5GHXA

Crystal structure of beta-lactamase penp mutant-e166h
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
257
structure length
257
Chain Sequence
DFAKLEEQFDAKLGIFALDTGTNRTVAYRPDERFAFASTIKALTVGVLLQQKSIEDLNQRITYTRDDLVNYNPITEKHVDTGMTLKELADASLRYSDNAAQNLILKQIGGPESLKKELRKIGDEVTNPERFHPELNEVNPGETQDTSTARALVTSLRAFALEDKLPSEKRELLIDWMKRNTTGDALIRAGVPDGWEVADKTGAASYGTRNDIAIIWPPKGDPVVLAVLSSRDKKDAKYDDKLIAEATKVVMKALNMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Crystallographic Snapshots of Class A beta-Lactamase Catalysis Reveal Structural Changes That Facilitate beta-Lactam Hydrolysis
pubmed doi rcsb
source organism Bacillus licheniformis
molecule tags Hydrolase
total genus 90
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2016-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5ghxA00
4KENB 1XGIA 3Q1FA 4KQQA 4OQ0A 4PMAA 1SCWA 3LEZA 4FH4A 3UN7A 2ZM2A 1O07A 2JC7A 2ZC3B 5FQ9A 1K55A 1PWDA 3GRJA 3HLDA 3G4PA 5A90A 2QPNA 3BRMA 2VGKA 2Y2GA 3IHBA 4OOLA 5EVIB 3TG9A 4O7DA 1FOFA 4S2NA 1JWZA 3BFFA 5FI7A 3WS5A 4JBFA 2EFXA 3DTMA 4YFMA 5JYPA 3V5MA 3BFEA 3IWQA 4K0WA 4E6XA 5HW3A 2X71A 3A3DA 3LCEA 2ZQ7A 4N9LA 5GLBA 3N8LA 1FCOA 5FI6A 1G6AA 2R9WA 4QHCA 2WKEA 5CTNA 4ZAMA 5E43A 3ZG0A 2WGVA 5CXWA 5CEBA 5JYOA 5CGSA 5L2FA 1K56D 1S0WA 2XD5A 3DWKA 4B4XA 2XEPA 2ZM0A 1N9BA 1XXMA 3D4FA 1KE0A 3EQUA 4KQOA 5FAOA 3G2YA 4QY5A 4UHUA 4E6WA 3VP1A 3PAEA 4JKTA 3VFFA 1CK3A 2OSUA 4DE2A 1YLYA 4DXBA 4BENA 2R9XA 4S2PA 1OMEA 3PBQA 3Q7ZA 1BT5A 5FQJA 4ZTKA 1MWRA 1E3UA 5HAQA 4KZAA 3WS4A 2ZQAA 4WEKA 1XA1A 3RXXA 4OONA 3ZGAB 4JXSA 3G32A 1SDNA 5FQKA 5FSRA 3IXDA 4PM7A 5CECA 1SDEA 3TSGA 4GZBA 2Y55A 4RYEA 5EPHA 2V1ZA 1YLTA 5U47A 1VQQA 1JTDA 5KZHA 3HLEA 4IEDA 4BLMA 4WM9A 2Q9MA 5CHJA 3SS5A 4E3MA 5A93A 1YLWA 1JWVA 3UY6A 1GA9A 3C4OA 3EQVA 2CC1A 4QD4A 2HDQA 3SH8A 3MXSA 2XGNA 1BLCA 3IF6A 3VOYA 4XUZA 2PBYA 4E3OA 5EOEA 3PBOA 4H8RA 4R23A 2PU4A 4Y0OA 1M6KA 1PW1A 3ZHHA 5GHZA 4P85A 4WMCA 4C3QA 3UNWA 5CTMA 1RP5A 4WELA 4MNRA 3G31A 2HDSA 4BQMA 4EBNA 5DTSA 5D3OA 4HBUA 3S22A 3V50A 2Y2MA 1Q2PA 1PIOA 2Y2HA 2C5WB 1DJCA 2HP9A 4X6TA 3W4OA 3MXRA 4S2JA 1SKFA 1XPBA 2ZC6B 3ZNTA 5CRFA 2WAEA 3IQAA 3S4XA 2WZZA 4K91A 2IWCA 3IXGA 3P09A 1MY8A 4OLGA 5AQAA 1DJBA 1NJ4A 4XXRA 3M2JA 1XGJA 1ZC2A 3HUOA 4X53A 5TR7A 4BL3A 2WGWB 3GSGA 1Z6FA 4LCMA 4QU3A 4UA9A 3N8RA 5FASA 3O3VA 2EX9A 4GKUA 1MWSA 3OPRA 1K57C 2A3UA 3O87A 2P9VB 2XQZA 3QHYA 5HARA 1DJAA 3VOZA 3WS1A 1MXOA 1LHYA 2Y2LA 1ESIA 4QB8A 4R3BA 4R4SA 5TFQA 1S6RA 2XH9A 3MZEA 4C75A 4U3TA 2XDMA 2FFFB 5EVIC 3MBZA 1K25A 1ERQA 3C4PA 4PM6A 1KVLA 5F1FA 1PI5A 3NY4A 3UE1A 3OPHA 5FQIA 1EROA 2XD1A 1G68A 2WAFA 3G34A 2V20A 4EV4A 1KDSA 4ZJ2A 1KGEA 1LI0A 1YMSA 3Q07A 4P87A 1YM1A 2H5SA 1ONHA 1ZG4A 1O7EA 1KGGA 4GDNA 2UWXA 5CGXA 1IYPA 1MWUA 4DDSA 1WE4A 1L0DA 1W5DA 2J9PA 3AGEA 4GN2A 4BL2A 3OC2A 3W4PA 3HBRA 1PWGA 1IYOA 1JTGA 1ERMA 1HD8A 1FQGA 4KZBA 5DTTA 1EWZA 4Q8IA 2QZ6A 5M18A 5DF9A 4GD6A 3PBNA 1KDWA 1PWCA 4NETA 1PYYA 3G2ZA 4Z9QA 2WUQA 5DVAA 1CEFA 3NDEA 3BLMA 1J9MA 3A3EA 3IXBA 5FDHA 3TOIA 2E8IA 3UE3A 1BLHA 4OOYA 5FQMA 4X55A 4IVKA 3I7JA 4RA7A 1W8YA 4X68A 5FAPA 5KMWA 3NCKA 3LY3A 2G2UA 5TGFA 3ZG8B 4S2IA 2H0TA 1KVMA 4KZ8A 1CI9A 4N92A 4FCFA 1E3UD 4RVAA 1FCNA 3NBLA 4ZJ3A 2ZMAA 3HLCA 2IWBA 5CHUA 2RCXA 2XFSA 4ZJ1A 4N1HA 1N4OA 3S1YA 1W7FA 2EXAA 3VP3A 3UDFA 4DDYA 1IYQA 2A49A 4EQIA 5CEDA 1JWPA 4WZ5A 4ZDXA 4BD0A 4BJPA 5KSHA 5FA7A 1I2WA 2ZQCA 4OVDA 3GQZA 3HREA 2XR0A 5HL1A 1HTZA 3HLWA 3P98A 4OP5A 5HX9A 1IKIA 2X01A 3IXHA 3QNCA 3VSKA 1BLSA 2Y2PA 4OLDA 3MFDA 4N1XA 3WS2A 4E3IA 2J7VA 4OQGA 3BFCA 4GDBA 4OPQA 1TDLA 4NK3A 4R3JA 1Y54A 3ZG5A 2JCHA 4P6BA 3FWLA 2Y2QA 1ONGA 4LENA 3PBTA 3SS4A 4QJGA 4CPKA 2ZQ8A 4Y0UA 4FSFA 3SH7A 4WMCD 1JVJA 1FSYA 1AXBA 2WKIA 3FKWA 3C5AA 4IVIA 2QMIA 5E2FA 1NYYA 3MKEA 4ID4A 1KE4A 4OPYA 1TDGA 4JF4A 5EOOA 4E3NA 1BUEA 1ESUA 3M6BA 3VP4A 2VGJA 3AGFA 4IBXA 3V39A 2H10A 4R4RA 5EVLA 4UAAA 1K54C 3ZVWA 2DRWA 5GL9A 3B3XA 1FR6A 1XP4A 4F94A 1LL5A 3N8SA 2DNSA 3E2KA 3HVFA 3ZDJA 3N6IA 2Z2MB 4L0LA 4FD8A 3HLBA 4LV1A 4U0XA 4XUXA 4GD8A 1EI5A 2P74A 2XF3A 3GTCA 1XKZA 3IWOA 4UA7A 3UO9A 4PM9A 5I94A 3G30A 5AQ7A 2OV5A 1FSWA 4HBTA 2Y2KA 3QNBA 4DE3A 5E2HA 5M19A 4PM5A 4MLLA 4S2MA 5HAPA 1K4EA 2EX2A 1GHPA 3HL9A 4IBRA 5CGWA 2J9OA 2Y2NA 3O86A 4X56A 4KG5A 1IEMA 3NI9A 3UE0A 1MKIA 1U60A 5EUAA 5BOHA 1H8ZA 3VP0A 3RJUA 1K55C 3V3RA 1H5XA 5DF8A 4R1GA 1HZOA 4S2NC 3HUMA 3WRTA 3CJMA 3VMAA 1YQSA 3FKVA 4GB7A 1M40A 3Q7VB 1ALQA 2PU2A 4D2OA 4OKPA 3SS3A 5HAIA 2OLUA 4LV0A 5F1GA 3Q81A 4MBHA 4JPMA 2ZD8A 2ZQ9A 2WZXA 5FI2A 3ZNYA 2P9VA 3WS0A 1RGYA 4JLFA 4KG2A 3ITBA 2WADA 4YINA 3CMZA 1ZKJA 3E2LA 5CHMA 3VP2A 2EX8A 4B88A 3W8KA 1C3BA 4E3LA 3GMWA 2Z2LB 1CI8A 1VM1A 1NXYA 2OLVA 3LY4A 4X69A 3ZFZA 3BM6A 2Y2JA 4KZ3A 5EE8A 2HDRA 3FYZA 5GLDA 5A92A 3IF5A 3GR2A 5M1AA 1KE3A 3M2KA 3FV7A 1BULA 1XX2A 1ES3A 4HESA 3PAGA 4DE1A 3ZG9B 2ZC7A 5KSCA 1K57A 3ITAA 2ZJ9A 1IYSA 3G35A 3NDGA 1FCMA 5F82A 3ZCZA 2Y2IA 1NY0A 5EVID 2HDUA 3BFGA 3A3JA 3V3SA 1E4DA 2I72A 1GHIA 1Q2QA 3ZG7B 2ZM8A 1WYCA 3OPLA 3Q82A 5EVIA 2G2WA 4C6YA 1BSGA 1TEMA 4DRTA 3HLFA 3C7VA 4LV3A 3VFHA 3M6HA 1LI9A 1I5QA 2XFTA 1YLPA 2BLSA 3UDXA 2X02A 2FFYA 3IF6C 4JXVA 4KZ5A 2BG1A 1DY6A 3IH9A 3PBRA 2EXBA 4OH0A 2WYXA 3UPNA 4OOMA 3SOIA 4OQIA 3UDIA 4UA6A 1NYMA 2B5RA 1FR1A 4K0XA 3WRZA 5IHVA 1K38A 4DF6A 2JE5A 4EBPA 3C7UA 5FQQA 1W79A 1K56A 1MWTA 4S2LA 4MBKA 4N9KA 1ES4A 2JBFA 5HFOA 1PW8A 3N7WA 5CERA 2EFUA 3OZHA 1MPLA 2Q9NA 2DCFA 4JF5A 3OCNA 1PZOA 4P0MA 4OQHA 1XA7A 5E2GA 3GVBA 3IF6B 1YMXA 3N4IA 1L0EA 4KQRA 3JYIA 4DXCA 3GV9A 1YLJA 2GDNA 3NC8A 4EUZA 1L2SA 3A3FA 5GLCA 4B4ZA 1NZOA 3HUNA 1TVFA 1HVBA 2ZQDA 1L0FA 2HP6A 5DF7A 4CJNA 2HP5A 3O88A 4EWFA 4WBGA 5GHXA 1NRFA 4LV2A 4MEZA 5GLAA 1GCEA 3MKFA 4MBFA 1ZG6A 3BECA 3OPPA 4KG6A 4KZ6A 3BEBA 5AQBA 1SHVA 4GNUA 4OP8A 5F83A 2HPBA 3ZVTA 4JF6A 4PPRA 4E3JA 5FAQA 4M3KA 1YLZA 5E2EA 3IH8A 3A3IA 3IWIA 3BYDA 2H0YA 2C6WB 2RL3A 4U0TA 1KGFA 3IHAA 5EECA 5AQ9A 3UPPA 3HLGA 4KZ7A 2ZC4B 1BZAA 3MZDA 4JXWA 4R0QA 3DWZA 1IKGA 2XK1A 5GHYA 4DKIA 4GOGA 2ZLYA 1K4FA 4WZ4A 3SH9A 1YT4A 4RX3A 3UPOA 4WYYA 2J8YA 1BLPA 4Y0TA 1PI4A 2Y59A 4KZ9A 3FZCA 5DTKA 4RX2A 1IELA 1LLBA 2Y2OA 4E3KA 4DE0A 1LL9A 5A91A 3PTEA 4FH2A 1L0GA 2Y4AA 1CEGA 2WKHA 3RXWA 3OCLA 4WEJA 4A5RA 1W8QA 3AGDA 3NIAA 1ES2A 2WGWA 1WYBA 1RGZA 3BFDA 1MBLA 3CG5A 4Y7PA 5FATA 3CZDA 2IWDA 4EBLA 3IT9A 3VSLA 5J8XA 3ISGA 2WK0A 3W4QA 4HEFA 1ES5A 1K54A 1QMEA 1E25A 1GHMA 2EX6A 1I2SA 3BLSA 4OPZA 3WWXA 2XLNA 2V2FF 3DW0A 4QY6A 1GA0A 1K6SA 4PM8A 4S2KA 4JXGA 4KZ4A 4BD1A 4S2OA 4ZBEA 2WGIA 3Q7VA 1BTLA 3MZFA 5G18A 1PZPA 3PBSA 1RCJA 2Y91A 4LCLA 4OPRA 1H8YA 3LO7A 4WZ5C 1K6RA 1NZUA 1QMFA 2ZC5B
chains in the Genus database with same CATH superfamily
