3SH7A

Crystal structure of fluorophore-labeled beta-lactamase penp
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
257
structure length
257
Chain Sequence
KDDFAKLEEQFDAKLGIFALDTGTNRTVAYRPDERFAFASTIKALTVGVLLQQKSIEDLNQRITYTRDDLVNYNPITEKHVDTGMTLKELADASLRYSDNAAQNLILKQIGGPESLKKELRKIGDEVTNPERFCPELNEVNPGETQDTSTARALVTSLRAFALEDKLPSEKRELLIDWMKRNTTGDALIRAGVPDGWEVADKTGAASYGTRNDIAIIWPPKGDPVVLAVLSSRDKKDAKYDDKLIAEATKVVMKALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Increased structural flexibility at the active site of a fluorophore-conjugated beta-lactamase distinctively impacts its binding toward diverse cephalosporin antibiotics
pubmed doi rcsb
source organism Bacillus licheniformis
molecule tags Hydrolase
total genus 86
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2011-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3sh7A00
1PWDA 2OLVA 4HBTA 4P85A 4K0XA 1I2SA 2ZM2A 2P9VA 4QY5A 3HUOA 3HLCA 2X02A 5FQ9A 2ZC7A 4WMCA 2GDNA 3V50A 3IF6C 4WEJA 2FFYA 3OPHA 5EECA 1K55C 4GDBA 1RP5A 4KG2A 4S2NA 4X53A 3MZDA 1QMFA 1SKFA 4DKIA 2Y2HA 1ERMA 1LI0A 4GD6A 1KVLA 2ZQDA 5J8XA 1FCMA 3IF6B 3UPNA 4KQQA 3NCKA 1PW1A 4LCLA 3MBZA 1BZAA 4Q8IA 4N1XA 1U60A 1K56D 4U0TA 4GZBA 4R3BA 1K56A 1NY0A 2H10A 2HP5A 4KZ7A 4DF6A 2Q9MA 5FQJA 2Q9NA 2DRWA 1XKZA 1IEMA 3HLWA 3N4IA 1ONGA 3NBLA 1WYBA 3OCNA 3VP1A 4DXBA 2IWCA 4IEDA 5HAQA 1E3UD 1IYPA 2QMIA 2E8IA 4S2LA 2X01A 4BENA 1BLPA 1FCNA 5U47A 5EVID 1GA9A 1MKIA 2B5RA 2WKIA 3LCEA 1ONHA 4KZ9A 1LL9A 2H5SA 3EQUA 2CC1A 1MPLA 3NDEA 1VQQA 4FH4A 1NXYA 1W8YA 4ZJ3A 5TGFA 4JKTA 2EFXA 3DTMA 1TDLA 2X71A 4E6WA 5L2FA 1FQGA 2C5WB 3A3DA 1GA0A 2ZD8A 1Y54A 1YLTA 2G2UA 4XUXA 3VOZA 2XK1A 1Q2QA 2V20A 1GHMA 1ESIA 3IWIA 4UHUA 5FAQA 1NYMA 1CI8A 3C4PA 5CTNA 3TOIA 1BLHA 3FWLA 3ZFZA 4C3QA 3FYZA 2ZJ9A 4N92A 3ZDJA 2IWDA 3Q81A 5GLDA 2V2FF 1K25A 1ES3A 2WGWA 4N9KA 2XEPA 1ERQA 1YLWA 4P0MA 4FCFA 4FD8A 1PZPA 1AXBA 4Y7PA 1SDNA 3IXDA 3ZNYA 2QPNA 2I72A 4KG5A 5CERA 4S2KA 3M2JA 4O7DA 5CEDA 4XXRA 2EX2A 4Y0OA 5FQMA 3O88A 4OP5A 1LHYA 4UA7A 1ALQA 4YFMA 5DTTA 3UE3A 3UDFA 4X68A 3AGEA 1ZKJA 2R9XA 4WELA 1CEFA 1N4OA 3EQVA 1MWTA 1PIOA 2Y59A 3ITAA 2EX9A 4DDSA 3CMZA 4R0QA 3RJUA 3O87A 3UDXA 4PM8A 2ZC6B 1KGGA 2XF3A 1W79A 3HBRA 4NK3A 1IYOA 4IBRA 1G68A 4MBKA 4OQGA 2ZC3B 4QD4A 5CHUA 2PU2A 3VSKA 3PBTA 3M2KA 1KDSA 3ZHHA 5CHJA 1ZG4A 5A90A 4D2OA 4C75A 2Y2LA 5CGXA 5FI7A 3ZG8B 3A3IA 1XX2A 2G2WA 1PI5A 4PM5A 1XP4A 1DJCA 1K57A 1L0EA 1YLJA 2XR0A 2HDUA 3N6IA 4R4SA 2WGWB 1N9BA 2ZQAA 3HLBA 3Q07A 3MXRA 4DDYA 3W4QA 3PBNA 1TVFA 3HLFA 4ZAMA 4LV2A 3CZDA 2EXBA 4JXWA 4E3IA 4JLFA 4RYEA 5HW3A 5G18A 1JWVA 3OC2A 4WZ5A 2WKEA 4BJPA 2XGNA 4MNRA 3VFHA 5AQ7A 1SDEA 1GHIA 2ZM8A 5FATA 4H8RA 4EUZA 1FR1A 2XFTA 4X6TA 3V5MA 1YT4A 5CRFA 3ZCZA 3BFDA 3CJMA 4LENA 3VP2A 3LY3A 1FCOA 3HUNA 1MY8A 4B4ZA 2WYXA 4DE2A 4S2OA 2EX8A 4BLMA 4S2PA 4IVKA 2WZZA 1VM1A 1S6RA 2H0YA 5KZHA 4C6YA 1IYSA 5FQQA 4OPQA 4KZ8A 2ZC4B 1HTZA 5FI6A 3CG5A 4PM7A 3ZVWA 5CHMA 1Z6FA 1SHVA 4BL3A 4ZDXA 1TEMA 3DWKA 3HUMA 3IH8A 3Q7VB 3BECA 1K38A 4CPKA 1BTLA 3BFCA 4DE1A 3N8SA 3O86A 2ZQ9A 3ISGA 3GQZA 2EFUA 3IXHA 1LI9A 1XPBA 2ZC5B 2DCFA 3GR2A 3ITBA 2J9PA 3SS5A 5M18A 1I2WA 3UE0A 2Y2IA 3G2YA 4UAAA 1G6AA 4FSFA 5F83A 1CK3A 1JTDA 1GHPA 4RX3A 4EBNA 4DRTA 5EVLA 2R9WA 4WEKA 4MBFA 2Y2NA 3PAGA 5HAIA 2OV5A 2XLNA 2VGJA 2A49A 3BYDA 2Y2OA 1E3UA 1K6SA 3HLGA 2Y91A 5KMWA 5FQKA 4OP8A 4ZJ1A 3UDIA 3B3XA 5EVIA 1HZOA 1NZOA 1S0WA 4LCMA 1IYQA 5HX9A 4E6XA 5AQBA 1CI9A 3QNBA 4S2NC 2WGVA 3BFEA 2P9VB 3G34A 4OOYA 1ZC2A 4MEZA 4B88A 4CJNA 5JYPA 4MLLA 3VP3A 3BLMA 4JF5A 4OONA 5TR7A 3FKWA 5JYOA 2XQZA 4OLGA 1C3BA 1DJBA 5I94A 4B4XA 1MWSA 5GLBA 4IBXA 4HESA 4BD0A 3OZHA 3IXGA 3GVBA 1YM1A 3FKVA 4E3LA 3E2KA 3VFFA 1YMXA 1EROA 5GL9A 3C7UA 3W4OA 1XA7A 4KQOA 3G32A 3OPPA 5HL1A 4EBPA 3GRJA 3VMAA 4OPYA 4N1HA 3BLSA 4U3TA 3C7VA 4S2MA 5AQAA 3V3RA 3PBRA 1O7EA 4E3OA 4OKPA 1BT5A 3WRTA 5AQ9A 2Y2GA 4BD1A 3SS4A 2WAFA 3ZG5A 5EVIC 4WM9A 2ZQ7A 5HFOA 3WS2A 1SCWA 4KZ6A 3Q82A 5EE8A 3MZFA 4ZBEA 3TSGA 3A3FA 5EOEA 1ESUA 1DJAA 1LL5A 1HD8A 1PYYA 2ZQCA 4X55A 1ZG6A 3ZNTA 5EVIB 4RX2A 3V39A 3OPLA 1MBLA 1KGFA 1O07A 3OPRA 2Y4AA 3ZVTA 4OQHA 4PM6A 4WBGA 5M19A 3AGDA 4OPRA 4RVAA 2P74A 2XH9A 5E2GA 3G4PA 4KZBA 3IQAA 3ZG9B 3N7WA 3W8KA 3GV9A 1YLZA 4ZJ2A 3BFFA 4OVDA 5DTSA 4KZAA 1EWZA 2ZM0A 3HLDA 4R4RA 3WS1A 4QJGA 2Y2JA 3IT9A 5CTMA 3QNCA 3VP4A 1H8ZA 3NC8A 3PAEA 3SOIA 3Q7ZA 4KZ3A 5GLCA 3BM6A 2J8YA 1M40A 5CXWA 5FQIA 2EX6A 4NETA 4P87A 4ID4A 2WAEA 1JVJA 1PWGA 1PWCA 3M6BA 4DXCA 1W8QA 4KG6A 1K54A 3Q1FA 1PZOA 3G2ZA 4N9LA 2WUQA 5DF8A 3DW0A 3UN7A 3IF6A 3S22A 2WK0A 5DVAA 1K55A 1W7FA 4KQRA 1BULA 2FFFB 4R23A 4S2JA 2Z2LB 2HDRA 3N8LA 3O3VA 2ZMAA 4BL2A 3S4XA 2PBYA 1MWUA 2JE5A 1ES4A 3M6HA 1IELA 1XXMA 5A92A 1YLPA 5M1AA 2XD1A 4QU3A 4R1GA 5IHVA 2IWBA 5BOHA 3JYIA 2WGIA 4GNUA 4Z9QA 4FH2A 3WRZA 2OLUA 2Z2MB 5F82A 4EWFA 5HAPA 3SH8A 5FA7A 3V3SA 3NI9A 3AGFA 3SH9A 3UPOA 1FOFA 3G35A 3QHYA 1W5DA 1WE4A 2J7VA 1BUEA 1K57C 4K91A 3TG9A 3GTCA 1YLYA 3VSLA 1H8YA 3PBSA 4DE0A 3UPPA 3NDGA 3SH7A 4A5RA 3GMWA 2QZ6A 3LEZA 1FSYA 1I5QA 5KSHA 2BG1A 4WMCD 5DF7A 5CGWA 4WZ4A 2Y2KA 1K54C 5DTKA 3IF5A 4JF4A 4HEFA 5GHYA 4R3JA 2J9OA 1NYYA 3VOYA 3BFGA 1NJ4A 5EPHA 4LV0A 3E2LA 4WZ5C 3NY4A 3PBQA 4YINA 2HPBA 2PU4A 2XDMA 1H5XA 5EUAA 5A91A 3WS4A 5FAOA 2C6WB 1L0GA 5E2HA 1J9MA 4UA9A 1E25A 4OH0A 1KGEA 1L0FA 2Y2QA 4WYYA 1RCJA 5E2EA 2Y2PA 4K0WA 4Y0TA 3S1YA 1ES5A 1K4FA 1EI5A 4UA6A 4GB7A 4EQIA 1XGIA 1K4EA 5GHXA 1KE0A 1FSWA 1YMSA 4LV1A 2XFSA 5F1FA 1KE3A 1QMEA 3IHBA 3P09A 3IH9A 4QY6A 5D3OA 2A3UA 2WZXA 4E3KA 3HREA 4E3NA 3UNWA 2HDSA 3IWQA 1NRFA 5HARA 3A3JA 1RGZA 3ZGAB 1MXOA 2DNSA 1HVBA 2VGKA 4PM9A 3I7JA 3IHAA 4M3KA 3WWXA 2ZLYA 1LLBA 4MBHA 5EOOA 1PW8A 3UO9A 1JWZA 4GN2A 4JPMA 1NZUA 4IVIA 3WS5A 2HP6A 3IXBA 5GLAA 3P98A 5DF9A 1CEGA 3RXWA 2UWXA 1KVMA 4PPRA 4P6BA 4KZ4A 3LO7A 2JBFA 4KZ5A 2ZQ8A 4OPZA 3GSGA 4HBUA 5GHZA 3DWZA 2XD5A 2WADA 3MZEA 4GKUA 4JXSA 4KENB 5FAPA 3A3EA 3IWOA 4OQ0A 4GOGA 1DY6A 2JCHA 4EBLA 3G30A 3W4PA 3C5AA 3HLEA 3NIAA 4GDNA 5FDHA 3PBOA 2EXAA 3UY6A 1L0DA 3RXXA 2Y55A 4GD8A 5E43A 2H0TA 2HDQA 1OMEA 3MFDA 4S2IA 3HVFA 4X69A 4RA7A 1IKIA 2OSUA 3FV7A 3HL9A 1XGJA 3FZCA 1FR6A 3LY4A 3C4OA 5FSRA 1WYCA 4X56A 3ZG0A 1L2SA 2V1ZA 3PTEA 3UE1A 3OCLA 4OOMA 5E2FA 1Q2PA 4ZTKA 1MWRA 3MKFA 5KSCA 4F94A 3MXSA 1ES2A 1XA1A 3Q7VA 2RCXA 1JTGA 4OQIA 2JC7A 3G31A 3D4FA 4OOLA 5CGSA 1KE4A 3VP0A 4PMAA 1BLCA 4U0XA 3BRMA 1GCEA 1E4DA 5FASA 3BEBA 4JF6A 4JBFA 4XUZA 4QB8A 4JXVA 1M6KA 5F1GA 4LV3A 4BQMA 1TDGA 1YQSA 4OLDA 5TFQA 5CEBA 5CECA 1JWPA 4QHCA 5FI2A 1K6RA 2Y2MA 2RL3A 3MKEA 4DE3A 3ZG7B 1RGYA 5A93A 1KDWA 2HP9A 4E3JA 3SS3A 3WS0A 4Y0UA 1IKGA 2BLSA 2WKHA 1BSGA 4JXGA 4E3MA 4EV4A 4L0LA 1BLSA 1PI4A 3N8RA
chains in the Genus database with same CATH superfamily
