5GHXA

Crystal structure of beta-lactamase penp mutant-e166h
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
257
structure length
257
Chain Sequence
DFAKLEEQFDAKLGIFALDTGTNRTVAYRPDERFAFASTIKALTVGVLLQQKSIEDLNQRITYTRDDLVNYNPITEKHVDTGMTLKELADASLRYSDNAAQNLILKQIGGPESLKKELRKIGDEVTNPERFHPELNEVNPGETQDTSTARALVTSLRAFALEDKLPSEKRELLIDWMKRNTTGDALIRAGVPDGWEVADKTGAASYGTRNDIAIIWPPKGDPVVLAVLSSRDKKDAKYDDKLIAEATKVVMKALNMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Crystallographic Snapshots of Class A beta-Lactamase Catalysis Reveal Structural Changes That Facilitate beta-Lactam Hydrolysis
pubmed doi rcsb
source organism Bacillus licheniformis
molecule tags Hydrolase
total genus 90
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2016-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5ghxA00
3W4OA 2JE5A 1KGGA 1MKIA 1SCWA 1BTLA 4JF6A 3C4PA 4F94A 4QHCA 1IKGA 4K0XA 3B3XA 3N4IA 1WYBA 3WS5A 2WADA 4OLDA 2H10A 1FOFA 1TVFA 2VGJA 3WS0A 3UY6A 3FV7A 2I72A 4OPQA 5CHUA 2XR0A 1K55A 1W8QA 2HDQA 3BLSA 1XA1A 5EVID 5DVAA 2WGVA 5CGWA 4KZ5A 3IT9A 1FCNA 1KGFA 3TG9A 3PBOA 4X55A 4C75A 1CK3A 1NY0A 3Q7ZA 5FI2A 1K4FA 3HLWA 3ZGAB 5KZHA 1ONHA 3D4FA 2Y2HA 5GLDA 2WKIA 4RA7A 1IYQA 4E3NA 1MBLA 4C6YA 2ZC3B 4QY6A 1H8YA 3P98A 2WK0A 2WUQA 2XFTA 2ZD8A 2ZJ9A 3HREA 3GR2A 2RCXA 5D3OA 4KG6A 5EVIC 1YLJA 3Q82A 4P6BA 1MWUA 5FDHA 4BENA 3UE1A 4S2IA 3P09A 2R9WA 2WKHA 5FQKA 1DY6A 3C7UA 3HUNA 4KZ6A 5FQJA 3VP2A 3IF6B 5HAIA 5AQBA 2WGWB 1ERMA 1MY8A 4E6XA 3BFGA 3HLGA 3ZG9B 4PMAA 1H5XA 3Q7VB 1FCMA 3UDFA 1KE0A 3TOIA 4ZDXA 1L2SA 1FR1A 1GHIA 4S2NA 2Q9MA 4WZ4A 1EI5A 3IXGA 2A3UA 4KZ4A 5JYPA 3CZDA 2HDRA 4OP5A 3CG5A 3NDEA 2Y2MA 2A49A 2WKEA 4RX2A 1K4EA 1Z6FA 5U47A 3FYZA 4X68A 3IXBA 2QMIA 2ZQAA 4NETA 3GVBA 3GMWA 1ES5A 1GCEA 4WEJA 3OPRA 3IXDA 1BULA 1ZG6A 3ITAA 5DTTA 2C5WB 1ES4A 1CI9A 3UNWA 1ERQA 2XD1A 3UE0A 2ZC4B 2XEPA 4MNRA 1QMEA 4QB8A 1KGEA 2XFSA 3VP3A 3BRMA 1ZC2A 3NC8A 4JXGA 1S6RA 5DTSA 4KG2A 3ITBA 4S2JA 5FQ9A 3WWXA 5FATA 1JTDA 3RXXA 4N1XA 4X56A 2EFUA 3FKWA 4P87A 1MXOA 3IWIA 5E2GA 1K54A 2XLNA 1VM1A 2Z2MB 4DDSA 1YLPA 4DDYA 3PBRA 4OQIA 4DE1A 1RGZA 4N92A 2XGNA 3PBQA 5GLCA 1LLBA 4R3JA 3RXWA 2IWCA 2G2WA 5DTKA 2G2UA 4P0MA 2CC1A 1IKIA 1Y54A 4KZ7A 2GDNA 1JTGA 1FSYA 3N7WA 3O86A 4GOGA 3NIAA 3IH9A 4R4RA 2Y2PA 1ZG4A 4OVDA 1DJCA 2Y2GA 2DNSA 1YMXA 4KZ8A 5CRFA 4QY5A 3M6HA 3LY4A 4OPYA 5TFQA 2XDMA 3BFFA 3G31A 5M18A 2P9VA 4KZ3A 2J9PA 3AGFA 3IF5A 1PW8A 3HUOA 1KVLA 1KDWA 1YT4A 4PM7A 3SS3A 1FCOA 4FH4A 2UWXA 4U3TA 1S0WA 1ONGA 3MKEA 3HL9A 4L0LA 4WZ5A 4C3QA 1JWPA 2XQZA 5EVLA 5FQIA 3MXSA 4Y7PA 2JCHA 4N1HA 5IHVA 3MZFA 3SH8A 4HBTA 2WGIA 5F1GA 4GB7A 4OOLA 2HP5A 5CTNA 3WS4A 5EUAA 3SH9A 1XXMA 5FAOA 4KQQA 2Y2NA 1GHPA 1HVBA 1Q2PA 5A90A 2E8IA 4IEDA 2ZC6B 4E3OA 3LY3A 1PW1A 2PBYA 1E3UA 5TGFA 4S2KA 5E2HA 4XUZA 3EQUA 2B5RA 2DRWA 3IHBA 4Z9QA 4E3IA 4IBRA 4X69A 3A3EA 1RGYA 2R9XA 4FSFA 4N9LA 4XUXA 3BECA 2P74A 4NK3A 4E6WA 1YLYA 5EOOA 4ZJ1A 3OZHA 3G30A 3Q81A 3W8KA 1E4DA 3Q1FA 4GDBA 2ZQ8A 4S2NC 4LCMA 4OOMA 4EBLA 3HLEA 1XA7A 2WAFA 3QHYA 1XKZA 2Y4AA 4P85A 1E25A 4OKPA 3SH7A 2OLVA 2JBFA 1SKFA 4LV2A 4OPZA 5FAQA 3BM6A 5EVIB 2J9OA 1K56A 5FASA 2OV5A 1YLTA 1H8ZA 3PBSA 3A3JA 2EX2A 2X71A 4DKIA 4HEFA 5HFOA 4DXBA 1HZOA 4OQGA 4WELA 3WRTA 5E2EA 4R0QA 2HP6A 5CGXA 5EECA 4R3BA 3MZEA 1ALQA 1I2SA 3OCLA 4MEZA 1Q2QA 2XF3A 4KQOA 1YQSA 3VMAA 3V50A 5EPHA 2WZZA 2Q9NA 4KZAA 4E3JA 3O88A 1PZPA 4OP8A 5DF8A 5BOHA 3E2LA 5DF9A 2JC7A 1BZAA 3ZG7B 1W5DA 1ES2A 1K54C 1PZOA 5E2FA 4ZJ3A 3V3SA 5KSCA 5HARA 1I5QA 2Y2LA 1N4OA 5TR7A 4EWFA 4WYYA 4KQRA 4PM5A 4CJNA 4GNUA 3MKFA 5GLAA 1KE3A 4HBUA 4GD8A 1K57C 1XP4A 3W4PA 5F83A 1DJBA 2DCFA 4LV1A 2ZQ7A 1XX2A 1L0DA 4FH2A 3PBTA 3VP0A 1XGJA 1WE4A 4LCLA 4DE2A 3M6BA 2XD5A 3HLDA 4E3KA 4BD1A 1YLZA 4RX3A 1SDEA 4BD0A 1RCJA 3LO7A 5CHJA 3IXHA 3BLMA 5CHMA 1SHVA 1J9MA 4UA6A 1NJ4A 1DJAA 3G2YA 3O3VA 5EOEA 5HAQA 5JYOA 5AQ9A 1E3UD 3BYDA 2EFXA 4UHUA 4XXRA 3E2KA 3GSGA 3FZCA 4WZ5C 4Y0OA 3UE3A 4BL3A 2Y2IA 1NZOA 3ZCZA 4A5RA 4Q8IA 3UDIA 1L0GA 3DW0A 3S1YA 4EBNA 2QZ6A 1IYOA 3ZG5A 4Y0TA 1BUEA 1MWSA 4UA9A 2FFYA 4WMCA 1PWDA 5DF7A 1N9BA 4KZBA 4B4ZA 5HX9A 4S2LA 4ZBEA 1JVJA 5CTMA 4MBFA 5KSHA 3A3IA 1I2WA 1K25A 3MZDA 2IWBA 1PWGA 1NRFA 1K56D 2QPNA 2WYXA 3C7VA 1ES3A 3N8SA 3DTMA 3NDGA 2Y2OA 1K55C 3BFEA 3A3FA 3N8RA 3IF6A 2WGWA 1YLWA 2C6WB 2HPBA 2ZM2A 2V1ZA 3NCKA 5GHXA 2RL3A 3Q7VA 1FQGA 2J7VA 4U0XA 2WZXA 3OC2A 5FI7A 4GDNA 3WS2A 2EX6A 2PU4A 1XGIA 1U60A 1BT5A 4JXSA 3HLBA 1YM1A 3VOZA 4OQHA 5GHZA 4YINA 3IWQA 4BL2A 3GQZA 4GN2A 2XH9A 3VOYA 3ZDJA 3ZFZA 3VSLA 2H5SA 4DE0A 4QD4A 4BQMA 3UDXA 4Y0UA 5L2FA 3Q07A 2ZC5B 5CECA 3AGDA 1FSWA 1CEGA 1EROA 3G35A 3CMZA 4PM6A 4OPRA 1BLPA 3LCEA 3RJUA 4DRTA 3PAGA 1PI4A 2WAEA 4ZTKA 5M19A 1LL9A 3G32A 1C3BA 3VSKA 4JF4A 2ZLYA 2BG1A 3NBLA 4UA7A 3V3RA 3DWKA 4GKUA 4EUZA 3N8LA 3TSGA 3UPOA 3PBNA 2Y2JA 3EQVA 3WS1A 4K0WA 3SOIA 1ESUA 2ZC7A 4E3LA 4LV3A 3G2ZA 4BLMA 3DWZA 3ZHHA 4LV0A 2ZM8A 5GHYA 4R23A 3SS4A 4LENA 1PIOA 5FI6A 4R1GA 2Y55A 4ZJ2A 2Y2KA 5CEBA 5F1FA 1HTZA 3HLCA 3PAEA 1LHYA 2Y59A 4JPMA 4S2MA 4WMCD 3UPNA 1KE4A 2ZMAA 3G4PA 4IVIA 1LI0A 1MPLA 2X01A 1W8YA 4R4SA 4PM9A 5A91A 5HW3A 3M2KA 1SDNA 5CEDA 1K38A 4S2PA 3GV9A 3W4QA 1IYPA 4OQ0A 3UPPA 4FCFA 4OH0A 4JF5A 4ID4A 4PPRA 3ZVWA 1L0EA 4PM8A 5A92A 5GLBA 3HUMA 3HBRA 4U0TA 3OPHA 2HP9A 5KMWA 5J8XA 4D2OA 3V5MA 1PWCA 1K6RA 3O87A 3FKVA 3S4XA 4X6TA 1FR6A 4ZAMA 1LI9A 1BLCA 1PI5A 3IQAA 4S2OA 5EE8A 1RP5A 1VQQA 2ZQ9A 5AQ7A 2BLSA 3M2JA 3IH8A 3MBZA 1ESIA 1ZKJA 3MFDA 5CGSA 4CPKA 2P9VB 1CI8A 1AXBA 3ZNYA 3C5AA 4RYEA 5F82A 1W7FA 2HDSA 3IF6C 3CJMA 2V2FF 5E43A 2ZQCA 3AGEA 3GTCA 3PTEA 4M3KA 1LL5A 1O7EA 1G6AA 2EX8A 5G18A 1GA9A 1TDGA 4QJGA 3UN7A 1KVMA 4E3MA 1EWZA 3VFHA 4DXCA 1IEMA 1JWVA 3C4OA 1MWRA 4H8RA 4IBXA 4JXVA 4N9KA 4OOYA 3VP4A 3ZG8B 4RVAA 1QMFA 3A3DA 4WM9A 4EQIA 3QNCA 4DF6A 2OSUA 3I7JA 1PYYA 4KG5A 3JYIA 4EV4A 3BEBA 4WBGA 4GD6A 4KZ9A 5EVIA 4K91A 5FQMA 3HLFA 3NI9A 5AQAA 3QNBA 4JBFA 4MBHA 1NZUA 5HAPA 4B88A 4IVKA 5FQQA 1G68A 1WYCA 2EXBA 3ZG0A 3IWOA 3NY4A 4OLGA 3V39A 4OONA 1CEFA 1L0FA 3VP1A 2XK1A 4JKTA 4YFMA 2HDUA 3OCNA 3ISGA 1HD8A 5FSRA 1M40A 3VFFA 3IHAA 2PU2A 1BSGA 3ZNTA 1NXYA 3BFCA 4KENB 1K57A 1JWZA 1OMEA 1TEMA 1NYMA 4FD8A 3OPPA 4GZBA 5A93A 4O7DA 2EXAA 1O07A 2OLUA 3BFDA 3ZVTA 4MLLA 5CERA 1IYSA 3GRJA 1BLHA 3LEZA 5I94A 1GHMA 3MXRA 3OPLA 5FA7A 2H0YA 2ZQDA 2H0TA 3HVFA 5CXWA 1XPBA 2Y91A 1K6SA 4DE3A 4BJPA 3N6IA 2FFFB 3UO9A 5HL1A 2Z2LB 2J8YA 2Y2QA 2EX9A 2V20A 4JXWA 1BLSA 1MWTA 1NYYA 2IWDA 4X53A 4B4XA 1TDLA 3SS5A 4JLFA 5M1AA 2X02A 5GL9A 1IELA 1KDSA 4UAAA 2VGKA 5FAPA 1GA0A 3FWLA 3WRZA 1YMSA 4WEKA 1M6KA 3G34A 2ZM0A 4HESA 4EBPA 4MBKA 1W79A 4QU3A 3S22A
