3SH7A

Crystal structure of fluorophore-labeled beta-lactamase penp
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
257
structure length
257
Chain Sequence
KDDFAKLEEQFDAKLGIFALDTGTNRTVAYRPDERFAFASTIKALTVGVLLQQKSIEDLNQRITYTRDDLVNYNPITEKHVDTGMTLKELADASLRYSDNAAQNLILKQIGGPESLKKELRKIGDEVTNPERFCPELNEVNPGETQDTSTARALVTSLRAFALEDKLPSEKRELLIDWMKRNTTGDALIRAGVPDGWEVADKTGAASYGTRNDIAIIWPPKGDPVVLAVLSSRDKKDAKYDDKLIAEATKVVMKALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Increased structural flexibility at the active site of a fluorophore-conjugated beta-lactamase distinctively impacts its binding toward diverse cephalosporin antibiotics
pubmed doi rcsb
source organism Bacillus licheniformis
molecule tags Hydrolase
total genus 86
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2011-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3sh7A00
4KQRA 4NK3A 3C7UA 4GDNA 3SH7A 3VSKA 2ZC7A 3ZG7B 1L0GA 5JYPA 4LV2A 4K0XA 1OMEA 4YFMA 5CEBA 2OLVA 4JLFA 4N1HA 5EOOA 1Y54A 4QHCA 4OPRA 1Z6FA 3LCEA 4S2LA 4GN2A 4JBFA 2XGNA 3B3XA 1GHMA 3BRMA 3TOIA 2Y2HA 1K54A 1CI9A 1HD8A 1QMFA 3HLEA 4JF4A 5DF7A 3SOIA 1ZKJA 1W79A 4PPRA 3ZCZA 3C4OA 4LENA 3V5MA 5CGXA 4QB8A 3RXWA 4BENA 3MXSA 4GB7A 5EECA 4S2MA 4DE3A 1E3UD 5CHJA 1TEMA 5HL1A 1LI9A 3MBZA 5CERA 4BL3A 3DWZA 3E2LA 1PWDA 3MXRA 1L2SA 4GD6A 4GDBA 4GOGA 4EV4A 1XA1A 1W7FA 1BLPA 2C6WB 4RX2A 1WE4A 4ZDXA 1ONHA 3WS2A 5FQ9A 3HLWA 4WBGA 1PWCA 2H0YA 3UO9A 5CHUA 1VQQA 4MBFA 4R4SA 2R9XA 3N4IA 2ZM2A 1IYPA 2DRWA 4E3KA 5FAPA 5FI7A 4XXRA 2XD5A 2JC7A 4B88A 2XF3A 1PI5A 3GR2A 2X02A 3G2YA 1SKFA 1LI0A 1MBLA 1YMSA 4OQGA 1GHPA 2WAFA 3Q7ZA 3WS4A 3A3IA 4OPYA 5EVID 2E8IA 3BFFA 5E2GA 5IHVA 1LHYA 3N7WA 1SDEA 3ITBA 4UA9A 3FV7A 5FQJA 3FKWA 3SS3A 2Y2PA 4UA6A 2RL3A 5M1AA 1K57A 2JBFA 2V20A 3AGEA 4DF6A 1RGZA 3NCKA 3ZNTA 3W4OA 1N4OA 1SCWA 2EX6A 1KVLA 4OQ0A 3ZDJA 3IXGA 3WS0A 4OOLA 4R3BA 3UDIA 1YMXA 2WGVA 3UPPA 1EI5A 2X01A 4KENB 1GA9A 2WUQA 2H0TA 2VGJA 3LEZA 4Y0OA 5E2EA 4ZJ3A 4QJGA 2Z2MB 3ZG8B 3A3EA 2OV5A 2XFSA 1IYQA 3ZG5A 1K55A 5DTTA 4PM7A 4JKTA 1C3BA 5GLCA 2G2WA 4HBUA 3G30A 5HW3A 3N8SA 5EE8A 1K6RA 4FD8A 4DKIA 2IWDA 4RX3A 4X68A 3S4XA 2EX9A 2WKIA 3FKVA 2XDMA 3PBTA 3BFEA 3V50A 4L0LA 3BFDA 3PBOA 1FR1A 4BD0A 1KGFA 2X71A 3WRTA 4WZ5A 4A5RA 1SDNA 2HP6A 3W4PA 5AQ9A 4C75A 4OLGA 4KG5A 3VP4A 5GLAA 4LCLA 1XX2A 1K6SA 4E3NA 4OH0A 3IHBA 3PBRA 4ZTKA 4K91A 3ZNYA 1I2SA 2QZ6A 1LL5A 5JYOA 3BEBA 1W5DA 3C5AA 3G2ZA 1NZUA 3C4PA 4U0XA 5G18A 5EUAA 3MKFA 2HDQA 3BM6A 5CTNA 3UE1A 3IF6A 3LY4A 4IBXA 1K25A 2WKHA 1PZOA 3DW0A 3IXHA 3O86A 1FOFA 4EUZA 5CGSA 2OLUA 3BFCA 5F82A 3Q82A 1YM1A 3IHAA 1IKIA 2ZQ8A 3UE0A 1S6RA 4JPMA 2XEPA 4S2JA 1RP5A 2IWCA 1YLYA 2HDSA 4N9LA 5DF9A 1O07A 1G6AA 5J8XA 1MXOA 3OCNA 5HAIA 2HDRA 2XR0A 1PWGA 5M18A 2A49A 4Y0TA 1BSGA 2BLSA 3LO7A 4WELA 3VP2A 3Q7VB 1NYYA 2UWXA 3PBNA 3QHYA 2ZM8A 4S2OA 1FCOA 1JWZA 4P85A 2Y2JA 1ZG4A 4JF6A 1BULA 5A92A 5CEDA 3ITAA 5FSRA 1W8QA 3MZEA 4KZAA 3RXXA 5FI2A 1MKIA 5CECA 4LV0A 4K0WA 5FAQA 3LY3A 2J7VA 2WK0A 5FA7A 2EFXA 3DTMA 5EVIC 2Q9MA 5DTSA 4EWFA 4KZ6A 2HP9A 3V3RA 3W4QA 4P87A 3TG9A 1ES3A 3VP3A 3GRJA 4IBRA 5DVAA 4DDSA 4WZ4A 1NRFA 3M6HA 5GL9A 2QPNA 3FYZA 3HUOA 3Q1FA 1N9BA 2HP5A 2ZQ7A 1K4FA 5AQ7A 4WEKA 4OOMA 4LV1A 3C7VA 3GV9A 2ZD8A 4EBNA 2J8YA 2WGWB 3OC2A 4R3JA 1MY8A 2EXBA 5E2FA 3FWLA 5EVIB 1CK3A 1WYBA 5TGFA 1EWZA 4DE0A 2XD1A 3HL9A 3OZHA 1MWRA 1XKZA 3P98A 3ZG0A 3SS4A 1IEMA 5M19A 1BUEA 1HTZA 2ZQDA 4IVIA 4ZJ2A 4FCFA 2ZM0A 4WEJA 5GLDA 4BL2A 1K54C 1YLPA 2WZXA 3A3DA 3NIAA 3Q07A 2ZQ9A 5E43A 4DE1A 3N6IA 2Y2KA 4OPQA 1DJCA 2Y2LA 1XA7A 3VFHA 1FR6A 2QMIA 1NY0A 3V3SA 5FI6A 2V1ZA 5EPHA 2WAEA 3HLGA 3VOZA 5F1GA 4OVDA 1IYSA 3NI9A 3MKEA 2ZC3B 2ZJ9A 4E3JA 4F94A 5CRFA 1L0EA 4ZJ1A 5FASA 2EFUA 4P0MA 2HPBA 2JE5A 2XFTA 3WS5A 2V2FF 1LL9A 5KSCA 2EXAA 4S2NA 3A3FA 3HLFA 5KSHA 3N8LA 1BLSA 1HZOA 3S22A 4BD1A 5FQKA 4PM9A 5DTKA 4FSFA 1TDGA 2XK1A 2R9WA 3OPLA 1LLBA 1JTGA 1PW1A 1AXBA 4R1GA 3IT9A 1BZAA 4PM8A 3QNCA 4JF5A 3UE3A 3MFDA 1GHIA 1ZG6A 4JXSA 3BECA 1K56A 4KG6A 4KQQA 4EBLA 4OKPA 4KG2A 2ZC4B 5CXWA 3WWXA 2BG1A 2H10A 3M2KA 1TVFA 4KZ7A 3UY6A 3Q81A 2G2UA 4HEFA 2Y2NA 3WS1A 2H5SA 1IKGA 4Q8IA 2Y2MA 2Y59A 3VSLA 4P6BA 2Y4AA 1FSYA 2ZQAA 1K57C 1ONGA 2B5RA 2Z2LB 3I7JA 4JXGA 4DE2A 4MBHA 4KZ5A 3M2JA 1KE3A 3UDFA 1S0WA 2A3UA 2ZQCA 3MZDA 5CTMA 5AQBA 5FDHA 1MPLA 3W8KA 3IWOA 4Y7PA 5HX9A 4E3MA 5GLBA 3IQAA 2P9VB 3HUNA 1CEGA 1M40A 4HESA 3ZG9B 1E4DA 4DDYA 3CG5A 1BLHA 3IF5A 3QNBA 5GHZA 5HFOA 3UPOA 1YT4A 1Q2PA 1MWUA 5HAPA 4DXCA 1RGYA 5CGWA 4XUZA 3OPHA 1YLZA 3M6BA 4QD4A 3HUMA 1JWPA 3VOYA 4E6WA 1K55C 4ID4A 4KZ8A 4E3LA 3G31A 1I2WA 3UPNA 1QMEA 1FCNA 1KGEA 1I5QA 1W8YA 1G68A 4LV3A 3TSGA 2XLNA 1KDWA 2J9OA 4D2OA 1BTLA 2DCFA 5DF8A 2RCXA 4R4RA 3SH9A 4PMAA 1YLTA 1PW8A 2Y2GA 4GZBA 4PM6A 4S2IA 3BFGA 1DY6A 1ALQA 1NJ4A 1YLWA 2ZC5B 1MWSA 2XH9A 5FATA 5CHMA 5E2HA 5FQMA 2WADA 3IWIA 5HAQA 3NY4A 2DNSA 2Y2OA 4WZ5C 3V39A 3BYDA 1YLJA 1NYMA 2C5WB 2VGKA 4OP5A 1L0FA 3SS5A 4EQIA 1GA0A 3HLBA 4GKUA 3BLMA 3EQUA 2HDUA 1VM1A 2PU2A 4OOYA 4WM9A 5A90A 2Y55A 4GNUA 1ESUA 1KE4A 1ERMA 3O87A 4HBTA 2Y91A 4E3OA 3HBRA 2CC1A 5KZHA 3CJMA 1ES5A 4KZ4A 4UA7A 4X6TA 1H8ZA 4XUXA 1XP4A 4C3QA 2P74A 4Y0UA 1K4EA 1NXYA 3CZDA 2J9PA 3A3JA 4O7DA 5FAOA 5GHYA 3VP0A 5KMWA 4DXBA 2IWBA 3IF6C 3IH8A 4MLLA 1DJAA 3UN7A 1K56D 3G4PA 4CJNA 1XXMA 4U3TA 1PYYA 4ZBEA 3AGDA 2GDNA 4B4ZA 1ZC2A 2WKEA 4NETA 1XGIA 4OLDA 3G32A 1BT5A 3PAGA 4Z9QA 5EVLA 1XPBA 1FSWA 4QY5A 3PBQA 1ERQA 1MWTA 4E3IA 1E25A 4BJPA 2ZLYA 4X53A 3IXDA 5EOEA 3O88A 1ES2A 3IXBA 4R0QA 4WMCD 2WYXA 4JXVA 3HLDA 3NDGA 3HLCA 4H8RA 4YINA 3ZGAB 3D4FA 3IF6B 3MZFA 2OSUA 3O3VA 5U47A 3ZHHA 1FCMA 3WRZA 1ES4A 1TDLA 1DJBA 3G35A 3OPPA 3ZVWA 4OQHA 5A91A 4IVKA 1JTDA 1K38A 3CMZA 3N8RA 5FQQA 1ESIA 1O7EA 3NDEA 1Q2QA 4MBKA 2Y2QA 1L0DA 4DRTA 1IELA 4R23A 3OPRA 3UDXA 5D3OA 1J9MA 3E2KA 3GQZA 4JXWA 3GTCA 4FH4A 2P9VA 5TFQA 4QU3A 4QY6A 3UNWA 4MEZA 2JCHA 2EX8A 2PBYA 2XQZA 3PBSA 1HVBA 1BLCA 1KDSA 5A93A 4C6YA 4KZBA 4BQMA 4MNRA 3BLSA 4BLMA 1GCEA 2WZZA 2PU4A 3AGFA 3PAEA 4X56A 4UAAA 4PM5A 4S2KA 1EROA 3FZCA 4EBPA 4RYEA 4WYYA 4OP8A 4E6XA 1CI8A 3Q7VA 1SHVA 1JVJA 1JWVA 4X55A 3DWKA 4X69A 1H8YA 4M3KA 2ZC6B 3GVBA 3IH9A 4LCMA 4GD8A 3EQVA 4N92A 1H5XA 3VMAA 1E3UA 2ZMAA 4S2PA 4RA7A 1PZPA 5BOHA 5I94A 4KZ3A 1NZOA 4N9KA 3VFFA 2Q9NA 1KE0A 3HREA 3JYIA 4WMCA 3S1YA 1YQSA 2WGIA 3G34A 1KGGA 4OONA 4CPKA 2FFFB 1FQGA 3GMWA 3NBLA 1KVMA 4FH2A 4OQIA 4KZ9A 2EX2A 2FFYA 3RJUA 4OPZA 3ZVTA 4N1XA 2WGWA 3P09A 3PTEA 1WYCA 3OCLA 3ISGA 5HARA 5EVIA 5F83A 4S2NC 5F1FA 2Y2IA 1U60A 3HVFA 4ZAMA 5TR7A 1CEFA 4IEDA 2I72A 5AQAA 4RVAA 3IWQA 1PI4A 3GSGA 5GHXA 5FQIA 3ZFZA 4B4XA 1XGJA 4U0TA 1M6KA 3SH8A 4KQOA 1IYOA 3VP1A 1PIOA 5L2FA 4UHUA 1RCJA 3NC8A
chains in the Genus database with same CATH superfamily
