3SH7A

Crystal structure of fluorophore-labeled beta-lactamase penp
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
257
structure length
257
Chain Sequence
b'KDDFAKLEEQFDAKLGIFALDTGTNRTVAYRPDERFAFASTIKALTVGVLLQQKSIEDLNQRITYTRDDLVNYNPITEKHVDTGMTLKELADASLRYSDNAAQNLILKQIGGPESLKKELRKIGDEVTNPERFCPELNEVNPGETQDTSTARALVTSLRAFALEDKLPSEKRELLIDWMKRNTTGDALIRAGVPDGWEVADKTGAASYGTRNDIAIIWPPKGDPVVLAVLSSRDKKDAKYDDKLIAEATKVVMKALN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
molecule tags Hydrolase
source organism Bacillus licheniformis
publication title Increased structural flexibility at the active site of a fluorophore-conjugated beta-lactamase distinctively impacts its binding toward diverse cephalosporin antibiotics
pubmed doi rcsb
total genus 86
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2011-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3sh7A00
2WKHA 3LY3A 2JCHA 5E2GA 3LO7A 1ZKJA 3OZHA 4FD8A 5FATA 2FFYA 2XD5A 4JPMA 4E3MA 5FSRA 1GHMA 1MBLA 1L0EA 4N1HA 1GA9A 1PZPA 1VM1A 2H10A 2Y2GA 2QPNA 2Y2QA 3BLSA 3SS4A 4DF6A 2Y2KA 4K0XA 4F94A 5M18A 1K56D 1YLTA 4KZ7A 5E2EA 2HDSA 1I5QA 2WGIA 1PW8A 4N9LA 4BJPA 1BT5A 3OCNA 3M6BA 3TSGA 1HD8A 1NRFA 3FV7A 3N8LA 1IYQA 5U47A 4KZ9A 4OLDA 4WEJA 4P6BA 5FI7A 5GLBA 1ERMA 4JKTA 1S0WA 1KGEA 4KZ4A 1U60A 1IELA 1IEMA 3G2ZA 5EOEA 3AGDA 5FQIA 2UWXA 1NYMA 1MWSA 1IYSA 2Y91A 3FYZA 3VOYA 1O7EA 1ZC2A 2WZXA 3OC2A 4KZ3A 1FSYA 3BFEA 3GTCA 3OPRA 5DF8A 2WGWA 1KVMA 4CPKA 4QY6A 2Y2MA 3BM6A 2Q9NA 1RCJA 1KGFA 3IHAA 5F1GA 3IXHA 2IWBA 4KQOA 2ZMAA 1E3UA 1BLHA 1K6SA 4S2LA 3Q07A 2V2FF 3BLMA 1NY0A 1L0GA 4Y7PA 2HP6A 1M6KA 1Q2QA 3HLGA 1K56A 3IT9A 4N92A 2WAEA 1TVFA 3C4OA 3RXWA 4MLLA 2ZM2A 2ZC3B 4ZTKA 3SH7A 3WS0A 1K25A 1DJBA 1EROA 3NC8A 1NZOA 4E6XA 3NI9A 1MPLA 3OCLA 4KZAA 3V50A 4DXBA 3VP2A 1BSGA 1PWGA 4ID4A 4LV2A 4GN2A 1NZUA 4BL3A 4S2IA 4C75A 3MXSA 5HARA 3TG9A 2C5WB 2J9PA 5AQAA 2V20A 4Z9QA 4EV4A 1K6RA 3UNWA 3SOIA 3A3JA 5EVLA 5HAQA 3PBNA 2XGNA 4PM6A 1G6AA 3VP1A 2A49A 2HDUA 1C3BA 5KMWA 1JWVA 2WYXA 2CC1A 2E8IA 1E4DA 1XKZA 4WZ5C 1K38A 3HUNA 4S2JA 4FCFA 4FH4A 1HZOA 1ESIA 4P85A 3IXBA 1WYCA 4PPRA 3FKWA 1JTDA 4OOLA 3S1YA 1DJCA 1XPBA 4LCLA 5KZHA 3HLDA 1ES4A 3IHBA 3EQUA 4OKPA 4LV0A 3VSLA 4R3BA 1CEGA 2Y2OA 3HBRA 3ISGA 3IF6A 1FR1A 5KSHA 3WS4A 3HUMA 5EVIC 5EVID 1GA0A 3OPLA 2WK0A 2G2WA 2H0YA 2J9OA 1PWDA 4OQGA 3UPNA 1LHYA 5CRFA 4B4XA 3PBSA 2WGVA 5CHUA 1N9BA 3G35A 1Z6FA 4IBRA 4GD8A 2ZJ9A 2J7VA 3IH9A 3D4FA 3GSGA 1YMXA 4MNRA 3S22A 4N9KA 4OH0A 5AQ7A 3N8SA 1LL5A 4S2KA 3V3SA 3VMAA 4QJGA 3WRZA 3GVBA 4KQQA 1FCOA 3ZFZA 2RL3A 4L0LA 4IVIA 4DDYA 4PM7A 2P9VB 4XUXA 3NIAA 4KQRA 1O07A 4HESA 4OOYA 4UHUA 1BTLA 4X55A 3Q81A 2Y2IA 1VQQA 4DDSA 4U3TA 3TOIA 2XFTA 2WKEA 4Y0OA 3UE3A 2BG1A 3N7WA 4R1GA 3NCKA 4U0XA 4OQIA 1ES5A 4PMAA 4EUZA 4GOGA 5FQ9A 1FCNA 5GHYA 4R0QA 1CI9A 3NY4A 4R4RA 1ES2A 2B5RA 3SH8A 4JBFA 2H5SA 2QZ6A 3HL9A 5L2FA 1MKIA 4MBKA 3PTEA 4UA9A 3UY6A 2PU4A 3C5AA 1LI9A 3IWOA 2P74A 4XXRA 1SDEA 3N8RA 3MKFA 3M6HA 4X68A 1NXYA 2JE5A 2P9VA 1N4OA 1KE0A 3ZG9B 1WYBA 4KZ5A 3BFDA 3V3RA 1YQSA 2EX2A 3WWXA 3AGFA 5CTMA 2ZQDA 5EPHA 4MEZA 5GL9A 3ITAA 3SS5A 1H8ZA 4E3IA 1PIOA 2Y2NA 4DRTA 4Y0UA 1HVBA 5HL1A 3UE0A 1H8YA 2Z2MB 2DNSA 5GLDA 4E3KA 5CEBA 3BECA 1XP4A 4E3JA 4EBNA 3SH9A 3A3EA 5CEDA 3NBLA 4K91A 3LY4A 3VP3A 3IF6C 5AQBA 1IKGA 1FOFA 4BLMA 3CG5A 3RXXA 3ZHHA 1W79A 1PI5A 1S6RA 3ZG8B 4OVDA 4XUZA 2IWDA 1W5DA 4RVAA 4HEFA 2HP5A 1RP5A 5FI6A 3P09A 4C6YA 4CJNA 4GNUA 4EQIA 2ZQ8A 3A3DA 5CHMA 1JWZA 2HP9A 2ZC7A 3UO9A 1EI5A 2R9WA 5HFOA 3RJUA 5F82A 1K4EA 1YT4A 2ZQCA 2ZM8A 4UA6A 5KSCA 2Y55A 4ZBEA 1IKIA 4KZ6A 2ZQ7A 3MZDA 4O7DA 1PZOA 1EWZA 2WZZA 1Y54A 4P87A 3VFHA 5I94A 3UDXA 3UDFA 5CGSA 5EVIA 4B4ZA 4RX2A 2X71A 4QY5A 2EX6A 1K55A 1LLBA 1DY6A 3IWQA 3GQZA 3MZFA 3O86A 4OPRA 3SS3A 1FR6A 3FKVA 4NETA 2WADA 3WS2A 3QHYA 4BQMA 1ES3A 4WELA 2HDQA 2Q9MA 1MWUA 3BFGA 4JF4A 3VSKA 1M40A 1QMFA 3HUOA 4OQ0A 1CI8A 1KDWA 1ERQA 1XXMA 3G31A 5M1AA 3UE1A 3UDIA 2G2UA 4K0WA 5FDHA 4MBFA 4BENA 4JXGA 1IYOA 4S2NC 3O87A 3V5MA 2BLSA 1L2SA 3UPOA 4OOMA 5DF9A 2J8YA 2ZQ9A 3IXGA 1E3UD 5GLAA 3VP4A 4FSFA 4JXSA 4DE3A 3BRMA 1KGGA 3Q7VA 1RGZA 5A93A 4LV1A 2EX9A 2EXAA 1SCWA 2OLUA 1E25A 4X6TA 3FZCA 3G4PA 1CK3A 1L0DA 3W4OA 1FCMA 5CGXA 4KG6A 4OP8A 3W8KA 5EVIB 4OPYA 3DTMA 1NYYA 2C6WB 3AGEA 4HBUA 1XA1A 2XF3A 3WS1A 3GR2A 1SHVA 3O3VA 3PBOA 5DTKA 2RCXA 1ONGA 5F1FA 4BD1A 2HPBA 2OV5A 5DF7A 2X01A 5E43A 3DW0A 3IF5A 1MWRA 3PBTA 3CJMA 1MWTA 2H0TA 5HAIA 3A3IA 1ALQA 5CECA 3C7UA 4X56A 5E2FA 2ZC5B 3GV9A 5FASA 1YLZA 5GHZA 1PWCA 5CXWA 3E2LA 1IYPA 2WGWB 4GDBA 4JF5A 4NK3A 2IWCA 2WKIA 2HDRA 4YFMA 4M3KA 3GMWA 4U0TA 1BULA 2PBYA 1K55C 3G2YA 3G34A 2XLNA 4ZAMA 1KDSA 5FA7A 1BLCA 4E3LA 2DRWA 2XDMA 1MXOA 2Z2LB 4FH2A 2QMIA 3MFDA 3Q7VB 4DKIA 5FQKA 1K4FA 1GCEA 4OPZA 4DE2A 4ZJ3A 2EFXA 2X02A 4C3QA 5TGFA 4WZ5A 1FSWA 5DTTA 3VFFA 3HLWA 2WUQA 3PAEA 4S2PA 5EUAA 3LEZA 4DE1A 4LV3A 5FQMA 5A91A 4KZ8A 4X69A 4JXWA 3G32A 3A3FA 2JBFA 4PM5A 4E6WA 3ZNYA 5GHXA 1ZG6A 3DWKA 3HREA 4KG2A 5CERA 3VP0A 1XGJA 2XD1A 5DTSA 1LI0A 1YMSA 2Y2JA 1BLSA 3NDGA 4EBPA 1MY8A 2ZC4B 3IQAA 3N4IA 3N6IA 2GDNA 1I2SA 4ZJ2A 3ZNTA 4Q8IA 1ONHA 3OPHA 2XR0A 2ZD8A 3Q82A 5EOOA 5TR7A 3JYIA 4WMCD 1ESUA 1KE4A 4WYYA 4S2NA 3WRTA 3C4PA 3E2KA 4RA7A 2DCFA 1AXBA 3NDEA 3W4QA 5HW3A 1I2WA 5FQQA 3UPPA 1DJAA 2WAFA 2PU2A 1Q2PA 4GKUA 5DVAA 4OPQA 2ZC6B 2XQZA 1YLPA 4GDNA 4WMCA 2ZLYA 3P98A 2V1ZA 4WEKA 4WBGA 5EECA 5CHJA 4QHCA 4RYEA 1BZAA 3BFFA 4UA7A 1CEFA 3HLFA 4OLGA 5EE8A 4RX3A 5G18A 1BLPA 3IF6B 1XX2A 3O88A 2EFUA 4IVKA 3IXDA 2R9XA 5E2HA 5FQJA 4D2OA 4R23A 4GD6A 4N1XA 1RGYA 1W7FA 1XA7A 4Y0TA 4DE0A 1FQGA 4E3OA 1L0FA 5JYOA 1TDGA 4P0MA 3M2KA 1W8YA 5F83A 3VOZA 5HAPA 5CGWA 1PW1A 4LCMA 2OSUA 3ZG0A 4BL2A 2FFFB 4EBLA 4JF6A 1W8QA 4QD4A 4S2OA 4UAAA 3BYDA 5TFQA 1NJ4A 5M19A 1LL9A 4JLFA 3LCEA 1PI4A 4DXCA 5A90A 1HTZA 2Y4AA 3ITBA 3HLBA 5BOHA 1YM1A 1YLJA 4PM8A 1SKFA 2Y2HA 4H8RA 1K57C 1WE4A 3EQVA 2VGJA 5A92A 1TDLA 1QMEA 3FWLA 3MXRA 2XH9A 4MBHA 4GZBA 3ZDJA 3GRJA 4KG5A 4KZBA 3S4XA 3BEBA 3ZCZA 4KENB 2Y2LA 3MKEA 2EX8A 5FI2A 3WS5A 3ZVWA 3V39A 3CZDA 4E3NA 3BFCA 2ZQAA 3HVFA 2JC7A 4ZJ1A 1JTGA 5FAQA 4QU3A 4S2MA 5GLCA 4EWFA 3G30A 1SDNA 4BD0A 1KVLA 4JXVA 4IEDA 5D3OA 5HX9A 3W4PA 1G68A 3ZGAB 3QNCA 3C7VA 3OPPA 1KE3A 4A5RA 2I72A 1K54A 4R4SA 2VGKA 1GHPA 1TEMA 3Q7ZA 4IBXA 4GB7A 2XEPA 3HLCA 4OONA 3Q1FA 4LENA 4HBTA 3QNBA 1GHIA 3UN7A 4R3JA 3IWIA 1K54C 2Y59A 4X53A 2ZM0A 1K57A 1PYYA 2EXBA 1JVJA 4PM9A 4YINA 4QB8A 2OLVA 1J9MA 1YLWA 3B3XA 3IH8A 1OMEA 3HLEA 3PBRA 3MBZA 3MZEA 1JWPA 5IHVA 4B88A 1BUEA 4WM9A 3ZVTA 3ZG5A 1H5XA 3PBQA 3PAGA 3CMZA 4OP5A 5FAOA 3M2JA 2Y2PA 4WZ4A 3I7JA 2A3UA 2XK1A 5JYPA 1XGIA 3ZG7B 4ZDXA 3DWZA 4OQHA 5CTNA 1ZG4A 5AQ9A 5FAPA 1YLYA 2XFSA 5J8XA
chains in the Genus database with same CATH superfamily