4KENB 4PMAA 1F2KA 2ZM2A 2JC7A 1SKOB 2ZC3B 3GRJA 5F68A 2QPNA 2VGKA 4I38A 3IHBA 4OOLA 5EVIB 3E4PA 3WS5A 4ME4A 5JYPA 3RH8B 3IWQA 1Z09A 4JGOA 3LCEA 4DJ2A 2ZQ7A 3MSHA 3P01A 3LR3A 1P97A 4HNBA 3UB5P 1OTEA 3PHYA 5L2FA 2PD8A 2ZM0A 1XXMA 4O01A 5L07A 4E6WA 1T1CA 3PAEA 2ACGA 2PBDP 5FQJA 4ZTKA 3S7PA 1H8MA 3RXXA 4OONA 3CWFA 2A24A 5DJUA 3T4OA 1SDEA 3TSGA 3LICA 5U47A 2LB5A 1JTDA 4BLMA 2W3DA 3F1NB 3S7NA 1GA9A 3UY6A 2VA0A 2HDQA 3CHWP 2XGNA 1BLCA 3IF6A 5EOEA 2JHEA 3MFXA 4Y0OA 5GHZA 4LRYC 1Y28A 4EBNA 4HBUA 2FH5A 2Y2HA 2HP9A 3MXRA 4S2JA 1XPBA 3ZNTA 3S4XA 4WL9A 1DJBA 1NJ4A 4XXRA 1XGJA 1ZC2A 4X53A 3UB8A 5TR7A 3GSGA 1Z6FA 4UA9A 4H6JA 3O3VA 3F1OB 3LR0A 1GSXA 3O87A 2XA7S 2XQZA 4R4SA 1UGUA 4U3TA 1CQAA 1D06A 1ERQA 2E8JA 3NY4A 4QWOA 3MQOA 4HJ6A 2WAFA 4EV4A 2V20A 1FILA 1YMSA 1O7EA 1KGGA 2VV8A 4GDNA 4DDSA 1WE4A 3C8CA 1L0DA 2V0UA 1CJFA 3OC2A 5DF9A 1PYYA 1G5UA 3NDEA 2W1TA 5FDHA 3UE3A 3BY8A 4X55A 1W8YA 3CUEC 5FAPA 3NOUC 4PKYA 3D9YA 4N92A 4F3LA 4RVAA 2ZOIA 1E3UD 1LSVA 4ETXA 4PHTA 4NEED 3S1YA 1W7FA 4DDYA 1IOUA 2A49A 4ZDXA 4BJPA 3LIBA 2ZQCA 4OVDA 3HREA 2XR0A 3A0RA 1HTZA 1IKIA 2X01A 3QNCA 4E3IA 2J7VA 5FDSA 4AFIA 4OQGA 1DP8A 1NLYA 3OOVA 1Y54A 3SS4A 4CPKA 3SH7A 1ZHHB 4WMCD 4IVIA 5CX7A 2QMIA 5E2FA 3E4QA 3M6BA 2VGJA 1K54C 3ZVWA 3E2KA 4LV1A 4B4XA 4GD8A 1XKZA 1LL8A 4PM9A 2AVXA 1MC0A 1FSWA 4HBTA 2Y2KA 5HAPA 5CGWA 3HL9A 5EFWA 2J9OA 4KG5A 4EEPA 3NI9A 5BOHA 1MKIA 3VV4A 3RJUA 1K55C 3C30A 4PAUA 1VETA 4ETZA 4GB7A 3Q7VB 4X1LA 4LPZA 4LV0A 5F1GA 3NOPC 3Q81A 4JPMA 3ZNYA 1RGYA 3D3OA 3CMZA 3KSHA 3E2LA 5CHMA 4NG2A 3W8KA 4B88A 3GMWA 3B47A 2JKFA 2HDRA 1OT6A 4FUWA 4LFUA 1KE3A 1XX2A 1ES3A 2Z6CA 1IYSA 1FCMA 3BWLA 1X0OA 4CLCE 5EVEA 1GHIA 1MZUA 3ZG7B 3OPLA 1BSGA 4LV3A 4JXVA 2BG1A 3IH9A 3ICYA 3E0YA 4PKYG 4OH0A 2WYXA 3UPNA 4Q0JA 1NYMA 2QJ5A 1FR1A 4K0XA 3WRZA 5IHVA 3K3CA 2JE5A 3KSFA 4HIAA 1MWTA 4BMWA 4MBKA 4N9KA 2JBFA 5HFOA 3N7WA 5CERA 3OZHA 1MPLA 4JF5A 1PZOA 4LRXC 4P0MA 4GHIB 1YMXA 5F5YA 1YLJA 4CLCA 4EUZA 1L2SA 3CUEA 5G4YA 1TVFA 3MQQA 4CJNA 2L4RA 5HD3A 5L8MA 3O88A 5GHXA 4LV2A 3FG8A 2O9CA 1GCEA 3MKFA 3BECA 4KZ6A 1SHVA 4GNUA 4OP8A 5TBMB 4E3JA 4KUOA 3BW6A 5EECA 3UPPA 3IHAA 4KZ7A 4EERA 4GS9A 4R0QA 1IKGA 2XK1A 3IBRA 3SH9A 3TW8A 4RX3A 1PI4A 4KZ9A 1DP9A 5A91A 3OCLA 4WEJA 4HI4A 3F1PA 2VK3A 3AGDA 1TS0A 4Y7PA 3BFDA 1RGZA 4D60A 5TJJA 3CI6A 3B42A 3VSLA 2JN7A 1YPRA 3H82B 1K54A 3WWXA 3BLSA 4QY6A 1GA0A 4JXGA 4BD1A 2JKRM 5L09A 2Y91A 1QMFA 1G6OA 3Q1FA 4KQQA 3U2AA 4FH4A 2V8FA 1T1AA 1K55A 1PWDA 5HDDA 5A90A 2OWJA 1FOFA 1JWZA 3BFFA 3T4QA 4JBFA 2EFXA 5EV0A 3V5MA 4K0WA 4E6XA 5HW3A 2X71A 1GSVA 5GLBA 3TJZC 5FI6A 5CTNA 2WGVA 5CEBA 2HF6A 5HDCA 1S0WA 2NUTC 5C5KA 1N9BA 5FAOA 3G2YA 4UHUA 3CITA 4B9OA 2OSUA 4DXBA 2R9XA 4S2PA 5HAQA 2O99A 2GX5A 2Z6DA 3U4LP 4P6ZM 5FQKA 3QP2A 4PM7A 3EWKA 3UE6A 5KZHA 2P04A 5CHJA 4E3MA 2A2LA 4E04A 1YLWA 1L3LA 1JWVA 4O8GA 3C4OA 3MXSA 4NKPA 3VOYA 4XUZA 4H8RA 4R23A 2PU4A 3LYXA 4P85A 4C3QA 3UNWA 5CTMA 4WELA 1XFNA 4DJ3A 2HDSA 4BQMA 2H28A 1YKDA 2Y2MA 3T1SA 5J3WA 2OOLA 2O9BA 3NHQA 1P9WA 1OTBA 3M2JA 3R4KA 2PYPA 2WGWB 4LCMA 2QWSA 5FASA 4Y3IA 3NJAA 3CPTB 3QHYA 1DJAA 3A0SA 4QB8A 3PR6A 1S6RA 1D7EA 2XH9A 2XDMA 3D72A 4ARZB 3C4PA 2B02A 1KVLA 5F1FA 3UE1A 4LLOB 3H7WB 3G34A 1KGEA 1GSWA 1YM1A 2H5SA 4HQAA 2UWXA 5CGXA 1IYPA 1MWUA 4XT2B 3HBRA 2NUPC 5HPIA 2PRFA 3LGOA 5DTTA 2QZ6A 5G4ZA 3PBNA 1KDWA 1P0ZA 4NETA 4MN6A 4LRZE 1CEFA 3BLMA 1EW0A 3A3EA 2E8IA 1OTDA 4OOYA 2GJ3A 3LR4A 2M7UA 3A0VA 1SKOA 3LY3A 2G2UA 5TGFA 2H0TA 2D02A 4FCFA 1FCNA 4ZJ3A 4ZJ1A 2VEAA 4EQIA 5CEDA 1S67L 3L9KA 3GQZA 5HL1A 4NXGA 5HX9A 3VSKA 3MFDA 3QP5A 3EEAA 2L0WA 5HWWA 4OPQA 4NK3A 2Y2QA 1ONGA 4LENA 2KX6A 2ZQ8A 4Y0UA 4HP9A 3MKEA 1MKMA 4JF4A 5EOOA 3VP4A 3AGFA 4IBXA 3G6OA 3F1NA 5GL9A 4UEYA 4NXEA 1FR6A 1LL5A 2DNSA 4L0LA 4U0XA 3GTCA 1TS6A 2INWA 4L9EA 2VGLM 5M19A 4WUJA 1K4EA 3QP1A 1IEMA 3UE0A 1U60A 3V3RA 5A8BA 2B95A 3VMAA 3OBFA 4D2OA 2PU2A 2BTFP 1G28A 4ZRRA 3F1OA 3KSGA 2PHYA 2ZD8A 5FI2A 4KG2A 2WADA 1ZKJA 4Y2FA 2EX8A 5IU1A 4UQIM 1VM1A 2HJ9C 4X69A 3LY4A 3ZFZA 2Y2JA 3FC7A 3PYPA 4KZ3A 5GLDA 3GR2A 4DMZA 3FV7A 1BULA 2Q0OA 3MMHA 4HESA 3PAGA 4CLCC 2JKTM 5KSCA 2ZJ9A 3G35A 4GLQA 1DP6A 3BFGA 4HOIA 3A3JA 1Q2QA 2FZ0A 2J3TC 4C6YA 1JNUA 3M6HA 1IFQA 2XFTA 2BLSA 4YOFA 2X02A 2FFYA 1DY6A 3PBRA 2EXBA 1PRQA 4OOMA 2B5RA 3K2NA 1K38A 4BWIA 3C7UA 3UMEA 1K56A 4S2LA 1S4SA 2D01A 3LIEA 1PW8A 2Q9NA 3OCNA 3EOIA 3IX3A 2BASA 3GVBA 3N4IA 3JYIA 2GDNA 2J3WA 1NZOA 3HUNA 2ZQDA 4Y5FA 2HP5A 4EWFA 4MBFA 2WKPA 5AQBA 5F83A 3BYDA 3BJNA 4FOFA 4U0TA 1KGFA 5AQ9A 4CQHA 5DFXA 2ZC4B 3MZDA 4R6LA 5GHYA 4DKIA 4GOGA 3UPOA 2XRNA 1CF0A 3FZCA 4RX2A 1HLUP 1XJ6A 2Y2OA 1TS8A 1L0GA 2WKHA 3RXWA 5EM0A 5HD5A 1ES2A 5FATA 3CG5A 3T1QB 4EBLA 3CZDA 2IWDA 3ISGA 2WK0A 1ES5A 1QMEA 1E25A 1GHMA 1I2SA 2XLNA 3HJIA 1N9LA 4R38A 1K6SA 4S2KA 2HGVA 2W27A 3Q7VA 3MZFA 2VV7A 1PZPA 3PBSA 4OPRA 4WZ5C 1H8YA 4LCLA 2Y79A 1K6RA 4A5RA 1S4RA 4OQ0A 3UN7A 1O07A 1TD5A 4IJGA 3HLDA 3G4PA 4MDZA 3IS2B 3BRMA 2Y2GA 3TG9A 5FI7A 3DTMA 4EESA 1V9ZA 3N8LA 1PNEA 2R9WA 3VE4A 5E43A 4Y17A 3R7WB 5CXWA 5JYOA 4R3AA 3LIDA 5CGSA 3SZTA 3DWKA 2XEPA 3D4FA 4HY8A 3LI9A 3EQUA 2PR6A 3VP1A 2V1AA 1OMEA 3PBQA 1SZVA 3Q7ZA 1BT5A 1MWRA 3LR5A 4KZAA 3WS4A 2QYBA 4WEKA 2V1BA 1XA1A 2ZQAA 5L10A 3ZGAB 4CLCD 4JXSA 4KQDA 5FSRA 3IXDA 5HSQA 4GZBA 4GW9A 2W3HA 4RYEA 2V1ZA 3LUQA 3EEHA 4IEDA 3SS5A 1VHMA 2CC1A 4QD4A 3SH8A 4JGRA 4GHIA 3T4JA 3PBOA 1M6KA 1PW1A 3S7OA 1RP5A 4GJ4A 3G31A 5FL3A 3S22A 3SW1A 3V50A 1Q2PA 4HJ3A 4RQ9A 1SKFA 3IQAA 4FTXA 2WZZA 3DBAA 1K0KA 2IWCA 4K91A 1T19A 4OLGA 5AQAA 1OTIA 5TBMA 4G3KA 3CLOA 3F1PB 3HUOA 3HCYA 1T18A 3N8RA 4GKUA 1WA9A 1K57C 2P9VB 5HARA 1MXOA 1LHYA 2Y2LA 4R3BA 3MZEA 2FFFB 5EVIC 1K25A 4PM6A 3E4OA 1PI5A 3OPHA 1EROA 3KYEA 4Y13A 5DKLA 4HH3A 1H3QA 1ZG4A 1FIKA 4GN2A 1W5DA 4BL2A 3W4PA 3H82A 4WN5A 1IYOA 1ERMA 1HD8A 4NXFA 1EWZA 5M18A 3G2ZA 2WUQA 5DVAA 3T1XA 1ODVA 3NULA 4R70A 2PAVP 3TOIA 1BLHA 4HJ4A 4Y15A 5FQMA 4RA7A 5KMWA 1OTAA 3ZG8B 4S2IA 5IT5A 2K2NA 5HL6A 3EGXC 3HLCA 1ACFA 2GNXA 2IWBA 2W3FA 2RCXA 2XFSA 5CHUA 4N1HA 1N4OA 4LGWA 3VP3A 2EWWA 1IYQA 1JWPA 4WZ5A 3MS6A 4BD0A 5FA7A 4EQ1A 3P98A 4OP5A 1S1YA 3IXHA 1VEUB 3WS2A 1XFQA 4GDBA 4HP4A 1OPXA 1TDLA 4R3JA 2JCHA 3FWLA 4MMNA 4FSFA 3BQAA 3FKWA 1NYYA 1BUEA 2IA2A 4NXBA 3V39A 2H10A 2KDKA 5EVLA 4UAAA 3UB9A 3T12B 1XP4A 4F94A 3N8SA 4FD8A 1EI5A 3IWOA 2XF3A 2V0WA 5I94A 5AQ7A 1ZTUA 4DE3A 5E2HA 3JVVA 2EX2A 2Y2NA 4ESPA 2ZBBA 5EUAA 3T1RA 1H8ZA 3VP0A 4I3IA 2OAP1 3JPUA 4KUKA 4R1GA 5DF8A 1HZOA 3TRCA 4JGPA 4S2NC 1F5MA 1YQSA 3DAVA 4EETB 3T4LA 3IX4A 4G3VA 1ALQA 2ZL1B 3H9WA 4OKPA 2R78A 3SS3A 2OLUA 4MBHA 3CPTA 2EWVA 2QKPA 4JLFA 3ITBA 3NECA 4YINA 3VP2A 2GZAA 2V9AA 1C3BA 4X25A 1XJ3A 2Z2LB 1CI8A 1TS7A 4L9GA 1A0KA 2OLVA 4ARZA 3P7NA 5EE8A 3FYZA 4WLAA 4X1MA 5DFYA 4EU0A 3IF5A 5M1AA 5F69A 3H7WA 3M2KA 2XA7M 2XSSA 4EUVA 1S66L 2PDRA 2M7VA 3ZG9B 2ZC7A 1K57A 4XT2A 5F82A 5EVID 4P6ZS 1E4DA 2ZM8A 1WYCA 5EVIA 4DRTA 3C7VA 5J7EA 1I5QA 4KZ5A 4M4XA 2A24B 2HZ5A 3SOIA 3UDIA 3RFBA 5LBRA 2HV1A 4DF6A 4I3AA 5FQQA 2YKHA 2CMNA 3QP8A 2EFUA 2Y8HA 2O9AA 3IF6B 3FPVA 4KQRA 3GV9A 3A3FA 1HVBA 4YWZA 2MJ6A 1L0FA 2HP6A 1W63Q 2UV0E 4WBGA 5GLAA 3JVUA 4KG6A 3BEBA 5FAQA 