4KQRA 3C7UA 3ZG7B 1L0GA 4K0XA 1OMEA 4YFMA 1Y54A 4OPRA 2VEAA 3R7WB 3B3XA 1GHMA 3LYXA 5C5KA 4JF4A 3CUEC 5DF7A 1W79A 3ZCZA 3V5MA 4GDBA 3B42A 3MQ0A 1BLPA 1AWIA 3PYPA 5FQ9A 4KUOA 4MBFA 4R4SA 2R9XA 4F3LB 2XF3A 2X02A 4O8GA 2WAFA 3Q7ZA 3A3IA 3T4TA 3F1NB 4NXFA 5IHVA 1P97A 3ITBA 4UA9A 3T12B 4I3AA 2O9AA 2OOLA 3AGEA 3NCKA 3LGOA 2L1MA 5FL3A 3DTKA 3WS0A 4OOLA 4R3BA 4IJGA 1EI5A 2X01A 2JKGA 3QP2A 2WUQA 4ZJ3A 5E2EA 4QJGA 3A3EA 3IS2B 5HW3A 3F1OB 5EE8A 1K6RA 4EEUA 4DN0A 1G6OA 3PBTA 4L0LA 3BFDA 2O99A 1FR1A 3IX8A 3E4OA 3VP4A 4OH0A 3O5YA 2QZ6A 1BYWA 1P0ZA 5JYOA 1DP6A 3G2ZA 2EWWA 3BM6A 3UE1A 2K7SA 1PZOA 3DW0A 3O86A 1YM1A 1RP5A 3KYZA 5J8XA 5HDDA 4LRZE 1PWGA 2A49A 4Y0TA 1BSGA 2BLSA 3QHYA 2ZM8A 2VK3A 3RTYA 1VB6A 4UEYA 5FSRA 3MZEA 5FI2A 4CLCA 3LI9A 4LV0A 3D9YA 3W2ZA 2B02A 1CQAA 4NXGA 3DTIA 1ES3A 4Q0IA 5DVAA 4DDSA 5GL9A 3A0VA 3HUOA 3Q1FA 4G3VA 2ZQ7A 4LV1A 3C7VA 2J8YA 2EXBA 5E2FA 4XT2B 5TGFA 3HJIA 4ME4A 1T1BA 1FILA 3ZG0A 5M19A 3FPVA 4QPRA 4BL2A 3EEAA 4HJ4A 3OLOA 5E43A 4DE1A 3RFBA 3R4KA 3N6IA 5F69A 4RQ9A 2Y2KA 1DJCA 2QMIA 3V3SA 5F1GA 5I5LA 2ZC3B 3CI6A 4E3JA 5CRFA 5FASA 2EFUA 2HPBA 2XFTA 3HCYA 1LL9A 3LIBA 1BLSA 3S22A 3KO6A 5DTKA 4GLQA 3NOTC 2R9WA 1LLBA 1JTGA 1PW1A 4PHTA 3TJZC 3T1SA 4LRXC 4JF5A 3UB9A 1ZG6A 2J3TD 4EBLA 4OKPA 4KG2A 2ZC4B 3S7PA 2W1RA 4HEFA 4Q8IA 1IKGA 3ICYA 2Y2MA 3VSLA 2Y4AA 3ZQ5A 4WUJA 2B5RA 4Y17A 4KZ5A 3M2JA 3UDFA 2ZQCA 5CTMA 1MPLA 5HX9A 4MN5A 5L10A 5GLBA 4PKYG 3VE4A 3HUNA 4BBVA 3ZG9B 4BBUA 5DJUA 2JKTI 1LL8A 4DDYA 3UPOA 4WN5A 5HAPA 2I9VA 4XUZA 4QD4A 3VOYA 4KZ8A 1I2WA 1FCNA 1W8YA 4LV3A 3TSGA 2XLNA 2WKRA 3U2AA 5DJTA 1OTAA 4PMAA 4S2IA 1DY6A 1ALQA 1MWSA 5FATA 4I5SA 2DNSA 2Y2OA 3P7NA 2JKRM 3CPTA 4OP5A 5L09A 3MF0A 1VM1A 5A90A 1VETB 4GNUA 1ESUA 1ERMA 3P01A 5KZHA 4KZ4A 5IS1A 4UA7A 3MXQA 2QKPA 4C3QA 3CZDA 1T19A 2J9PA 2Z6CA 5GHYA 3UB8A 2HV1A 2QHKA 3IH8A 1DJAA 4Y2FA 1K56D 4ZBEA 4UQIM 2WKEA 5F6AA 1MWTA 4X53A 3K2NA 1MC0A 4JXVA 1PNEA 1GSXA 4JGQA 3HLCA 1NLYA 3MZFA 2WKQA 3O3VA 5U47A 3IX4A 1FCMA 5HWTA 5A91A 4IVKA 5FQQA 2D01A 1F2KA 4NXBA 3GTCA 1XJ3A 4QU3A 3UNWA 2EX8A 2QYBA 2XQZA 4KZBA 4MN7A 4L9FA 4MNRA 1D1JA 4X56A 4S2KA 3BWLA 4CLCB 1CI8A 3B47A 1SHVA 1JWVA 4X55A 1H0MA 2PHYA 4M3KA 4X1MA 4GD8A 3EQVA 3T4QA 1H5XA 3VMAA 2ZMAA 4RA7A 1IOUA 4N9KA 1L3LA 4WMCA 4LLOB 4II7A 3T50A 3CUEA 2WGIA 3G34A 3TE8A 4FH2A 3U4LP 4KZ9A 2FFYA 4EXOA 4G3KA 4D60A 2JKFA 5LBRA 2K31A 3LIFA 3HVFA 1SZVA 3NULA 4B4XA 4U0TA 1M6KA 3SH8A 4KQOA 2O0YA 1UWNX 5KIZA 1OPXA 3VSKA 5CEBA 2OLVA 4EQ1A 3LCEA 2XGNA 3BRMA 2Y2HA 2QJ5A 3HLEA 4PPRA 4LENA 5CGXA 3RXWA 5EECA 5CHJA 3MBZA 3CLOA 3DWZA 1PWDA 1L2SA 4GD6A 1W7FA 3WS2A 5CHUA 1ODVA 5AJGA 3N4IA 2XA7M 4G3WA 2HGVA 1P9WA 1TF1A 1MBLA 2HJ9C 1GHPA 3A0RA 1XJ6A 2W1TA 1LHYA 3SS3A 2Y2PA 4GJ4A 2P08A 2RL3A 4UQIS 1K57A 2JBFA 2A24A 2V20A 1PRQA 5HPFA 3CPTB 4OQ0A 1YSPA 4ZRRA 2GX5A 3UPPA 2V8CA 4Y0OA 3S7NA 3QP1A 2OV5A 2K2NA 1C3BA 3LIDA 4HBUA 2V0WA 4JGOA 1TD5A 1X0OA 3C38A 2E8JA 1OTIA 3BFEA 4WZ5A 4A5RA 5L8MA 2M1CA 1K6SA 4ETZA 3IHBA 4ZTKA 2J80A 4LPZA 4K91A 3ZNYA 3VE3A 3BEBA 3C5AA 2EWVA 1IFQA 5CTNA 3LY4A 1K25A 3K3CA 4WLAA 1UGUA 4R6LA 4NG2A 3BJNA 1G6AA 3LICA 5HAIA 3VP2A 2UWXA 3PBNA 2KX6A 2XROA 1FCOA 4LGWA 5CECA 5FAQA 1HLUP 3JPUA 3LY3A 5J4EA 5FA7A 2Q9MA 4EWFA 3TG9A 1P9RA 4WZ4A 1NRFA 3LIEA 3M6HA 2QPNA 5G4ZA 3UMEA 2HP5A 1K4FA 5FEFA 2ZD8A 4FUWA 3LR5A 1WYBA 1EWZA 4DE0A 3HL9A 1MWRA 1XKZA 2ZQDA 4IVIA 2ZM0A 1VEUA 1YLPA 3NIAA 5FEGA 3DBAA 5HSQA 4OPQA 2Y2LA 1FR6A 3T4SA 1NY0A 2WAEA 3HLGA 3MS6A 2MJ6A 4AFIA 2VKSA 1IYSA 3NI9A 2XA7S 2ZJ9A 2PT7A 1L0EA 2V0UA 4P0MA 3A0SA 3HLFA 5KSHA 1F9IA 4GCZA 2H28A 5FQKA 5HD3A 2EA9A 4FSFA 4NKPA 3IT9A 3TW8A 3QNCA 1DP8A 5G4YA 1GHIA 1K56A 3NOUC 2BG1A 1G28A 4EESA 2H5SA 2Y59A 4P6BA 1K57C 1ONGA 4DE2A 3SZTA 1KE3A 1S0WA 5AQBA 5FDHA 3W8KA 3IWOA 2JKRI 2W1TB 3IQAA 1CEGA 4HH3A 3CG5A 3IF5A 5J3WA 1S4SA 1Q2PA 1MWUA 4MN6A 4DXCA 1YLZA 3M6BA 3E4QA 4E3LA 3G31A 2VV7A 2A24B 1QMEA 3BY9A 5DKLA 2J9OA 4BMWA 2RCXA 4R4RA 1YLTA 4GZBA 1PFLA 1A0KA 3BFGA 1NJ4A 5CHMA 2WADA 3NY4A 4WZ5C 5HD5A 4R38A 2A2LA 2W27A 1L0FA 2HJEA 2L4RA 2Y55A 4HBTA 1KE4A 3O87A 5TBMA 3CJMA 4GHIB 1H8ZA 3C8CA 3SW1A 2P74A 1Y4OA 4DXBA 2IWBA 5HPIA 2BASA 3EGXC 4U3TA 1PYYA 2ZOIA 2GDNA 2R78A 4ESPA 1BT5A 3PAGA 1FSWA 4QY5A 1LSVA 4E3IA 4BJPA 3IXDA 3O88A 2WYXA 3LFVA 3EGDC 3D4FA 2ZMFA 1GSVA 3JVVA 3G35A 3ZVWA 3E98A 1O7EA 1IELA 4R23A 3UDXA 2P7JA 1J9MA 3E2KA 4JXWA 1S66L 2P9VA 4QY6A 2M7UA 2NUPC 2PBYA 3IX3A 2G7UA 1BLCA 1KDSA 3BQAA 4C6YA 3VOLA 3PR6A 2J3TC 4PKYA 3AGFA 3T1XA 3FZCA 5AVEA 4RYEA 4OP8A 1NLZA 3Q7VA 3KYEA 4X69A 4X25A 4LCMA 4N92A 4S2PA 2ZMVA 1YSQA 5I94A 1Y28A 1NZOA 3VFFA 3QP4A 3S1YA 4E04A 1KGGA 3UB5P 4CPKA 1K0KA 1N9LA 2EX2A 3HJKA 3ZVTA 4N1XA 2WGWA 3PTEA 3OCLA 1VEUB 2FZ0A 4KUKA 2B18A 3IWQA 3GSGA 5FQIA 3MFXA 4I38A 1PIOA 5L2FA 3CHWP 3NC8A 4NK3A 4GDNA 3ZYTA 5JYPA 2WKPA 4JLFA 4N1HA 2IA2A 4QHCA 4DMZA 4GN2A 4JBFA 2KLIA 3L7HA 3TOIA 1K54A 3SOIA 2V1AA 1ZKJA 1EW0A 4BENA 3MXSA 4GB7A 4S2MA 1J3WA 4DE3A 1TEMA 2PDRA 5CERA 1D7EA 1S1ZA 2PD8A 3E2LA 4GOGA 2C6WB 1WE4A 1D06A 4WBGA 3UO9A 2GZAA 1VQQA 4E3KA 5FAPA 2XD5A 2JC7A 4HHDA 1MZUA 1PI5A 3GR2A 3G2YA 1SKFA 5FDSA 3H82A 1YMSA 2PYPA 4NXEA 4OPYA 5EVID 2E8IA 3BFFA 1OTBA 3N7WA 3H9WA 3FV7A 5FQJA 2ACGA 1JNUA 4CQHA 5M1AA 4HP9A 4MMNA 3ZNTA 5CX7A 1FIKA 1N4OA 1SCWA 1KVLA 1YMXA 2WGVA 4KENB 5TBMB 1GA9A 2H0TA 2VGJA 3LEZA 3LR0A 2Z2MB 3S7QA 3ZG8B 1IYQA 5DTTA 4JKTA 5GLCA 3G30A 3N8SA 4R70A 4FD8A 1N9NA 4RX3A 4X68A 3S4XA 2EX9A 4M4XA 2XDMA 3V50A 2X71A 4YNRA 3WRTA 2VZWA 1Z09A 1SDNA 4PAUA 2HP6A 5AQ9A 4KG5A 1TS6A 4LCLA 1LT0A 2M7VA 3EWKA 1I2SA 2INWA 1LL5A 5EV0A 1NZUA 3C4PA 4U0XA 5G18A 3MKFA 2J3WA 3VV4A 3IF6A 4IBXA 5HDCA 3IXHA 1XJ4A 5CGSA 2VJWA 3BFCA 4ETXA 1S67L 1IKIA 2ZQ8A 3C2WA 4JPMA 4S2JA 4EETB 2IWCA 3MQQA 1YLYA 4N9LA 2P04A 5DFYA 1MXOA 3OCNA 2HDRA 3B33A 1W63Q 2CMNA 5M18A 3LO7A 3Q7VB 1NYYA 1OJGA 4Y15A 1V9YA 3OBFA 3D72A 4EUVA 1JWZA 4P85A 2Y2JA 1BULA 5A92A 2W3EA 3ITAA 4KZAA 4WL9A 4Z1WA 2B95A 4K0WA 4YOFA 3FG8A 5DTSA 3V67A 3W4QA 4P87A 3VP3A 3GRJA 4IBRA 2W3FA 3F1OA 4GW9A 2YKFA 1TS8A 3C30A 5AQ7A 3GV9A 4HI4A 2W3DA 2WGWB 4R3JA 1MY8A 1CJFA 1BUEA 4JGRA 5GLDA 5HZHA 1K54C 3A3DA 2ZQ9A 3DAVA 4FOFA 5EPHA 3VOZA 4OVDA 4QWOA 3LR4A 4O0PA 3WS5A 4S2NA 2LB9A 5L07A 3N8LA 4PM9A 4DJ3A 2PRFA 4X1LA 3UB6A 1BZAA 3BECA 3GDIA 4KG6A 3M2KA 2Y2NA 5A8BA 5IT5A 2OWJA 2ZQAA 2Z2LB 3I7JA 4MBHA 2OWHA 5K5BA 4MCWA 3MZDA 5DKKA 1KOUA 4Y7PA 5DFXA 1E4DA 2W0NA 3QNBA 1YT4A 1RGYA 5CGWA 3OPHA 3PHYA 3HUMA 4E6WA 1I5QA 1KDWA 4D2OA 2DCFA 5DF8A 3SH9A 2Y2GA 5FQMA 2HZ5A 2XH9A 3IWIA 3KSHA 3F1PA 4Y13A 3V39A 1YLJA 1NYMA 2VGKA 4EQIA 1GA0A 3HLBA 4GKUA 3BLMA 2HDUA 4WM9A 3LEQA 2Y91A 5EM0A 3HBRA 1ES5A 4XUXA 4Y0UA 3L9KA 3A3JA 2KDKA 3VP0A 2L0WA 5EM1A 3IF6C 5EVEA 4MLLA 1XFNA 4K08A 4CJNA 1XXMA 2QJ7A 3ULFA 4B4ZA 4NETA 4OLDA 5EVLA 5F68A 1XPBA 3PBQA 1ERQA 2ZLYA 5EOEA 2V8FA 4R0QA 4WMCD 3HLDA 3NDGA 3BQ8A 3ZGAB 3IF6B 2OSUA 3ZHHA 4ARZA 1ES4A 1TDLA 5HL6A 4OQHA 2VA0A 3EEHA 3QP8A 2VLGA 1JTDA 4MDZA 3CMZA 3N8RA 1ESIA 3NDEA 1Q2QA 1L0DA 1VHMA 5D3OA 3GQZA 4FH4A 4O01A 4I3JA 5TFQA 1DP9A 4MEZA 2JCHA 2OAP1 2Y8HA 3PBSA 1HVBA 5A93A 2PR6A 2ZOHA 2LB5A 4BQMA 4BLMA 