5GHXA

Crystal structure of beta-lactamase penp mutant-e166h
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
257
structure length
257
Chain Sequence
DFAKLEEQFDAKLGIFALDTGTNRTVAYRPDERFAFASTIKALTVGVLLQQKSIEDLNQRITYTRDDLVNYNPITEKHVDTGMTLKELADASLRYSDNAAQNLILKQIGGPESLKKELRKIGDEVTNPERFHPELNEVNPGETQDTSTARALVTSLRAFALEDKLPSEKRELLIDWMKRNTTGDALIRAGVPDGWEVADKTGAASYGTRNDIAIIWPPKGDPVVLAVLSSRDKKDAKYDDKLIAEATKVVMKALNMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase
publication title Crystallographic Snapshots of Class A beta-Lactamase Catalysis Reveal Structural Changes That Facilitate beta-Lactam Hydrolysis
pubmed doi rcsb
source organism Bacillus licheniformis
total genus 90
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2016-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5ghxA00
4IVKA 1BZAA 4YINA 1ONHA 4ZJ2A 2HDQA 2Y4AA 3O3VA 4OVDA 3ZNYA 4IBXA 2ZLYA 4DRTA 2HDSA 2DNSA 4JF6A 4X55A 3ZVTA 1YM1A 2XGNA 5FAOA 3C7UA 4OP8A 4OPQA 5E43A 5GLBA 3WRTA 2C5WB 5FDHA 1E4DA 1PI4A 1TVFA 4E3OA 5JYOA 3OPHA 1ONGA 4OOYA 5CEDA 3PBRA 3V5MA 2Y2KA 4X68A 1FCNA 4UA7A 3VP1A 4S2NC 4LV3A 4LCLA 2IWDA 1VQQA 1DJCA 1ES4A 5GHYA 1LLBA 3MXSA 4QJGA 1FSWA 5EECA 3DTMA 4MLLA 3M2KA 1BUEA 4BJPA 2C6WB 1WE4A 1MWUA 4E3MA 3N6IA 4HEFA 3TG9A 3ZG9B 2PBYA 2QZ6A 4DXCA 4BD0A 1PZOA 3BFCA 5CHJA 1BULA 3OPLA 3QNCA 4GDBA 2EX8A 3G2YA 1EWZA 4EUZA 3NY4A 3S1YA 3ZG8B 5FQ9A 4GNUA 1YLZA 1RGZA 5E2GA 4KENB 2V20A 2WAEA 1BLSA 1LI9A 2PU2A 3SS5A 1YMXA 5HW3A 4X69A 3ZDJA 1SCWA 4K0XA 2FFYA 5EVLA 2XDMA 1XGIA 3M2JA 1FCMA 1NZOA 1HVBA 1PW8A 2Y2IA 2Y55A 1O07A 4MBFA 3A3FA 4OH0A 5FQMA 3JYIA 3UO9A 4WEJA 3A3DA 3D4FA 3A3IA 1E3UA 5I94A 2ZM8A 3HBRA 5CTMA 2QPNA 2I72A 5E2FA 1YLPA 3UDIA 1TDGA 4OPYA 1N4OA 2HDRA 2WKHA 4K91A 3RXXA 1JWPA 3VOZA 4EWFA 3NI9A 4MNRA 1YLWA 3A3JA 4LCMA 4S2NA 1L0GA 5CEBA 3VMAA 2WUQA 4HESA 2XFSA 4E3KA 4S2KA 3VP2A 1H5XA 3VSLA 3UPPA 4KZ8A 2J7VA 5M19A 3MBZA 5A90A 2FFFB 1KDWA 3MZDA 1QMFA 3HLCA 4JXWA 5CGSA 1IEMA 2WKEA 1GHMA 1K4EA 3GR2A 2ZC6B 4OLDA 2B5RA 3Q7VA 2Y2MA 3UN7A 5KMWA 1I2SA 1W79A 5M1AA 5EPHA 4DDYA 5CERA 5TR7A 3OPPA 2ZC3B 4JXGA 5DF7A 4FH2A 1YMSA 2ZM0A 3LY4A 2XH9A 4EQIA 5HX9A 4R3BA 2XK1A 4RA7A 4S2LA 4R3JA 3I7JA 4XUZA 3VFHA 2OLVA 3CMZA 1XP4A 3FYZA 1HD8A 3PAEA 5E2HA 5EOOA 3IWQA 4R23A 4R4RA 4GKUA 4JBFA 1PZPA 3C4PA 4Q8IA 3UPOA 1KDSA 1PWDA 4LV2A 3MKFA 1G6AA 4DF6A 4PM5A 1ALQA 1S0WA 5A92A 4OQHA 1JWZA 3IHAA 3N8SA 1K55C 4L0LA 3BM6A 4P87A 4E6WA 5D3OA 4S2IA 3ZNTA 2ZQDA 1IKGA 3PBQA 3PBTA 3SH9A 4OQGA 1I5QA 4Y0UA 4H8RA 4DXBA 4KZ9A 4BD1A 3FKWA 3GVBA 4DE3A 5E2EA 2H10A 3FKVA 5FI7A 3HUNA 1H8ZA 1MWSA 3WWXA 3ZG7B 1SKFA 1HTZA 1IKIA 1KGEA 1K56D 1K6RA 1S6RA 3AGEA 5F1GA 4DDSA 4RX2A 5FQKA 3B3XA 2P9VB 3NBLA 3N7WA 5GLDA 3V3RA 2PU4A 3IF5A 4KZ7A 2VGJA 3IT9A 3G2ZA 3HVFA 1PWCA 2UWXA 3LEZA 1JTDA 4X56A 5EVIB 5GHZA 4BL3A 4EV4A 5FI6A 4OQIA 1K4FA 2WZXA 1W5DA 4JKTA 3AGFA 3HLBA 3Q07A 1YLYA 4FCFA 4KG6A 1I2WA 4R4SA 5GHXA 3UE0A 2XD1A 3A3EA 5FQQA 1K57C 4E6XA 4OLGA 3IH8A 4HBTA 3VOYA 3Q81A 3W4QA 3VP0A 3NDGA 2GDNA 3GQZA 1XPBA 2WGIA 1K55A 3GMWA 3IF6C 3IWOA 3SS4A 3BEBA 4WM9A 2XD5A 2EX6A 2IWCA 3WS4A 4ZTKA 2Y2LA 3E2LA 3QNBA 3UDFA 3BFGA 4P6BA 1NYMA 1DY6A 2OV5A 4MBHA 4U0TA 2X02A 1LL9A 4C6YA 3ZFZA 3OCNA 4EBLA 3EQVA 1BT5A 5FSRA 4N9KA 1MY8A 3GTCA 2VGKA 3P98A 1ES2A 3TSGA 2Y2HA 4FH4A 5DF8A 1XA1A 5CGWA 4QU3A 1BSGA 1PYYA 2Y59A 3OPRA 3HL9A 3GSGA 4KG2A 1KGFA 1ES5A 1SDEA 4E3LA 4N1HA 4KZBA 5FQJA 3VSKA 4CJNA 1ZKJA 3FV7A 5CXWA 1FR6A 1XGJA 4M3KA 1SDNA 1WYBA 2WZZA 1BLCA 4PM8A 5HL1A 1G68A 2Y2QA 1K56A 3LY3A 3M6HA 4DE2A 2ZC5B 1K57A 1FSYA 2ZQ8A 3G35A 4GZBA 4KZAA 4WELA 4A5RA 4OQ0A 4Y0OA 1XX2A 3ZCZA 1MWRA 4MBKA 5GLCA 2ZJ9A 1H8YA 5TGFA 4JXVA 1ZG6A 1K6SA 4PPRA 4LV0A 1M40A 2Y2JA 3O87A 4JLFA 3IF6A 4OP5A 4S2OA 3ZGAB 1JTGA 5KZHA 2Y2PA 4MEZA 4JXSA 2V1ZA 1PIOA 4S2JA 4LV1A 1DJBA 4RVAA 4WMCD 4WYYA 4XXRA 1ESIA 2Y91A 3PBNA 5F83A 4CPKA 1W8QA 1NY0A 4BENA 2H5SA 1SHVA 3O88A 4KZ6A 1RCJA 3BFEA 5A93A 3CZDA 1C3BA 1CEFA 1ZC2A 1KVMA 1JWVA 2ZQAA 4JF5A 4RYEA 2HPBA 5HFOA 1JVJA 3NC8A 5DF9A 4P0MA 1OMEA 4GD8A 4ID4A 1QMEA 4KZ4A 5BOHA 3G30A 2JC7A 1E25A 4Y7PA 3Q7VB 5DVAA 3FWLA 4LENA 4ZBEA 3RJUA 3HUOA 2XF3A 4IVIA 3EQUA 4Z9QA 3IQAA 2XFTA 3C5AA 2Y2GA 4K0WA 4JF4A 4GB7A 5FASA 1BLPA 2ZD8A 3MZFA 4OKPA 2A49A 2WK0A 3IWIA 3VP4A 2Z2MB 2H0TA 2J9PA 4PMAA 2X71A 2RL3A 3UE3A 3FZCA 2DCFA 3ISGA 3Q1FA 4PM9A 5JYPA 5DTKA 3G34A 1CK3A 1MWTA 4N9LA 4RX3A 1K54C 3DW0A 5HAPA 1KE4A 3HLGA 5F1FA 3BYDA 3OC2A 1K25A 2EFXA 5DTTA 1GHIA 3Q82A 3C4OA 4KQRA 1N9BA 4NETA 4E3JA 4PM7A 4WZ5C 5F82A 3RXWA 5CTNA 1CI9A 2H0YA 2OLUA 1PI5A 2ZMAA 3HLDA 2WGWB 1LL5A 1ERQA 3BLSA 4HBUA 1L0EA 3N8LA 5EUAA 4GOGA 3BLMA 5EOEA 3W4OA 3UY6A 3CG5A 5G18A 1NZUA 3WS1A 1XXMA 3V50A 3WS2A 2EXAA 5A91A 3LCEA 1FCOA 3E2KA 3N8RA 1CEGA 3PBOA 2Y2OA 4KQOA 4BL2A 1GHPA 2ZQ9A 4R0QA 3NDEA 3MXRA 3SH7A 4WMCA 3VP3A 5AQAA 5CRFA 5L2FA 3ZG5A 3W4PA 1YT4A 1EI5A 1FQGA 1MKIA 1XA7A 4DE1A 4BQMA 2OSUA 3MFDA 2A3UA 2WGVA 3DWKA 4IEDA 3S4XA 4E3IA 2HP9A 2ZQCA 4S2PA 2X01A 2BG1A 5KSHA 1MXOA 1IYSA 4P85A 2RCXA 3G4PA 1FOFA 3WRZA 2JCHA 2QMIA 3ITBA 4D2OA 2J8YA 2P74A 3UDXA 4OPRA 1K54A 1LI0A 4WEKA 4ZAMA 4WBGA 2Q9MA 3W8KA 5DTSA 2ZC7A 4DKIA 1U60A 5FA7A 3OZHA 4ZJ1A 3SOIA 5TFQA 2G2WA 3P09A 1VM1A 4WZ5A 4FSFA 2WYXA 1L2SA 4F94A 3WS0A 1KE0A 1NRFA 3S22A 5FAPA 2JBFA 1BTLA 1O7EA 2DRWA 4NK3A 1IYQA 1YQSA 2Q9NA 4X53A 1BLHA 3NIAA 1DJAA 3PTEA 2G2UA 5CGXA 3MKEA 5FATA 3GV9A 1W8YA 4GN2A 5HAIA 2XLNA 4ZJ3A 3OCLA 1TDLA 3BRMA 2JE5A 1NYYA 1GA0A 4KZ3A 1AXBA 1KVLA 1WYCA 1IYOA 1LHYA 2ZM2A 3HLFA 5EVID 4C3QA 1K38A 2Y2NA 1RGYA 1GCEA 3BFFA 3PBSA 3IXHA 2EFUA 5EE8A 1Y54A 4E3NA 2HP6A 2EXBA 4GD6A 1MPLA 5KSCA 3ZG0A 1MBLA 1ERMA 3M6BA 5IHVA 2BLSA 5AQ7A 4Y0TA 5HARA 2ZC4B 3ITAA 4QY6A 1KE3A 3UPNA 4KQQA 4C75A 3AGDA 3ZHHA 2J9OA 2WKIA 1PW1A 3IH9A 2XEPA 3IF6B 5CHMA 5EVIC 3C7VA 3NCKA 3BFDA 3PAGA 4YFMA 3V3SA 3WS5A 1GA9A 4U0XA 2IWBA 4BLMA 3LO7A 4EBNA 3QHYA 3IHBA 4N92A 1IELA 2Z2LB 2HDUA 3V39A 3N4IA 5FQIA 4EBPA 4B88A 1J9MA 5GL9A 3CJMA 4X6TA 5AQ9A 4U3TA 4B4ZA 2R9XA 1KGGA 2EX9A 5HAQA 4B4XA 4WZ4A 1M6KA 2V2FF 4O7DA 4PM6A 4OPZA 4XUXA 4OONA 1XKZA 4DE0A 4UAAA 4OOLA 3IXGA 4QB8A 4FD8A 4QD4A 3HLEA 1CI8A 2XQZA 3G32A 4ZDXA 3HLWA 2XR0A 2EX2A 3HUMA 4UA6A 1EROA 1PWGA 1NJ4A 4KZ5A 1L0DA 1HZOA 2R9WA 4QY5A 3SS3A 1L0FA 1FR1A 1Q2PA 3UNWA 4IBRA 3VFFA 1ZG4A 2E8IA 2WADA 1Q2QA 2P9VA 2CC1A 3IXDA 4S2MA 3G31A 2ZQ7A 3O86A 1Z6FA 4UHUA 5FI2A 5GLAA 4UA9A 1IYPA 4N1XA 4GDNA 5AQBA 3MZEA 1YLJA 2WGWA 5FAQA 4KG5A 1TEMA 3BECA 5U47A 5EVIA 3Q7ZA 5CECA 3SH8A 3ZVWA 4JPMA 3HREA 1E3UD 4OOMA 2WAFA 3TOIA 1YLTA 3UE1A 5J8XA 4R1GA 4QHCA 1ES3A 1ESUA 3GRJA 3DWZA 3IXBA 1RP5A 1W7FA 2HP5A 5M18A 1NXYA 5CHUA
chains in the Genus database with same CATH superfamily