3EEAA 3VOLA 2JCHA 4ARZB 3OZHA 4FD8A 4M4XA 2XD5A 4JPMA 4E3MA 1GHMA 2VK3A 2PR5A 4GS9A 2Y2GA 4DF6A 2QPNA 4F94A 5HDSA 5LBRA 5E2EA 2HDSA 2WGIA 1BT5A 3BW6A 4BMWA 3TSGA 1NRFA 3FV7A 5HPFA 5L8MA 2KOIA 1IEMA 5EOEA 3AGDA 5J3WA 1NYMA 5FDSA 3EEHA 4MN6A 3OC2A 4HY8A 3BFEA 3GTCA 3BM6A 2EA9A 1E3UA 4S2LA 1YAXA 3QP8A 1L0GA 3CI6A 4XT2B 3IT9A 1YSQA 1TVFA 1BYWA 1K25A 1EROA 4IUHA 4E6XA 3NI9A 4FOFA 2O9AA 3OCLA 4DXBA 4H6JA 3VP2A 4LV2A 4BL3A 4S2IA 4C75A 2QKPA 3MXSA 3TG9A 2W3DA 5AQAA 1K6RA 3UNWA 3SOIA 5EVLA 3PHYA 3VP1A 3UB8A 1C3BA 1E4DA 1XKZA 4R38A 2KLIA 4AFIA 3HUNA 5HPIA 4FCFA 4FH4A 4PPRA 2JKRI 1DJCA 4OKPA 4R3BA 1CEGA 2PD8A 3WS4A 2J9OA 4OQGA 1PWDA 4X1LA 3S7OA 2W27A 5IU1A 1OJGA 3IH9A 2PDRA 2L1MA 3D4FA 3GSGA 1YMXA 5AQ7A 3VMAA 1P97A 1J3WA 2O99A 4HI4A 4HJ6A 3UMEA 4LRXC 1MZUA 2JN7A 4IVIA 4PM7A 4NG2A 4XUXA 1BTLA 1TS7A 4X55A 3UE3A 4R1GA 3TE8A 1CI9A 2B5RA 4UA9A 2PU4A 2ZL1A 3R7WB 2P74A 1NXYA 1KOUA 1N4OA 3ZG9B 5FEGA 5EPHA 5GL9A 1H8ZA 4E3IA 4Y0UA 3UE0A 5GLDA 2DNSA 1XP4A 4E3JA 2WKRA 2A2LA 3IF6C 4BLMA 3CG5A 3RXXA 4GCZA 2XA7M 1W79A 5HWTA 4XUZA 5AVFA 2HP5A 3G6OA 3P09A 1XJ4A 4GNUA 3A3DA 1JWZA 2HP9A 5HFOA 5F82A 1GSXA 2ZQ7A 1TS6A 2D02A 1ZHHB 3BWLA 1Y54A 4P87A 1CQAA 5HWVA 5I94A 4CLCE 5EVIA 1H3QA 3FG8A 2X71A 4QY5A 4EUVA 1LLBA 1DY6A 3IWQA 3FKVA 4NETA 1F9IA 1ES3A 4WELA 3H82A 4JF4A 5KIZA 1QMFA 2WKQA 3G31A 2MJ6A 3UE1A 1OTBA 2A24B 4EETB 3FC7A 4L9FA 3IBJA 2I9VA 4DJ2A 2P04A 3UPOA 2J8YA 3VP4A 3LEQA 4DE3A 3BRMA 1KGGA 3Q7VA 3T1SA 4ARZA 1L0DA 3W4OA 1FCMA 5CGXA 4KG6A 5EVIB 2C6WB 4HBUA 3WS1A 4FUWA 2J3WA 2X01A 3IF5A 3T4QA 1MWRA 5HAIA 3CJMA 1Z09A 2H0TA 1VEUB 2W3FA 3LIBA 3GV9A 5CXWA 5J7EA 4GDBA 3D3OA 5TJJA 5HZHA 2HDRA 2VV8A 4M3KA 3JPUA 1K55C 4FH2A 1SKOA 3MQOA 2EFXA 2X02A 5TGFA 4MMNA 2WUQA 3IS2A 4X69A 3G32A 1XFNA 5GHXA 3DWKA 4WN5A 4EW7A 5CERA 2XD1A 5DTSA 3UB5P 2Y2JA 1MY8A 3IQAA 3N4IA 3LIAA 2P08A 2O9BA 3ZNTA 1ONHA 1EW0A 2XR0A 3OPHA 3Q82A 3JYIA 3DTKA 3C4PA 4RA7A 3W4QA 1I2WA 2WAFA 5DVAA 3T4LA 2ZLYA 4Q0JA 1LSWA 5EECA 5CHJA 4EEPA 2PAVP 3BFFA 2KDKA 3B47A 4RX3A 5G18A 3IF6B 2V1AA 5FQJA 3IBRA 4N1XA 1RGYA 1XA7A 1FQGA 4E3OA 1L0FA 4YNRA 5F5YA 5CGWA 3UB9A 4LCMA 3ZG0A 3EGXC 4YWZA 4JF6A 5TFQA 1OJ5A 1FIKA 2Y4AA 1YM1A 1YLJA 1SKFA 2Y2HA 2ZOHA 2HJ9C 2VGJA 1TDLA 1NLZA 3ZDJA 2V1BA 4KZBA 3BEBA 3ZCZA 3L9KA 2QJ5A 3MKEA 5F68A 4E3NA 3BFCA 4QU3A 4ETXA 2Z6CA 1TF1A 5D3OA 4IEDA 4HP4A 3W4PA 1D1JA 3ZGAB 3QNCA 2LB9A 4LENA 4HBTA 4Z1WA 4R3JA 3IWIA 1K54C 1K57A 2EXBA 2EWVA 3DTEA 1LSVA 1OMEA 4BBTA 1JWPA 4B88A 3PAGA 4OP5A 4CLCB 1FILA 1WA9A 1XGIA 2ZMFA 4OQHA 4UQIM 1P0ZA 4JGPA 1OPXA 1STZA 3LO7A 5FATA 2FFYA 4Y5FA 1L0EA 3MR0A 3HJIA 1GA9A 3LUQA 2H10A 3SS4A 2VA0A 4K0XA 1YLTA 4XT2A 4KZ7A 1T1AA 3TW8A 1I5QA 4N9LA 3MQ0A 3OCNA 3M6BA 4WUJA 3N8LA 1IYQA 3PR6A 3KYQA 1ERMA 3G2ZA 1PNEA 2UWXA 2V8CA 4MCWA 2Y91A 4HJ4A 5F6AA 1KVMA 5HD5A 3OLOA 1F2KA 2ZMAA 1BLHA 2AVXA 4NEED 1CF0A 2PR6A 2JKTM 3HLGA 4N92A 1K56A 3C38A 2W1RA 2P7JA 3C4OA 1D06A 4MLLA 2PBDP 2ZC3B 3WS0A 3NC8A 4GLQA 4KZAA 1XJ3A 5EVEA 4P6ZS 1PWGA 4GN2A 4HH3A 2C5WB 4EV4A 2V20A 3A3JA 3PBNA 2XGNA 4G3KA 1JWVA 2CC1A 3C8CA 4WZ5C 2VV7A 5EV0A 3CUEC 4S2JA 1WYCA 3C30A 3R4KA 2V0UA 1XPBA 3LIDA 3IHBA 3U4LP 3VSLA 2XROA 2Y2OA 3NOUC 2JKFA 5EVID 1GA0A 5EM1A 3OPLA 2O0YA 2QHKA 4R70A 3PBSA 2WGVA 1N9BA 4GD8A 3S22A 4OH0A 5DJUA 3N8SA 1LL5A 4JGQA 4QJGA 4PKYA 4L0LA 2P9VB 2M7VA 1O07A 4DDSA 2K2NA 2WKEA 2BG1A 1T18A 4U0XA 3LI8A 4PMAA 2HF6A 4R0QA 2FZ0A 2H5SA 2QZ6A 3LIEA 4HJ3A 1LI9A 3MKFA 3D9YA 3M6HA 1DP9A 2JE5A 2HGVA 1KE0A 1WYBA 4KZ5A 3V3RA 2EX2A 3K3CA 5CTMA 3ITAA 3SS5A 1PIOA 4DRTA 3CPTB 1HVBA 2Z2MB 4PAUA 5CEDA 3A3EA 1ODVA 1UWNX 3IX4A 4K91A 3LY4A 3VP3A 1IKGA 4BWIA 1S6RA 1W5DA 3CAXA 4RVAA 5HD3A 4CJNA 4EQIA 5CHMA 2M1CA 3UO9A 2R9WA 3RJUA 4GHIB 5KSCA 4FTXA 1IKIA 4KZ6A 4Y15A 2Z6DA 3K3DA 3UDFA 3MMHA 5CGSA 3LGOA 1FR6A 2M7UA 2Q9MA 3VSKA 1M40A 4OQ0A 1CI8A 1KDWA 1XXMA 2G2UA 1VHMA 4MBFA 4BENA 1IYOA 4S2NC 3O87A 3V5MA 2J3TC 5DF9A 5DKLA 5GLAA 4GW9A 1PFLA 2EX9A 3T4TA 2ZOIA 2OLUA 3G4PA 3E98A 4OP8A 3V67A 3W8KA 2O9CA 1NYYA 2ZMVA 2XF3A 4JGRA 3PBOA 2RCXA 2Q0OA 4BD1A 3LR3A 1T1BA 2FH5A 3PBTA 5AJGA 1MWTA 1X0OA 2GNXA 5FASA 1YPRA 4LGWA 1PWCA 4D60A 3E2LA 2WGWB 2WKIA 4YFMA 3K2NA 4U0TA 1BULA 3G2YA 3G34A 1KDSA 4E3LA 2DRWA 3Q7VB 3RTYA 4DKIA 4F3LA 1Y4OA 1FSWA 3HLWA 3PAEA 4S2PA 3P7NA 3LEZA 4LV3A 5L07A 5TBMA 3A3FA 2JBFA 4PM5A 3ZNYA 4KG2A 1T19A 4EBPA 2ZC4B 3N6IA 4MN7A 2V9AA 5F69A 5EOOA 1OTDA 1D7EA 3WRTA 3E2KA 2DCFA 5HW3A 3JVVA 2PU2A 4GKUA 2ACGA 2V1ZA 2OWHA 3UE6A 5IS1A 3LR0A 1BZAA 1S4SA 5EE8A 4OLGA 3EGDC 3KSHA 1BLPA 1S66L 4IVKA 5E2HA 4D2OA 4R23A 1W7FA 4Y0TA 4DE0A 4P0MA 1W8YA 5HAPA 2A24A 1PW1A 2OSUA 4EBLA 3LICA 1T1CA 3U2AA 4JLFA 3LCEA 3KSGA 1HTZA 5BOHA 1GSVA 3EQVA 3IX3A 3MXRA 2XH9A 3C2WA 3GRJA 4KG5A 2Y2LA 2EX8A 3MF0A 4I3JA 3CZDA 1JTGA 1S67L 5EFWA 2DMWA 4BBUA 1SDNA 1KVLA 4P6ZM 5HX9A 1G68A 2GZAA 2L0WA 4A5RA 3ZQ5A 2VGKA 1TEMA 1Y28A 3Q7ZA 4IBXA 2VGLM 2NUTC 4L9GA 3QNBA 4PKYG 1NRJA 3UN7A 2OOLA 2NUPC 2ZM0A 1JVJA 3QP6A 3HCYA 1YLWA 4YOFA 3MBZA 4X25A 1H5XA 3PBQA 1IFQA 5FAOA 2A3UA 1VETA 5JYPA 3ZG7B 2VEAA 1N9NA 4EXOA 2VGLS 2G7UA 5FSRA 5HDDA 1PZPA 2Y2QA 2Y2KA 5M18A 1K56D 1PW8A 3MS6A 3NOTC 1HD8A 5U47A 4KZ9A 5HDCA 4OLDA 4WEJA 4I3AA 4NKPA 4KZ4A 1U60A 1IELA 1IYSA 1H8MA 4KZ3A 5DF8A 3HJKA 2WGWA 4QY6A 2Q9NA 5J8XA 1K6SA 2YKHA 4WL9A 1V9YA 3Q07A 2V2FF 3BLMA 4Y7PA 1M6KA 1Q2QA 2WAEA 4QWOA 2VKSA 4ZTKA 1DJBA 5CX7A 1NZOA 1MPLA 1TS8A 3V50A 2Y79A 1BSGA 3VE3A 3H9WA 1NZUA 4RQ9A 4DJ3A 3S7NA 1NLYA 3QP5A 4PM6A 2HDUA 5KMWA 4WF0A 1K38A 3L7HA 1HZOA 1ESIA 3IXBA 3FKWA 1JTDA 3S1YA 3HLDA 4LV0A 3T50A 5DKKA 3DAVA 3ISGA 2HJEA 5KSHA 3HUMA 1K0KA 4HHDA 5EVIC 2WK0A 2G2WA 2JKGA 3UPNA 1UGUA 5CRFA 3T4OA 1YSPA 5CHUA 3G35A 4IBRA 2ZJ9A 1VETB 1P9WA 4S2KA 2Y8HA 3WRZA 3GVBA 3ZFZA 4DDYA 3QP2A 3NIAA 1AWIA 2JKRM 4OOYA 3VV4A 2B02A 3O5YA 2Y2IA 3TOIA 2QJ7A 2XFTA 3N7WA 3NCKA 4OQIA 5FQ9A 3TJZC 5GHYA 4R4RA 1ES2A 3SH8A 1SZVA 4MBKA 3UY6A 3IWOA 4KUOA 5C5KA 1SDEA 3N8RA 3SZTA 2CMNA 1TS0A 2PRFA 4B93A 1G5UA 2P9VA 3FPWA 5I5LA 4Y3IA 3WWXA 3AGFA 4MEZA 3MSHA 4ME4A 1F5MA 4E3KA 4LLOB 4EBNA 3DTIA 5HSQA 1PI5A 3ZG8B 4OVDA 2IA2A 2IWDA 3KX0X 1RP5A 5FI6A 2ZQ8A 3CHWP 3MQQA 2B18A 1K4EA 2ZQCA 4UA6A 2Y55A 2BASA 2WZZA 5FL3A 1SKOB 3UDXA 3OOVA 4B4ZA 4RX2A 3F1NA 2EX6A 1LSXA 3GQZA 4OPRA 4X1MA 3RH8B 3SS3A 3WS2A 2WADA 3B42A 4BQMA 1CJFA 3CITA 3BFGA 3HUOA 1ERQA 5M1AA 3UDIA 4K0WA 4JXGA 2BLSA 3PYPA 2J3TD 4OOMA 1L3LA 2ZQ9A 3IXGA 4FSFA 2GJ3A 4JXSA 4O01A 2ZL1B 1SCWA 3E0YA 1E25A 4X6TA 4HNBA 1CK3A 3A0RA 1XJ6A 1OT9A 5DFXA 3NHQA 1OTAA 4NXBA 1XA1A 4IJGA 1VEUA 1SHVA 3O3VA 1ONGA 2HPBA 3BY8A 4R6LA 2OV5A 5DF7A 5E43A 2VZWA 3UMDA 1N9OA 3A3IA 5CECA 4HOIA 5E2FA 1YLZA 5GHZA 2R78A 1IYPA 1ZTUA 4JF5A 4NK3A 2IWCA 1OT6A 2OAP1 3DBAA 3F1NB 2XLNA 4ZAMA 5FA7A 1BLCA 2XDMA 1MXOA 4PHTA 4Y17A 4G3WA 5FQKA 1K4FA 4OPZA 4DE2A 4ZJ3A 4C3QA 4WZ5A 3PXPA 5EUAA 4KZ8A 5AVEA 4DMZA 4E6WA 5DJTA 1LI0A 1YMSA 3A0VA 4DN0A 1BLSA 2GX5A 1I2SA 4ZJ2A 1W63Q 3F1PA 3LYXA 1XJ2A 3SW1A 2JKTI 5TR7A 2ZBBA 3P01A 4I5SA 1ESUA 4WMCD 2PHYA 3NECA 4NXEA 1AXBA 3T1RA 2VJWA 2VV6A 4OPQA 1YLPA 4WMCA 4WEKA 5G4ZA 4QHCA 3T12B 4HP9A 3EWKA 1XX2A 3O88A 