1PRQA 2VZWA 3LIEA 2X02A 5FQ9A 4LGWA 2L4RA 1OTEA 1DRMA 2Y2HA 1ERMA 3IF6B 4KQQA 3NCKA 1PW1A 3RH8B 5HD5A 1K56D 3S7QA 4R3BA 2HP5A 4B93A 1DP9A 3HLWA 1WYBA 5HAQA 1IYPA 2X01A 1FCNA 5A8BA 3NECA 1LL9A 2H5SA 3MFXA 3FG8A 4MDZA 3DTMA 2EWVA 4E6WA 1FQGA 2C5WB 4QPRA 1TD5A 4EERA 1YLTA 3VOZA 4FTXA 1NYMA 1ODVA 2IWDA 5GLDA 3ULFA 2PYPA 1YLWA 4FCFA 4FD8A 5J3WA 1AXBA 2W3EA 3M2JA 5CEDA 2EX2A 1Y28A 3TJZC 2J3TC 2PBDP 4OP5A 1LHYA 4XT2A 2QJ5A 3UE3A 3LI9A 2R9XA 3CWFA 1N4OA 3H9WA 3ITAA 3CMZA 3LICA 3UDXA 5TBMB 1KGGA 1W79A 1P9WA 5FL3A 3BY8A 1G68A 3BW6A 4MBKA 4G3WA 4LRZE 5CHJA 4H6JB 5HWWA 3MQOA 3A3IA 3LIDA 4PM5A 1L0EA 5L07A 1TS8A 1TVFA 4NXGA 3CZDA 4HH3A 3LEQA 3OC2A 4WZ5A 5FATA 4X6TA 1YT4A 3ZCZA 3BFDA 3CJMA 1FCOA 1MY8A 2WYXA 4S2OA 5DKLA 4S2PA 5KZHA 4KZ8A 1HTZA 4PKYG 3CG5A 5CHMA 3Q7VB 2PR5A 3HUMA 3BECA 2OOLA 1BTLA 2ZQ9A 3GQZA 2INWA 3IXHA 1SKOA 1LI9A 2DCFA 2QYBA 5FDSA 2Y2IA 3T1RA 4Y15A 3H82B 4LLOB 4RX3A 3C2WA 4EBNA 5J4EA 2R9WA 4L9GA 4MBFA 1KOUA 5IU1A 2Y2OA 2Y91A 4D60A 4OP8A 3VV4A 1OT6A 2VV6A 3EWKA 4F3LB 3DBAA 2P9VB 2UV0E 4OOYA 1ZC2A 5DFXA 5JYPA 4OONA 2VA0A 2QKPA 4NKPA 4B4XA 5GLBA 4IBXA 4O8GA 1YM1A 3LI8A 3E2KA 1YMXA 3W4OA 3EEHA 3VMAA 4OPYA 4N1HA 5AQAA 1O7EA 5AQ9A 4HP4A 1D06A 3HCYA 4EEUA 3TSGA 3NOUC 1DJAA 4X55A 4RX2A 2O9BA 3KSFA 1MBLA 4PKYA 4CLCB 4OPRA 3ZG9B 3N7WA 5DTSA 4KZAA 2ZM0A 3MQQA 3NC8A 4KUKA 1JNUA 2VGLM 3M6BA 4PHTA 2VGLS 3K3DA 3IF6A 4MN5A 2BASA 1K55A 4KQRA 1BULA 1TS0A 2Z2LB 2BTFP 3O3VA 5EM0A 1F9IA 1MWUA 1ES4A 3M6HA 2P08A 4R1GA 3RFBA 3LYXA 2V1AA 2OLUA 3SH8A 3AGFA 3UMEA 5DFYA 3UPOA 1FOFA 1WE4A 2OWJA 3PXPA 4K91A 3TG9A 1WA9A 1H8YA 3NDGA 4Y3IA 3GMWA 1I5QA 2GZAA 1UWPX 1K54C 2Z6CA 4HEFA 4R3JA 2J9OA 1DP8A 3VOYA 4YINA 1F98A 2XDMA 3S7OA 2YKFA 3OLOA 1MKMA 1RCJA 5E2EA 3FPVA 4Y0TA 1EI5A 1W63Q 3ZYTA 1MC0A 3EGDC 3BQ8A 2EA9A 3IH9A 5D3OA 2WZXA 4E3KA 3T4QA 3T4SA 3JVUA 4DN0A 3IWQA 1NRFA 3A3JA 1RGZA 5TBMA 2B95A 2VV8A 1S4RA 1XJ6A 3I7JA 4M3KA 4Q0JA 1PW8A 4GN2A 3IXBA 4H6JA 4BBVA 5HPFA 3RXWA 3P98A 1OTAA 4OPZA 2ZQ8A 2QWSA 2JKFA 3MZEA 5FAPA 4YNRA 4OQ0A 4LRXC 4EBLA 3LR3A 3W4PA 3NHQA 3T4KA 3C5AA 3NIAA 1L0DA 4GHIA 5E43A 5HD3A 2HDQA 1OMEA 4S2IA 1IKIA 3TE8A 3FV7A 1T1CA 4ARZA 1XGJA 1ZTUA 2KLIA 2ZBBA 1T1AA 3S7NA 5DJUA 4DJ3A 4OOMA 1Q2PA 5MC7A 4ZTKA 5KSCA 3MXSA 3Q7VA 4M4XA 3D4FA 1BLCA 1IFQA 3BRMA 1GCEA 3BEBA 4JXVA 5EV0A 3H82A 5CEBA 5G4ZA 1JWPA 5FEFA 4R38A 1K6RA 2WKQA 4Y13A 4HOIA 5A93A 2HP9A 3SS3A 4L0LA 4F3LA 4GW9A 2ZM2A 2P9VA 3KYQA 3HUOA 4GJ4A 3V50A 2FFYA 3D3OA 4S2NA 4X53A 1QMFA 1SKFA 1P9RA 2O99A 2ZQDA 1VHMA 1U60A 4Z1WA 2W1TB 2CMNA 3PHYA 4NXBA 4X25A 1D7EA 1IEMA 3N4IA 3NBLA 3OCNA 4IEDA 2QMIA 1LT0A 2ZL1A 3LCEA 2WKIA 4P6ZM 3EQUA 2CC1A 5F6AA 2O0YA 1NXYA 2G7UA 4ZJ3A 4P6ZS 1ZHHB 5L2FA 3A3DA 1OTBA 1GA0A 3NULA 5J7EA 2HV1A 2XK1A 1Q2QA 1GHMA 1ESIA 4UHUA 3TOIA 1CI8A 1BLHA 4C3QA 3FYZA 3Q81A 1K25A 1ES3A 2WGWA 4E3LA 1ERQA 3ZNYA 2I72A 4S2KA 3P01A 3SW1A 3NOTC 4XXRA 2MJ6A 2KX6A 4Y0OA 3UB8A 3NJAA 2V0WA 5DTTA 1ZKJA 2JHEA 4WELA 4R0QA 3RJUA 4PM8A 4HQAA 3HBRA 1V9YA 4NXEA 2W3FA 2PU2A 3PBTA 1ZG4A 4D2OA 5FI7A 3FC7A 3E4QA 2FZ0A 3QP6A 1XJ2A 4ETZA 3N6IA 4R4SA 2Y8HA 2ZQAA 3MXRA 3W4QA 4WL9A 2WKRA 4ZAMA 4LV2A 2EXBA 4JXWA 5F68A 4HJ4A 2WKEA 3B33A 4YOFA 5AQ7A 1SDEA 1GHIA 4EUZA 4H8RA 2XFTA 3V5MA 3VP2A 4MN7A 1VM1A 2H0YA 4C6YA 1IYSA 4OPQA 5FI6A 3ZVWA 5EM1A 1N9LA 4CPKA 4DE1A 3UB5P 2ZC5B 3GR2A 3ITBA 2J9PA 1I2WA 4RQ9A 4ZRRA 4UAAA 4FSFA 1JTDA 1GHPA 2W1RA 3BYDA 3HLGA 1SZVA 5KMWA 5FQKA 1STZA 4BBUA 1GSWA 5EVIA 2VX8A 2NUPC 4LCMA 5HX9A 4EW7A 1CI9A 4MEZA 3MR0A 2W0NA 2ZMFA 3VP3A 2P7JA 4JF5A 5TR7A 2XQZA 1EW0A 1C3BA 1DJBA 2HJ9C 2L0WA 3GVBA 4KQOA 4II7A 2FH5A 3T4JA 4EBPA 3BLSA 3C7VA 4S2MA 3V3RA 4O0PA 3WRTA 4BD1A 3ZG5A 4WM9A 1CQAA 4ZBEA 3A3FA 1HD8A 3O5YA 2E8JA 3A0SA 3OPLA 3V39A 1KGFA 2Y4AA 3ZVTA 4PM6A 3A0RA 4WBGA 4HP9A 1H3QA 2P74A 2XH9A 5AVEA 3G4PA 4KZBA 3GV9A 1YLZA 4ZJ2A 1XFQA 3JVVA 3KO6A 4OVDA 4R4RA 3HLDA 4QJGA 2Q0OA 3QNCA 4LFUA 3SOIA 3Q7ZA 4KZ3A 4P87A 4ID4A 2WAEA 1PWGA 3EEAA 2Z6DA 5L10A 3G2ZA 5HDCA 2DMWA 4N9LA 5DF8A 3UN7A 2L1MA 4EQ1A 5DVAA 2W1TA 2PBYA 1IELA 1XXMA 5A92A 4HHDA 2XD1A 4JGQA 1W63M 2V0UA 4DJ2A 4Z9QA 2WGIA 4R6LA 2QHKA 2Z2MB 4BBTA 2PAVP 5FA7A 3QHYA 1K57C 4MMNA 3GTCA 4HJ6A 2KOIA 3SH7A 3U4LP 2BG1A 5DF7A 5CGWA 2Y2KA 5DTKA 4JF4A 5GHYA 4GLQA 3CITA 3DTKA 3E2LA 3NY4A 2HPBA 2PU4A 5FAOA 3CLOA 1J9MA 4UA9A 2VKSA 2Y2QA 2PDRA 2Y2PA 2I9VA 3T50A 3NOPC 3MXQA 2XROA 4GB7A 4EQIA 1FSWA 1YMSA 2XFSA 1LSVA 3K2NA 1KE3A 1QMEA 5DKKA 4QY6A 4EEPA 3R4KA 4Q0IA 1HVBA 2JKRI 4NEED 3WWXA 3IHAA 2ZLYA 1H0MA 1JWZA 4JPMA 4IVIA 3A0VA 3T4OA 5GLAA 2UWXA 3KYEA 5HSQA 3GSGA 1G6OA 3B42A 2AVXA 3IWOA 2VLGA 4I3JA 1OTIA 1LSWA 5FDHA 3PBOA 2Y55A 2H0TA 3BY9A 3MFDA 2K31A 3FZCA 4GS9B 2HJEA 1WYCA 3QP5A 1L2SA 5HZHA 3F1NB 3OCLA 1ES2A 1XA1A 1JTGA 4ME4A 2PRFA 3G31A 4U0XA 1PNEA 4QB8A 4LV3A 4BQMA 4OLDA 5CECA 4NXFA 3MKEA 4DE3A 1RGYA 1KDWA 2KDKA 1NLZA 4Y0UA 4HI4A 3UB6A 4E3MA 3N8RA 4WUJA 1PWDA 1VB6A 2OLVA 4HBTA 4P85A 4HH2A 1I2SA 3GDIA 4QY5A 2ZC7A 4WMCA 2GDNA 5EECA 1T1BA 4KG2A 3MZDA 4DKIA 1FCMA 5DJTA 4HJ3A 1XJ3A 5F69A 4LCLA 4Q8IA 4N1XA 3ICYA 4U0TA 4GZBA 4DF6A 1K56A 2H10A 3LFVA 4JGRA 1ONGA 3F1OB 1VETB 4BWIA 3VP1A 4B9OA 4DXBA 2IWCA 3OOVA 3D72A 2E8IA 3D9YA 4S2LA 4BENA 4O01A 5U47A 5EVID 1MKIA 1MPLA 4FH4A 4UQIM 5TGFA 2OWHA 4JKTA 2EFXA 1S1YA 2X71A 4UQIS 5I5LA 1J3WA 2ZD8A 2G2UA 4XUXA 2HF6A 4Q0HA 4IHQA 3W2ZA 2GJ3A 3C4PA 3IX4A 3ZFZA 3FWLA 2ZJ9A 3VOLA 4N9KA 1S66L 2XEPA 4Y7PA 3PR6A 5HPIA 1F2KA 2QPNA 4KG5A 2NUTC 4O7DA 2GNXA 4HY8A 2O9CA 3LR0A 3DAVA 4UA7A 3S7PA 1L3LA 1ALQA 4HIAA 3LIFA 4X68A 3AGEA 1CEFA 1LL8A 1MWTA 2Y59A 2EX9A 3O87A 2VV7A 2ZC6B 2XF3A 2HGVA 4NK3A 2PYRA 4IBRA 2M7UA 4IUKA 4OQGA 2ZC3B 4JGOA 5FEGA 3M2KA 1KDSA 3U2AA 4HNBA 3ZQ5A 5A90A 3F1PB 2Y2LA 3IS2B 3HJKA 4ESPA 2G2WA 1PI5A 1XP4A 5TJJA 1YLJA 1OTDA 2XR0A 4X1MA 3Q07A 4DDYA 3L7HA 1DP6A 4ETXA 3VE3A 1JWVA 2JKRM 2ZOHA 4R3AA 2XGNA 4JGPA 3JPUA 3T4TA 5L09A 4LENA 4DE2A 2EX8A 4BLMA 4IVKA 1S6RA 2VEAA 5FQQA 4PM7A 1Z6FA 1SHVA 1TEMA 2V8CA 3BFCA 1NRJA 3N8SA 3ISGA 2EFUA 3SS5A 3LIBA 3UE0A 3MF0A 3G2YA 1G6AA 5F83A 1BYWA 5EVLA 3PYPA 2Y2NA 2XLNA 4X1LA 2VGJA 2A49A 3KYZA 1E3UA 2VJWA 3CI6A 1Y4OA 3B3XA 3UDIA 1HZOA 1NZOA 3R7WB 2XRNA 4E6XA 4CLCA 3QNBA 3BFEA 4LRYC 3G34A 3OBFA 4B88A 4MLLA 3FKWA 5HDSA 4GS9A 1MWSA 2JKTI 4HESA 3OZHA 2K7SA 3IX3A 1EROA 1SKOB 3C7UA 5AVFA 3G32A 3L9KA 1IOUA 2LB5A 3GRJA 4E3OA 3CAXA 1BT5A 4OKPA 3KSIA 3SS4A 2XSSA 4KUOA 5EVIC 5HFOA 3WS2A 4AFIA 1CF0A 5EE8A 1LL5A 2ZQCA 1ZG6A 3IBRA 3OPRA 1O07A 3QP4A 4OQHA 5M19A 5E2GA 3CHWP 3KSHA 4DMZA 3W8KA 3BFFA 1YKDA 1EWZA 2OAQ1 3WS1A 3E4PA 1XFNA 3IT9A 3VP4A 1H8ZA 2GX5A 2M1CA 4FUWA 5FQIA 3T1XA 1TS7A 3VE4A 4NETA 5AJGA 1JVJA 1PWCA 4DXCA 4UEYA 1W8QA 4EXOA 3Q1FA 3S22A 2WK0A 1HLUP 3T4LA 2FFFB 4S2JA 2ZMAA 4BL2A 1S67L 2R78A 1A0KA 4QU3A 1VETA 5IHVA 2IWBA 5BOHA 3CUEA 3JYIA 3C30A 4GNUA 3WRZA 4FH2A 4EWFA 3V3SA 3NI9A 3MS6A 3SH9A 3G35A 1W5DA 2J7VA 1T18A 3VSLA 3UPPA 4I3IA 2QZ6A 3LEZA 4WMCD 3IF5A 5HWTA 2LB9A 1NJ4A 4LV0A 4WZ5C 3PBQA 5HL6A 5EUAA 1H5XA 3CPTB 4I38A 4OH0A 1KGEA 1L0FA 4K0WA 1K4FA 4CQHA 1KE0A 4LV1A 4PAUA 3BWLA 5HWVA 3P09A 3T12B 3UB7A 3LR4A 3HREA 4E3NA 3UNWA 3ZGAB 