1OTAA 3NOUC 2HDSA 2LB9A 2VV6A 2GNXA 2W1TA 5FDHA 4E3OA 3OPHA 4X68A 4UA7A 3QP4A 4LV3A 4LCLA 2IWDA 1VQQA 3MMHA 1ES4A 1OJ5A 3DTMA 4MLLA 4BJPA 1MWUA 4E3MA 3TG9A 2O9AA 1DP9A 4LRXC 3ZG8B 1VHMA 4GNUA 1YLZA 1RGZA 3O5YA 4BBTA 4KENB 1YMXA 3ZDJA 4WUJA 4K0XA 1NZOA 4MBFA 4K08A 4GJ4A 1E3UA 5CTMA 5E2FA 1YLPA 4I5SA 2WKRA 4LPZA 3JVVA 3RXXA 1JWPA 2B95A 2HZ5A 1IOUA 2XFSA 3BW6A 3VP2A 4KZ8A 5M19A 3MBZA 5A90A 5HWWA 3HLCA 4JXWA 3LI8A 5J7EA 2WKEA 1GHMA 4EESA 1VEUA 2ZC6B 4OLDA 5AVEA 5L10A 5KMWA 1W79A 4DDYA 5HL6A 1YPRA 3IX3A 4EQIA 5HX9A 2XK1A 3OOVA 4R3JA 2OLVA 3FYZA 3PAEA 5EOOA 3ZQ5A 4E04A 4R4RA 4Q8IA 4GS9B 3UB9A 4DF6A 2EWWA 4OQHA 1JWZA 3IHAA 1K55C 4P87A 3BM6A 3EWKA 3NOTC 4F3LA 4EQ1A 4OQGA 2OAQ1 4Y0UA 4KZ9A 2NUPC 5E2EA 4BBVA 3FKVA 1MWSA 3WWXA 2JHEA 1HTZA 1S6RA 3T1RA 3H82B 2L0WA 2PR6A 5FQKA 3NBLA 5DJUA 5HD5A 3IF5A 1CF0A 2VGJA 3DBAA 3MXQA 3NOPC 3HVFA 3LEZA 4BL3A 3MSHA 5GHXA 3DAVA 3FG8A 3R4KA 4HBTA 1VETA 3VE4A 3Q81A 4DMZA 3NJAA 3PYPA 4WN5A 2WGIA 3BEBA 3A0RA 3UMEA 4NXEA 2PYRA 1YSQA 3E2LA 3BFGA 3PHYA 2OV5A 2L1MA 4CQHA 4CLCD 3OCNA 1BT5A 3P98A 2Y2HA 2VGLM 2Q0OA 3OPRA 2Y59A 4KG2A 1DP6A 4E3LA 1SDEA 3VSKA 5CXWA 4M3KA 4PM8A 5HL1A 2Y2QA 3LY3A 2ZQ8A 4GZBA 4WELA 3JVUA 2HJ9C 4LLOB 4P6ZS 5TGFA 1ZG6A 4PPRA 5HWVA 3ZGAB 3T4JA 4HJ4A 4DN0A 4EXOA 1H3QA 4JXSA 4WF0A 1PIOA 4LV1A 4RVAA 4XXRA 3PBNA 5F83A 1OTDA 4CLCE 3CZDA 1ZC2A 1KVMA 4RYEA 2W3EA 1OMEA 4ID4A 2QYBA 1QMEA 5BOHA 1F2KA 1TS0A 2JC7A 3Q7VB 2GZAA 3LIFA 5J4EA 3IQAA 2VZWA 2XFTA 2JKRI 4UEYA 1S1ZA 3MZFA 3IWIA 5HDDA 4NG2A 3UE3A 5F5YA 3HJIA 5DTKA 1CK3A 5F1FA 4JGOA 3BYDA 3OC2A 1K25A 2EFXA 5DTTA 4G3VA 4NETA 1UWPX 3RXWA 2H0YA 2OLUA 3HLDA 2WGWB 3LR5A 1L0EA 2XA7M 3EEAA 5EUAA 4Y15A 3CG5A 4BMWA 1NZUA 3WS1A 1XXMA 2PBDP 3WS2A 3LCEA 3QP1A 3PBOA 2Y2OA 3VV4A 3NDEA 3P7NA 3MXRA 3S7QA 3SH7A 4WMCA 4PKYA 5L2FA 2NUTC 2K2NA 4DE1A 2OSUA 5KSHA 2HP9A 1MXOA 4P85A 5L07A 2RCXA 4MMNA 3G4PA 3LR3A 2V0UA 1K54A 1LI0A 4WBGA 5DTSA 3LICA 5FA7A 4EU0A 5TFQA 5HD3A 4WZ5A 4FSFA 3WS0A 5F68A 1NRFA 4ARZA 1UWNX 2JBFA 5G4ZA 3QP2A 3A0VA 2JE5A 1NYYA 1GA0A 2H28A 1AXBA 1STZA 2ZM2A 3HLFA 1GCEA 3PBSA 2EFUA 5EE8A 1Y54A 2KX6A 4HP9A 3MQ0A 4GD6A 4KQQA 3AGDA 1PW1A 2UV0E 3IH9A 3IF6B 2JKRM 3IS2B 5EVIC 3V3SA 5HPFA 3IHBA 4N92A 3MQQA 1OJGA 2O9CA 2A24B 2HDUA 2VK3A 4B88A 3CWFA 1J9MA 4X6TA 3GDIA 4B4ZA 1KGGA 4WZ4A 3K3CA 4IUHA 4XUXA 5J3WA 3EEHA 3HLWA 2XR0A 4HJ6A 3HUMA 4CLCB 3F1OB 1PWGA 2G7UA 2R9WA 1Q2PA 4HOIA 4IBRA 1ZG4A 4S2MA 1TF1A 4N1XA 5FAQA 2EA9A 3HREA 1E3UD 4II7A 4OOMA 4QHCA 4FOFA 4O0PA 3IXBA 1NXYA 3ULFA 1BZAA 3KSFA 4ZJ2A 3L9KA 2FH5A 4O8GA 2ZLYA 4DRTA 2VV7A 4R38A 1E4DA 1ONGA 5CEDA 2Y2KA 3VP1A 1X0OA 5FDSA 4O01A 4QJGA 2QHKA 1PFLA 1D7EA 1Z09A 5LBRA 2MJ6A 1PZOA 5CHJA 4BWIA 5IS1A 1BULA 3OPLA 3G2YA 3NY4A 3S1YA 5TJJA 5E2GA 2EWVA 2PU2A 4XT2B 4X69A 3KO6A 3VE3A 1HVBA 2Y2IA 1O07A 3UDIA 3HBRA 2I72A 4K91A 3VOZA 1OT9A 3NI9A 4MNRA 2VLGA 2XROA 5CEBA 4L9EA 3VMAA 4LRZE 1H5XA 3UPPA 1J3WA 1KDWA 1QMFA 4HJ3A 1IEMA 2V1AA 3GR2A 3UN7A 3IBRA 3SW1A 1I2SA 5M1AA 3NULA 5CERA 1PNEA 5DF7A 4R3BA 4XUZA 3I7JA 3RH8B 3CMZA 5E2HA 1D1JA 4R23A 1GSWA 4JBFA 2YKHA 3QP8A 3UPOA 1KDSA 3MKFA 1G6AA 2W3GA 4PM5A 3E4OA 4L0LA 3ZNTA 5DFYA 3PBTA 1TS8A 3SH9A 1T18A 1I5QA 3E0YA 4H8RA 4DXBA 3FKWA 3GVBA 2H10A 5CX7A 1H8ZA 1SKFA 1XJ2A 1T1AA 4HH3A 3IT9A 1P97A 4Y2FA 1JTDA 4OQIA 4MN6A 3HLBA 1YLYA 4KG6A 1I2WA 3UE0A 3A3EA 3U2AA 4E6XA 2GX5A 3KYZA 3IH8A 3VP0A 2GDNA 3GQZA 1K55A 3SS4A 2ACGA 2XD5A 2EX6A 2IWCA 3WS4A 3UDFA 4P6BA 1NYMA 1DY6A 5HDCA 2X02A 1LL9A 5EV0A 4IHQA 2VA0A 3T4OA 3EQVA 1MY8A 1ES2A 3TSGA 4FH4A 3EOIA 1TD5A 4N1HA 4CJNA 1ZKJA 3FV7A 1SDNA 1WYBA 3NECA 2WZZA 3HCYA 3RTYA 4Y5FA 1K56A 3M6HA 2W3FA 5HPIA 3G35A 4OQ0A 3UB8A 1YSPA 3ZCZA 4MBKA 3UB6A 3T1QB 4GHIA 4GLQA 4S2OA 1M40A 3O87A 4JLFA 3BQAA 2JKFA 1JTGA 3S7OA 2Y2PA 2V1ZA 4M4XA 3HJKA 2PT7A 2A2LA 1DJBA 4WMCD 2E8JA 3ICYA 3F1PA 5TBMB 2H5SA 3DTKA 5A93A 1C3BA 1CEFA 2ZQAA 2HPBA 4GD8A 3LYXA 1V9YA 1VEUB 1E25A 4ZBEA 3LGOA 3RJUA 2XF3A 4Z9QA 5C5KA 3LR4A 4GS9A 3C5AA 1EW0A 4JF4A 2VKSA 1BLPA 3RFBA 2WK0A 3VP4A 2J9PA 2RL3A 3IBJA 2DCFA 5JYPA 3G34A 4IJGA 1KE4A 1L3LA 3LIBA 1GHIA 3P01A 4L9GA 5F82A 4YWZA 3K3DA 1CI9A 2ZMAA 1LL5A 1BYWA 1ERQA 3KSHA 4LRYC 5EOEA 1XJ6A 3UY6A 4ZRRA 2EXAA 5DKLA 1CEGA 1NLZA 4IUKA 2QJ5A 3SZTA 3OLOA 5AQAA 5CRFA 3ZG5A 1ACFA 1LSXA 1YT4A 3MFDA 2WGVA 3S4XA 4MDZA 4E3IA 2ZQCA 2J3TC 2OAP1 4Y3IA 1FIKA 1VETB 3ZYTA 4PKYG 1P9RA 3S7NA 4ZAMA 3D3OA 4DKIA 3W8KA 1U60A 2G2WA 3P09A 1VM1A 2WYXA 1HLUP 5FL3A 1F9IA 1O7EA 2K7SA 4X53A 1BLHA 3PTEA 5FATA 1V9ZA 4GN2A 4KQDA 3F1NA 4ZJ3A 1K0KA 4UQIM 2FZ0A 3BRMA 4EEPA 1WYCA 1IYOA 2W3HA 3BFFA 3IXHA 1MPLA 5KSCA 3ZG0A 4Y0TA 2BLSA 5AQ7A 5HARA 2ZC4B 3E4QA 4YNRA 3PAGA 3BFDA 4YFMA 1KOUA 2BTFP 2VGLS 4NKPA 4EBPA 5GL9A 3CJMA 4EEUA 3DTEA 2ZMFA 4B4XA 2WKPA 2V2FF 1XKZA 4HP4A 3IXGA 4QB8A 3R7WB 3HLEA 3G32A 1W63M 4HHDA 1NJ4A 4QY5A 5FEFA 3VFFA 2E8IA 2P9VA 2ZQ7A 1IYPA 1F5MA 1F98A 3MZEA 2WGWA 3BECA 5EVIA 5CECA 3UE1A 2OWHA 1ES3A 3D72A 2HP5A 1G28A 4IVKA 2W3DA 5IT5A 1ONHA 2HDQA 2Y4AA 2BASA 3O3VA 4IBXA 2DNSA 1YM1A 1G6OA 2XGNA 5FAOA 4B9OA 4OP8A 4OPQA 5GLBA 3WRTA 5JYOA 1PI4A 1TVFA 4Y17A 4OOYA 3PBRA 3V5MA 4S2NC 4ESPA 5GHYA 1LLBA 3MXSA 4G3WA 1FSWA 4X25A 5EECA 1WE4A 3N6IA 3LI9A 3ZG9B 2PBYA 5DFXA 1P0ZA 3LEQA 4EERA 4GDBA 2EX8A 3BY8A 4EUZA 5FQ9A 3V67A 2V20A 1D06A 2WAEA 1BLSA 4ARZB 3SS5A 5EFWA 1SCWA 2FFYA 5EVLA 2XDMA 1XGIA 1S4RA 4OH0A 3A3FA 3UO9A 5F69A 3KYQA 2ZM8A 2QPNA 4MN7A 4H6JA 4OPYA 1N4OA 2HDRA 2P04A 2PYPA 3A3JA 2INWA 4S2KA 3T4SA 3LIEA 2B5RA 2Y2MA 2A24A 3LIDA 5EPHA 5TR7A 1YMSA 2ZM0A 3LY4A 4Z1WA 3L7HA 3VFHA 1XP4A 1DP8A 4WLAA 3C4PA 4QPRA 1UGUA 3TE8A 5A92A 1AWIA 4E6WA 2ZQDA 3PBQA 4HI4A 4EETB 2QWSA 3E98A 4BD1A 1SKOA 4DE3A 4I38A 4I3JA 1VB6A 1LL8A 3UB5P 4I39A 1KGEA 1IKIA 1K56D 3V3RA 1LSWA 3CAXA 2KLIA 2J3WA 4X1MA 1K4FA 1W5DA 3AGFA 3Q07A 4FCFA 1K57C 4OLGA 3H7WB 3W2ZA 3VOYA 3W4QA 2R78A 4MCWA 1XPBA 3GMWA 3IF6C 3IWOA 3T4KA 1H8MA 3C8CA 2VV8A 2Y2LA 4MBHA 4DJ3A 1ZHHB 3UMDA 2B18A 3LIAA 2Z6DA 1ODVA 4EBLA 5FSRA 4JGPA 1S4SA 2VGKA 2W0NA 1XA1A 3BWLA 1PYYA 3T12B 3KX0X 1ES5A 5FQJA 1FR6A 1XGJA 5A8BA 4CLCC 2W1RA 1BLCA 4JGRA 4PHTA 2OWJA 2ZC5B 4DE2A 4KZAA 1FSYA 2V8CA 1T1CA 4L9FA 4A5RA 1G5UA 4B93A 4BBUA 1NLYA 5GLCA 2ZJ9A 5L8MA 4Q0HA 2Y2JA 2LB5A 2D01A 5KZHA 2PAVP 3CPTA 4MEZA 1N9NA 1ESIA 1W8QA 4BENA 1OTEA 3U4LP 5DKKA 2GJ3A 3BFEA 1JVJA 2IA2A 3NC8A 4Y7PA 3KSIA 3FWLA 3GECA 4LENA 3HUOA 4R6LA 3EQUA 1H0MA 1CQAA 5DJTA 4NXGA 4K0WA 3T50A 4GB7A 5FASA 2A49A 1T19A 2Z2MB 2H0TA 2X71A 3FZCA 3ISGA 4PM9A 1MWTA 4RX3A 1Y28A 3CITA 3DW0A 3UB7A 3HLGA 3B47A 3Q82A 4E3JA 3IX4A 1NWZA 5HDSA 4GOGA 3W4OA 5F6AA 2ZL1B 3V50A 5A91A 1FCOA 1LT0A 3E2KA 4KQOA 4BL2A 4LGWA 1WA9A 2ZQ9A 3VP3A 1Y4OA 3W4PA 1MKIA 1XA7A 4BQMA 2JKTI 1ZTUA 2W1TB 4IEDA 4S2PA 2BG1A 1IYSA 1IFQA 4PAUA 1FOFA 3WRZA 4HNBA 2QMIA 2ZBBA 4D2OA 5FEGA 2J8YA 2P74A 4QWOA 4OPRA 4WEKA 2Q9MA 1XFQA 2ZC7A 3OZHA 3SOIA 2M7UA 4GCZA 1L2SA 2M1CA 2ZMVA 2CMNA 1KE0A 3S22A 3FC7A 2DRWA 4GW9A 1IYQA 2PHYA 3NIAA 1LSVA 1DJAA 2G2UA 5CGXA 3MKEA 3GV9A 1W8YA 1OPXA 5HAIA 3LUQA 2XLNA 3OCLA 1DRMA 1TDLA 4ETXA 1KVLA 5AJGA 4NXBA 5EVID 4C3QA 1K38A 1RGYA 4KUKA 4E3NA 2HP6A 1MBLA 1ERMA 3M6BA 5IHVA 2KOIA 5EVEA 3UPNA 