E A;  5HZH A;  2ZQC A;  3PXP A;  3VV4 A;  4KUO A;  5CTM A;  3ZGA B;  2ZC6 B;  3HBR A;  1ONH A;  3ULF A;  4GDN A;  3LYX A;  2EFU A;  2EX2 A;  2W3H A;  4WZ4 A;  3NDE A;  4M4X A;  1ONG A;  3MKF A;  3LY4 A;  4GS9 B;  5DTS A;  3NCK A;  3FKW A; 
#chains in the Genus database with same CATH homology
 2ZLY A;  4X6T A;  5J8X A;  4R23 A;  1JTD A;  4GD6 A;  4BQM A;  4KQQ A;  2HP9 A;  4E6X A;  2EXB A;  1BSG A;  1BLC A;  2X02 A;  1TDG A;  3BFE A;  3JYI A;  1PI5 A;  5HAI A;  4FH2 A;  5IHV A;  1YMX A;  1JVJ A;  2A49 A;  2WGV A;  3SOI A;  5CXW A;  2WAE A;  1WYC A;  3G31 A;  1JWV A;  1FR1 A;  1MWU A;  4LEN A;  4CJN A;  1O07 A;  1TDL A;  1TVF A;  1WE4 A;  3NI9 A;  5KSH A;  2B5R A;  4ZJ3 A;  2ZQD A;  4KG6 A;  2EX9 A;  2Y2M A;  4P85 A;  5CHU A;  4DKI A;  4E3K A;  1CEF A;  5JYO A;  5BOH A;  2ZQ7 A;  2PU4 A;  5TFQ A;  2ZD8 A;  1BTL A;  4F94 A;  4JXS A;  1DJA A;  5A91 A;  2IWD A;  3PTE A;  4S2N A;  2RCX A;  3TSG A;  3O3V A;  4LV1 A;  3C7V A;  5GHZ A;  4ZDX A;  2CC1 A;  5FQ9 A;  2OV5 A;  3V39 A;  1W5D A;  2OLV A;  3ZFZ A;  1I2W A;  3IF5 A;  1BZA A;  4KZ9 A;  2JCH A;  1MPL A;  1MXO A;  5KMW A;  4LV3 A;  4HES A;  3HLC A;  4S2L A;  3M6B A;  1K56 D;  3MZD A;  3NBL A;  5CGS A;  3IT9 A;  1CEG A;  5E2E A;  1BUL A;  1YT4 A;  3A3I A;  4BLM A;  4E3M A;  4QY6 A;  4WZ5 A;  4Y7P A;  5EEC A;  4JF6 A;  5HAR A;  4WYY A;  4B4X A;  2I72 A;  4UAA A;  4OP8 A;  2DCF A;  3O88 A;  3IWQ A;  3OPH A;  1XP4 A;  1XPB A;  5AQ7 A;  3SS5 A;  5CER A;  1K56 A;  4OH0 A;  4FD8 A;  1N9B A;  5D3O A;  4X53 A;  3GV9 A;  4S2P A;  1GHM A;  2XLN A;  1JWP A;  3Q7V B;  1GA9 A;  2V2F F;  4S2M A;  4PM5 A;  2HDR A;  4QB8 A;  1ES4 A;  2Y2I A;  1KGF A;  3ZVW A;  1ZKJ A;  3UNW A;  3M6H A;  3G30 A;  2EFX A;  1SHV A;  1IYP A;  1E4D A;  4R4R A;  4N92 A;  4WBG A;  4EBN A;  2H5S A;  1E25 A;  1KVM A;  1YLJ A;  3UDI A;  5FA7 A;  4OQH A;  2Y2J A;  1ES3 A;  2EX6 A;  1L0D A;  2WKI A;  4ID4 A;  5FQI A;  3ZNT A;  4A5R A;  3BFC A;  3ITB A;  3VSL A;  2OLU A;  1CK3 A;  2H0Y A;  4UA9 A;  2Y91 A;  5E2F A;  4D2O A;  4OOM A;  3CMZ A;  4OP5 A;  4E3N A;  1I5Q A;  4KQO A;  3UPP A;  1FCN A;  5FI2 A;  3IH9 A;  3G2Z A;  4K0X A;  1KDW A;  3FYZ A;  3DTM A;  3FWL A;  3ZG7 B;  4EBP A;  1QMF A;  