4M3KA 5J4EA 3IH8A 3A3IA 3IWIA 2H0YA 2RL3A 3HLGA 4H6JB 3DWZA 3B33A 3RTYA 2ZLYA 4Z1WA 2VJWA 1YT4A 4WYYA 3UB7A 4Y0TA 2Y59A 5DTKA 4Q0HA 1YSPA 4FH2A 2Y4AA 1CEGA 1W8QA 4IHQA 1WYBA 1MBLA 3IT9A 5J8XA 2KOIA 2W3GA 4BBUA 4HEFA 2K31A 3C38A 4JGQA 3DW0A 4PM8A 3O5YA 4ZBEA 2PT7A 2WGIA 1BTLA 3MXQA 1OJ5A 5HWTA 2W1TB 3L7HA 3LO7A 2HJEA 4WF0A 1XGIA 2K7SA 1SCWA 3LEZA 5FQ9A 2J80A 4O7DA 4F3LB 3BQ8A 4S2NA 4BBVA 4YFMA 3HJKA 3BFEA 2JKGA 3A3DA 3NOTC 4N9LA 1FCOA 1G6AA 4QHCA 2WKEA 4ZAMA 4EEUA 3ZG0A 1K56D 2XD5A 3DTIA 5I5LA 4KQOA 1KE0A 4QY5A 2V8CA 4JKTA 3VFFA 1CK3A 1T1BA 2JKRI 4DE2A 1YLYA 4BENA 4DN0A 1E3UA 2B18A 3KSIA 1J3WA 1KOUA 1W63M 5FEFA 1F98A 3G32A 1SDNA 5CECA 2Y55A 1STZA 5EPHA 1YLTA 2ZOHA 1VQQA 2VGLS 4IUHA 3HLEA 4WM9A 2Q9MA 5A93A 3E98A 3EQVA 2EA9A 2ZMVA 1LT0A 2PBYA 4E3OA 5AJGA 1PFLA 3ZHHA 3S7QA 4WMCA 4MNRA 5DTSA 5D3OA 1PIOA 3W4OA 2C5WB 1DJCA 4X6TA 1VETB 2OWHA 5F6AA 2ZC6B 5CRFA 2WAEA 3IX8A 3IXGA 3KO6A 3P09A 1MY8A 3BY9A 4UQIS 5DJTA 4BL3A 4QU3A 2M1CA 2EX9A 5HZHA 1MWSA 3OPRA 4O0PA 2A3UA 3VOZA 3WS1A 1ESIA 5TFQA 3GDIA 4C75A 1LSXA 3MBZA 2PD7A 4L9FA 3MJQA 4K08A 5FQIA 2XD1A 1G68A 1KDSA 4ZJ2A 1LI0A 3Q07A 4P87A 1ONHA 3GECA 2QHKA 2J9PA 3AGEA 4GCZA 1PWGA 5EM1A 1JTGA 4KZBA 1FQGA 4Q8IA 3LFVA 4GD6A 1PWCA 3MR0A 4Z9QA 3OLOA 3IXBA 1J9MA 2I9VA 4IVKA 3I7JA 4X68A 3NCKA 3K3DA 3IS2A 1YSQA 2L1MA 3T4TA 1KVMA 4KZ8A 1CI9A 1S1ZA 3NBLA 1YAXA 2ZMAA 2EXAA 4I39A 5DKKA 3UDFA 1OJGA 5KSHA 3FPWA 1I2WA 3R7WA 5AVFA 4CLCB 2P7JA 2ZMFA 3HLWA 1BLSA 2J3TD 2Y2PA 4OLDA 3MQ0A 4N1XA 3BFCA 1BYWA 3LEQA 3ZG5A 4P6BA 2KLIA 3PBTA 4QJGA 2W3EA 1JVJA 1FSYA 1AXBA 2WKIA 3C5AA 2YKFA 4EW7A 4OPYA 4ID4A 1KE4A 4GS9B 3LI8A 1TDGA 4E3NA 1ESUA 1D1JA 4R4RA 5HDSA 2DRWA 3B3XA 2XROA 1NRJA 3ZDJA 3HVFA 3N6IA 3ZQ5A 2Z2MB 4XUXA 3HLBA 3UO9A 2P74A 4UA7A 2PYRA 3G30A 1Y4OA 3CAXA 2OV5A 3QNBA 4PM5A 4MLLA 4S2MA 1GHPA 2PR5A 2VX8A 4IBRA 4MN5A 3O86A 3VOLA 4X56A 2VLGA 4MN7A 3TE8A 1H5XA 5HWVA 1VB6A 2LB9A 4IUKA 3HUMA 4BBTA 3WRTA 3CJMA 3T4SA 5K5BA 3FKVA 1M40A 5MC7A 4II7A 5HAIA 1P9RA 3VE3A 1N9OA 3V67A 2ZQ9A 2WZXA 2P9VA 3PXPA 3WS0A 4EXOA 1DRMA 4E3LA 2W0NA 1NLZA 1NXYA 3BM6A 4YNRA 5A92A 3IBJA 3ZYTA 3EGDC 4DE1A 3MF0A 3ITAA 3NDGA 3ZCZA 2Y2IA 1NY0A 2HDUA 1LSWA 3V3SA 2DMWA 2I72A 3LIFA 3UB6A 5HPFA 2W1RA 3Q82A 2G2WA 1TEMA 3HLFA 3VFHA 4HHDA 2VV6A 4HH2A 1LI9A 1YLPA 3UDXA 1TF1A 3IF6C 1XJ4A 3QP4A 4OQIA 4UA6A 1UWPX 4EBPA 3W2ZA 1W79A 1ES4A 3KYZA 2O0YA 2DCFA 4OQHA 1XA7A 5E2GA 1L0EA 2JKTI 4DXCA 4G3WA 4MCWA 3NC8A 2G7UA 2WKQA 5GLCA 3T50A 4B4ZA 4QPRA 1VEUA 5DF7A 5IS1A 1NRFA 5FEGA 1NWZA 4MEZA 3DTEA 5KIZA 1ZG6A 3OPPA 1N9NA 1H0MA 2HPBA 3ZVTA 3ULFA 4JF6A 4PPRA 1YLZA 5E2EA 3LIAA 2C6WB 1BZAA 3QP6A 4JXWA 3KX0X 1K4FA 4WZ4A 4Q0IA 2VZWA 2J8YA 1BLPA 1UWNX 1XJ2A 2OAQ1 4B93A 1IELA 1LLBA 4I5SA 3UMDA 4E3KA 4DE0A 1LL9A 3PTEA 1OT9A 3NIAA 2WGWA 3W4QA 5AVEA 2VKSA 1AWIA 4OPZA 3C2WA 2EX6A 3DTKA 2V2FF 1V9YA 4I3JA 4KZ4A 2WKRA 4S2OA 3KYQA 3T4KA 2ZL1A 5G18A 1RCJA 2P08A 1F9IA 2QJ7A 1NZUA 2ZC5B
chains in the Genus database with same CATH topology
4KENB 1XGIA 3Q1FA 4KQQA 4OQ0A 4PMAA 1SCWA 3LEZA 4FH4A 3UN7A 2ZM2A 1O07A 2JC7A 2ZC3B 5FQ9A 1K55A 1PWDA 3GRJA 3HLDA 3G4PA 5A90A 2QPNA 3BRMA 2VGKA 2Y2GA 3IHBA 4OOLA 5EVIB 3TG9A 4O7DA 1FOFA 4S2NA 1JWZA 3BFFA 5FI7A 3WS5A 4JBFA 2EFXA 3DTMA 4YFMA 5JYPA 3V5MA 3BFEA 3IWQA 4K0WA 4E6XA 5HW3A 2X71A 3A3DA 3LCEA 2ZQ7A 4N9LA 5GLBA 3N8LA 1FCOA 5FI6A 1G6AA 2R9WA 4QHCA 2WKEA 5CTNA 4ZAMA 5E43A 3ZG0A 2WGVA 5CXWA 5CEBA 5JYOA 5CGSA 5L2FA 1K56D 1S0WA 2XD5A 3DWKA 4B4XA 2XEPA 2ZM0A 1N9BA 1XXMA 3D4FA 1KE0A 3EQUA 4KQOA 5FAOA 3G2YA 4QY5A 4UHUA 4E6WA 3VP1A 3PAEA 4JKTA 3VFFA 1CK3A 2OSUA 4DE2A 1YLYA 4DXBA 4BENA 2R9XA 4S2PA 1OMEA 3PBQA 3Q7ZA 1BT5A 5FQJA 4ZTKA 1MWRA 1E3UA 5HAQA 4KZAA 3WS4A 2ZQAA 4WEKA 1XA1A 3RXXA 4OONA 3ZGAB 4JXSA 3G32A 1SDNA 5FQKA 5FSRA 3IXDA 4PM7A 5CECA 1SDEA 3TSGA 4GZBA 2Y55A 4RYEA 5EPHA 2V1ZA 1YLTA 5U47A 1VQQA 1JTDA 5KZHA 3HLEA 4IEDA 4BLMA 4WM9A 2Q9MA 5CHJA 3SS5A 4E3MA 5A93A 1YLWA 1JWVA 3UY6A 1GA9A 3C4OA 3EQVA 2CC1A 4QD4A 2HDQA 3SH8A 3MXSA 2XGNA 1BLCA 3IF6A 3VOYA 4XUZA 2PBYA 4E3OA 5EOEA 3PBOA 4H8RA 4R23A 2PU4A 4Y0OA 1M6KA 1PW1A 3ZHHA 5GHZA 4P85A 4WMCA 4C3QA 3UNWA 5CTMA 1RP5A 4WELA 4MNRA 3G31A 2HDSA 4BQMA 4EBNA 5DTSA 5D3OA 4HBUA 3S22A 3V50A 2Y2MA 1Q2PA 1PIOA 2Y2HA 2C5WB 1DJCA 2HP9A 4X6TA 3W4OA 3MXRA 4S2JA 1SKFA 1XPBA 2ZC6B 3ZNTA 5CRFA 2WAEA 3IQAA 3S4XA 2WZZA 4K91A 2IWCA 3IXGA 3P09A 1MY8A 4OLGA 5AQAA 1DJBA 1NJ4A 4XXRA 3M2JA 1XGJA 1ZC2A 3HUOA 4X53A 5TR7A 4BL3A 2WGWB 3GSGA 1Z6FA 4LCMA 4QU3A 4UA9A 3N8RA 5FASA 3O3VA 2EX9A 4GKUA 1MWSA 3OPRA 1K57C 2A3UA 3O87A 2P9VB 2XQZA 3QHYA 5HARA 1DJAA 3VOZA 3WS1A 1MXOA 1LHYA 2Y2LA 1ESIA 4QB8A 4R3BA 4R4SA 5TFQA 1S6RA 2XH9A 3MZEA 4C75A 4U3TA 2XDMA 2FFFB 5EVIC 3MBZA 1K25A 1ERQA 3C4PA 4PM6A 1KVLA 5F1FA 1PI5A 3NY4A 3UE1A 3OPHA 5FQIA 1EROA 2XD1A 1G68A 2WAFA 3G34A 2V20A 4EV4A 1KDSA 4ZJ2A 1KGEA 1LI0A 1YMSA 3Q07A 4P87A 1YM1A 2H5SA 1ONHA 1ZG4A 1O7EA 1KGGA 4GDNA 2UWXA 5CGXA 1IYPA 1MWUA 4DDSA 1WE4A 1L0DA 1W5DA 2J9PA 3AGEA 4GN2A 4BL2A 3OC2A 3W4PA 3HBRA 1PWGA 1IYOA 1JTGA 1ERMA 1HD8A 1FQGA 4KZBA 5DTTA 1EWZA 4Q8IA 2QZ6A 5M18A 5DF9A 4GD6A 3PBNA 1KDWA 1PWCA 4NETA 1PYYA 3G2ZA 4Z9QA 2WUQA 5DVAA 1CEFA 3NDEA 3BLMA 1J9MA 3A3EA 3IXBA 5FDHA 3TOIA 2E8IA 3UE3A 1BLHA 4OOYA 5FQMA 4X55A 4IVKA 3I7JA 4RA7A 1W8YA 4X68A 5FAPA 5KMWA 3NCKA 3LY3A 2G2UA 5TGFA 3ZG8B 4S2IA 2H0TA 1KVMA 4KZ8A 1CI9A 4N92A 4FCFA 1E3UD 4RVAA 1FCNA 3NBLA 4ZJ3A 2ZMAA 3HLCA 2IWBA 5CHUA 2RCXA 2XFSA 4ZJ1A 4N1HA 1N4OA 3S1YA 1W7FA 2EXAA 3VP3A 3UDFA 4DDYA 1IYQA 2A49A 4EQIA 5CEDA 1JWPA 4WZ5A 4ZDXA 4BD0A 4BJPA 5KSHA 5FA7A 1I2WA 2ZQCA 4OVDA 3GQZA 3HREA 2XR0A 5HL1A 1HTZA 3HLWA 3P98A 4OP5A 5HX9A 1IKIA 2X01A 3IXHA 3QNCA 3VSKA 1BLSA 2Y2PA 4OLDA 3MFDA 4N1XA 3WS2A 4E3IA 2J7VA 4OQGA 3BFCA 4GDBA 4OPQA 1TDLA 4NK3A 4R3JA 1Y54A 3ZG5A 2JCHA 4P6BA 3FWLA 2Y2QA 1ONGA 4LENA 3PBTA 3SS4A 4QJGA 4CPKA 2ZQ8A 4Y0UA 4FSFA 3SH7A 4WMCD 1JVJA 1FSYA 1AXBA 2WKIA 3FKWA 3C5AA 4IVIA 2QMIA 5E2FA 1NYYA 3MKEA 4ID4A 1KE4A 4OPYA 1TDGA 4JF4A 5EOOA 4E3NA 1BUEA 1ESUA 3M6BA 3VP4A 2VGJA 3AGFA 4IBXA 3V39A 2H10A 4R4RA 5EVLA 4UAAA 1K54C 3ZVWA 2DRWA 5GL9A 3B3XA 1FR6A 1XP4A 4F94A 1LL5A 3N8SA 2DNSA 3E2KA 3HVFA 3ZDJA 3N6IA 2Z2MB 4L0LA 4FD8A 3HLBA 4LV1A 4U0XA 4XUXA 4GD8A 1EI5A 2P74A 2XF3A 3GTCA 1XKZA 3IWOA 4UA7A 3UO9A 4PM9A 5I94A 3G30A 5AQ7A 2OV5A 1FSWA 4HBTA 2Y2KA 3QNBA 4DE3A 5E2HA 5M19A 4PM5A 4MLLA 4S2MA 5HAPA 1K4EA 2EX2A 1GHPA 3HL9A 4IBRA 5CGWA 2J9OA 2Y2NA 3O86A 4X56A 4KG5A 1IEMA 3NI9A 3UE0A 1MKIA 1U60A 5EUAA 5BOHA 1H8ZA 3VP0A 3RJUA 1K55C 3V3RA 1H5XA 5DF8A 4R1GA 1HZOA 4S2NC 3HUMA 3WRTA 3CJMA 3VMAA 1YQSA 3FKVA 4GB7A 1M40A 3Q7VB 1ALQA 2PU2A 4D2OA 4OKPA 3SS3A 5HAIA 2OLUA 4LV0A 5F1GA 3Q81A 4MBHA 4JPMA 2ZD8A 2ZQ9A 2WZXA 5FI2A 3ZNYA 2P9VA 3WS0A 1RGYA 4JLFA 4KG2A 3ITBA 2WADA 4YINA 3CMZA 1ZKJA 3E2LA 5CHMA 3VP2A 2EX8A 4B88A 3W8KA 1C3BA 4E3LA 3GMWA 2Z2LB 1CI8A 1VM1A 1NXYA 2OLVA 3LY4A 4X69A 3ZFZA 3BM6A 2Y2JA 4KZ3A 5EE8A 2HDRA 