2EFUA 3IXDA 3ZYTA 3KO6A 5J4EA 4ESPA 3T4KA 5TBMB 5JYOA 3T1XA 1TDGA 3M2KA 3VOZA 2OAQ1 4I3IA 1W8QA 4QD4A 4UAAA 1NJ4A 4DXCA 1PI4A 3EOIA 4PM8A 4H8RA 1K57C 1WE4A 2XFSA 5A92A 1S1YA 5IT5A 2HV1A 3FWLA 4MBHA 4GZBA 1JNUA 2W3EA 2W3GA 3BQAA 5FI2A 3ZVWA 3WS5A 2UV0E 2INWA 5K5BA 2JC7A 5FAQA 2QWSA 4S2MA 5GLCA 3CWFA 3NJAA 4G3VA 3OPPA 4CLCD 4R4SA 1GHPA 3KSFA 1DRMA 4OONA 3Q1FA 1PRQA 3MJQA 2Y59A 4X53A 2EWWA 1PYYA 3NOPC 3CLOA 4MDZA 2OLVA 3IH8A 3FPVA 3HLEA 3PBRA 4EQ1A 1BUEA 4WM9A 3ZVTA 3H7WA 3CMZA 3CUEA 1DP8A 3H7WB 2KX6A 3BJNA 3I7JA 2H28A 2XK1A 3LFVA 3ICYA 3DWZA 1ZG4A 4II7A 4QB8A 2L4RA 2WKHA 3LY3A 4Y13A 5E2GA 1ZKJA 4H6JB 5DFYA 1MBLA 3IX8A 4N1HA 1VM1A 3BLSA 4Q0IA 2XA7S 4C6YA 4BJPA 2BTFP 5FI7A 1W63M 4P6BA 5GLBA 1IOUA 4JKTA 1S0WA 1KGEA 5EM0A 4E04A 5FQIA 2VLGA 1UWPX 1MWSA 3BY9A 3FYZA 2PYRA 3VOYA 1O7EA 1ZC2A 2WZXA 1FSYA 1G28A 3OPRA 4CPKA 2Y2MA 3W2ZA 1RCJA 1KGFA 3IHAA 5F1GA 3IXHA 2IWBA 4KQOA 4IHQA 4LPZA 4I38A 5MC7A 4KQDA 3KYZA 1NY0A 4WLAA 4GHIA 2HP6A 4ETZA 3RXWA 2ZM2A 3SH7A 4L9EA 3H82B 4R3AA 4EU0A 4IUKA 2B95A 4ID4A 5HARA 2J9PA 4Z9QA 5HAQA 1G6AA 2A49A 2W1TA 2WYXA 2E8IA 3BQ8A 4P85A 3GECA 4OOLA 4LCLA 5KZHA 1ES4A 3EQUA 1OTEA 3HBRA 3IF6A 1FR1A 3T4JA 2H0YA 2PD7A 4B4XA 3LR5A 1LHYA 3MXQA 1Z6FA 1DP6A 4UEYA 2J7VA 4O8GA 4MNRA 4N9KA 3V3SA 4KQQA 1FCOA 2RL3A 4KQRA 4HESA 4UHUA 3LI9A 3Q81A 2W1TB 1VQQA 4U3TA 4Y0OA 4EUZA 1ES5A 2K31A 3F1OA 4GOGA 1FCNA 1NWZA 3NY4A 4JBFA 3HL9A 5L2FA 1MKIA 3PTEA 2QYBA 3C5AA 1LL8A 4XXRA 4JGOA 2OWJA 4X68A 1HLUP 2K7SA 3BFDA 1YQSA 2ZQDA 4CQHA 2Y2NA 4EESA 5HL1A 1H8YA 5CEBA 3BECA 3SH9A 3NBLA 5AQBA 1FOFA 3ZHHA 1OTIA 2D01A 4HIAA 1XFQA 4HEFA 3QP4A 3CPTA 4Y2FA 3LR4A 4HQAA 2ZC7A 1EI5A 2XSSA 4KUKA 1YT4A 2ZM8A 4ZBEA 1N9LA 3MZDA 4O7DA 3UB6A 1PZOA 1EWZA 4LFUA 1P9RA 3VFHA 4K08A 1K55A 3GDIA 4UQIS 3O86A 3MZFA 3QHYA 2HDQA 1MWUA 2V0WA 3JVUA 4QPRA 1H0MA 4B9OA 3IS2B 5FDHA 3KYEA 4I39A 3S7PA 1L2SA 1E3UD 1RGZA 5A93A 4LV1A 2EXAA 3FZCA 4MN5A 3OBFA 4OPYA 3DTMA 2V8FA 3AGEA 3S7QA 3GR2A 4CLCA 5DTKA 5F1FA 3DW0A 1ALQA 3C7UA 4X56A 4GS9B 5A8BA 3E4QA 2E8JA 2W3HA 1G6OA 2J80A 3GMWA 2PBYA 3RFBA 3D72A 2Z2LB 2QMIA 3MFDA 1GCEA 4O0PA 1V9ZA 3VFFA 5DTTA 4DE1A 5FQMA 5A91A 4GJ4A 4JXWA 4NXFA 1ZG6A 3HREA 3VP0A 1XGJA 5L09A 1LT0A 3NDGA 1A0KA 2GDNA 4ZRRA 2JHEA 1MC0A 4LRZE 4Q8IA 3TRCA 1S4RA 2ZD8A 3QP1A 1KE4A 4WYYA 4S2NA 3UB7A 3NDEA 5FQQA 3UPPA 4NXGA 4Q0HA 1DJAA 1Q2PA 5HWWA 1TD5A 2XQZA 2ZC6B 4GDNA 3P98A 2LB5A 4WBGA 3F1PB 1S1ZA 4RYEA 4UA7A 1CEFA 3HLFA 2VX8A 2HZ5A 4HH2A 3F1OB 5L10A 2R9XA 1ACFA 4GD6A 4LRYC 3A0SA 3B33A 5G4YA 5F83A 2YKFA 4BL2A 2FFFB 3LIFA 4S2OA 3BYDA 5M19A 2PT7A 1LL9A 3KSIA 5A90A 3ITBA 3R7WA 3HLBA 3VE4A 1VB6A 4EEUA 1QMEA 1F98A 3S4XA 4KENB 3V39A 2ZQAA 3HVFA 2PYPA 2W0NA 4ZJ1A 1MKMA 3T1QB 2WKPA 4EWFA 3G30A 3E4OA 2XRNA 4BD0A 4JXVA 3C7VA 1KE3A 2I72A 1K54A 4CLCC 3NULA 4GB7A 2XEPA 3HLCA 4EERA 1GHIA 1YKDA 4PM9A 4YINA 1J9MA 3ULFA 4BBVA 3B3XA 3T4SA 3MZEA 5IHVA 3ZG5A 3M2JA 1GSWA 2Y2PA 4WZ4A 5HL6A 4F3LB 4ZDXA 5CTNA 3E4PA 5AQ9A 3MFXA 5FAPA 1YLYA 2ZC5B 5FEFA
chains in the Genus database with same CATH topology
2WKHA 3LY3A 2JCHA 5E2GA 3LO7A 1ZKJA 3OZHA 4FD8A 5FATA 2FFYA 2XD5A 4JPMA 4E3MA 5FSRA 1GHMA 1MBLA 1L0EA 4N1HA 1GA9A 1PZPA 1VM1A 2H10A 2Y2GA 2QPNA 2Y2QA 3BLSA 3SS4A 4DF6A 2Y2KA 4K0XA 4F94A 5M18A 1K56D 1YLTA 4KZ7A 5E2EA 2HDSA 1I5QA 2WGIA 1PW8A 4N9LA 4BJPA 1BT5A 3OCNA 3M6BA 3TSGA 1HD8A 1NRFA 3FV7A 3N8LA 1IYQA 5U47A 4KZ9A 4OLDA 4WEJA 4P6BA 5FI7A 5GLBA 1ERMA 4JKTA 1S0WA 1KGEA 4KZ4A 1U60A 1IELA 1IEMA 3G2ZA 5EOEA 3AGDA 5FQIA 2UWXA 1NYMA 1MWSA 1IYSA 2Y91A 3FYZA 3VOYA 1O7EA 1ZC2A 2WZXA 3OC2A 4KZ3A 1FSYA 3BFEA 3GTCA 3OPRA 5DF8A 2WGWA 1KVMA 4CPKA 4QY6A 2Y2MA 3BM6A 2Q9NA 1RCJA 1KGFA 3IHAA 5F1GA 3IXHA 2IWBA 4KQOA 2ZMAA 1E3UA 1BLHA 1K6SA 4S2LA 3Q07A 2V2FF 3BLMA 1NY0A 1L0GA 4Y7PA 2HP6A 1M6KA 1Q2QA 3HLGA 1K56A 3IT9A 4N92A 2WAEA 1TVFA 3C4OA 3RXWA 4MLLA 2ZM2A 2ZC3B 4ZTKA 3SH7A 3WS0A 1K25A 1DJBA 1EROA 3NC8A 1NZOA 4E6XA 3NI9A 1MPLA 3OCLA 4KZAA 3V50A 4DXBA 3VP2A 1BSGA 1PWGA 4ID4A 4LV2A 4GN2A 1NZUA 4BL3A 4S2IA 4C75A 3MXSA 5HARA 3TG9A 2C5WB 2J9PA 5AQAA 2V20A 4Z9QA 4EV4A 1K6RA 3UNWA 3SOIA 3A3JA 5EVLA 5HAQA 3PBNA 2XGNA 4PM6A 1G6AA 3VP1A 2A49A 2HDUA 1C3BA 5KMWA 1JWVA 2WYXA 2CC1A 2E8IA 1E4DA 1XKZA 4WZ5C 1K38A 3HUNA 4S2JA 4FCFA 4FH4A 1HZOA 1ESIA 4P85A 3IXBA 1WYCA 4PPRA 3FKWA 1JTDA 4OOLA 3S1YA 1DJCA 1XPBA 4LCLA 5KZHA 3HLDA 1ES4A 3IHBA 3EQUA 4OKPA 4LV0A 3VSLA 4R3BA 1CEGA 2Y2OA 3HBRA 3ISGA 3IF6A 1FR1A 5KSHA 3WS4A 3HUMA 5EVIC 5EVID 1GA0A 3OPLA 2WK0A 2G2WA 2H0YA 2J9OA 1PWDA 4OQGA 3UPNA 1LHYA 5CRFA 4B4XA 3PBSA 2WGVA 5CHUA 1N9BA 3G35A 1Z6FA 4IBRA 4GD8A 2ZJ9A 2J7VA 3IH9A 3D4FA 3GSGA 1YMXA 4MNRA 3S22A 4N9KA 4OH0A 5AQ7A 3N8SA 1LL5A 4S2KA 3V3SA 3VMAA 4QJGA 3WRZA 3GVBA 4KQQA 1FCOA 3ZFZA 2RL3A 4L0LA 4IVIA 4DDYA 4PM7A 2P9VB 4XUXA 3NIAA 4KQRA 1O07A 4HESA 4OOYA 4UHUA 1BTLA 4X55A 3Q81A 2Y2IA 1VQQA 4DDSA 4U3TA 3TOIA 2XFTA 2WKEA 4Y0OA 3UE3A 2BG1A 3N7WA 4R1GA 3NCKA 4U0XA 4OQIA 1ES5A 4PMAA 4EUZA 4GOGA 5FQ9A 1FCNA 5GHYA 4R0QA 1CI9A 3NY4A 4R4RA 1ES2A 2B5RA 3SH8A 4JBFA 2H5SA 2QZ6A 3HL9A 5L2FA 1MKIA 4MBKA 3PTEA 4UA9A 3UY6A 2PU4A 3C5AA 1LI9A 3IWOA 2P74A 4XXRA 1SDEA 3N8RA 3MKFA 3M6HA 4X68A 1NXYA 2JE5A 2P9VA 1N4OA 1KE0A 3ZG9B 1WYBA 4KZ5A 3BFDA 3V3RA 1YQSA 2EX2A 3WWXA 3AGFA 5CTMA 2ZQDA 5EPHA 4MEZA 5GL9A 3ITAA 3SS5A 1H8ZA 4E3IA 1PIOA 2Y2NA 4DRTA 4Y0UA 1HVBA 5HL1A 3UE0A 1H8YA 2Z2MB 2DNSA 5GLDA 4E3KA 5CEBA 3BECA 1XP4A 4E3JA 4EBNA 3SH9A 3A3EA 5CEDA 3NBLA 4K91A 3LY4A 3VP3A 3IF6C 5AQBA 1IKGA 1FOFA 4BLMA 3CG5A 3RXXA 3ZHHA 1W79A 1PI5A 1S6RA 3ZG8B 4OVDA 4XUZA 2IWDA 1W5DA 4RVAA 4HEFA 2HP5A 1RP5A 5FI6A 3P09A 4C6YA 4CJNA 4GNUA 4EQIA 2ZQ8A 3A3DA 5CHMA 1JWZA 2HP9A 2ZC7A 3UO9A 1EI5A 2R9WA 5HFOA 3RJUA 5F82A 1K4EA 1YT4A 2ZQCA 2ZM8A 4UA6A 5KSCA 2Y55A 4ZBEA 1IKIA 4KZ6A 2ZQ7A 3MZDA 4O7DA 1PZOA 1EWZA 2WZZA 1Y54A 4P87A 3VFHA 5I94A 3UDXA 3UDFA 5CGSA 5EVIA 4B4ZA 4RX2A 2X71A 4QY5A 2EX6A 1K55A 1LLBA 1DY6A 3IWQA 3GQZA 3MZFA 3O86A 4OPRA 3SS3A 1FR6A 3FKVA 4NETA 2WADA 3WS2A 3QHYA 4BQMA 1ES3A 4WELA 2HDQA 2Q9MA 1MWUA 3BFGA 4JF4A 3VSKA 1M40A 1QMFA 3HUOA 4OQ0A 1CI8A 1KDWA 1ERQA 1XXMA 3G31A 5M1AA 3UE1A 3UDIA 2G2UA 4K0WA 5FDHA 4MBFA 4BENA 4JXGA 1IYOA 4S2NC 3O87A 3V5MA 2BLSA 1L2SA 3UPOA 4OOMA 5DF9A 2J8YA 2ZQ9A 3IXGA 1E3UD 5GLAA 3VP4A 4FSFA 4JXSA 4DE3A 3BRMA 1KGGA 3Q7VA 1RGZA 5A93A 4LV1A 2EX9A 2EXAA 1SCWA 2OLUA 1E25A 4X6TA 3FZCA 3G4PA 1CK3A 1L0DA 3W4OA 1FCMA 5CGXA 4KG6A 4OP8A 3W8KA 5EVIB 4OPYA 3DTMA 1NYYA 2C6WB 3AGEA 4HBUA 1XA1A 2XF3A 3WS1A 3GR2A 1SHVA 3O3VA 3PBOA 5DTKA 2RCXA 1ONGA 5F1FA 4BD1A 2HPBA 2OV5A 5DF7A 2X01A 5E43A 3DW0A 3IF5A 1MWRA 3PBTA 3CJMA 1MWTA 2H0TA 5HAIA 3A3IA 1ALQA 5CECA 3C7UA 4X56A 5E2FA 2ZC5B 3GV9A 5FASA 1YLZA 5GHZA 1PWCA 5CXWA 3E2LA 1IYPA 2WGWB 4GDBA 4JF5A 4NK3A 2IWCA 2WKIA 2HDRA 4YFMA 4M3KA 3GMWA 4U0TA 1BULA 2PBYA 1K55C 3G2YA 3G34A 2XLNA 4ZAMA 1KDSA 5FA7A 1BLCA 4E3LA 2DRWA 2XDMA 1MXOA 2Z2LB 4FH2A 2QMIA 3MFDA 3Q7VB 4DKIA 5FQKA 1K4FA 1GCEA 4OPZA 4DE2A 