1GCEA 3PAEA 2O9BA 4Y3IA 4UAAA 4WYYA 4E6XA 1DRMA 2Y79A 3T4KA 1H8YA 2ZC6B 3IH9A 4Y5FA 4HH2A 2NUTC 4I3IA 1VETA 3T4LA 1PZPA 4KZ3A 3JVUA 2PD7A 2Q9NA 4EERA 3QP6A 1SKOA 3QP5A 2FFFB 3NBLA 3RJUA 4OPZA 2JN7A 4B93A 3P09A 3ISGA 5HARA 1OT9A 2PBDP 5EVIA 4S2NC 2Y2IA 4ZAMA 2FH5A 1CEFA 4RVAA 5GHXA 4UHUA 1RCJA 3SH7A 2ZC7A 4LV2A 5EOOA 1Z6FA 1F98A 4S2LA 4I39A 3KX0X 1OTEA 1CI9A 1HD8A 1QMFA 2Q0OA 3C4OA 4QB8A 3KYQA 1E3UD 5HL1A 1LI9A 4BL3A 3MXRA 4EV4A 1XA1A 4RX2A 4ZDXA 4L9EA 1ONHA 4EW7A 3HLWA 1PWCA 2H0YA 4HNBA 2ZM2A 1IYPA 1NRJA 2DRWA 3KSFA 5FI7A 4XXRA 4B88A 1YPRA 1LI0A 3KSIA 4OQGA 3WS4A 1YKDA 5HDSA 5E2GA 4P6ZM 2PAVP 4IUHA 1SDEA 3T4JA 1ACFA 3FKWA 4YWZA 4UA6A 3F1PB 4DF6A 1RGZA 2HF6A 2PR5A 3W4OA 2EX6A 3ZDJA 4EEPA 3MJQA 2VV8A 3IXGA 4H6JA 3UDIA 3T1RA 1T1CA 1H8MA 1OTDA 2XFSA 3ZG5A 1K55A 4PM7A 4HQAA 2G2WA 3NECA 3NHQA 4DKIA 2IWDA 2WKIA 3FKVA 3PBOA 4BD0A 1KGFA 3W4PA 4C75A 4OLGA 5GLAA 1XX2A 4E3NA 2VGLM 3PBRA 4ARZB 2XSSA 1WA9A 3D3OA 1GSWA 1W5DA 5EUAA 3CITA 2HDQA 2WKHA 2VV6A 1FOFA 4EUZA 2OLUA 5F82A 3Q82A 3IHAA 3UE0A 1S6RA 1CF0A 2XEPA 2HDSA 5DF9A 5IU1A 3TRCA 1O07A 2XR0A 4WELA 3KSGA 4LFUA 4S2OA 1ZG4A 4JF6A 5CEDA 1W8QA 3RXXA 1MKIA 1UWPX 4EU0A 3LIAA 2J7VA 2WK0A 2EFXA 3DTMA 5EVIC 1SKOB 4HJ3A 4KQDA 4KZ6A 2HP9A 3V3RA 3MR0A 5F5YA 5J7EA 3FYZA 5MC7A 1N9BA 3H7WA 3S7OA 5HWVA 3UB7A 4WEKA 2W3GA 4OOMA 1S1YA 4EBNA 3OC2A 3FWLA 5EVIB 1CK3A 2XD1A 3BW6A 3OZHA 3NJAA 3P98A 3SS4A 3FC7A 1IEMA 5EFWA 1HTZA 1LSWA 4ZJ2A 3UMDA 4FCFA 4GS9A 3NOPC 4WEJA 3IBJA 4BBTA 2WZXA 3GECA 3Q07A 1T1AA 4JGPA 1XA7A 3VFHA 5FI6A 2V1ZA 4CLCC 2GNXA 2ZL1A 3MKEA 3MMHA 4F94A 4HY8A 4ZJ1A 1STZA 2JE5A 2V2FF 1TS7A 5KSCA 2EXAA 3A3FA 1HZOA 4BD1A 4CLCD 1TDGA 2XK1A 3OPLA 4P6ZS 3R7WA 2GJ3A 1AXBA 4HP4A 3CWFA 4R1GA 4PM8A 4B9OA 1OJ5A 3UE3A 3MFDA 3K3DA 4JXSA 4KQQA 2QWSA 3WWXA 5CXWA 4KZ7A 2H10A 1TVFA 3UY6A 3WS1A 3Q81A 2G2UA 1FSYA 4JXGA 2A3UA 4WF0A 4E3MA 3LI8A 2P9VB 4NEED 1M40A 4HESA 4BWIA 4F3LA 1BLHA 5GHZA 5HFOA 2DMWA 3BY8A 3MSHA 1JWPA 1K55C 4ID4A 2V9AA 3F1NA 3UPNA 1KGEA 2ZBBA 1G68A 3OOVA 1BTLA 3E0YA 3FPWA 4H6JB 1PW8A 4PM6A 1YLWA 2ZC5B 5E2HA 5HAQA 2VGLS 3BYDA 2C5WB 5HWWA 2JKTM 3SS5A 1XJ2A 1MKMA 3EQUA 1G5UA 2UV0E 4HJ6A 2PU2A 4OOYA 2AVXA 4E3OA 1ZTUA 2CC1A 4X6TA 2YKHA 1XP4A 1S4RA 2XRNA 1K4EA 4O7DA 1NXYA 1LSXA 5FAOA 5KMWA 1V9ZA 3IS2A 3MQOA 3UN7A 3G4PA 4CLCE 3AGDA 1ZHHB 1ZC2A 4HIAA 1XGIA 3G32A 4Z9QA 1E25A 1ES2A 3IXBA 3DTEA 4H8RA 4YINA 3WRZA 1DJBA 3OPPA 2PYRA 1K38A 2JHEA 4MBKA 2Y2QA 4DRTA 3OPRA 1NWZA 3IBRA 3UE6A 4DJ2A 3T1QB 3LUQA 2Z6DA 4IUKA 3G6OA 2VX8A 1N9OA 5TJJA 4IHQA 3BLSA 2WZZA 2PU4A 2W3HA 4PM5A 1EROA 4FTXA 4EBPA 4Q0JA 3PXPA 4HOIA 2OAQ1 1JVJA 3DWKA 4Q0HA 3EOIA 2D02A 3GVBA 1YAXA 5AVFA 1OT6A 3T4OA 1E3UA 5BOHA 3H7WB 3H82B 4GHIA 3LR3A 1KE0A 3HREA 3JYIA 1H3QA 1TS0A 1YQSA 4OONA 1T18A 1FQGA 3GMWA 1F5MA 2BTFP 1KVMA 4OQIA 2O9CA 4LRYC 3RH8B 4L9GA 4GS9B 1WYCA 5F83A 4XT2A 5F1FA 1U60A 1XFQA 5TR7A 2V1BA 4IEDA 2I72A 1W63M 5AQAA 1PI4A 3ZFZA 4R3AA 1XGJA 2KOIA 3CAXA 3E4PA 1IYOA 2ZL1B 3VP1A
chains in the Genus database with same CATH topology
4KQRA 4NK3A 3C7UA 4GDNA 3SH7A 3VSKA 2ZC7A 3ZG7B 1L0GA 5JYPA 4LV2A 4K0XA 1OMEA 4YFMA 5CEBA 2OLVA 4JLFA 4N1HA 5EOOA 1Y54A 4QHCA 4OPRA 1Z6FA 3LCEA 4S2LA 4GN2A 4JBFA 2XGNA 3B3XA 1GHMA 3BRMA 3TOIA 2Y2HA 1K54A 1CI9A 1HD8A 1QMFA 3HLEA 4JF4A 5DF7A 3SOIA 1ZKJA 1W79A 4PPRA 3ZCZA 3C4OA 4LENA 3V5MA 5CGXA 4QB8A 3RXWA 4BENA 3MXSA 4GB7A 5EECA 4S2MA 4DE3A 1E3UD 5CHJA 1TEMA 5HL1A 1LI9A 3MBZA 5CERA 4BL3A 3DWZA 3E2LA 1PWDA 3MXRA 1L2SA 4GD6A 4GDBA 4GOGA 4EV4A 1XA1A 1W7FA 1BLPA 2C6WB 4RX2A 1WE4A 4ZDXA 1ONHA 3WS2A 5FQ9A 3HLWA 4WBGA 1PWCA 2H0YA 3UO9A 5CHUA 1VQQA 4MBFA 4R4SA 2R9XA 3N4IA 2ZM2A 1IYPA 2DRWA 4E3KA 5FAPA 5FI7A 4XXRA 2XD5A 2JC7A 4B88A 2XF3A 1PI5A 3GR2A 2X02A 3G2YA 1SKFA 1LI0A 1MBLA 1YMSA 4OQGA 1GHPA 2WAFA 3Q7ZA 3WS4A 3A3IA 4OPYA 5EVID 2E8IA 3BFFA 5E2GA 5IHVA 1LHYA 3N7WA 1SDEA 3ITBA 4UA9A 3FV7A 5FQJA 3FKWA 3SS3A 2Y2PA 4UA6A 2RL3A 5M1AA 1K57A 2JBFA 2V20A 3AGEA 4DF6A 1RGZA 3NCKA 3ZNTA 3W4OA 1N4OA 1SCWA 2EX6A 1KVLA 4OQ0A 3ZDJA 3IXGA 3WS0A 4OOLA 4R3BA 3UDIA 1YMXA 2WGVA 3UPPA 1EI5A 2X01A 4KENB 1GA9A 2WUQA 2H0TA 2VGJA 3LEZA 4Y0OA 5E2EA 4ZJ3A 4QJGA 2Z2MB 3ZG8B 3A3EA 2OV5A 2XFSA 1IYQA 3ZG5A 1K55A 5DTTA 4PM7A 4JKTA 1C3BA 5GLCA 2G2WA 4HBUA 3G30A 5HW3A 3N8SA 5EE8A 1K6RA 4FD8A 4DKIA 2IWDA 4RX3A 4X68A 3S4XA 2EX9A 2WKIA 3FKVA 2XDMA 3PBTA 3BFEA 3V50A 4L0LA 3BFDA 3PBOA 1FR1A 4BD0A 1KGFA 2X71A 3WRTA 4WZ5A 4A5RA 1SDNA 2HP6A 3W4PA 5AQ9A 4C75A 4OLGA 4KG5A 3VP4A 5GLAA 4LCLA 1XX2A 1K6SA 4E3NA 4OH0A 3IHBA 3PBRA 4ZTKA 4K91A 3ZNYA 1I2SA 2QZ6A 1LL5A 5JYOA 3BEBA 1W5DA 3C5AA 3G2ZA 1NZUA 3C4PA 4U0XA 5G18A 5EUAA 3MKFA 2HDQA 3BM6A 5CTNA 3UE1A 3IF6A 3LY4A 4IBXA 1K25A 2WKHA 1PZOA 3DW0A 3IXHA 3O86A 1FOFA 4EUZA 5CGSA 2OLUA 3BFCA 5F82A 3Q82A 1YM1A 3IHAA 1IKIA 2ZQ8A 3UE0A 1S6RA 4JPMA 2XEPA 4S2JA 1RP5A 2IWCA 1YLYA 2HDSA 4N9LA 5DF9A 1O07A 1G6AA 5J8XA 1MXOA 3OCNA 5HAIA 2HDRA 2XR0A 1PWGA 5M18A 2A49A 4Y0TA 1BSGA 2BLSA 3LO7A 4WELA 3VP2A 3Q7VB 1NYYA 2UWXA 3PBNA 3QHYA 2ZM8A 4S2OA 1FCOA 1JWZA 4P85A 2Y2JA 1ZG4A 4JF6A 1BULA 5A92A 5CEDA 3ITAA 5FSRA 1W8QA 3MZEA 4KZAA 3RXXA 5FI2A 1MKIA 5CECA 4LV0A 4K0WA 5FAQA 3LY3A 2J7VA 2WK0A 5FA7A 2EFXA 3DTMA 5EVIC 2Q9MA 5DTSA 4EWFA 4KZ6A 2HP9A 3V3RA 3W4QA 4P87A 3TG9A 1ES3A 3VP3A 3GRJA 4IBRA 5DVAA 4DDSA 4WZ4A 1NRFA 3M6HA 5GL9A 2QPNA 3FYZA 3HUOA 3Q1FA 1N9BA 2HP5A 2ZQ7A 1K4FA 5AQ7A 4WEKA 4OOMA 4LV1A 3C7VA 3GV9A 2ZD8A 4EBNA 2J8YA 2WGWB 3OC2A 4R3JA 1MY8A 2EXBA 5E2FA 3FWLA 5EVIB 1CK3A 1WYBA 5TGFA 1EWZA 4DE0A 2XD1A 3HL9A 3OZHA 1MWRA 1XKZA 3P98A 3ZG0A 3SS4A 1IEMA 5M19A 1BUEA 1HTZA 2ZQDA 4IVIA 4ZJ2A 4FCFA 2ZM0A 4WEJA 5GLDA 4BL2A 1K54C 1YLPA 2WZXA 3A3DA 3NIAA 3Q07A 2ZQ9A 5E43A 4DE1A 3N6IA 2Y2KA 4OPQA 1DJCA 2Y2LA 1XA7A 3VFHA 1FR6A 2QMIA 1NY0A 3V3SA 5FI6A 2V1ZA 5EPHA 2WAEA 3HLGA 3VOZA 5F1GA 4OVDA 1IYSA 3NI9A 3MKEA 2ZC3B 2ZJ9A 4E3JA 4F94A 5CRFA 1L0EA 4ZJ1A 5FASA 2EFUA 4P0MA 2HPBA 2JE5A 2XFTA 3WS5A 2V2FF 1LL9A 5KSCA 2EXAA 4S2NA 3A3FA 3HLFA 5KSHA 3N8LA 1BLSA 1HZOA 3S22A 4BD1A 5FQKA 4PM9A 5DTKA 4FSFA 1TDGA 2XK1A 2R9WA 3OPLA 1LLBA 1JTGA 1PW1A 1AXBA 4R1GA 3IT9A 1BZAA 4PM8A 3QNCA 4JF5A 3UE3A 3MFDA 1GHIA 1ZG6A 4JXSA 3BECA 1K56A 4KG6A 4KQQA 4EBLA 4OKPA 4KG2A 2ZC4B 5CXWA 3WWXA 2BG1A 2H10A 3M2KA 1TVFA 4KZ7A 3UY6A 3Q81A 2G2UA 4HEFA 2Y2NA 3WS1A 2H5SA 1IKGA 4Q8IA 2Y2MA 2Y59A 3VSLA 4P6BA 2Y4AA 1FSYA 2ZQAA 1K57C 1ONGA 2B5RA 2Z2LB 3I7JA 4JXGA 4DE2A 4MBHA 4KZ5A 3M2JA 1KE3A 3UDFA 1S0WA 2A3UA 2ZQCA 3MZDA 5CTMA 5AQBA 5FDHA 1MPLA 3W8KA 3IWOA 4Y7PA 5HX9A 4E3MA 5GLBA 3IQAA 2P9VB 3HUNA 1CEGA 1M40A 4HESA 3ZG9B 1E4DA 4DDYA 3CG5A 1BLHA 3IF5A 3QNBA 5GHZA 5HFOA 3UPOA 1YT4A 1Q2PA 1MWUA 5HAPA 4DXCA 1RGYA 5CGWA 4XUZA 3OPHA 1YLZA 3M6BA 4QD4A 3HUMA 1JWPA 3VOYA 4E6WA 1K55C 4ID4A 4KZ8A 4E3LA 3G31A 1I2WA 3UPNA 1QMEA 1FCNA 1KGEA 1I5QA 1W8YA 1G68A 4LV3A 3TSGA 2XLNA 1KDWA 2J9OA 4D2OA 1BTLA 2DCFA 5DF8A 2RCXA 4R4RA 3SH9A 4PMAA 1YLTA 1PW8A 2Y2GA 4GZBA 4PM6A 4S2IA 3BFGA 