3FYZA 5GLDA 5A92A 3IF5A 3GR2A 5M1AA 1KE3A 3M2KA 3FV7A 1BULA 1XX2A 1ES3A 4HESA 3PAGA 4DE1A 3ZG9B 2ZC7A 5KSCA 1K57A 3ITAA 2ZJ9A 1IYSA 3G35A 3NDGA 1FCMA 5F82A 3ZCZA 2Y2IA 1NY0A 5EVID 2HDUA 3BFGA 3A3JA 3V3SA 1E4DA 2I72A 1GHIA 1Q2QA 3ZG7B 2ZM8A 1WYCA 3OPLA 3Q82A 5EVIA 2G2WA 4C6YA 1BSGA 1TEMA 4DRTA 3HLFA 3C7VA 4LV3A 3VFHA 3M6HA 1LI9A 1I5QA 2XFTA 1YLPA 2BLSA 3UDXA 2X02A 2FFYA 3IF6C 4JXVA 4KZ5A 2BG1A 1DY6A 3IH9A 3PBRA 2EXBA 4OH0A 2WYXA 3UPNA 4OOMA 3SOIA 4OQIA 3UDIA 4UA6A 1NYMA 2B5RA 1FR1A 4K0XA 3WRZA 5IHVA 1K38A 4DF6A 2JE5A 4EBPA 3C7UA 5FQQA 1W79A 1K56A 1MWTA 4S2LA 4MBKA 4N9KA 1ES4A 2JBFA 5HFOA 1PW8A 3N7WA 5CERA 2EFUA 3OZHA 1MPLA 2Q9NA 2DCFA 4JF5A 3OCNA 1PZOA 4P0MA 4OQHA 1XA7A 5E2GA 3GVBA 3IF6B 1YMXA 3N4IA 1L0EA 4KQRA 3JYIA 4DXCA 3GV9A 1YLJA 2GDNA 3NC8A 4EUZA 1L2SA 3A3FA 5GLCA 4B4ZA 1NZOA 3HUNA 1TVFA 1HVBA 2ZQDA 1L0FA 2HP6A 5DF7A 4CJNA 2HP5A 3O88A 4EWFA 4WBGA 5GHXA 1NRFA 4LV2A 4MEZA 5GLAA 1GCEA 3MKFA 4MBFA 1ZG6A 3BECA 3OPPA 4KG6A 4KZ6A 3BEBA 5AQBA 1SHVA 4GNUA 4OP8A 5F83A 2HPBA 3ZVTA 4JF6A 4PPRA 4E3JA 5FAQA 4M3KA 1YLZA 5E2EA 3IH8A 3A3IA 3IWIA 3BYDA 2H0YA 2C6WB 2RL3A 4U0TA 1KGFA 3IHAA 5EECA 5AQ9A 3UPPA 3HLGA 4KZ7A 2ZC4B 1BZAA 3MZDA 4JXWA 4R0QA 3DWZA 1IKGA 2XK1A 5GHYA 4DKIA 4GOGA 2ZLYA 1K4FA 4WZ4A 3SH9A 1YT4A 4RX3A 3UPOA 4WYYA 2J8YA 1BLPA 4Y0TA 1PI4A 2Y59A 4KZ9A 3FZCA 5DTKA 4RX2A 1IELA 1LLBA 2Y2OA 4E3KA 4DE0A 1LL9A 5A91A 3PTEA 4FH2A 1L0GA 2Y4AA 1CEGA 2WKHA 3RXWA 3OCLA 4WEJA 4A5RA 1W8QA 3AGDA 3NIAA 1ES2A 2WGWA 1WYBA 1RGZA 3BFDA 1MBLA 3CG5A 4Y7PA 5FATA 3CZDA 2IWDA 4EBLA 3IT9A 3VSLA 5J8XA 3ISGA 2WK0A 3W4QA 4HEFA 1ES5A 1K54A 1QMEA 1E25A 1GHMA 2EX6A 1I2SA 3BLSA 4OPZA 3WWXA 2XLNA 2V2FF 3DW0A 4QY6A 1GA0A 1K6SA 4PM8A 4S2KA 4JXGA 4KZ4A 4BD1A 4S2OA 4ZBEA 2WGIA 3Q7VA 1BTLA 3MZFA 5G18A 1PZPA 3PBSA 1RCJA 2Y91A 4LCLA 4OPRA 1H8YA 3LO7A 4WZ5C 1K6RA 1NZUA 1QMFA 2ZC5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KEN B;  1XGI A;  3Q1F A;  4KQQ A;  4OQ0 A;  4PMA A;  1SCW A;  3LEZ A;  4FH4 A;  3UN7 A;  2ZM2 A;  1O07 A;  2JC7 A;  2ZC3 B;  5FQ9 A;  1K55 A;  1PWD A;  3GRJ A;  3HLD A;  3G4P A;  5A90 A;  2QPN A;  3BRM A;  2VGK A;  2Y2G A;  3IHB A;  4OOL A;  5EVI B;  3TG9 A;  4O7D A;  1FOF A;  4S2N A;  1JWZ A;  3BFF A;  5FI7 A;  3WS5 A;  4JBF A;  2EFX A;  3DTM A;  4YFM A;  5JYP A;  3V5M A;  3BFE A;  3IWQ A;  4K0W A;  4E6X A;  5HW3 A;  2X71 A;  3A3D A;  3LCE A;  2ZQ7 A;  4N9L A;  5GLB A;  3N8L A;  1FCO A;  5FI6 A;  1G6A A;  2R9W A;  4QHC A;  2WKE A;  5CTN A;  4ZAM A;  5E43 A;  3ZG0 A;  2WGV A;  5CXW A;  5CEB A;  5JYO A;  5CGS A;  5L2F A;  1K56 D;  1S0W A;  2XD5 A;  3DWK A;  4B4X A;  2XEP A;  2ZM0 A;  1N9B A;  1XXM A;  3D4F A;  1KE0 A;  3EQU A;  4KQO A;  5FAO A;  3G2Y A;  4QY5 A;  4UHU A;  4E6W A;  3VP1 A;  3PAE A;  4JKT A;  3VFF A;  1CK3 A;  2OSU A;  4DE2 A;  1YLY A;  4DXB A;  4BEN A;  2R9X A;  4S2P A;  1OME A;  3PBQ A;  3Q7Z A;  1BT5 A;  5FQJ A;  4ZTK A;  1MWR A;  1E3U A;  5HAQ A;  4KZA A;  3WS4 A;  2ZQA A;  4WEK A;  1XA1 A;  3RXX A;  4OON A;  3ZGA B;  4JXS A;  3G32 A;  1SDN A;  5FQK A;  5FSR A;  3IXD A;  4PM7 A;  5CEC A;  1SDE A;  3TSG A;  4GZB A;  2Y55 A;  4RYE A;  5EPH A;  2V1Z A;  1YLT A;  5U47 A;  1VQQ A;  1JTD A;  5KZH A;  3HLE A;  4IED A;  4BLM A;  4WM9 A;  2Q9M A;  5CHJ A;  3SS5 A;  4E3M A;  5A93 A;  1YLW A;  1JWV A;  3UY6 A;  1GA9 A;  3C4O A;  3EQV A;  2CC1 A;  4QD4 A;  2HDQ A;  3SH8 A;  3MXS A;  2XGN A;  1BLC A;  3IF6 A;  3VOY A;  4XUZ A;  2PBY A;  4E3O A;  5EOE A;  3PBO A;  4H8R A;  4R23 A;  2PU4 A;  4Y0O A;  1M6K A;  1PW1 A;  3ZHH A;  5GHZ A;  4P85 A;  4WMC A;  4C3Q A;  3UNW A;  5CTM A;  1RP5 A;  4WEL A;  4MNR A;  3G31 A;  2HDS A;  4BQM A;  4EBN A;  5DTS A;  5D3O A;  4HBU A;  3S22 A;  3V50 A;  2Y2M A;  1Q2P A;  1PIO A;  2Y2H A;  2C5W B;  1DJC A;  2HP9 A;  4X6T A;  3W4O A;  3MXR A;  4S2J A;  1SKF A;  1XPB A;  2ZC6 B;  3ZNT A;  5CRF A;  2WAE A;  3IQA A;  3S4X A;  2WZZ A;  4K91 A;  2IWC A;  3IXG A;  3P09 A;  1MY8 A;  4OLG A;  5AQA A;  1DJB A;  1NJ4 A;  4XXR A;  3M2J A;  1XGJ A;  1ZC2 A;  3HUO A;  4X53 A;  5TR7 A;  4BL3 A;  2WGW B;  3GSG A;  1Z6F A;  4LCM A;  4QU3 A;  4UA9 A;  3N8R A;  5FAS A;  3O3V A;  2EX9 A;  4GKU A;  1MWS A;  3OPR A;  1K57 C;  2A3U A;  3O87 A;  2P9V B;  2XQZ A;  3QHY A;  5HAR A;  1DJA A;  3VOZ A;  3WS1 A;  1MXO A;  1LHY A;  2Y2L A;  1ESI A;  4QB8 A;  4R3B A;  4R4S A;  5TFQ A;  1S6R A;  2XH9 A;  3MZE A;  4C75 A;  4U3T A;  2XDM A;  2FFF B;  5EVI C;  3MBZ A;  1K25 A;  1ERQ A;  3C4P A;  4PM6 A;  1KVL A;  5F1F A;  1PI5 A;  3NY4 A;  3UE1 A;  3OPH A;  5FQI A;  1ERO A;  2XD1 A;  1G68 A;  2WAF A;  3G34 A;  2V20 A;  4EV4 A;  1KDS A;  4ZJ2 A;  1KGE A;  1LI0 A;  1YMS A;  3Q07 A;  4P87 A;  1YM1 A;  2H5S A;  1ONH A;  1ZG4 A;  1O7E A;  1KGG A;  4GDN A;  2UWX A;  5CGX A;  1IYP A;  1MWU A;  4DDS A;  1WE4 A;  1L0D A;  1W5D A;  2J9P A;  3AGE A;  4GN2 A;  4BL2 A;  3OC2 A;  3W4P A;  3HBR A;  1PWG A;  1IYO A;  1JTG A;  1ERM A;  1HD8 A;  1FQG A;  4KZB A;  5DTT A;  1EWZ A;  4Q8I A;  2QZ6 A;  5M18 A;  5DF9 A;  4GD6 A;  3PBN A;  1KDW A;  1PWC A;  4NET A;  1PYY A;  3G2Z A;  4Z9Q A;  2WUQ A;  5DVA A;  1CEF A;  3NDE A;  3BLM A;  1J9M A;  3A3E A;  3IXB A;  5FDH A;  3TOI A;  2E8I A;  3UE3 A;  1BLH A;  4OOY A;  5FQM A;  4X55 A;  4IVK A;  3I7J A;  4RA7 A;  1W8Y A;  4X68 A;  5FAP A;  5KMW A;  3NCK A;  3LY3 A;  2G2U A;  5TGF A;  3ZG8 B;  4S2I A;  2H0T A;  1KVM A;  4KZ8 A;  1CI9 A;  4N92 A;  4FCF A;  1E3U D;  4RVA A;  1FCN A;  3NBL A;  4ZJ3 A;  2ZMA A;  3HLC A;  2IWB A;  5CHU A;  2RCX A;  2XFS A;  4ZJ1 A;  4N1H A;  1N4O A;  3S1Y A;  1W7F A;  2EXA A;  3VP3 A;  3UDF A;  4DDY A;  1IYQ A;  2A49 A;  4EQI A;  5CED A;  1JWP A;  4WZ5 A;  4ZDX A;  4BD0 A;  4BJP A;  5KSH A;  5FA7 A;  1I2W A;  2ZQC A;  4OVD A;  3GQZ A;  3HRE A;  2XR0 A;  5HL1 A;  1HTZ A;  3HLW A;  3P98 A;  4OP5 A;  5HX9 A;  1IKI A;  2X01 A;  3IXH A;  3QNC A;  3VSK A;  1BLS A;  2Y2P A;  4OLD A;  3MFD A;  4N1X A;  3WS2 A;  4E3I A;  2J7V A;  4OQG A;  3BFC A;  4GDB A;  4OPQ A;  1TDL A;  4NK3 A;  4R3J A;  1Y54 A;  3ZG5 A;  2JCH A;  4P6B A;  3FWL A;  2Y2Q A;  1ONG A;  4LEN A;  3PBT A;  3SS4 A;  4QJG A;  4CPK A;  2ZQ8 A;  4Y0U A;  4FSF A;  3SH7 A;  4WMC D;  1JVJ A;  1FSY A;  1AXB A;  2WKI A;  3FKW A;  3C5A A;  4IVI A;  2QMI A;  5E2F A;  1NYY A;  3MKE A;  4ID4 A;  1KE4 A;  4OPY A;  1TDG A;  4JF4 A;  5EOO A;  4E3N A;  1BUE A;  1ESU A;  3M6B A;  3VP4 A;  2VGJ A;  3AGF A;  4IBX A;  3V39 A;  2H10 A;  4R4R A;  5EVL A;  4UAA A;  1K54 C;  3ZVW A;  2DRW A;  5GL9 A;  3B3X A;  1FR6 A;  1XP4 A;  4F94 A;  1LL5 A;  3N8S A;  2DNS A;  3E2K A;  3HVF A;  3ZDJ A;  3N6I A;  2Z2M B;  4L0L A;  4FD8 A;  3HLB A;  4LV1 A;  4U0X A;  4XUX A;  4GD8 A;  1EI5 A;  2P74 A;  2XF3 A;  3GTC A;  1XKZ A;  3IWO A;  4UA7 A;  3UO9 A;  4PM9 A;  5I94 A;  3G30 A;  5AQ7 A;  2OV5 A;  1FSW A;  4HBT A;  2Y2K A;  3QNB A;  4DE3 A;  5E2H