chains in the Genus database with same CATH superfamily
1BTLA 4JF6A 3C4PA 1IKGA 1Y28A 3B3XA 3WS5A 1WYBA 2WADA 1FOFA 1TVFA 2VGJA 3WS0A 1KOUA 4ME4A 3BLSA 3PR6A 1XA1A 2WGVA 1G5UA 3PBOA 2O99A 3Q7ZA 5FI2A 3CHWP 3HLWA 3ZGAB 4RA7A 1IYQA 4C6YA 1OT9A 4QY6A 1H8YA 1Z09A 3P98A 3F1PB 4PHTA 2B18A 2VV6A 2RCXA 3TE8A 2LB5A 2J80A 2QYBA 2R9WA 3HUNA 4KZ6A 5FQJA 4E6XA 3BFGA 1H5XA 3TOIA 4ZDXA 1FR1A 4NEED 3A0VA 2NUPC 5JYPA 4I5SA 3CZDA 4Y3IA 1MKMA 4HNBA 5U47A 4X68A 2ZQAA 2M7UA 4WEJA 2W3HA 1ERQA 1YKDA 1QMEA 4JXGA 4O01A 2J3TC 1F5MA 3RXXA 4EETB 3MMHA 4WLAA 2Q0OA 1K54A 2Z2MB 3F1NA 3V67A 4DE1A 4N92A 1LLBA 4IUKA 3RXWA 2IWCA 2G2WA 1IKIA 1Y54A 2GDNA 1FSYA 3O86A 4O0PA 1T19A 1YPRA 4OVDA 2FH5A 1S4RA 2Y2GA 5F6AA 5CRFA 2XDMA 3HUOA 3SZTA 4EUVA 4NXEA 1LL8A 2UWXA 1ONGA 2PDRA 5IHVA 5CTNA 3T4TA 2QHKA 3BQ8A 4KQQA 4LRXC 1PW1A 2PBYA 3VE3A 4XUZA 4Z9QA 2DRWA 4X69A 2PD8A 4NG2A 4BWIA 2PYPA 4NK3A 2P74A 4E6WA 3L7HA 3OZHA 3Q1FA 4S2NC 1XA7A 1V9YA 3SH7A 2JBFA 1SKFA 4DN0A 3BM6A 3U2AA 1K56A 2AVXA 1YLTA 2JKFA 1H8ZA 3PBSA 3A3JA 1HZOA 4WELA 4GHIB 4XT2B 5E2EA 5CGXA 3MZEA 1ALQA 1I2SA 2KLIA 1H8MA 2Q9NA 3O88A 4OP8A 5BOHA 1STZA 3E2LA 4ZJ3A 5HWVA 3BW6A 3V3SA 5TBMA 4ESPA 4PM5A 4CJNA 4GNUA 1XFQA 3W4PA 1DJBA 2PYRA 2ZQ7A 3NOPC 1OTAA 5HWWA 3A0SA 4Y17A 2XD5A 3HLDA 3T1SA 1SHVA 4GCZA 3BYDA 2HV1A 4XXRA 4Y0OA 1NZOA 3JVVA 3NHQA 2W3FA 4CLCE 3P01A 3R7WB 3DW0A 2QZ6A 3T4OA 4WUJA 3T1XA 1BUEA 4WMCA 3F1PA 3BY9A 5HX9A 1JVJA 1V9ZA 5KSHA 1I2WA 1K25A 2IWBA 2V1BA 1NRFA 4WN5A 3C7VA 4EXOA 3DTMA 3A3FA 3ZYTA 1YLWA 2JKTI 3C8CA 4Z1WA 2RL3A 4G3KA 1FQGA 5FI7A 3KSGA 4GDNA 5F5YA 2V8FA 1U60A 4BL2A 3GQZA 4CQHA 4B93A 2QJ5A 4BQMA 5L2FA 3Q07A 3AGDA 1FSWA 3ZG0A 3LCEA 2V1AA 1PI4A 1NLYA 3VSKA 2Z6DA 2V9AA 2J3WA 4GKUA 3UPOA 1YSPA 3VOLA 2GJ3A 2HGVA 5FDSA 4LRYC 1D7EA 2ZBBA 4PKYA 3IBJA 4LV0A 4ZJ2A 2Y55A 5CEBA 3BJNA 1LHYA 3UPNA 5IU1A 4S2MA 3RTYA 3G4PA 4KUOA 1XJ6A 5HW3A 2HJ9C 1K38A 4FCFA 3ZVWA 4PM8A 3HUMA 3OPHA 4D2OA 3FKVA 2V0WA 3S4XA 1BLCA 1PI5A 3IH8A 3MBZA 5CGSA 3PYPA 3LIEA 1W63Q 2V2FF 2ZQCA 2XA7S 1JWVA 4IBXA 2W3GA 3C4OA 4HP4A 3KYQA 2OSUA 1NLZA 3JYIA 4X1MA 4EV4A 4K91A 1OTEA 3NI9A 5HD3A 2QKPA 4IVKA 4MDZA 1G68A 4XT2A 2EXBA 4GHIA 3DTEA 3PXPA 1DP8A 3NY4A 1L0FA 3DBAA 2XK1A 3KYZA 2HDUA 1S1ZA 1HD8A 2PU2A 1BSGA 4ZRRA 4GZBA 1NYMA 3OPPA 5A93A 2OWHA 1NWZA 1K0KA 5DJTA 2VKSA 3LR3A 4MLLA 3GRJA 1BLHA 5HPIA 4HHDA 2H0YA 1PRQA 1XPBA 2FFFB 3JPUA 1CQAA 2Y2QA 1G28A 1J3WA 3KO6A 3UMDA 4UAAA 2O9AA 3WRZA 4WEKA 3GDIA 2EWVA 3QP6A 3W4OA 1KGGA 3R7WA 1S67L 4F94A 3SW1A 2XR0A 1W8QA 2OWJA 2PRFA 4X55A 1NY0A 3H9WA 3L9KA 5EM1A 3T1QB 1K4FA 3MQQA 1ONHA 5GLDA 2Y2HA 4E3NA 2P04A 5KIZA 2WUQA 2XSSA 2XFTA 2ZD8A 2ZJ9A 3HREA 3GR2A 5C5KA 4KG6A 5EVIC 4P6BA 4HI4A 4S2IA 3VV4A 1DY6A 3TW8A 3VP2A 4PMAA 1X0OA 1W63M 1KE0A 4L9GA 4S2NA 2Q9MA 4WZ4A 1EI5A 3FG8A 3BQAA 2HDRA 3CG5A 2WKEA 4MN5A 1T1AA 4NETA 1ES5A 2V0UA 3IXDA 2W3EA 5DJUA 4MCWA 3UE0A 4MNRA 1KGEA 3BRMA 2LB9A 3NC8A 5DTSA 3T4SA 4N1XA 2EFUA 3FKWA 5HZHA 1EW0A 3IWIA 3F1OB 2R78A 2XGNA 5GLCA 4R3JA 2W27A 3MQ0A 4P0MA 1JTGA 3T4KA 2OOLA 3IH9A 2B95A 2QWSA 2Y2PA 1T1BA 5EVEA 4DJ2A 1YMXA 4KZ8A 2L1MA 4R3AA 4QY5A 3M6HA 1PW8A 1YT4A 4NKPA 1FCOA 4U3TA 3MKEA 4C3QA 1JWPA 3QP8A 2HJEA 3SH8A 4HBTA 2WGIA 5F1GA 2HP5A 3SH9A 1HVBA 4E3OA 5TGFA 3BY8A 5E2HA 3EQUA 4UQIM 4IHQA 3A3EA 1RGYA 2R9XA 4N9LA 1N9LA 3BECA 2PT7A 5EOOA 4ZJ1A 2KX6A 2ZMVA 3W8KA 5J3WA 3GECA 1SKOB 2Y8HA 4NXFA 3QHYA 4Q0IA 1PNEA 5EVIB 3LIDA 4AFIA 2J9OA 5FASA 2INWA 2GZAA 1ZHHB 5F69A 5HDDA 4DKIA 2X71A 4DXBA 2V8CA 1BYWA 1Q2QA 2XF3A 4KQOA 4FOFA 4PAUA 3LYXA 5EPHA 4KZAA 2JC7A 1BZAA 5L10A 1W5DA 5E2FA 5KSCA 1N4OA 4WYYA 5GLAA 5FL3A 3NJAA 4GD8A 3E4QA 5F83A 4CLCD 4LV1A 3KYEA 4R6LA 2GNXA 3UB6A 3LIBA 3M6BA 3FPVA 1XFNA 1RCJA 3BLMA 5HD5A 4UA6A 1NJ4A 3KSIA 5EOEA 3HJIA 2EFXA 3E2KA 1L3LA 4BL3A 4BMWA 3UMEA 3ZCZA 4Q8IA 3UDIA 2O9BA 4HQAA 3S1YA 3ZG5A 2FFYA 1XJ4A 3FPWA 4B4ZA 5CTMA 4MBFA 1PWGA 1K56D 2QPNA 1ES3A 3N8SA 3T12B 3EOIA 3BFEA 1F2KA 2HPBA 2ZM2A 3NCKA 1N9NA 4R38A 4U0XA 2WZXA 2YKHA 4I3JA 5DFYA 3S7NA 1VHMA 1TS0A 5I5LA 1S1YA 1YM1A 3VOZA 2Y79A 4GN2A 4DE0A 3UDXA 5EM0A 5CECA 4PM6A 3CMZA 4OPRA 1BLPA 1LL9A 3V3RA 1S66L 5G4YA 3C38A 2BASA 3SOIA 2WKPA 3F1OA 3B42A 2JKGA 4LV3A 4BLMA 2I9VA 1CJFA 4GLQA 1ZTUA 3SS4A 1PIOA 1HTZA 1UWPX 2Y59A 4WMCD 4B9OA 1KE4A 1OTIA 1MPLA 4PM9A 5A91A 3M2KA 3H82B 3W4QA 1IYPA 4OQ0A 3UPPA 4JF5A 4ID4A 5A92A 4U0TA 2A2LA 2P08A 1D1JA 1YAXA 1PWCA 2B02A 4X6TA 3IQAA 4S2OA 5EE8A 2ZQ9A 3M2JA 3LFVA 4FTXA 1ZKJA 3MFDA 4CPKA 4Y13A 2PR6A 1NRJA 4RYEA 5F82A 3T4QA 3EEAA 1OJGA 1G6OA 3GTCA 4FUWA 4QJGA 1KVMA 4H8RA 4OOYA 4N9KA 1SKOA 1QMFA 2ACGA 4WM9A 4EQIA 2PD7A 4YOFA 4KG5A 1P9RA 5EVIA 5FQMA 5AQAA 3ULFA 3QNBA 1OJ5A 4JBFA 1NZUA 3IX4A 1Y4OA 3IWOA 3DTIA 4OONA 4HH3A 3S7PA 1F98A 3CLOA 3TRCA 4LLOB 5FSRA 1M40A 3VFFA 3ZNTA 3ICYA 1K57A 1JWZA 1TEMA 4FD8A 3LIFA 3A0RA 1A0KA 2WKQA 4O7DA 2EXAA 2PAVP 5CERA 3MXRA 2ZQDA 3HVFA 3O5YA 2Y91A 2KOIA 1K6SA 4HJ6A 2Z2LB 3RFBA 3S7QA 4F3LB 2V20A 1BLSA 2VK3A 3QP5A 4X53A 3SS5A 5GL9A 1KDSA 2W0NA 3EGDC 3FWLA 2ZOHA 2ZM0A 4QU3A 2JE5A 1SCWA 2L4RA 1IFQA 4QHCA 4K0XA 3N4IA 4DJ3A 3UY6A 3FV7A 2I72A 1K55A 1D06A 4Y5FA 3CAXA 2HDQA 5DVAA 5CGWA 5J7EA 3IT9A 5HDSA 1CK3A 4EESA 5KZHA 3D4FA 4IUHA 4I3IA 1MBLA 5IT5A 3D9YA 1PFLA 3G6OA 5D3OA 4NXGA 2VV7A 1YLJA 3U4LP 3Q82A 1MWUA 5FDHA 4BENA 3P09A 3T4LA 2K7SA 3MXQA 5AQBA 2WGWB 3LIAA 1OTBA 4Y15A 1FCMA 4UEYA 1L2SA 4NXBA 3IXGA 2VX8A 2A3UA 4KZ4A 4OP5A 2J3TD 3NDEA 2Y2MA 5DKKA 1K4EA 4P6ZM 4HH2A 2QMIA 4BBUA 1GCEA 3OPRA 1ZG6A 3K3DA 2C5WB 1ES4A 3UNWA 2XD1A 2QJ7A 4QB8A 3BWLA 3ITBA 4S2JA 5FATA 1JTDA 1JNUA 4X56A 1MXOA 4YWZA 4EERA 4DDYA 3PBRA 4LPZA 3UB9A 3H82A 3PBQA 3MS6A 2G2UA 4GOGA 2VJWA 4R4RA 1ZG4A 1DJCA 2DNSA 4HP9A 3LY4A 3BFFA 3G31A 1GSVA 2JHEA 3AGFA 3IF5A 4RQ9A 1KDWA 4PM7A 4IJGA 3K3CA 1S0WA 4L0LA 3HL9A 2VV8A 5HDCA 5EVLA 5FQIA 3MXSA 3UB5P 2JCHA 3LEQA 4GB7A 4EEUA 2XROA 5EUAA 4QPRA 2Y2NA 1GHPA 5A90A 2E8IA 2ZC6B 1E3UA 2VGLM 5K5BA 4E3IA 2JKRI 2W1RA 1YLYA 1E4DA 4PKYG 2GX5A 4GDBA 4LCMA 5L8MA 2WAFA 4P85A 1XKZA 2Y4AA 4OKPA 4LV2A 5FAQA 2OV5A 2EX2A 4HEFA 3IX3A 3WRTA 3CITA 4R0QA 5EECA 3OCLA 3NECA 1YQSA 1SZVA 1P9WA 3V50A 2WZZA 1PZPA 5DF8A 5DF9A 4F3LA 5HARA 1I5QA 4EWFA 5TR7A 4KQRA 4MN7A 1K57C 1XP4A 5L09A 2JN7A 1L0DA 1AWIA 3PBTA 3S7OA 1XGJA 1WE4A 1YLZA 3LGOA 4RX3A 4BD0A 5MC7A 4CLCB 4MN6A 3LO7A 3HCYA 3MQOA 3IXHA 5CHJA 3LICA 2L0WA 4I39A 4KQDA 5HAQA 5JYOA 4EU0A 4UHUA 3GSGA 4WZ5C 3UE3A 3DTKA 4A5RA 