4ZJ3A 2EFXA 2X02A 4C3QA 5TGFA 4WZ5A 1FSWA 5DTTA 3VFFA 3HLWA 2WUQA 3PAEA 4S2PA 5EUAA 3LEZA 4DE1A 4LV3A 5FQMA 5A91A 4KZ8A 4X69A 4JXWA 3G32A 3A3FA 2JBFA 4PM5A 4E6WA 3ZNYA 5GHXA 1ZG6A 3DWKA 3HREA 4KG2A 5CERA 3VP0A 1XGJA 2XD1A 5DTSA 1LI0A 1YMSA 2Y2JA 1BLSA 3NDGA 4EBPA 1MY8A 2ZC4B 3IQAA 3N4IA 3N6IA 2GDNA 1I2SA 4ZJ2A 3ZNTA 4Q8IA 1ONHA 3OPHA 2XR0A 2ZD8A 3Q82A 5EOOA 5TR7A 3JYIA 4WMCD 1ESUA 1KE4A 4WYYA 4S2NA 3WRTA 3C4PA 3E2KA 4RA7A 2DCFA 1AXBA 3NDEA 3W4QA 5HW3A 1I2WA 5FQQA 3UPPA 1DJAA 2WAFA 2PU2A 1Q2PA 4GKUA 5DVAA 4OPQA 2ZC6B 2XQZA 1YLPA 4GDNA 4WMCA 2ZLYA 3P98A 2V1ZA 4WEKA 4WBGA 5EECA 5CHJA 4QHCA 4RYEA 1BZAA 3BFFA 4UA7A 1CEFA 3HLFA 4OLGA 5EE8A 4RX3A 5G18A 1BLPA 3IF6B 1XX2A 3O88A 2EFUA 4IVKA 3IXDA 2R9XA 5E2HA 5FQJA 4D2OA 4R23A 4GD6A 4N1XA 1RGYA 1W7FA 1XA7A 4Y0TA 4DE0A 1FQGA 4E3OA 1L0FA 5JYOA 1TDGA 4P0MA 3M2KA 1W8YA 5F83A 3VOZA 5HAPA 5CGWA 1PW1A 4LCMA 2OSUA 3ZG0A 4BL2A 2FFFB 4EBLA 4JF6A 1W8QA 4QD4A 4S2OA 4UAAA 3BYDA 5TFQA 1NJ4A 5M19A 1LL9A 4JLFA 3LCEA 1PI4A 4DXCA 5A90A 1HTZA 2Y4AA 3ITBA 3HLBA 5BOHA 1YM1A 1YLJA 4PM8A 1SKFA 2Y2HA 4H8RA 1K57C 1WE4A 3EQVA 2VGJA 5A92A 1TDLA 1QMEA 3FWLA 3MXRA 2XH9A 4MBHA 4GZBA 3ZDJA 3GRJA 4KG5A 4KZBA 3S4XA 3BEBA 3ZCZA 4KENB 2Y2LA 3MKEA 2EX8A 5FI2A 3WS5A 3ZVWA 3V39A 3CZDA 4E3NA 3BFCA 2ZQAA 3HVFA 2JC7A 4ZJ1A 1JTGA 5FAQA 4QU3A 4S2MA 5GLCA 4EWFA 3G30A 1SDNA 4BD0A 1KVLA 4JXVA 4IEDA 5D3OA 5HX9A 3W4PA 1G68A 3ZGAB 3QNCA 3C7VA 3OPPA 1KE3A 4A5RA 2I72A 1K54A 4R4SA 2VGKA 1GHPA 1TEMA 3Q7ZA 4IBXA 4GB7A 2XEPA 3HLCA 4OONA 3Q1FA 4LENA 4HBTA 3QNBA 1GHIA 3UN7A 4R3JA 3IWIA 1K54C 2Y59A 4X53A 2ZM0A 1K57A 1PYYA 2EXBA 1JVJA 4PM9A 4YINA 4QB8A 2OLVA 1J9MA 1YLWA 3B3XA 3IH8A 1OMEA 3HLEA 3PBRA 3MBZA 3MZEA 1JWPA 5IHVA 4B88A 1BUEA 4WM9A 3ZVTA 3ZG5A 1H5XA 3PBQA 3PAGA 3CMZA 4OP5A 5FAOA 3M2JA 2Y2PA 4WZ4A 3I7JA 2A3UA 2XK1A 5JYPA 1XGIA 3ZG7B 4ZDXA 3DWZA 4OQHA 5CTNA 1ZG4A 5AQ9A 5FAPA 1YLYA 2XFSA 5J8XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WKH A;  3LY3 A;  2JCH A;  5E2G A;  3LO7 A;  1ZKJ A;  3OZH A;  4FD8 A;  5FAT A;  2FFY A;  2XD5 A;  4JPM A;  4E3M A;  5FSR A;  1GHM A;  1MBL A;  1L0E A;  4N1H A;  1GA9 A;  1PZP A;  1VM1 A;  2H10 A;  2Y2G A;  2QPN A;  2Y2Q A;  3BLS A;  3SS4 A;  4DF6 A;  2Y2K A;  4K0X A;  4F94 A;  5M18 A;  1K56 D;  1YLT A;  4KZ7 A;  5E2E A;  2HDS A;  1I5Q A;  2WGI A;  1PW8 A;  4N9L A;  4BJP A;  1BT5 A;  3OCN A;  3M6B A;  3TSG A;  1HD8 A;  1NRF A;  3FV7 A;  3N8L A;  1IYQ A;  5U47 A;  4KZ9 A;  4OLD A;  4WEJ A;  4P6B A;  5FI7 A;  5GLB A;  1ERM A;  4JKT A;  1S0W A;  1KGE A;  4KZ4 A;  1U60 A;  1IEL A;  1IEM A;  3G2Z A;  5EOE A;  3AGD A;  5FQI A;  2UWX A;  1NYM A;  1MWS A;  1IYS A;  2Y91 A;  3FYZ A;  3VOY A;  1O7E A;  1ZC2 A;  2WZX A;  3OC2 A;  4KZ3 A;  1FSY A;  3BFE A;  3GTC A;  3OPR A;  5DF8 A;  2WGW A;  1KVM A;  4CPK A;  4QY6 A;  2Y2M A;  3BM6 A;  2Q9N A;  1RCJ A;  1KGF A;  3IHA A;  5F1G A;  3IXH A;  2IWB A;  4KQO A;  2ZMA A;  1E3U A;  1BLH A;  1K6S A;  4S2L A;  3Q07 A;  2V2F F;  3BLM A;  1NY0 A;  1L0G A;  4Y7P A;  2HP6 A;  1M6K A;  1Q2Q A;  3HLG A;  1K56 A;  3IT9 A;  4N92 A;  2WAE A;  1TVF A;  3C4O A;  3RXW A;  4MLL A;  2ZM2 A;  2ZC3 B;  4ZTK A;  3SH7 A;  3WS0 A;  1K25 A;  1DJB A;  1ERO A;  3NC8 A;  1NZO A;  4E6X A;  3NI9 A;  1MPL A;  3OCL A;  4KZA A;  3V50 A;  4DXB A;  3VP2 A;  1BSG A;  1PWG A;  4ID4 A;  4LV2 A;  4GN2 A;  1NZU A;  4BL3 A;  4S2I A;  4C75 A;  3MXS A;  5HAR A;  3TG9 A;  2C5W B;  2J9P A;  5AQA A;  2V20 A;  4Z9Q A;  4EV4 A;  1K6R A;  3UNW A;  3SOI A;  3A3J A;  5EVL A;  5HAQ A;  3PBN A;  2XGN A;  4PM6 A;  1G6A A;  3VP1 A;  2A49 A;  2HDU A;  1C3B A;  5KMW A;  1JWV A;  2WYX A;  2CC1 A;  2E8I A;  1E4D A;  1XKZ A;  4WZ5 C;  1K38 A;  3HUN A;  4S2J A;  4FCF A;  4FH4 A;  1HZO A;  1ESI A;  4P85 A;  3IXB A;  1WYC A;  4PPR A;  3FKW A;  1JTD A;  4OOL A;  3S1Y A;  1DJC A;  1XPB A;  4LCL A;  5KZH A;  3HLD A;  1ES4 A;  3IHB A;  3EQU A;  4OKP A;  4LV0 A;  3VSL A;  4R3B A;  1CEG A;  2Y2O A;  3HBR A;  3ISG A;  3IF6 A;  1FR1 A;  5KSH A;  3WS4 A;  3HUM A;  5EVI C;  5EVI D;  1GA0 A;  3OPL A;  2WK0 A;  2G2W A;  2H0Y A;  2J9O A;  1PWD A;  4OQG A;  3UPN A;  1LHY A;  5CRF A;  4B4X A;  3PBS A;  2WGV A;  5CHU A;  1N9B A;  3G35 A;  1Z6F A;  4IBR A;  4GD8 A;  2ZJ9 A;  2J7V A;  3IH9 A;  3D4F A;  3GSG A;  1YMX A;  4MNR A;  3S22 A;  4N9K A;  4OH0 A;  5AQ7 A;  3N8S A;  1LL5 A;  4S2K A;  3V3S A;  3VMA A;  4QJG A;  3WRZ A;  3GVB A;  4KQQ A;  1FCO A;  3ZFZ A;  2RL3 A;  4L0L A;  4IVI A;  4DDY A;  4PM7 A;  2P9V B;  4XUX A;  3NIA A;  4KQR A;  1O07 A;  4HES A;  4OOY A;  4UHU A;  1BTL A;  4X55 A;  3Q81 A;  2Y2I A;  1VQQ A;  4DDS A;  4U3T A;  3TOI A;  2XFT A;  2WKE A;  4Y0O A;  3UE3 A;  2BG1 A;  3N7W A;  4R1G A;  3NCK A;  4U0X A;  4OQI A;  1ES5 A;  4PMA A;  4EUZ A;  4GOG A;  5FQ9 A;  1FCN A;  5GHY A;  4R0Q A;  1CI9 A;  3NY4 A;  4R4R A;  1ES2 A;  2B5R A;  3SH8 A;  4JBF A;  2H5S A;  2QZ6 A;  3HL9 A;  5L2F A;  1MKI A;  4MBK A;  3PTE A;  4UA9 A;  3UY6 A;  2PU4 A;  3C5A A;  1LI9 A;  3IWO A;  2P74 A;  4XXR A;  1SDE A;  3N8R A;  3MKF A;  3M6H A;  4X68 A;  1NXY A;  2JE5 A;  2P9V A;  1N4O A;  1KE0 A;  3ZG9 B;  1WYB A;  4KZ5 A;  3BFD A;  3V3R A;  1YQS A;  2EX2 A;  3WWX A;  3AGF A;  5CTM A;  2ZQD A;  5EPH A;  4MEZ A;  5GL9 A;  3ITA A;  3SS5 A;  1H8Z A;  4E3I A;  1PIO A;  2Y2N A;  4DRT A;  4Y0U A;  1HVB A;  5HL1 A;  3UE0 A;  1H8Y A;  2Z2M B;  2DNS A;  5GLD A;  4E3K A;  5CEB A;  3BEC A;  1XP4 A;  4E3J A;  4EBN A;  3SH9 A;  3A3E A;  5CED A;  3NBL A;  4K91 A;  3LY4 A;  3VP3 A;  3IF6 C;  5AQB A;  1IKG A;  1FOF A;  4BLM A;  3CG5 A;  3RXX A;  3ZHH A;  1W79 A;  1PI5 A;  1S6R A;  3ZG8 B;  4OVD A;  4XUZ A;  2IWD A;  1W5D A;  4RVA A;  4HEF A;  2HP5 A;  1RP5 A;  5FI6 A;  3P09 A;  4C6Y A;  4CJN A;  4GNU A;  4EQI A;  2ZQ8 A;  3A3D A;  5CHM A;  1JWZ A;  2HP9 A;  2ZC7 A;  3UO9 A;  1EI5 A;  2R9W A;  5HFO A;  3RJU A;  5F82 A;  1K4E A;  1YT4 A;  2ZQC A;  2ZM8 A;  4UA6 A;  5KSC A;  2Y55 A;  4ZBE A;  1IKI A;  4KZ6 A;  2ZQ7 A;  3MZD A;  4O7D A;  1PZO A;  1EWZ A;  2WZZ A;  1Y54 A;  4P87 A;  3VFH A;  5I94 A;  3UDX A;  3UDF A;  5CGS A;  5EVI A;  4B4Z A;  4RX2 A;  2X71 A;  4QY5 A;  2EX6 A;  1K55 A;  1LLB A;  1DY6 A;  3IWQ A;  3GQZ A;  3MZF A;  3O86 A;  4OPR A;  3SS3 A;  1FR6 A;  3FKV A;  4NET A;  2WAD A;  3WS2 A;  3QHY A;  4BQM A;  1ES3 A;  4WEL A;  2HDQ A;  2Q9M A;  1MWU A;  3BFG A;  4JF4 A;  3VSK A;  1M40 A;  1QMF A;  3HUO A;  4OQ0 A;  1CI8 A;  1KDW A;  1ERQ A;  1XXM A;  3G31 A;  5M1A A;  3UE1 A;  3UDI A;  2G2U A;  4K0W A;  5FDH A;  4MBF A;  4BEN A;  4JXG A;  1IYO A;  4S2N C;  3O87 A;  3V5M A;  2BLS A;  1L2S A;  3UPO A;  4OOM A;  5DF9 A;  2J8Y A;  2ZQ9 A;  3IXG A;  1E3U D;  5GLA A;  3VP4 A;  4FSF A;  4JXS A;  4DE3 A;  3BRM A;  1KGG A;  3Q7V A;  1RGZ A;  5A93 A;  4LV1 A;  2EX9 A;  2EXA A;  1SCW A;  2OLU A;  1E25 A;  4X6T A;  3FZC A;  3G4P A;  1CK3 A;  1L0D A;  3W4O