A;  5M19 A;  4PM5 A;  4MLL A;  4S2M A;  5HAP A;  1K4E A;  2EX2 A;  1GHP A;  3HL9 A;  4IBR A;  5CGW A;  2J9O A;  2Y2N A;  3O86 A;  4X56 A;  4KG5 A;  1IEM A;  3NI9 A;  3UE0 A;  1MKI A;  1U60 A;  5EUA A;  5BOH A;  1H8Z A;  3VP0 A;  3RJU A;  1K55 C;  3V3R A;  1H5X A;  5DF8 A;  4R1G A;  1HZO A;  4S2N C;  3HUM A;  3WRT A;  3CJM A;  3VMA A;  1YQS A;  3FKV A;  4GB7 A;  1M40 A;  3Q7V B;  1ALQ A;  2PU2 A;  4D2O A;  4OKP A;  3SS3 A;  5HAI A;  2OLU A;  4LV0 A;  5F1G A;  3Q81 A;  4MBH A;  4JPM A;  2ZD8 A;  2ZQ9 A;  2WZX A;  5FI2 A;  3ZNY A;  2P9V A;  3WS0 A;  1RGY A;  4JLF A;  4KG2 A;  3ITB A;  2WAD A;  4YIN A;  3CMZ A;  1ZKJ A;  3E2L A;  5CHM A;  3VP2 A;  2EX8 A;  4B88 A;  3W8K A;  1C3B A;  4E3L A;  3GMW A;  2Z2L B;  1CI8 A;  1VM1 A;  1NXY A;  2OLV A;  3LY4 A;  4X69 A;  3ZFZ A;  3BM6 A;  2Y2J A;  4KZ3 A;  5EE8 A;  2HDR A;  3FYZ A;  5GLD A;  5A92 A;  3IF5 A;  3GR2 A;  5M1A A;  1KE3 A;  3M2K A;  3FV7 A;  1BUL A;  1XX2 A;  1ES3 A;  4HES A;  3PAG A;  4DE1 A;  3ZG9 B;  2ZC7 A;  5KSC A;  1K57 A;  3ITA A;  2ZJ9 A;  1IYS A;  3G35 A;  3NDG A;  1FCM A;  5F82 A;  3ZCZ A;  2Y2I A;  1NY0 A;  5EVI D;  2HDU A;  3BFG A;  3A3J A;  3V3S A;  1E4D A;  2I72 A;  1GHI A;  1Q2Q A;  3ZG7 B;  2ZM8 A;  1WYC A;  3OPL A;  3Q82 A;  5EVI A;  2G2W A;  4C6Y A;  1BSG A;  1TEM A;  4DRT A;  3HLF A;  3C7V A;  4LV3 A;  3VFH A;  3M6H A;  1LI9 A;  1I5Q A;  2XFT A;  1YLP A;  2BLS A;  3UDX A;  2X02 A;  2FFY A;  3IF6 C;  4JXV A;  4KZ5 A;  2BG1 A;  1DY6 A;  3IH9 A;  3PBR A;  2EXB A;  4OH0 A;  2WYX A;  3UPN A;  4OOM A;  3SOI A;  4OQI A;  3UDI A;  4UA6 A;  1NYM A;  2B5R A;  1FR1 A;  4K0X A;  3WRZ A;  5IHV A;  1K38 A;  4DF6 A;  2JE5 A;  4EBP A;  3C7U A;  5FQQ A;  1W79 A;  1K56 A;  1MWT A;  4S2L A;  4MBK A;  4N9K A;  1ES4 A;  2JBF A;  5HFO A;  1PW8 A;  3N7W A;  5CER A;  2EFU A;  3OZH A;  1MPL A;  2Q9N A;  2DCF A;  4JF5 A;  3OCN A;  1PZO A;  4P0M A;  4OQH A;  1XA7 A;  5E2G A;  3GVB A;  3IF6 B;  1YMX A;  3N4I A;  1L0E A;  4KQR A;  3JYI A;  4DXC A;  3GV9 A;  1YLJ A;  2GDN A;  3NC8 A;  4EUZ A;  1L2S A;  3A3F A;  5GLC A;  4B4Z A;  1NZO A;  3HUN A;  1TVF A;  1HVB A;  2ZQD A;  1L0F A;  2HP6 A;  5DF7 A;  4CJN A;  2HP5 A;  3O88 A;  4EWF A;  4WBG A;  5GHX A;  1NRF A;  4LV2 A;  4MEZ A;  5GLA A;  1GCE A;  3MKF A;  4MBF A;  1ZG6 A;  3BEC A;  3OPP A;  4KG6 A;  4KZ6 A;  3BEB A;  5AQB A;  1SHV A;  4GNU A;  4OP8 A;  5F83 A;  2HPB A;  3ZVT A;  4JF6 A;  4PPR A;  4E3J A;  5FAQ A;  4M3K A;  1YLZ A;  5E2E A;  3IH8 A;  3A3I A;  3IWI A;  3BYD A;  2H0Y A;  2C6W B;  2RL3 A;  4U0T A;  1KGF A;  3IHA A;  5EEC A;  5AQ9 A;  3UPP A;  3HLG A;  4KZ7 A;  2ZC4 B;  1BZA A;  3MZD A;  4JXW A;  4R0Q A;  3DWZ A;  1IKG A;  2XK1 A;  5GHY A;  4DKI A;  4GOG A;  2ZLY A;  1K4F A;  4WZ4 A;  3SH9 A;  1YT4 A;  4RX3 A;  3UPO A;  4WYY A;  2J8Y A;  1BLP A;  4Y0T A;  1PI4 A;  2Y59 A;  4KZ9 A;  3FZC A;  5DTK A;  4RX2 A;  1IEL A;  1LLB A;  2Y2O A;  4E3K A;  4DE0 A;  1LL9 A;  5A91 A;  3PTE A;  4FH2 A;  1L0G A;  2Y4A A;  1CEG A;  2WKH A;  3RXW A;  3OCL A;  4WEJ A;  4A5R A;  1W8Q A;  3AGD A;  3NIA A;  1ES2 A;  2WGW A;  1WYB A;  1RGZ A;  3BFD A;  1MBL A;  3CG5 A;  4Y7P A;  5FAT A;  3CZD A;  2IWD A;  4EBL A;  3IT9 A;  3VSL A;  5J8X A;  3ISG A;  2WK0 A;  3W4Q A;  4HEF A;  1ES5 A;  1K54 A;  1QME A;  1E25 A;  1GHM A;  2EX6 A;  1I2S A;  3BLS A;  4OPZ A;  3WWX A;  2XLN A;  2V2F F;  3DW0 A;  4QY6 A;  1GA0 A;  1K6S A;  4PM8 A;  4S2K A;  4JXG A;  4KZ4 A;  4BD1 A;  4S2O A;  4ZBE A;  2WGI A;  3Q7V A;  1BTL A;  3MZF A;  5G18 A;  1PZP A;  3PBS A;  1RCJ A;  2Y91 A;  4LCL A;  4OPR A;  1H8Y A;  3LO7 A;  4WZ5 C;  1K6R A;  1NZU A;  1QMF A;  2ZC5 B; 
#chains in the Genus database with same CATH topology
 4KEN B;  4PMA A;  1F2K A;  2ZM2 A;  2JC7 A;  1SKO B;  2ZC3 B;  3GRJ A;  5F68 A;  2QPN A;  2VGK A;  4I38 A;  3IHB A;  4OOL A;  5EVI B;  3E4P A;  3WS5 A;  4ME4 A;  5JYP A;  3RH8 B;  3IWQ A;  1Z09 A;  4JGO A;  3LCE A;  4DJ2 A;  2ZQ7 A;  3MSH A;  3P01 A;  3LR3 A;  1P97 A;  4HNB A;  3UB5 P;  1OTE A;  3PHY A;  5L2F A;  2PD8 A;  2ZM0 A;  1XXM A;  4O01 A;  5L07 A;  4E6W A;  1T1C A;  3PAE A;  2ACG A;  2PBD P;  5FQJ A;  4ZTK A;  3S7P A;  1H8M A;  3RXX A;  4OON A;  3CWF A;  2A24 A;  5DJU A;  3T4O A;  1SDE A;  3TSG A;  3LIC A;  5U47 A;  2LB5 A;  1JTD A;  4BLM A;  2W3D A;  3F1N B;  3S7N A;  1GA9 A;  3UY6 A;  2VA0 A;  2HDQ A;  3CHW P;  2XGN A;  1BLC A;  3IF6 A;  5EOE A;  2JHE A;  3MFX A;  4Y0O A;  5GHZ A;  4LRY C;  1Y28 A;  4EBN A;  4HBU A;  2FH5 A;  2Y2H A;  2HP9 A;  3MXR A;  4S2J A;  1XPB A;  3ZNT A;  3S4X A;  4WL9 A;  1DJB A;  1NJ4 A;  4XXR A;  1XGJ A;  1ZC2 A;  4X53 A;  3UB8 A;  5TR7 A;  3GSG A;  1Z6F A;  4UA9 A;  4H6J A;  3O3V A;  3F1O B;  3LR0 A;  1GSX A;  3O87 A;  2XA7 S;  2XQZ A;  4R4S A;  1UGU A;  4U3T A;  1CQA A;  1D06 A;  1ERQ A;  2E8J A;  3NY4 A;  4QWO A;  3MQO A;  4HJ6 A;  2WAF A;  4EV4 A;  2V20 A;  1FIL A;  1YMS A;  1O7E A;  1KGG A;  2VV8 A;  4GDN A;  4DDS A;  1WE4 A;  3C8C A;  1L0D A;  2V0U A;  1CJF A;  3OC2 A;  5DF9 A;  1PYY A;  1G5U A;  3NDE A;  2W1T A;  5FDH A;  3UE3 A;  3BY8 A;  4X55 A;  1W8Y A;  3CUE C;  5FAP A;  3NOU C;  4PKY A;  3D9Y A;  4N92 A;  4F3L A;  4RVA A;  2ZOI A;  1E3U D;  1LSV A;  4ETX A;  4PHT A;  4NEE D;  3S1Y A;  1W7F A;  4DDY A;  1IOU A;  2A49 A;  4ZDX A;  4BJP A;  3LIB A;  2ZQC A;  4OVD A;  3HRE A;  2XR0 A;  3A0R A;  1HTZ A;  1IKI A;  2X01 A;  3QNC A;  4E3I A;  2J7V A;  5FDS A;  4AFI A;  4OQG A;  1DP8 A;  1NLY A;  3OOV A;  1Y54 A;  3SS4 A;  4CPK A;  3SH7 A;  1ZHH B;  4WMC D;  4IVI A;  5CX7 A;  2QMI A;  5E2F A;  3E4Q A;  3M6B A;  2VGJ A;  1K54 C;  3ZVW A;  3E2K A;  4LV1 A;  4B4X A;  4GD8 A;  1XKZ A;  1LL8 A;  4PM9 A;  2AVX A;  1MC0 A;  1FSW A;  4HBT A;  2Y2K A;  5HAP A;  5CGW A;  3HL9 A;  5EFW A;  2J9O A;  4KG5 A;  4EEP A;  3NI9 A;  5BOH A;  1MKI A;  3VV4 A;  3RJU A;  1K55 C;  3C30 A;  4PAU A;  1VET A;  4ETZ A;  4GB7 A;  3Q7V B;  4X1L A;  4LPZ A;  4LV0 A;  5F1G A;  3NOP C;  3Q81 A;  4JPM A;  3ZNY A;  1RGY A;  3D3O A;  3CMZ A;  3KSH A;  3E2L A;  5CHM A;  4NG2 A;  3W8K A;  4B88 A;  3GMW A;  3B47 A;  2JKF A;  2HDR A;  1OT6 A;  4FUW A;  4LFU A;  1KE3 A;  1XX2 A;  1ES3 A;  2Z6C A;  1IYS A;  1FCM A;  3BWL A;  1X0O A;  4CLC E;  5EVE A;  1GHI A;  1MZU A;  3ZG7 B;  3OPL A;  1BSG A;  4LV3 A;  4JXV A;  2BG1 A;  3IH9 A;  3ICY A;  3E0Y A;  4PKY G;  4OH0 A;  2WYX A;  3UPN A;  4Q0J A;  1NYM A;  2QJ5 A;  1FR1 A;  4K0X A;  3WRZ A;  5IHV A;  3K3C A;  2JE5 A;  3KSF A;  4HIA A;  1MWT A;  4BMW A;  4MBK A;  4N9K A;  2JBF A;  5HFO A;  3N7W A;  5CER A;  3OZH A;  1MPL A;  4JF5 A;  1PZO A;  4LRX C;  4P0M A;  4GHI B;  1YMX A;  5F5Y A;  1YLJ A;  4CLC A;  4EUZ A;  1L2S A;  3CUE A;  5G4Y A;  1TVF A;  3MQQ A;  4CJN A;  2L4R A;  5HD3 A;  5L8M A;  3O88 A;  5GHX A;  4LV2 A;  3FG8 A;  2O9C A;  1GCE A;  3MKF A;  3BEC A;  4KZ6 A;  1SHV A;  4GNU A;  