3E0YA 2DNSA 2H28A 4PM9A 1LLBA 5EOOA 1OJGA 3F1PA 3IS2A 1OPXA 4P6BA 4KZ4A 3LO7A 2JBFA 4HBUA 4FOFA 2W3GA 5GHZA 2XD5A 2D01A 4JXSA 1D1JA 4KENB 1DY6A 2JKGA 1S1ZA 3HLEA 1LSXA 5LBRA 4GDNA 2EXAA 3UY6A 1AWIA 3LGOA 5CX7A 4K08A 3RXXA 2V9AA 3HVFA 4X69A 4RA7A 2J3WA 3C38A 2XA7M 2YKHA 3HL9A 3QP1A 3LIAA 1FR6A 2ZOIA 3C4OA 3ZG0A 2XA7S 4X56A 1V9ZA 4EU0A 4IJGA 3PTEA 3UE1A 1MZUA 3DTIA 2K2NA 3C8CA 3G6OA 5CGSA 4PMAA 5FASA 4XUZA 1PFLA 1M6KA 5F1GA 3UB9A 1YQSA 4QHCA 2Y2MA 2RL3A 2JKTM 4GHIB 4E3JA 2Y79A 2WKHA 1BSGA 4JXGA 1BLSA 1PI4A 4ARZB 3R7WA 4K0XA 4Y2FA 3E4OA 3TW8A 3HLCA 4EESA 1N9NA 5EFWA 3IF6C 4WEJA 3OPHA 1K55C 4GDBA 1RP5A 3BJNA 2QJ7A 1TS6A 3MJQA 1LI0A 4GD6A 5J8XA 1KVLA 5HDDA 3UPNA 3V67A 3MBZA 1BZAA 4Y17A 1NY0A 4KZ7A 1UGUA 2Q9MA 5FQJA 5KIZA 2Q9NA 2DRWA 1XKZA 3E98A 1E3UD 3RTYA 1YAXA 4G3VA 1BLPA 3H7WB 1NWZA 1GA9A 2B5RA 3QP8A 4KZ9A 1ONHA 2W3DA 4CLCD 3NDEA 1VQQA 1W8YA 1TDLA 1Y54A 2V20A 3IWIA 5FAQA 5CTNA 4N92A 3ZDJA 4YWZA 4EETB 2V2FF 1Z09A 5G4YA 4P0MA 1CJFA 1PZPA 1SDNA 3IXDA 5CERA 2EWWA 3FPWA 4CLCE 2P04A 5FQMA 3O88A 4YFMA 3UDFA 3EQVA 1PIOA 2ZL1B 4DDSA 1K0KA 2W3HA 5K5BA 1IYOA 4QD4A 2D02A 5CHUA 5F5YA 3VSKA 4G3KA 3ZHHA 4C75A 5CGXA 2A24B 3LUQA 3ZG8B 1XX2A 1DJCA 1K57A 3EGXC 2HDUA 2WGWB 4L9FA 1N9BA 3HLBA 2ACGA 3PBNA 5IS1A 3CPTA 3HLFA 4I5SA 4E3IA 4JLFA 4RYEA 5HW3A 5G18A 2J80A 4BJPA 4MNRA 3VFHA 2ZM8A 1FR1A 4LPZA 1P97A 5CRFA 3LY3A 3HUNA 4B4ZA 3IX8A 1H8MA 2WZZA 2ZC4B 4BL3A 4ZDXA 3MQ0A 3DWKA 3IH8A 1K38A 3O86A 5IT5A 1GSVA 1XPBA 3MSHA 5M18A 1VEUB 3MMHA 4GCZA 1CK3A 4DRTA 4WEKA 4MCWA 3IBJA 2IA2A 3PAGA 4KQDA 5HAIA 2OV5A 3EOIA 1K6SA 3QP2A 4ZJ1A 1S0WA 3K3CA 2M7VA 1IYQA 5AQBA 4S2NC 2WGVA 4CJNA 4NG2A 3BLMA 5JYOA 4OLGA 5I94A 4BD0A 3IXGA 1OJ5A 1FILA 3FKVA 4QWOA 3GECA 3VFFA 5GL9A 1NLYA 1XA7A 3OPPA 5HL1A 4U3TA 3PBRA 5L8MA 3UE6A 2Y2GA 2WAFA 4EUVA 1YSQA 2PT7A 2ZQ7A 1SCWA 4KZ6A 3Q82A 3MZFA 4CLCC 2HZ5A 1ESUA 5EOEA 1PYYA 3ZNTA 5EVIB 3AGDA 3KSGA 4RVAA 2PD8A 1GSXA 2PHYA 3IQAA 1G28A 4MN6A 1N9OA 2Y2JA 5CTMA 1YPRA 3HJIA 3PAEA 5GLCA 3BM6A 2J8YA 1M40A 5CXWA 3SZTA 2EX6A 4KG6A 1K54A 1PZOA 3B47A 2WUQA 2OAP1 3DW0A 4XT2B 1W7FA 4Y5FA 4R23A 2HDRA 3N8LA 4R70A 4L9EA 3S4XA 2WKPA 4BMWA 2JE5A 1YLPA 5M1AA 2ZMVA 4WF0A 1T19A 5HAPA 5F82A 3H7WA 1BUEA 1YLYA 1OT9A 3PBSA 4DE0A 4A5RA 1FSYA 2A2LA 5KSHA 4WZ4A 2V1BA 2VK3A 1NYYA 3BFGA 5EPHA 5A91A 3WS4A 3BQAA 2C6WB 1L0GA 4I3AA 5E2HA 1E25A 4WYYA 3S1YA 3KX0X 1G5UA 3CUEC 1ES5A 4UA6A 1XGIA 1K4EA 4WN5A 5GHXA 3DTEA 5F1FA 2JN7A 3IHBA 2J3TD 2A3UA 2PD7A 1S4SA 2W27A 2HDSA 3T1SA 3LR5A 5HARA 3F1NA 1MXOA 2VGKA 3T1QB 4MBHA 3UO9A 1NZUA 3WS5A 2HP6A 5DF9A 1CEGA 1KVMA 2A24A 4PPRA 2O9AA 4KZ5A 3DWZA 2WADA 4GKUA 3A3EA 1P0ZA 4GOGA 2JCHA 3G30A 1X0OA 1XJ4A 4GD8A 1ACFA 2OSUA 2PR6A 4I39A 3LY4A 5FSRA 2V1ZA 3P7NA 5E2FA 4E04A 3TRCA 1MWRA 3MKFA 1FIKA 4F94A 4IUHA 2RCXA 4OQIA 2JC7A 5C5KA 4OOLA 1KE4A 3UMDA 1TF1A 3VP0A 1E4DA 4JF6A 4JBFA 2B18A 1VEUA 1TDGA 5TFQA 1UWNX 3F1OA 5FI2A 5EVEA 3ZG7B 2V8FA 1YSPA 1F5MA 3WS0A 2B02A 1IKGA 2BLSA 4EV4A 4WLAA
chains in the Genus database with same CATH topology
1PWDA 2OLVA 4HBTA 4P85A 4K0XA 1I2SA 2ZM2A 2P9VA 4QY5A 3HUOA 3HLCA 2X02A 5FQ9A 2ZC7A 4WMCA 2GDNA 3V50A 3IF6C 4WEJA 2FFYA 3OPHA 5EECA 1K55C 4GDBA 1RP5A 4KG2A 4S2NA 4X53A 3MZDA 1QMFA 1SKFA 4DKIA 2Y2HA 1ERMA 1LI0A 4GD6A 1KVLA 2ZQDA 5J8XA 1FCMA 3IF6B 3UPNA 4KQQA 3NCKA 1PW1A 4LCLA 3MBZA 1BZAA 4Q8IA 4N1XA 1U60A 1K56D 4U0TA 4GZBA 4R3BA 1K56A 1NY0A 2H10A 2HP5A 4KZ7A 4DF6A 2Q9MA 5FQJA 2Q9NA 2DRWA 1XKZA 1IEMA 3HLWA 3N4IA 1ONGA 3NBLA 1WYBA 3OCNA 3VP1A 4DXBA 2IWCA 4IEDA 5HAQA 1E3UD 1IYPA 2QMIA 2E8IA 4S2LA 2X01A 4BENA 1BLPA 1FCNA 5U47A 5EVID 1GA9A 1MKIA 2B5RA 2WKIA 3LCEA 1ONHA 4KZ9A 1LL9A 2H5SA 3EQUA 2CC1A 1MPLA 3NDEA 1VQQA 4FH4A 1NXYA 1W8YA 4ZJ3A 5TGFA 4JKTA 2EFXA 3DTMA 1TDLA 2X71A 4E6WA 5L2FA 1FQGA 2C5WB 3A3DA 1GA0A 2ZD8A 1Y54A 1YLTA 2G2UA 4XUXA 3VOZA 2XK1A 1Q2QA 2V20A 1GHMA 1ESIA 3IWIA 4UHUA 5FAQA 1NYMA 1CI8A 3C4PA 5CTNA 3TOIA 1BLHA 3FWLA 3ZFZA 4C3QA 3FYZA 2ZJ9A 4N92A 3ZDJA 2IWDA 3Q81A 5GLDA 2V2FF 1K25A 1ES3A 2WGWA 4N9KA 2XEPA 1ERQA 1YLWA 4P0MA 4FCFA 4FD8A 1PZPA 1AXBA 4Y7PA 1SDNA 3IXDA 3ZNYA 2QPNA 2I72A 4KG5A 5CERA 4S2KA 3M2JA 4O7DA 5CEDA 4XXRA 2EX2A 4Y0OA 5FQMA 3O88A 4OP5A 1LHYA 4UA7A 1ALQA 4YFMA 5DTTA 3UE3A 3UDFA 4X68A 3AGEA 1ZKJA 2R9XA 4WELA 1CEFA 1N4OA 3EQVA 1MWTA 1PIOA 2Y59A 3ITAA 2EX9A 4DDSA 3CMZA 4R0QA 3RJUA 3O87A 3UDXA 4PM8A 2ZC6B 1KGGA 2XF3A 1W79A 3HBRA 4NK3A 1IYOA 4IBRA 1G68A 4MBKA 4OQGA 2ZC3B 4QD4A 5CHUA 2PU2A 3VSKA 3PBTA 3M2KA 1KDSA 3ZHHA 5CHJA 1ZG4A 5A90A 4D2OA 4C75A 2Y2LA 5CGXA 5FI7A 3ZG8B 3A3IA 1XX2A 2G2WA 1PI5A 4PM5A 1XP4A 1DJCA 1K57A 1L0EA 1YLJA 2XR0A 2HDUA 3N6IA 4R4SA 2WGWB 1N9BA 2ZQAA 3HLBA 3Q07A 3MXRA 4DDYA 3W4QA 3PBNA 1TVFA 3HLFA 4ZAMA 4LV2A 3CZDA 2EXBA 4JXWA 4E3IA 4JLFA 4RYEA 5HW3A 5G18A 1JWVA 3OC2A 4WZ5A 2WKEA 4BJPA 2XGNA 4MNRA 3VFHA 5AQ7A 1SDEA 1GHIA 2ZM8A 5FATA 4H8RA 4EUZA 1FR1A 2XFTA 4X6TA 3V5MA 1YT4A 5CRFA 3ZCZA 3BFDA 3CJMA 4LENA 3VP2A 3LY3A 1FCOA 3HUNA 1MY8A 4B4ZA 2WYXA 4DE2A 4S2OA 2EX8A 4BLMA 4S2PA 4IVKA 2WZZA 1VM1A 1S6RA 2H0YA 5KZHA 4C6YA 1IYSA 5FQQA 4OPQA 4KZ8A 2ZC4B 1HTZA 5FI6A 3CG5A 4PM7A 3ZVWA 5CHMA 1Z6FA 1SHVA 4BL3A 4ZDXA 1TEMA 3DWKA 3HUMA 3IH8A 3Q7VB 3BECA 1K38A 4CPKA 1BTLA 3BFCA 4DE1A 3N8SA 3O86A 2ZQ9A 3ISGA 3GQZA 2EFUA 3IXHA 1LI9A 1XPBA 2ZC5B 2DCFA 3GR2A 3ITBA 2J9PA 3SS5A 5M18A 1I2WA 3UE0A 2Y2IA 3G2YA 4UAAA 1G6AA 4FSFA 5F83A 1CK3A 1JTDA 1GHPA 4RX3A 4EBNA 4DRTA 5EVLA 2R9WA 4WEKA 4MBFA 2Y2NA 3PAGA 5HAIA 2OV5A 2XLNA 2VGJA 2A49A 3BYDA 2Y2OA 1E3UA 1K6SA 3HLGA 2Y91A 5KMWA 5FQKA 4OP8A 4ZJ1A 3UDIA 3B3XA 5EVIA 1HZOA 1NZOA 1S0WA 4LCMA 1IYQA 5HX9A 4E6XA 5AQBA 1CI9A 3QNBA 4S2NC 2WGVA 3BFEA 2P9VB 3G34A 4OOYA 1ZC2A 4MEZA 4B88A 4CJNA 5JYPA 4MLLA 3VP3A 3BLMA 4JF5A 4OONA 5TR7A 3FKWA 5JYOA 2XQZA 4OLGA 1C3BA 1DJBA 5I94A 4B4XA 1MWSA 5GLBA 4IBXA 4HESA 4BD0A 3OZHA 3IXGA 3GVBA 1YM1A 3FKVA 4E3LA 3E2KA 3VFFA 1YMXA 1EROA 5GL9A 3C7UA 3W4OA 1XA7A 4KQOA 3G32A 3OPPA 5HL1A 4EBPA 3GRJA 3VMAA 4OPYA 4N1HA 3BLSA 4U3TA 3C7VA 4S2MA 5AQAA 3V3RA 3PBRA 1O7EA 4E3OA 4OKPA 1BT5A 3WRTA 5AQ9A 2Y2GA 4BD1A 3SS4A 2WAFA 3ZG5A 5EVIC 4WM9A 2ZQ7A 5HFOA 3WS2A 1SCWA 4KZ6A 3Q82A 5EE8A 3MZFA 4ZBEA 3TSGA 3A3FA 5EOEA 1ESUA 1DJAA 1LL5A 1HD8A 1PYYA 2ZQCA 4X55A 1ZG6A 3ZNTA 5EVIB 4RX2A 3V39A 3OPLA 1MBLA 1KGFA 1O07A 3OPRA 2Y4AA 3ZVTA 4OQHA 4PM6A 4WBGA 5M19A 3AGDA 4OPRA 4RVAA 2P74A 2XH9A 5E2GA 3G4PA 4KZBA 3IQAA 3ZG9B 3N7WA 3W8KA 3GV9A 1YLZA 4ZJ2A 3BFFA 4OVDA 5DTSA 4KZAA 1EWZA 2ZM0A 3HLDA 4R4RA 3WS1A 4QJGA 2Y2JA 3IT9A 5CTMA 3QNCA 3VP4A 1H8ZA 3NC8A 3PAEA 3SOIA 3Q7ZA 4KZ3A 5GLCA 3BM6A 2J8YA 1M40A 5CXWA 5FQIA 2EX6A 4NETA 4P87A 4ID4A 2WAEA 1JVJA 1PWGA 1PWCA 3M6BA 4DXCA 1W8QA 4KG6A 1K54A 3Q1FA 1PZOA 3G2ZA 4N9LA 2WUQA 5DF8A 3DW0A 3UN7A 3IF6A 3S22A 2WK0A 5DVAA 1K55A 1W7FA 4KQRA 1BULA 2FFFB 4R23A 4S2JA 2Z2LB 2HDRA 3N8LA 3O3VA 2ZMAA 4BL2A 3S4XA 2PBYA 1MWUA 2JE5A 1ES4A 3M6HA 1IELA 1XXMA 5A92A 1YLPA 5M1AA 2XD1A 4QU3A 4R1GA 5IHVA 2IWBA 