A;  1FCM A;  5CGX A;  4KG6 A;  4OP8 A;  3W8K A;  5EVI B;  4OPY A;  3DTM A;  1NYY A;  2C6W B;  3AGE A;  4HBU A;  1XA1 A;  2XF3 A;  3WS1 A;  3GR2 A;  1SHV A;  3O3V A;  3PBO A;  5DTK A;  2RCX A;  1ONG A;  5F1F A;  4BD1 A;  2HPB A;  2OV5 A;  5DF7 A;  2X01 A;  5E43 A;  3DW0 A;  3IF5 A;  1MWR A;  3PBT A;  3CJM A;  1MWT A;  2H0T A;  5HAI A;  3A3I A;  1ALQ A;  5CEC A;  3C7U A;  4X56 A;  5E2F A;  2ZC5 B;  3GV9 A;  5FAS A;  1YLZ A;  5GHZ A;  1PWC A;  5CXW A;  3E2L A;  1IYP A;  2WGW B;  4GDB A;  4JF5 A;  4NK3 A;  2IWC A;  2WKI A;  2HDR A;  4YFM A;  4M3K A;  3GMW A;  4U0T A;  1BUL A;  2PBY A;  1K55 C;  3G2Y A;  3G34 A;  2XLN A;  4ZAM A;  1KDS A;  5FA7 A;  1BLC A;  4E3L A;  2DRW A;  2XDM A;  1MXO A;  2Z2L B;  4FH2 A;  2QMI A;  3MFD A;  3Q7V B;  4DKI A;  5FQK A;  1K4F A;  1GCE A;  4OPZ A;  4DE2 A;  4ZJ3 A;  2EFX A;  2X02 A;  4C3Q A;  5TGF A;  4WZ5 A;  1FSW A;  5DTT A;  3VFF A;  3HLW A;  2WUQ A;  3PAE A;  4S2P A;  5EUA A;  3LEZ A;  4DE1 A;  4LV3 A;  5FQM A;  5A91 A;  4KZ8 A;  4X69 A;  4JXW A;  3G32 A;  3A3F A;  2JBF A;  4PM5 A;  4E6W A;  3ZNY A;  5GHX A;  1ZG6 A;  3DWK A;  3HRE A;  4KG2 A;  5CER A;  3VP0 A;  1XGJ A;  2XD1 A;  5DTS A;  1LI0 A;  1YMS A;  2Y2J A;  1BLS A;  3NDG A;  4EBP A;  1MY8 A;  2ZC4 B;  3IQA A;  3N4I A;  3N6I A;  2GDN A;  1I2S A;  4ZJ2 A;  3ZNT A;  4Q8I A;  1ONH A;  3OPH A;  2XR0 A;  2ZD8 A;  3Q82 A;  5EOO A;  5TR7 A;  3JYI A;  4WMC D;  1ESU A;  1KE4 A;  4WYY A;  4S2N A;  3WRT A;  3C4P A;  3E2K A;  4RA7 A;  2DCF A;  1AXB A;  3NDE A;  3W4Q A;  5HW3 A;  1I2W A;  5FQQ A;  3UPP A;  1DJA A;  2WAF A;  2PU2 A;  1Q2P A;  4GKU A;  5DVA A;  4OPQ A;  2ZC6 B;  2XQZ A;  1YLP A;  4GDN A;  4WMC A;  2ZLY A;  3P98 A;  2V1Z A;  4WEK A;  4WBG A;  5EEC A;  5CHJ A;  4QHC A;  4RYE A;  1BZA A;  3BFF A;  4UA7 A;  1CEF A;  3HLF A;  4OLG A;  5EE8 A;  4RX3 A;  5G18 A;  1BLP A;  3IF6 B;  1XX2 A;  3O88 A;  2EFU A;  4IVK A;  3IXD A;  2R9X A;  5E2H A;  5FQJ A;  4D2O A;  4R23 A;  4GD6 A;  4N1X A;  1RGY A;  1W7F A;  1XA7 A;  4Y0T A;  4DE0 A;  1FQG A;  4E3O A;  1L0F A;  5JYO A;  1TDG A;  4P0M A;  3M2K A;  1W8Y A;  5F83 A;  3VOZ A;  5HAP A;  5CGW A;  1PW1 A;  4LCM A;  2OSU A;  3ZG0 A;  4BL2 A;  2FFF B;  4EBL A;  4JF6 A;  1W8Q A;  4QD4 A;  4S2O A;  4UAA A;  3BYD A;  5TFQ A;  1NJ4 A;  5M19 A;  1LL9 A;  4JLF A;  3LCE A;  1PI4 A;  4DXC A;  5A90 A;  1HTZ A;  2Y4A A;  3ITB A;  3HLB A;  5BOH A;  1YM1 A;  1YLJ A;  4PM8 A;  1SKF A;  2Y2H A;  4H8R A;  1K57 C;  1WE4 A;  3EQV A;  2VGJ A;  5A92 A;  1TDL A;  1QME A;  3FWL A;  3MXR A;  2XH9 A;  4MBH A;  4GZB A;  3ZDJ A;  3GRJ A;  4KG5 A;  4KZB A;  3S4X A;  3BEB A;  3ZCZ A;  4KEN B;  2Y2L A;  3MKE A;  2EX8 A;  5FI2 A;  3WS5 A;  3ZVW A;  3V39 A;  3CZD A;  4E3N A;  3BFC A;  2ZQA A;  3HVF A;  2JC7 A;  4ZJ1 A;  1JTG A;  5FAQ A;  4QU3 A;  4S2M A;  5GLC A;  4EWF A;  3G30 A;  1SDN A;  4BD0 A;  1KVL A;  4JXV A;  4IED A;  5D3O A;  5HX9 A;  3W4P A;  1G68 A;  3ZGA B;  3QNC A;  3C7V A;  3OPP A;  1KE3 A;  4A5R A;  2I72 A;  1K54 A;  4R4S A;  2VGK A;  1GHP A;  1TEM A;  3Q7Z A;  4IBX A;  4GB7 A;  2XEP A;  3HLC A;  4OON A;  3Q1F A;  4LEN A;  4HBT A;  3QNB A;  1GHI A;  3UN7 A;  4R3J A;  3IWI A;  1K54 C;  2Y59 A;  4X53 A;  2ZM0 A;  1K57 A;  1PYY A;  2EXB A;  1JVJ A;  4PM9 A;  4YIN A;  4QB8 A;  2OLV A;  1J9M A;  1YLW A;  3B3X A;  3IH8 A;  1OME A;  3HLE A;  3PBR A;  3MBZ A;  3MZE A;  1JWP A;  5IHV A;  4B88 A;  1BUE A;  4WM9 A;  3ZVT A;  3ZG5 A;  1H5X A;  3PBQ A;  3PAG A;  3CMZ A;  4OP5 A;  5FAO A;  3M2J A;  2Y2P A;  4WZ4 A;  3I7J A;  2A3U A;  2XK1 A;  5JYP A;  1XGI A;  3ZG7 B;  4ZDX A;  3DWZ A;  4OQH A;  5CTN A;  1ZG4 A;  5AQ9 A;  5FAP A;  1YLY A;  2XFS A;  5J8X A; 
#chains in the Genus database with same CATH topology
 3EEA A;  3VOL A;  2JCH A;  4ARZ B;  3OZH A;  4FD8 A;  4M4X A;  2XD5 A;  4JPM A;  4E3M A;  1GHM A;  2VK3 A;  2PR5 A;  4GS9 A;  2Y2G A;  4DF6 A;  2QPN A;  4F94 A;  5HDS A;  5LBR A;  5E2E A;  2HDS A;  2WGI A;  1BT5 A;  3BW6 A;  4BMW A;  3TSG A;  1NRF A;  3FV7 A;  5HPF A;  5L8M A;  2KOI A;  1IEM A;  5EOE A;  3AGD A;  5J3W A;  1NYM A;  5FDS A;  3EEH A;  4MN6 A;  3OC2 A;  4HY8 A;  3BFE A;  3GTC A;  3BM6 A;  2EA9 A;  1E3U A;  4S2L A;  1YAX A;  3QP8 A;  1L0G A;  3CI6 A;  4XT2 B;  3IT9 A;  1YSQ A;  1TVF A;  1BYW A;  1K25 A;  1ERO A;  4IUH A;  4E6X A;  3NI9 A;  4FOF A;  2O9A A;  3OCL A;  4DXB A;  4H6J A;  3VP2 A;  4LV2 A;  4BL3 A;  4S2I A;  4C75 A;  2QKP A;  3MXS A;  3TG9 A;  2W3D A;  5AQA A;  1K6R A;  3UNW A;  3SOI A;  5EVL A;  3PHY A;  3VP1 A;  3UB8 A;  1C3B A;  1E4D A;  1XKZ A;  4R38 A;  2KLI A;  4AFI A;  3HUN A;  5HPI A;  4FCF A;  4FH4 A;  4PPR A;  2JKR I;  1DJC A;  4OKP A;  4R3B A;  1CEG A;  2PD8 A;  3WS4 A;  2J9O A;  4OQG A;  1PWD A;  4X1L A;  3S7O A;  2W27 A;  5IU1 A;  1OJG A;  3IH9 A;  2PDR A;  2L1M A;  3D4F A;  3GSG A;  1YMX A;  5AQ7 A;  3VMA A;  1P97 A;  1J3W A;  2O99 A;  4HI4 A;  4HJ6 A;  3UME A;  4LRX C;  1MZU A;  2JN7 A;  4IVI A;  4PM7 A;  4NG2 A;  4XUX A;  1BTL A;  1TS7 A;  4X55 A;  3UE3 A;  4R1G A;  3TE8 A;  1CI9 A;  2B5R A;  4UA9 A;  2PU4 A;  2ZL1 A;  3R7W B;  2P74 A;  1NXY A;  1KOU A;  1N4O A;  3ZG9 B;  5FEG A;  5EPH A;  5GL9 A;  1H8Z A;  4E3I A;  4Y0U A;  3UE0 A;  5GLD A;  2DNS A;  1XP4 A;  4E3J A;  2WKR A;  2A2L A;  3IF6 C;  4BLM A;  3CG5 A;  3RXX A;  4GCZ A;  2XA7 M;  1W79 A;  5HWT A;  4XUZ A;  5AVF A;  2HP5 A;  3G6O A;  3P09 A;  1XJ4 A;  4GNU A;  3A3D A;  1JWZ A;  2HP9 A;  5HFO A;  5F82 A;  1GSX A;  2ZQ7 A;  1TS6 A;  2D02 A;  1ZHH B;  3BWL A;  1Y54 A;  4P87 A;  1CQA A;  5HWV A;  5I94 A;  4CLC E;  5EVI A;  1H3Q A;  3FG8 A;  2X71 A;  4QY5 A;  4EUV A;  1LLB A;  1DY6 A;  3IWQ A;  3FKV A;  4NET A;  1F9I A;  1ES3 A;  4WEL A;  3H82 A;  4JF4 A;  5KIZ A;  1QMF A;  2WKQ A;  3G31 A;  2MJ6 A;  3UE1 A;  1OTB A;  2A24 B;  4EET B;  3FC7 A;  4L9F A;  3IBJ A;  2I9V A;  4DJ2 A;  2P04 A;  3UPO A;  2J8Y A;  3VP4 A;  3LEQ A;  4DE3 A;  3BRM A;  1KGG A;  3Q7V A;  3T1S A;  4ARZ A;  1L0D A;  3W4O A;  1FCM A;  5CGX A;  4KG6 A;  5EVI B;  2C6W B;  4HBU A;  3WS1 A;  4FUW A;  2J3W A;  2X01 A;  3IF5 A;  3T4Q A;  1MWR A;  5HAI A;  3CJM A;  1Z09 A;  2H0T A;  1VEU B;  2W3F A;  3LIB A;  3GV9 A;  5CXW A;  5J7E A;  4GDB A;  3D3O A;  5TJJ A;  5HZH A;  2HDR A;  2VV8 A;  4M3K A;  3JPU A;  1K55 C;  4FH2 A;  1SKO A;  3MQO A;  2EFX A;  2X02 A;  5TGF A;  4MMN A;  2WUQ A;  3IS2 A;  4X69 A;  3G32 A;  1XFN A;  5GHX A;  3DWK A;  4WN5 A;  4EW7 A;  5CER A;  2XD1 A;  5DTS A;  3UB5 P;  2Y2J A;  1MY8 A;  3IQA A;  3N4I A;  3LIA A;  2P08 A;  2O9B A;  3ZNT A;  1ONH A;  1EW0 A;  2XR0 A;  3OPH A;  3Q82 A;  3JYI A;  3DTK A;  3C4P A;  4RA7 A;  3W4Q A;  1I2W A;  2WAF A;  5DVA A;  3T4L A;  2ZLY A;  4Q0J A;  1LSW A;  5EEC A;  5CHJ A;  4EEP A;  2PAV P;  3BFF A;  2KDK A;  3B47 A;  4RX3 A;  5G18 A;  3IF6 B;  2V1A A;  5FQJ A;  3IBR A;  4N1X A;  1RGY A;  1XA7 A;  