4FTXA 4C75A 2J9OA 2WKIA 4GHIB 2I9VA 5TBMA 2M7VA 3C7VA 1GA9A 3QHYA 1MZUA 3LR0A 2O9BA 1IELA 2Z2LB 3F1PB 3N4IA 3T4LA 2R9XA 2EX9A 2D02A 4O7DA 3TJZC 4PM6A 4OPZA 3S7PA 4OONA 4UAAA 4OOLA 3IX8A 4QD4A 4ZDXA 4F3LB 2HV1A 4KZ5A 1L0DA 1L0FA 3H82A 5G4YA 1XJ3A 2WADA 1Q2QA 1N9OA 3IXDA 5FI2A 1Z6FA 2V0WA 4UHUA 1YLJA 2HGVA 3LFVA 4KG5A 3EGDC 2PR5A 4ME4A 5U47A 1OTIA 3Q7ZA 2JKTM 1JNUA 3SH8A 2WAFA 3TOIA 2O99A 4R1GA 1ESUA 3BY9A 2W27A 1W7FA 5M18A 5CHUA 4YINA 4OVDA 3ZNYA 3B33A 4JF6A 4X55A 3ZVTA 2B02A 3C7UA 4YOFA 4DJ2A 2J80A 1GSXA 1XJ4A 4P6ZM 5E43A 2C5WB 5K5BA 2OOLA 5L09A 1FCNA 4X1LA 3BJNA 4I3AA 2VEAA 1DJCA 2P08A 4EW7A 4WL9A 3A0SA 4AFIA 3M2KA 1BUEA 2C6WB 4HEFA 2VJWA 2QZ6A 4DXCA 5KIZA 4BD0A 3BFCA 3QNCA 1EWZA 3QP6A 3MR0A 1LI9A 5HW3A 3D9YA 3M2JA 1FCMA 4NXFA 1PW8A 2Y55A 5FQMA 3JYIA 4WEJA 3A3DA 3D4FA 3A3IA 3F1NB 3B42A 5I94A 5I5LA 1TDGA 2WKHA 4EWFA 1YLWA 4S2NA 4LCMA 1L0GA 2WUQA 4HESA 4E3KA 3VSLA 4R70A 2J7VA 2FFFB 3MZDA 5CGSA 1K4EA 3Q7VA 3CLOA 3G6OA 4LFUA 3OPPA 2ZC3B 4JXGA 4FH2A 2QJ7A 4Y13A 2XH9A 2V1BA 4RA7A 4S2LA 2HF6A 2PRFA 1HD8A 3IWQA 3CHWP 4GKUA 1PZPA 3DTIA 3R7WA 1PWDA 4LV2A 4UQIS 3C38A 1ALQA 2XSSA 1S0WA 2V8FA 2JN7A 3N8SA 3JPUA 5D3OA 4S2IA 1IKGA 5FI7A 3HUNA 3QP5A 3ZG7B 3AGEA 4DDSA 1K6RA 5F1GA 4RX2A 3B3XA 2P9VB 5GLDA 3N7WA 2PU4A 4ETZA 4KZ7A 3G2ZA 1PWCA 4HIAA 3PXPA 2UWXA 3MS6A 5AVFA 4X56A 5EVIB 5GHZA 4EV4A 5FI6A 2WZXA 4JKTA 3UE6A 4R4SA 2XD1A 5FQQA 3NDGA 2PDRA 3PR6A 4KUOA 3NHQA 4WM9A 3T4QA 3K2NA 2JKGA 4ZTKA 2HJEA 2ZOIA 3QNBA 1TS7A 2AVXA 4U0TA 4C6YA 1A0KA 4MN5A 3ZFZA 4N9KA 2XA7S 3GTCA 5DF8A 5CGWA 4QU3A 1BSGA 1YKDA 3HL9A 3GSGA 1KGFA 5HSQA 4KZBA 4I3IA 3OBFA 3E4PA 3MFXA 1G68A 1K57A 2VX8A 1GSVA 4Y0OA 1XX2A 1MWRA 1H8YA 4JXVA 1K6SA 2K31A 4LV0A 4OP5A 3IF6A 1P9WA 2QKPA 5HZHA 3IS2A 1MKMA 4H6JB 4S2JA 4CPKA 4WYYA 2Y91A 4NEED 1CJFA 1NY0A 1SHVA 3O88A 4KZ6A 1RCJA 1JWVA 1MC0A 4JF5A 5HFOA 5DF9A 3CI6A 4P0MA 3FPWA 4KZ4A 3MJQA 3G30A 2V9AA 2ZOHA 5DVAA 2XRNA 4IVIA 4CLCA 3F1OA 2Y2GA 2ZD8A 4OKPA 1SZVA 3FPVA 4PMAA 3Q1FA 4N9LA 1K54C 5HAPA 3T4TA 1XFNA 3T1SA 4KQRA 3C4OA 1N9BA 4HQAA 4PM7A 4WZ5C 5CTNA 1PI5A 1SKOB 3BLSA 4HBUA 3N8LA 3BLMA 4JGQA 5G18A 5EM1A 1YAXA 2J3TD 3N8RA 1TS6A 2O0YA 4HY8A 3EGXC 1N9LA 1GHPA 4R0QA 2KDKA 1W63Q 3H7WA 1EI5A 1FQGA 2Y8HA 2A3UA 3DWKA 2X01A 3CUEA 5EM0A 2JCHA 3ITBA 2P7JA 3UDXA 1S66L 2DMWA 4ZJ1A 4D60A 3KYEA 4F94A 5FAPA 1BTLA 4XT2A 4NK3A 4Q0IA 1YQSA 2Q9NA 2WKQA 3VOLA 2PD7A 3C2WA 1NRJA 4KZ3A 5IU1A 1LHYA 2Y2NA 4Q0JA 2EXBA 3TW8A 4EUVA 3ITAA 4QY6A 1KE3A 3T1XA 3ZHHA 4RQ9A 2XEPA 5CHMA 2Z6CA 3NCKA 3WS5A 3CPTB 3MF0A 2IWBA 4U0XA 4BLMA 3LO7A 4EBNA 5HWTA 3V39A 3TRCA 1S67L 2L4RA 2Y79A 5FQIA 5MC7A 5AQ9A 4U3TA 5HAQA 1FILA 4G3KA 1M6KA 3MQOA 3CUEC 4DE0A 4FD8A 4FUWA 1CI8A 2XQZA 2EX2A 4UA6A 1EROA 2PD8A 1HZOA 1T1BA 3SS3A 3KSGA 1FR1A 3UNWA 2CC1A 3G31A 3H9WA 3O86A 5GLAA 4UA9A 4GDNA 5AQBA 3BQ8A 1S1YA 1TEMA 1PRQA 4HH2A 1OT6A 3ZVWA 4JPMA 4R3AA 2ZL1A 5J8XA 1YLTA 2YKFA 3GRJA 3DWZA 1RP5A 3C30A 1OTBA
chains in the Genus database with same CATH topology
4IVKA 1BZAA 4YINA 1ONHA 4ZJ2A 2HDQA 2Y4AA 3O3VA 4OVDA 3ZNYA 4IBXA 2ZLYA 4DRTA 2HDSA 2DNSA 4JF6A 4X55A 3ZVTA 1YM1A 2XGNA 5FAOA 3C7UA 4OP8A 4OPQA 5E43A 5GLBA 3WRTA 2C5WB 5FDHA 1E4DA 1PI4A 1TVFA 4E3OA 5JYOA 3OPHA 1ONGA 4OOYA 5CEDA 3PBRA 3V5MA 2Y2KA 4X68A 1FCNA 4UA7A 3VP1A 4S2NC 4LV3A 4LCLA 2IWDA 1VQQA 1DJCA 1ES4A 5GHYA 1LLBA 3MXSA 4QJGA 1FSWA 5EECA 3DTMA 4MLLA 3M2KA 1BUEA 4BJPA 2C6WB 1WE4A 1MWUA 4E3MA 3N6IA 4HEFA 3TG9A 3ZG9B 2PBYA 2QZ6A 4DXCA 4BD0A 1PZOA 3BFCA 5CHJA 1BULA 3OPLA 3QNCA 4GDBA 2EX8A 3G2YA 1EWZA 4EUZA 3NY4A 3S1YA 3ZG8B 5FQ9A 4GNUA 1YLZA 1RGZA 5E2GA 4KENB 2V20A 2WAEA 1BLSA 1LI9A 2PU2A 3SS5A 1YMXA 5HW3A 4X69A 3ZDJA 1SCWA 4K0XA 2FFYA 5EVLA 2XDMA 1XGIA 3M2JA 1FCMA 1NZOA 1HVBA 1PW8A 2Y2IA 2Y55A 1O07A 4MBFA 3A3FA 4OH0A 5FQMA 3JYIA 3UO9A 4WEJA 3A3DA 3D4FA 3A3IA 1E3UA 5I94A 2ZM8A 3HBRA 5CTMA 2QPNA 2I72A 5E2FA 1YLPA 3UDIA 1TDGA 4OPYA 1N4OA 2HDRA 2WKHA 4K91A 3RXXA 1JWPA 3VOZA 4EWFA 3NI9A 4MNRA 1YLWA 3A3JA 4LCMA 4S2NA 1L0GA 5CEBA 3VMAA 2WUQA 4HESA 2XFSA 4E3KA 4S2KA 3VP2A 1H5XA 3VSLA 3UPPA 4KZ8A 2J7VA 5M19A 3MBZA 5A90A 2FFFB 1KDWA 3MZDA 1QMFA 3HLCA 4JXWA 5CGSA 1IEMA 2WKEA 1GHMA 1K4EA 3GR2A 2ZC6B 4OLDA 2B5RA 3Q7VA 2Y2MA 3UN7A 5KMWA 1I2SA 1W79A 5M1AA 5EPHA 4DDYA 5CERA 5TR7A 3OPPA 2ZC3B 4JXGA 5DF7A 4FH2A 1YMSA 2ZM0A 3LY4A 2XH9A 4EQIA 5HX9A 4R3BA 2XK1A 4RA7A 4S2LA 4R3JA 3I7JA 4XUZA 3VFHA 2OLVA 3CMZA 1XP4A 3FYZA 1HD8A 3PAEA 5E2HA 5EOOA 3IWQA 4R23A 4R4RA 4GKUA 4JBFA 1PZPA 3C4PA 4Q8IA 3UPOA 1KDSA 1PWDA 4LV2A 3MKFA 1G6AA 4DF6A 4PM5A 1ALQA 1S0WA 5A92A 4OQHA 1JWZA 3IHAA 3N8SA 1K55C 4L0LA 3BM6A 4P87A 4E6WA 5D3OA 4S2IA 3ZNTA 2ZQDA 1IKGA 3PBQA 3PBTA 3SH9A 4OQGA 1I5QA 4Y0UA 4H8RA 4DXBA 4KZ9A 4BD1A 3FKWA 3GVBA 4DE3A 5E2EA 2H10A 3FKVA 5FI7A 3HUNA 1H8ZA 1MWSA 3WWXA 3ZG7B 1SKFA 1HTZA 1IKIA 1KGEA 1K56D 1K6RA 1S6RA 3AGEA 5F1GA 4DDSA 4RX2A 5FQKA 3B3XA 2P9VB 3NBLA 3N7WA 5GLDA 3V3RA 2PU4A 3IF5A 4KZ7A 2VGJA 3IT9A 3G2ZA 3HVFA 1PWCA 2UWXA 3LEZA 1JTDA 4X56A 5EVIB 5GHZA 4BL3A 4EV4A 5FI6A 4OQIA 1K4FA 2WZXA 1W5DA 4JKTA 3AGFA 3HLBA 3Q07A 1YLYA 4FCFA 4KG6A 1I2WA 4R4SA 5GHXA 3UE0A 2XD1A 3A3EA 5FQQA 1K57C 4E6XA 4OLGA 3IH8A 4HBTA 3VOYA 3Q81A 3W4QA 3VP0A 3NDGA 2GDNA 3GQZA 1XPBA 2WGIA 1K55A 3GMWA 3IF6C 3IWOA 3SS4A 3BEBA 4WM9A 2XD5A 2EX6A 2IWCA 3WS4A 4ZTKA 2Y2LA 3E2LA 3QNBA 3UDFA 3BFGA 4P6BA 1NYMA 1DY6A 2OV5A 4MBHA 4U0TA 2X02A 1LL9A 4C6YA 3ZFZA 3OCNA 4EBLA 3EQVA 1BT5A 5FSRA 4N9KA 1MY8A 3GTCA 2VGKA 3P98A 1ES2A 3TSGA 2Y2HA 4FH4A 5DF8A 1XA1A 5CGWA 4QU3A 1BSGA 1PYYA 2Y59A 3OPRA 3HL9A 3GSGA 4KG2A 1KGFA 1ES5A 1SDEA 4E3LA 4N1HA 4KZBA 5FQJA 3VSKA 4CJNA 1ZKJA 3FV7A 5CXWA 1FR6A 1XGJA 4M3KA 1SDNA 1WYBA 2WZZA 1BLCA 4PM8A 5HL1A 1G68A 2Y2QA 1K56A 3LY3A 3M6HA 4DE2A 2ZC5B 1K57A 1FSYA 2ZQ8A 3G35A 4GZBA 4KZAA 4WELA 4A5RA 4OQ0A 4Y0OA 1XX2A 3ZCZA 1MWRA 4MBKA 5GLCA 2ZJ9A 1H8YA 5TGFA 4JXVA 1ZG6A 1K6SA 4PPRA 4LV0A 1M40A 2Y2JA 3O87A 4JLFA 3IF6A 4OP5A 4S2OA 3ZGAB 1JTGA 5KZHA 2Y2PA 4MEZA 4JXSA 2V1ZA 1PIOA 4S2JA 4LV1A 1DJBA 4RVAA 4WMCD 4WYYA 4XXRA 1ESIA 2Y91A 3PBNA 5F83A 4CPKA 1W8QA 1NY0A 4BENA 2H5SA 1SHVA 3O88A 4KZ6A 1RCJA 3BFEA 5A93A 3CZDA 1C3BA 1CEFA 1ZC2A 1KVMA 1JWVA 2ZQAA 4JF5A 4RYEA 2HPBA 5HFOA 1JVJA 3NC8A 5DF9A 4P0MA 1OMEA 4GD8A 4ID4A 1QMEA 4KZ4A 5BOHA 3G30A 2JC7A 1E25A 4Y7PA 3Q7VB 5DVAA 3FWLA 4LENA 4ZBEA 3RJUA 3HUOA 2XF3A 4IVIA 3EQUA 4Z9QA 3IQAA 2XFTA 3C5AA 2Y2GA 4K0WA 4JF4A 4GB7A 5FASA 1BLPA 2ZD8A 3MZFA 4OKPA 2A49A 2WK0A 3IWIA 3VP4A 2Z2MB 2H0TA 2J9PA 4PMAA 2X71A 2RL3A 3UE3A 3FZCA 2DCFA 3ISGA 3Q1FA 4PM9A 5JYPA 5DTKA 3G34A 1CK3A 1MWTA 4N9LA 4RX3A 1K54C 3DW0A 5HAPA 1KE4A 3HLGA 5F1FA 3BYDA 3OC2A 1K25A 2EFXA 5DTTA 1GHIA 3Q82A 3C4OA 4KQRA 1N9BA 4NETA 4E3JA 4PM7A 4WZ5C 5F82A 3RXWA 5CTNA 1CI9A 2H0YA 2OLUA 1PI5A 2ZMAA 3HLDA 2WGWB 1LL5A 1ERQA 3BLSA 4HBUA 1L0EA 3N8LA 5EUAA 4GOGA 3BLMA 5EOEA 3W4OA 3UY6A 3CG5A 5G18A 1NZUA 3WS1A 1XXMA 3V50A 3WS2A 2EXAA 5A91A 3LCEA 1FCOA 3E2KA 3N8RA 1CEGA 