3LI8A 3E0YA 5HPFA 1L0GA 4EBNA 4Y0TA 4UA9A 1T18A 1LSXA 3IS2B 5DF7A 4KZBA 5AVEA 2PR5A 3MZDA 4EEPA 4DMZA 2WYXA 1N9OA 3NDGA 2Y2OA 1K55C 2WGWA 2C6WB 2V1ZA 4LFUA 1XJ2A 2FZ0A 2J7VA 3RH8B 4GS9B 2PU4A 1BT5A 4JXSA 3LR5A 5GHZA 4YINA 3IWQA 4O8GA 4BBTA 1ACFA 3ZDJA 3VSLA 4QD4A 4Y0UA 1EROA 4DRTA 4ZTKA 5M19A 1VETB 1C3BA 2ZLYA 4UA7A 3DWKA 4EUZA 3K2NA 3TSGA 3OBFA 3EQVA 3WS1A 4K0WA 1LSVA 1ESUA 4JGQA 2ZC7A 2VGLS 2H28A 3G2ZA 2VA0A 1FIKA 3DWZA 2ZM8A 4LENA 3LR4A 2Y2KA 4M4XA 3HLCA 2IA2A 3LI9A 4G3WA 4JPMA 4K08A 2ZMAA 4IVIA 4KUKA 4HIAA 3HJKA 3GV9A 4PPRA 1L0EA 3DAVA 3HBRA 4HY8A 2HP9A 5KMWA 5J8XA 1UGUA 2JKRM 1K6RA 4ZAMA 1LI9A 1GSXA 1ODVA 1VQQA 2BLSA 5L07A 2P9VB 3ZNYA 1UWNX 1IOUA 3IF6C 2A24B 3AGEA 3PTEA 1LL5A 1G6AA 3E4OA 1TDGA 3VFHA 1IEMA 3VP4A 3ZG8B 4ARZB 1H3QA 2VLGA 3QNCA 3I7JA 1PYYA 1MZUA 4WBGA 3H7WB 3OOVA 2CMNA 3HLFA 2ZMFA 1WYCA 3NOTC 3JVUA 3LUQA 3V39A 1CEFA 3VP1A 4JKTA 1NXYA 3BFCA 4KENB 3C2WA 1O07A 3BFDA 2M1CA 3OPLA 5FA7A 2D02A 2H0TA 3ZQ5A 5FEFA 1OTDA 2ZOIA 3CI6A 3MF0A 4DE3A 3N6IA 4D60A 2J8YA 1S4SA 1T1CA 4CLCA 1MWTA 2Z6CA 4B4XA 1TDLA 3UB7A 2X02A 1IELA 2VGKA 1GA0A 1YMSA 1M6KA 3G34A 1TS7A 1TF1A 4EBPA 3MSHA 2W1TB 1MKIA 1OT6A 1H0MA 4UQIS 3IS2A 4OLDA 2H10A 1DP6A 1F9IA 4OPQA 5CHUA 1MC0A 4JGPA 5EVID 3KX0X 4KZ5A 1FCNA 1KGFA 3TG9A 4C75A 2WKIA 3E98A 2ZC3B 4ETZA 3MR0A 1FILA 2HF6A 3KSHA 2WK0A 3LR0A 4BBVA 2E8JA 4GS9A 3UE1A 2PBDP 3T4JA 2WKHA 3KSFA 5FQKA 3C7UA 3IF6B 5HAIA 1ERMA 1MY8A 3HLGA 3ZG9B 5DFXA 3MFXA 3Q7VB 3UDFA 1GHIA 1VETA 2K31A 2XA7M 2A49A 2NUTC 1Z6FA 4RX2A 1TD5A 3FYZA 3IXBA 3B47A 3GVBA 3GMWA 5HL6A 5DTTA 1BULA 3ITAA 1CI9A 2ZC4B 2XEPA 4EQ1A 1LT0A 2XFSA 3VP3A 1ZC2A 1S6RA 4X1LA 4KG2A 2O0YA 5EFWA 5FQ9A 3B33A 5F68A 3WWXA 3MJQA 5HSQA 4P87A 5E2GA 2XLNA 5AVFA 1VM1A 4DDSA 1YLPA 4OQIA 4II7A 1RGZA 1VEUB 5DTKA 2CC1A 4KZ7A 5G4ZA 3N7WA 3QP4A 3NIAA 2D01A 1LSWA 3D3OA 3IBRA 5TFQA 4OPYA 5IS1A 5M18A 2P9VA 4KZ3A 2J9PA 3E4PA 1KVLA 2XRNA 3P7NA 3SS3A 3T50A 4FH4A 4WZ5A 4EW7A 2EA9A 1TS8A 2A24A 2XQZA 4H6JB 3CWFA 4Y7PA 4N1HA 3MZFA 5LBRA 3WS4A 4OOLA 4HJ4A 2VZWA 4ARZA 1XXMA 5FAOA 4Q0JA 1Q2PA 4IEDA 1DRMA 3CPTB 3LY3A 3H7WA 4S2KA 3IHBA 2B5RA 4IBRA 4FSFA 3VE4A 3G30A 3NOUC 3Q81A 1P97A 1OPXA 4HJ3A 2ZQ8A 4OOMA 4EBLA 3HLEA 4GW9A 2W3DA 1E25A 2OLVA 2UV0E 4OPZA 3CUEA 2M7VA 3C30A 5HFOA 3QP1A 4OQGA 2HP6A 4R3BA 4MEZA 3VMAA 4E3JA 2EWWA 3UB8A 3ZG7B 1ES2A 1K54C 1PZOA 4G3VA 2Y2LA 3R4KA 3MKFA 1KE3A 4HBUA 2DCFA 1XX2A 4FH2A 3VP0A 2W1TA 4LCLA 4DE2A 4E3KA 4BD1A 1SDEA 5CHMA 5DKLA 1DP9A 4L9FA 1J9MA 3T1RA 1DJAA 3G2YA 3O3VA 2ZL1B 2VEAA 5AQ9A 4CLCC 1E3UD 2OAQ1 3FZCA 2Y2IA 2KDKA 1IYOA 1MWSA 1PWDA 1N9BA 4E04A 1HLUP 4S2LA 4ZBEA 4L9EA 3A3IA 2O9CA 5FEGA 3N8RA 3IF6A 4HOIA 5TJJA 4WL9A 5GHXA 3Q7VA 1P0ZA 3OC2A 4LRZE 3WS2A 2EX6A 4Y2FA 2K2NA 1XGIA 3HLBA 2HZ5A 5J4EA 4X25A 1CF0A 4OQHA 1WA9A 3TJZC 2XH9A 5AJGA 3EGXC 3VOYA 3ZFZA 2H5SA 2ZC5B 4XUXA 3G35A 1CEGA 2G7UA 3RJUA 3PAGA 2WAEA 3G32A 3W2ZA 4JF4A 2BG1A 3NBLA 2YKFA 3N8LA 1XJ3A 4JGOA 3PBNA 2Y2JA 1VB6A 4E3LA 1VEUA 2PHYA 3NULA 3ZHHA 4ETXA 5GHYA 4R23A 2JKTM 5FI6A 4R1GA 5F1FA 3PAEA 1YSQA 1LI0A 2MJ6A 2X01A 1W8YA 4R4SA 3EEHA 3F1NB 1SDNA 5CEDA 4S2PA 4OH0A 5GLBA 4Q0HA 4H6JA 3V5MA 3O87A 1FR6A 1RP5A 5AQ7A 3IX8A 4MMNA 1ESIA 3CPTA 1CI8A 1AXBA 2DMWA 3C5AA 4I3AA 4JGRA 1W7FA 2HDSA 3CJMA 5E43A 5G18A 4M3KA 1O7EA 2EX8A 1GA9A 3UN7A 4E3MA 1EWZA 1GSWA 4JXVA 4DXCA 1MWRA 2P7JA 1TS6A 4P6ZS 4RVAA 3A3DA 3OLOA 5CX7A 4DF6A 2WKRA 3BEBA 4GD6A 4KZ9A 3QP2A 4MBHA 5HAPA 4B88A 5FQQA 4GJ4A 4OLGA 4WF0A 4LGWA 4YFMA 3OCNA 3ISGA 4R70A 3IHAA 1OMEA 2BTFP 3D72A 2OLUA 3ZVTA 5A8BA 1IYSA 3LEZA 5I94A 5EV0A 3CUEC 1GHMA 3UE6A 3FC7A 5HWTA 3PHYA 3EWKA 5CXWA 4BJPA 3UO9A 5HL1A 4I38A 4QWOA 2EX9A 4JXWA 5TBMB 1NYYA 2IWDA 4YNRA 2OAP1 4JLFA 5M1AA 2ZL1A 5FAPA 4HESA 4MBKA 1W79A 3S22A
chains in the Genus database with same CATH topology
3W4OA 2JE5A 1KGGA 1MKIA 1SCWA 1BTLA 4JF6A 3C4PA 4F94A 4QHCA 1IKGA 4K0XA 3B3XA 3N4IA 1WYBA 3WS5A 2WADA 4OLDA 2H10A 1FOFA 1TVFA 2VGJA 3WS0A 3UY6A 3FV7A 2I72A 4OPQA 5CHUA 2XR0A 1K55A 1W8QA 2HDQA 3BLSA 1XA1A 5EVID 5DVAA 2WGVA 5CGWA 4KZ5A 3IT9A 1FCNA 1KGFA 3TG9A 3PBOA 4X55A 4C75A 1CK3A 1NY0A 3Q7ZA 5FI2A 1K4FA 3HLWA 3ZGAB 5KZHA 1ONHA 3D4FA 2Y2HA 5GLDA 2WKIA 4RA7A 1IYQA 4E3NA 1MBLA 4C6YA 2ZC3B 4QY6A 1H8YA 3P98A 2WK0A 2WUQA 2XFTA 2ZD8A 2ZJ9A 3HREA 3GR2A 2RCXA 5D3OA 4KG6A 5EVIC 1YLJA 3Q82A 4P6BA 1MWUA 5FDHA 4BENA 3UE1A 4S2IA 3P09A 2R9WA 2WKHA 5FQKA 1DY6A 3C7UA 3HUNA 4KZ6A 5FQJA 3VP2A 3IF6B 5HAIA 5AQBA 2WGWB 1ERMA 1MY8A 4E6XA 3BFGA 3HLGA 3ZG9B 4PMAA 1H5XA 3Q7VB 1FCMA 3UDFA 1KE0A 3TOIA 4ZDXA 1L2SA 1FR1A 1GHIA 4S2NA 2Q9MA 4WZ4A 1EI5A 3IXGA 2A3UA 4KZ4A 5JYPA 3CZDA 2HDRA 4OP5A 3CG5A 3NDEA 2Y2MA 2A49A 2WKEA 4RX2A 1K4EA 1Z6FA 5U47A 3FYZA 4X68A 3IXBA 2QMIA 2ZQAA 4NETA 3GVBA 3GMWA 1ES5A 1GCEA 4WEJA 3OPRA 3IXDA 1BULA 1ZG6A 3ITAA 5DTTA 2C5WB 1ES4A 1CI9A 3UNWA 1ERQA 2XD1A 3UE0A 2ZC4B 2XEPA 4MNRA 1QMEA 4QB8A 1KGEA 2XFSA 3VP3A 3BRMA 1ZC2A 3NC8A 4JXGA 1S6RA 5DTSA 4KG2A 3ITBA 4S2JA 5FQ9A 3WWXA 5FATA 1JTDA 3RXXA 4N1XA 4X56A 2EFUA 3FKWA 4P87A 1MXOA 3IWIA 5E2GA 1K54A 2XLNA 1VM1A 2Z2MB 4DDSA 1YLPA 4DDYA 3PBRA 4OQIA 4DE1A 1RGZA 4N92A 2XGNA 3PBQA 5GLCA 1LLBA 4R3JA 3RXWA 2IWCA 2G2WA 5DTKA 2G2UA 4P0MA 2CC1A 1IKIA 1Y54A 4KZ7A 2GDNA 1JTGA 1FSYA 3N7WA 3O86A 4GOGA 3NIAA 3IH9A 4R4RA 2Y2PA 1ZG4A 4OVDA 1DJCA 2Y2GA 2DNSA 1YMXA 4KZ8A 5CRFA 4QY5A 3M6HA 3LY4A 4OPYA 5TFQA 2XDMA 3BFFA 3G31A 5M18A 2P9VA 4KZ3A 2J9PA 3AGFA 3IF5A 1PW8A 3HUOA 1KVLA 1KDWA 1YT4A 4PM7A 3SS3A 1FCOA 4FH4A 2UWXA 4U3TA 1S0WA 1ONGA 3MKEA 3HL9A 4L0LA 4WZ5A 4C3QA 1JWPA 2XQZA 5EVLA 5FQIA 3MXSA 4Y7PA 2JCHA 4N1HA 5IHVA 3MZFA 3SH8A 4HBTA 2WGIA 5F1GA 4GB7A 4OOLA 2HP5A 5CTNA 3WS4A 5EUAA 3SH9A 1XXMA 5FAOA 4KQQA 2Y2NA 1GHPA 1HVBA 1Q2PA 5A90A 2E8IA 4IEDA 2ZC6B 4E3OA 3LY3A 1PW1A 2PBYA 1E3UA 5TGFA 4S2KA 5E2HA 4XUZA 3EQUA 2B5RA 2DRWA 3IHBA 4Z9QA 4E3IA 4IBRA 4X69A 3A3EA 1RGYA 2R9XA 4FSFA 4N9LA 4XUXA 3BECA 2P74A 4NK3A 4E6WA 1YLYA 5EOOA 4ZJ1A 3OZHA 3G30A 3Q81A 3W8KA 1E4DA 3Q1FA 4GDBA 2ZQ8A 4S2NC 4LCMA 4OOMA 4EBLA 3HLEA 1XA7A 2WAFA 3QHYA 1XKZA 2Y4AA 4P85A 1E25A 4OKPA 3SH7A 2OLVA 2JBFA 1SKFA 4LV2A 4OPZA 5FAQA 3BM6A 5EVIB 2J9OA 1K56A 5FASA 2OV5A 1YLTA 1H8ZA 3PBSA 3A3JA 2EX2A 2X71A 4DKIA 4HEFA 5HFOA 4DXBA 1HZOA 4OQGA 4WELA 3WRTA 5E2EA 4R0QA 2HP6A 5CGXA 5EECA 4R3BA 3MZEA 1ALQA 1I2SA 3OCLA 4MEZA 1Q2QA 2XF3A 4KQOA 1YQSA 3VMAA 3V50A 5EPHA 2WZZA 2Q9NA 4KZAA 4E3JA 3O88A 1PZPA 4OP8A 5DF8A 5BOHA 3E2LA 5DF9A 2JC7A 1BZAA 3ZG7B 1W5DA 1ES2A 1K54C 1PZOA 5E2FA 4ZJ3A 3V3SA 5KSCA 5HARA 1I5QA 2Y2LA 1N4OA 5TR7A 4EWFA 