4OP8 A;  5TBM B;  4E3J A;  4KUO A;  3BW6 A;  5EEC A;  3UPP A;  3IHA A;  4KZ7 A;  4EER A;  4GS9 A;  4R0Q A;  1IKG A;  2XK1 A;  3IBR A;  3SH9 A;  3TW8 A;  4RX3 A;  1PI4 A;  4KZ9 A;  1DP9 A;  5A91 A;  3OCL A;  4WEJ A;  4HI4 A;  3F1P A;  2VK3 A;  3AGD A;  1TS0 A;  4Y7P A;  3BFD A;  1RGZ A;  4D60 A;  5TJJ A;  3CI6 A;  3B42 A;  3VSL A;  2JN7 A;  1YPR A;  3H82 B;  1K54 A;  3WWX A;  3BLS A;  4QY6 A;  1GA0 A;  4JXG A;  4BD1 A;  2JKR M;  5L09 A;  2Y91 A;  1QMF A;  1G6O A;  3Q1F A;  4KQQ A;  3U2A A;  4FH4 A;  2V8F A;  1T1A A;  1K55 A;  1PWD A;  5HDD A;  5A90 A;  2OWJ A;  1FOF A;  1JWZ A;  3BFF A;  3T4Q A;  4JBF A;  2EFX A;  5EV0 A;  3V5M A;  4K0W A;  4E6X A;  5HW3 A;  2X71 A;  1GSV A;  5GLB A;  3TJZ C;  5FI6 A;  5CTN A;  2WGV A;  5CEB A;  2HF6 A;  5HDC A;  1S0W A;  2NUT C;  5C5K A;  1N9B A;  5FAO A;  3G2Y A;  4UHU A;  3CIT A;  4B9O A;  2OSU A;  4DXB A;  2R9X A;  4S2P A;  5HAQ A;  2O99 A;  2GX5 A;  2Z6D A;  3U4L P;  4P6Z M;  5FQK A;  3QP2 A;  4PM7 A;  3EWK A;  3UE6 A;  5KZH A;  2P04 A;  5CHJ A;  4E3M A;  2A2L A;  4E04 A;  1YLW A;  1L3L A;  1JWV A;  4O8G A;  3C4O A;  3MXS A;  4NKP A;  3VOY A;  4XUZ A;  4H8R A;  4R23 A;  2PU4 A;  3LYX A;  4P85 A;  4C3Q A;  3UNW A;  5CTM A;  4WEL A;  1XFN A;  4DJ3 A;  2HDS A;  4BQM A;  2H28 A;  1YKD A;  2Y2M A;  3T1S A;  5J3W A;  2OOL A;  2O9B A;  3NHQ A;  1P9W A;  1OTB A;  3M2J A;  3R4K A;  2PYP A;  2WGW B;  4LCM A;  2QWS A;  5FAS A;  4Y3I A;  3NJA A;  3CPT B;  3QHY A;  1DJA A;  3A0S A;  4QB8 A;  3PR6 A;  1S6R A;  1D7E A;  2XH9 A;  2XDM A;  3D72 A;  4ARZ B;  3C4P A;  2B02 A;  1KVL A;  5F1F A;  3UE1 A;  4LLO B;  3H7W B;  3G34 A;  1KGE A;  1GSW A;  1YM1 A;  2H5S A;  4HQA A;  2UWX A;  5CGX A;  1IYP A;  1MWU A;  4XT2 B;  3HBR A;  2NUP C;  5HPI A;  2PRF A;  3LGO A;  5DTT A;  2QZ6 A;  5G4Z A;  3PBN A;  1KDW A;  1P0Z A;  4NET A;  4MN6 A;  4LRZ E;  1CEF A;  3BLM A;  1EW0 A;  3A3E A;  2E8I A;  1OTD A;  4OOY A;  2GJ3 A;  3LR4 A;  2M7U A;  3A0V A;  1SKO A;  3LY3 A;  2G2U A;  5TGF A;  2H0T A;  2D02 A;  4FCF A;  1FCN A;  4ZJ3 A;  4ZJ1 A;  2VEA A;  4EQI A;  5CED A;  1S67 L;  3L9K A;  3GQZ A;  5HL1 A;  4NXG A;  5HX9 A;  3VSK A;  3MFD A;  3QP5 A;  3EEA A;  2L0W A;  5HWW A;  4OPQ A;  4NK3 A;  2Y2Q A;  1ONG A;  4LEN A;  2KX6 A;  2ZQ8 A;  4Y0U A;  4HP9 A;  3MKE A;  1MKM A;  4JF4 A;  5EOO A;  3VP4 A;  3AGF A;  4IBX A;  3G6O A;  3F1N A;  5GL9 A;  4UEY A;  4NXE A;  1FR6 A;  1LL5 A;  2DNS A;  4L0L A;  4U0X A;  3GTC A;  1TS6 A;  2INW A;  4L9E A;  2VGL M;  5M19 A;  4WUJ A;  1K4E A;  3QP1 A;  1IEM A;  3UE0 A;  1U60 A;  3V3R A;  5A8B A;  2B95 A;  3VMA A;  3OBF A;  4D2O A;  2PU2 A;  2BTF P;  1G28 A;  4ZRR A;  3F1O A;  3KSG A;  2PHY A;  2ZD8 A;  5FI2 A;  4KG2 A;  2WAD A;  1ZKJ A;  4Y2F A;  2EX8 A;  5IU1 A;  4UQI M;  1VM1 A;  2HJ9 C;  4X69 A;  3LY4 A;  3ZFZ A;  2Y2J A;  3FC7 A;  3PYP A;  4KZ3 A;  5GLD A;  3GR2 A;  4DMZ A;  3FV7 A;  1BUL A;  2Q0O A;  3MMH A;  4HES A;  3PAG A;  4CLC C;  2JKT M;  5KSC A;  2ZJ9 A;  3G35 A;  4GLQ A;  1DP6 A;  3BFG A;  4HOI A;  3A3J A;  1Q2Q A;  2FZ0 A;  2J3T C;  4C6Y A;  1JNU A;  3M6H A;  1IFQ A;  2XFT A;  2BLS A;  4YOF A;  2X02 A;  2FFY A;  1DY6 A;  3PBR A;  2EXB A;  1PRQ A;  4OOM A;  2B5R A;  3K2N A;  1K38 A;  4BWI A;  3C7U A;  3UME A;  1K56 A;  4S2L A;  1S4S A;  2D01 A;  3LIE A;  1PW8 A;  2Q9N A;  3OCN A;  3EOI A;  3IX3 A;  2BAS A;  3GVB A;  3N4I A;  3JYI A;  2GDN A;  2J3W A;  1NZO A;  3HUN A;  2ZQD A;  4Y5F A;  2HP5 A;  4EWF A;  4MBF A;  2WKP A;  5AQB A;  5F83 A;  3BYD A;  3BJN A;  4FOF A;  4U0T A;  1KGF A;  5AQ9 A;  4CQH A;  5DFX A;  2ZC4 B;  3MZD A;  4R6L A;  5GHY A;  4DKI A;  4GOG A;  3UPO A;  2XRN A;  1CF0 A;  3FZC A;  4RX2 A;  1HLU P;  1XJ6 A;  2Y2O A;  1TS8 A;  1L0G A;  2WKH A;  3RXW A;  5EM0 A;  5HD5 A;  1ES2 A;  5FAT A;  3CG5 A;  3T1Q B;  4EBL A;  3CZD A;  2IWD A;  3ISG A;  2WK0 A;  1ES5 A;  1QME A;  1E25 A;  1GHM A;  1I2S A;  2XLN A;  3HJI A;  1N9L A;  4R38 A;  1K6S A;  4S2K A;  2HGV A;  2W27 A;  3Q7V A;  3MZF A;  2VV7 A;  1PZP A;  3PBS A;  4OPR A;  4WZ5 C;  1H8Y A;  4LCL A;  2Y79 A;  1K6R A;  4A5R A;  1S4R A;  4OQ0 A;  3UN7 A;  1O07 A;  1TD5 A;  4IJG A;  3HLD A;  3G4P A;  4MDZ A;  3IS2 B;  3BRM A;  2Y2G A;  3TG9 A;  5FI7 A;  3DTM A;  4EES A;  1V9Z A;  3N8L A;  1PNE A;  2R9W A;  3VE4 A;  5E43 A;  4Y17 A;  3R7W B;  5CXW A;  5JYO A;  4R3A A;  3LID A;  5CGS A;  3SZT A;  3DWK A;  2XEP A;  3D4F A;  4HY8 A;  3LI9 A;  3EQU A;  2PR6 A;  3VP1 A;  2V1A A;  1OME A;  3PBQ A;  1SZV A;  3Q7Z A;  1BT5 A;  1MWR A;  3LR5 A;  4KZA A;  3WS4 A;  2QYB A;  4WEK A;  2V1B A;  1XA1 A;  2ZQA A;  5L10 A;  3ZGA B;  4CLC D;  4JXS A;  4KQD A;  5FSR A;  3IXD A;  5HSQ A;  4GZB A;  4GW9 A;  2W3H A;  4RYE A;  2V1Z A;  3LUQ A;  3EEH A;  4IED A;  3SS5 A;  1VHM A;  2CC1 A;  4QD4 A;  3SH8 A;  4JGR A;  4GHI A;  3T4J A;  3PBO A;  1M6K A;  1PW1 A;  3S7O A;  1RP5 A;  4GJ4 A;  3G31 A;  5FL3 A;  3S22 A;  3SW1 A;  3V50 A;  1Q2P A;  4HJ3 A;  4RQ9 A;  1SKF A;  3IQA A;  4FTX A;  2WZZ A;  3DBA A;  1K0K A;  2IWC A;  4K91 A;  1T19 A;  4OLG A;  5AQA A;  1OTI A;  5TBM A;  4G3K A;  3CLO A;  3F1P B;  3HUO A;  3HCY A;  1T18 A;  3N8R A;  4GKU A;  1WA9 A;  1K57 C;  2P9V B;  5HAR A;  1MXO A;  1LHY A;  2Y2L A;  4R3B A;  3MZE A;  2FFF B;  5EVI C;  1K25 A;  4PM6 A;  3E4O A;  1PI5 A;  3OPH A;  1ERO A;  3KYE A;  4Y13 A;  5DKL A;  4HH3 A;  1H3Q A;  1ZG4 A;  1FIK A;  4GN2 A;  1W5D A;  4BL2 A;  3W4P A;  3H82 A;  4WN5 A;  1IYO A;  1ERM A;  1HD8 A;  4NXF A;  1EWZ A;  5M18 A;  3G2Z A;  2WUQ A;  5DVA A;  3T1X A;  1ODV A;  3NUL A;  4R70 A;  2PAV P;  3TOI A;  1BLH A;  4HJ4 A;  4Y15 A;  5FQM A;  4RA7 A;  5KMW A;  1OTA A;  3ZG8 B;  4S2I A;  5IT5 A;  2K2N A;  5HL6 A;  3EGX C;  3HLC A;  1ACF A;  2GNX A;  2IWB A;  2W3F A;  2RCX A;  2XFS A;  5CHU A;  4N1H A;  1N4O A;  4LGW A;  3VP3 A;  2EWW A;  1IYQ A;  1JWP A;  4WZ5 A;  3MS6 A;  4BD0 A;  5FA7 A;  4EQ1 A;  3P98 A;  4OP5 A;  1S1Y A;  3IXH A;  1VEU B;  3WS2 A;  1XFQ A;  4GDB A;  4HP4 A;  1OPX A;  1TDL A;  4R3J A;  2JCH A;  3FWL A;  4MMN A;  4FSF A;  3BQA A;  3FKW A;  1NYY A;  1BUE A;  2IA2 A;  4NXB A;  3V39 A;  2H10 A;  2KDK A;  5EVL A;  4UAA A;  3UB9 A;  3T12 B;  1XP4 A;  4F94 A;  3N8S A;  4FD8 A;  1EI5 A;  3IWO A;  2XF3 A;  2V0W A;  5I94 A;  5AQ7 A;  1ZTU A;  4DE3 A;  5E2H A;  3JVV A;  2EX2 A;  2Y2N A;  4ESP A;  2ZBB A;  5EUA A;  3T1R A;  1H8Z A;  3VP0 A;  4I3I A;  2OAP 1;  3JPU A;  4KUK A;  4R1G A;  5DF8 A;  1HZO A;  3TRC A;  4JGP A;  4S2N C;  1F5M A;  1YQS A;  3DAV A;  4EET B;  3T4L A;  3IX4 A;  4G3V A;  1ALQ A;  2ZL1 B;  3H9W A;  4OKP A;  2R78 A;  3SS3 A;  2OLU A;  4MBH A;  3CPT A;  2EWV A;  2QKP A;  4JLF A;  3ITB A;  3NEC A;  4YIN A;  3VP2 A;  2GZA A;  2V9A A;  1C3B A;  4X25 A;  1XJ3 A;  2Z2L B;  1CI8 A;  1TS7 A;  4L9G A;  1A0K A;  2OLV A;  4ARZ A;  3P7N A;  5EE8 A;  3FYZ A;  4WLA A;  4X1M