1FQG A;  4E3O A;  1L0F A;  4YNR A;  5F5Y A;  5CGW A;  3UB9 A;  4LCM A;  3ZG0 A;  3EGX C;  4YWZ A;  4JF6 A;  5TFQ A;  1OJ5 A;  1FIK A;  2Y4A A;  1YM1 A;  1YLJ A;  1SKF A;  2Y2H A;  2ZOH A;  2HJ9 C;  2VGJ A;  1TDL A;  1NLZ A;  3ZDJ A;  2V1B A;  4KZB A;  3BEB A;  3ZCZ A;  3L9K A;  2QJ5 A;  3MKE A;  5F68 A;  4E3N A;  3BFC A;  4QU3 A;  4ETX A;  2Z6C A;  1TF1 A;  5D3O A;  4IED A;  4HP4 A;  3W4P A;  1D1J A;  3ZGA B;  3QNC A;  2LB9 A;  4LEN A;  4HBT A;  4Z1W A;  4R3J A;  3IWI A;  1K54 C;  1K57 A;  2EXB A;  2EWV A;  3DTE A;  1LSV A;  1OME A;  4BBT A;  1JWP A;  4B88 A;  3PAG A;  4OP5 A;  4CLC B;  1FIL A;  1WA9 A;  1XGI A;  2ZMF A;  4OQH A;  4UQI M;  1P0Z A;  4JGP A;  1OPX A;  1STZ A;  3LO7 A;  5FAT A;  2FFY A;  4Y5F A;  1L0E A;  3MR0 A;  3HJI A;  1GA9 A;  3LUQ A;  2H10 A;  3SS4 A;  2VA0 A;  4K0X A;  1YLT A;  4XT2 A;  4KZ7 A;  1T1A A;  3TW8 A;  1I5Q A;  4N9L A;  3MQ0 A;  3OCN A;  3M6B A;  4WUJ A;  3N8L A;  1IYQ A;  3PR6 A;  3KYQ A;  1ERM A;  3G2Z A;  1PNE A;  2UWX A;  2V8C A;  4MCW A;  2Y91 A;  4HJ4 A;  5F6A A;  1KVM A;  5HD5 A;  3OLO A;  1F2K A;  2ZMA A;  1BLH A;  2AVX A;  4NEE D;  1CF0 A;  2PR6 A;  2JKT M;  3HLG A;  4N92 A;  1K56 A;  3C38 A;  2W1R A;  2P7J A;  3C4O A;  1D06 A;  4MLL A;  2PBD P;  2ZC3 B;  3WS0 A;  3NC8 A;  4GLQ A;  4KZA A;  1XJ3 A;  5EVE A;  4P6Z S;  1PWG A;  4GN2 A;  4HH3 A;  2C5W B;  4EV4 A;  2V20 A;  3A3J A;  3PBN A;  2XGN A;  4G3K A;  1JWV A;  2CC1 A;  3C8C A;  4WZ5 C;  2VV7 A;  5EV0 A;  3CUE C;  4S2J A;  1WYC A;  3C30 A;  3R4K A;  2V0U A;  1XPB A;  3LID A;  3IHB A;  3U4L P;  3VSL A;  2XRO A;  2Y2O A;  3NOU C;  2JKF A;  5EVI D;  1GA0 A;  5EM1 A;  3OPL A;  2O0Y A;  2QHK A;  4R70 A;  3PBS A;  2WGV A;  1N9B A;  4GD8 A;  3S22 A;  4OH0 A;  5DJU A;  3N8S A;  1LL5 A;  4JGQ A;  4QJG A;  4PKY A;  4L0L A;  2P9V B;  2M7V A;  1O07 A;  4DDS A;  2K2N A;  2WKE A;  2BG1 A;  1T18 A;  4U0X A;  3LI8 A;  4PMA A;  2HF6 A;  4R0Q A;  2FZ0 A;  2H5S A;  2QZ6 A;  3LIE A;  4HJ3 A;  1LI9 A;  3MKF A;  3D9Y A;  3M6H A;  1DP9 A;  2JE5 A;  2HGV A;  1KE0 A;  1WYB A;  4KZ5 A;  3V3R A;  2EX2 A;  3K3C A;  5CTM A;  3ITA A;  3SS5 A;  1PIO A;  4DRT A;  3CPT B;  1HVB A;  2Z2M B;  4PAU A;  5CED A;  3A3E A;  1ODV A;  1UWN X;  3IX4 A;  4K91 A;  3LY4 A;  3VP3 A;  1IKG A;  4BWI A;  1S6R A;  1W5D A;  3CAX A;  4RVA A;  5HD3 A;  4CJN A;  4EQI A;  5CHM A;  2M1C A;  3UO9 A;  2R9W A;  3RJU A;  4GHI B;  5KSC A;  4FTX A;  1IKI A;  4KZ6 A;  4Y15 A;  2Z6D A;  3K3D A;  3UDF A;  3MMH A;  5CGS A;  3LGO A;  1FR6 A;  2M7U A;  2Q9M A;  3VSK A;  1M40 A;  4OQ0 A;  1CI8 A;  1KDW A;  1XXM A;  2G2U A;  1VHM A;  4MBF A;  4BEN A;  1IYO A;  4S2N C;  3O87 A;  3V5M A;  2J3T C;  5DF9 A;  5DKL A;  5GLA A;  4GW9 A;  1PFL A;  2EX9 A;  3T4T A;  2ZOI A;  2OLU A;  3G4P A;  3E98 A;  4OP8 A;  3V67 A;  3W8K A;  2O9C A;  1NYY A;  2ZMV A;  2XF3 A;  4JGR A;  3PBO A;  2RCX A;  2Q0O A;  4BD1 A;  3LR3 A;  1T1B A;  2FH5 A;  3PBT A;  5AJG A;  1MWT A;  1X0O A;  2GNX A;  5FAS A;  1YPR A;  4LGW A;  1PWC A;  4D60 A;  3E2L A;  2WGW B;  2WKI A;  4YFM A;  3K2N A;  4U0T A;  1BUL A;  3G2Y A;  3G34 A;  1KDS A;  4E3L A;  2DRW A;  3Q7V B;  3RTY A;  4DKI A;  4F3L A;  1Y4O A;  1FSW A;  3HLW A;  3PAE A;  4S2P A;  3P7N A;  3LEZ A;  4LV3 A;  5L07 A;  5TBM A;  3A3F A;  2JBF A;  4PM5 A;  3ZNY A;  4KG2 A;  1T19 A;  4EBP A;  2ZC4 B;  3N6I A;  4MN7 A;  2V9A A;  5F69 A;  5EOO A;  1OTD A;  1D7E A;  3WRT A;  3E2K A;  2DCF A;  5HW3 A;  3JVV A;  2PU2 A;  4GKU A;  2ACG A;  2V1Z A;  2OWH A;  3UE6 A;  5IS1 A;  3LR0 A;  1BZA A;  1S4S A;  5EE8 A;  4OLG A;  3EGD C;  3KSH A;  1BLP A;  1S66 L;  4IVK A;  5E2H A;  4D2O A;  4R23 A;  1W7F A;  4Y0T A;  4DE0 A;  4P0M A;  1W8Y A;  5HAP A;  2A24 A;  1PW1 A;  2OSU A;  4EBL A;  3LIC A;  1T1C A;  3U2A A;  4JLF A;  3LCE A;  3KSG A;  1HTZ A;  5BOH A;  1GSV A;  3EQV A;  3IX3 A;  3MXR A;  2XH9 A;  3C2W A;  3GRJ A;  4KG5 A;  2Y2L A;  2EX8 A;  3MF0 A;  4I3J A;  3CZD A;  1JTG A;  1S67 L;  5EFW A;  2DMW A;  4BBU A;  1SDN A;  1KVL A;  4P6Z M;  5HX9 A;  1G68 A;  2GZA A;  2L0W A;  4A5R A;  3ZQ5 A;  2VGK A;  1TEM A;  1Y28 A;  3Q7Z A;  4IBX A;  2VGL M;  2NUT C;  4L9G A;  3QNB A;  4PKY G;  1NRJ A;  3UN7 A;  2OOL A;  2NUP C;  2ZM0 A;  1JVJ A;  3QP6 A;  3HCY A;  1YLW A;  4YOF A;  3MBZ A;  4X25 A;  1H5X A;  3PBQ A;  1IFQ A;  5FAO A;  2A3U A;  1VET A;  5JYP A;  3ZG7 B;  2VEA A;  1N9N A;  4EXO A;  2VGL S;  2G7U A;  5FSR A;  5HDD A;  1PZP A;  2Y2Q A;  2Y2K A;  5M18 A;  1K56 D;  1PW8 A;  3MS6 A;  3NOT C;  1HD8 A;  5U47 A;  4KZ9 A;  5HDC A;  4OLD A;  4WEJ A;  4I3A A;  4NKP A;  4KZ4 A;  1U60 A;  1IEL A;  1IYS A;  1H8M A;  4KZ3 A;  5DF8 A;  3HJK A;  2WGW A;  4QY6 A;  2Q9N A;  5J8X A;  1K6S A;  2YKH A;  4WL9 A;  1V9Y A;  3Q07 A;  2V2F F;  3BLM A;  4Y7P A;  1M6K A;  1Q2Q A;  2WAE A;  4QWO A;  2VKS A;  4ZTK A;  1DJB A;  5CX7 A;  1NZO A;  1MPL A;  1TS8 A;  3V50 A;  2Y79 A;  1BSG A;  3VE3 A;  3H9W A;  1NZU A;  4RQ9 A;  4DJ3 A;  3S7N A;  1NLY A;  3QP5 A;  4PM6 A;  2HDU A;  5KMW A;  4WF0 A;  1K38 A;  3L7H A;  1HZO A;  1ESI A;  3IXB A;  3FKW A;  1JTD A;  3S1Y A;  3HLD A;  4LV0 A;  3T50 A;  5DKK A;  3DAV A;  3ISG A;  2HJE A;  5KSH A;  3HUM A;  1K0K A;  4HHD A;  5EVI C;  2WK0 A;  2G2W A;  2JKG A;  3UPN A;  1UGU A;  5CRF A;  3T4O A;  1YSP A;  5CHU A;  3G35 A;  4IBR A;  2ZJ9 A;  1VET B;  1P9W A;  4S2K A;  2Y8H A;  3WRZ A;  3GVB A;  3ZFZ A;  4DDY A;  3QP2 A;  3NIA A;  1AWI A;  2JKR M;  4OOY A;  3VV4 A;  2B02 A;  3O5Y A;  2Y2I A;  3TOI A;  2QJ7 A;  2XFT A;  3N7W A;  3NCK A;  4OQI A;  5FQ9 A;  3TJZ C;  5GHY A;  4R4R A;  1ES2 A;  3SH8 A;  1SZV A;  4MBK A;  3UY6 A;  3IWO A;  4KUO A;  5C5K A;  1SDE A;  3N8R A;  3SZT A;  2CMN A;  1TS0 A;  2PRF A;  4B93 A;  1G5U A;  2P9V A;  3FPW A;  5I5L A;  4Y3I A;  3WWX A;  3AGF A;  4MEZ A;  3MSH A;  4ME4 A;  1F5M A;  4E3K A;  4LLO B;  4EBN A;  3DTI A;  5HSQ A;  1PI5 A;  3ZG8 B;  4OVD A;  2IA2 A;  2IWD A;  3KX0 X;  1RP5 A;  5FI6 A;  2ZQ8 A;  3CHW P;  3MQQ A;  2B18 A;  1K4E A;  2ZQC A;  4UA6 A;  2Y55 A;  2BAS A;  2WZZ A;  5FL3 A;  1SKO B;  3UDX A;  3OOV A;  4B4Z A;  4RX2 A;  3F1N A;  2EX6 A;  1LSX A;  3GQZ A;  4OPR A;  4X1M A;  3RH8 B;  3SS3 A;  3WS2 A;  2WAD A;  3B42 A;  4BQM A;  1CJF A;  3CIT A;  3BFG A;  3HUO A;  1ERQ A;  5M1A A;  3UDI A;  4K0W A;  4JXG A;  2BLS A;  3PYP A;  2J3T D;  4OOM A;  1L3L A;  2ZQ9 A;  3IXG A;  4FSF A;  2GJ3 A;  4JXS A;  4O01 A;  2ZL1 B;  1SCW A;  3E0Y A;  1E25 A;  4X6T A;  4HNB A;  1CK3 A;  3A0R A;  1XJ6 A;  1OT9 A;  5DFX A;  3NHQ A;  1OTA A;  4NXB A;  1XA1 A;  4IJG A;  1VEU A;  1SHV A;  3O3V A;  1ONG A;  2HPB A;  3BY8 A;  4R6L A;  2OV5 A;  5DF7 A;  5E43 A;  2VZW A;  3UMD A;  1N9O A;  3A3I A;  5CEC A;  4HOI A;  5E2F A;  1YLZ A;  5GHZ A;  2R78 A;  1IYP A;  1ZTU A;  4JF5 A;  4NK3 A;  2IWC A;  1OT6 A;  2OAP 1;  3DBA A;  3F1N B;  2XLN A;  4ZAM A;  5FA7 A;  1BLC