5BOHA 3JYIA 2WGIA 4GNUA 4Z9QA 4FH2A 3WRZA 2OLUA 2Z2MB 5F82A 4EWFA 5HAPA 3SH8A 5FA7A 3V3SA 3NI9A 3AGFA 3SH9A 3UPOA 1FOFA 3G35A 3QHYA 1W5DA 1WE4A 2J7VA 1BUEA 1K57C 4K91A 3TG9A 3GTCA 1YLYA 3VSLA 1H8YA 3PBSA 4DE0A 3UPPA 3NDGA 3SH7A 4A5RA 3GMWA 2QZ6A 3LEZA 1FSYA 1I5QA 5KSHA 2BG1A 4WMCD 5DF7A 5CGWA 4WZ4A 2Y2KA 1K54C 5DTKA 3IF5A 4JF4A 4HEFA 5GHYA 4R3JA 2J9OA 1NYYA 3VOYA 3BFGA 1NJ4A 5EPHA 4LV0A 3E2LA 4WZ5C 3NY4A 3PBQA 4YINA 2HPBA 2PU4A 2XDMA 1H5XA 5EUAA 5A91A 3WS4A 5FAOA 2C6WB 1L0GA 5E2HA 1J9MA 4UA9A 1E25A 4OH0A 1KGEA 1L0FA 2Y2QA 4WYYA 1RCJA 5E2EA 2Y2PA 4K0WA 4Y0TA 3S1YA 1ES5A 1K4FA 1EI5A 4UA6A 4GB7A 4EQIA 1XGIA 1K4EA 5GHXA 1KE0A 1FSWA 1YMSA 4LV1A 2XFSA 5F1FA 1KE3A 1QMEA 3IHBA 3P09A 3IH9A 4QY6A 5D3OA 2A3UA 2WZXA 4E3KA 3HREA 4E3NA 3UNWA 2HDSA 3IWQA 1NRFA 5HARA 3A3JA 1RGZA 3ZGAB 1MXOA 2DNSA 1HVBA 2VGKA 4PM9A 3I7JA 3IHAA 4M3KA 3WWXA 2ZLYA 1LLBA 4MBHA 5EOOA 1PW8A 3UO9A 1JWZA 4GN2A 4JPMA 1NZUA 4IVIA 3WS5A 2HP6A 3IXBA 5GLAA 3P98A 5DF9A 1CEGA 3RXWA 2UWXA 1KVMA 4PPRA 4P6BA 4KZ4A 3LO7A 2JBFA 4KZ5A 2ZQ8A 4OPZA 3GSGA 4HBUA 5GHZA 3DWZA 2XD5A 2WADA 3MZEA 4GKUA 4JXSA 4KENB 5FAPA 3A3EA 3IWOA 4OQ0A 4GOGA 1DY6A 2JCHA 4EBLA 3G30A 3W4PA 3C5AA 3HLEA 3NIAA 4GDNA 5FDHA 3PBOA 2EXAA 3UY6A 1L0DA 3RXXA 2Y55A 4GD8A 5E43A 2H0TA 2HDQA 1OMEA 3MFDA 4S2IA 3HVFA 4X69A 4RA7A 1IKIA 2OSUA 3FV7A 3HL9A 1XGJA 3FZCA 1FR6A 3LY4A 3C4OA 5FSRA 1WYCA 4X56A 3ZG0A 1L2SA 2V1ZA 3PTEA 3UE1A 3OCLA 4OOMA 5E2FA 1Q2PA 4ZTKA 1MWRA 3MKFA 5KSCA 4F94A 3MXSA 1ES2A 1XA1A 3Q7VA 2RCXA 1JTGA 4OQIA 2JC7A 3G31A 3D4FA 4OOLA 5CGSA 1KE4A 3VP0A 4PMAA 1BLCA 4U0XA 3BRMA 1GCEA 1E4DA 5FASA 3BEBA 4JF6A 4JBFA 4XUZA 4QB8A 4JXVA 1M6KA 5F1GA 4LV3A 4BQMA 1TDGA 1YQSA 4OLDA 5TFQA 5CEBA 5CECA 1JWPA 4QHCA 5FI2A 1K6RA 2Y2MA 2RL3A 3MKEA 4DE3A 3ZG7B 1RGYA 5A93A 1KDWA 2HP9A 4E3JA 3SS3A 3WS0A 4Y0UA 1IKGA 2BLSA 2WKHA 1BSGA 4JXGA 4E3MA 4EV4A 4L0LA 1BLSA 1PI4A 3N8RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PWD A;  2OLV A;  4HBT A;  4P85 A;  4K0X A;  1I2S A;  2ZM2 A;  2P9V A;  4QY5 A;  3HUO A;  3HLC A;  2X02 A;  5FQ9 A;  2ZC7 A;  4WMC A;  2GDN A;  3V50 A;  3IF6 C;  4WEJ A;  2FFY A;  3OPH A;  5EEC A;  1K55 C;  4GDB A;  1RP5 A;  4KG2 A;  4S2N A;  4X53 A;  3MZD A;  1QMF A;  1SKF A;  4DKI A;  2Y2H A;  1ERM A;  1LI0 A;  4GD6 A;  1KVL A;  2ZQD A;  5J8X A;  1FCM A;  3IF6 B;  3UPN A;  4KQQ A;  3NCK A;  1PW1 A;  4LCL A;  3MBZ A;  1BZA A;  4Q8I A;  4N1X A;  1U60 A;  1K56 D;  4U0T A;  4GZB A;  4R3B A;  1K56 A;  1NY0 A;  2H10 A;  2HP5 A;  4KZ7 A;  4DF6 A;  2Q9M A;  5FQJ A;  2Q9N A;  2DRW A;  1XKZ A;  1IEM A;  3HLW A;  3N4I A;  1ONG A;  3NBL A;  1WYB A;  3OCN A;  3VP1 A;  4DXB A;  2IWC A;  4IED A;  5HAQ A;  1E3U D;  1IYP A;  2QMI A;  2E8I A;  4S2L A;  2X01 A;  4BEN A;  1BLP A;  1FCN A;  5U47 A;  5EVI D;  1GA9 A;  1MKI A;  2B5R A;  2WKI A;  3LCE A;  1ONH A;  4KZ9 A;  1LL9 A;  2H5S A;  3EQU A;  2CC1 A;  1MPL A;  3NDE A;  1VQQ A;  4FH4 A;  1NXY A;  1W8Y A;  4ZJ3 A;  5TGF A;  4JKT A;  2EFX A;  3DTM A;  1TDL A;  2X71 A;  4E6W A;  5L2F A;  1FQG A;  2C5W B;  3A3D A;  1GA0 A;  2ZD8 A;  1Y54 A;  1YLT A;  2G2U A;  4XUX A;  3VOZ A;  2XK1 A;  1Q2Q A;  2V20 A;  1GHM A;  1ESI A;  3IWI A;  4UHU A;  5FAQ A;  1NYM A;  1CI8 A;  3C4P A;  5CTN A;  3TOI A;  1BLH A;  3FWL A;  3ZFZ A;  4C3Q A;  3FYZ A;  2ZJ9 A;  4N92 A;  3ZDJ A;  2IWD A;  3Q81 A;  5GLD A;  2V2F F;  1K25 A;  1ES3 A;  2WGW A;  4N9K A;  2XEP A;  1ERQ A;  1YLW A;  4P0M A;  4FCF A;  4FD8 A;  1PZP A;  1AXB A;  4Y7P A;  1SDN A;  3IXD A;  3ZNY A;  2QPN A;  2I72 A;  4KG5 A;  5CER A;  4S2K A;  3M2J A;  4O7D A;  5CED A;  4XXR A;  2EX2 A;  4Y0O A;  5FQM A;  3O88 A;  4OP5 A;  1LHY A;  4UA7 A;  1ALQ A;  4YFM A;  5DTT A;  3UE3 A;  3UDF A;  4X68 A;  3AGE A;  1ZKJ A;  2R9X A;  4WEL A;  1CEF A;  1N4O A;  3EQV A;  1MWT A;  1PIO A;  2Y59 A;  3ITA A;  2EX9 A;  4DDS A;  3CMZ A;  4R0Q A;  3RJU A;  3O87 A;  3UDX A;  4PM8 A;  2ZC6 B;  1KGG A;  2XF3 A;  1W79 A;  3HBR A;  4NK3 A;  1IYO A;  4IBR A;  1G68 A;  4MBK A;  4OQG A;  2ZC3 B;  4QD4 A;  5CHU A;  2PU2 A;  3VSK A;  3PBT A;  3M2K A;  1KDS A;  3ZHH A;  5CHJ A;  1ZG4 A;  5A90 A;  4D2O A;  4C75 A;  2Y2L A;  5CGX A;  5FI7 A;  3ZG8 B;  3A3I A;  1XX2 A;  2G2W A;  1PI5 A;  4PM5 A;  1XP4 A;  1DJC A;  1K57 A;  1L0E A;  1YLJ A;  2XR0 A;  2HDU A;  3N6I A;  4R4S A;  2WGW B;  1N9B A;  2ZQA A;  3HLB A;  3Q07 A;  3MXR A;  4DDY A;  3W4Q A;  3PBN A;  1TVF A;  3HLF A;  4ZAM A;  4LV2 A;  3CZD A;  2EXB A;  4JXW A;  4E3I A;  4JLF A;  4RYE A;  5HW3 A;  5G18 A;  1JWV A;  3OC2 A;  4WZ5 A;  2WKE A;  4BJP A;  2XGN A;  4MNR A;  3VFH A;  5AQ7 A;  1SDE A;  1GHI A;  2ZM8 A;  5FAT A;  4H8R A;  4EUZ A;  1FR1 A;  2XFT A;  4X6T A;  3V5M A;  1YT4 A;  5CRF A;  3ZCZ A;  3BFD A;  3CJM A;  4LEN A;  3VP2 A;  3LY3 A;  1FCO A;  3HUN A;  1MY8 A;  4B4Z A;  2WYX A;  4DE2 A;  4S2O A;  2EX8 A;  4BLM A;  4S2P A;  4IVK A;  2WZZ A;  1VM1 A;  1S6R A;  2H0Y A;  5KZH A;  4C6Y A;  1IYS A;  5FQQ A;  4OPQ A;  4KZ8 A;  2ZC4 B;  1HTZ A;  5FI6 A;  3CG5 A;  4PM7 A;  3ZVW A;  5CHM A;  1Z6F A;  1SHV A;  4BL3 A;  4ZDX A;  1TEM A;  3DWK A;  3HUM A;  3IH8 A;  3Q7V B;  3BEC A;  1K38 A;  4CPK A;  1BTL A;  3BFC A;  4DE1 A;  3N8S A;  3O86 A;  2ZQ9 A;  3ISG A;  3GQZ A;  2EFU A;  3IXH A;  1LI9 A;  1XPB A;  2ZC5 B;  2DCF A;  3GR2 A;  3ITB A;  2J9P A;  3SS5 A;  5M18 A;  1I2W A;  3UE0 A;  2Y2I A;  3G2Y A;  4UAA A;  1G6A A;  4FSF A;  5F83 A;  1CK3 A;  1JTD A;  1GHP A;  4RX3 A;  4EBN A;  4DRT A;  5EVL A;  2R9W A;  4WEK A;  4MBF A;  2Y2N A;  3PAG A;  5HAI A;  2OV5 A;  2XLN A;  2VGJ A;  2A49 A;  3BYD A;  2Y2O A;  1E3U A;  1K6S A;  3HLG A;  2Y91 A;  5KMW A;  5FQK A;  4OP8 A;  4ZJ1 A;  3UDI A;  3B3X A;  5EVI A;  1HZO A;  1NZO A;  1S0W A;  4LCM A;  1IYQ A;  5HX9 A;  4E6X A;  5AQB A;  1CI9 A;  3QNB A;  4S2N C;  2WGV A;  3BFE A;  2P9V B;  3G34 A;  4OOY A;  1ZC2 A;  4MEZ A;  4B88 A;  4CJN A;  5JYP A;  4MLL A;  3VP3 A;  3BLM A;  4JF5 A;  4OON A;  5TR7 A;  3FKW A;  5JYO A;  2XQZ A;  4OLG A;  1C3B A;  1DJB A;  5I94 A;  4B4X A;  1MWS A;  5GLB A;  4IBX A;  4HES A;  4BD0 A;  3OZH A;  3IXG A;  3GVB A;  1YM1 A;  3FKV A;  4E3L A;  3E2K A;  3VFF A;  1YMX A;  1ERO A;  5GL9 A;  3C7U A;  3W4O A;  1XA7 A;  4KQO A;  3G32 A;  3OPP A;  5HL1 A;  4EBP A;  3GRJ A;  3VMA A;  4OPY A;  4N1H A;  3BLS A;  4U3T A;  3C7V A;  4S2M A;  5AQA A;  3V3R A;  3PBR A;  1O7E A;  4E3O A;  4OKP A;  1BT5 A;  3WRT A;  5AQ9 A;  2Y2G A;  4BD1 A;  3SS4 A;  2WAF A;  3ZG5 A;  5EVI C;  4WM9 A;  2ZQ7 A;  5HFO A;  3WS2 A;  1SCW A;  4KZ6 A;  3Q82 A;  5EE8 A;  3MZF A;  4ZBE A;  3TSG A;  3A3F A;  5EOE A;  1ESU A;  1DJA A;  1LL5 A;  1HD8 A;  1PYY A;  2ZQC A;  4X55 A;  1ZG6 A;  3ZNT A;  5EVI B;  4RX2 A;  3V39 A;  3OPL A;  1MBL A;  1KGF A;  1O07 A;  3OPR A;  2Y4A A;  3ZVT A;  4OQH A;  4PM6 A;  4WBG A;  5M19 A;  3AGD A;  4OPR A;  4RVA A;  2P74 A;  2XH9 A;  5E2G A;  3G4P A;  