3PBOA 2Y2OA 4KQOA 4BL2A 1GHPA 2ZQ9A 4R0QA 3NDEA 3MXRA 3SH7A 4WMCA 3VP3A 5AQAA 5CRFA 5L2FA 3ZG5A 3W4PA 1YT4A 1EI5A 1FQGA 1MKIA 1XA7A 4DE1A 4BQMA 2OSUA 3MFDA 2A3UA 2WGVA 3DWKA 4IEDA 3S4XA 4E3IA 2HP9A 2ZQCA 4S2PA 2X01A 2BG1A 5KSHA 1MXOA 1IYSA 4P85A 2RCXA 3G4PA 1FOFA 3WRZA 2JCHA 2QMIA 3ITBA 4D2OA 2J8YA 2P74A 3UDXA 4OPRA 1K54A 1LI0A 4WEKA 4ZAMA 4WBGA 2Q9MA 3W8KA 5DTSA 2ZC7A 4DKIA 1U60A 5FA7A 3OZHA 4ZJ1A 3SOIA 5TFQA 2G2WA 3P09A 1VM1A 4WZ5A 4FSFA 2WYXA 1L2SA 4F94A 3WS0A 1KE0A 1NRFA 3S22A 5FAPA 2JBFA 1BTLA 1O7EA 2DRWA 4NK3A 1IYQA 1YQSA 2Q9NA 4X53A 1BLHA 3NIAA 1DJAA 3PTEA 2G2UA 5CGXA 3MKEA 5FATA 3GV9A 1W8YA 4GN2A 5HAIA 2XLNA 4ZJ3A 3OCLA 1TDLA 3BRMA 2JE5A 1NYYA 1GA0A 4KZ3A 1AXBA 1KVLA 1WYCA 1IYOA 1LHYA 2ZM2A 3HLFA 5EVID 4C3QA 1K38A 2Y2NA 1RGYA 1GCEA 3BFFA 3PBSA 3IXHA 2EFUA 5EE8A 1Y54A 4E3NA 2HP6A 2EXBA 4GD6A 1MPLA 5KSCA 3ZG0A 1MBLA 1ERMA 3M6BA 5IHVA 2BLSA 5AQ7A 4Y0TA 5HARA 2ZC4B 3ITAA 4QY6A 1KE3A 3UPNA 4KQQA 4C75A 3AGDA 3ZHHA 2J9OA 2WKIA 1PW1A 3IH9A 2XEPA 3IF6B 5CHMA 5EVIC 3C7VA 3NCKA 3BFDA 3PAGA 4YFMA 3V3SA 3WS5A 1GA9A 4U0XA 2IWBA 4BLMA 3LO7A 4EBNA 3QHYA 3IHBA 4N92A 1IELA 2Z2LB 2HDUA 3V39A 3N4IA 5FQIA 4EBPA 4B88A 1J9MA 5GL9A 3CJMA 4X6TA 5AQ9A 4U3TA 4B4ZA 2R9XA 1KGGA 2EX9A 5HAQA 4B4XA 4WZ4A 1M6KA 2V2FF 4O7DA 4PM6A 4OPZA 4XUXA 4OONA 1XKZA 4DE0A 4UAAA 4OOLA 3IXGA 4QB8A 4FD8A 4QD4A 3HLEA 1CI8A 2XQZA 3G32A 4ZDXA 3HLWA 2XR0A 2EX2A 3HUMA 4UA6A 1EROA 1PWGA 1NJ4A 4KZ5A 1L0DA 1HZOA 2R9WA 4QY5A 3SS3A 1L0FA 1FR1A 1Q2PA 3UNWA 4IBRA 3VFFA 1ZG4A 2E8IA 2WADA 1Q2QA 2P9VA 2CC1A 3IXDA 4S2MA 3G31A 2ZQ7A 3O86A 1Z6FA 4UHUA 5FI2A 5GLAA 4UA9A 1IYPA 4N1XA 4GDNA 5AQBA 3MZEA 1YLJA 2WGWA 5FAQA 4KG5A 1TEMA 3BECA 5U47A 5EVIA 3Q7ZA 5CECA 3SH8A 3ZVWA 4JPMA 3HREA 1E3UD 4OOMA 2WAFA 3TOIA 1YLTA 3UE1A 5J8XA 4R1GA 4QHCA 1ES3A 1ESUA 3GRJA 3DWZA 3IXBA 1RP5A 1W7FA 2HP5A 5M18A 1NXYA 5CHUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IVK A;  1BZA A;  4YIN A;  1ONH A;  4ZJ2 A;  2HDQ A;  2Y4A A;  3O3V A;  4OVD A;  3ZNY A;  4IBX A;  2ZLY A;  4DRT A;  2HDS A;  2DNS A;  4JF6 A;  4X55 A;  3ZVT A;  1YM1 A;  2XGN A;  5FAO A;  3C7U A;  4OP8 A;  4OPQ A;  5E43 A;  5GLB A;  3WRT A;  2C5W B;  5FDH A;  1E4D A;  1PI4 A;  1TVF A;  4E3O A;  5JYO A;  3OPH A;  1ONG A;  4OOY A;  5CED A;  3PBR A;  3V5M A;  2Y2K A;  4X68 A;  1FCN A;  4UA7 A;  3VP1 A;  4S2N C;  4LV3 A;  4LCL A;  2IWD A;  1VQQ A;  1DJC A;  1ES4 A;  5GHY A;  1LLB A;  3MXS A;  4QJG A;  1FSW A;  5EEC A;  3DTM A;  4MLL A;  3M2K A;  1BUE A;  4BJP A;  2C6W B;  1WE4 A;  1MWU A;  4E3M A;  3N6I A;  4HEF A;  3TG9 A;  3ZG9 B;  2PBY A;  2QZ6 A;  4DXC A;  4BD0 A;  1PZO A;  3BFC A;  5CHJ A;  1BUL A;  3OPL A;  3QNC A;  4GDB A;  2EX8 A;  3G2Y A;  1EWZ A;  4EUZ A;  3NY4 A;  3S1Y A;  3ZG8 B;  5FQ9 A;  4GNU A;  1YLZ A;  1RGZ A;  5E2G A;  4KEN B;  2V20 A;  2WAE A;  1BLS A;  1LI9 A;  2PU2 A;  3SS5 A;  1YMX A;  5HW3 A;  4X69 A;  3ZDJ A;  1SCW A;  4K0X A;  2FFY A;  5EVL A;  2XDM A;  1XGI A;  3M2J A;  1FCM A;  1NZO A;  1HVB A;  1PW8 A;  2Y2I A;  2Y55 A;  1O07 A;  4MBF A;  3A3F A;  4OH0 A;  5FQM A;  3JYI A;  3UO9 A;  4WEJ A;  3A3D A;  3D4F A;  3A3I A;  1E3U A;  5I94 A;  2ZM8 A;  3HBR A;  5CTM A;  2QPN A;  2I72 A;  5E2F A;  1YLP A;  3UDI A;  1TDG A;  4OPY A;  1N4O A;  2HDR A;  2WKH A;  4K91 A;  3RXX A;  1JWP A;  3VOZ A;  4EWF A;  3NI9 A;  4MNR A;  1YLW A;  3A3J A;  4LCM A;  4S2N A;  1L0G A;  5CEB A;  3VMA A;  2WUQ A;  4HES A;  2XFS A;  4E3K A;  4S2K A;  3VP2 A;  1H5X A;  3VSL A;  3UPP A;  4KZ8 A;  2J7V A;  5M19 A;  3MBZ A;  5A90 A;  2FFF B;  1KDW A;  3MZD A;  1QMF A;  3HLC A;  4JXW A;  5CGS A;  1IEM A;  2WKE A;  1GHM A;  1K4E A;  3GR2 A;  2ZC6 B;  4OLD A;  2B5R A;  3Q7V A;  2Y2M A;  3UN7 A;  5KMW A;  1I2S A;  1W79 A;  5M1A A;  5EPH A;  4DDY A;  5CER A;  5TR7 A;  3OPP A;  2ZC3 B;  4JXG A;  5DF7 A;  4FH2 A;  1YMS A;  2ZM0 A;  3LY4 A;  2XH9 A;  4EQI A;  5HX9 A;  4R3B A;  2XK1 A;  4RA7 A;  4S2L A;  4R3J A;  3I7J A;  4XUZ A;  3VFH A;  2OLV A;  3CMZ A;  1XP4 A;  3FYZ A;  1HD8 A;  3PAE A;  5E2H A;  5EOO A;  3IWQ A;  4R23 A;  4R4R A;  4GKU A;  4JBF A;  1PZP A;  3C4P A;  4Q8I A;  3UPO A;  1KDS A;  1PWD A;  4LV2 A;  3MKF A;  1G6A A;  4DF6 A;  4PM5 A;  1ALQ A;  1S0W A;  5A92 A;  4OQH A;  1JWZ A;  3IHA A;  3N8S A;  1K55 C;  4L0L A;  3BM6 A;  4P87 A;  4E6W A;  5D3O A;  4S2I A;  3ZNT A;  2ZQD A;  1IKG A;  3PBQ A;  3PBT A;  3SH9 A;  4OQG A;  1I5Q A;  4Y0U A;  4H8R A;  4DXB A;  4KZ9 A;  4BD1 A;  3FKW A;  3GVB A;  4DE3 A;  5E2E A;  2H10 A;  3FKV A;  5FI7 A;  3HUN A;  1H8Z A;  1MWS A;  3WWX A;  3ZG7 B;  1SKF A;  1HTZ A;  1IKI A;  1KGE A;  1K56 D;  1K6R A;  1S6R A;  3AGE A;  5F1G A;  4DDS A;  4RX2 A;  5FQK A;  3B3X A;  2P9V B;  3NBL A;  3N7W A;  5GLD A;  3V3R A;  2PU4 A;  3IF5 A;  4KZ7 A;  2VGJ A;  3IT9 A;  3G2Z A;  3HVF A;  1PWC A;  2UWX A;  3LEZ A;  1JTD A;  4X56 A;  5EVI B;  5GHZ A;  4BL3 A;  4EV4 A;  5FI6 A;  4OQI A;  1K4F A;  2WZX A;  1W5D A;  4JKT A;  3AGF A;  3HLB A;  3Q07 A;  1YLY A;  4FCF A;  4KG6 A;  1I2W A;  4R4S A;  5GHX A;  3UE0 A;  2XD1 A;  3A3E A;  5FQQ A;  1K57 C;  4E6X A;  4OLG A;  3IH8 A;  4HBT A;  3VOY A;  3Q81 A;  3W4Q A;  3VP0 A;  3NDG A;  2GDN A;  3GQZ A;  1XPB A;  2WGI A;  1K55 A;  3GMW A;  3IF6 C;  3IWO A;  3SS4 A;  3BEB A;  4WM9 A;  2XD5 A;  2EX6 A;  2IWC A;  3WS4 A;  4ZTK A;  2Y2L A;  3E2L A;  3QNB A;  3UDF A;  3BFG A;  4P6B A;  1NYM A;  1DY6 A;  2OV5 A;  4MBH A;  4U0T A;  2X02 A;  1LL9 A;  4C6Y A;  3ZFZ A;  3OCN A;  4EBL A;  3EQV A;  1BT5 A;  5FSR A;  4N9K A;  1MY8 A;  3GTC A;  2VGK A;  3P98 A;  1ES2 A;  3TSG A;  2Y2H A;  4FH4 A;  5DF8 A;  1XA1 A;  5CGW A;  4QU3 A;  1BSG A;  1PYY A;  2Y59 A;  3OPR A;  3HL9 A;  3GSG A;  4KG2 A;  1KGF A;  1ES5 A;  1SDE A;  4E3L A;  4N1H A;  4KZB A;  5FQJ A;  3VSK A;  4CJN A;  1ZKJ A;  3FV7 A;  5CXW A;  1FR6 A;  1XGJ A;  4M3K A;  1SDN A;  1WYB A;  2WZZ A;  1BLC A;  4PM8 A;  5HL1 A;  1G68 A;  2Y2Q A;  1K56 A;  3LY3 A;  3M6H A;  4DE2 A;  2ZC5 B;  1K57 A;  1FSY A;  2ZQ8 A;  3G35 A;  4GZB A;  4KZA A;  4WEL A;  4A5R A;  4OQ0 A;  4Y0O A;  1XX2 A;  3ZCZ A;  1MWR A;  4MBK A;  5GLC A;  2ZJ9 A;  1H8Y A;  5TGF A;  4JXV A;  1ZG6 A;  1K6S A;  4PPR A;  4LV0 A;  1M40 A;  2Y2J A;  3O87 A;  4JLF A;  3IF6 A;  4OP5 A;  4S2O A;  3ZGA B;  1JTG A;  5KZH A;  2Y2P A;  4MEZ A;  4JXS A;  2V1Z A;  1PIO A;  4S2J A;  4LV1 A;  1DJB A;  4RVA A;  4WMC D;  4WYY A;  4XXR A;  1ESI A;  2Y91 A;  3PBN A;  5F83 A;  4CPK A;  1W8Q A;  1NY0 A;  4BEN A;  2H5S A;  1SHV A;  3O88 A;  4KZ6 A;  1RCJ A;  3BFE A;  5A93 A;  3CZD A;  1C3B A;  1CEF A;  1ZC2 A;  1KVM A;  1JWV A;  2ZQA A;  4JF5 A;  4RYE A;  2HPB A;  5HFO A;  1JVJ A;  3NC8 A;  5DF9 A;  4P0M A;  1OME A;  4GD8 A;  4ID4 A;  1QME A;  4KZ4 A;  5BOH A;  3G30 A;  2JC7 A;  1E25 A;  4Y7P A;  3Q7V B;  5DVA A;  3FWL A;  4LEN A;  4ZBE A;  3RJU A;  3HUO A;  2XF3 A;  4IVI A;  3EQU A;  4Z9Q