1DY6A 1ALQA 1NJ4A 1YLWA 2ZC5B 1MWSA 2XH9A 5FATA 5CHMA 5E2HA 5FQMA 2WADA 3IWIA 5HAQA 3NY4A 2DNSA 2Y2OA 4WZ5C 3V39A 3BYDA 1YLJA 1NYMA 2C5WB 2VGKA 4OP5A 1L0FA 3SS5A 4EQIA 1GA0A 3HLBA 4GKUA 3BLMA 3EQUA 2HDUA 1VM1A 2PU2A 4OOYA 4WM9A 5A90A 2Y55A 4GNUA 1ESUA 1KE4A 1ERMA 3O87A 4HBTA 2Y91A 4E3OA 3HBRA 2CC1A 5KZHA 3CJMA 1ES5A 4KZ4A 4UA7A 4X6TA 1H8ZA 4XUXA 1XP4A 4C3QA 2P74A 4Y0UA 1K4EA 1NXYA 3CZDA 2J9PA 3A3JA 4O7DA 5FAOA 5GHYA 3VP0A 5KMWA 4DXBA 2IWBA 3IF6C 3IH8A 4MLLA 1DJAA 3UN7A 1K56D 3G4PA 4CJNA 1XXMA 4U3TA 1PYYA 4ZBEA 3AGDA 2GDNA 4B4ZA 1ZC2A 2WKEA 4NETA 1XGIA 4OLDA 3G32A 1BT5A 3PAGA 4Z9QA 5EVLA 1XPBA 1FSWA 4QY5A 3PBQA 1ERQA 1MWTA 4E3IA 1E25A 4BJPA 2ZLYA 4X53A 3IXDA 5EOEA 3O88A 1ES2A 3IXBA 4R0QA 4WMCD 2WYXA 4JXVA 3HLDA 3NDGA 3HLCA 4H8RA 4YINA 3ZGAB 3D4FA 3IF6B 3MZFA 2OSUA 3O3VA 5U47A 3ZHHA 1FCMA 3WRZA 1ES4A 1TDLA 1DJBA 3G35A 3OPPA 3ZVWA 4OQHA 5A91A 4IVKA 1JTDA 1K38A 3CMZA 3N8RA 5FQQA 1ESIA 1O7EA 3NDEA 1Q2QA 4MBKA 2Y2QA 1L0DA 4DRTA 1IELA 4R23A 3OPRA 3UDXA 5D3OA 1J9MA 3E2KA 3GQZA 4JXWA 3GTCA 4FH4A 2P9VA 5TFQA 4QU3A 4QY6A 3UNWA 4MEZA 2JCHA 2EX8A 2PBYA 2XQZA 3PBSA 1HVBA 1BLCA 1KDSA 5A93A 4C6YA 4KZBA 4BQMA 4MNRA 3BLSA 4BLMA 1GCEA 2WZZA 2PU4A 3AGFA 3PAEA 4X56A 4UAAA 4PM5A 4S2KA 1EROA 3FZCA 4EBPA 4RYEA 4WYYA 4OP8A 4E6XA 1CI8A 3Q7VA 1SHVA 1JVJA 1JWVA 4X55A 3DWKA 4X69A 1H8YA 4M3KA 2ZC6B 3GVBA 3IH9A 4LCMA 4GD8A 3EQVA 4N92A 1H5XA 3VMAA 1E3UA 2ZMAA 4S2PA 4RA7A 1PZPA 5BOHA 5I94A 4KZ3A 1NZOA 4N9KA 3VFFA 2Q9NA 1KE0A 3HREA 3JYIA 4WMCA 3S1YA 1YQSA 2WGIA 3G34A 1KGGA 4OONA 4CPKA 2FFFB 1FQGA 3GMWA 3NBLA 1KVMA 4FH2A 4OQIA 4KZ9A 2EX2A 2FFYA 3RJUA 4OPZA 3ZVTA 4N1XA 2WGWA 3P09A 3PTEA 1WYCA 3OCLA 3ISGA 5HARA 5EVIA 5F83A 4S2NC 5F1FA 2Y2IA 1U60A 3HVFA 4ZAMA 5TR7A 1CEFA 4IEDA 2I72A 5AQAA 4RVAA 3IWQA 1PI4A 3GSGA 5GHXA 5FQIA 3ZFZA 4B4XA 1XGJA 4U0TA 1M6KA 3SH8A 4KQOA 1IYOA 3VP1A 1PIOA 5L2FA 4UHUA 1RCJA 3NC8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KQR A;  4NK3 A;  3C7U A;  4GDN A;  3SH7 A;  3VSK A;  2ZC7 A;  3ZG7 B;  1L0G A;  5JYP A;  4LV2 A;  4K0X A;  1OME A;  4YFM A;  5CEB A;  2OLV A;  4JLF A;  4N1H A;  5EOO A;  1Y54 A;  4QHC A;  4OPR A;  1Z6F A;  3LCE A;  4S2L A;  4GN2 A;  4JBF A;  2XGN A;  3B3X A;  1GHM A;  3BRM A;  3TOI A;  2Y2H A;  1K54 A;  1CI9 A;  1HD8 A;  1QMF A;  3HLE A;  4JF4 A;  5DF7 A;  3SOI A;  1ZKJ A;  1W79 A;  4PPR A;  3ZCZ A;  3C4O A;  4LEN A;  3V5M A;  5CGX A;  4QB8 A;  3RXW A;  4BEN A;  3MXS A;  4GB7 A;  5EEC A;  4S2M A;  4DE3 A;  1E3U D;  5CHJ A;  1TEM A;  5HL1 A;  1LI9 A;  3MBZ A;  5CER A;  4BL3 A;  3DWZ A;  3E2L A;  1PWD A;  3MXR A;  1L2S A;  4GD6 A;  4GDB A;  4GOG A;  4EV4 A;  1XA1 A;  1W7F A;  1BLP A;  2C6W B;  4RX2 A;  1WE4 A;  4ZDX A;  1ONH A;  3WS2 A;  5FQ9 A;  3HLW A;  4WBG A;  1PWC A;  2H0Y A;  3UO9 A;  5CHU A;  1VQQ A;  4MBF A;  4R4S A;  2R9X A;  3N4I A;  2ZM2 A;  1IYP A;  2DRW A;  4E3K A;  5FAP A;  5FI7 A;  4XXR A;  2XD5 A;  2JC7 A;  4B88 A;  2XF3 A;  1PI5 A;  3GR2 A;  2X02 A;  3G2Y A;  1SKF A;  1LI0 A;  1MBL A;  1YMS A;  4OQG A;  1GHP A;  2WAF A;  3Q7Z A;  3WS4 A;  3A3I A;  4OPY A;  5EVI D;  2E8I A;  3BFF A;  5E2G A;  5IHV A;  1LHY A;  3N7W A;  1SDE A;  3ITB A;  4UA9 A;  3FV7 A;  5FQJ A;  3FKW A;  3SS3 A;  2Y2P A;  4UA6 A;  2RL3 A;  5M1A A;  1K57 A;  2JBF A;  2V20 A;  3AGE A;  4DF6 A;  1RGZ A;  3NCK A;  3ZNT A;  3W4O A;  1N4O A;  1SCW A;  2EX6 A;  1KVL A;  4OQ0 A;  3ZDJ A;  3IXG A;  3WS0 A;  4OOL A;  4R3B A;  3UDI A;  1YMX A;  2WGV A;  3UPP A;  1EI5 A;  2X01 A;  4KEN B;  1GA9 A;  2WUQ A;  2H0T A;  2VGJ A;  3LEZ A;  4Y0O A;  5E2E A;  4ZJ3 A;  4QJG A;  2Z2M B;  3ZG8 B;  3A3E A;  2OV5 A;  2XFS A;  1IYQ A;  3ZG5 A;  1K55 A;  5DTT A;  4PM7 A;  4JKT A;  1C3B A;  5GLC A;  2G2W A;  4HBU A;  3G30 A;  5HW3 A;  3N8S A;  5EE8 A;  1K6R A;  4FD8 A;  4DKI A;  2IWD A;  4RX3 A;  4X68 A;  3S4X A;  2EX9 A;  2WKI A;  3FKV A;  2XDM A;  3PBT A;  3BFE A;  3V50 A;  4L0L A;  3BFD A;  3PBO A;  1FR1 A;  4BD0 A;  1KGF A;  2X71 A;  3WRT A;  4WZ5 A;  4A5R A;  1SDN A;  2HP6 A;  3W4P A;  5AQ9 A;  4C75 A;  4OLG A;  4KG5 A;  3VP4 A;  5GLA A;  4LCL A;  1XX2 A;  1K6S A;  4E3N A;  4OH0 A;  3IHB A;  3PBR A;  4ZTK A;  4K91 A;  3ZNY A;  1I2S A;  2QZ6 A;  1LL5 A;  5JYO A;  3BEB A;  1W5D A;  3C5A A;  3G2Z A;  1NZU A;  3C4P A;  4U0X A;  5G18 A;  5EUA A;  3MKF A;  2HDQ A;  3BM6 A;  5CTN A;  3UE1 A;  3IF6 A;  3LY4 A;  4IBX A;  1K25 A;  2WKH A;  1PZO A;  3DW0 A;  3IXH A;  3O86 A;  1FOF A;  4EUZ A;  5CGS A;  2OLU A;  3BFC A;  5F82 A;  3Q82 A;  1YM1 A;  3IHA A;  1IKI A;  2ZQ8 A;  3UE0 A;  1S6R A;  4JPM A;  2XEP A;  4S2J A;  1RP5 A;  2IWC A;  1YLY A;  2HDS A;  4N9L A;  5DF9 A;  1O07 A;  1G6A A;  5J8X A;  1MXO A;  3OCN A;  5HAI A;  2HDR A;  2XR0 A;  1PWG A;  5M18 A;  2A49 A;  4Y0T A;  1BSG A;  2BLS A;  3LO7 A;  4WEL A;  3VP2 A;  3Q7V B;  1NYY A;  2UWX A;  3PBN A;  3QHY A;  2ZM8 A;  4S2O A;  1FCO A;  1JWZ A;  4P85 A;  2Y2J A;  1ZG4 A;  4JF6 A;  1BUL A;  5A92 A;  5CED A;  3ITA A;  5FSR A;  1W8Q A;  3MZE A;  4KZA A;  3RXX A;  5FI2 A;  1MKI A;  5CEC A;  4LV0 A;  4K0W A;  5FAQ A;  3LY3 A;  2J7V A;  2WK0 A;  5FA7 A;  2EFX A;  3DTM A;  5EVI C;  2Q9M A;  5DTS A;  4EWF A;  4KZ6 A;  2HP9 A;  3V3R A;  3W4Q A;  4P87 A;  3TG9 A;  1ES3 A;  3VP3 A;  3GRJ A;  4IBR A;  5DVA A;  4DDS A;  4WZ4 A;  1NRF A;  3M6H A;  5GL9 A;  2QPN A;  3FYZ A;  3HUO A;  3Q1F A;  1N9B A;  2HP5 A;  2ZQ7 A;  1K4F A;  5AQ7 A;  4WEK A;  4OOM A;  4LV1 A;  3C7V A;  3GV9 A;  2ZD8 A;  4EBN A;  2J8Y A;  2WGW B;  3OC2 A;  4R3J A;  1MY8 A;  2EXB A;  5E2F A;  3FWL A;  5EVI B;  1CK3 A;  1WYB A;  5TGF A;  1EWZ A;  4DE0 A;  2XD1 A;  3HL9 A;  3OZH A;  1MWR A;  1XKZ A;  3P98 A;  3ZG0 A;  3SS4 A;  1IEM A;  5M19 A;  1BUE A;  1HTZ A;  2ZQD A;  4IVI A;  4ZJ2 A;  4FCF A;  2ZM0 A;  4WEJ A;  5GLD A;  4BL2 A;  1K54 C;  1YLP A;  2WZX A;  3A3D A;  3NIA A;  3Q07 A;  2ZQ9 A;  5E43 A;  4DE1 A;  3N6I A;  2Y2K A;  4OPQ A;  1DJC A;  2Y2L A;  1XA7 A;  3VFH A;  1FR6 A;  2QMI A;  1NY0 A;  3V3S A;  5FI6 A;  2V1Z A;  5EPH A;  2WAE A;  3HLG A;  3VOZ A;  5F1G A;  4OVD A;  1IYS A;  3NI9 A;  3MKE A;  2ZC3 B;  2ZJ9 A;  4E3J A;  4F94 A;  5CRF A;  1L0E A;  4ZJ1 A;  5FAS A;  2EFU A;  4P0M A;  2HPB A;  2JE5 A;  2XFT A;  3WS5 A;  2V2F F;  1LL9 A;  5KSC A;  2EXA A;  4S2N A;  3A3F A;  3HLF A;  5KSH A;  3N8L A;  1BLS A;  1HZO A;  3S22 A;  4BD1 A;  5FQK A;  4PM9 A;  5DTK A;  4FSF A;  1TDG A;  2XK1 A;  2R9W A;  3OPL A;  1LLB A;  1JTG A;  1PW1 A;  1AXB A;  4R1G A;  3IT9 A;  1BZA A;  4PM8 A;  3QNC A;  4JF5 A;  3UE3 A;  3MFD A;  1GHI A;  1ZG6 A;  4JXS A;  3BEC A;  1K56 A;  4KG6 A;  4KQQ A;  4EBL A;  4OKP A;  4KG2 A;  2ZC4 B;  5CXW A;  3WWX A;  2BG1 A;  2H10 A;  3M2K A;  1TVF A;  4KZ7 A;  3UY6 A;  3Q81 A;  2G2U A;  4HEF A;  2Y2N A;  3WS1 A;  2H5S A;  1IKG A;  4Q8I A;  2Y2M A;  2Y59 A;  3VSL A;  4P6B A;  2Y4A A;  1FSY A;  2ZQA A;  1K57 C;  1ONG A;  