A;  2XDM A;  1MXO A;  4PHT A;  4Y17 A;  4G3W A;  5FQK A;  1K4F A;  4OPZ A;  4DE2 A;  4ZJ3 A;  4C3Q A;  4WZ5 A;  3PXP A;  5EUA A;  4KZ8 A;  5AVE A;  4DMZ A;  4E6W A;  5DJT A;  1LI0 A;  1YMS A;  3A0V A;  4DN0 A;  1BLS A;  2GX5 A;  1I2S A;  4ZJ2 A;  1W63 Q;  3F1P A;  3LYX A;  1XJ2 A;  3SW1 A;  2JKT I;  5TR7 A;  2ZBB A;  3P01 A;  4I5S A;  1ESU A;  4WMC D;  2PHY A;  3NEC A;  4NXE A;  1AXB A;  3T1R A;  2VJW A;  2VV6 A;  4OPQ A;  1YLP A;  4WMC A;  4WEK A;  5G4Z A;  4QHC A;  3T12 B;  4HP9 A;  3EWK A;  1XX2 A;  3O88 A;  2EFU A;  3IXD A;  3ZYT A;  3KO6 A;  5J4E A;  4ESP A;  3T4K A;  5TBM B;  5JYO A;  3T1X A;  1TDG A;  3M2K A;  3VOZ A;  2OAQ 1;  4I3I A;  1W8Q A;  4QD4 A;  4UAA A;  1NJ4 A;  4DXC A;  1PI4 A;  3EOI A;  4PM8 A;  4H8R A;  1K57 C;  1WE4 A;  2XFS A;  5A92 A;  1S1Y A;  5IT5 A;  2HV1 A;  3FWL A;  4MBH A;  4GZB A;  1JNU A;  2W3E A;  2W3G A;  3BQA A;  5FI2 A;  3ZVW A;  3WS5 A;  2UV0 E;  2INW A;  5K5B A;  2JC7 A;  5FAQ A;  2QWS A;  4S2M A;  5GLC A;  3CWF A;  3NJA A;  4G3V A;  3OPP A;  4CLC D;  4R4S A;  1GHP A;  3KSF A;  1DRM A;  4OON A;  3Q1F A;  1PRQ A;  3MJQ A;  2Y59 A;  4X53 A;  2EWW A;  1PYY A;  3NOP C;  3CLO A;  4MDZ A;  2OLV A;  3IH8 A;  3FPV A;  3HLE A;  3PBR A;  4EQ1 A;  1BUE A;  4WM9 A;  3ZVT A;  3H7W A;  3CMZ A;  3CUE A;  1DP8 A;  3H7W B;  2KX6 A;  3BJN A;  3I7J A;  2H28 A;  2XK1 A;  3LFV A;  3ICY A;  3DWZ A;  1ZG4 A;  4II7 A;  4QB8 A;  2L4R A;  2WKH A;  3LY3 A;  4Y13 A;  5E2G A;  1ZKJ A;  4H6J B;  5DFY A;  1MBL A;  3IX8 A;  4N1H A;  1VM1 A;  3BLS A;  4Q0I A;  2XA7 S;  4C6Y A;  4BJP A;  2BTF P;  5FI7 A;  1W63 M;  4P6B A;  5GLB A;  1IOU A;  4JKT A;  1S0W A;  1KGE A;  5EM0 A;  4E04 A;  5FQI A;  2VLG A;  1UWP X;  1MWS A;  3BY9 A;  3FYZ A;  2PYR A;  3VOY A;  1O7E A;  1ZC2 A;  2WZX A;  1FSY A;  1G28 A;  3OPR A;  4CPK A;  2Y2M A;  3W2Z A;  1RCJ A;  1KGF A;  3IHA A;  5F1G A;  3IXH A;  2IWB A;  4KQO A;  4IHQ A;  4LPZ A;  4I38 A;  5MC7 A;  4KQD A;  3KYZ A;  1NY0 A;  4WLA A;  4GHI A;  2HP6 A;  4ETZ A;  3RXW A;  2ZM2 A;  3SH7 A;  4L9E A;  3H82 B;  4R3A A;  4EU0 A;  4IUK A;  2B95 A;  4ID4 A;  5HAR A;  2J9P A;  4Z9Q A;  5HAQ A;  1G6A A;  2A49 A;  2W1T A;  2WYX A;  2E8I A;  3BQ8 A;  4P85 A;  3GEC A;  4OOL A;  4LCL A;  5KZH A;  1ES4 A;  3EQU A;  1OTE A;  3HBR A;  3IF6 A;  1FR1 A;  3T4J A;  2H0Y A;  2PD7 A;  4B4X A;  3LR5 A;  1LHY A;  3MXQ A;  1Z6F A;  1DP6 A;  4UEY A;  2J7V A;  4O8G A;  4MNR A;  4N9K A;  3V3S A;  4KQQ A;  1FCO A;  2RL3 A;  4KQR A;  4HES A;  4UHU A;  3LI9 A;  3Q81 A;  2W1T B;  1VQQ A;  4U3T A;  4Y0O A;  4EUZ A;  1ES5 A;  2K31 A;  3F1O A;  4GOG A;  1FCN A;  1NWZ A;  3NY4 A;  4JBF A;  3HL9 A;  5L2F A;  1MKI A;  3PTE A;  2QYB A;  3C5A A;  1LL8 A;  4XXR A;  4JGO A;  2OWJ A;  4X68 A;  1HLU P;  2K7S A;  3BFD A;  1YQS A;  2ZQD A;  4CQH A;  2Y2N A;  4EES A;  5HL1 A;  1H8Y A;  5CEB A;  3BEC A;  3SH9 A;  3NBL A;  5AQB A;  1FOF A;  3ZHH A;  1OTI A;  2D01 A;  4HIA A;  1XFQ A;  4HEF A;  3QP4 A;  3CPT A;  4Y2F A;  3LR4 A;  4HQA A;  2ZC7 A;  1EI5 A;  2XSS A;  4KUK A;  1YT4 A;  2ZM8 A;  4ZBE A;  1N9L A;  3MZD A;  4O7D A;  3UB6 A;  1PZO A;  1EWZ A;  4LFU A;  1P9R A;  3VFH A;  4K08 A;  1K55 A;  3GDI A;  4UQI S;  3O86 A;  3MZF A;  3QHY A;  2HDQ A;  1MWU A;  2V0W A;  3JVU A;  4QPR A;  1H0M A;  4B9O A;  3IS2 B;  5FDH A;  3KYE A;  4I39 A;  3S7P A;  1L2S A;  1E3U D;  1RGZ A;  5A93 A;  4LV1 A;  2EXA A;  3FZC A;  4MN5 A;  3OBF A;  4OPY A;  3DTM A;  2V8F A;  3AGE A;  3S7Q A;  3GR2 A;  4CLC A;  5DTK A;  5F1F A;  3DW0 A;  1ALQ A;  3C7U A;  4X56 A;  4GS9 B;  5A8B A;  3E4Q A;  2E8J A;  2W3H A;  1G6O A;  2J80 A;  3GMW A;  2PBY A;  3RFB A;  3D72 A;  2Z2L B;  2QMI A;  3MFD A;  1GCE A;  4O0P A;  1V9Z A;  3VFF A;  5DTT A;  4DE1 A;  5FQM A;  5A91 A;  4GJ4 A;  4JXW A;  4NXF A;  1ZG6 A;  3HRE A;  3VP0 A;  1XGJ A;  5L09 A;  1LT0 A;  3NDG A;  1A0K A;  2GDN A;  4ZRR A;  2JHE A;  1MC0 A;  4LRZ E;  4Q8I A;  3TRC A;  1S4R A;  2ZD8 A;  3QP1 A;  1KE4 A;  4WYY A;  4S2N A;  3UB7 A;  3NDE A;  5FQQ A;  3UPP A;  4NXG A;  4Q0H A;  1DJA A;  1Q2P A;  5HWW A;  1TD5 A;  2XQZ A;  2ZC6 B;  4GDN A;  3P98 A;  2LB5 A;  4WBG A;  3F1P B;  1S1Z A;  4RYE A;  4UA7 A;  1CEF A;  3HLF A;  2VX8 A;  2HZ5 A;  4HH2 A;  3F1O B;  5L10 A;  2R9X A;  1ACF A;  4GD6 A;  4LRY C;  3A0S A;  3B33 A;  5G4Y A;  5F83 A;  2YKF A;  4BL2 A;  2FFF B;  3LIF A;  4S2O A;  3BYD A;  5M19 A;  2PT7 A;  1LL9 A;  3KSI A;  5A90 A;  3ITB A;  3R7W A;  3HLB A;  3VE4 A;  1VB6 A;  4EEU A;  1QME A;  1F98 A;  3S4X A;  4KEN B;  3V39 A;  2ZQA A;  3HVF A;  2PYP A;  2W0N A;  4ZJ1 A;  1MKM A;  3T1Q B;  2WKP A;  4EWF A;  3G30 A;  3E4O A;  2XRN A;  4BD0 A;  4JXV A;  3C7V A;  1KE3 A;  2I72 A;  1K54 A;  4CLC C;  3NUL A;  4GB7 A;  2XEP A;  3HLC A;  4EER A;  1GHI A;  1YKD A;  4PM9 A;  4YIN A;  1J9M A;  3ULF A;  4BBV A;  3B3X A;  3T4S A;  3MZE A;  5IHV A;  3ZG5 A;  3M2J A;  1GSW A;  2Y2P A;  4WZ4 A;  5HL6 A;  4F3L B;  4ZDX A;  5CTN A;  3E4P A;  5AQ9 A;  3MFX A;  5FAP A;  1YLY A;  2ZC5 B;  5FEF A; 
#chains in the Genus database with same CATH homology
 2WKH A;  3LY3 A;  2JCH A;  5E2G A;  3LO7 A;  1ZKJ A;  3OZH A;  4FD8 A;  5FAT A;  2FFY A;  2XD5 A;  4JPM A;  4E3M A;  5FSR A;  1GHM A;  1MBL A;  1L0E A;  4N1H A;  1GA9 A;  1PZP A;  1VM1 A;  2H10 A;  2Y2G A;  2QPN A;  2Y2Q A;  3BLS A;  3SS4 A;  4DF6 A;  2Y2K A;  4K0X A;  4F94 A;  5M18 A;  1K56 D;  1YLT A;  4KZ7 A;  5E2E A;  2HDS A;  1I5Q A;  2WGI A;  1PW8 A;  4N9L A;  4BJP A;  1BT5 A;  3OCN A;  3M6B A;  3TSG A;  1HD8 A;  1NRF A;  3FV7 A;  3N8L A;  1IYQ A;  5U47 A;  4KZ9 A;  4OLD A;  4WEJ A;  4P6B A;  5FI7 A;  5GLB A;  1ERM A;  4JKT A;  1S0W A;  1KGE A;  4KZ4 A;  1U60 A;  1IEL A;  1IEM A;  3G2Z A;  5EOE A;  3AGD A;  5FQI A;  2UWX A;  1NYM A;  1MWS A;  1IYS A;  2Y91 A;  3FYZ A;  3VOY A;  1O7E A;  1ZC2 A;  2WZX A;  3OC2 A;  4KZ3 A;  1FSY A;  3BFE A;  3GTC A;  3OPR A;  5DF8 A;  2WGW A;  1KVM A;  4CPK A;  4QY6 A;  2Y2M A;  3BM6 A;  2Q9N A;  1RCJ A;  1KGF A;  3IHA A;  5F1G A;  3IXH A;  2IWB A;  4KQO A;  2ZMA A;  1E3U A;  1BLH A;  1K6S A;  4S2L A;  3Q07 A;  2V2F F;  3BLM A;  1NY0 A;  1L0G A;  4Y7P A;  2HP6 A;  1M6K A;  1Q2Q A;  3HLG A;  1K56 A;  3IT9 A;  4N92 A;  2WAE A;  1TVF A;  3C4O A;  3RXW A;  4MLL A;  2ZM2 A;  2ZC3 B;  4ZTK A;  3SH7 A;  3WS0 A;  1K25 A;  1DJB A;  1ERO A;  3NC8 A;  1NZO A;  4E6X A;  3NI9 A;  1MPL A;  3OCL A;  4KZA A;  3V50 A;  4DXB A;  3VP2 A;  1BSG A;  1PWG A;  4ID4 A;  4LV2 A;  4GN2 A;  1NZU A;  4BL3 A;  4S2I A;  4C75 A;  3MXS A;  5HAR A;  3TG9 A;  2C5W B;  2J9P A;  5AQA A;  2V20 A;  4Z9Q A;  4EV4 A;  1K6R A;  3UNW A;  3SOI A;  3A3J A;  5EVL A;  5HAQ A;  3PBN A;  2XGN A;  4PM6 A;  1G6A A;  3VP1 A;  2A49 A;  2HDU A;  1C3B A;  5KMW A;  1JWV A;  2WYX A;  2CC1 A;  2E8I A;  1E4D A;  1XKZ A;  4WZ5 C;  1K38 A;  3HUN A;  4S2J A;  4FCF A;  4FH4 A;  1HZO A;  1ESI A;  