A;  5DFY A;  4EU0 A;  3IF5 A;  5M1A A;  5F69 A;  3H7W A;  3M2K A;  2XA7 M;  2XSS A;  4EUV A;  1S66 L;  2PDR A;  2M7V A;  3ZG9 B;  2ZC7 A;  1K57 A;  4XT2 A;  5F82 A;  5EVI D;  4P6Z S;  1E4D A;  2ZM8 A;  1WYC A;  5EVI A;  4DRT A;  3C7V A;  5J7E A;  1I5Q A;  4KZ5 A;  4M4X A;  2A24 B;  2HZ5 A;  3SOI A;  3UDI A;  3RFB A;  5LBR A;  2HV1 A;  4DF6 A;  4I3A A;  5FQQ A;  2YKH A;  2CMN A;  3QP8 A;  2EFU A;  2Y8H A;  2O9A A;  3IF6 B;  3FPV A;  4KQR A;  3GV9 A;  3A3F A;  1HVB A;  4YWZ A;  2MJ6 A;  1L0F A;  2HP6 A;  1W63 Q;  2UV0 E;  4WBG A;  5GLA A;  3JVU A;  4KG6 A;  3BEB A;  5FAQ A;  4M3K A;  5J4E A;  3IH8 A;  3A3I A;  3IWI A;  2H0Y A;  2RL3 A;  3HLG A;  4H6J B;  3DWZ A;  3B33 A;  3RTY A;  2ZLY A;  4Z1W A;  2VJW A;  1YT4 A;  4WYY A;  3UB7 A;  4Y0T A;  2Y59 A;  5DTK A;  4Q0H A;  1YSP A;  4FH2 A;  2Y4A A;  1CEG A;  1W8Q A;  4IHQ A;  1WYB A;  1MBL A;  3IT9 A;  5J8X A;  2KOI A;  2W3G A;  4BBU A;  4HEF A;  2K31 A;  3C38 A;  4JGQ A;  3DW0 A;  4PM8 A;  3O5Y A;  4ZBE A;  2PT7 A;  2WGI A;  1BTL A;  3MXQ A;  1OJ5 A;  5HWT A;  2W1T B;  3L7H A;  3LO7 A;  2HJE A;  4WF0 A;  1XGI A;  2K7S A;  1SCW A;  3LEZ A;  5FQ9 A;  2J80 A;  4O7D A;  4F3L B;  3BQ8 A;  4S2N A;  4BBV A;  4YFM A;  3HJK A;  3BFE A;  2JKG A;  3A3D A;  3NOT C;  4N9L A;  1FCO A;  1G6A A;  4QHC A;  2WKE A;  4ZAM A;  4EEU A;  3ZG0 A;  1K56 D;  2XD5 A;  3DTI A;  5I5L A;  4KQO A;  1KE0 A;  4QY5 A;  2V8C A;  4JKT A;  3VFF A;  1CK3 A;  1T1B A;  2JKR I;  4DE2 A;  1YLY A;  4BEN A;  4DN0 A;  1E3U A;  2B18 A;  3KSI A;  1J3W A;  1KOU A;  1W63 M;  5FEF A;  1F98 A;  3G32 A;  1SDN A;  5CEC A;  2Y55 A;  1STZ A;  5EPH A;  1YLT A;  2ZOH A;  1VQQ A;  2VGL S;  4IUH A;  3HLE A;  4WM9 A;  2Q9M A;  5A93 A;  3E98 A;  3EQV A;  2EA9 A;  2ZMV A;  1LT0 A;  2PBY A;  4E3O A;  5AJG A;  1PFL A;  3ZHH A;  3S7Q A;  4WMC A;  4MNR A;  5DTS A;  5D3O A;  1PIO A;  3W4O A;  2C5W B;  1DJC A;  4X6T A;  1VET B;  2OWH A;  5F6A A;  2ZC6 B;  5CRF A;  2WAE A;  3IX8 A;  3IXG A;  3KO6 A;  3P09 A;  1MY8 A;  3BY9 A;  4UQI S;  5DJT A;  4BL3 A;  4QU3 A;  2M1C A;  2EX9 A;  5HZH A;  1MWS A;  3OPR A;  4O0P A;  2A3U A;  3VOZ A;  3WS1 A;  1ESI A;  5TFQ A;  3GDI A;  4C75 A;  1LSX A;  3MBZ A;  2PD7 A;  4L9F A;  3MJQ A;  4K08 A;  5FQI A;  2XD1 A;  1G68 A;  1KDS A;  4ZJ2 A;  1LI0 A;  3Q07 A;  4P87 A;  1ONH A;  3GEC A;  2QHK A;  2J9P A;  3AGE A;  4GCZ A;  1PWG A;  5EM1 A;  1JTG A;  4KZB A;  1FQG A;  4Q8I A;  3LFV A;  4GD6 A;  1PWC A;  3MR0 A;  4Z9Q A;  3OLO A;  3IXB A;  1J9M A;  2I9V A;  4IVK A;  3I7J A;  4X68 A;  3NCK A;  3K3D A;  3IS2 A;  1YSQ A;  2L1M A;  3T4T A;  1KVM A;  4KZ8 A;  1CI9 A;  1S1Z A;  3NBL A;  1YAX A;  2ZMA A;  2EXA A;  4I39 A;  5DKK A;  3UDF A;  1OJG A;  5KSH A;  3FPW A;  1I2W A;  3R7W A;  5AVF A;  4CLC B;  2P7J A;  2ZMF A;  3HLW A;  1BLS A;  2J3T D;  2Y2P A;  4OLD A;  3MQ0 A;  4N1X A;  3BFC A;  1BYW A;  3LEQ A;  3ZG5 A;  4P6B A;  2KLI A;  3PBT A;  4QJG A;  2W3E A;  1JVJ A;  1FSY A;  1AXB A;  2WKI A;  3C5A A;  2YKF A;  4EW7 A;  4OPY A;  4ID4 A;  1KE4 A;  4GS9 B;  3LI8 A;  1TDG A;  4E3N A;  1ESU A;  1D1J A;  4R4R A;  5HDS A;  2DRW A;  3B3X A;  2XRO A;  1NRJ A;  3ZDJ A;  3HVF A;  3N6I A;  3ZQ5 A;  2Z2M B;  4XUX A;  3HLB A;  3UO9 A;  2P74 A;  4UA7 A;  2PYR A;  3G30 A;  1Y4O A;  3CAX A;  2OV5 A;  3QNB A;  4PM5 A;  4MLL A;  4S2M A;  1GHP A;  2PR5 A;  2VX8 A;  4IBR A;  4MN5 A;  3O86 A;  3VOL A;  4X56 A;  2VLG A;  4MN7 A;  3TE8 A;  1H5X A;  5HWV A;  1VB6 A;  2LB9 A;  4IUK A;  3HUM A;  4BBT A;  3WRT A;  3CJM A;  3T4S A;  5K5B A;  3FKV A;  1M40 A;  5MC7 A;  4II7 A;  5HAI A;  1P9R A;  3VE3 A;  1N9O A;  3V67 A;  2ZQ9 A;  2WZX A;  2P9V A;  3PXP A;  3WS0 A;  4EXO A;  1DRM A;  4E3L A;  2W0N A;  1NLZ A;  1NXY A;  3BM6 A;  4YNR A;  5A92 A;  3IBJ A;  3ZYT A;  3EGD C;  4DE1 A;  3MF0 A;  3ITA A;  3NDG A;  3ZCZ A;  2Y2I A;  1NY0 A;  2HDU A;  1LSW A;  3V3S A;  2DMW A;  2I72 A;  3LIF A;  3UB6 A;  5HPF A;  2W1R A;  3Q82 A;  2G2W A;  1TEM A;  3HLF A;  3VFH A;  4HHD A;  2VV6 A;  4HH2 A;  1LI9 A;  1YLP A;  3UDX A;  1TF1 A;  3IF6 C;  1XJ4 A;  3QP4 A;  4OQI A;  4UA6 A;  1UWP X;  4EBP A;  3W2Z A;  1W79 A;  1ES4 A;  3KYZ A;  2O0Y A;  2DCF A;  4OQH A;  1XA7 A;  5E2G A;  1L0E A;  2JKT I;  4DXC A;  4G3W A;  4MCW A;  3NC8 A;  2G7U A;  2WKQ A;  5GLC A;  3T50 A;  4B4Z A;  4QPR A;  1VEU A;  5DF7 A;  5IS1 A;  1NRF A;  5FEG A;  1NWZ A;  4MEZ A;  3DTE A;  5KIZ A;  1ZG6 A;  3OPP A;  1N9N A;  1H0M A;  2HPB A;  3ZVT A;  3ULF A;  4JF6 A;  4PPR A;  1YLZ A;  5E2E A;  3LIA A;  2C6W B;  1BZA A;  3QP6 A;  4JXW A;  3KX0 X;  1K4F A;  4WZ4 A;  4Q0I A;  2VZW A;  2J8Y A;  1BLP A;  1UWN X;  1XJ2 A;  2OAQ 1;  4B93 A;  1IEL A;  1LLB A;  4I5S A;  3UMD A;  4E3K A;  4DE0 A;  1LL9 A;  3PTE A;  1OT9 A;  3NIA A;  2WGW A;  3W4Q A;  5AVE A;  2VKS A;  1AWI A;  4OPZ A;  3C2W A;  2EX6 A;  3DTK A;  2V2F F;  1V9Y A;  4I3J A;  4KZ4 A;  2WKR A;  4S2O A;  3KYQ A;  3T4K A;  2ZL1 A;  5G18 A;  1RCJ A;  2P08 A;  1F9I A;  2QJ7 A;  1NZU A;  2ZC5 B; 
#chains in the Genus database with same CATH homology
 4KEN B;  1XGI A;  3Q1F A;  4KQQ A;  4OQ0 A;  4PMA A;  1SCW A;  3LEZ A;  4FH4 A;  3UN7 A;  2ZM2 A;  1O07 A;  2JC7 A;  2ZC3 B;  5FQ9 A;  1K55 A;  1PWD A;  3GRJ A;  3HLD A;  3G4P A;  5A90 A;  2QPN A;  3BRM A;  2VGK A;  2Y2G A;  3IHB A;  4OOL A;  5EVI B;  3TG9 A;  4O7D A;  1FOF A;  4S2N A;  1JWZ A;  3BFF A;  5FI7 A;  3WS5 A;  4JBF A;  2EFX A;  3DTM A;  4YFM A;  5JYP A;  3V5M A;  3BFE A;  3IWQ A;  4K0W A;  4E6X A;  5HW3 A;  2X71 A;  3A3D A;  3LCE A;  2ZQ7 A;  4N9L A;  5GLB A;  3N8L A;  1FCO A;  5FI6 A;  1G6A A;  2R9W A;  4QHC A;  2WKE A;  5CTN A;  4ZAM A;  5E43 A;  3ZG0 A;  2WGV A;  5CXW A;  5CEB A;  5JYO A;  5CGS A;  5L2F A;  1K56 D;  1S0W A;  2XD5 A;  3DWK A;  4B4X A;  2XEP A;  2ZM0 A;  1N9B A;  1XXM A;  3D4F A;  1KE0 A;  3EQU A;  4KQO A;  5FAO A;  3G2Y A;  4QY5 A;  4UHU A;  4E6W A;  3VP1 A;  3PAE A;  4JKT A;  3VFF A;  1CK3 A;  2OSU A;  4DE2 A;  1YLY A;  4DXB A;  4BEN A;  2R9X A;  4S2P A;  1OME A;  3PBQ A;  3Q7Z A;  1BT5 A;  5FQJ A;  4ZTK A;  1MWR A;  1E3U A;  5HAQ A;  4KZA A;  3WS4 A;  2ZQA A;  4WEK A;  1XA1 A;  3RXX A;  4OON A;  3ZGA B;  4JXS A;  3G32 A;  1SDN A;  5FQK A;  5FSR A;  3IXD A;  4PM7 A;  5CEC A;  1SDE A;  3TSG A;  4GZB A;  2Y55 A;  4RYE A;  5EPH A;  2V1Z A;  1YLT A;  5U47 A;  1VQQ A;  1JTD A;  5KZH A;  3HLE A;  4IED A;  4BLM A;  4WM9 A;  2Q9M A;  5CHJ A;  3SS5 A;  4E3M A;  5A93 A;  1YLW A;  1JWV A;  3UY6 A;  1GA9 A;  3C4O A;  3EQV A;  2CC1 A;  4QD4 A;  2HDQ A;  3SH8 A;  3MXS A;  2XGN A;  1BLC A;  3IF6 A;  3VOY A;  4XUZ A;  2PBY A;  4E3O A;  5EOE A;  3PBO A;  4H8R A;  4R23 A;  2PU4 A;  4Y0O A;  1M6K A;  1PW1 A;  3ZHH A;  5GHZ A;  4P85 A;  4WMC A;  4C3Q A;  3UNW A;  5CTM A;  1RP5 A;  4WEL A;  4MNR A;  3G31 A;  2HDS A;  4BQM A;  4EBN A;  5DTS A;  5D3O A;  4HBU A;  3S22 A;  