2B5R A;  2Z2L B;  3I7J A;  4JXG A;  4DE2 A;  4MBH A;  4KZ5 A;  3M2J A;  1KE3 A;  3UDF A;  1S0W A;  2A3U A;  2ZQC A;  3MZD A;  5CTM A;  5AQB A;  5FDH A;  1MPL A;  3W8K A;  3IWO A;  4Y7P A;  5HX9 A;  4E3M A;  5GLB A;  3IQA A;  2P9V B;  3HUN A;  1CEG A;  1M40 A;  4HES A;  3ZG9 B;  1E4D A;  4DDY A;  3CG5 A;  1BLH A;  3IF5 A;  3QNB A;  5GHZ A;  5HFO A;  3UPO A;  1YT4 A;  1Q2P A;  1MWU A;  5HAP A;  4DXC A;  1RGY A;  5CGW A;  4XUZ A;  3OPH A;  1YLZ A;  3M6B A;  4QD4 A;  3HUM A;  1JWP A;  3VOY A;  4E6W A;  1K55 C;  4ID4 A;  4KZ8 A;  4E3L A;  3G31 A;  1I2W A;  3UPN A;  1QME A;  1FCN A;  1KGE A;  1I5Q A;  1W8Y A;  1G68 A;  4LV3 A;  3TSG A;  2XLN A;  1KDW A;  2J9O A;  4D2O A;  1BTL A;  2DCF A;  5DF8 A;  2RCX A;  4R4R A;  3SH9 A;  4PMA A;  1YLT A;  1PW8 A;  2Y2G A;  4GZB A;  4PM6 A;  4S2I A;  3BFG A;  1DY6 A;  1ALQ A;  1NJ4 A;  1YLW A;  2ZC5 B;  1MWS A;  2XH9 A;  5FAT A;  5CHM A;  5E2H A;  5FQM A;  2WAD A;  3IWI A;  5HAQ A;  3NY4 A;  2DNS A;  2Y2O A;  4WZ5 C;  3V39 A;  3BYD A;  1YLJ A;  1NYM A;  2C5W B;  2VGK A;  4OP5 A;  1L0F A;  3SS5 A;  4EQI A;  1GA0 A;  3HLB A;  4GKU A;  3BLM A;  3EQU A;  2HDU A;  1VM1 A;  2PU2 A;  4OOY A;  4WM9 A;  5A90 A;  2Y55 A;  4GNU A;  1ESU A;  1KE4 A;  1ERM A;  3O87 A;  4HBT A;  2Y91 A;  4E3O A;  3HBR A;  2CC1 A;  5KZH A;  3CJM A;  1ES5 A;  4KZ4 A;  4UA7 A;  4X6T A;  1H8Z A;  4XUX A;  1XP4 A;  4C3Q A;  2P74 A;  4Y0U A;  1K4E A;  1NXY A;  3CZD A;  2J9P A;  3A3J A;  4O7D A;  5FAO A;  5GHY A;  3VP0 A;  5KMW A;  4DXB A;  2IWB A;  3IF6 C;  3IH8 A;  4MLL A;  1DJA A;  3UN7 A;  1K56 D;  3G4P A;  4CJN A;  1XXM A;  4U3T A;  1PYY A;  4ZBE A;  3AGD A;  2GDN A;  4B4Z A;  1ZC2 A;  2WKE A;  4NET A;  1XGI A;  4OLD A;  3G32 A;  1BT5 A;  3PAG A;  4Z9Q A;  5EVL A;  1XPB A;  1FSW A;  4QY5 A;  3PBQ A;  1ERQ A;  1MWT A;  4E3I A;  1E25 A;  4BJP A;  2ZLY A;  4X53 A;  3IXD A;  5EOE A;  3O88 A;  1ES2 A;  3IXB A;  4R0Q A;  4WMC D;  2WYX A;  4JXV A;  3HLD A;  3NDG A;  3HLC A;  4H8R A;  4YIN A;  3ZGA B;  3D4F A;  3IF6 B;  3MZF A;  2OSU A;  3O3V A;  5U47 A;  3ZHH A;  1FCM A;  3WRZ A;  1ES4 A;  1TDL A;  1DJB A;  3G35 A;  3OPP A;  3ZVW A;  4OQH A;  5A91 A;  4IVK A;  1JTD A;  1K38 A;  3CMZ A;  3N8R A;  5FQQ A;  1ESI A;  1O7E A;  3NDE A;  1Q2Q A;  4MBK A;  2Y2Q A;  1L0D A;  4DRT A;  1IEL A;  4R23 A;  3OPR A;  3UDX A;  5D3O A;  1J9M A;  3E2K A;  3GQZ A;  4JXW A;  3GTC A;  4FH4 A;  2P9V A;  5TFQ A;  4QU3 A;  4QY6 A;  3UNW A;  4MEZ A;  2JCH A;  2EX8 A;  2PBY A;  2XQZ A;  3PBS A;  1HVB A;  1BLC A;  1KDS A;  5A93 A;  4C6Y A;  4KZB A;  4BQM A;  4MNR A;  3BLS A;  4BLM A;  1GCE A;  2WZZ A;  2PU4 A;  3AGF A;  3PAE A;  4X56 A;  4UAA A;  4PM5 A;  4S2K A;  1ERO A;  3FZC A;  4EBP A;  4RYE A;  4WYY A;  4OP8 A;  4E6X A;  1CI8 A;  3Q7V A;  1SHV A;  1JVJ A;  1JWV A;  4X55 A;  3DWK A;  4X69 A;  1H8Y A;  4M3K A;  2ZC6 B;  3GVB A;  3IH9 A;  4LCM A;  4GD8 A;  3EQV A;  4N92 A;  1H5X A;  3VMA A;  1E3U A;  2ZMA A;  4S2P A;  4RA7 A;  1PZP A;  5BOH A;  5I94 A;  4KZ3 A;  1NZO A;  4N9K A;  3VFF A;  2Q9N A;  1KE0 A;  3HRE A;  3JYI A;  4WMC A;  3S1Y A;  1YQS A;  2WGI A;  3G34 A;  1KGG A;  4OON A;  4CPK A;  2FFF B;  1FQG A;  3GMW A;  3NBL A;  1KVM A;  4FH2 A;  4OQI A;  4KZ9 A;  2EX2 A;  2FFY A;  3RJU A;  4OPZ A;  3ZVT A;  4N1X A;  2WGW A;  3P09 A;  3PTE A;  1WYC A;  3OCL A;  3ISG A;  5HAR A;  5EVI A;  5F83 A;  4S2N C;  5F1F A;  2Y2I A;  1U60 A;  3HVF A;  4ZAM A;  5TR7 A;  1CEF A;  4IED A;  2I72 A;  5AQA A;  4RVA A;  3IWQ A;  1PI4 A;  3GSG A;  5GHX A;  5FQI A;  3ZFZ A;  4B4X A;  1XGJ A;  4U0T A;  1M6K A;  3SH8 A;  4KQO A;  1IYO A;  3VP1 A;  1PIO A;  5L2F A;  4UHU A;  1RCJ A;  3NC8 A; 
#chains in the Genus database with same CATH topology
 4KQR A;  3C7U A;  3ZG7 B;  1L0G A;  4K0X A;  1OME A;  4YFM A;  1Y54 A;  4OPR A;  2VEA A;  3R7W B;  3B3X A;  1GHM A;  3LYX A;  5C5K A;  4JF4 A;  3CUE C;  5DF7 A;  1W79 A;  3ZCZ A;  3V5M A;  4GDB A;  3B42 A;  3MQ0 A;  1BLP A;  1AWI A;  3PYP A;  5FQ9 A;  4KUO A;  4MBF A;  4R4S A;  2R9X A;  4F3L B;  2XF3 A;  2X02 A;  4O8G A;  2WAF A;  3Q7Z A;  3A3I A;  3T4T A;  3F1N B;  4NXF A;  5IHV A;  1P97 A;  3ITB A;  4UA9 A;  3T12 B;  4I3A A;  2O9A A;  2OOL A;  3AGE A;  3NCK A;  3LGO A;  2L1M A;  5FL3 A;  3DTK A;  3WS0 A;  4OOL A;  4R3B A;  4IJG A;  1EI5 A;  2X01 A;  2JKG A;  3QP2 A;  2WUQ A;  4ZJ3 A;  5E2E A;  4QJG A;  3A3E A;  3IS2 B;  5HW3 A;  3F1O B;  5EE8 A;  1K6R A;  4EEU A;  4DN0 A;  1G6O A;  3PBT A;  4L0L A;  3BFD A;  2O99 A;  1FR1 A;  3IX8 A;  3E4O A;  3VP4 A;  4OH0 A;  3O5Y A;  2QZ6 A;  1BYW A;  1P0Z A;  5JYO A;  1DP6 A;  3G2Z A;  2EWW A;  3BM6 A;  3UE1 A;  2K7S A;  1PZO A;  3DW0 A;  3O86 A;  1YM1 A;  1RP5 A;  3KYZ A;  5J8X A;  5HDD A;  4LRZ E;  1PWG A;  2A49 A;  4Y0T A;  1BSG A;  2BLS A;  3QHY A;  2ZM8 A;  2VK3 A;  3RTY A;  1VB6 A;  4UEY A;  5FSR A;  3MZE A;  5FI2 A;  4CLC A;  3LI9 A;  4LV0 A;  3D9Y A;  3W2Z A;  2B02 A;  1CQA A;  4NXG A;  3DTI A;  1ES3 A;  4Q0I A;  5DVA A;  4DDS A;  5GL9 A;  3A0V A;  3HUO A;  3Q1F A;  4G3V A;  2ZQ7 A;  4LV1 A;  3C7V A;  2J8Y A;  2EXB A;  5E2F A;  4XT2 B;  5TGF A;  3HJI A;  4ME4 A;  1T1B A;  1FIL A;  3ZG0 A;  5M19 A;  3FPV A;  4QPR A;  4BL2 A;  3EEA A;  4HJ4 A;  3OLO A;  5E43 A;  4DE1 A;  3RFB A;  3R4K A;  3N6I A;  5F69 A;  4RQ9 A;  2Y2K A;  1DJC A;  2QMI A;  3V3S A;  5F1G A;  5I5L A;  2ZC3 B;  3CI6 A;  4E3J A;  5CRF A;  5FAS A;  2EFU A;  2HPB A;  2XFT A;  3HCY A;  1LL9 A;  3LIB A;  1BLS A;  3S22 A;  3KO6 A;  5DTK A;  4GLQ A;  3NOT C;  2R9W A;  1LLB A;  1JTG A;  1PW1 A;  4PHT A;  3TJZ C;  3T1S A;  4LRX C;  4JF5 A;  3UB9 A;  1ZG6 A;  2J3T D;  4EBL A;  4OKP A;  4KG2 A;  2ZC4 B;  3S7P A;  2W1R A;  4HEF A;  4Q8I A;  1IKG A;  3ICY A;  2Y2M A;  3VSL A;  2Y4A A;  3ZQ5 A;  4WUJ A;  2B5R A;  4Y17 A;  4KZ5 A;  3M2J A;  3UDF A;  2ZQC A;  5CTM A;  1MPL A;  5HX9 A;  4MN5 A;  5L10 A;  5GLB A;  4PKY G;  3VE4 A;  3HUN A;  4BBV A;  3ZG9 B;  4BBU A;  5DJU A;  2JKT I;  1LL8 A;  4DDY A;  3UPO A;  4WN5 A;  5HAP A;  2I9V A;  4XUZ A;  4QD4 A;  3VOY A;  4KZ8 A;  1I2W A;  1FCN A;  1W8Y A;  4LV3 A;  3TSG A;  2XLN A;  2WKR A;  3U2A A;  5DJT A;  1OTA A;  4PMA A;  4S2I A;  1DY6 A;  1ALQ A;  1MWS A;  5FAT A;  4I5S A;  2DNS A;  2Y2O A;  3P7N A;  2JKR M;  3CPT A;  4OP5 A;  5L09 A;  3MF0 A;  1VM1 A;  5A90 A;  1VET B;  4GNU A;  1ESU A;  1ERM A;  3P01 A;  5KZH A;  4KZ4 A;  5IS1 A;  4UA7 A;  3MXQ A;  2QKP A;  4C3Q A;  3CZD A;  1T19 A;  2J9P A;  2Z6C A;  5GHY A;  3UB8 A;  2HV1 A;  2QHK A;  3IH8 A;  1DJA A;  4Y2F A;  1K56 D;  4ZBE A;  4UQI M;  2WKE A;  5F6A A;  1MWT A;  4X53 A;  3K2N A;  1MC0 A;  4JXV A;  1PNE A;  1GSX A;  4JGQ A;  3HLC A;  1NLY A;  3MZF A;  2WKQ A;  3O3V A;  5U47 A;  3IX4 A;  1FCM A;  5HWT A;  5A91 A;  4IVK A;  5FQQ A;  2D01 A;  1F2K A;  4NXB A;  3GTC A;  1XJ3 A;  4QU3 A;  3UNW A;  2EX8 A;  2QYB A;  2XQZ A;  