4P85 A;  3IXB A;  1WYC A;  4PPR A;  3FKW A;  1JTD A;  4OOL A;  3S1Y A;  1DJC A;  1XPB A;  4LCL A;  5KZH A;  3HLD A;  1ES4 A;  3IHB A;  3EQU A;  4OKP A;  4LV0 A;  3VSL A;  4R3B A;  1CEG A;  2Y2O A;  3HBR A;  3ISG A;  3IF6 A;  1FR1 A;  5KSH A;  3WS4 A;  3HUM A;  5EVI C;  5EVI D;  1GA0 A;  3OPL A;  2WK0 A;  2G2W A;  2H0Y A;  2J9O A;  1PWD A;  4OQG A;  3UPN A;  1LHY A;  5CRF A;  4B4X A;  3PBS A;  2WGV A;  5CHU A;  1N9B A;  3G35 A;  1Z6F A;  4IBR A;  4GD8 A;  2ZJ9 A;  2J7V A;  3IH9 A;  3D4F A;  3GSG A;  1YMX A;  4MNR A;  3S22 A;  4N9K A;  4OH0 A;  5AQ7 A;  3N8S A;  1LL5 A;  4S2K A;  3V3S A;  3VMA A;  4QJG A;  3WRZ A;  3GVB A;  4KQQ A;  1FCO A;  3ZFZ A;  2RL3 A;  4L0L A;  4IVI A;  4DDY A;  4PM7 A;  2P9V B;  4XUX A;  3NIA A;  4KQR A;  1O07 A;  4HES A;  4OOY A;  4UHU A;  1BTL A;  4X55 A;  3Q81 A;  2Y2I A;  1VQQ A;  4DDS A;  4U3T A;  3TOI A;  2XFT A;  2WKE A;  4Y0O A;  3UE3 A;  2BG1 A;  3N7W A;  4R1G A;  3NCK A;  4U0X A;  4OQI A;  1ES5 A;  4PMA A;  4EUZ A;  4GOG A;  5FQ9 A;  1FCN A;  5GHY A;  4R0Q A;  1CI9 A;  3NY4 A;  4R4R A;  1ES2 A;  2B5R A;  3SH8 A;  4JBF A;  2H5S A;  2QZ6 A;  3HL9 A;  5L2F A;  1MKI A;  4MBK A;  3PTE A;  4UA9 A;  3UY6 A;  2PU4 A;  3C5A A;  1LI9 A;  3IWO A;  2P74 A;  4XXR A;  1SDE A;  3N8R A;  3MKF A;  3M6H A;  4X68 A;  1NXY A;  2JE5 A;  2P9V A;  1N4O A;  1KE0 A;  3ZG9 B;  1WYB A;  4KZ5 A;  3BFD A;  3V3R A;  1YQS A;  2EX2 A;  3WWX A;  3AGF A;  5CTM A;  2ZQD A;  5EPH A;  4MEZ A;  5GL9 A;  3ITA A;  3SS5 A;  1H8Z A;  4E3I A;  1PIO A;  2Y2N A;  4DRT A;  4Y0U A;  1HVB A;  5HL1 A;  3UE0 A;  1H8Y A;  2Z2M B;  2DNS A;  5GLD A;  4E3K A;  5CEB A;  3BEC A;  1XP4 A;  4E3J A;  4EBN A;  3SH9 A;  3A3E A;  5CED A;  3NBL A;  4K91 A;  3LY4 A;  3VP3 A;  3IF6 C;  5AQB A;  1IKG A;  1FOF A;  4BLM A;  3CG5 A;  3RXX A;  3ZHH A;  1W79 A;  1PI5 A;  1S6R A;  3ZG8 B;  4OVD A;  4XUZ A;  2IWD A;  1W5D A;  4RVA A;  4HEF A;  2HP5 A;  1RP5 A;  5FI6 A;  3P09 A;  4C6Y A;  4CJN A;  4GNU A;  4EQI A;  2ZQ8 A;  3A3D A;  5CHM A;  1JWZ A;  2HP9 A;  2ZC7 A;  3UO9 A;  1EI5 A;  2R9W A;  5HFO A;  3RJU A;  5F82 A;  1K4E A;  1YT4 A;  2ZQC A;  2ZM8 A;  4UA6 A;  5KSC A;  2Y55 A;  4ZBE A;  1IKI A;  4KZ6 A;  2ZQ7 A;  3MZD A;  4O7D A;  1PZO A;  1EWZ A;  2WZZ A;  1Y54 A;  4P87 A;  3VFH A;  5I94 A;  3UDX A;  3UDF A;  5CGS A;  5EVI A;  4B4Z A;  4RX2 A;  2X71 A;  4QY5 A;  2EX6 A;  1K55 A;  1LLB A;  1DY6 A;  3IWQ A;  3GQZ A;  3MZF A;  3O86 A;  4OPR A;  3SS3 A;  1FR6 A;  3FKV A;  4NET A;  2WAD A;  3WS2 A;  3QHY A;  4BQM A;  1ES3 A;  4WEL A;  2HDQ A;  2Q9M A;  1MWU A;  3BFG A;  4JF4 A;  3VSK A;  1M40 A;  1QMF A;  3HUO A;  4OQ0 A;  1CI8 A;  1KDW A;  1ERQ A;  1XXM A;  3G31 A;  5M1A A;  3UE1 A;  3UDI A;  2G2U A;  4K0W A;  5FDH A;  4MBF A;  4BEN A;  4JXG A;  1IYO A;  4S2N C;  3O87 A;  3V5M A;  2BLS A;  1L2S A;  3UPO A;  4OOM A;  5DF9 A;  2J8Y A;  2ZQ9 A;  3IXG A;  1E3U D;  5GLA A;  3VP4 A;  4FSF A;  4JXS A;  4DE3 A;  3BRM A;  1KGG A;  3Q7V A;  1RGZ A;  5A93 A;  4LV1 A;  2EX9 A;  2EXA A;  1SCW A;  2OLU A;  1E25 A;  4X6T A;  3FZC A;  3G4P A;  1CK3 A;  1L0D A;  3W4O A;  1FCM A;  5CGX A;  4KG6 A;  4OP8 A;  3W8K A;  5EVI B;  4OPY A;  3DTM A;  1NYY A;  2C6W B;  3AGE A;  4HBU A;  1XA1 A;  2XF3 A;  3WS1 A;  3GR2 A;  1SHV A;  3O3V A;  3PBO A;  5DTK A;  2RCX A;  1ONG A;  5F1F A;  4BD1 A;  2HPB A;  2OV5 A;  5DF7 A;  2X01 A;  5E43 A;  3DW0 A;  3IF5 A;  1MWR A;  3PBT A;  3CJM A;  1MWT A;  2H0T A;  5HAI A;  3A3I A;  1ALQ A;  5CEC A;  3C7U A;  4X56 A;  5E2F A;  2ZC5 B;  3GV9 A;  5FAS A;  1YLZ A;  5GHZ A;  1PWC A;  5CXW A;  3E2L A;  1IYP A;  2WGW B;  4GDB A;  4JF5 A;  4NK3 A;  2IWC A;  2WKI A;  2HDR A;  4YFM A;  4M3K A;  3GMW A;  4U0T A;  1BUL A;  2PBY A;  1K55 C;  3G2Y A;  3G34 A;  2XLN A;  4ZAM A;  1KDS A;  5FA7 A;  1BLC A;  4E3L A;  2DRW A;  2XDM A;  1MXO A;  2Z2L B;  4FH2 A;  2QMI A;  3MFD A;  3Q7V B;  4DKI A;  5FQK A;  1K4F A;  1GCE A;  4OPZ A;  4DE2 A;  4ZJ3 A;  2EFX A;  2X02 A;  4C3Q A;  5TGF A;  4WZ5 A;  1FSW A;  5DTT A;  3VFF A;  3HLW A;  2WUQ A;  3PAE A;  4S2P A;  5EUA A;  3LEZ A;  4DE1 A;  4LV3 A;  5FQM A;  5A91 A;  4KZ8 A;  4X69 A;  4JXW A;  3G32 A;  3A3F A;  2JBF A;  4PM5 A;  4E6W A;  3ZNY A;  5GHX A;  1ZG6 A;  3DWK A;  3HRE A;  4KG2 A;  5CER A;  3VP0 A;  1XGJ A;  2XD1 A;  5DTS A;  1LI0 A;  1YMS A;  2Y2J A;  1BLS A;  3NDG A;  4EBP A;  1MY8 A;  2ZC4 B;  3IQA A;  3N4I A;  3N6I A;  2GDN A;  1I2S A;  4ZJ2 A;  3ZNT A;  4Q8I A;  1ONH A;  3OPH A;  2XR0 A;  2ZD8 A;  3Q82 A;  5EOO A;  5TR7 A;  3JYI A;  4WMC D;  1ESU A;  1KE4 A;  4WYY A;  4S2N A;  3WRT A;  3C4P A;  3E2K A;  4RA7 A;  2DCF A;  1AXB A;  3NDE A;  3W4Q A;  5HW3 A;  1I2W A;  5FQQ A;  3UPP A;  1DJA A;  2WAF A;  2PU2 A;  1Q2P A;  4GKU A;  5DVA A;  4OPQ A;  2ZC6 B;  2XQZ A;  1YLP A;  4GDN A;  4WMC A;  2ZLY A;  3P98 A;  2V1Z A;  4WEK A;  4WBG A;  5EEC A;  5CHJ A;  4QHC A;  4RYE A;  1BZA A;  3BFF A;  4UA7 A;  1CEF A;  3HLF A;  4OLG A;  5EE8 A;  4RX3 A;  5G18 A;  1BLP A;  3IF6 B;  1XX2 A;  3O88 A;  2EFU A;  4IVK A;  3IXD A;  2R9X A;  5E2H A;  5FQJ A;  4D2O A;  4R23 A;  4GD6 A;  4N1X A;  1RGY A;  1W7F A;  1XA7 A;  4Y0T A;  4DE0 A;  1FQG A;  4E3O A;  1L0F A;  5JYO A;  1TDG A;  4P0M A;  3M2K A;  1W8Y A;  5F83 A;  3VOZ A;  5HAP A;  5CGW A;  1PW1 A;  4LCM A;  2OSU A;  3ZG0 A;  4BL2 A;  2FFF B;  4EBL A;  4JF6 A;  1W8Q A;  4QD4 A;  4S2O A;  4UAA A;  3BYD A;  5TFQ A;  1NJ4 A;  5M19 A;  1LL9 A;  4JLF A;  3LCE A;  1PI4 A;  4DXC A;  5A90 A;  1HTZ A;  2Y4A A;  3ITB A;  3HLB A;  5BOH A;  1YM1 A;  1YLJ A;  4PM8 A;  1SKF A;  2Y2H A;  4H8R A;  1K57 C;  1WE4 A;  3EQV A;  2VGJ A;  5A92 A;  1TDL A;  1QME A;  3FWL A;  3MXR A;  2XH9 A;  4MBH A;  4GZB A;  3ZDJ A;  3GRJ A;  4KG5 A;  4KZB A;  3S4X A;  3BEB A;  3ZCZ A;  4KEN B;  2Y2L A;  3MKE A;  2EX8 A;  5FI2 A;  3WS5 A;  3ZVW A;  3V39 A;  3CZD A;  4E3N A;  3BFC A;  2ZQA A;  3HVF A;  2JC7 A;  4ZJ1 A;  1JTG A;  5FAQ A;  4QU3 A;  4S2M A;  5GLC A;  4EWF A;  3G30 A;  1SDN A;  4BD0 A;  1KVL A;  4JXV A;  4IED A;  5D3O A;  5HX9 A;  3W4P A;  1G68 A;  3ZGA B;  3QNC A;  3C7V A;  3OPP A;  1KE3 A;  4A5R A;  2I72 A;  1K54 A;  4R4S A;  2VGK A;  1GHP A;  1TEM A;  3Q7Z A;  4IBX A;  4GB7 A;  2XEP A;  3HLC A;  4OON A;  3Q1F A;  4LEN A;  4HBT A;  3QNB A;  1GHI A;  3UN7 A;  4R3J A;  3IWI A;  1K54 C;  2Y59 A;  4X53 A;  2ZM0 A;  1K57 A;  1PYY A;  2EXB A;  1JVJ A;  4PM9 A;  4YIN A;  4QB8 A;  2OLV A;  1J9M A;  1YLW A;  3B3X A;  3IH8 A;  1OME A;  3HLE A;  3PBR A;  3MBZ A;  3MZE A;  1JWP A;  5IHV A;  4B88 A;  1BUE A;  4WM9 A;  3ZVT A;  3ZG5 A;  1H5X A;  3PBQ A;  3PAG A;  3CMZ A;  4OP5 A;  5FAO A;  3M2J A;  2Y2P A;  4WZ4 A;  3I7J A;  2A3U A;  2XK1 A;  5JYP A;  1XGI A;  3ZG7 B;  4ZDX A;  3DWZ A;  4OQH A;  5CTN A;  1ZG4 A;  5AQ9 A;  5FAP A;  1YLY A;  2XFS A;  5J8X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...