2DRW A;  3G32 A;  2WKH A;  1BLS A;  4MBH A;  4S2K A;  4YIN A;  3TOI A;  3S4X A;  4QD4 A;  2VGK A;  3G35 A;  5CHM A;  1M40 A;  1IEM A;  1PWD A;  5CED A;  3SS4 A;  4Y0O A;  4UA6 A;  4DE1 A;  3CJM A;  2Y2P A;  1BLP A;  5GLA A;  5DTK A;  4R3J A;  3Q7V A;  3Q81 A;  4ZTK A;  4BD0 A;  3BFF A;  3E2K A;  4DDS A;  2XF3 A;  4S2O A;  1YM1 A;  2UWX A;  4JPM A;  1WYB A;  2P74 A;  1K4E A;  2WGW A;  1HZO A;  3BFD A;  3PAE A;  3BEC A;  4E6W A;  1DY6 A;  1YLT A;  1S0W A;  2Y2Q A;  1LL5 A;  1YLP A;  1KVL A;  4FCF A;  4ZAM A;  3AGE A;  5FQK A;  5EOO A;  1HVB A;  2XEP A;  4FH4 A;  2JC7 A;  1OME A;  3SH8 A;  3SS3 A;  1L0G A;  3UDX A;  1PW8 A;  1FR6 A;  1LHY A;  3ITA A;  4OOL A;  1YLZ A;  3WS4 A;  5M18 A;  3ZG5 A;  2P9V A;  5HFO A;  2FFY A;  5EPH A;  3IXD A;  3WRT A;  2OSU A;  2WKE A;  1PWG A;  3PBN A;  3WS1 A;  3WS0 A;  5CRF A;  4RVA A;  1XA7 A;  3GR2 A;  1G6A A;  2WAD A;  5FDH A;  2XGN A;  3V3S A;  4R3B A;  3UE3 A;  1YQS A;  2WK0 A;  2R9W A;  2Z2L B;  1G68 A;  1CI9 A;  1ERO A;  4P87 A;  5GLD A;  3G4P A;  3HUM A;  3MZF A;  4P6B A;  1ESI A;  1KGG A;  1O7E A;  1PWC A;  1N4O A;  4ZJ2 A;  4KZ7 A;  2ZQ9 A;  1RGY A;  4JF4 A;  3FV7 A;  4OON A;  3ZG8 B;  4IED A;  2ZM2 A;  3ZDJ A;  3NIA A;  2Y2N A;  4PM9 A;  3UE0 A;  2BG1 A;  2C5W B;  4RX3 A;  4E3I A;  1YMS A;  2HDS A;  3WWX A;  4GNU A;  4WEL A;  4DE2 A;  3D4F A;  4E3L A;  4RX2 A;  3PAG A;  3OCL A;  1PZO A;  1IKG A;  3NY4 A;  3HLF A;  1ERM A;  1HTZ A;  3VFF A;  4DXC A;  1BT5 A;  5A92 A;  1AXB A;  3V50 A;  1VQQ A;  4HEF A;  3C5A A;  2ZM0 A;  5GHX A;  3A3D A;  4X55 A;  5CTN A;  3ZCZ A;  3HLD A;  1PW1 A;  4FSF A;  1K54 C;  1PIO A;  3N7W A;  5M19 A;  1GHP A;  3HLG A;  5FQM A;  4KQR A;  5GLB A;  1W79 A;  3MZE A;  4Y0T A;  4JLF A;  5CEC A;  4OPR A;  3OCN A;  3UY6 A;  5DF8 A;  1LI0 A;  3Q1F A;  3UE1 A;  3PBR A;  3NC8 A;  4R0Q A;  3BFG A;  3GRJ A;  2WZX A;  3E2L A;  4U3T A;  2XFS A;  1QME A;  2R9X A;  3UPO A;  1PZP A;  2WGW B;  1DJC A;  2HPB A;  3P98 A;  1ALQ A;  2HP5 A;  3ISG A;  3BLS A;  5E2G A;  3VP0 A;  2ZQA A;  4ZJ1 A;  1NY0 A;  3N8L A;  1Q2P A;  1FCO A;  3BLM A;  5EVI A;  4OQG A;  3HUO A;  2H10 A;  3P09 A;  1NYY A;  4Q8I A;  5A93 A;  1I2S A;  4KZ4 A;  3UDF A;  2P9V B;  4GDB A;  