4WYYA 4KQRA 4PM5A 4CJNA 4GNUA 3MKFA 5GLAA 1KE3A 4HBUA 4GD8A 1K57C 1XP4A 3W4PA 5F83A 1DJBA 2DCFA 4LV1A 2ZQ7A 1XX2A 1L0DA 4FH2A 3PBTA 3VP0A 1XGJA 1WE4A 4LCLA 4DE2A 3M6BA 2XD5A 3HLDA 4E3KA 4BD1A 1YLZA 4RX3A 1SDEA 4BD0A 1RCJA 3LO7A 5CHJA 3IXHA 3BLMA 5CHMA 1SHVA 1J9MA 4UA6A 1NJ4A 1DJAA 3G2YA 3O3VA 5EOEA 5HAQA 5JYOA 5AQ9A 1E3UD 3BYDA 2EFXA 4UHUA 4XXRA 3E2KA 3GSGA 3FZCA 4WZ5C 4Y0OA 3UE3A 4BL3A 2Y2IA 1NZOA 3ZCZA 4A5RA 4Q8IA 3UDIA 1L0GA 3DW0A 3S1YA 4EBNA 2QZ6A 1IYOA 3ZG5A 4Y0TA 1BUEA 1MWSA 4UA9A 2FFYA 4WMCA 1PWDA 5DF7A 1N9BA 4KZBA 4B4ZA 5HX9A 4S2LA 4ZBEA 1JVJA 5CTMA 4MBFA 5KSHA 3A3IA 1I2WA 1K25A 3MZDA 2IWBA 1PWGA 1NRFA 1K56D 2QPNA 2WYXA 3C7VA 1ES3A 3N8SA 3DTMA 3NDGA 2Y2OA 1K55C 3BFEA 3A3FA 3N8RA 3IF6A 2WGWA 1YLWA 2C6WB 2HPBA 2ZM2A 2V1ZA 3NCKA 5GHXA 2RL3A 3Q7VA 1FQGA 2J7VA 4U0XA 2WZXA 3OC2A 5FI7A 4GDNA 3WS2A 2EX6A 2PU4A 1XGIA 1U60A 1BT5A 4JXSA 3HLBA 1YM1A 3VOZA 4OQHA 5GHZA 4YINA 3IWQA 4BL2A 3GQZA 4GN2A 2XH9A 3VOYA 3ZDJA 3ZFZA 3VSLA 2H5SA 4DE0A 4QD4A 4BQMA 3UDXA 4Y0UA 5L2FA 3Q07A 2ZC5B 5CECA 3AGDA 1FSWA 1CEGA 1EROA 3G35A 3CMZA 4PM6A 4OPRA 1BLPA 3LCEA 3RJUA 4DRTA 3PAGA 1PI4A 2WAEA 4ZTKA 5M19A 1LL9A 3G32A 1C3BA 3VSKA 4JF4A 2ZLYA 2BG1A 3NBLA 4UA7A 3V3RA 3DWKA 4GKUA 4EUZA 3N8LA 3TSGA 3UPOA 3PBNA 2Y2JA 3EQVA 3WS1A 4K0WA 3SOIA 1ESUA 2ZC7A 4E3LA 4LV3A 3G2ZA 4BLMA 3DWZA 3ZHHA 4LV0A 2ZM8A 5GHYA 4R23A 3SS4A 4LENA 1PIOA 5FI6A 4R1GA 2Y55A 4ZJ2A 2Y2KA 5CEBA 5F1FA 1HTZA 3HLCA 3PAEA 1LHYA 2Y59A 4JPMA 4S2MA 4WMCD 3UPNA 1KE4A 2ZMAA 3G4PA 4IVIA 1LI0A 1MPLA 2X01A 1W8YA 4R4SA 4PM9A 5A91A 5HW3A 3M2KA 1SDNA 5CEDA 1K38A 4S2PA 3GV9A 3W4QA 1IYPA 4OQ0A 3UPPA 4FCFA 4OH0A 4JF5A 4ID4A 4PPRA 3ZVWA 1L0EA 4PM8A 5A92A 5GLBA 3HUMA 3HBRA 4U0TA 3OPHA 2HP9A 5KMWA 5J8XA 4D2OA 3V5MA 1PWCA 1K6RA 3O87A 3FKVA 3S4XA 4X6TA 1FR6A 4ZAMA 1LI9A 1BLCA 1PI5A 3IQAA 4S2OA 5EE8A 1RP5A 1VQQA 2ZQ9A 5AQ7A 2BLSA 3M2JA 3IH8A 3MBZA 1ESIA 1ZKJA 3MFDA 5CGSA 4CPKA 2P9VB 1CI8A 1AXBA 3ZNYA 3C5AA 4RYEA 5F82A 1W7FA 2HDSA 3IF6C 3CJMA 2V2FF 5E43A 2ZQCA 3AGEA 3GTCA 3PTEA 4M3KA 1LL5A 1O7EA 1G6AA 2EX8A 5G18A 1GA9A 1TDGA 4QJGA 3UN7A 1KVMA 4E3MA 1EWZA 3VFHA 4DXCA 1IEMA 1JWVA 3C4OA 1MWRA 4H8RA 4IBXA 4JXVA 4N9KA 4OOYA 3VP4A 3ZG8B 4RVAA 1QMFA 3A3DA 4WM9A 4EQIA 3QNCA 4DF6A 2OSUA 3I7JA 1PYYA 4KG5A 3JYIA 4EV4A 3BEBA 4WBGA 4GD6A 4KZ9A 5EVIA 4K91A 5FQMA 3HLFA 3NI9A 5AQAA 3QNBA 4JBFA 4MBHA 1NZUA 5HAPA 4B88A 4IVKA 5FQQA 1G68A 1WYCA 2EXBA 3ZG0A 3IWOA 3NY4A 4OLGA 3V39A 4OONA 1CEFA 1L0FA 3VP1A 2XK1A 4JKTA 4YFMA 2HDUA 3OCNA 3ISGA 1HD8A 5FSRA 1M40A 3VFFA 3IHAA 2PU2A 1BSGA 3ZNTA 1NXYA 3BFCA 4KENB 1K57A 1JWZA 1OMEA 1TEMA 1NYMA 4FD8A 3OPPA 4GZBA 5A93A 4O7DA 2EXAA 1O07A 2OLUA 3BFDA 3ZVTA 4MLLA 5CERA 1IYSA 3GRJA 1BLHA 3LEZA 5I94A 1GHMA 3MXRA 3OPLA 5FA7A 2H0YA 2ZQDA 2H0TA 3HVFA 5CXWA 1XPBA 2Y91A 1K6SA 4DE3A 4BJPA 3N6IA 2FFFB 3UO9A 5HL1A 2Z2LB 2J8YA 2Y2QA 2EX9A 2V20A 4JXWA 1BLSA 1MWTA 1NYYA 2IWDA 4X53A 4B4XA 1TDLA 3SS5A 4JLFA 5M1AA 2X02A 5GL9A 1IELA 1KDSA 4UAAA 2VGKA 5FAPA 1GA0A 3FWLA 3WRZA 1YMSA 4WEKA 1M6KA 3G34A 2ZM0A 4HESA 4EBPA 4MBKA 1W79A 4QU3A 3S22A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W4O A;  2JE5 A;  1KGG A;  1MKI A;  1SCW A;  1BTL A;  4JF6 A;  3C4P A;  4F94 A;  4QHC A;  1IKG A;  4K0X A;  3B3X A;  3N4I A;  1WYB A;  3WS5 A;  2WAD A;  4OLD A;  2H10 A;  1FOF A;  1TVF A;  2VGJ A;  3WS0 A;  3UY6 A;  3FV7 A;  2I72 A;  4OPQ A;  5CHU A;  2XR0 A;  1K55 A;  1W8Q A;  2HDQ A;  3BLS A;  1XA1 A;  5EVI D;  5DVA A;  2WGV A;  5CGW A;  4KZ5 A;  3IT9 A;  1FCN A;  1KGF A;  3TG9 A;  3PBO A;  4X55 A;  4C75 A;  1CK3 A;  1NY0 A;  3Q7Z A;  5FI2 A;  1K4F A;  3HLW A;  3ZGA B;  5KZH A;  1ONH A;  3D4F A;  2Y2H A;  5GLD A;  2WKI A;  4RA7 A;  1IYQ A;  4E3N A;  1MBL A;  4C6Y A;  2ZC3 B;  4QY6 A;  1H8Y A;  3P98 A;  2WK0 A;  2WUQ A;  2XFT A;  2ZD8 A;  2ZJ9 A;  3HRE A;  3GR2 A;  2RCX A;  5D3O A;  4KG6 A;  5EVI C;  1YLJ A;  3Q82 A;  4P6B A;  1MWU A;  5FDH A;  4BEN A;  3UE1 A;  4S2I A;  3P09 A;  2R9W A;  2WKH A;  5FQK A;  1DY6 A;  3C7U A;  3HUN A;  4KZ6 A;  5FQJ A;  3VP2 A;  3IF6 B;  5HAI A;  5AQB A;  2WGW B;  1ERM A;  1MY8 A;  4E6X A;  3BFG A;  3HLG A;  3ZG9 B;  4PMA A;  1H5X A;  3Q7V B;  1FCM A;  3UDF A;  1KE0 A;  3TOI A;  4ZDX A;  1L2S A;  1FR1 A;  1GHI A;  4S2N A;  2Q9M A;  4WZ4 A;  1EI5 A;  3IXG A;  2A3U A;  4KZ4 A;  5JYP A;  3CZD A;  2HDR A;  4OP5 A;  3CG5 A;  3NDE A;  2Y2M A;  2A49 A;  2WKE A;  4RX2 A;  1K4E A;  1Z6F A;  5U47 A;  3FYZ A;  4X68 A;  3IXB A;  2QMI A;  2ZQA A;  4NET A;  3GVB A;  3GMW A;  1ES5 A;  1GCE A;  4WEJ A;  3OPR A;  3IXD A;  1BUL A;  1ZG6 A;  3ITA A;  5DTT A;  2C5W B;  1ES4 A;  1CI9 A;  3UNW A;  1ERQ A;  2XD1 A;  3UE0 A;  2ZC4 B;  2XEP A;  4MNR A;  1QME A;  4QB8 A;  1KGE A;  2XFS A;  3VP3 A;  3BRM A;  1ZC2 A;  3NC8 A;  4JXG A;  1S6R A;  5DTS A;  4KG2 A;  3ITB A;  4S2J A;  5FQ9 A;  3WWX A;  5FAT A;  1JTD A;  3RXX A;  4N1X A;  4X56 A;  2EFU A;  3FKW A;  4P87 A;  1MXO A;  3IWI A;  5E2G A;  1K54 A;  2XLN A;  1VM1 A;  2Z2M B;  4DDS A;  1YLP A;  4DDY A;  3PBR A;  4OQI A;  4DE1 A;  1RGZ A;  4N92 A;  2XGN A;  3PBQ A;  5GLC A;  1LLB A;  4R3J A;  3RXW A;  2IWC A;  2G2W A;  5DTK A;  2G2U A;  4P0M A;  2CC1 A;  1IKI A;  1Y54 A;  4KZ7 A;  2GDN A;  1JTG A;  1FSY A;  3N7W A;  3O86 A;  4GOG A;  3NIA A;  3IH9 A;  4R4R A;  2Y2P A;  1ZG4 A;  4OVD A;  1DJC A;  2Y2G A;  2DNS A;  1YMX A;  4KZ8 A;  5CRF A;  4QY5 A;  3M6H A;  3LY4 A;  4OPY A;  5TFQ A;  2XDM A;  3BFF A;  3G31 A;  5M18 A;  2P9V A;  4KZ3 A;  2J9P A;  3AGF A;  3IF5 A;  1PW8 A;  3HUO A;  1KVL A;  1KDW A;  1YT4 A;  4PM7 A;  3SS3 A;  1FCO A;  4FH4 A;  2UWX A;  4U3T A;  1S0W A;  1ONG A;  3MKE A;  3HL9 A;  4L0L A;  4WZ5 A;  4C3Q A;  1JWP A;  2XQZ A;  5EVL A;  5FQI A;  3MXS A;  4Y7P A;  2JCH A;  4N1H A;  5IHV A;  3MZF A;  3SH8 A;  4HBT A;  2WGI A;  5F1G A;  4GB7 A;  4OOL A;  2HP5 A;  5CTN A;  3WS4 A;  5EUA A;  3SH9 A;  1XXM A;  5FAO A;  4KQQ A;  2Y2N A;  1GHP A;  1HVB A;  1Q2P A;  5A90 A;  2E8I A;  4IED A;  2ZC6 B;  4E3O A;  3LY3 A;  1PW1 A;  2PBY A;  1E3U A;  5TGF A;  4S2K A;  5E2H A;  4XUZ A;  3EQU A;  2B5R A;  2DRW A;  3IHB A;  4Z9Q A;  4E3I A;  4IBR A;  4X69 A;  3A3E A;  1RGY A;  2R9X A;  4FSF A;  4N9L A;  4XUX A;  3BEC A;  2P74 A;  4NK3 A;  4E6W A;  1YLY A;  5EOO A;  4ZJ1 A;  3OZH A;  3G30 A;  3Q81 A;  3W8K A;  1E4D A;  3Q1F A;  4GDB A;  2ZQ8 A;  4S2N C;  4LCM A;  4OOM A;  4EBL A;  3HLE A;  1XA7 A;  2WAF A;  3QHY A;  1XKZ A;  2Y4A A;  4P85 A;  1E25 A;  4OKP A;  3SH7 A;  2OLV A;  