4KZB A;  4MN7 A;  4L9F A;  4MNR A;  1D1J A;  4X56 A;  4S2K A;  3BWL A;  4CLC B;  1CI8 A;  3B47 A;  1SHV A;  1JWV A;  4X55 A;  1H0M A;  2PHY A;  4M3K A;  4X1M A;  4GD8 A;  3EQV A;  3T4Q A;  1H5X A;  3VMA A;  2ZMA A;  4RA7 A;  1IOU A;  4N9K A;  1L3L A;  4WMC A;  4LLO B;  4II7 A;  3T50 A;  3CUE A;  2WGI A;  3G34 A;  3TE8 A;  4FH2 A;  3U4L P;  4KZ9 A;  2FFY A;  4EXO A;  4G3K A;  4D60 A;  2JKF A;  5LBR A;  2K31 A;  3LIF A;  3HVF A;  1SZV A;  3NUL A;  4B4X A;  4U0T A;  1M6K A;  3SH8 A;  4KQO A;  2O0Y A;  1UWN X;  5KIZ A;  1OPX A;  3VSK A;  5CEB A;  2OLV A;  4EQ1 A;  3LCE A;  2XGN A;  3BRM A;  2Y2H A;  2QJ5 A;  3HLE A;  4PPR A;  4LEN A;  5CGX A;  3RXW A;  5EEC A;  5CHJ A;  3MBZ A;  3CLO A;  3DWZ A;  1PWD A;  1L2S A;  4GD6 A;  1W7F A;  3WS2 A;  5CHU A;  1ODV A;  5AJG A;  3N4I A;  2XA7 M;  4G3W A;  2HGV A;  1P9W A;  1TF1 A;  1MBL A;  2HJ9 C;  1GHP A;  3A0R A;  1XJ6 A;  2W1T A;  1LHY A;  3SS3 A;  2Y2P A;  4GJ4 A;  2P08 A;  2RL3 A;  4UQI S;  1K57 A;  2JBF A;  2A24 A;  2V20 A;  1PRQ A;  5HPF A;  3CPT B;  4OQ0 A;  1YSP A;  4ZRR A;  2GX5 A;  3UPP A;  2V8C A;  4Y0O A;  3S7N A;  3QP1 A;  2OV5 A;  2K2N A;  1C3B A;  3LID A;  4HBU A;  2V0W A;  4JGO A;  1TD5 A;  1X0O A;  3C38 A;  2E8J A;  1OTI A;  3BFE A;  4WZ5 A;  4A5R A;  5L8M A;  2M1C A;  1K6S A;  4ETZ A;  3IHB A;  4ZTK A;  2J80 A;  4LPZ A;  4K91 A;  3ZNY A;  3VE3 A;  3BEB A;  3C5A A;  2EWV A;  1IFQ A;  5CTN A;  3LY4 A;  1K25 A;  3K3C A;  4WLA A;  1UGU A;  4R6L A;  4NG2 A;  3BJN A;  1G6A A;  3LIC A;  5HAI A;  3VP2 A;  2UWX A;  3PBN A;  2KX6 A;  2XRO A;  1FCO A;  4LGW A;  5CEC A;  5FAQ A;  1HLU P;  3JPU A;  3LY3 A;  5J4E A;  5FA7 A;  2Q9M A;  4EWF A;  3TG9 A;  1P9R A;  4WZ4 A;  1NRF A;  3LIE A;  3M6H A;  2QPN A;  5G4Z A;  3UME A;  2HP5 A;  1K4F A;  5FEF A;  2ZD8 A;  4FUW A;  3LR5 A;  1WYB A;  1EWZ A;  4DE0 A;  3HL9 A;  1MWR A;  1XKZ A;  2ZQD A;  4IVI A;  2ZM0 A;  1VEU A;  1YLP A;  3NIA A;  5FEG A;  3DBA A;  5HSQ A;  4OPQ A;  2Y2L A;  1FR6 A;  3T4S A;  1NY0 A;  2WAE A;  3HLG A;  3MS6 A;  2MJ6 A;  4AFI A;  2VKS A;  1IYS A;  3NI9 A;  2XA7 S;  2ZJ9 A;  2PT7 A;  1L0E A;  2V0U A;  4P0M A;  3A0S A;  3HLF A;  5KSH A;  1F9I A;  4GCZ A;  2H28 A;  5FQK A;  5HD3 A;  2EA9 A;  4FSF A;  4NKP A;  3IT9 A;  3TW8 A;  3QNC A;  1DP8 A;  5G4Y A;  1GHI A;  1K56 A;  3NOU C;  2BG1 A;  1G28 A;  4EES A;  2H5S A;  2Y59 A;  4P6B A;  1K57 C;  1ONG A;  4DE2 A;  3SZT A;  1KE3 A;  1S0W A;  5AQB A;  5FDH A;  3W8K A;  3IWO A;  2JKR I;  2W1T B;  3IQA A;  1CEG A;  4HH3 A;  3CG5 A;  3IF5 A;  5J3W A;  1S4S A;  1Q2P A;  1MWU A;  4MN6 A;  4DXC A;  1YLZ A;  3M6B A;  3E4Q A;  4E3L A;  3G31 A;  2VV7 A;  2A24 B;  1QME A;  3BY9 A;  5DKL A;  2J9O A;  4BMW A;  2RCX A;  4R4R A;  1YLT A;  4GZB A;  1PFL A;  1A0K A;  3BFG A;  1NJ4 A;  5CHM A;  2WAD A;  3NY4 A;  4WZ5 C;  5HD5 A;  4R38 A;  2A2L A;  2W27 A;  1L0F A;  2HJE A;  2L4R A;  2Y55 A;  4HBT A;  1KE4 A;  3O87 A;  5TBM A;  3CJM A;  4GHI B;  1H8Z A;  3C8C A;  3SW1 A;  2P74 A;  1Y4O A;  4DXB A;  2IWB A;  5HPI A;  2BAS A;  3EGX C;  4U3T A;  1PYY A;  2ZOI A;  2GDN A;  2R78 A;  4ESP A;  1BT5 A;  3PAG A;  1FSW A;  4QY5 A;  1LSV A;  4E3I A;  4BJP A;  3IXD A;  3O88 A;  2WYX A;  3LFV A;  3EGD C;  3D4F A;  2ZMF A;  1GSV A;  3JVV A;  3G35 A;  3ZVW A;  3E98 A;  1O7E A;  1IEL A;  4R23 A;  3UDX A;  2P7J A;  1J9M A;  3E2K A;  4JXW A;  1S66 L;  2P9V A;  4QY6 A;  2M7U A;  2NUP C;  2PBY A;  3IX3 A;  2G7U A;  1BLC A;  1KDS A;  3BQA A;  4C6Y A;  3VOL A;  3PR6 A;  2J3T C;  4PKY A;  3AGF A;  3T1X A;  3FZC A;  5AVE A;  4RYE A;  4OP8 A;  1NLZ A;  3Q7V A;  3KYE A;  4X69 A;  4X25 A;  4LCM A;  4N92 A;  4S2P A;  2ZMV A;  1YSQ A;  5I94 A;  1Y28 A;  1NZO A;  3VFF A;  3QP4 A;  3S1Y A;  4E04 A;  1KGG A;  3UB5 P;  4CPK A;  1K0K A;  1N9L A;  2EX2 A;  3HJK A;  3ZVT A;  4N1X A;  2WGW A;  3PTE A;  3OCL A;  1VEU B;  2FZ0 A;  4KUK A;  2B18 A;  3IWQ A;  3GSG A;  5FQI A;  3MFX A;  4I38 A;  1PIO A;  5L2F A;  3CHW P;  3NC8 A;  4NK3 A;  4GDN A;  3ZYT A;  5JYP A;  2WKP A;  4JLF A;  4N1H A;  2IA2 A;  4QHC A;  4DMZ A;  4GN2 A;  4JBF A;  2KLI A;  3L7H A;  3TOI A;  1K54 A;  3SOI A;  2V1A A;  1ZKJ A;  1EW0 A;  4BEN A;  3MXS A;  4GB7 A;  4S2M A;  1J3W A;  4DE3 A;  1TEM A;  2PDR A;  5CER A;  1D7E A;  1S1Z A;  2PD8 A;  3E2L A;  4GOG A;  2C6W B;  1WE4 A;  1D06 A;  4WBG A;  3UO9 A;  2GZA A;  1VQQ A;  4E3K A;  5FAP A;  2XD5 A;  2JC7 A;  4HHD A;  1MZU A;  1PI5 A;  3GR2 A;  3G2Y A;  1SKF A;  5FDS A;  3H82 A;  1YMS A;  2PYP A;  4NXE A;  4OPY A;  5EVI D;  2E8I A;  3BFF A;  1OTB A;  3N7W A;  3H9W A;  3FV7 A;  5FQJ A;  2ACG A;  1JNU A;  4CQH A;  5M1A A;  4HP9 A;  4MMN A;  3ZNT A;  5CX7 A;  1FIK A;  1N4O A;  1SCW A;  1KVL A;  1YMX A;  2WGV A;  4KEN B;  5TBM B;  1GA9 A;  2H0T A;  2VGJ A;  3LEZ A;  3LR0 A;  2Z2M B;  3S7Q A;  3ZG8 B;  1IYQ A;  5DTT A;  4JKT A;  5GLC A;  3G30 A;  3N8S A;  4R70 A;  4FD8 A;  1N9N A;  4RX3 A;  4X68 A;  3S4X A;  2EX9 A;  4M4X A;  2XDM A;  3V50 A;  2X71 A;  4YNR A;  3WRT A;  2VZW A;  1Z09 A;  1SDN A;  4PAU A;  2HP6 A;  5AQ9 A;  4KG5 A;  1TS6 A;  4LCL A;  1LT0 A;  2M7V A;  3EWK A;  1I2S A;  2INW A;  1LL5 A;  5EV0 A;  1NZU A;  3C4P A;  4U0X A;  5G18 A;  3MKF A;  2J3W A;  3VV4 A;  3IF6 A;  4IBX A;  5HDC A;  3IXH A;  1XJ4 A;  5CGS A;  2VJW A;  3BFC A;  4ETX A;  1S67 L;  1IKI A;  2ZQ8 A;  3C2W A;  4JPM A;  4S2J A;  4EET B;  2IWC A;  3MQQ A;  1YLY A;  4N9L A;  2P04 A;  5DFY A;  1MXO A;  3OCN A;  2HDR A;  3B33 A;  1W63 Q;  2CMN A;  5M18 A;  3LO7 A;  3Q7V B;  1NYY A;  1OJG A;  4Y15 A;  1V9Y A;  3OBF A;  3D72 A;  4EUV A;  1JWZ A;  4P85 A;  2Y2J A;  1BUL A;  5A92 A;  2W3E A;  3ITA A;  4KZA A;  4WL9 A;  4Z1W A;  2B95 A;  4K0W A;  4YOF A;  3FG8 A;  5DTS A;  3V67 A;  3W4Q A;  4P87 A;  3VP3 A;  3GRJ A;  4IBR A;  2W3F A;  3F1O A;  4GW9 A;  2YKF A;  1TS8 A;  3C30 A;  5AQ7 A;  3GV9 A;  4HI4 A;  2W3D A;  2WGW B;  4R3J A;  1MY8 A;  1CJF A;  1BUE A;  4JGR A;  5GLD A;  5HZH A;  1K54 C;  3A3D A;  2ZQ9 A;  3DAV A;  4FOF A;  5EPH A;  3VOZ A;  4OVD A;  4QWO A;  3LR4 A;  4O0P A;  3WS5 A;  4S2N A;  2LB9 A;  5L07 A;  3N8L A;  4PM9 A;  4DJ3 A;  2PRF A;  4X1L A;  3UB6 A;  1BZA A;  3BEC A;  3GDI A;  4KG6 A;  3M2K A;  2Y2N A;  5A8B A;  5IT5 A;  2OWJ A;  2ZQA A;  2Z2L B;  3I7J A;  4MBH A;  2OWH A;  5K5B A;  4MCW A;  3MZD A;  5DKK A;  1KOU A;  4Y7P A;  5DFX A;  1E4D A;  2W0N A;  3QNB A;  1YT4 A;  1RGY A;  5CGW A;  3OPH A;  3PHY A;  3HUM A;  4E6W A;  1I5Q A;  1KDW A;  4D2O A;  2DCF A;  5DF8 A;  3SH9 A;  2Y2G A;  5FQM A;  2HZ5 A;  2XH9 A;  3IWI A;  3KSH A;  3F1P A;  4Y13 A;  3V39 A;  1YLJ A;  1NYM A;  2VGK A;  4EQI A;  1GA0 A;  3HLB A;  4GKU A;  3BLM A;  2HDU A;  4WM9 A;  3LEQ A;  2Y91 A;  5EM0 A;  3HBR A;  1ES5 A;  4XUX A;  4Y0U A;  3L9K A;  3A3J A;  2KDK A;  3VP0 A;  2L0W A;  5EM1 A;  3IF6 C;  5EVE A;  4MLL A;  1XFN A;  4K08 A;  4CJN A;  