3V50 A;  2Y2M A;  1Q2P A;  1PIO A;  2Y2H A;  2C5W B;  1DJC A;  2HP9 A;  4X6T A;  3W4O A;  3MXR A;  4S2J A;  1SKF A;  1XPB A;  2ZC6 B;  3ZNT A;  5CRF A;  2WAE A;  3IQA A;  3S4X A;  2WZZ A;  4K91 A;  2IWC A;  3IXG A;  3P09 A;  1MY8 A;  4OLG A;  5AQA A;  1DJB A;  1NJ4 A;  4XXR A;  3M2J A;  1XGJ A;  1ZC2 A;  3HUO A;  4X53 A;  5TR7 A;  4BL3 A;  2WGW B;  3GSG A;  1Z6F A;  4LCM A;  4QU3 A;  4UA9 A;  3N8R A;  5FAS A;  3O3V A;  2EX9 A;  4GKU A;  1MWS A;  3OPR A;  1K57 C;  2A3U A;  3O87 A;  2P9V B;  2XQZ A;  3QHY A;  5HAR A;  1DJA A;  3VOZ A;  3WS1 A;  1MXO A;  1LHY A;  2Y2L A;  1ESI A;  4QB8 A;  4R3B A;  4R4S A;  5TFQ A;  1S6R A;  2XH9 A;  3MZE A;  4C75 A;  4U3T A;  2XDM A;  2FFF B;  5EVI C;  3MBZ A;  1K25 A;  1ERQ A;  3C4P A;  4PM6 A;  1KVL A;  5F1F A;  1PI5 A;  3NY4 A;  3UE1 A;  3OPH A;  5FQI A;  1ERO A;  2XD1 A;  1G68 A;  2WAF A;  3G34 A;  2V20 A;  4EV4 A;  1KDS A;  4ZJ2 A;  1KGE A;  1LI0 A;  1YMS A;  3Q07 A;  4P87 A;  1YM1 A;  2H5S A;  1ONH A;  1ZG4 A;  1O7E A;  1KGG A;  4GDN A;  2UWX A;  5CGX A;  1IYP A;  1MWU A;  4DDS A;  1WE4 A;  1L0D A;  1W5D A;  2J9P A;  3AGE A;  4GN2 A;  4BL2 A;  3OC2 A;  3W4P A;  3HBR A;  1PWG A;  1IYO A;  1JTG A;  1ERM A;  1HD8 A;  1FQG A;  4KZB A;  5DTT A;  1EWZ A;  4Q8I A;  2QZ6 A;  5M18 A;  5DF9 A;  4GD6 A;  3PBN A;  1KDW A;  1PWC A;  4NET A;  1PYY A;  3G2Z A;  4Z9Q A;  2WUQ A;  5DVA A;  1CEF A;  3NDE A;  3BLM A;  1J9M A;  3A3E A;  3IXB A;  5FDH A;  3TOI A;  2E8I A;  3UE3 A;  1BLH A;  4OOY A;  5FQM A;  4X55 A;  4IVK A;  3I7J A;  4RA7 A;  1W8Y A;  4X68 A;  5FAP A;  5KMW A;  3NCK A;  3LY3 A;  2G2U A;  5TGF A;  3ZG8 B;  4S2I A;  2H0T A;  1KVM A;  4KZ8 A;  1CI9 A;  4N92 A;  4FCF A;  1E3U D;  4RVA A;  1FCN A;  3NBL A;  4ZJ3 A;  2ZMA A;  3HLC A;  2IWB A;  5CHU A;  2RCX A;  2XFS A;  4ZJ1 A;  4N1H A;  1N4O A;  3S1Y A;  1W7F A;  2EXA A;  3VP3 A;  3UDF A;  4DDY A;  1IYQ A;  2A49 A;  4EQI A;  5CED A;  1JWP A;  4WZ5 A;  4ZDX A;  4BD0 A;  4BJP A;  5KSH A;  5FA7 A;  1I2W A;  2ZQC A;  4OVD A;  3GQZ A;  3HRE A;  2XR0 A;  5HL1 A;  1HTZ A;  3HLW A;  3P98 A;  4OP5 A;  5HX9 A;  1IKI A;  2X01 A;  3IXH A;  3QNC A;  3VSK A;  1BLS A;  2Y2P A;  4OLD A;  3MFD A;  4N1X A;  3WS2 A;  4E3I A;  2J7V A;  4OQG A;  3BFC A;  4GDB A;  4OPQ A;  1TDL A;  4NK3 A;  4R3J A;  1Y54 A;  3ZG5 A;  2JCH A;  4P6B A;  3FWL A;  2Y2Q A;  1ONG A;  4LEN A;  3PBT A;  3SS4 A;  4QJG A;  4CPK A;  2ZQ8 A;  4Y0U A;  4FSF A;  3SH7 A;  4WMC D;  1JVJ A;  1FSY A;  1AXB A;  2WKI A;  3FKW A;  3C5A A;  4IVI A;  2QMI A;  5E2F A;  1NYY A;  3MKE A;  4ID4 A;  1KE4 A;  4OPY A;  1TDG A;  4JF4 A;  5EOO A;  4E3N A;  1BUE A;  1ESU A;  3M6B A;  3VP4 A;  2VGJ A;  3AGF A;  4IBX A;  3V39 A;  2H10 A;  4R4R A;  5EVL A;  4UAA A;  1K54 C;  3ZVW A;  2DRW A;  5GL9 A;  3B3X A;  1FR6 A;  1XP4 A;  4F94 A;  1LL5 A;  3N8S A;  2DNS A;  3E2K A;  3HVF A;  3ZDJ A;  3N6I A;  2Z2M B;  4L0L A;  4FD8 A;  3HLB A;  4LV1 A;  4U0X A;  4XUX A;  4GD8 A;  1EI5 A;  2P74 A;  2XF3 A;  3GTC A;  1XKZ A;  3IWO A;  4UA7 A;  3UO9 A;  4PM9 A;  5I94 A;  3G30 A;  5AQ7 A;  2OV5 A;  1FSW A;  4HBT A;  2Y2K A;  3QNB A;  4DE3 A;  5E2H A;  5M19 A;  4PM5 A;  4MLL A;  4S2M A;  5HAP A;  1K4E A;  2EX2 A;  1GHP A;  3HL9 A;  4IBR A;  5CGW A;  2J9O A;  2Y2N A;  3O86 A;  4X56 A;  4KG5 A;  1IEM A;  3NI9 A;  3UE0 A;  1MKI A;  1U60 A;  5EUA A;  5BOH A;  1H8Z A;  3VP0 A;  3RJU A;  1K55 C;  3V3R A;  1H5X A;  5DF8 A;  4R1G A;  1HZO A;  4S2N C;  3HUM A;  3WRT A;  3CJM A;  3VMA A;  1YQS A;  3FKV A;  4GB7 A;  1M40 A;  3Q7V B;  1ALQ A;  2PU2 A;  4D2O A;  4OKP A;  3SS3 A;  5HAI A;  2OLU A;  4LV0 A;  5F1G A;  3Q81 A;  4MBH A;  4JPM A;  2ZD8 A;  2ZQ9 A;  2WZX A;  5FI2 A;  3ZNY A;  2P9V A;  3WS0 A;  1RGY A;  4JLF A;  4KG2 A;  3ITB A;  2WAD A;  4YIN A;  3CMZ A;  1ZKJ A;  3E2L A;  5CHM A;  3VP2 A;  2EX8 A;  4B88 A;  3W8K A;  1C3B A;  4E3L A;  3GMW A;  2Z2L B;  1CI8 A;  1VM1 A;  1NXY A;  2OLV A;  3LY4 A;  4X69 A;  3ZFZ A;  3BM6 A;  2Y2J A;  4KZ3 A;  5EE8 A;  2HDR A;  3FYZ A;  5GLD A;  5A92 A;  3IF5 A;  3GR2 A;  5M1A A;  1KE3 A;  3M2K A;  3FV7 A;  1BUL A;  1XX2 A;  1ES3 A;  4HES A;  3PAG A;  4DE1 A;  3ZG9 B;  2ZC7 A;  5KSC A;  1K57 A;  3ITA A;  2ZJ9 A;  1IYS A;  3G35 A;  3NDG A;  1FCM A;  5F82 A;  3ZCZ A;  2Y2I A;  1NY0 A;  5EVI D;  2HDU A;  3BFG A;  3A3J A;  3V3S A;  1E4D A;  2I72 A;  1GHI A;  1Q2Q A;  3ZG7 B;  2ZM8 A;  1WYC A;  3OPL A;  3Q82 A;  5EVI A;  2G2W A;  4C6Y A;  1BSG A;  1TEM A;  4DRT A;  3HLF A;  3C7V A;  4LV3 A;  3VFH A;  3M6H A;  1LI9 A;  1I5Q A;  2XFT A;  1YLP A;  2BLS A;  3UDX A;  2X02 A;  2FFY A;  3IF6 C;  4JXV A;  4KZ5 A;  2BG1 A;  1DY6 A;  3IH9 A;  3PBR A;  2EXB A;  4OH0 A;  2WYX A;  3UPN A;  4OOM A;  3SOI A;  4OQI A;  3UDI A;  4UA6 A;  1NYM A;  2B5R A;  1FR1 A;  4K0X A;  3WRZ A;  5IHV A;  1K38 A;  4DF6 A;  2JE5 A;  4EBP A;  3C7U A;  5FQQ A;  1W79 A;  1K56 A;  1MWT A;  4S2L A;  4MBK A;  4N9K A;  1ES4 A;  2JBF A;  5HFO A;  1PW8 A;  3N7W A;  5CER A;  2EFU A;  3OZH A;  1MPL A;  2Q9N A;  2DCF A;  4JF5 A;  3OCN A;  1PZO A;  4P0M A;  4OQH A;  1XA7 A;  5E2G A;  3GVB A;  3IF6 B;  1YMX A;  3N4I A;  1L0E A;  4KQR A;  3JYI A;  4DXC A;  3GV9 A;  1YLJ A;  2GDN A;  3NC8 A;  4EUZ A;  1L2S A;  3A3F A;  5GLC A;  4B4Z A;  1NZO A;  3HUN A;  1TVF A;  1HVB A;  2ZQD A;  1L0F A;  2HP6 A;  5DF7 A;  4CJN A;  2HP5 A;  3O88 A;  4EWF A;  4WBG A;  5GHX A;  1NRF A;  4LV2 A;  4MEZ A;  5GLA A;  1GCE A;  3MKF A;  4MBF A;  1ZG6 A;  3BEC A;  3OPP A;  4KG6 A;  4KZ6 A;  3BEB A;  5AQB A;  1SHV A;  4GNU A;  4OP8 A;  5F83 A;  2HPB A;  3ZVT A;  4JF6 A;  4PPR A;  4E3J A;  5FAQ A;  4M3K A;  1YLZ A;  5E2E A;  3IH8 A;  3A3I A;  3IWI A;  3BYD A;  2H0Y A;  2C6W B;  2RL3 A;  4U0T A;  1KGF A;  3IHA A;  5EEC A;  5AQ9 A;  3UPP A;  3HLG A;  4KZ7 A;  2ZC4 B;  1BZA A;  3MZD A;  4JXW A;  4R0Q A;  3DWZ A;  1IKG A;  2XK1 A;  5GHY A;  4DKI A;  4GOG A;  2ZLY A;  1K4F A;  4WZ4 A;  3SH9 A;  1YT4 A;  4RX3 A;  3UPO A;  4WYY A;  2J8Y A;  1BLP A;  4Y0T A;  1PI4 A;  2Y59 A;  4KZ9 A;  3FZC A;  5DTK A;  4RX2 A;  1IEL A;  1LLB A;  2Y2O A;  4E3K A;  4DE0 A;  1LL9 A;  5A91 A;  3PTE A;  4FH2 A;  1L0G A;  2Y4A A;  1CEG A;  2WKH A;  3RXW A;  3OCL A;  4WEJ A;  4A5R A;  1W8Q A;  3AGD A;  3NIA A;  1ES2 A;  2WGW A;  1WYB A;  1RGZ A;  3BFD A;  1MBL A;  3CG5 A;  4Y7P A;  5FAT A;  3CZD A;  2IWD A;  4EBL A;  3IT9 A;  3VSL A;  5J8X A;  3ISG A;  2WK0 A;  3W4Q A;  4HEF A;  1ES5 A;  1K54 A;  1QME A;  1E25 A;  1GHM A;  2EX6 A;  1I2S A;  3BLS A;  4OPZ A;  3WWX A;  2XLN A;  2V2F F;  3DW0 A;  4QY6 A;  1GA0 A;  1K6S A;  4PM8 A;  4S2K A;  4JXG A;  4KZ4 A;  4BD1 A;  4S2O A;  4ZBE A;  2WGI A;  3Q7V A;  1BTL A;  3MZF A;  5G18 A;  1PZP A;  3PBS A;  1RCJ A;  2Y91 A;  4LCL A;  4OPR A;  1H8Y A;  3LO7 A;  4WZ5 C;  1K6R A;  1NZU A;  1QMF A;  2ZC5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...