2JBF A;  1SKF A;  4LV2 A;  4OPZ A;  5FAQ A;  3BM6 A;  5EVI B;  2J9O A;  1K56 A;  5FAS A;  2OV5 A;  1YLT A;  1H8Z A;  3PBS A;  3A3J A;  2EX2 A;  2X71 A;  4DKI A;  4HEF A;  5HFO A;  4DXB A;  1HZO A;  4OQG A;  4WEL A;  3WRT A;  5E2E A;  4R0Q A;  2HP6 A;  5CGX A;  5EEC A;  4R3B A;  3MZE A;  1ALQ A;  1I2S A;  3OCL A;  4MEZ A;  1Q2Q A;  2XF3 A;  4KQO A;  1YQS A;  3VMA A;  3V50 A;  5EPH A;  2WZZ A;  2Q9N A;  4KZA A;  4E3J A;  3O88 A;  1PZP A;  4OP8 A;  5DF8 A;  5BOH A;  3E2L A;  5DF9 A;  2JC7 A;  1BZA A;  3ZG7 B;  1W5D A;  1ES2 A;  1K54 C;  1PZO A;  5E2F A;  4ZJ3 A;  3V3S A;  5KSC A;  5HAR A;  1I5Q A;  2Y2L A;  1N4O A;  5TR7 A;  4EWF A;  4WYY A;  4KQR A;  4PM5 A;  4CJN A;  4GNU A;  3MKF A;  5GLA A;  1KE3 A;  4HBU A;  4GD8 A;  1K57 C;  1XP4 A;  3W4P A;  5F83 A;  1DJB A;  2DCF A;  4LV1 A;  2ZQ7 A;  1XX2 A;  1L0D A;  4FH2 A;  3PBT A;  3VP0 A;  1XGJ A;  1WE4 A;  4LCL A;  4DE2 A;  3M6B A;  2XD5 A;  3HLD A;  4E3K A;  4BD1 A;  1YLZ A;  4RX3 A;  1SDE A;  4BD0 A;  1RCJ A;  3LO7 A;  5CHJ A;  3IXH A;  3BLM A;  5CHM A;  1SHV A;  1J9M A;  4UA6 A;  1NJ4 A;  1DJA A;  3G2Y A;  3O3V A;  5EOE A;  5HAQ A;  5JYO A;  5AQ9 A;  1E3U D;  3BYD A;  2EFX A;  4UHU A;  4XXR A;  3E2K A;  3GSG A;  3FZC A;  4WZ5 C;  4Y0O A;  3UE3 A;  4BL3 A;  2Y2I A;  1NZO A;  3ZCZ A;  4A5R A;  4Q8I A;  3UDI A;  1L0G A;  3DW0 A;  3S1Y A;  4EBN A;  2QZ6 A;  1IYO A;  3ZG5 A;  4Y0T A;  1BUE A;  1MWS A;  4UA9 A;  2FFY A;  4WMC A;  1PWD A;  5DF7 A;  1N9B A;  4KZB A;  4B4Z A;  5HX9 A;  4S2L A;  4ZBE A;  1JVJ A;  5CTM A;  4MBF A;  5KSH A;  3A3I A;  1I2W A;  1K25 A;  3MZD A;  2IWB A;  1PWG A;  1NRF A;  1K56 D;  2QPN A;  2WYX A;  3C7V A;  1ES3 A;  3N8S A;  3DTM A;  3NDG A;  2Y2O A;  1K55 C;  3BFE A;  3A3F A;  3N8R A;  3IF6 A;  2WGW A;  1YLW A;  2C6W B;  2HPB A;  2ZM2 A;  2V1Z A;  3NCK A;  5GHX A;  2RL3 A;  3Q7V A;  1FQG A;  2J7V A;  4U0X A;  2WZX A;  3OC2 A;  5FI7 A;  4GDN A;  3WS2 A;  2EX6 A;  2PU4 A;  1XGI A;  1U60 A;  1BT5 A;  4JXS A;  3HLB A;  1YM1 A;  3VOZ A;  4OQH A;  5GHZ A;  4YIN A;  3IWQ A;  4BL2 A;  3GQZ A;  4GN2 A;  2XH9 A;  3VOY A;  3ZDJ A;  3ZFZ A;  3VSL A;  2H5S A;  4DE0 A;  4QD4 A;  4BQM A;  3UDX A;  4Y0U A;  5L2F A;  3Q07 A;  2ZC5 B;  5CEC A;  3AGD A;  1FSW A;  1CEG A;  1ERO A;  3G35 A;  3CMZ A;  4PM6 A;  4OPR A;  1BLP A;  3LCE A;  3RJU A;  4DRT A;  3PAG A;  1PI4 A;  2WAE A;  4ZTK A;  5M19 A;  1LL9 A;  3G32 A;  1C3B A;  3VSK A;  4JF4 A;  2ZLY A;  2BG1 A;  3NBL A;  4UA7 A;  3V3R A;  3DWK A;  4GKU A;  4EUZ A;  3N8L A;  3TSG A;  3UPO A;  3PBN A;  2Y2J A;  3EQV A;  3WS1 A;  4K0W A;  3SOI A;  1ESU A;  2ZC7 A;  4E3L A;  4LV3 A;  3G2Z A;  4BLM A;  3DWZ A;  3ZHH A;  4LV0 A;  2ZM8 A;  5GHY A;  4R23 A;  3SS4 A;  4LEN A;  1PIO A;  5FI6 A;  4R1G A;  2Y55 A;  4ZJ2 A;  2Y2K A;  5CEB A;  5F1F A;  1HTZ A;  3HLC A;  3PAE A;  1LHY A;  2Y59 A;  4JPM A;  4S2M A;  4WMC D;  3UPN A;  1KE4 A;  2ZMA A;  3G4P A;  4IVI A;  1LI0 A;  1MPL A;  2X01 A;  1W8Y A;  4R4S A;  4PM9 A;  5A91 A;  5HW3 A;  3M2K A;  1SDN A;  5CED A;  1K38 A;  4S2P A;  3GV9 A;  3W4Q A;  1IYP A;  4OQ0 A;  3UPP A;  4FCF A;  4OH0 A;  4JF5 A;  4ID4 A;  4PPR A;  3ZVW A;  1L0E A;  4PM8 A;  5A92 A;  5GLB A;  3HUM A;  3HBR A;  4U0T A;  3OPH A;  2HP9 A;  5KMW A;  5J8X A;  4D2O A;  3V5M A;  1PWC A;  1K6R A;  3O87 A;  3FKV A;  3S4X A;  4X6T A;  1FR6 A;  4ZAM A;  1LI9 A;  1BLC A;  1PI5 A;  3IQA A;  4S2O A;  5EE8 A;  1RP5 A;  1VQQ A;  2ZQ9 A;  5AQ7 A;  2BLS A;  3M2J A;  3IH8 A;  3MBZ A;  1ESI A;  1ZKJ A;  3MFD A;  5CGS A;  4CPK A;  2P9V B;  1CI8 A;  1AXB A;  3ZNY A;  3C5A A;  4RYE A;  5F82 A;  1W7F A;  2HDS A;  3IF6 C;  3CJM A;  2V2F F;  5E43 A;  2ZQC A;  3AGE A;  3GTC A;  3PTE A;  4M3K A;  1LL5 A;  1O7E A;  1G6A A;  2EX8 A;  5G18 A;  1GA9 A;  1TDG A;  4QJG A;  3UN7 A;  1KVM A;  4E3M A;  1EWZ A;  3VFH A;  4DXC A;  1IEM A;  1JWV A;  3C4O A;  1MWR A;  4H8R A;  4IBX A;  4JXV A;  4N9K A;  4OOY A;  3VP4 A;  3ZG8 B;  4RVA A;  1QMF A;  3A3D A;  4WM9 A;  4EQI A;  3QNC A;  4DF6 A;  2OSU A;  3I7J A;  1PYY A;  4KG5 A;  3JYI A;  4EV4 A;  3BEB A;  4WBG A;  4GD6 A;  4KZ9 A;  5EVI A;  4K91 A;  5FQM A;  3HLF A;  3NI9 A;  5AQA A;  3QNB A;  4JBF A;  4MBH A;  1NZU A;  5HAP A;  4B88 A;  4IVK A;  5FQQ A;  1G68 A;  1WYC A;  2EXB A;  3ZG0 A;  3IWO A;  3NY4 A;  4OLG A;  3V39 A;  4OON A;  1CEF A;  1L0F A;  3VP1 A;  2XK1 A;  4JKT A;  4YFM A;  2HDU A;  3OCN A;  3ISG A;  1HD8 A;  5FSR A;  1M40 A;  3VFF A;  3IHA A;  2PU2 A;  1BSG A;  3ZNT A;  1NXY A;  3BFC A;  4KEN B;  1K57 A;  1JWZ A;  1OME A;  1TEM A;  1NYM A;  4FD8 A;  3OPP A;  4GZB A;  5A93 A;  4O7D A;  2EXA A;  1O07 A;  2OLU A;  3BFD A;  3ZVT A;  4MLL A;  5CER A;  1IYS A;  3GRJ A;  1BLH A;  3LEZ A;  5I94 A;  1GHM A;  3MXR A;  3OPL A;  5FA7 A;  2H0Y A;  2ZQD A;  2H0T A;  3HVF A;  5CXW A;  1XPB A;  2Y91 A;  1K6S A;  4DE3 A;  4BJP A;  3N6I A;  2FFF B;  3UO9 A;  5HL1 A;  2Z2L B;  2J8Y A;  2Y2Q A;  2EX9 A;  2V20 A;  4JXW A;  1BLS A;  1MWT A;  1NYY A;  2IWD A;  4X53 A;  4B4X A;  1TDL A;  3SS5 A;  4JLF A;  5M1A A;  2X02 A;  5GL9 A;  1IEL A;  1KDS A;  4UAA A;  2VGK A;  5FAP A;  1GA0 A;  3FWL A;  3WRZ A;  1YMS A;  4WEK A;  1M6K A;  3G34 A;  2ZM0 A;  4HES A;  4EBP A;  4MBK A;  1W79 A;  4QU3 A;  3S22 A; 
#chains in the Genus database with same CATH topology
 1BTL A;  4JF6 A;  3C4P A;  1IKG A;  1Y28 A;  3B3X A;  3WS5 A;  1WYB A;  2WAD A;  1FOF A;  1TVF A;  2VGJ A;  3WS0 A;  1KOU A;  4ME4 A;  3BLS A;  3PR6 A;  1XA1 A;  2WGV A;  1G5U A;  3PBO A;  2O99 A;  3Q7Z A;  5FI2 A;  3CHW P;  3HLW A;  3ZGA B;  4RA7 A;  1IYQ A;  4C6Y A;  1OT9 A;  4QY6 A;  1H8Y A;  1Z09 A;  3P98 A;  3F1P B;  4PHT A;  2B18 A;  2VV6 A;  2RCX A;  3TE8 A;  2LB5 A;  2J80 A;  2QYB A;  2R9W A;  3HUN A;  4KZ6 A;  5FQJ A;  4E6X A;  3BFG A;  1H5X A;  3TOI A;  4ZDX A;  1FR1 A;  4NEE D;  3A0V A;  2NUP C;  5JYP A;  4I5S A;  3CZD A;  4Y3I A;  1MKM A;  4HNB A;  5U47 A;  4X68 A;  2ZQA A;  2M7U A;  4WEJ A;  2W3H A;  1ERQ A;  1YKD A;  1QME A;  4JXG A;  4O01 A;  2J3T C;  1F5M A;  3RXX A;  4EET B;  3MMH A;  4WLA A;  2Q0O A;  1K54 A;  2Z2M B;  3F1N A;  3V67 A;  4DE1 A;  4N92 A;  1LLB A;  4IUK A;  3RXW A;  2IWC A;  2G2W A;  1IKI A;  1Y54 A;  2GDN A;  1FSY A;  3O86 A;  4O0P A;  1T19 A;  1YPR A;  4OVD A;  2FH5 A;  1S4R A;  2Y2G A;  5F6A A;  5CRF A;  2XDM A;  3HUO A;  3SZT A;  4EUV A;  4NXE A;  1LL8 A;  2UWX A;  1ONG A;  2PDR A;  5IHV A;  5CTN A;  3T4T A;  2QHK A;  3BQ8 A;  4KQQ A;  