A;  3IQA A;  2XFT A;  3C5A A;  2Y2G A;  4K0W A;  4JF4 A;  4GB7 A;  5FAS A;  1BLP A;  2ZD8 A;  3MZF A;  4OKP A;  2A49 A;  2WK0 A;  3IWI A;  3VP4 A;  2Z2M B;  2H0T A;  2J9P A;  4PMA A;  2X71 A;  2RL3 A;  3UE3 A;  3FZC A;  2DCF A;  3ISG A;  3Q1F A;  4PM9 A;  5JYP A;  5DTK A;  3G34 A;  1CK3 A;  1MWT A;  4N9L A;  4RX3 A;  1K54 C;  3DW0 A;  5HAP A;  1KE4 A;  3HLG A;  5F1F A;  3BYD A;  3OC2 A;  1K25 A;  2EFX A;  5DTT A;  1GHI A;  3Q82 A;  3C4O A;  4KQR A;  1N9B A;  4NET A;  4E3J A;  4PM7 A;  4WZ5 C;  5F82 A;  3RXW A;  5CTN A;  1CI9 A;  2H0Y A;  2OLU A;  1PI5 A;  2ZMA A;  3HLD A;  2WGW B;  1LL5 A;  1ERQ A;  3BLS A;  4HBU A;  1L0E A;  3N8L A;  5EUA A;  4GOG A;  3BLM A;  5EOE A;  3W4O A;  3UY6 A;  3CG5 A;  5G18 A;  1NZU A;  3WS1 A;  1XXM A;  3V50 A;  3WS2 A;  2EXA A;  5A91 A;  3LCE A;  1FCO A;  3E2K A;  3N8R A;  1CEG A;  3PBO A;  2Y2O A;  4KQO A;  4BL2 A;  1GHP A;  2ZQ9 A;  4R0Q A;  3NDE A;  3MXR A;  3SH7 A;  4WMC A;  3VP3 A;  5AQA A;  5CRF A;  5L2F A;  3ZG5 A;  3W4P A;  1YT4 A;  1EI5 A;  1FQG A;  1MKI A;  1XA7 A;  4DE1 A;  4BQM A;  2OSU A;  3MFD A;  2A3U A;  2WGV A;  3DWK A;  4IED A;  3S4X A;  4E3I A;  2HP9 A;  2ZQC A;  4S2P A;  2X01 A;  2BG1 A;  5KSH A;  1MXO A;  1IYS A;  4P85 A;  2RCX A;  3G4P A;  1FOF A;  3WRZ A;  2JCH A;  2QMI A;  3ITB A;  4D2O A;  2J8Y A;  2P74 A;  3UDX A;  4OPR A;  1K54 A;  1LI0 A;  4WEK A;  4ZAM A;  4WBG A;  2Q9M A;  3W8K A;  5DTS A;  2ZC7 A;  4DKI A;  1U60 A;  5FA7 A;  3OZH A;  4ZJ1 A;  3SOI A;  5TFQ A;  2G2W A;  3P09 A;  1VM1 A;  4WZ5 A;  4FSF A;  2WYX A;  1L2S A;  4F94 A;  3WS0 A;  1KE0 A;  1NRF A;  3S22 A;  5FAP A;  2JBF A;  1BTL A;  1O7E A;  2DRW A;  4NK3 A;  1IYQ A;  1YQS A;  2Q9N A;  4X53 A;  1BLH A;  3NIA A;  1DJA A;  3PTE A;  2G2U A;  5CGX A;  3MKE A;  5FAT A;  3GV9 A;  1W8Y A;  4GN2 A;  5HAI A;  2XLN A;  4ZJ3 A;  3OCL A;  1TDL A;  3BRM A;  2JE5 A;  1NYY A;  1GA0 A;  4KZ3 A;  1AXB A;  1KVL A;  1WYC A;  1IYO A;  1LHY A;  2ZM2 A;  3HLF A;  5EVI D;  4C3Q A;  1K38 A;  2Y2N A;  1RGY A;  1GCE A;  3BFF A;  3PBS A;  3IXH A;  2EFU A;  5EE8 A;  1Y54 A;  4E3N A;  2HP6 A;  2EXB A;  4GD6 A;  1MPL A;  5KSC A;  3ZG0 A;  1MBL A;  1ERM A;  3M6B A;  5IHV A;  2BLS A;  5AQ7 A;  4Y0T A;  5HAR A;  2ZC4 B;  3ITA A;  4QY6 A;  1KE3 A;  3UPN A;  4KQQ A;  4C75 A;  3AGD A;  3ZHH A;  2J9O A;  2WKI A;  1PW1 A;  3IH9 A;  2XEP A;  3IF6 B;  5CHM A;  5EVI C;  3C7V A;  3NCK A;  3BFD A;  3PAG A;  4YFM A;  3V3S A;  3WS5 A;  1GA9 A;  4U0X A;  2IWB A;  4BLM A;  3LO7 A;  4EBN A;  3QHY A;  3IHB A;  4N92 A;  1IEL A;  2Z2L B;  2HDU A;  3V39 A;  3N4I A;  5FQI A;  4EBP A;  4B88 A;  1J9M A;  5GL9 A;  3CJM A;  4X6T A;  5AQ9 A;  4U3T A;  4B4Z A;  2R9X A;  1KGG A;  2EX9 A;  5HAQ A;  4B4X A;  4WZ4 A;  1M6K A;  2V2F F;  4O7D A;  4PM6 A;  4OPZ A;  4XUX A;  4OON A;  1XKZ A;  4DE0 A;  4UAA A;  4OOL A;  3IXG A;  4QB8 A;  4FD8 A;  4QD4 A;  3HLE A;  1CI8 A;  2XQZ A;  3G32 A;  4ZDX A;  3HLW A;  2XR0 A;  2EX2 A;  3HUM A;  4UA6 A;  1ERO A;  1PWG A;  1NJ4 A;  4KZ5 A;  1L0D A;  1HZO A;  2R9W A;  4QY5 A;  3SS3 A;  1L0F A;  1FR1 A;  1Q2P A;  3UNW A;  4IBR A;  3VFF A;  1ZG4 A;  2E8I A;  2WAD A;  1Q2Q A;  2P9V A;  2CC1 A;  3IXD A;  4S2M A;  3G31 A;  2ZQ7 A;  3O86 A;  1Z6F A;  4UHU A;  5FI2 A;  5GLA A;  4UA9 A;  1IYP A;  4N1X A;  4GDN A;  5AQB A;  3MZE A;  1YLJ A;  2WGW A;  5FAQ A;  4KG5 A;  1TEM A;  3BEC A;  5U47 A;  5EVI A;  3Q7Z A;  5CEC A;  3SH8 A;  3ZVW A;  4JPM A;  3HRE A;  1E3U D;  4OOM A;  2WAF A;  3TOI A;  1YLT A;  3UE1 A;  5J8X A;  4R1G A;  4QHC A;  1ES3 A;  1ESU A;  3GRJ A;  3DWZ A;  3IXB A;  1RP5 A;  1W7F A;  2HP5 A;  5M18 A;  1NXY A;  5CHU A; 
#chains in the Genus database with same CATH topology
 1OTA A;  3NOU C;  2HDS A;  2LB9 A;  2VV6 A;  2GNX A;  2W1T A;  5FDH A;  4E3O A;  3OPH A;  4X68 A;  4UA7 A;  3QP4 A;  4LV3 A;  4LCL A;  2IWD A;  1VQQ A;  3MMH A;  1ES4 A;  1OJ5 A;  3DTM A;  4MLL A;  4BJP A;  1MWU A;  4E3M A;  3TG9 A;  2O9A A;  1DP9 A;  4LRX C;  3ZG8 B;  1VHM A;  4GNU A;  1YLZ A;  1RGZ A;  3O5Y A;  4BBT A;  4KEN B;  1YMX A;  3ZDJ A;  4WUJ A;  4K0X A;  1NZO A;  4MBF A;  4K08 A;  4GJ4 A;  1E3U A;  5CTM A;  5E2F A;  1YLP A;  4I5S A;  2WKR A;  4LPZ A;  3JVV A;  3RXX A;  1JWP A;  2B95 A;  2HZ5 A;  1IOU A;  2XFS A;  3BW6 A;  3VP2 A;  4KZ8 A;  5M19 A;  3MBZ A;  5A90 A;  5HWW A;  3HLC A;  4JXW A;  3LI8 A;  5J7E A;  2WKE A;  1GHM A;  4EES A;  1VEU A;  2ZC6 B;  4OLD A;  5AVE A;  5L10 A;  5KMW A;  1W79 A;  4DDY A;  5HL6 A;  1YPR A;  3IX3 A;  4EQI A;  5HX9 A;  2XK1 A;  3OOV A;  4R3J A;  2OLV A;  3FYZ A;  3PAE A;  5EOO A;  3ZQ5 A;  4E04 A;  4R4R A;  4Q8I A;  4GS9 B;  3UB9 A;  4DF6 A;  2EWW A;  4OQH A;  1JWZ A;  3IHA A;  1K55 C;  4P87 A;  3BM6 A;  3EWK A;  3NOT C;  4F3L A;  4EQ1 A;  4OQG A;  2OAQ 1;  4Y0U A;  4KZ9 A;  2NUP C;  5E2E A;  4BBV A;  3FKV A;  1MWS A;  3WWX A;  2JHE A;  1HTZ A;  1S6R A;  3T1R A;  3H82 B;  2L0W A;  2PR6 A;  5FQK A;  3NBL A;  5DJU A;  5HD5 A;  3IF5 A;  1CF0 A;  2VGJ A;  3DBA A;  3MXQ A;  3NOP C;  3HVF A;  3LEZ A;  4BL3 A;  3MSH A;  5GHX A;  3DAV A;  3FG8 A;  3R4K A;  4HBT A;  1VET A;  3VE4 A;  3Q81 A;  4DMZ A;  3NJA A;  3PYP A;  4WN5 A;  2WGI A;  3BEB A;  3A0R A;  3UME A;  4NXE A;  2PYR A;  1YSQ A;  3E2L A;  3BFG A;  3PHY A;  2OV5 A;  2L1M A;  4CQH A;  4CLC D;  3OCN A;  1BT5 A;  3P98 A;  2Y2H A;  2VGL M;  2Q0O A;  3OPR A;  2Y59 A;  4KG2 A;  1DP6 A;  4E3L A;  1SDE A;  3VSK A;  5CXW A;  4M3K A;  4PM8 A;  5HL1 A;  2Y2Q A;  3LY3 A;  2ZQ8 A;  4GZB A;  4WEL A;  3JVU A;  2HJ9 C;  4LLO B;  4P6Z S;  5TGF A;  1ZG6 A;  4PPR A;  5HWV A;  3ZGA B;  3T4J A;  4HJ4 A;  4DN0 A;  4EXO A;  1H3Q A;  4JXS A;  4WF0 A;  1PIO A;  4LV1 A;  4RVA A;  4XXR A;  3PBN A;  5F83 A;  1OTD A;  4CLC E;  3CZD A;  1ZC2 A;  1KVM A;  4RYE A;  2W3E A;  1OME A;  4ID4 A;  2QYB A;  1QME A;  5BOH A;  1F2K A;  1TS0 A;  2JC7 A;  3Q7V B;  2GZA A;  3LIF A;  5J4E A;  3IQA A;  2VZW A;  2XFT A;  2JKR I;  4UEY A;  1S1Z A;  3MZF A;  3IWI A;  5HDD A;  4NG2 A;  3UE3 A;  5F5Y A;  3HJI A;  5DTK A;  1CK3 A;  5F1F A;  4JGO A;  3BYD A;  3OC2 A;  1K25 A;  2EFX A;  5DTT A;  4G3V A;  4NET A;  1UWP X;  3RXW A;  2H0Y A;  2OLU A;  3HLD A;  2WGW B;  3LR5 A;  1L0E A;  2XA7 M;  3EEA A;  5EUA A;  4Y15 A;  3CG5 A;  4BMW A;  1NZU A;  3WS1 A;  1XXM A;  2PBD P;  3WS2 A;  3LCE A;  3QP1 A;  3PBO A;  2Y2O A;  3VV4 A;  3NDE A;  3P7N A;  3MXR A;  3S7Q A;  3SH7 A;  4WMC A;  4PKY A;  5L2F A;  2NUT C;  2K2N A;  4DE1 A;  2OSU A;  5KSH A;  2HP9 A;  1MXO A;  4P85 A;  5L07 A;  2RCX A;  4MMN A;  3G4P A;  3LR3 A;  2V0U A;  1K54 A;  1LI0 A;  4WBG A;  5DTS A;  3LIC A;  5FA7 A;  4EU0 A;  5TFQ A;  5HD3 A;  4WZ5 A;  4FSF A;  3WS0 A;  5F68 A;  1NRF A;  4ARZ A;  1UWN X;  2JBF A;  5G4Z A;  3QP2 A;  3A0V A;  2JE5 A;  1NYY A;  1GA0 A;  2H28 A;  1AXB A;  1STZ A;  2ZM2 A;  3HLF A;  1GCE A;  3PBS A;  2EFU A;  