4KZB A;  3IQA A;  3ZG9 B;  3N7W A;  3W8K A;  3GV9 A;  1YLZ A;  4ZJ2 A;  3BFF A;  4OVD A;  5DTS A;  4KZA A;  1EWZ A;  2ZM0 A;  3HLD A;  4R4R A;  3WS1 A;  4QJG A;  2Y2J A;  3IT9 A;  5CTM A;  3QNC A;  3VP4 A;  1H8Z A;  3NC8 A;  3PAE A;  3SOI A;  3Q7Z A;  4KZ3 A;  5GLC A;  3BM6 A;  2J8Y A;  1M40 A;  5CXW A;  5FQI A;  2EX6 A;  4NET A;  4P87 A;  4ID4 A;  2WAE A;  1JVJ A;  1PWG A;  1PWC A;  3M6B A;  4DXC A;  1W8Q A;  4KG6 A;  1K54 A;  3Q1F A;  1PZO A;  3G2Z A;  4N9L A;  2WUQ A;  5DF8 A;  3DW0 A;  3UN7 A;  3IF6 A;  3S22 A;  2WK0 A;  5DVA A;  1K55 A;  1W7F A;  4KQR A;  1BUL A;  2FFF B;  4R23 A;  4S2J A;  2Z2L B;  2HDR A;  3N8L A;  3O3V A;  2ZMA A;  4BL2 A;  3S4X A;  2PBY A;  1MWU A;  2JE5 A;  1ES4 A;  3M6H A;  1IEL A;  1XXM A;  5A92 A;  1YLP A;  5M1A A;  2XD1 A;  4QU3 A;  4R1G A;  5IHV A;  2IWB A;  5BOH A;  3JYI A;  2WGI A;  4GNU A;  4Z9Q A;  4FH2 A;  3WRZ A;  2OLU A;  2Z2M B;  5F82 A;  4EWF A;  5HAP A;  3SH8 A;  5FA7 A;  3V3S A;  3NI9 A;  3AGF A;  3SH9 A;  3UPO A;  1FOF A;  3G35 A;  3QHY A;  1W5D A;  1WE4 A;  2J7V A;  1BUE A;  1K57 C;  4K91 A;  3TG9 A;  3GTC A;  1YLY A;  3VSL A;  1H8Y A;  3PBS A;  4DE0 A;  3UPP A;  3NDG A;  3SH7 A;  4A5R A;  3GMW A;  2QZ6 A;  3LEZ A;  1FSY A;  1I5Q A;  5KSH A;  2BG1 A;  4WMC D;  5DF7 A;  5CGW A;  4WZ4 A;  2Y2K A;  1K54 C;  5DTK A;  3IF5 A;  4JF4 A;  4HEF A;  5GHY A;  4R3J A;  2J9O A;  1NYY A;  3VOY A;  3BFG A;  1NJ4 A;  5EPH A;  4LV0 A;  3E2L A;  4WZ5 C;  3NY4 A;  3PBQ A;  4YIN A;  2HPB A;  2PU4 A;  2XDM A;  1H5X A;  5EUA A;  5A91 A;  3WS4 A;  5FAO A;  2C6W B;  1L0G A;  5E2H A;  1J9M A;  4UA9 A;  1E25 A;  4OH0 A;  1KGE A;  1L0F A;  2Y2Q A;  4WYY A;  1RCJ A;  5E2E A;  2Y2P A;  4K0W A;  4Y0T A;  3S1Y A;  1ES5 A;  1K4F A;  1EI5 A;  4UA6 A;  4GB7 A;  4EQI A;  1XGI A;  1K4E A;  5GHX A;  1KE0 A;  1FSW A;  1YMS A;  4LV1 A;  2XFS A;  5F1F A;  1KE3 A;  1QME A;  3IHB A;  3P09 A;  3IH9 A;  4QY6 A;  5D3O A;  2A3U A;  2WZX A;  4E3K A;  3HRE A;  4E3N A;  3UNW A;  2HDS A;  3IWQ A;  1NRF A;  5HAR A;  3A3J A;  1RGZ A;  3ZGA B;  1MXO A;  2DNS A;  1HVB A;  2VGK A;  4PM9 A;  3I7J A;  3IHA A;  4M3K A;  3WWX A;  2ZLY A;  1LLB A;  4MBH A;  5EOO A;  1PW8 A;  3UO9 A;  1JWZ A;  4GN2 A;  4JPM A;  1NZU A;  4IVI A;  3WS5 A;  2HP6 A;  3IXB A;  5GLA A;  3P98 A;  5DF9 A;  1CEG A;  3RXW A;  2UWX A;  1KVM A;  4PPR A;  4P6B A;  4KZ4 A;  3LO7 A;  2JBF A;  4KZ5 A;  2ZQ8 A;  4OPZ A;  3GSG A;  4HBU A;  5GHZ A;  3DWZ A;  2XD5 A;  2WAD A;  3MZE A;  4GKU A;  4JXS A;  4KEN B;  5FAP A;  3A3E A;  3IWO A;  4OQ0 A;  4GOG A;  1DY6 A;  2JCH A;  4EBL A;  3G30 A;  3W4P A;  3C5A A;  3HLE A;  3NIA A;  4GDN A;  5FDH A;  3PBO A;  2EXA A;  3UY6 A;  1L0D A;  3RXX A;  2Y55 A;  4GD8 A;  5E43 A;  2H0T A;  2HDQ A;  1OME A;  3MFD A;  4S2I A;  3HVF A;  4X69 A;  4RA7 A;  1IKI A;  2OSU A;  3FV7 A;  3HL9 A;  1XGJ A;  3FZC A;  1FR6 A;  3LY4 A;  3C4O A;  5FSR A;  1WYC A;  4X56 A;  3ZG0 A;  1L2S A;  2V1Z A;  3PTE A;  3UE1 A;  3OCL A;  4OOM A;  5E2F A;  1Q2P A;  4ZTK A;  1MWR A;  3MKF A;  5KSC A;  4F94 A;  3MXS A;  1ES2 A;  1XA1 A;  3Q7V A;  2RCX A;  1JTG A;  4OQI A;  2JC7 A;  3G31 A;  3D4F A;  4OOL A;  5CGS A;  1KE4 A;  3VP0 A;  4PMA A;  1BLC A;  4U0X A;  3BRM A;  1GCE A;  1E4D A;  5FAS A;  3BEB A;  4JF6 A;  4JBF A;  4XUZ A;  4QB8 A;  4JXV A;  1M6K A;  5F1G A;  4LV3 A;  4BQM A;  1TDG A;  1YQS A;  4OLD A;  5TFQ A;  5CEB A;  5CEC A;  1JWP A;  4QHC A;  5FI2 A;  1K6R A;  2Y2M A;  2RL3 A;  3MKE A;  4DE3 A;  3ZG7 B;  1RGY A;  5A93 A;  1KDW A;  2HP9 A;  4E3J A;  3SS3 A;  3WS0 A;  4Y0U A;  1IKG A;  2BLS A;  2WKH A;  1BSG A;  4JXG A;  4E3M A;  4EV4 A;  4L0L A;  1BLS A;  1PI4 A;  3N8R A; 
#chains in the Genus database with same CATH topology
 1PRQ A;  2VZW A;  3LIE A;  2X02 A;  5FQ9 A;  4LGW A;  2L4R A;  1OTE A;  1DRM A;  2Y2H A;  1ERM A;  3IF6 B;  4KQQ A;  3NCK A;  1PW1 A;  3RH8 B;  5HD5 A;  1K56 D;  3S7Q A;  4R3B A;  2HP5 A;  4B93 A;  1DP9 A;  3HLW A;  1WYB A;  5HAQ A;  1IYP A;  2X01 A;  1FCN A;  5A8B A;  3NEC A;  1LL9 A;  2H5S A;  3MFX A;  3FG8 A;  4MDZ A;  3DTM A;  2EWV A;  4E6W A;  1FQG A;  2C5W B;  4QPR A;  1TD5 A;  4EER A;  1YLT A;  3VOZ A;  4FTX A;  1NYM A;  1ODV A;  2IWD A;  5GLD A;  3ULF A;  2PYP A;  1YLW A;  4FCF A;  4FD8 A;  5J3W A;  1AXB A;  2W3E A;  3M2J A;  5CED A;  2EX2 A;  1Y28 A;  3TJZ C;  2J3T C;  2PBD P;  4OP5 A;  1LHY A;  4XT2 A;  2QJ5 A;  3UE3 A;  3LI9 A;  2R9X A;  3CWF A;  1N4O A;  3H9W A;  3ITA A;  3CMZ A;  3LIC A;  3UDX A;  5TBM B;  1KGG A;  1W79 A;  1P9W A;  5FL3 A;  3BY8 A;  1G68 A;  3BW6 A;  4MBK A;  4G3W A;  4LRZ E;  5CHJ A;  4H6J B;  5HWW A;  3MQO A;  3A3I A;  3LID A;  4PM5 A;  1L0E A;  5L07 A;  1TS8 A;  1TVF A;  4NXG A;  3CZD A;  4HH3 A;  3LEQ A;  3OC2 A;  4WZ5 A;  5FAT A;  4X6T A;  1YT4 A;  3ZCZ A;  3BFD A;  3CJM A;  1FCO A;  1MY8 A;  2WYX A;  4S2O A;  5DKL A;  4S2P A;  5KZH A;  4KZ8 A;  1HTZ A;  4PKY G;  3CG5 A;  5CHM A;  3Q7V B;  2PR5 A;  3HUM A;  3BEC A;  2OOL A;  1BTL A;  2ZQ9 A;  3GQZ A;  2INW A;  3IXH A;  1SKO A;  1LI9 A;  2DCF A;  2QYB A;  5FDS A;  2Y2I A;  3T1R A;  4Y15 A;  3H82 B;  4LLO B;  4RX3 A;  3C2W A;  4EBN A;  5J4E A;  2R9W A;  4L9G A;  4MBF A;  1KOU A;  5IU1 A;  2Y2O A;  2Y91 A;  4D60 A;  4OP8 A;  3VV4 A;  1OT6 A;  2VV6 A;  3EWK A;  4F3L B;  3DBA A;  2P9V B;  2UV0 E;  4OOY A;  1ZC2 A;  5DFX A;  5JYP A;  4OON A;  2VA0 A;  2QKP A;  4NKP A;  4B4X A;  5GLB A;  4IBX A;  4O8G A;  1YM1 A;  3LI8 A;  3E2K A;  1YMX A;  3W4O A;  3EEH A;  3VMA A;  4OPY A;  4N1H A;  5AQA A;  1O7E A;  5AQ9 A;  4HP4 A;  1D06 A;  3HCY A;  4EEU A;  3TSG A;  3NOU C;  1DJA A;  4X55 A;  4RX2 A;  2O9B A;  3KSF A;  1MBL A;  4PKY A;  4CLC B;  4OPR A;  3ZG9 B;  3N7W A;  5DTS A;  4KZA A;  2ZM0 A;  3MQQ A;  3NC8 A;  4KUK A;  1JNU A;  2VGL M;  3M6B A;  4PHT A;  2VGL S;  3K3D A;  3IF6 A;  4MN5 A;  2BAS A;  1K55 A;  4KQR A;  1BUL A;  1TS0 A;  2Z2L B;  2BTF P;  3O3V A;  5EM0 A;  1F9I A;  1MWU A;  1ES4 A;  3M6H A;  2P08 A;  4R1G A;  3RFB A;  3LYX A;  2V1A A;  2OLU A;  3SH8 A;  3AGF A;  3UME A;  5DFY A;  3UPO A;  1FOF A;  1WE4 A;  2OWJ A;  3PXP A;  4K91 A;  3TG9 A;  1WA9 A;  1H8Y A;  3NDG A;  4Y3I A;  3GMW A;  1I5Q A;  2GZA A;  1UWP X;  1K54 C;  2Z6C A;  4HEF A;  4R3J A;  2J9O A;  1DP8 A;  3VOY A;  4YIN A;  1F98 A;  2XDM A;  3S7O A;  2YKF A;  3OLO A;  1MKM A;  1RCJ A;  5E2E A;  3FPV A;  4Y0T A;  1EI5 A;  1W63 Q;  3ZYT A;  1MC0 A;  3EGD C;  3BQ8 A;  2EA9 A;  3IH9 A;  5D3O A;  2WZX A;  4E3K A;  3T4Q A;  3T4S A;  3JVU A;  4DN0 A;  3IWQ A;  1NRF A;  3A3J A;  1RGZ A;  5TBM A;  2B95 A;  2VV8 A;  1S4R A;  1XJ6 A;  3I7J A;  4M3K A;  4Q0J A;  1PW8 A;  4GN2 A;  3IXB A;  4H6J A;  4BBV A;  5HPF A;  3RXW A;  3P98 A;  1OTA A;  4OPZ A;  2ZQ8 A;  2QWS A;  2JKF A;  3MZE A;  5FAP A;  4YNR A;  4OQ0 A;  4LRX C;  4EBL A;  3LR3 A;  3W4P A;  3NHQ A;  3T4K A;  3C5A A;  3NIA A;  