4LRX C;  1PW1 A;  2PBY A;  3VE3 A;  4XUZ A;  4Z9Q A;  2DRW A;  4X69 A;  2PD8 A;  4NG2 A;  4BWI A;  2PYP A;  4NK3 A;  2P74 A;  4E6W A;  3L7H A;  3OZH A;  3Q1F A;  4S2N C;  1XA7 A;  1V9Y A;  3SH7 A;  2JBF A;  1SKF A;  4DN0 A;  3BM6 A;  3U2A A;  1K56 A;  2AVX A;  1YLT A;  2JKF A;  1H8Z A;  3PBS A;  3A3J A;  1HZO A;  4WEL A;  4GHI B;  4XT2 B;  5E2E A;  5CGX A;  3MZE A;  1ALQ A;  1I2S A;  2KLI A;  1H8M A;  2Q9N A;  3O88 A;  4OP8 A;  5BOH A;  1STZ A;  3E2L A;  4ZJ3 A;  5HWV A;  3BW6 A;  3V3S A;  5TBM A;  4ESP A;  4PM5 A;  4CJN A;  4GNU A;  1XFQ A;  3W4P A;  1DJB A;  2PYR A;  2ZQ7 A;  3NOP C;  1OTA A;  5HWW A;  3A0S A;  4Y17 A;  2XD5 A;  3HLD A;  3T1S A;  1SHV A;  4GCZ A;  3BYD A;  2HV1 A;  4XXR A;  4Y0O A;  1NZO A;  3JVV A;  3NHQ A;  2W3F A;  4CLC E;  3P01 A;  3R7W B;  3DW0 A;  2QZ6 A;  3T4O A;  4WUJ A;  3T1X A;  1BUE A;  4WMC A;  3F1P A;  3BY9 A;  5HX9 A;  1JVJ A;  1V9Z A;  5KSH A;  1I2W A;  1K25 A;  2IWB A;  2V1B A;  1NRF A;  4WN5 A;  3C7V A;  4EXO A;  3DTM A;  3A3F A;  3ZYT A;  1YLW A;  2JKT I;  3C8C A;  4Z1W A;  2RL3 A;  4G3K A;  1FQG A;  5FI7 A;  3KSG A;  4GDN A;  5F5Y A;  2V8F A;  1U60 A;  4BL2 A;  3GQZ A;  4CQH A;  4B93 A;  2QJ5 A;  4BQM A;  5L2F A;  3Q07 A;  3AGD A;  1FSW A;  3ZG0 A;  3LCE A;  2V1A A;  1PI4 A;  1NLY A;  3VSK A;  2Z6D A;  2V9A A;  2J3W A;  4GKU A;  3UPO A;  1YSP A;  3VOL A;  2GJ3 A;  2HGV A;  5FDS A;  4LRY C;  1D7E A;  2ZBB A;  4PKY A;  3IBJ A;  4LV0 A;  4ZJ2 A;  2Y55 A;  5CEB A;  3BJN A;  1LHY A;  3UPN A;  5IU1 A;  4S2M A;  3RTY A;  3G4P A;  4KUO A;  1XJ6 A;  5HW3 A;  2HJ9 C;  1K38 A;  4FCF A;  3ZVW A;  4PM8 A;  3HUM A;  3OPH A;  4D2O A;  3FKV A;  2V0W A;  3S4X A;  1BLC A;  1PI5 A;  3IH8 A;  3MBZ A;  5CGS A;  3PYP A;  3LIE A;  1W63 Q;  2V2F F;  2ZQC A;  2XA7 S;  1JWV A;  4IBX A;  2W3G A;  3C4O A;  4HP4 A;  3KYQ A;  2OSU A;  1NLZ A;  3JYI A;  4X1M A;  4EV4 A;  4K91 A;  1OTE A;  3NI9 A;  5HD3 A;  2QKP A;  4IVK A;  4MDZ A;  1G68 A;  4XT2 A;  2EXB A;  4GHI A;  3DTE A;  3PXP A;  1DP8 A;  3NY4 A;  1L0F A;  3DBA A;  2XK1 A;  3KYZ A;  2HDU A;  1S1Z A;  1HD8 A;  2PU2 A;  1BSG A;  4ZRR A;  4GZB A;  1NYM A;  3OPP A;  5A93 A;  2OWH A;  1NWZ A;  1K0K A;  5DJT A;  2VKS A;  3LR3 A;  4MLL A;  3GRJ A;  1BLH A;  5HPI A;  4HHD A;  2H0Y A;  1PRQ A;  1XPB A;  2FFF B;  3JPU A;  1CQA A;  2Y2Q A;  1G28 A;  1J3W A;  3KO6 A;  3UMD A;  4UAA A;  2O9A A;  3WRZ A;  4WEK A;  3GDI A;  2EWV A;  3QP6 A;  3W4O A;  1KGG A;  3R7W A;  1S67 L;  4F94 A;  3SW1 A;  2XR0 A;  1W8Q A;  2OWJ A;  2PRF A;  4X55 A;  1NY0 A;  3H9W A;  3L9K A;  5EM1 A;  3T1Q B;  1K4F A;  3MQQ A;  1ONH A;  5GLD A;  2Y2H A;  4E3N A;  2P04 A;  5KIZ A;  2WUQ A;  2XSS A;  2XFT A;  2ZD8 A;  2ZJ9 A;  3HRE A;  3GR2 A;  5C5K A;  4KG6 A;  5EVI C;  4P6B A;  4HI4 A;  4S2I A;  3VV4 A;  1DY6 A;  3TW8 A;  3VP2 A;  4PMA A;  1X0O A;  1W63 M;  1KE0 A;  4L9G A;  4S2N A;  2Q9M A;  4WZ4 A;  1EI5 A;  3FG8 A;  3BQA A;  2HDR A;  3CG5 A;  2WKE A;  4MN5 A;  1T1A A;  4NET A;  1ES5 A;  2V0U A;  3IXD A;  2W3E A;  5DJU A;  4MCW A;  3UE0 A;  4MNR A;  1KGE A;  3BRM A;  2LB9 A;  3NC8 A;  5DTS A;  3T4S A;  4N1X A;  2EFU A;  3FKW A;  5HZH A;  1EW0 A;  3IWI A;  3F1O B;  2R78 A;  2XGN A;  5GLC A;  4R3J A;  2W27 A;  3MQ0 A;  4P0M A;  1JTG A;  3T4K A;  2OOL A;  3IH9 A;  2B95 A;  2QWS A;  2Y2P A;  1T1B A;  5EVE A;  4DJ2 A;  1YMX A;  4KZ8 A;  2L1M A;  4R3A A;  4QY5 A;  3M6H A;  1PW8 A;  1YT4 A;  4NKP A;  1FCO A;  4U3T A;  3MKE A;  4C3Q A;  1JWP A;  3QP8 A;  2HJE A;  3SH8 A;  4HBT A;  2WGI A;  5F1G A;  2HP5 A;  3SH9 A;  1HVB A;  4E3O A;  5TGF A;  3BY8 A;  5E2H A;  3EQU A;  4UQI M;  4IHQ A;  3A3E A;  1RGY A;  2R9X A;  4N9L A;  1N9L A;  3BEC A;  2PT7 A;  5EOO A;  4ZJ1 A;  2KX6 A;  2ZMV A;  3W8K A;  5J3W A;  3GEC A;  1SKO B;  2Y8H A;  4NXF A;  3QHY A;  4Q0I A;  1PNE A;  5EVI B;  3LID A;  4AFI A;  2J9O A;  5FAS A;  2INW A;  2GZA A;  1ZHH B;  5F69 A;  5HDD A;  4DKI A;  2X71 A;  4DXB A;  2V8C A;  1BYW A;  1Q2Q A;  2XF3 A;  4KQO A;  4FOF A;  4PAU A;  3LYX A;  5EPH A;  4KZA A;  2JC7 A;  1BZA A;  5L10 A;  1W5D A;  5E2F A;  5KSC A;  1N4O A;  4WYY A;  5GLA A;  5FL3 A;  3NJA A;  4GD8 A;  3E4Q A;  5F83 A;  4CLC D;  4LV1 A;  3KYE A;  4R6L A;  2GNX A;  3UB6 A;  3LIB A;  3M6B A;  3FPV A;  1XFN A;  1RCJ A;  3BLM A;  5HD5 A;  4UA6 A;  1NJ4 A;  3KSI A;  5EOE A;  3HJI A;  2EFX A;  3E2K A;  1L3L A;  4BL3 A;  4BMW A;  3UME A;  3ZCZ A;  4Q8I A;  3UDI A;  2O9B A;  4HQA A;  3S1Y A;  3ZG5 A;  2FFY A;  1XJ4 A;  3FPW A;  4B4Z A;  5CTM A;  4MBF A;  1PWG A;  1K56 D;  2QPN A;  1ES3 A;  3N8S A;  3T12 B;  3EOI A;  3BFE A;  1F2K A;  2HPB A;  2ZM2 A;  3NCK A;  1N9N A;  4R38 A;  4U0X A;  2WZX A;  2YKH A;  4I3J A;  5DFY A;  3S7N A;  1VHM A;  1TS0 A;  5I5L A;  1S1Y A;  1YM1 A;  3VOZ A;  2Y79 A;  4GN2 A;  4DE0 A;  3UDX A;  5EM0 A;  5CEC A;  4PM6 A;  3CMZ A;  4OPR A;  1BLP A;  1LL9 A;  3V3R A;  1S66 L;  5G4Y A;  3C38 A;  2BAS A;  3SOI A;  2WKP A;  3F1O A;  3B42 A;  2JKG A;  4LV3 A;  4BLM A;  2I9V A;  1CJF A;  4GLQ A;  1ZTU A;  3SS4 A;  1PIO A;  1HTZ A;  1UWP X;  2Y59 A;  4WMC D;  4B9O A;  1KE4 A;  1OTI A;  1MPL A;  4PM9 A;  5A91 A;  3M2K A;  3H82 B;  3W4Q A;  1IYP A;  4OQ0 A;  3UPP A;  4JF5 A;  4ID4 A;  5A92 A;  4U0T A;  2A2L A;  2P08 A;  1D1J A;  1YAX A;  1PWC A;  2B02 A;  4X6T A;  3IQA A;  4S2O A;  5EE8 A;  2ZQ9 A;  3M2J A;  3LFV A;  4FTX A;  1ZKJ A;  3MFD A;  4CPK A;  4Y13 A;  2PR6 A;  1NRJ A;  4RYE A;  5F82 A;  3T4Q A;  3EEA A;  1OJG A;  1G6O A;  3GTC A;  4FUW A;  4QJG A;  1KVM A;  4H8R A;  4OOY A;  4N9K A;  1SKO A;  1QMF A;  2ACG A;  4WM9 A;  4EQI A;  2PD7 A;  4YOF A;  4KG5 A;  1P9R A;  5EVI A;  5FQM A;  5AQA A;  3ULF A;  3QNB A;  1OJ5 A;  4JBF A;  1NZU A;  3IX4 A;  1Y4O A;  3IWO A;  3DTI A;  4OON A;  4HH3 A;  3S7P A;  1F98 A;  3CLO A;  3TRC A;  4LLO B;  5FSR A;  1M40 A;  3VFF A;  3ZNT A;  3ICY A;  1K57 A;  1JWZ A;  1TEM A;  4FD8 A;  3LIF A;  3A0R A;  1A0K A;  2WKQ A;  4O7D A;  2EXA A;  2PAV P;  5CER A;  3MXR A;  2ZQD A;  3HVF A;  3O5Y A;  2Y91 A;  2KOI A;  1K6S A;  4HJ6 A;  2Z2L B;  3RFB A;  3S7Q A;  4F3L B;  2V20 A;  1BLS A;  2VK3 A;  3QP5 A;  4X53 A;  3SS5 A;  5GL9 A;  1KDS A;  2W0N A;  3EGD C;  3FWL A;  2ZOH A;  2ZM0 A;  4QU3 A;  2JE5 A;  1SCW A;  2L4R A;  1IFQ A;  4QHC A;  4K0X A;  3N4I A;  4DJ3 A;  3UY6 A;  3FV7 A;  2I72 A;  1K55 A;  1D06 A;  4Y5F A;  3CAX A;  2HDQ A;  5DVA A;  5CGW A;  5J7E A;  3IT9 A;  5HDS A;  1CK3 A;  4EES A;  5KZH A;  3D4F A;  4IUH A;  4I3I A;  1MBL A;  5IT5 A;  3D9Y A;  1PFL A;  3G6O A;  5D3O A;  4NXG A;  2VV7 A;  1YLJ A;  3U4L P;  3Q82 A;  1MWU A;  5FDH A;  4BEN A;  3P09 A;  3T4L A;  2K7S A;  3MXQ A;  5AQB A;  2WGW B;  3LIA A;  1OTB A;  4Y15 A;  1FCM A;  4UEY A;  1L2S A;  4NXB A;  3IXG A;  2VX8 A;  2A3U A;  4KZ4 A;  4OP5 A;  2J3T D;  3NDE A;  2Y2M A;  5DKK A;  1K4E A;  4P6Z M;  4HH2 A;  2QMI A;  4BBU A;  1GCE A;  3OPR A;  1ZG6 A;  3K3D A;  2C5W B;  1ES4 A;  3UNW A;  2XD1 A;  2QJ7 A;  4QB8 A;  3BWL A;  3ITB A;  4S2J A;  5FAT A;  1JTD A;  1JNU A;  4X56 A;  1MXO A;  4YWZ A;  4EER A;  4DDY A;  3PBR A;  4LPZ A;  3UB9 A;  3H82 A;  3PBQ A;  3MS6 A;  2G2U A;  4GOG A;  2VJW A;  4R4R A;  1ZG4 A;  1DJC A;  2DNS A;  4HP9 A;  3LY4 A;  3BFF A;  3G31 A;  1GSV A;  2JHE A;  3AGF A;  3IF5 A;  4RQ9 A;  1KDW A;  4PM7 A;  4IJG A;  3K3C A;  1S0W A;  4L0L A;  3HL9 A;  2VV8 A;  5HDC A;  5EVL A;  5FQI A;  3MXS A;  3UB5 P;  2JCH A;  3LEQ A;  4GB7 A;  4EEU A;  2XRO A;  5EUA A;  4QPR A;  2Y2N A;  1GHP A;  5A90 A;  2E8I A;  2ZC6 B;  1E3U A;  2VGL M;  5K5B A;  4E3I A;  2JKR I;  2W1R A;  1YLY A;  1E4D A;  4PKY G;  2GX5 A;  4GDB A;  4LCM A;  5L8M A;  2WAF A;  4P85 A;  1XKZ A;  2Y4A A;  4OKP A;  4LV2 A;  5FAQ A;  2OV5 A;  2EX2 A;  4HEF A;  3IX3 A;  3WRT A;  3CIT A;  4R0Q A;  5EEC A;  3OCL A;  3NEC A;  1YQS A;  1SZV A;  1P9W A;  3V50 A;  2WZZ A;  1PZP A;  5DF8 A;  5DF9 A;  4F3L A;  5HAR A;  1I5Q A;  4EWF A;  5TR7 A;  4KQR A;  4MN7 A;  1K57 C;  1XP4 A;  5L09 A;  2JN7 A;  1L0D A;  1AWI A;  3PBT A;  3S7O A;  1XGJ A;  1WE4 A;  1YLZ A;  3LGO A;  4RX3 A;  4BD0 A;  5MC7 A;  4CLC B;  4MN6 A;  3LO7 A;  3HCY A;  3MQO A;  3IXH A;  5CHJ A;  3LIC A;  2L0W A;  4I39 A;  4KQD A;  5HAQ A;  5JYO A;  4EU0 A;  4UHU A;  3GSG A;  4WZ5 C;  3UE3 A;  3DTK A;  4A5R A;  3LI8 A;  3E0Y A;  5HPF A;  1L0G A;  4EBN A;  4Y0T A;  4UA9 A;  1T18 A;  1LSX A;  3IS2 B;  5DF7 A;  4KZB A;  5AVE A;  2PR5 A;  3MZD A;  4EEP A;  4DMZ A;  2WYX A;  1N9O A;  3NDG A;  2Y2O A;  1K55 C;  2WGW A;  2C6W B;  2V1Z A;  4LFU A;  1XJ2 A;  2FZ0 A;  2J7V A;  3RH8 B;  4GS9 B;  2PU4 A;  1BT5 A;  4JXS A;  3LR5 A;  5GHZ A;  4YIN A;  3IWQ A;  4O8G A;  4BBT A;  1ACF A;  3ZDJ A;  3VSL A;  4QD4 A;  4Y0U A;  1ERO A;  4DRT A;  4ZTK A;  5M19 A;  1VET B;  1C3B A;  2ZLY A;  4UA7 A;  3DWK A;  4EUZ A;  3K2N A;  3TSG A;  3OBF A;  3EQV A;  3WS1 A;  4K0W A;  1LSV A;  1ESU A;  4JGQ A;  2ZC7 A;  2VGL S;  2H28 A;  3G2Z A;  2VA0 A;  1FIK A;  3DWZ A;  2ZM8 A;  4LEN A;  3LR4 A;  2Y2K A;  4M4X A;  3HLC A;  2IA2 A;  3LI9 A;  4G3W A;  4JPM A;  4K08 A;  2ZMA A;  4IVI A;  4KUK A;  4HIA A;  3HJK A;  3GV9 A;  4PPR A;  1L0E A;  3DAV A;  3HBR A;  4HY8 A;  2HP9 A;  5KMW A;  5J8X A;  1UGU A;  2JKR M;  1K6R A;  4ZAM A;  1LI9 A;  1GSX A;  1ODV A;  1VQQ A;  2BLS A;  5L07 A;  2P9V B;  3ZNY A;  1UWN X;  1IOU A;  3IF6 C;  2A24 B;  3AGE A;  3PTE A;  1LL5 A;  1G6A A;  3E4O A;  1TDG A;  3VFH A;  1IEM A;  3VP4 A;  3ZG8 B;  4ARZ B;  1H3Q A;  2VLG A;  3QNC A;  3I7J A;  1PYY A;  1MZU A;  4WBG A;  3H7W B;  3OOV A;  2CMN A;  3HLF A;  2ZMF A;  1WYC A;  3NOT C;  3JVU A;  3LUQ A;  3V39 A;  1CEF A;  3VP1 A;  4JKT A;  1NXY A;  3BFC A;  4KEN B;  3C2W A;  1O07 A;  3BFD A;  2M1C A;  3OPL A;  5FA7 A;  2D02 A;  2H0T A;  3ZQ5 A;  5FEF A;  1OTD A;  2ZOI A;  3CI6 A;  3MF0 A;  4DE3 A;  3N6I A;  4D60 A;  2J8Y A;  1S4S A;  1T1C A;  4CLC A;  1MWT A;  2Z6C A;  4B4X A;  1TDL A;  3UB7 A;  2X02 A;  1IEL A;  2VGK A;  1GA0 A;  1YMS A;  1M6K A;  3G34 A;  1TS7 A;  1TF1 A;  4EBP A;  3MSH A;  2W1T B;  1MKI A;  1OT6 A;  1H0M A;  4UQI S;  3IS2 A;  4OLD A;  2H10 A;  1DP6 A;  1F9I A;  4OPQ A;  5CHU A;  1MC0 A;  4JGP A;  5EVI D;  3KX0 X;  4KZ5 A;  1FCN A;  1KGF A;  3TG9 A;  4C75 A;  2WKI A;  3E98 A;  2ZC3 B;  4ETZ A;  3MR0 A;  1FIL A;  2HF6 A;  3KSH A;  2WK0 A;  3LR0 A;  4BBV A;  2E8J A;  4GS9 A;  3UE1 A;  2PBD P;  3T4J A;  2WKH A;  3KSF A;  5FQK A;  3C7U A;  3IF6 B;  5HAI A;  1ERM A;  1MY8 A;  3HLG A;  3ZG9 B;  5DFX A;  3MFX A;  3Q7V B;  3UDF A;  1GHI A;  1VET A;  2K31 A;  2XA7 M;  2A49 A;  2NUT C;  1Z6F A;  4RX2 A;  1TD5 A;  3FYZ A;  3IXB A;  3B47 A;  3GVB A;  3GMW A;  5HL6 A;  5DTT A;  1BUL A;  3ITA A;  1CI9 A;  2ZC4 B;  2XEP A;  4EQ1 A;  1LT0 A;  2XFS A;  3VP3 A;  1ZC2 A;  1S6R A;  4X1L A;  4KG2 A;  2O0Y A;  5EFW A;  5FQ9 A;  3B33 A;  5F68 A;  3WWX A;  3MJQ A;  5HSQ A;  4P87 A;  5E2G A;  2XLN A;  5AVF A;  1VM1 A;  4DDS A;  1YLP A;  4OQI A;  4II7 A;  1RGZ A;  1VEU B;  5DTK A;  2CC1 A;  4KZ7 A;  5G4Z A;  3N7W A;  3QP4 A;  3NIA A;  2D01 A;  1LSW A;  3D3O A;  3IBR A;  5TFQ A;  4OPY A;  5IS1 A;  5M18 A;  2P9V A;  4KZ3 A;  2J9P A;  3E4P A;  1KVL A;  2XRN A;  3P7N A;  3SS3 A;  3T50 A;  4FH4 A;  4WZ5 A;  4EW7 A;  2EA9 A;  1TS8 A;  2A24 A;  2XQZ A;  4H6J B;  3CWF A;  4Y7P A;  4N1H A;  3MZF A;  5LBR A;  3WS4 A;  4OOL A;  4HJ4 A;  2VZW A;  4ARZ A;  1XXM A;  5FAO A;  4Q0J A;  1Q2P A;  4IED A;  1DRM A;  3CPT B;  3LY3 A;  3H7W A;  4S2K A;  3IHB A;  2B5R A;  4IBR A;  4FSF A;  3VE4 A;  3G30 A;  3NOU C;  3Q81 A;  1P97 A;  1OPX A;  4HJ3 A;  2ZQ8 A;  4OOM A;  4EBL A;  3HLE A;  4GW9 A;  2W3D A;  1E25 A;  2OLV A;  2UV0 E;  4OPZ A;  3CUE A;  2M7V A;  3C30 A;  5HFO A;  3QP1 A;  4OQG A;  2HP6 A;  4R3B A;  4MEZ A;  3VMA A;  4E3J A;  2EWW A;  3UB8 A;  3ZG7 B;  1ES2 A;  1K54 C;  1PZO A;  4G3V A;  2Y2L A;  3R4K A;  3MKF A;  1KE3 A;  4HBU A;  2DCF A;  1XX2 A;  4FH2 A;  3VP0 A;  2W1T A;  4LCL A;  4DE2 A;  4E3K A;  4BD1 A;  1SDE A;  5CHM A;  5DKL A;  1DP9 A;  4L9F A;  1J9M A;  3T1R A;  1DJA A;  3G2Y A;  3O3V A;  2ZL1 B;  2VEA A;  5AQ9 A;  4CLC C;  1E3U D;  2OAQ 1;  3FZC A;  2Y2I A;  2KDK A;  1IYO A;  1MWS A;  1PWD A;  1N9B A;  4E04 A;  1HLU P;  4S2L A;  4ZBE A;  4L9E A;  3A3I A;  2O9C A;  5FEG A;  3N8R A;  3IF6 A;  4HOI A;  5TJJ A;  4WL9 A;  5GHX A;  3Q7V A;  1P0Z A;  3OC2 A;  4LRZ E;  3WS2 A;  2EX6 A;  4Y2F A;  2K2N A;  1XGI A;  3HLB A;  2HZ5 A;  5J4E A;  4X25 A;  1CF0 A;  4OQH A;  1WA9 A;  3TJZ C;  2XH9 A;  5AJG A;  3EGX C;  3VOY A;  3ZFZ A;  2H5S A;  2ZC5 B;  4XUX A;  3G35 A;  1CEG A;  2G7U A;  3RJU A;  3PAG A;  2WAE A;  3G32 A;  3W2Z A;  4JF4 A;  2BG1 A;  3NBL A;  2YKF A;  3N8L A;  1XJ3 A;  4JGO A;  3PBN A;  2Y2J A;  1VB6 A;  4E3L A;  1VEU A;  2PHY A;  3NUL A;  3ZHH A;  4ETX A;  5GHY A;  4R23 A;  2JKT M;  5FI6 A;  4R1G A;  5F1F A;  3PAE A;  1YSQ A;  1LI0 A;  2MJ6 A;  2X01 A;  1W8Y A;  4R4S A;  3EEH A;  3F1N B;  1SDN A;  5CED A;  4S2P A;  4OH0 A;  5GLB A;  4Q0H A;  4H6J A;  3V5M A;  3O87 A;  1FR6 A;  1RP5 A;  5AQ7 A;  3IX8 A;  4MMN A;  1ESI A;  3CPT A;  1CI8 A;  1AXB A;  2DMW A;  3C5A A;  4I3A A;  4JGR A;  1W7F A;  2HDS A;  3CJM A;  5E43 A;  5G18 A;  4M3K A;  1O7E A;  2EX8 A;  1GA9 A;  3UN7 A;  4E3M A;  1EWZ A;  1GSW A;  4JXV A;  4DXC A;  1MWR A;  2P7J A;  1TS6 A;  4P6Z S;  4RVA A;  3A3D A;  3OLO A;  5CX7 A;  4DF6 A;  2WKR A;  3BEB A;  4GD6 A;  4KZ9 A;  3QP2 A;  4MBH A;  5HAP A;  4B88 A;  5FQQ A;  4GJ4 A;  4OLG A;  4WF0 A;  4LGW A;  4YFM A;  3OCN A;  3ISG A;  4R70 A;  3IHA A;  1OME A;  2BTF P;  3D72 A;  2OLU A;  3ZVT A;  5A8B A;  1IYS A;  3LEZ A;  5I94 A;  5EV0 A;  3CUE C;  1GHM A;  3UE6 A;  3FC7 A;  5HWT A;  3PHY A;  3EWK A;  5CXW A;  4BJP A;  3UO9 A;  5HL1 A;  4I38 A;  4QWO A;  2EX9 A;  4JXW A;  5TBM B;  1NYY A;  2IWD A;  4YNR A;  2OAP 1;  4JLF A;  5M1A A;  2ZL1 A;  5FAP A;  4HES A;  4MBK A;  1W79 A;  3S22 A; 