5EE8 A;  1Y54 A;  2KX6 A;  4HP9 A;  3MQ0 A;  4GD6 A;  4KQQ A;  3AGD A;  1PW1 A;  2UV0 E;  3IH9 A;  3IF6 B;  2JKR M;  3IS2 B;  5EVI C;  3V3S A;  5HPF A;  3IHB A;  4N92 A;  3MQQ A;  1OJG A;  2O9C A;  2A24 B;  2HDU A;  2VK3 A;  4B88 A;  3CWF A;  1J9M A;  4X6T A;  3GDI A;  4B4Z A;  1KGG A;  4WZ4 A;  3K3C A;  4IUH A;  4XUX A;  5J3W A;  3EEH A;  3HLW A;  2XR0 A;  4HJ6 A;  3HUM A;  4CLC B;  3F1O B;  1PWG A;  2G7U A;  2R9W A;  1Q2P A;  4HOI A;  4IBR A;  1ZG4 A;  4S2M A;  1TF1 A;  4N1X A;  5FAQ A;  2EA9 A;  3HRE A;  1E3U D;  4II7 A;  4OOM A;  4QHC A;  4FOF A;  4O0P A;  3IXB A;  1NXY A;  3ULF A;  1BZA A;  3KSF A;  4ZJ2 A;  3L9K A;  2FH5 A;  4O8G A;  2ZLY A;  4DRT A;  2VV7 A;  4R38 A;  1E4D A;  1ONG A;  5CED A;  2Y2K A;  3VP1 A;  1X0O A;  5FDS A;  4O01 A;  4QJG A;  2QHK A;  1PFL A;  1D7E A;  1Z09 A;  5LBR A;  2MJ6 A;  1PZO A;  5CHJ A;  4BWI A;  5IS1 A;  1BUL A;  3OPL A;  3G2Y A;  3NY4 A;  3S1Y A;  5TJJ A;  5E2G A;  2EWV A;  2PU2 A;  4XT2 B;  4X69 A;  3KO6 A;  3VE3 A;  1HVB A;  2Y2I A;  1O07 A;  3UDI A;  3HBR A;  2I72 A;  4K91 A;  3VOZ A;  1OT9 A;  3NI9 A;  4MNR A;  2VLG A;  2XRO A;  5CEB A;  4L9E A;  3VMA A;  4LRZ E;  1H5X A;  3UPP A;  1J3W A;  1KDW A;  1QMF A;  4HJ3 A;  1IEM A;  2V1A A;  3GR2 A;  3UN7 A;  3IBR A;  3SW1 A;  1I2S A;  5M1A A;  3NUL A;  5CER A;  1PNE A;  5DF7 A;  4R3B A;  4XUZ A;  3I7J A;  3RH8 B;  3CMZ A;  5E2H A;  1D1J A;  4R23 A;  1GSW A;  4JBF A;  2YKH A;  3QP8 A;  3UPO A;  1KDS A;  3MKF A;  1G6A A;  2W3G A;  4PM5 A;  3E4O A;  4L0L A;  3ZNT A;  5DFY A;  3PBT A;  1TS8 A;  3SH9 A;  1T18 A;  1I5Q A;  3E0Y A;  4H8R A;  4DXB A;  3FKW A;  3GVB A;  2H10 A;  5CX7 A;  1H8Z A;  1SKF A;  1XJ2 A;  1T1A A;  4HH3 A;  3IT9 A;  1P97 A;  4Y2F A;  1JTD A;  4OQI A;  4MN6 A;  3HLB A;  1YLY A;  4KG6 A;  1I2W A;  3UE0 A;  3A3E A;  3U2A A;  4E6X A;  2GX5 A;  3KYZ A;  3IH8 A;  3VP0 A;  2GDN A;  3GQZ A;  1K55 A;  3SS4 A;  2ACG A;  2XD5 A;  2EX6 A;  2IWC A;  3WS4 A;  3UDF A;  4P6B A;  1NYM A;  1DY6 A;  5HDC A;  2X02 A;  1LL9 A;  5EV0 A;  4IHQ A;  2VA0 A;  3T4O A;  3EQV A;  1MY8 A;  1ES2 A;  3TSG A;  4FH4 A;  3EOI A;  1TD5 A;  4N1H A;  4CJN A;  1ZKJ A;  3FV7 A;  1SDN A;  1WYB A;  3NEC A;  2WZZ A;  3HCY A;  3RTY A;  4Y5F A;  1K56 A;  3M6H A;  2W3F A;  5HPI A;  3G35 A;  4OQ0 A;  3UB8 A;  1YSP A;  3ZCZ A;  4MBK A;  3UB6 A;  3T1Q B;  4GHI A;  4GLQ A;  4S2O A;  1M40 A;  3O87 A;  4JLF A;  3BQA A;  2JKF A;  1JTG A;  3S7O A;  2Y2P A;  2V1Z A;  4M4X A;  3HJK A;  2PT7 A;  2A2L A;  1DJB A;  4WMC D;  2E8J A;  3ICY A;  3F1P A;  5TBM B;  2H5S A;  3DTK A;  5A93 A;  1C3B A;  1CEF A;  2ZQA A;  2HPB A;  4GD8 A;  3LYX A;  1V9Y A;  1VEU B;  1E25 A;  4ZBE A;  3LGO A;  3RJU A;  2XF3 A;  4Z9Q A;  5C5K A;  3LR4 A;  4GS9 A;  3C5A A;  1EW0 A;  4JF4 A;  2VKS A;  1BLP A;  3RFB A;  2WK0 A;  3VP4 A;  2J9P A;  2RL3 A;  3IBJ A;  2DCF A;  5JYP A;  3G34 A;  4IJG A;  1KE4 A;  1L3L A;  3LIB A;  1GHI A;  3P01 A;  4L9G A;  5F82 A;  4YWZ A;  3K3D A;  1CI9 A;  2ZMA A;  1LL5 A;  1BYW A;  1ERQ A;  3KSH A;  4LRY C;  5EOE A;  1XJ6 A;  3UY6 A;  4ZRR A;  2EXA A;  5DKL A;  1CEG A;  1NLZ A;  4IUK A;  2QJ5 A;  3SZT A;  3OLO A;  5AQA A;  5CRF A;  3ZG5 A;  1ACF A;  1LSX A;  1YT4 A;  3MFD A;  2WGV A;  3S4X A;  4MDZ A;  4E3I A;  2ZQC A;  2J3T C;  2OAP 1;  4Y3I A;  1FIK A;  1VET B;  3ZYT A;  4PKY G;  1P9R A;  3S7N A;  4ZAM A;  3D3O A;  4DKI A;  3W8K A;  1U60 A;  2G2W A;  3P09 A;  1VM1 A;  2WYX A;  1HLU P;  5FL3 A;  1F9I A;  1O7E A;  2K7S A;  4X53 A;  1BLH A;  3PTE A;  5FAT A;  1V9Z A;  4GN2 A;  4KQD A;  3F1N A;  4ZJ3 A;  1K0K A;  4UQI M;  2FZ0 A;  3BRM A;  4EEP A;  1WYC A;  1IYO A;  2W3H A;  3BFF A;  3IXH A;  1MPL A;  5KSC A;  3ZG0 A;  4Y0T A;  2BLS A;  5AQ7 A;  5HAR A;  2ZC4 B;  3E4Q A;  4YNR A;  3PAG A;  3BFD A;  4YFM A;  1KOU A;  2BTF P;  2VGL S;  4NKP A;  4EBP A;  5GL9 A;  3CJM A;  4EEU A;  3DTE A;  2ZMF A;  4B4X A;  2WKP A;  2V2F F;  1XKZ A;  4HP4 A;  3IXG A;  4QB8 A;  3R7W B;  3HLE A;  3G32 A;  1W63 M;  4HHD A;  1NJ4 A;  4QY5 A;  5FEF A;  3VFF A;  2E8I A;  2P9V A;  2ZQ7 A;  1IYP A;  1F5M A;  1F98 A;  3MZE A;  2WGW A;  3BEC A;  5EVI A;  5CEC A;  3UE1 A;  2OWH A;  1ES3 A;  3D72 A;  2HP5 A;  1G28 A;  4IVK A;  2W3D A;  5IT5 A;  1ONH A;  2HDQ A;  2Y4A A;  2BAS A;  3O3V A;  4IBX A;  2DNS A;  1YM1 A;  1G6O A;  2XGN A;  5FAO A;  4B9O A;  4OP8 A;  4OPQ A;  5GLB A;  3WRT A;  5JYO A;  1PI4 A;  1TVF A;  4Y17 A;  4OOY A;  3PBR A;  3V5M A;  4S2N C;  4ESP A;  5GHY A;  1LLB A;  3MXS A;  4G3W A;  1FSW A;  4X25 A;  5EEC A;  1WE4 A;  3N6I A;  3LI9 A;  3ZG9 B;  2PBY A;  5DFX A;  1P0Z A;  3LEQ A;  4EER A;  4GDB A;  2EX8 A;  3BY8 A;  4EUZ A;  5FQ9 A;  3V67 A;  2V20 A;  1D06 A;  2WAE A;  1BLS A;  4ARZ B;  3SS5 A;  5EFW A;  1SCW A;  2FFY A;  5EVL A;  2XDM A;  1XGI A;  1S4R A;  4OH0 A;  3A3F A;  3UO9 A;  5F69 A;  3KYQ A;  2ZM8 A;  2QPN A;  4MN7 A;  4H6J A;  4OPY A;  1N4O A;  2HDR A;  2P04 A;  2PYP A;  3A3J A;  2INW A;  4S2K A;  3T4S A;  3LIE A;  2B5R A;  2Y2M A;  2A24 A;  3LID A;  5EPH A;  5TR7 A;  1YMS A;  2ZM0 A;  3LY4 A;  4Z1W A;  3L7H A;  3VFH A;  1XP4 A;  1DP8 A;  4WLA A;  3C4P A;  4QPR A;  1UGU A;  3TE8 A;  5A92 A;  1AWI A;  4E6W A;  2ZQD A;  3PBQ A;  4HI4 A;  4EET B;  2QWS A;  3E98 A;  4BD1 A;  1SKO A;  4DE3 A;  4I38 A;  4I3J A;  1VB6 A;  1LL8 A;  3UB5 P;  4I39 A;  1KGE A;  1IKI A;  1K56 D;  3V3R A;  1LSW A;  3CAX A;  2KLI A;  2J3W A;  4X1M A;  1K4F A;  1W5D A;  3AGF A;  3Q07 A;  4FCF A;  1K57 C;  4OLG A;  3H7W B;  3W2Z A;  3VOY A;  3W4Q A;  2R78 A;  4MCW A;  1XPB A;  3GMW A;  3IF6 C;  3IWO A;  3T4K A;  1H8M A;  3C8C A;  2VV8 A;  2Y2L A;  4MBH A;  4DJ3 A;  1ZHH B;  3UMD A;  2B18 A;  3LIA A;  2Z6D A;  1ODV A;  4EBL A;  5FSR A;  4JGP A;  1S4S A;  2VGK A;  2W0N A;  1XA1 A;  3BWL A;  1PYY A;  3T12 B;  3KX0 X;  1ES5 A;  5FQJ A;  1FR6 A;  1XGJ A;  5A8B A;  4CLC C;  2W1R A;  1BLC A;  4JGR A;  4PHT A;  2OWJ A;  2ZC5 B;  4DE2 A;  4KZA A;  1FSY A;  2V8C A;  1T1C A;  4L9F A;  4A5R A;  1G5U A;  4B93 A;  4BBU A;  1NLY A;  5GLC A;  2ZJ9 A;  5L8M A;  4Q0H A;  2Y2J A;  2LB5 A;  2D01 A;  5KZH A;  2PAV P;  3CPT A;  4MEZ A;  1N9N A;  1ESI A;  1W8Q A;  4BEN A;  1OTE A;  3U4L P;  5DKK A;  2GJ3 A;  3BFE A;  1JVJ A;  2IA2 A;  3NC8 A;  4Y7P A;  3KSI A;  3FWL A;  3GEC A;  4LEN A;  3HUO A;  4R6L A;  3EQU A;  1H0M A;  1CQA A;  5DJT A;  4NXG A;  4K0W A;  3T50 A;  4GB7 A;  5FAS A;  2A49 A;  1T19 A;  2Z2M B;  2H0T A;  2X71 A;  3FZC A;  3ISG A;  4PM9 A;  1MWT A;  4RX3 A;  1Y28 A;  3CIT A;  3DW0 A;  3UB7 A;  3HLG A;  3B47 A;  3Q82 A;  4E3J A;  3IX4 A;  1NWZ A;  5HDS A;  4GOG A;  3W4O A;  5F6A A;  2ZL1 B;  3V50 A;  5A91 A;  1FCO A;  1LT0 A;  3E2K A;  4KQO A;  4BL2 A;  4LGW A;  1WA9 A;  2ZQ9 A;  3VP3 A;  1Y4O A;  3W4P A;  1MKI A;  1XA7 A;  4BQM A;  2JKT I;  1ZTU A;  2W1T B;  4IED A;  4S2P A;  2BG1 A;  1IYS A;  1IFQ A;  4PAU A;  1FOF A;  3WRZ A;  4HNB A;  2QMI A;  2ZBB A;  4D2O A;  5FEG A;  2J8Y A;  2P74 A;  4QWO A;  4OPR A;  4WEK A;  2Q9M A;  1XFQ A;  2ZC7 A;  3OZH A;  3SOI A;  2M7U A;  4GCZ A;  1L2S A;  2M1C A;  2ZMV A;  2CMN A;  1KE0 A;  3S22 A;  3FC7 A;  2DRW A;  4GW9 A;  1IYQ A;  2PHY A;  3NIA A;  1LSV A;  1DJA A;  2G2U A;  5CGX A;  3MKE A;  3GV9 A;  1W8Y A;  1OPX A;  5HAI A;  3LUQ A;  2XLN A;  3OCL A;  1DRM A;  1TDL A;  4ETX A;  1KVL A;  5AJG A;  4NXB A;  5EVI D;  4C3Q A;  1K38 A;  1RGY A;  4KUK A;  4E3N A;  2HP6 A;  1MBL A;  1ERM A;  3M6B A;  5IHV A;  2KOI A;  5EVE A;  3UPN A;  4FTX A;  4C75 A;  2J9O A;  2WKI A;  4GHI B;  2I9V A;  5TBM A;  2M7V A;  3C7V A;  1GA9 A;  3QHY A;  1MZU A;  3LR0 A;  2O9B A;  1IEL A;  2Z2L B;  3F1P B;  3N4I A;  3T4L A;  2R9X A;  2EX9 A;  2D02 A;  4O7D A;  3TJZ C;  4PM6 A;  4OPZ A;  3S7P A;  4OON A;  4UAA A;  4OOL A;  3IX8 A;  4QD4 A;  4ZDX A;  4F3L B;  2HV1 A;  4KZ5 A;  1L0D A;  1L0F A;  3H82 A;  5G4Y A;  1XJ3 A;  2WAD A;  1Q2Q A;  1N9O A;  3IXD A;  5FI2 A;  1Z6F A;  2V0W A;  4UHU A;  1YLJ A;  2HGV A;  3LFV A;  4KG5 A;  3EGD C;  2PR5 A;  4ME4 A;  5U47 A;  1OTI A;  3Q7Z A;  2JKT M;  1JNU A;  3SH8 A;  2WAF A;  3TOI A;  2O99 A;  4R1G A;  1ESU A;  3BY9 A;  2W27 A;  1W7F A;  5M18 A;  5CHU A;  4YIN A;  4OVD A;  3ZNY A;  3B33 A;  4JF6 A;  4X55 A;  3ZVT A;  2B02 A;  3C7U A;  4YOF A;  4DJ2 A;  2J80 A;  1GSX A;  1XJ4 A;  4P6Z M;  5E43 A;  2C5W B;  5K5B A;  2OOL A;  5L09 A;  1FCN A;  4X1L A;  3BJN A;  4I3A A;  2VEA A;  1DJC A;  2P08 A;  4EW7 A;  4WL9 A;  3A0S A;  4AFI A;  3M2K A;  1BUE A;  2C6W B;  4HEF A;  2VJW A;  2QZ6 A;  4DXC A;  5KIZ A;  4BD0 A;  3BFC A;  3QNC A;  1EWZ A;  3QP6 A;  3MR0 A;  1LI9 A;  5HW3 A;  3D9Y A;  3M2J A;  1FCM A;  4NXF A;  1PW8 A;  2Y55 A;  5FQM A;  3JYI A;  4WEJ A;  3A3D A;  3D4F A;  3A3I A;  3F1N B;  3B42 A;  5I94 A;  5I5L A;  1TDG A;  2WKH A;  4EWF A;  1YLW A;  4S2N A;  4LCM A;  1L0G A;  2WUQ A;  4HES A;  4E3K A;  3VSL A;  4R70 A;  2J7V A;  2FFF B;  3MZD A;  5CGS A;  1K4E A;  3Q7V A;  3CLO A;  3G6O A;  4LFU A;  3OPP A;  2ZC3 B;  4JXG A;  4FH2 A;  2QJ7 A;  4Y13 A;  2XH9 A;  2V1B A;  4RA7 A;  4S2L A;  2HF6 A;  2PRF A;  1HD8 A;  3IWQ A;  3CHW P;  4GKU A;  1PZP A;  3DTI A;  3R7W A;  1PWD A;  4LV2 A;  4UQI S;  3C38 A;  1ALQ A;  2XSS A;  1S0W A;  2V8F A;  2JN7 A;  3N8S A;  3JPU A;  5D3O A;  4S2I A;  1IKG A;  5FI7 A;  3HUN A;  3QP5 A;  3ZG7 B;  3AGE A;  4DDS A;  1K6R A;  5F1G A;  4RX2 A;  3B3X A;  2P9V B;  5GLD A;  3N7W A;  2PU4 A;  4ETZ A;  4KZ7 A;  3G2Z A;  1PWC A;  4HIA A;  3PXP A;  2UWX A;  3MS6 A;  5AVF A;  4X56 A;  5EVI B;  5GHZ A;  4EV4 A;  5FI6 A;  2WZX A;  4JKT A;  3UE6 A;  4R4S A;  2XD1 A;  5FQQ A;  3NDG A;  2PDR A;  3PR6 A;  4KUO A;  3NHQ A;  4WM9 A;  3T4Q A;  3K2N A;  2JKG A;  4ZTK A;  2HJE A;  2ZOI A;  3QNB A;  1TS7 A;  2AVX A;  4U0T A;  4C6Y A;  1A0K A;  4MN5 A;  3ZFZ A;  4N9K A;  2XA7 S;  3GTC A;  5DF8 A;  5CGW A;  4QU3 A;  1BSG A;  1YKD A;  3HL9 A;  3GSG A;  1KGF A;  5HSQ A;  4KZB A;  4I3I A;  3OBF A;  3E4P A;  3MFX A;  1G68 A;  1K57 A;  2VX8 A;  1GSV A;  4Y0O A;  1XX2 A;  1MWR A;  1H8Y A;  4JXV A;  1K6S A;  2K31 A;  4LV0 A;  4OP5 A;  3IF6 A;  1P9W A;  2QKP A;  5HZH A;  3IS2 A;  1MKM A;  4H6J B;  4S2J A;  4CPK A;  4WYY A;  2Y91 A;  4NEE D;  1CJF A;  1NY0 A;  1SHV A;  3O88 A;  4KZ6 A;  1RCJ A;  1JWV A;  1MC0 A;  4JF5 A;  5HFO A;  5DF9 A;  3CI6 A;  4P0M A;  3FPW A;  4KZ4 A;  3MJQ A;  3G30 A;  2V9A A;  2ZOH A;  5DVA A;  2XRN A;  4IVI A;  4CLC A;  3F1O A;  2Y2G A;  2ZD8 A;  4OKP A;  1SZV A;  3FPV A;  4PMA A;  3Q1F A;  4N9L A;  1K54 C;  5HAP A;  3T4T A;  1XFN A;  3T1S A;  4KQR A;  3C4O A;  1N9B A;  4HQA A;  4PM7 A;  4WZ5 C;  5CTN A;  1PI5 A;  1SKO B;  3BLS A;  4HBU A;  3N8L A;  3BLM A;  4JGQ A;  5G18 A;  5EM1 A;  1YAX A;  2J3T D;  3N8R A;  1TS6 A;  2O0Y A;  4HY8 A;  3EGX C;  1N9L A;  1GHP A;  4R0Q A;  2KDK A;  1W63 Q;  3H7W A;  1EI5 A;  1FQG A;  2Y8H A;  2A3U A;  3DWK A;  2X01 A;  3CUE A;  5EM0 A;  2JCH A;  3ITB A;  2P7J A;  3UDX A;  1S66 L;  2DMW A;  4ZJ1 A;  4D60 A;  3KYE A;  4F94 A;  5FAP A;  1BTL A;  4XT2 A;  4NK3 A;  4Q0I A;  1YQS A;  2Q9N A;  2WKQ A;  3VOL A;  2PD7 A;  3C2W A;  1NRJ A;  4KZ3 A;  5IU1 A;  1LHY A;  2Y2N A;  4Q0J A;  2EXB A;  3TW8 A;  4EUV A;  3ITA A;  4QY6 A;  1KE3 A;  3T1X A;  3ZHH A;  4RQ9 A;  2XEP A;  5CHM A;  2Z6C A;  3NCK A;  3WS5 A;  3CPT B;  3MF0 A;  2IWB A;  4U0X A;  4BLM A;  3LO7 A;  4EBN A;  5HWT A;  3V39 A;  3TRC A;  1S67 L;  2L4R A;  2Y79 A;  5FQI A;  5MC7 A;  5AQ9 A;  4U3T A;  5HAQ A;  1FIL A;  4G3K A;  1M6K A;  3MQO A;  3CUE C;  4DE0 A;  4FD8 A;  4FUW A;  1CI8 A;  2XQZ A;  2EX2 A;  4UA6 A;  1ERO A;  2PD8 A;  1HZO A;  1T1B A;  3SS3 A;  3KSG A;  1FR1 A;  3UNW A;  2CC1 A;  3G31 A;  3H9W A;  3O86 A;  5GLA A;  4UA9 A;  4GDN A;  5AQB A;  3BQ8 A;  1S1Y A;  1TEM A;  1PRQ A;  4HH2 A;  1OT6 A;  3ZVW A;  4JPM A;  4R3A A;  2ZL1 A;  5J8X A;  1YLT A;  2YKF A;  3GRJ A;  3DWZ A;  1RP5 A;  3C30 A;  1OTB A; 
#chains in the Genus database with same CATH homology
 4IVK A;  1BZA A;  4YIN A;  1ONH A;  4ZJ2 A;  2HDQ A;  2Y4A A;  3O3V A;  4OVD A;  3ZNY A;  4IBX A;  2ZLY A;  4DRT A;  2HDS A;  2DNS A;  4JF6 A;  4X55 A;  3ZVT A;  1YM1 A;  2XGN A;  5FAO A;  3C7U A;  4OP8 A;  4OPQ A;  5E43 A;  5GLB A;  3WRT A;  2C5W B;  5FDH A;  1E4D A;  1PI4 A;  1TVF A;  4E3O A;  5JYO A;  3OPH A;  1ONG A;  4OOY A;  5CED A;  3PBR A;  3V5M A;  2Y2K A;  4X68 A;  1FCN A;  4UA7 A;  3VP1 A;  4S2N C;  4LV3 A;  4LCL A;  2IWD A;  1VQQ A;  1DJC A;  1ES4 A;  5GHY A;  1LLB A;  3MXS A;  4QJG A;  1FSW A;  5EEC A;  3DTM A;  4MLL A;  3M2K A;  1BUE A;  4BJP A;  2C6W B;  1WE4 A;  1MWU A;  4E3M A;  3N6I A;  4HEF A;  3TG9 A;  3ZG9 B;  2PBY A;  2QZ6 A;  4DXC A;  4BD0 A;  1PZO A;  3BFC A;  5CHJ A;  1BUL A;  3OPL A;  3QNC A;  4GDB A;  2EX8 A;  3G2Y A;  1EWZ A;  4EUZ A;  3NY4 A;  3S1Y A;  3ZG8 B;  5FQ9 A;  4GNU A;  1YLZ A;  1RGZ A;  5E2G A;  4KEN B;  2V20 A;  2WAE A;  1BLS A;  1LI9 A;  2PU2 A;  3SS5 A;  1YMX A;  5HW3 A;  4X69 A;  3ZDJ A;  1SCW A;  4K0X A;  2FFY A;  5EVL A;  2XDM A;  1XGI A;  3M2J A;  1FCM A;  1NZO A;  1HVB A;  1PW8 A;  2Y2I A;  2Y55 A;  1O07 A;  4MBF A;  3A3F A;  4OH0 A;  5FQM A;  3JYI A;  3UO9 A;  4WEJ A;  3A3D A;  3D4F A;  3A3I A;  1E3U A;  5I94 A;  2ZM8 A;  3HBR A;  5CTM A;  2QPN A;  2I72 A;  5E2F A;  1YLP A;  3UDI A;  1TDG A;  4OPY A;  1N4O A;  2HDR A;  2WKH A;  4K91 A;  3RXX A;  1JWP A;  3VOZ A;  4EWF A;  3NI9 A;  4MNR A;  1YLW A;  3A3J A;  4LCM A;  4S2N A;  1L0G A;  5CEB A;  3VMA A;  2WUQ A;  4HES A;  2XFS A;  4E3K A;  4S2K A;  3VP2 A;  1H5X A;  3VSL A;  3UPP A;  4KZ8 A;  2J7V A;  5M19 A;  3MBZ A;  5A90 A;  2FFF B;  1KDW A;  3MZD A;  1QMF A;  3HLC A;  4JXW A;  5CGS A;  1IEM A;  2WKE A;  1GHM A;  1K4E A;  3GR2 A;  2ZC6 B;  4OLD A;  2B5R A;  3Q7V A;  2Y2M A;  3UN7 A;  