1XXM A;  2QJ7 A;  3ULF A;  4B4Z A;  4NET A;  4OLD A;  5EVL A;  5F68 A;  1XPB A;  3PBQ A;  1ERQ A;  2ZLY A;  5EOE A;  2V8F A;  4R0Q A;  4WMC D;  3HLD A;  3NDG A;  3BQ8 A;  3ZGA B;  3IF6 B;  2OSU A;  3ZHH A;  4ARZ A;  1ES4 A;  1TDL A;  5HL6 A;  4OQH A;  2VA0 A;  3EEH A;  3QP8 A;  2VLG A;  1JTD A;  4MDZ A;  3CMZ A;  3N8R A;  1ESI A;  3NDE A;  1Q2Q A;  1L0D A;  1VHM A;  5D3O A;  3GQZ A;  4FH4 A;  4O01 A;  4I3J A;  5TFQ A;  1DP9 A;  4MEZ A;  2JCH A;  2OAP 1;  2Y8H A;  3PBS A;  1HVB A;  5A93 A;  2PR6 A;  2ZOH A;  2LB5 A;  4BQM A;  4BLM A;  1GCE A;  3PAE A;  2O9B A;  4Y3I A;  4UAA A;  4WYY A;  4E6X A;  1DRM A;  2Y79 A;  3T4K A;  1H8Y A;  2ZC6 B;  3IH9 A;  4Y5F A;  4HH2 A;  2NUT C;  4I3I A;  1VET A;  3T4L A;  1PZP A;  4KZ3 A;  3JVU A;  2PD7 A;  2Q9N A;  4EER A;  3QP6 A;  1SKO A;  3QP5 A;  2FFF B;  3NBL A;  3RJU A;  4OPZ A;  2JN7 A;  4B93 A;  3P09 A;  3ISG A;  5HAR A;  1OT9 A;  2PBD P;  5EVI A;  4S2N C;  2Y2I A;  4ZAM A;  2FH5 A;  1CEF A;  4RVA A;  5GHX A;  4UHU A;  1RCJ A;  3SH7 A;  2ZC7 A;  4LV2 A;  5EOO A;  1Z6F A;  1F98 A;  4S2L A;  4I39 A;  3KX0 X;  1OTE A;  1CI9 A;  1HD8 A;  1QMF A;  2Q0O A;  3C4O A;  4QB8 A;  3KYQ A;  1E3U D;  5HL1 A;  1LI9 A;  4BL3 A;  3MXR A;  4EV4 A;  1XA1 A;  4RX2 A;  4ZDX A;  4L9E A;  1ONH A;  4EW7 A;  3HLW A;  1PWC A;  2H0Y A;  4HNB A;  2ZM2 A;  1IYP A;  1NRJ A;  2DRW A;  3KSF A;  5FI7 A;  4XXR A;  4B88 A;  1YPR A;  1LI0 A;  3KSI A;  4OQG A;  3WS4 A;  1YKD A;  5HDS A;  5E2G A;  4P6Z M;  2PAV P;  4IUH A;  1SDE A;  3T4J A;  1ACF A;  3FKW A;  4YWZ A;  4UA6 A;  3F1P B;  4DF6 A;  1RGZ A;  2HF6 A;  2PR5 A;  3W4O A;  2EX6 A;  3ZDJ A;  4EEP A;  3MJQ A;  2VV8 A;  3IXG A;  4H6J A;  3UDI A;  3T1R A;  1T1C A;  1H8M A;  1OTD A;  2XFS A;  3ZG5 A;  1K55 A;  4PM7 A;  4HQA A;  2G2W A;  3NEC A;  3NHQ A;  4DKI A;  2IWD A;  2WKI A;  3FKV A;  3PBO A;  4BD0 A;  1KGF A;  3W4P A;  4C75 A;  4OLG A;  5GLA A;  1XX2 A;  4E3N A;  2VGL M;  3PBR A;  4ARZ B;  2XSS A;  1WA9 A;  3D3O A;  1GSW A;  1W5D A;  5EUA A;  3CIT A;  2HDQ A;  2WKH A;  2VV6 A;  1FOF A;  4EUZ A;  2OLU A;  5F82 A;  3Q82 A;  3IHA A;  3UE0 A;  1S6R A;  1CF0 A;  2XEP A;  2HDS A;  5DF9 A;  5IU1 A;  3TRC A;  1O07 A;  2XR0 A;  4WEL A;  3KSG A;  4LFU A;  4S2O A;  1ZG4 A;  4JF6 A;  5CED A;  1W8Q A;  3RXX A;  1MKI A;  1UWP X;  4EU0 A;  3LIA A;  2J7V A;  2WK0 A;  2EFX A;  3DTM A;  5EVI C;  1SKO B;  4HJ3 A;  4KQD A;  4KZ6 A;  2HP9 A;  3V3R A;  3MR0 A;  5F5Y A;  5J7E A;  3FYZ A;  5MC7 A;  1N9B A;  3H7W A;  3S7O A;  5HWV A;  3UB7 A;  4WEK A;  2W3G A;  4OOM A;  1S1Y A;  4EBN A;  3OC2 A;  3FWL A;  5EVI B;  1CK3 A;  2XD1 A;  3BW6 A;  3OZH A;  3NJA A;  3P98 A;  3SS4 A;  3FC7 A;  1IEM A;  5EFW A;  1HTZ A;  1LSW A;  4ZJ2 A;  3UMD A;  4FCF A;  4GS9 A;  3NOP C;  4WEJ A;  3IBJ A;  4BBT A;  2WZX A;  3GEC A;  3Q07 A;  1T1A A;  4JGP A;  1XA7 A;  3VFH A;  5FI6 A;  2V1Z A;  4CLC C;  2GNX A;  2ZL1 A;  3MKE A;  3MMH A;  4F94 A;  4HY8 A;  4ZJ1 A;  1STZ A;  2JE5 A;  2V2F F;  1TS7 A;  5KSC A;  2EXA A;  3A3F A;  1HZO A;  4BD1 A;  4CLC D;  1TDG A;  2XK1 A;  3OPL A;  4P6Z S;  3R7W A;  2GJ3 A;  1AXB A;  4HP4 A;  3CWF A;  4R1G A;  4PM8 A;  4B9O A;  1OJ5 A;  3UE3 A;  3MFD A;  3K3D A;  4JXS A;  4KQQ A;  2QWS A;  3WWX A;  5CXW A;  4KZ7 A;  2H10 A;  1TVF A;  3UY6 A;  3WS1 A;  3Q81 A;  2G2U A;  1FSY A;  4JXG A;  2A3U A;  4WF0 A;  4E3M A;  3LI8 A;  2P9V B;  4NEE D;  1M40 A;  4HES A;  4BWI A;  4F3L A;  1BLH A;  5GHZ A;  5HFO A;  2DMW A;  3BY8 A;  3MSH A;  1JWP A;  1K55 C;  4ID4 A;  2V9A A;  3F1N A;  3UPN A;  1KGE A;  2ZBB A;  1G68 A;  3OOV A;  1BTL A;  3E0Y A;  3FPW A;  4H6J B;  1PW8 A;  4PM6 A;  1YLW A;  2ZC5 B;  5E2H A;  5HAQ A;  2VGL S;  3BYD A;  2C5W B;  5HWW A;  2JKT M;  3SS5 A;  1XJ2 A;  1MKM A;  3EQU A;  1G5U A;  2UV0 E;  4HJ6 A;  2PU2 A;  4OOY A;  2AVX A;  4E3O A;  1ZTU A;  2CC1 A;  4X6T A;  2YKH A;  1XP4 A;  1S4R A;  2XRN A;  1K4E A;  4O7D A;  1NXY A;  1LSX A;  5FAO A;  5KMW A;  1V9Z A;  3IS2 A;  3MQO A;  3UN7 A;  3G4P A;  4CLC E;  3AGD A;  1ZHH B;  1ZC2 A;  4HIA A;  1XGI A;  3G32 A;  4Z9Q A;  1E25 A;  1ES2 A;  3IXB A;  3DTE A;  4H8R A;  4YIN A;  3WRZ A;  1DJB A;  3OPP A;  2PYR A;  1K38 A;  2JHE A;  4MBK A;  2Y2Q A;  4DRT A;  3OPR A;  1NWZ A;  3IBR A;  3UE6 A;  4DJ2 A;  3T1Q B;  3LUQ A;  2Z6D A;  4IUK A;  3G6O A;  2VX8 A;  1N9O A;  5TJJ A;  4IHQ A;  3BLS A;  2WZZ A;  2PU4 A;  2W3H A;  4PM5 A;  1ERO A;  4FTX A;  4EBP A;  4Q0J A;  3PXP A;  4HOI A;  2OAQ 1;  1JVJ A;  3DWK A;  4Q0H A;  3EOI A;  2D02 A;  3GVB A;  1YAX A;  5AVF A;  1OT6 A;  3T4O A;  1E3U A;  5BOH A;  3H7W B;  3H82 B;  4GHI A;  3LR3 A;  1KE0 A;  3HRE A;  3JYI A;  1H3Q A;  1TS0 A;  1YQS A;  4OON A;  1T18 A;  1FQG A;  3GMW A;  1F5M A;  2BTF P;  1KVM A;  4OQI A;  2O9C A;  4LRY C;  3RH8 B;  4L9G A;  4GS9 B;  1WYC A;  5F83 A;  4XT2 A;  5F1F A;  1U60 A;  1XFQ A;  5TR7 A;  2V1B A;  4IED A;  2I72 A;  1W63 M;  5AQA A;  1PI4 A;  3ZFZ A;  4R3A A;  1XGJ A;  2KOI A;  3CAX A;  3E4P A;  1IYO A;  2ZL1 B;  3VP1 A; 
#chains in the Genus database with same CATH homology
 4KQR A;  4NK3 A;  3C7U A;  4GDN A;  3SH7 A;  3VSK A;  2ZC7 A;  3ZG7 B;  1L0G A;  5JYP A;  4LV2 A;  4K0X A;  1OME A;  4YFM A;  5CEB A;  2OLV A;  4JLF A;  4N1H A;  5EOO A;  1Y54 A;  4QHC A;  4OPR A;  1Z6F A;  3LCE A;  4S2L A;  4GN2 A;  4JBF A;  2XGN A;  3B3X A;  1GHM A;  3BRM A;  3TOI A;  2Y2H A;  1K54 A;  1CI9 A;  1HD8 A;  1QMF A;  3HLE A;  4JF4 A;  5DF7 A;  3SOI A;  1ZKJ A;  1W79 A;  4PPR A;  3ZCZ A;  3C4O A;  4LEN A;  3V5M A;  5CGX A;  4QB8 A;  3RXW A;  4BEN A;  3MXS A;  4GB7 A;  5EEC A;  4S2M A;  4DE3 A;  1E3U D;  5CHJ A;  1TEM A;  5HL1 A;  1LI9 A;  3MBZ A;  5CER A;  4BL3 A;  3DWZ A;  3E2L A;  1PWD A;  3MXR A;  1L2S A;  4GD6 A;  4GDB A;  4GOG A;  4EV4 A;  1XA1 A;  1W7F A;  1BLP A;  2C6W B;  4RX2 A;  1WE4 A;  4ZDX A;  1ONH A;  3WS2 A;  5FQ9 A;  3HLW A;  4WBG A;  1PWC A;  2H0Y A;  3UO9 A;  5CHU A;  1VQQ A;  4MBF A;  4R4S A;  2R9X A;  3N4I A;  2ZM2 A;  1IYP A;  2DRW A;  4E3K A;  5FAP A;  5FI7 A;  4XXR A;  2XD5 A;  2JC7 A;  4B88 A;  2XF3 A;  1PI5 A;  3GR2 A;  2X02 A;  3G2Y A;  1SKF A;  1LI0 A;  1MBL A;  1YMS A;  4OQG A;  1GHP A;  2WAF A;  3Q7Z A;  3WS4 A;  3A3I A;  4OPY A;  5EVI D;  2E8I A;  3BFF A;  5E2G A;  5IHV A;  1LHY A;  3N7W A;  1SDE A;  3ITB A;  4UA9 A;  3FV7 A;  5FQJ A;  3FKW A;  3SS3 A;  2Y2P A;  4UA6 A;  2RL3 A;  5M1A A;  1K57 A;  2JBF A;  2V20 A;  3AGE A;  4DF6 A;  1RGZ A;  3NCK A;  3ZNT A;  3W4O A;  1N4O A;  1SCW A;  2EX6 A;  1KVL A;  4OQ0 A;  3ZDJ A;  3IXG A;  3WS0 A;  4OOL A;  4R3B A;  3UDI A;  1YMX A;  2WGV A;  3UPP A;  1EI5 A;  2X01 A;  4KEN B;  1GA9 A;  2WUQ A;  2H0T A;  2VGJ A;  3LEZ A;  4Y0O A;  5E2E A;  4ZJ3 A;  4QJG A;  2Z2M B;  3ZG8 B;  3A3E A;  2OV5 A;  2XFS A;  1IYQ A;  3ZG5 A;  1K55 A;  5DTT A;  4PM7 A;  4JKT A;  1C3B A;  5GLC A;  2G2W A;  4HBU A;  3G30 