1L0D A;  4GHI A;  5E43 A;  5HD3 A;  2HDQ A;  1OME A;  4S2I A;  1IKI A;  3TE8 A;  3FV7 A;  1T1C A;  4ARZ A;  1XGJ A;  1ZTU A;  2KLI A;  2ZBB A;  1T1A A;  3S7N A;  5DJU A;  4DJ3 A;  4OOM A;  1Q2P A;  5MC7 A;  4ZTK A;  5KSC A;  3MXS A;  3Q7V A;  4M4X A;  3D4F A;  1BLC A;  1IFQ A;  3BRM A;  1GCE A;  3BEB A;  4JXV A;  5EV0 A;  3H82 A;  5CEB A;  5G4Z A;  1JWP A;  5FEF A;  4R38 A;  1K6R A;  2WKQ A;  4Y13 A;  4HOI A;  5A93 A;  2HP9 A;  3SS3 A;  4L0L A;  4F3L A;  4GW9 A;  2ZM2 A;  2P9V A;  3KYQ A;  3HUO A;  4GJ4 A;  3V50 A;  2FFY A;  3D3O A;  4S2N A;  4X53 A;  1QMF A;  1SKF A;  1P9R A;  2O99 A;  2ZQD A;  1VHM A;  1U60 A;  4Z1W A;  2W1T B;  2CMN A;  3PHY A;  4NXB A;  4X25 A;  1D7E A;  1IEM A;  3N4I A;  3NBL A;  3OCN A;  4IED A;  2QMI A;  1LT0 A;  2ZL1 A;  3LCE A;  2WKI A;  4P6Z M;  3EQU A;  2CC1 A;  5F6A A;  2O0Y A;  1NXY A;  2G7U A;  4ZJ3 A;  4P6Z S;  1ZHH B;  5L2F A;  3A3D A;  1OTB A;  1GA0 A;  3NUL A;  5J7E A;  2HV1 A;  2XK1 A;  1Q2Q A;  1GHM A;  1ESI A;  4UHU A;  3TOI A;  1CI8 A;  1BLH A;  4C3Q A;  3FYZ A;  3Q81 A;  1K25 A;  1ES3 A;  2WGW A;  4E3L A;  1ERQ A;  3ZNY A;  2I72 A;  4S2K A;  3P01 A;  3SW1 A;  3NOT C;  4XXR A;  2MJ6 A;  2KX6 A;  4Y0O A;  3UB8 A;  3NJA A;  2V0W A;  5DTT A;  1ZKJ A;  2JHE A;  4WEL A;  4R0Q A;  3RJU A;  4PM8 A;  4HQA A;  3HBR A;  1V9Y A;  4NXE A;  2W3F A;  2PU2 A;  3PBT A;  1ZG4 A;  4D2O A;  5FI7 A;  3FC7 A;  3E4Q A;  2FZ0 A;  3QP6 A;  1XJ2 A;  4ETZ A;  3N6I A;  4R4S A;  2Y8H A;  2ZQA A;  3MXR A;  3W4Q A;  4WL9 A;  2WKR A;  4ZAM A;  4LV2 A;  2EXB A;  4JXW A;  5F68 A;  4HJ4 A;  2WKE A;  3B33 A;  4YOF A;  5AQ7 A;  1SDE A;  1GHI A;  4EUZ A;  4H8R A;  2XFT A;  3V5M A;  3VP2 A;  4MN7 A;  1VM1 A;  2H0Y A;  4C6Y A;  1IYS A;  4OPQ A;  5FI6 A;  3ZVW A;  5EM1 A;  1N9L A;  4CPK A;  4DE1 A;  3UB5 P;  2ZC5 B;  3GR2 A;  3ITB A;  2J9P A;  1I2W A;  4RQ9 A;  4ZRR A;  4UAA A;  4FSF A;  1JTD A;  1GHP A;  2W1R A;  3BYD A;  3HLG A;  1SZV A;  5KMW A;  5FQK A;  1STZ A;  4BBU A;  1GSW A;  5EVI A;  2VX8 A;  2NUP C;  4LCM A;  5HX9 A;  4EW7 A;  1CI9 A;  4MEZ A;  3MR0 A;  2W0N A;  2ZMF A;  3VP3 A;  2P7J A;  4JF5 A;  5TR7 A;  2XQZ A;  1EW0 A;  1C3B A;  1DJB A;  2HJ9 C;  2L0W A;  3GVB A;  4KQO A;  4II7 A;  2FH5 A;  3T4J A;  4EBP A;  3BLS A;  3C7V A;  4S2M A;  3V3R A;  4O0P A;  3WRT A;  4BD1 A;  3ZG5 A;  4WM9 A;  1CQA A;  4ZBE A;  3A3F A;  1HD8 A;  3O5Y A;  2E8J A;  3A0S A;  3OPL A;  3V39 A;  1KGF A;  2Y4A A;  3ZVT A;  4PM6 A;  3A0R A;  4WBG A;  4HP9 A;  1H3Q A;  2P74 A;  2XH9 A;  5AVE A;  3G4P A;  4KZB A;  3GV9 A;  1YLZ A;  4ZJ2 A;  1XFQ A;  3JVV A;  3KO6 A;  4OVD A;  4R4R A;  3HLD A;  4QJG A;  2Q0O A;  3QNC A;  4LFU A;  3SOI A;  3Q7Z A;  4KZ3 A;  4P87 A;  4ID4 A;  2WAE A;  1PWG A;  3EEA A;  2Z6D A;  5L10 A;  3G2Z A;  5HDC A;  2DMW A;  4N9L A;  5DF8 A;  3UN7 A;  2L1M A;  4EQ1 A;  5DVA A;  2W1T A;  2PBY A;  1IEL A;  1XXM A;  5A92 A;  4HHD A;  2XD1 A;  4JGQ A;  1W63 M;  2V0U A;  4DJ2 A;  4Z9Q A;  2WGI A;  4R6L A;  2QHK A;  2Z2M B;  4BBT A;  2PAV P;  5FA7 A;  3QHY A;  1K57 C;  4MMN A;  3GTC A;  4HJ6 A;  2KOI A;  3SH7 A;  3U4L P;  2BG1 A;  5DF7 A;  5CGW A;  2Y2K A;  5DTK A;  4JF4 A;  5GHY A;  4GLQ A;  3CIT A;  3DTK A;  3E2L A;  3NY4 A;  2HPB A;  2PU4 A;  5FAO A;  3CLO A;  1J9M A;  4UA9 A;  2VKS A;  2Y2Q A;  2PDR A;  2Y2P A;  2I9V A;  3T50 A;  3NOP C;  3MXQ A;  2XRO A;  4GB7 A;  4EQI A;  1FSW A;  1YMS A;  2XFS A;  1LSV A;  3K2N A;  1KE3 A;  1QME A;  5DKK A;  4QY6 A;  4EEP A;  3R4K A;  4Q0I A;  1HVB A;  2JKR I;  4NEE D;  3WWX A;  3IHA A;  2ZLY A;  1H0M A;  1JWZ A;  4JPM A;  4IVI A;  3A0V A;  3T4O A;  5GLA A;  2UWX A;  3KYE A;  5HSQ A;  3GSG A;  1G6O A;  3B42 A;  2AVX A;  3IWO A;  2VLG A;  4I3J A;  1OTI A;  1LSW A;  5FDH A;  3PBO A;  2Y55 A;  2H0T A;  3BY9 A;  3MFD A;  2K31 A;  3FZC A;  4GS9 B;  2HJE A;  1WYC A;  3QP5 A;  1L2S A;  5HZH A;  3F1N B;  3OCL A;  1ES2 A;  1XA1 A;  1JTG A;  4ME4 A;  2PRF A;  3G31 A;  4U0X A;  1PNE A;  4QB8 A;  4LV3 A;  4BQM A;  4OLD A;  5CEC A;  4NXF A;  3MKE A;  4DE3 A;  1RGY A;  1KDW A;  2KDK A;  1NLZ A;  4Y0U A;  4HI4 A;  3UB6 A;  4E3M A;  3N8R A;  4WUJ A;  1PWD A;  1VB6 A;  2OLV A;  4HBT A;  4P85 A;  4HH2 A;  1I2S A;  3GDI A;  4QY5 A;  2ZC7 A;  4WMC A;  2GDN A;  5EEC A;  1T1B A;  4KG2 A;  3MZD A;  4DKI A;  1FCM A;  5DJT A;  4HJ3 A;  1XJ3 A;  5F69 A;  4LCL A;  4Q8I A;  4N1X A;  3ICY A;  4U0T A;  4GZB A;  4DF6 A;  1K56 A;  2H10 A;  3LFV A;  4JGR A;  1ONG A;  3F1O B;  1VET B;  4BWI A;  3VP1 A;  4B9O A;  4DXB A;  2IWC A;  3OOV A;  3D72 A;  2E8I A;  3D9Y A;  4S2L A;  4BEN A;  4O01 A;  5U47 A;  5EVI D;  1MKI A;  1MPL A;  4FH4 A;  4UQI M;  5TGF A;  2OWH A;  4JKT A;  2EFX A;  1S1Y A;  2X71 A;  4UQI S;  5I5L A;  1J3W A;  2ZD8 A;  2G2U A;  4XUX A;  2HF6 A;  4Q0H A;  4IHQ A;  3W2Z A;  2GJ3 A;  3C4P A;  3IX4 A;  3ZFZ A;  3FWL A;  2ZJ9 A;  3VOL A;  4N9K A;  1S66 L;  2XEP A;  4Y7P A;  3PR6 A;  5HPI A;  1F2K A;  2QPN A;  4KG5 A;  2NUT C;  4O7D A;  2GNX A;  4HY8 A;  2O9C A;  3LR0 A;  3DAV A;  4UA7 A;  3S7P A;  1L3L A;  1ALQ A;  4HIA A;  3LIF A;  4X68 A;  3AGE A;  1CEF A;  1LL8 A;  1MWT A;  2Y59 A;  2EX9 A;  3O87 A;  2VV7 A;  2ZC6 B;  2XF3 A;  2HGV A;  4NK3 A;  2PYR A;  4IBR A;  2M7U A;  4IUK A;  4OQG A;  2ZC3 B;  4JGO A;  5FEG A;  3M2K A;  1KDS A;  3U2A A;  4HNB A;  3ZQ5 A;  5A90 A;  3F1P B;  2Y2L A;  3IS2 B;  3HJK A;  4ESP A;  2G2W A;  1PI5 A;  1XP4 A;  5TJJ A;  1YLJ A;  1OTD A;  2XR0 A;  4X1M A;  3Q07 A;  4DDY A;  3L7H A;  1DP6 A;  4ETX A;  3VE3 A;  1JWV A;  2JKR M;  2ZOH A;  4R3A A;  2XGN A;  4JGP A;  3JPU A;  3T4T A;  5L09 A;  4LEN A;  4DE2 A;  2EX8 A;  4BLM A;  4IVK A;  1S6R A;  2VEA A;  5FQQ A;  4PM7 A;  1Z6F A;  1SHV A;  1TEM A;  2V8C A;  3BFC A;  1NRJ A;  3N8S A;  3ISG A;  2EFU A;  3SS5 A;  3LIB A;  3UE0 A;  3MF0 A;  3G2Y A;  1G6A A;  5F83 A;  1BYW A;  5EVL A;  3PYP A;  2Y2N A;  2XLN A;  4X1L A;  2VGJ A;  2A49 A;  3KYZ A;  1E3U A;  2VJW A;  3CI6 A;  1Y4O A;  3B3X A;  3UDI A;  1HZO A;  1NZO A;  3R7W B;  2XRN A;  4E6X A;  4CLC A;  3QNB A;  3BFE A;  4LRY C;  3G34 A;  3OBF A;  4B88 A;  4MLL A;  3FKW A;  5HDS A;  4GS9 A;  1MWS A;  2JKT I;  4HES A;  3OZH A;  2K7S A;  3IX3 A;  1ERO A;  1SKO B;  3C7U A;  5AVF A;  3G32 A;  3L9K A;  1IOU A;  2LB5 A;  3GRJ A;  4E3O A;  3CAX A;  1BT5 A;  4OKP A;  3KSI A;  3SS4 A;  2XSS A;  4KUO A;  5EVI C;  5HFO A;  3WS2 A;  4AFI A;  1CF0 A;  5EE8 A;  1LL5 A;  2ZQC A;  1ZG6 A;  3IBR A;  3OPR A;  1O07 A;  3QP4 A;  4OQH A;  5M19 A;  5E2G A;  3CHW P;  3KSH A;  4DMZ A;  3W8K A;  3BFF A;  1YKD A;  1EWZ A;  2OAQ 1;  3WS1 A;  3E4P A;  1XFN A;  3IT9 A;  3VP4 A;  1H8Z A;  2GX5 A;  2M1C A;  4FUW A;  5FQI A;  3T1X A;  1TS7 A;  3VE4 A;  4NET A;  5AJG A;  1JVJ A;  1PWC A;  4DXC A;  4UEY A;  1W8Q A;  4EXO A;  3Q1F A;  3S22 A;  2WK0 A;  1HLU P;  3T4L A;  2FFF B;  4S2J A;  2ZMA A;  4BL2 A;  1S67 L;  2R78 A;  1A0K A;  4QU3 A;  1VET A;  5IHV A;  2IWB A;  5BOH A;  3CUE A;  3JYI A;  3C30 A;  4GNU A;  3WRZ A;  4FH2 A;  4EWF A;  3V3S A;  3NI9 A;  3MS6 A;  3SH9 A;  3G35 A;  1W5D A;  2J7V A;  1T18 A;  3VSL A;  3UPP A;  4I3I A;  2QZ6 A;  3LEZ A;  4WMC D;  3IF5 A;  5HWT A;  2LB9 A;  1NJ4 A;  4LV0 A;  4WZ5 C;  3PBQ A;  5HL6 A;  5EUA A;  1H5X A;  3CPT B;  4I38 A;  4OH0 A;  1KGE A;  1L0F A;  4K0W A;  1K4F A;  4CQH A;  1KE0 A;  4LV1 A;  4PAU A;  3BWL A;  5HWV A;  3P09 A;  3T12 B;  3UB7 A;  3LR4 A;  3HRE A;  4E3N A;  3UNW A;  3ZGA B;  3E0Y A;  2DNS A;  2H28 A;  4PM9 A;  1LLB A;  5EOO A;  1OJG A;  3F1P A;  3IS2 A;  1OPX A;  4P6B A;  4KZ4 A;  3LO7 A;  2JBF A;  4HBU A;  4FOF A;  2W3G A;  5GHZ A;  2XD5 A;  2D01 A;  4JXS A;  1D1J A;  4KEN B;  1DY6 A;  2JKG A;  1S1Z A;  3HLE A;  1LSX A;  5LBR A;  4GDN A;  2EXA A;  3UY6 A;  1AWI A;  3LGO A;  5CX7 A;  4K08 A;  3RXX A;  2V9A A;  3HVF A;  4X69 A;  4RA7 A;  2J3W A;  3C38 A;  2XA7 M;  2YKH A;  3HL9 A;  3QP1 A;  3LIA A;  1FR6 A;  2ZOI A;  3C4O A;  3ZG0 A;  2XA7 S;  4X56 A;  1V9Z A;  4EU0 A;  4IJG A;  3PTE A;  3UE1 A;  1MZU A;  3DTI A;  2K2N A;  3C8C A;  3G6O A;  5CGS A;  4PMA A;  5FAS A;  4XUZ A;  1PFL A;  1M6K A;  5F1G A;  3UB9 A;  1YQS A;  4QHC A;  2Y2M A;  2RL3 A;  2JKT M;  4GHI B;  4E3J A;  2Y79 A;  2WKH A;  1BSG A;  4JXG A;  1BLS A;  1PI4 A;  4ARZ B;  3R7W A;  4K0X A;  4Y2F A;  3E4O A;  3TW8 A;  3HLC A;  4EES A;  1N9N A;  5EFW A;  3IF6 C;  4WEJ A;  3OPH A;  1K55 C;  4GDB A;  1RP5 A;  3BJN A;  2QJ7 A;  1TS6 A;  3MJQ A;  1LI0 A;  4GD6 A;  5J8X A;  1KVL A;  5HDD A;  3UPN A;  3V67 A;  3MBZ A;  1BZA A;  4Y17 A;  1NY0 A;  4KZ7 A;  1UGU A;  2Q9M A;  5FQJ A;  5KIZ A;  2Q9N A;  2DRW A;  1XKZ A;  3E98 A;  1E3U D;  3RTY A;  1YAX A;  4G3V A;  1BLP A;  3H7W B;  1NWZ A;  1GA9 A;  2B5R A;  3QP8 A;  4KZ9 A;  1ONH A;  2W3D A;  4CLC D;  3NDE A;  1VQQ A;  1W8Y A;  1TDL A;  1Y54 A;  2V20 A;  3IWI A;  5FAQ A;  5CTN A;  4N92 A;  3ZDJ A;  4YWZ A;  4EET B;  2V2F F;  1Z09 A;  5G4Y A;  4P0M A;  1CJF A;  1PZP A;  1SDN A;  3IXD A;  5CER A;  2EWW A;  3FPW A;  4CLC E;  2P04 A;  5FQM A;  3O88 A;  4YFM A;  3UDF A;  3EQV A;  1PIO A;  2ZL1 B;  4DDS A;  1K0K A;  2W3H A;  5K5B A;  1IYO A;  4QD4 A;  2D02 A;  5CHU A;  5F5Y A;  3VSK A;  4G3K A;  3ZHH A;  4C75 A;  5CGX A;  2A24 B;  3LUQ A;  3ZG8 B;  1XX2 A;  1DJC A;  1K57 A;  3EGX C;  2HDU A;  2WGW B;  4L9F A;  1N9B A;  3HLB A;  2ACG A;  3PBN A;  5IS1 A;  3CPT A;  3HLF A;  4I5S A;  4E3I A;  4JLF A;  4RYE A;  5HW3 A;  5G18 A;  2J80 A;  4BJP A;  4MNR A;  3VFH A;  2ZM8 A;  1FR1 A;  4LPZ A;  1P97 A;  5CRF A;  3LY3 A;  3HUN A;  4B4Z A;  3IX8 A;  1H8M A;  2WZZ A;  2ZC4 B;  4BL3 A;  4ZDX A;  3MQ0 A;  3DWK A;  3IH8 A;  1K38 A;  3O86 A;  5IT5 A;  1GSV A;  1XPB A;  3MSH A;  5M18 A;  1VEU B;  3MMH A;  4GCZ A;  1CK3 A;  4DRT A;  4WEK A;  4MCW A;  3IBJ A;  2IA2 A;  3PAG A;  4KQD A;  5HAI A;  2OV5 A;  3EOI A;  1K6S A;  3QP2 A;  4ZJ1 A;  1S0W A;  3K3C A;  2M7V A;  1IYQ A;  5AQB A;  4S2N C;  2WGV A;  4CJN A;  4NG2 A;  3BLM A;  5JYO A;  4OLG A;  5I94 A;  4BD0 A;  3IXG A;  1OJ5 A;  1FIL A;  3FKV A;  4QWO A;  3GEC A;  3VFF A;  5GL9 A;  1NLY A;  1XA7 A;  3OPP A;  5HL1 A;  4U3T A;  3PBR A;  5L8M A;  3UE6 A;  2Y2G A;  2WAF A;  4EUV A;  1YSQ A;  2PT7 A;  2ZQ7 A;  1SCW A;  4KZ6 A;  3Q82 A;  3MZF A;  4CLC C;  2HZ5 A;  1ESU A;  5EOE A;  1PYY A;  3ZNT A;  5EVI B;  3AGD A;  3KSG A;  4RVA A;  2PD8 A;  1GSX A;  2PHY A;  3IQA A;  1G28 A;  4MN6 A;  1N9O A;  2Y2J A;  5CTM A;  1YPR A;  3HJI A;  3PAE A;  5GLC A;  3BM6 A;  2J8Y A;  1M40 A;  5CXW A;  3SZT A;  2EX6 A;  4KG6 A;  1K54 A;  1PZO A;  3B47 A;  2WUQ A;  2OAP 1;  3DW0 A;  4XT2 B;  1W7F A;  4Y5F A;  4R23 A;  2HDR A;  3N8L A;  4R70 A;  4L9E A;  3S4X A;  2WKP A;  4BMW A;  2JE5 A;  1YLP A;  5M1A A;  2ZMV A;  4WF0 A;  1T19 A;  5HAP A;  5F82 A;  3H7W A;  1BUE A;  1YLY A;  1OT9 A;  3PBS A;  4DE0 A;  4A5R A;  1FSY A;  2A2L A;  5KSH A;  4WZ4 A;  2V1B A;  2VK3 A;  1NYY A;  3BFG A;  5EPH A;  5A91 A;  3WS4 A;  3BQA A;  2C6W B;  1L0G A;  4I3A A;  5E2H A;  1E25 A;  4WYY A;  3S1Y A;  3KX0 X;  1G5U A;  3CUE C;  1ES5 A;  4UA6 A;  1XGI A;  1K4E A;  4WN5 A;  5GHX A;  3DTE A;  5F1F A;  2JN7 A;  3IHB A;  2J3T D;  2A3U A;  2PD7 A;  1S4S A;  2W27 A;  2HDS A;  3T1S A;  3LR5 A;  5HAR A;  3F1N A;  1MXO A;  2VGK A;  3T1Q B;  4MBH A;  3UO9 A;  1NZU A;  3WS5 A;  2HP6 A;  5DF9 A;  1CEG A;  1KVM A;  2A24 A;  4PPR A;  2O9A A;  4KZ5 A;  3DWZ A;  2WAD A;  4GKU A;  3A3E A;  1P0Z A;  4GOG A;  2JCH A;  3G30 A;  1X0O A;  1XJ4 A;  4GD8 A;  1ACF A;  2OSU A;  2PR6 A;  4I39 A;  3LY4 A;  5FSR A;  2V1Z A;  3P7N A;  5E2F A;  4E04 A;  3TRC A;  1MWR A;  3MKF A;  1FIK A;  4F94 A;  4IUH A;  2RCX A;  4OQI A;  2JC7 A;  5C5K A;  4OOL A;  1KE4 A;  3UMD A;  1TF1 A;  3VP0 A;  1E4D A;  4JF6 A;  4JBF A;  2B18 A;  1VEU A;  1TDG A;  5TFQ A;  1UWN X;  3F1O A;  5FI2 A;  5EVE A;  3ZG7 B;  2V8F A;  1YSP A;  1F5M A;  3WS0 A;  2B02 A;  1IKG A;  2BLS A;  4EV4 A;  4WLA A; 
#chains in the Genus database with same CATH homology
 1PWD A;  2OLV A;  4HBT A;  4P85 A;  4K0X A;  1I2S A;  2ZM2 A;  2P9V A;  4QY5 A;  3HUO A;  3HLC A;  2X02 A;  5FQ9 A;  2ZC7 A;  4WMC A;  2GDN A;  3V50 A;  3IF6 C;  4WEJ A;  2FFY A;  3OPH A;  5EEC A;  1K55 C;  4GDB A;  1RP5 A;  4KG2 A;  4S2N A;  4X53 A;  3MZD A;  1QMF A;  1SKF A;  4DKI A;  2Y2H A;  1ERM A;  1LI0 A;  4GD6 A;  1KVL A;  2ZQD A;  5J8X A;  1FCM A;  3IF6 B;  3UPN A;  4KQQ A;  3NCK A;  1PW1 A;  4LCL A;  3MBZ A;  1BZA A;  4Q8I A;  4N1X A;  1U60 A;  1K56 D;  4U0T A;  4GZB A;  4R3B A;  1K56 A;  1NY0 A;  2H10 A;  2HP5 A;  4KZ7 A;  4DF6 A;  2Q9M A;  5FQJ A;  2Q9N A;  2DRW A;  1XKZ A;  1IEM A;  3HLW A;  3N4I A;  1ONG A;  3NBL A;  1WYB A;  3OCN A;  3VP1 A;  4DXB A;  2IWC A;  4IED A;  5HAQ A;  1E3U D;  1IYP A;  2QMI A;  2E8I A;  4S2L A;  2X01 A;  4BEN A;  1BLP A;  1FCN A;  5U47 A;  5EVI D;  1GA9 A;  1MKI A;  2B5R A;  2WKI A;  3LCE A;  1ONH A;  4KZ9 A;  1LL9 A;  2H5S A;  3EQU A;  2CC1 A;  1MPL A;  3NDE A;  1VQQ A;  4FH4 A;  1NXY A;  1W8Y A;  4ZJ3 A;  5TGF A;  4JKT A;  2EFX A;  3DTM A;  1TDL A;  2X71 A;  4E6W A;  5L2F A;  1FQG A;  2C5W B;  3A3D A;  1GA0 A;  2ZD8 A;  1Y54 A;  1YLT A;  2G2U A;  4XUX A;  3VOZ A;  2XK1 A;  1Q2Q A;  2V20 A;  1GHM A;  1ESI A;  3IWI A;  4UHU A;  5FAQ A;  1NYM A;  1CI8 A;  3C4P A;  5CTN A;  3TOI A;  1BLH A;  3FWL A;  3ZFZ A;  4C3Q A;  3FYZ A;  2ZJ9 A;  4N92 A;  3ZDJ A;  2IWD A;  3Q81 A;  5GLD A;  2V2F F;  1K25 A;  1ES3 A;  2WGW A;  4N9K A;  2XEP A;  1ERQ A;  1YLW A;  4P0M A;  4FCF A;  4FD8 A;  1PZP A;  1AXB A;  4Y7P A;  1SDN A;  3IXD A;  3ZNY A;  2QPN A;  2I72 A;  4KG5 A;  5CER A;  4S2K A;  3M2J A;  4O7D A;  5CED A;  4XXR A;  2EX2 A;  4Y0O A;  5FQM A;  3O88 A;  4OP5 A;  1LHY A;  4UA7 A;  1ALQ A;  4YFM A;  5DTT A;  3UE3 A;  3UDF A;  4X68 A;  3AGE A;  1ZKJ A;  2R9X A;  4WEL A;  1CEF A;  1N4O A;  3EQV A;  1MWT A;  1PIO A;  2Y59 A;  3ITA A;  2EX9 A;  4DDS A;  3CMZ A;  4R0Q A;  3RJU A;  3O87 A;  3UDX A;  4PM8 A;  2ZC6 B;  1KGG A;  2XF3 A;  1W79 A;  3HBR A;  4NK3 A;  1IYO A;  4IBR A;  1G68 A;  4MBK A;  4OQG A;  2ZC3 B;  4QD4 A;  5CHU A;  2PU2 A;  3VSK A;  3PBT A;  3M2K A;  1KDS A;  3ZHH A;  5CHJ A;  1ZG4 A;  5A90 A;  4D2O A;  4C75 A;  2Y2L A;  5CGX A;  5FI7 A;  3ZG8 B;  3A3I A;  1XX2 A;  2G2W A;  1PI5 A;  4PM5 A;  1XP4 A;  1DJC A;  1K57 A;  1L0E A;  1YLJ A;  2XR0 A;  2HDU A;  3N6I A;  4R4S A;  2WGW B;  1N9B A;  2ZQA A;  3HLB A;  3Q07 A;  3MXR A;  4DDY A;  3W4Q A;  3PBN A;  1TVF A;  3HLF A;  4ZAM A;  4LV2 A;  3CZD A;  2EXB A;  4JXW A;  4E3I A;  4JLF A;  4RYE A;  5HW3 A;  5G18 A;  1JWV A;  3OC2 A;  4WZ5 A;  2WKE A;  4BJP A;  2XGN A;  4MNR A;  3VFH A;  5AQ7 A;  1SDE A;  1GHI A;  2ZM8 A;  5FAT A;  4H8R A;  4EUZ A;  1FR1 A;  2XFT A;  4X6T A;  3V5M A;  1YT4 A;  5CRF A;  3ZCZ A;  3BFD A;  3CJM A;  4LEN A;  3VP2 A;  3LY3 A;  1FCO A;  3HUN A;  1MY8 A;  4B4Z A;  2WYX A;  4DE2 A;  4S2O A;  2EX8 A;  4BLM A;  4S2P A;  4IVK A;  2WZZ A;  1VM1 A;  1S6R A;  2H0Y A;  5KZH A;  4C6Y A;  1IYS A;  5FQQ A;  4OPQ A;  4KZ8 A;  2ZC4 B;  1HTZ A;  5FI6 A;  3CG5 A;  4PM7 A;  3ZVW A;  5CHM A;  1Z6F A;  1SHV A;  4BL3 A;  4ZDX A;  1TEM A;  3DWK A;  3HUM A;  3IH8 A;  3Q7V B;  3BEC A;  1K38 A;  4CPK A;  1BTL A;  3BFC A;  4DE1 A;  3N8S A;  3O86 A;  2ZQ9 A;  3ISG A;  3GQZ A;  2EFU A;  3IXH A;  1LI9 A;  1XPB A;  2ZC5 B;  2DCF A;  3GR2 A;  3ITB A;  2J9P A;  3SS5 A;  5M18 A;  1I2W A;  3UE0 A;  2Y2I A;  3G2Y A;  4UAA A;  1G6A A;  4FSF A;  5F83 A;  1CK3 A;  1JTD A;  1GHP A;  4RX3 A;  4EBN A;  4DRT A;  5EVL A;  2R9W A;  4WEK A;  4MBF A;  2Y2N A;  3PAG A;  5HAI A;  2OV5 A;  2XLN A;  2VGJ A;  2A49 A;  3BYD A;  2Y2O A;  1E3U A;  1K6S A;  3HLG A;  2Y91 A;  5KMW A;  5FQK A;  4OP8 A;  4ZJ1 A;  3UDI A;  3B3X A;  5EVI A;  1HZO A;  1NZO A;  1S0W A;  4LCM A;  1IYQ A;  5HX9 A;  4E6X A;  5AQB A;  1CI9 A;  3QNB A;  4S2N C;  2WGV A;  3BFE A;  2P9V B;  3G34 A;  4OOY A;  1ZC2 A;  4MEZ A;  4B88 A;  4CJN A;  5JYP A;  4MLL A;  3VP3 A;  3BLM A;  4JF5 A;  4OON A;  5TR7 A;  3FKW A;  5JYO A;  2XQZ A;  4OLG A;  1C3B A;  1DJB A;  5I94 A;  4B4X A;  1MWS A;  5GLB A;  4IBX A;  4HES A;  4BD0 A;  3OZH A;  3IXG A;  3GVB A;  1YM1 A;  3FKV A;  4E3L A;  3E2K A;  3VFF A;  1YMX A;  1ERO A;  5GL9 A;  3C7U A;  3W4O A;  1XA7 A;  4KQO A;  3G32 A;  3OPP A;  5HL1 A;  4EBP A;  3GRJ A;  3VMA A;  4OPY A;  4N1H A;  3BLS A;  4U3T A;  3C7V A;  4S2M A;  5AQA A;  3V3R A;  3PBR A;  1O7E A;  4E3O A;  4OKP A;  1BT5 A;  3WRT A;  5AQ9 A;  2Y2G A;  4BD1 A;  3SS4 A;  2WAF A;  3ZG5 A;  5EVI C;  4WM9 A;  2ZQ7 A;  5HFO A;  3WS2 A;  1SCW A;  4KZ6 A;  3Q82 A;  5EE8 A;  3MZF A;  4ZBE A;  3TSG A;  3A3F A;  5EOE A;  1ESU A;  1DJA A;  1LL5 A;  1HD8 A;  1PYY A;  2ZQC A;  4X55 A;  1ZG6 A;  3ZNT A;  5EVI B;  4RX2 A;  3V39 A;  3OPL A;  1MBL A;  1KGF A;  1O07 A;  3OPR A;  2Y4A A;  3ZVT A;  4OQH A;  4PM6 A;  4WBG A;  5M19 A;  3AGD A;  4OPR A;  4RVA A;  2P74 A;  2XH9 A;  5E2G A;  3G4P A;  4KZB A;  3IQA A;  3ZG9 B;  3N7W A;  3W8K A;  3GV9 A;  1YLZ A;  4ZJ2 A;  3BFF A;  4OVD A;  5DTS A;  4KZA A;  1EWZ A;  2ZM0 A;  3HLD A;  4R4R A;  3WS1 A;  4QJG A;  2Y2J A;  3IT9 A;  5CTM A;  3QNC A;  3VP4 A;  1H8Z A;  3NC8 A;  3PAE A;  3SOI A;  3Q7Z A;  4KZ3 A;  5GLC A;  3BM6 A;  2J8Y A;  1M40 A;  5CXW A;  5FQI A;  2EX6 A;  4NET A;  4P87 A;  4ID4 A;  2WAE A;  1JVJ A;  1PWG A;  1PWC A;  3M6B A;  4DXC A;  1W8Q A;  4KG6 A;  1K54 A;  3Q1F A;  1PZO A;  3G2Z A;  4N9L A;  2WUQ A;  5DF8 A;  3DW0 A;  3UN7 A;  3IF6 A;  3S22 A;  2WK0 A;  5DVA A;  1K55 A;  1W7F A;  4KQR A;  1BUL A;  2FFF B;  4R23 A;  4S2J A;  2Z2L B;  2HDR A;  3N8L A;  3O3V A;  2ZMA A;  4BL2 A;  3S4X A;  2PBY A;  1MWU A;  2JE5 A;  1ES4 A;  3M6H A;  1IEL A;  1XXM A;  5A92 A;  1YLP A;  5M1A A;  2XD1 A;  4QU3 A;  4R1G A;  5IHV A;  2IWB A;  5BOH A;  3JYI A;  2WGI A;  4GNU A;  4Z9Q A;  4FH2 A;  3WRZ A;  2OLU A;  2Z2M B;  5F82 A;  4EWF A;  5HAP A;  3SH8 A;  5FA7 A;  3V3S A;  3NI9 A;  3AGF A;  3SH9 A;  3UPO A;  1FOF A;  3G35 A;  3QHY A;  1W5D A;  1WE4 A;  2J7V A;  1BUE A;  1K57 C;  4K91 A;  3TG9 A;  3GTC A;  1YLY A;  3VSL A;  1H8Y A;  3PBS A;  4DE0 A;  3UPP A;  3NDG A;  3SH7 A;  4A5R A;  3GMW A;  2QZ6 A;  3LEZ A;  1FSY A;  1I5Q A;  5KSH A;  2BG1 A;  4WMC D;  5DF7 A;  5CGW A;  4WZ4 A;  2Y2K A;  1K54 C;  5DTK A;  3IF5 A;  4JF4 A;  4HEF A;  5GHY A;  4R3J A;  2J9O A;  1NYY A;  3VOY A;  3BFG A;  1NJ4 A;  5EPH A;  4LV0 A;  3E2L A;  4WZ5 C;  3NY4 A;  3PBQ A;  4YIN A;  2HPB A;  2PU4 A;  2XDM A;  1H5X A;  5EUA A;  5A91 A;  3WS4 A;  5FAO A;  2C6W B;  1L0G A;  5E2H A;  1J9M A;  4UA9 A;  1E25 A;  4OH0 A;  1KGE A;  1L0F A;  2Y2Q A;  4WYY A;  1RCJ A;  5E2E A;  2Y2P A;  4K0W A;  4Y0T A;  3S1Y A;  1ES5 A;  1K4F A;  1EI5 A;  4UA6 A;  4GB7 A;  4EQI A;  1XGI A;  1K4E A;  5GHX A;  1KE0 A;  1FSW A;  1YMS A;  4LV1 A;  2XFS A;  5F1F A;  1KE3 A;  1QME A;  3IHB A;  3P09 A;  3IH9 A;  4QY6 A;  5D3O A;  2A3U A;  2WZX A;  4E3K A;  3HRE A;  4E3N A;  3UNW A;  2HDS A;  3IWQ A;  1NRF A;  5HAR A;  3A3J A;  1RGZ A;  3ZGA B;  1MXO A;  2DNS A;  1HVB A;  2VGK A;  4PM9 A;  3I7J A;  3IHA A;  4M3K A;  3WWX A;  2ZLY A;  1LLB A;  4MBH A;  5EOO A;  1PW8 A;  3UO9 A;  1JWZ A;  4GN2 A;  4JPM A;  1NZU A;  4IVI A;  3WS5 A;  2HP6 A;  3IXB A;  5GLA A;  3P98 A;  5DF9 A;  1CEG A;  3RXW A;  2UWX A;  1KVM A;  4PPR A;  4P6B A;  4KZ4 A;  3LO7 A;  2JBF A;  4KZ5 A;  2ZQ8 A;  4OPZ A;  3GSG A;  4HBU A;  5GHZ A;  3DWZ A;  2XD5 A;  2WAD A;  3MZE A;  4GKU A;  4JXS A;  4KEN B;  5FAP A;  3A3E A;  3IWO A;  4OQ0 A;  4GOG A;  1DY6 A;  2JCH A;  4EBL A;  3G30 A;  3W4P A;  3C5A A;  3HLE A;  3NIA A;  4GDN A;  5FDH A;  3PBO A;  2EXA A;  3UY6 A;  1L0D A;  3RXX A;  2Y55 A;  4GD8 A;  5E43 A;  2H0T A;  2HDQ A;  1OME A;  3MFD A;  4S2I A;  3HVF A;  4X69 A;  4RA7 A;  1IKI A;  2OSU A;  3FV7 A;  3HL9 A;  1XGJ A;  3FZC A;  1FR6 A;  3LY4 A;  3C4O A;  5FSR A;  1WYC A;  4X56 A;  3ZG0 A;  1L2S A;  2V1Z A;  3PTE A;  3UE1 A;  3OCL A;  4OOM A;  5E2F A;  1Q2P A;  4ZTK A;  1MWR A;  3MKF A;  5KSC A;  4F94 A;  3MXS A;  1ES2 A;  1XA1 A;  3Q7V A;  2RCX A;  1JTG A;  4OQI A;  2JC7 A;  3G31 A;  3D4F A;  4OOL A;  5CGS A;  1KE4 A;  3VP0 A;  4PMA A;  1BLC A;  4U0X A;  3BRM A;  1GCE A;  1E4D A;  5FAS A;  3BEB A;  4JF6 A;  4JBF A;  4XUZ A;  4QB8 A;  4JXV A;  1M6K A;  5F1G A;  4LV3 A;  4BQM A;  1TDG A;  1YQS A;  4OLD A;  5TFQ A;  5CEB A;  5CEC A;  1JWP A;  4QHC A;  5FI2 A;  1K6R A;  2Y2M A;  2RL3 A;  3MKE A;  4DE3 A;  3ZG7 B;  1RGY A;  5A93 A;  1KDW A;  2HP9 A;  4E3J A;  3SS3 A;  3WS0 A;  4Y0U A;  1IKG A;  2BLS A;  2WKH A;  1BSG A;  4JXG A;  4E3M A;  4EV4 A;  4L0L A;  1BLS A;  1PI4 A;  3N8R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...