5KMW A;  1I2S A;  1W79 A;  5M1A A;  5EPH A;  4DDY A;  5CER A;  5TR7 A;  3OPP A;  2ZC3 B;  4JXG A;  5DF7 A;  4FH2 A;  1YMS A;  2ZM0 A;  3LY4 A;  2XH9 A;  4EQI A;  5HX9 A;  4R3B A;  2XK1 A;  4RA7 A;  4S2L A;  4R3J A;  3I7J A;  4XUZ A;  3VFH A;  2OLV A;  3CMZ A;  1XP4 A;  3FYZ A;  1HD8 A;  3PAE A;  5E2H A;  5EOO A;  3IWQ A;  4R23 A;  4R4R A;  4GKU A;  4JBF A;  1PZP A;  3C4P A;  4Q8I A;  3UPO A;  1KDS A;  1PWD A;  4LV2 A;  3MKF A;  1G6A A;  4DF6 A;  4PM5 A;  1ALQ A;  1S0W A;  5A92 A;  4OQH A;  1JWZ A;  3IHA A;  3N8S A;  1K55 C;  4L0L A;  3BM6 A;  4P87 A;  4E6W A;  5D3O A;  4S2I A;  3ZNT A;  2ZQD A;  1IKG A;  3PBQ A;  3PBT A;  3SH9 A;  4OQG A;  1I5Q A;  4Y0U A;  4H8R A;  4DXB A;  4KZ9 A;  4BD1 A;  3FKW A;  3GVB A;  4DE3 A;  5E2E A;  2H10 A;  3FKV A;  5FI7 A;  3HUN A;  1H8Z A;  1MWS A;  3WWX A;  3ZG7 B;  1SKF A;  1HTZ A;  1IKI A;  1KGE A;  1K56 D;  1K6R A;  1S6R A;  3AGE A;  5F1G A;  4DDS A;  4RX2 A;  5FQK A;  3B3X A;  2P9V B;  3NBL A;  3N7W A;  5GLD A;  3V3R A;  2PU4 A;  3IF5 A;  4KZ7 A;  2VGJ A;  3IT9 A;  3G2Z A;  3HVF A;  1PWC A;  2UWX A;  3LEZ A;  1JTD A;  4X56 A;  5EVI B;  5GHZ A;  4BL3 A;  4EV4 A;  5FI6 A;  4OQI A;  1K4F A;  2WZX A;  1W5D A;  4JKT A;  3AGF A;  3HLB A;  3Q07 A;  1YLY A;  4FCF A;  4KG6 A;  1I2W A;  4R4S A;  5GHX A;  3UE0 A;  2XD1 A;  3A3E A;  5FQQ A;  1K57 C;  4E6X A;  4OLG A;  3IH8 A;  4HBT A;  3VOY A;  3Q81 A;  3W4Q A;  3VP0 A;  3NDG A;  2GDN A;  3GQZ A;  1XPB A;  2WGI A;  1K55 A;  3GMW A;  3IF6 C;  3IWO A;  3SS4 A;  3BEB A;  4WM9 A;  2XD5 A;  2EX6 A;  2IWC A;  3WS4 A;  4ZTK A;  2Y2L A;  3E2L A;  3QNB A;  3UDF A;  3BFG A;  4P6B A;  1NYM A;  1DY6 A;  2OV5 A;  4MBH A;  4U0T A;  2X02 A;  1LL9 A;  4C6Y A;  3ZFZ A;  3OCN A;  4EBL A;  3EQV A;  1BT5 A;  5FSR A;  4N9K A;  1MY8 A;  3GTC A;  2VGK A;  3P98 A;  1ES2 A;  3TSG A;  2Y2H A;  4FH4 A;  5DF8 A;  1XA1 A;  5CGW A;  4QU3 A;  1BSG A;  1PYY A;  2Y59 A;  3OPR A;  3HL9 A;  3GSG A;  4KG2 A;  1KGF A;  1ES5 A;  1SDE A;  4E3L A;  4N1H A;  4KZB A;  5FQJ A;  3VSK A;  4CJN A;  1ZKJ A;  3FV7 A;  5CXW A;  1FR6 A;  1XGJ A;  4M3K A;  1SDN A;  1WYB A;  2WZZ A;  1BLC A;  4PM8 A;  5HL1 A;  1G68 A;  2Y2Q A;  1K56 A;  3LY3 A;  3M6H A;  4DE2 A;  2ZC5 B;  1K57 A;  1FSY A;  2ZQ8 A;  3G35 A;  4GZB A;  4KZA A;  4WEL A;  4A5R A;  4OQ0 A;  4Y0O A;  1XX2 A;  3ZCZ A;  1MWR A;  4MBK A;  5GLC A;  2ZJ9 A;  1H8Y A;  5TGF A;  4JXV A;  1ZG6 A;  1K6S A;  4PPR A;  4LV0 A;  1M40 A;  2Y2J A;  3O87 A;  4JLF A;  3IF6 A;  4OP5 A;  4S2O A;  3ZGA B;  1JTG A;  5KZH A;  2Y2P A;  4MEZ A;  4JXS A;  2V1Z A;  1PIO A;  4S2J A;  4LV1 A;  1DJB A;  4RVA A;  4WMC D;  4WYY A;  4XXR A;  1ESI A;  2Y91 A;  3PBN A;  5F83 A;  4CPK A;  1W8Q A;  1NY0 A;  4BEN A;  2H5S A;  1SHV A;  3O88 A;  4KZ6 A;  1RCJ A;  3BFE A;  5A93 A;  3CZD A;  1C3B A;  1CEF A;  1ZC2 A;  1KVM A;  1JWV A;  2ZQA A;  4JF5 A;  4RYE A;  2HPB A;  5HFO A;  1JVJ A;  3NC8 A;  5DF9 A;  4P0M A;  1OME A;  4GD8 A;  4ID4 A;  1QME A;  4KZ4 A;  5BOH A;  3G30 A;  2JC7 A;  1E25 A;  4Y7P A;  3Q7V B;  5DVA A;  3FWL A;  4LEN A;  4ZBE A;  3RJU A;  3HUO A;  2XF3 A;  4IVI A;  3EQU A;  4Z9Q A;  3IQA A;  2XFT A;  3C5A A;  2Y2G A;  4K0W A;  4JF4 A;  4GB7 A;  5FAS A;  1BLP A;  2ZD8 A;  3MZF A;  4OKP A;  2A49 A;  2WK0 A;  3IWI A;  3VP4 A;  2Z2M B;  2H0T A;  2J9P A;  4PMA A;  2X71 A;  2RL3 A;  3UE3 A;  3FZC A;  2DCF A;  3ISG A;  3Q1F A;  4PM9 A;  5JYP A;  5DTK A;  3G34 A;  1CK3 A;  1MWT A;  4N9L A;  4RX3 A;  1K54 C;  3DW0 A;  5HAP A;  1KE4 A;  3HLG A;  5F1F A;  3BYD A;  3OC2 A;  1K25 A;  2EFX A;  5DTT A;  1GHI A;  3Q82 A;  3C4O A;  4KQR A;  1N9B A;  4NET A;  4E3J A;  4PM7 A;  4WZ5 C;  5F82 A;  3RXW A;  5CTN A;  1CI9 A;  2H0Y A;  2OLU A;  1PI5 A;  2ZMA A;  3HLD A;  2WGW B;  1LL5 A;  1ERQ A;  3BLS A;  4HBU A;  1L0E A;  3N8L A;  5EUA A;  4GOG A;  3BLM A;  5EOE A;  3W4O A;  3UY6 A;  3CG5 A;  5G18 A;  1NZU A;  3WS1 A;  1XXM A;  3V50 A;  3WS2 A;  2EXA A;  5A91 A;  3LCE A;  1FCO A;  3E2K A;  3N8R A;  1CEG A;  3PBO A;  2Y2O A;  4KQO A;  4BL2 A;  1GHP A;  2ZQ9 A;  4R0Q A;  3NDE A;  3MXR A;  3SH7 A;  4WMC A;  3VP3 A;  5AQA A;  5CRF A;  5L2F A;  3ZG5 A;  3W4P A;  1YT4 A;  1EI5 A;  1FQG A;  1MKI A;  1XA7 A;  4DE1 A;  4BQM A;  2OSU A;  3MFD A;  2A3U A;  2WGV A;  3DWK A;  4IED A;  3S4X A;  4E3I A;  2HP9 A;  2ZQC A;  4S2P A;  2X01 A;  2BG1 A;  5KSH A;  1MXO A;  1IYS A;  4P85 A;  2RCX A;  3G4P A;  1FOF A;  3WRZ A;  2JCH A;  2QMI A;  3ITB A;  4D2O A;  2J8Y A;  2P74 A;  3UDX A;  4OPR A;  1K54 A;  1LI0 A;  4WEK A;  4ZAM A;  4WBG A;  2Q9M A;  3W8K A;  5DTS A;  2ZC7 A;  4DKI A;  1U60 A;  5FA7 A;  3OZH A;  4ZJ1 A;  3SOI A;  5TFQ A;  2G2W A;  3P09 A;  1VM1 A;  4WZ5 A;  4FSF A;  2WYX A;  1L2S A;  4F94 A;  3WS0 A;  1KE0 A;  1NRF A;  3S22 A;  5FAP A;  2JBF A;  1BTL A;  1O7E A;  2DRW A;  4NK3 A;  1IYQ A;  1YQS A;  2Q9N A;  4X53 A;  1BLH A;  3NIA A;  1DJA A;  3PTE A;  2G2U A;  5CGX A;  3MKE A;  5FAT A;  3GV9 A;  1W8Y A;  4GN2 A;  5HAI A;  2XLN A;  4ZJ3 A;  3OCL A;  1TDL A;  3BRM A;  2JE5 A;  1NYY A;  1GA0 A;  4KZ3 A;  1AXB A;  1KVL A;  1WYC A;  1IYO A;  1LHY A;  2ZM2 A;  3HLF A;  5EVI D;  4C3Q A;  1K38 A;  2Y2N A;  1RGY A;  1GCE A;  3BFF A;  3PBS A;  3IXH A;  2EFU A;  5EE8 A;  1Y54 A;  4E3N A;  2HP6 A;  2EXB A;  4GD6 A;  1MPL A;  5KSC A;  3ZG0 A;  1MBL A;  1ERM A;  3M6B A;  5IHV A;  2BLS A;  5AQ7 A;  4Y0T A;  5HAR A;  2ZC4 B;  3ITA A;  4QY6 A;  1KE3 A;  3UPN A;  4KQQ A;  4C75 A;  3AGD A;  3ZHH A;  2J9O A;  2WKI A;  1PW1 A;  3IH9 A;  2XEP A;  3IF6 B;  5CHM A;  5EVI C;  3C7V A;  3NCK A;  3BFD A;  3PAG A;  4YFM A;  3V3S A;  3WS5 A;  1GA9 A;  4U0X A;  2IWB A;  4BLM A;  3LO7 A;  4EBN A;  3QHY A;  3IHB A;  4N92 A;  1IEL A;  2Z2L B;  2HDU A;  3V39 A;  3N4I A;  5FQI A;  4EBP A;  4B88 A;  1J9M A;  5GL9 A;  3CJM A;  4X6T A;  5AQ9 A;  4U3T A;  4B4Z A;  2R9X A;  1KGG A;  2EX9 A;  5HAQ A;  4B4X A;  4WZ4 A;  1M6K A;  2V2F F;  4O7D A;  4PM6 A;  4OPZ A;  4XUX A;  4OON A;  1XKZ A;  4DE0 A;  4UAA A;  4OOL A;  3IXG A;  4QB8 A;  4FD8 A;  4QD4 A;  3HLE A;  1CI8 A;  2XQZ A;  3G32 A;  4ZDX A;  3HLW A;  2XR0 A;  2EX2 A;  3HUM A;  4UA6 A;  1ERO A;  1PWG A;  1NJ4 A;  4KZ5 A;  1L0D A;  1HZO A;  2R9W A;  4QY5 A;  3SS3 A;  1L0F A;  1FR1 A;  1Q2P A;  3UNW A;  4IBR A;  3VFF A;  1ZG4 A;  2E8I A;  2WAD A;  1Q2Q A;  2P9V A;  2CC1 A;  3IXD A;  4S2M A;  3G31 A;  2ZQ7 A;  3O86 A;  1Z6F A;  4UHU A;  5FI2 A;  5GLA A;  4UA9 A;  1IYP A;  4N1X A;  4GDN A;  5AQB A;  3MZE A;  1YLJ A;  2WGW A;  5FAQ A;  4KG5 A;  1TEM A;  3BEC A;  5U47 A;  5EVI A;  3Q7Z A;  5CEC A;  3SH8 A;  3ZVW A;  4JPM A;  3HRE A;  1E3U D;  4OOM A;  2WAF A;  3TOI A;  1YLT A;  3UE1 A;  5J8X A;  4R1G A;  4QHC A;  1ES3 A;  1ESU A;  3GRJ A;  3DWZ A;  3IXB A;  1RP5 A;  1W7F A;  2HP5 A;  5M18 A;  1NXY A;  5CHU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...