A;  5HW3 A;  3N8S A;  5EE8 A;  1K6R A;  4FD8 A;  4DKI A;  2IWD A;  4RX3 A;  4X68 A;  3S4X A;  2EX9 A;  2WKI A;  3FKV A;  2XDM A;  3PBT A;  3BFE A;  3V50 A;  4L0L A;  3BFD A;  3PBO A;  1FR1 A;  4BD0 A;  1KGF A;  2X71 A;  3WRT A;  4WZ5 A;  4A5R A;  1SDN A;  2HP6 A;  3W4P A;  5AQ9 A;  4C75 A;  4OLG A;  4KG5 A;  3VP4 A;  5GLA A;  4LCL A;  1XX2 A;  1K6S A;  4E3N A;  4OH0 A;  3IHB A;  3PBR A;  4ZTK A;  4K91 A;  3ZNY A;  1I2S A;  2QZ6 A;  1LL5 A;  5JYO A;  3BEB A;  1W5D A;  3C5A A;  3G2Z A;  1NZU A;  3C4P A;  4U0X A;  5G18 A;  5EUA A;  3MKF A;  2HDQ A;  3BM6 A;  5CTN A;  3UE1 A;  3IF6 A;  3LY4 A;  4IBX A;  1K25 A;  2WKH A;  1PZO A;  3DW0 A;  3IXH A;  3O86 A;  1FOF A;  4EUZ A;  5CGS A;  2OLU A;  3BFC A;  5F82 A;  3Q82 A;  1YM1 A;  3IHA A;  1IKI A;  2ZQ8 A;  3UE0 A;  1S6R A;  4JPM A;  2XEP A;  4S2J A;  1RP5 A;  2IWC A;  1YLY A;  2HDS A;  4N9L A;  5DF9 A;  1O07 A;  1G6A A;  5J8X A;  1MXO A;  3OCN A;  5HAI A;  2HDR A;  2XR0 A;  1PWG A;  5M18 A;  2A49 A;  4Y0T A;  1BSG A;  2BLS A;  3LO7 A;  4WEL A;  3VP2 A;  3Q7V B;  1NYY A;  2UWX A;  3PBN A;  3QHY A;  2ZM8 A;  4S2O A;  1FCO A;  1JWZ A;  4P85 A;  2Y2J A;  1ZG4 A;  4JF6 A;  1BUL A;  5A92 A;  5CED A;  3ITA A;  5FSR A;  1W8Q A;  3MZE A;  4KZA A;  3RXX A;  5FI2 A;  1MKI A;  5CEC A;  4LV0 A;  4K0W A;  5FAQ A;  3LY3 A;  2J7V A;  2WK0 A;  5FA7 A;  2EFX A;  3DTM A;  5EVI C;  2Q9M A;  5DTS A;  4EWF A;  4KZ6 A;  2HP9 A;  3V3R A;  3W4Q A;  4P87 A;  3TG9 A;  1ES3 A;  3VP3 A;  3GRJ A;  4IBR A;  5DVA A;  4DDS A;  4WZ4 A;  1NRF A;  3M6H A;  5GL9 A;  2QPN A;  3FYZ A;  3HUO A;  3Q1F A;  1N9B A;  2HP5 A;  2ZQ7 A;  1K4F A;  5AQ7 A;  4WEK A;  4OOM A;  4LV1 A;  3C7V A;  3GV9 A;  2ZD8 A;  4EBN A;  2J8Y A;  2WGW B;  3OC2 A;  4R3J A;  1MY8 A;  2EXB A;  5E2F A;  3FWL A;  5EVI B;  1CK3 A;  1WYB A;  5TGF A;  1EWZ A;  4DE0 A;  2XD1 A;  3HL9 A;  3OZH A;  1MWR A;  1XKZ A;  3P98 A;  3ZG0 A;  3SS4 A;  1IEM A;  5M19 A;  1BUE A;  1HTZ A;  2ZQD A;  4IVI A;  4ZJ2 A;  4FCF A;  2ZM0 A;  4WEJ A;  5GLD A;  4BL2 A;  1K54 C;  1YLP A;  2WZX A;  3A3D A;  3NIA A;  3Q07 A;  2ZQ9 A;  5E43 A;  4DE1 A;  3N6I A;  2Y2K A;  4OPQ A;  1DJC A;  2Y2L A;  1XA7 A;  3VFH A;  1FR6 A;  2QMI A;  1NY0 A;  3V3S A;  5FI6 A;  2V1Z A;  5EPH A;  2WAE A;  3HLG A;  3VOZ A;  5F1G A;  4OVD A;  1IYS A;  3NI9 A;  3MKE A;  2ZC3 B;  2ZJ9 A;  4E3J A;  4F94 A;  5CRF A;  1L0E A;  4ZJ1 A;  5FAS A;  2EFU A;  4P0M A;  2HPB A;  2JE5 A;  2XFT A;  3WS5 A;  2V2F F;  1LL9 A;  5KSC A;  2EXA A;  4S2N A;  3A3F A;  3HLF A;  5KSH A;  3N8L A;  1BLS A;  1HZO A;  3S22 A;  4BD1 A;  5FQK A;  4PM9 A;  5DTK A;  4FSF A;  1TDG A;  2XK1 A;  2R9W A;  3OPL A;  1LLB A;  1JTG A;  1PW1 A;  1AXB A;  4R1G A;  3IT9 A;  1BZA A;  4PM8 A;  3QNC A;  4JF5 A;  3UE3 A;  3MFD A;  1GHI A;  1ZG6 A;  4JXS A;  3BEC A;  1K56 A;  4KG6 A;  4KQQ A;  4EBL A;  4OKP A;  4KG2 A;  2ZC4 B;  5CXW A;  3WWX A;  2BG1 A;  2H10 A;  3M2K A;  1TVF A;  4KZ7 A;  3UY6 A;  3Q81 A;  2G2U A;  4HEF A;  2Y2N A;  3WS1 A;  2H5S A;  1IKG A;  4Q8I A;  2Y2M A;  2Y59 A;  3VSL A;  4P6B A;  2Y4A A;  1FSY A;  2ZQA A;  1K57 C;  1ONG A;  2B5R A;  2Z2L B;  3I7J A;  4JXG A;  4DE2 A;  4MBH A;  4KZ5 A;  3M2J A;  1KE3 A;  3UDF A;  1S0W A;  2A3U A;  2ZQC A;  3MZD A;  5CTM A;  5AQB A;  5FDH A;  1MPL A;  3W8K A;  3IWO A;  4Y7P A;  5HX9 A;  4E3M A;  5GLB A;  3IQA A;  2P9V B;  3HUN A;  1CEG A;  1M40 A;  4HES A;  3ZG9 B;  1E4D A;  4DDY A;  3CG5 A;  1BLH A;  3IF5 A;  3QNB A;  5GHZ A;  5HFO A;  3UPO A;  1YT4 A;  1Q2P A;  1MWU A;  5HAP A;  4DXC A;  1RGY A;  5CGW A;  4XUZ A;  3OPH A;  1YLZ A;  3M6B A;  4QD4 A;  3HUM A;  1JWP A;  3VOY A;  4E6W A;  1K55 C;  4ID4 A;  4KZ8 A;  4E3L A;  3G31 A;  1I2W A;  3UPN A;  1QME A;  1FCN A;  1KGE A;  1I5Q A;  1W8Y A;  1G68 A;  4LV3 A;  3TSG A;  2XLN A;  1KDW A;  2J9O A;  4D2O A;  1BTL A;  2DCF A;  5DF8 A;  2RCX A;  4R4R A;  3SH9 A;  4PMA A;  1YLT A;  1PW8 A;  2Y2G A;  4GZB A;  4PM6 A;  4S2I A;  3BFG A;  1DY6 A;  1ALQ A;  1NJ4 A;  1YLW A;  2ZC5 B;  1MWS A;  2XH9 A;  5FAT A;  5CHM A;  5E2H A;  5FQM A;  2WAD A;  3IWI A;  5HAQ A;  3NY4 A;  2DNS A;  2Y2O A;  4WZ5 C;  3V39 A;  3BYD A;  1YLJ A;  1NYM A;  2C5W B;  2VGK A;  4OP5 A;  1L0F A;  3SS5 A;  4EQI A;  1GA0 A;  3HLB A;  4GKU A;  3BLM A;  3EQU A;  2HDU A;  1VM1 A;  2PU2 A;  4OOY A;  4WM9 A;  5A90 A;  2Y55 A;  4GNU A;  1ESU A;  1KE4 A;  1ERM A;  3O87 A;  4HBT A;  2Y91 A;  4E3O A;  3HBR A;  2CC1 A;  5KZH A;  3CJM A;  1ES5 A;  4KZ4 A;  4UA7 A;  4X6T A;  1H8Z A;  4XUX A;  1XP4 A;  4C3Q A;  2P74 A;  4Y0U A;  1K4E A;  1NXY A;  3CZD A;  2J9P A;  3A3J A;  4O7D A;  5FAO A;  5GHY A;  3VP0 A;  5KMW A;  4DXB A;  2IWB A;  3IF6 C;  3IH8 A;  4MLL A;  1DJA A;  3UN7 A;  1K56 D;  3G4P A;  4CJN A;  1XXM A;  4U3T A;  1PYY A;  4ZBE A;  3AGD A;  2GDN A;  4B4Z A;  1ZC2 A;  2WKE A;  4NET A;  1XGI A;  4OLD A;  3G32 A;  1BT5 A;  3PAG A;  4Z9Q A;  5EVL A;  1XPB A;  1FSW A;  4QY5 A;  3PBQ A;  1ERQ A;  1MWT A;  4E3I A;  1E25 A;  4BJP A;  2ZLY A;  4X53 A;  3IXD A;  5EOE A;  3O88 A;  1ES2 A;  3IXB A;  4R0Q A;  4WMC D;  2WYX A;  4JXV A;  3HLD A;  3NDG A;  3HLC A;  4H8R A;  4YIN A;  3ZGA B;  3D4F A;  3IF6 B;  3MZF A;  2OSU A;  3O3V A;  5U47 A;  3ZHH A;  1FCM A;  3WRZ A;  1ES4 A;  1TDL A;  1DJB A;  3G35 A;  3OPP A;  3ZVW A;  4OQH A;  5A91 A;  4IVK A;  1JTD A;  1K38 A;  3CMZ A;  3N8R A;  5FQQ A;  1ESI A;  1O7E A;  3NDE A;  1Q2Q A;  4MBK A;  2Y2Q A;  1L0D A;  4DRT A;  1IEL A;  4R23 A;  3OPR A;  3UDX A;  5D3O A;  1J9M A;  3E2K A;  3GQZ A;  4JXW A;  3GTC A;  4FH4 A;  2P9V A;  5TFQ A;  4QU3 A;  4QY6 A;  3UNW A;  4MEZ A;  2JCH A;  2EX8 A;  2PBY A;  2XQZ A;  3PBS A;  1HVB A;  1BLC A;  1KDS A;  5A93 A;  4C6Y A;  4KZB A;  4BQM A;  4MNR A;  3BLS A;  4BLM A;  1GCE A;  2WZZ A;  2PU4 A;  3AGF A;  3PAE A;  4X56 A;  4UAA A;  4PM5 A;  4S2K A;  1ERO A;  3FZC A;  4EBP A;  4RYE A;  4WYY A;  4OP8 A;  4E6X A;  1CI8 A;  3Q7V A;  1SHV A;  1JVJ A;  1JWV A;  4X55 A;  3DWK A;  4X69 A;  1H8Y A;  4M3K A;  2ZC6 B;  3GVB A;  3IH9 A;  4LCM A;  4GD8 A;  3EQV A;  4N92 A;  1H5X A;  3VMA A;  1E3U A;  2ZMA A;  4S2P A;  4RA7 A;  1PZP A;  5BOH A;  5I94 A;  4KZ3 A;  1NZO A;  4N9K A;  3VFF A;  2Q9N A;  1KE0 A;  3HRE A;  3JYI A;  4WMC A;  3S1Y A;  1YQS A;  2WGI A;  3G34 A;  1KGG A;  4OON A;  4CPK A;  2FFF B;  1FQG A;  3GMW A;  3NBL A;  1KVM A;  4FH2 A;  4OQI A;  4KZ9 A;  2EX2 A;  2FFY A;  3RJU A;  4OPZ A;  3ZVT A;  4N1X A;  2WGW A;  3P09 A;  3PTE A;  1WYC A;  3OCL A;  3ISG A;  5HAR A;  5EVI A;  5F83 A;  4S2N C;  5F1F A;  2Y2I A;  1U60 A;  3HVF A;  4ZAM A;  5TR7 A;  1CEF A;  4IED A;  2I72 A;  5AQA A;  4RVA A;  3IWQ A;  1PI4 A;  3GSG A;  5GHX A;  5FQI A;  3ZFZ A;  4B4X A;  1XGJ A;  4U0T A;  1M6K A;  3SH8 A;  4KQO A;  1IYO A;  3VP1 A;  1PIO A;  5L2F A;  4UHU A;  1RCJ A;  3NC8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...