5FAP A;  2ZC7 A;  5CHJ A;  2XFT A;  1K57 C;  3WRZ A;  4IBR A;  4OQ0 A;  4S2I A;  3PBT A;  3W4Q A;  1XGI A;  2WYX A;  4OKP A;  4O7D A;  5KZH A;  1BUE A;  5HW3 A;  4OLG A;  4OPY A;  2C6W B;  3OC2 A;  3Q82 A;  3N6I A;  4PMA A;  1L0F A;  4U0T A;  1K55 C;  3C4P A;  2X71 A;  3V5M A;  4L0L A;  5L2F A;  1DJB A;  3LEZ A;  4C3Q A;  4DDY A;  2A3U A;  1FQG A;  4HBT A;  4BEN A;  3VSK A;  3S22 A;  3N8S A;  3PBO A;  4LV0 A;  2XD5 A;  2XD1 A;  1XX2 A;  4GOG A;  1XGJ A;  2G2U A;  3UN7 A;  2DNS A;  2ZM8 A;  4GD8 A;  5F83 A;  1BLH A;  1K6R A;  3LCE A;  4N1X A;  1K54 A;  3FKV A;  4OQI A;  3HUN A;  4KG2 A;  5DF7 A;  3UO9 A;  3CZD A;  5GL9 A;  1U60 A;  3BYD A;  1MKI A;  3DWZ A;  3B3X A;  3GVB A;  3OZH A;  3Q07 A;  1IYQ A;  1S6R A;  4KEN B;  4C6Y A;  1SDN A;  5KSC A;  1FCM A;  1PI4 A;  2Y55 A;  3BEB A;  3WS5 A;  3QHY A;  3RXX A;  2J8Y A;  3IWO A;  5FI6 A;  3OPL A;  3M2K A;  5CEB A;  2Y2O A;  5FAT A;  3LY3 A;  4JBF A;  1RCJ A;  5CGW A;  4PM7 A;  4C75 A;  3IXB A;  1SDE A;  3QNB A;  1TEM A;  3RJU A;  1E3U D;  3IF6 C;  1KE0 A;  4H8R A;  4EWF A;  2XH9 A;  1ES5 A;  3IHB A;  4QY5 A;  2H0T A;  4R1G A;  2X01 A;  3ZVT A;  3C7U A;  4WMC D;  1KDS A;  5FAS A;  2J9P A;  3VP2 A;  1K57 A;  3LO7 A;  5FAO A;  1IYO A;  3I7J A;  1RP5 A;  2Y2G A;  1IKI A;  4UHU A;  3O87 A;  2JE5 A;  4N1H A;  1H8Y A;  4NET A;  3W4O A;  3VOZ A;  1E3U A;  4OOY A;  1Q2Q A;  4R4S A;  3MKE A;  1K55 A;  2WAF A;  2Y2L A;  3CG5 A;  4K0W A;  4BL2 A;  3G2Y A;  4WMC A;  4U0X A;  2XR0 A;  2Y59 A;  2ZJ9 A;  5CGX A;  4KZ8 A;  1IYS A;  4Y0U A;  2FFF B;  1SKF A;  2Q9M A;  4MBK A;  3W8K A;  1HD8 A;  5HL1 A;  1ZG4 A;  3BM6 A;  4LCM A;  5EVI C;  4M3K A;  5FQQ A;  4LV2 A;  3O86 A;  5EVI B;  4XUZ A;  3ZNY A;  4KZ6 A;  3Q7Z A;  4GN2 A;  2E8I A;  2BLS A;  3TG9 A;  1ZC2 A;  5DF9 A;  4DXB A;  4X56 A;  5M1A A;  1CI8 A;  3EQU A;  3VFH A;  2HDQ A;  4WEJ A;  3SH7 A;  5F1F A;  4QU3 A;  2V20 A;  2PBY A;  5I94 A;  1LL9 A;  1NXY A;  1XA1 A;  5F1G A;  1FSY A;  1PYY A;  3A3J A;  4RA7 A;  2WUQ A;  4DE0 A;  1LLB A;  3OPP A;  2V1Z A;  5AQB A;  1H5X A;  3C4O A;  3ZG9 B;  4EUZ A;  5FSR A;  3IF6 A;  5G18 A;  5HX9 A;  4DE3 A;  4JKT A;  2VGJ A;  4LCL A;  1K38 A;  2IWB A;  1L2S A;  5AQA A;  4EQI A;  1NJ4 A;  4JF5 A;  3N4I A;  3SH9 A;  4XUX A;  4BJP A;  1MY8 A;  3IH8 A;  3M2J A;  3IWI A;  2EXA A;  1YLW A;  2J9O A;  3UPN A;  2RL3 A;  2WGI A;  5EVI D;  5FQJ A;  3MXS A;  3QNC A;  2Q9N A;  4Z9Q A;  2WZZ A;  3N8R A;  2ZQ8 A;  4DRT A;  1W8Y A;  3NDG A;  1EI5 A;  4OVD A;  3V3R A;  4DF6 A;  5JYP A;  3MXR A;  4IBX A;  4IVK A;  4BL3 A;  5DTT A;  4KZA A;  4KZB A;  3G34 A;  3PBQ A;  3IXH A;  2QZ6 A;  4K91 A;  3VP3 A;  1KE4 A;  2XK1 A;  1M6K A;  1NYM A;  1ZG6 A;  3A3E A;  1W8Q A;  1Y54 A;  4QJG A;  5HAQ A;  3ZHH A;  1VM1 A;  5EVL A;  5HAP A;  4MLL A;  1FSW A;  5FI7 A;  4UA7 A;  1JWZ A;  3BRM A;  4P0M A;  1KGE A;  1W7F A;  3A3F A;  4JXG A;  4N9L A;  5DVA A;  4N9K A;  1SCW A;  5GLC A;  4GKU A;  3MBZ A;  3GTC A;  3AGD A;  5EOE A;  4BD1 A;  1JTG A;  2HDU A;  1MWT A;  4WEK A;  2GDN A;  3IQA A;  1NZO A;  4PPR A;  5F82 A;  3OPR A;  2PU2 A;  4X69 A;  1J9M A;  4KZ5 A;  1MWS A;  4WM9 A;  1RGZ A;  4MBF A;  4B88 A;  1KE3 A;  1MBL A;  5AQ9 A;  1XKZ A;  1NZU A;  2J7V A;  4S2J A;  1ERQ A;  3RXW A;  2ZC4 B;  4KG5 A;  5U47 A;  2XDM A;  2Y2H A;  5E43 A;  1GHI A;  4GB7 A;  4MNR A;  3PBS A;  4OPQ A;  3IHA A;  5A90 A;  3VP4 A;  3GMW A;  4HBU A;  2G2W A;  4IVI A;  2JBF A;  4CPK A;  3WS2 A;  4EV4 A;  2ZC5 B;  1IEL A;  4YFM A;  3DW0 A;  2Z2M B;  3HVF A;  5FAQ A;  4OPZ A;  2ZMA A;  3HLB A;  3DWK A;  1NRF A;  4RYE A;  5TGF A;  1C3B A;  1H8Z A;  3HRE A;  3EQV A;  1MWR A;  4QHC A;  4E3J A;  1ESU A;  1K25 A;  1GA0 A;  1YLY A;  3FZC A;  4B4Z A;  3IXG A;  3HLW A;  5GHY A;  4PM6 A;  1EWZ A;  1XXM A;  4ZBE A;  3IF6 B;  1K6S A;  1L0E A;  2Y4A A;  3VP1 A;  3VOY A;  1Z6F A;  4S2N C;  4NK3 A;  2ZQC A;  2HP6 A;  3AGF A;  5CTM A;  2ZC3 B;  4JXW A;  5EE8 A;  1K4F A;  1LI9 A;  3ZGA B;  2ZC6 B;  4KZ3 A;  5EUA A;  3HL9 A;  1FOF A;  3MFD A;  3HBR A;  2XQZ A;  3VMA A;  1ONH A;  5E2H A;  4OLD A;  4PM8 A;  4JXV A;  2IWC A;  4X68 A;  4GDN A;  3GSG A;  2QPN A;  3HLE A;  5TR7 A;  1GCE A;  2EFU A;  2EX2 A;  4WZ4 A;  1ES2 A;  4GZB A;  3NDE A;  4EBL A;  4MEZ A;  4WZ5 C;  1ONG A;  3MKF A;  4E3O A;  3GQZ A;  3S1Y A;  2EX8 A;  3LY4 A;  2QMI A;  4XXR A;  5DTS A;  3NCK A;  3W4P A;  2Y2K A;  3FKW A;  3ZG0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...