#chains in the Genus database with same CATH homology
 3W4O A;  2JE5 A;  1KGG A;  1MKI A;  1SCW A;  1BTL A;  4JF6 A;  3C4P A;  4F94 A;  4QHC A;  1IKG A;  4K0X A;  3B3X A;  3N4I A;  1WYB A;  3WS5 A;  2WAD A;  4OLD A;  2H10 A;  1FOF A;  1TVF A;  2VGJ A;  3WS0 A;  3UY6 A;  3FV7 A;  2I72 A;  4OPQ A;  5CHU A;  2XR0 A;  1K55 A;  1W8Q A;  2HDQ A;  3BLS A;  1XA1 A;  5EVI D;  5DVA A;  2WGV A;  5CGW A;  4KZ5 A;  3IT9 A;  1FCN A;  1KGF A;  3TG9 A;  3PBO A;  4X55 A;  4C75 A;  1CK3 A;  1NY0 A;  3Q7Z A;  5FI2 A;  1K4F A;  3HLW A;  3ZGA B;  5KZH A;  1ONH A;  3D4F A;  2Y2H A;  5GLD A;  2WKI A;  4RA7 A;  1IYQ A;  4E3N A;  1MBL A;  4C6Y A;  2ZC3 B;  4QY6 A;  1H8Y A;  3P98 A;  2WK0 A;  2WUQ A;  2XFT A;  2ZD8 A;  2ZJ9 A;  3HRE A;  3GR2 A;  2RCX A;  5D3O A;  4KG6 A;  5EVI C;  1YLJ A;  3Q82 A;  4P6B A;  1MWU A;  5FDH A;  4BEN A;  3UE1 A;  4S2I A;  3P09 A;  2R9W A;  2WKH A;  5FQK A;  1DY6 A;  3C7U A;  3HUN A;  4KZ6 A;  5FQJ A;  3VP2 A;  3IF6 B;  5HAI A;  5AQB A;  2WGW B;  1ERM A;  1MY8 A;  4E6X A;  3BFG A;  3HLG A;  3ZG9 B;  4PMA A;  1H5X A;  3Q7V B;  1FCM A;  3UDF A;  1KE0 A;  3TOI A;  4ZDX A;  1L2S A;  1FR1 A;  1GHI A;  4S2N A;  2Q9M A;  4WZ4 A;  1EI5 A;  3IXG A;  2A3U A;  4KZ4 A;  5JYP A;  3CZD A;  2HDR A;  4OP5 A;  3CG5 A;  3NDE A;  2Y2M A;  2A49 A;  2WKE A;  4RX2 A;  1K4E A;  1Z6F A;  5U47 A;  3FYZ A;  4X68 A;  3IXB A;  2QMI A;  2ZQA A;  4NET A;  3GVB A;  3GMW A;  1ES5 A;  1GCE A;  4WEJ A;  3OPR A;  3IXD A;  1BUL A;  1ZG6 A;  3ITA A;  5DTT A;  2C5W B;  1ES4 A;  1CI9 A;  3UNW A;  1ERQ A;  2XD1 A;  3UE0 A;  2ZC4 B;  2XEP A;  4MNR A;  1QME A;  4QB8 A;  1KGE A;  2XFS A;  3VP3 A;  3BRM A;  1ZC2 A;  3NC8 A;  4JXG A;  1S6R A;  5DTS A;  4KG2 A;  3ITB A;  4S2J A;  5FQ9 A;  3WWX A;  5FAT A;  1JTD A;  3RXX A;  4N1X A;  4X56 A;  2EFU A;  3FKW A;  4P87 A;  1MXO A;  3IWI A;  5E2G A;  1K54 A;  2XLN A;  1VM1 A;  2Z2M B;  4DDS A;  1YLP A;  4DDY A;  3PBR A;  4OQI A;  4DE1 A;  1RGZ A;  4N92 A;  2XGN A;  3PBQ A;  5GLC A;  1LLB A;  4R3J A;  3RXW A;  2IWC A;  2G2W A;  5DTK A;  2G2U A;  4P0M A;  2CC1 A;  1IKI A;  1Y54 A;  4KZ7 A;  2GDN A;  1JTG A;  1FSY A;  3N7W A;  3O86 A;  4GOG A;  3NIA A;  3IH9 A;  4R4R A;  2Y2P A;  1ZG4 A;  4OVD A;  1DJC A;  2Y2G A;  2DNS A;  1YMX A;  4KZ8 A;  5CRF A;  4QY5 A;  3M6H A;  3LY4 A;  4OPY A;  5TFQ A;  2XDM A;  3BFF A;  3G31 A;  5M18 A;  2P9V A;  4KZ3 A;  2J9P A;  3AGF A;  3IF5 A;  1PW8 A;  3HUO A;  1KVL A;  1KDW A;  1YT4 A;  4PM7 A;  3SS3 A;  1FCO A;  4FH4 A;  2UWX A;  4U3T A;  1S0W A;  1ONG A;  3MKE A;  3HL9 A;  4L0L A;  4WZ5 A;  4C3Q A;  1JWP A;  2XQZ A;  5EVL A;  5FQI A;  3MXS A;  4Y7P A;  2JCH A;  4N1H A;  5IHV A;  3MZF A;  3SH8 A;  4HBT A;  2WGI A;  5F1G A;  4GB7 A;  4OOL A;  2HP5 A;  5CTN A;  3WS4 A;  5EUA A;  3SH9 A;  1XXM A;  5FAO A;  4KQQ A;  2Y2N A;  1GHP A;  1HVB A;  1Q2P A;  5A90 A;  2E8I A;  4IED A;  2ZC6 B;  4E3O A;  3LY3 A;  1PW1 A;  2PBY A;  1E3U A;  5TGF A;  4S2K A;  5E2H A;  4XUZ A;  3EQU A;  2B5R A;  2DRW A;  3IHB A;  4Z9Q A;  4E3I A;  4IBR A;  4X69 A;  3A3E A;  1RGY A;  2R9X A;  4FSF A;  4N9L A;  4XUX A;  3BEC A;  2P74 A;  4NK3 A;  4E6W A;  1YLY A;  5EOO A;  4ZJ1 A;  3OZH A;  3G30 A;  3Q81 A;  3W8K A;  1E4D A;  3Q1F A;  4GDB A;  2ZQ8 A;  4S2N C;  4LCM A;  4OOM A;  4EBL A;  3HLE A;  1XA7 A;  2WAF A;  3QHY A;  1XKZ A;  2Y4A A;  4P85 A;  1E25 A;  4OKP A;  3SH7 A;  2OLV A;  2JBF A;  1SKF A;  4LV2 A;  4OPZ A;  5FAQ A;  3BM6 A;  5EVI B;  2J9O A;  1K56 A;  5FAS A;  2OV5 A;  1YLT A;  1H8Z A;  3PBS A;  3A3J A;  2EX2 A;  2X71 A;  4DKI A;  4HEF A;  5HFO A;  4DXB A;  1HZO A;  4OQG A;  4WEL A;  3WRT A;  5E2E A;  4R0Q A;  2HP6 A;  5CGX A;  5EEC A;  4R3B A;  3MZE A;  1ALQ A;  1I2S A;  3OCL A;  4MEZ A;  1Q2Q A;  2XF3 A;  4KQO A;  1YQS A;  3VMA A;  3V50 A;  5EPH A;  2WZZ A;  2Q9N A;  4KZA A;  4E3J A;  3O88 A;  1PZP A;  4OP8 A;  5DF8 A;  5BOH A;  3E2L A;  5DF9 A;  2JC7 A;  1BZA A;  3ZG7 B;  1W5D A;  1ES2 A;  1K54 C;  1PZO A;  5E2F A;  4ZJ3 A;  3V3S A;  5KSC A;  5HAR A;  1I5Q A;  2Y2L A;  1N4O A;  5TR7 A;  4EWF A;  4WYY A;  4KQR A;  4PM5 A;  4CJN A;  4GNU A;  3MKF A;  5GLA A;  1KE3 A;  4HBU A;  4GD8 A;  1K57 C;  1XP4 A;  3W4P A;  5F83 A;  1DJB A;  2DCF A;  4LV1 A;  2ZQ7 A;  1XX2 A;  1L0D A;  4FH2 A;  3PBT A;  3VP0 A;  1XGJ A;  1WE4 A;  4LCL A;  4DE2 A;  3M6B A;  2XD5 A;  3HLD A;  4E3K A;  4BD1 A;  1YLZ A;  4RX3 A;  1SDE A;  4BD0 A;  1RCJ A;  3LO7 A;  5CHJ A;  3IXH A;  3BLM A;  5CHM A;  1SHV A;  1J9M A;  4UA6 A;  1NJ4 A;  1DJA A;  3G2Y A;  3O3V A;  5EOE A;  5HAQ A;  5JYO A;  5AQ9 A;  1E3U D;  3BYD A;  2EFX A;  4UHU A;  4XXR A;  3E2K A;  3GSG A;  3FZC A;  4WZ5 C;  4Y0O A;  3UE3 A;  4BL3 A;  2Y2I A;  1NZO A;  3ZCZ A;  4A5R A;  4Q8I A;  3UDI A;  1L0G A;  3DW0 A;  3S1Y A;  4EBN A;  2QZ6 A;  1IYO A;  3ZG5 A;  4Y0T A;  1BUE A;  1MWS A;  4UA9 A;  2FFY A;  4WMC A;  1PWD A;  5DF7 A;  1N9B A;  4KZB A;  4B4Z A;  5HX9 A;  4S2L A;  4ZBE A;  1JVJ A;  5CTM A;  4MBF A;  5KSH A;  3A3I A;  1I2W A;  1K25 A;  3MZD A;  2IWB A;  1PWG A;  1NRF A;  1K56 D;  2QPN A;  2WYX A;  3C7V A;  1ES3 A;  3N8S A;  3DTM A;  3NDG A;  2Y2O A;  1K55 C;  3BFE A;  3A3F A;  3N8R A;  3IF6 A;  2WGW A;  1YLW A;  2C6W B;  2HPB A;  2ZM2 A;  2V1Z A;  3NCK A;  5GHX A;  2RL3 A;  3Q7V A;  1FQG A;  2J7V A;  4U0X A;  2WZX A;  3OC2 A;  5FI7 A;  4GDN A;  3WS2 A;  2EX6 A;  2PU4 A;  1XGI A;  1U60 A;  1BT5 A;  4JXS A;  3HLB A;  1YM1 A;  3VOZ A;  4OQH A;  5GHZ A;  4YIN A;  3IWQ A;  4BL2 A;  3GQZ A;  4GN2 A;  2XH9 A;  3VOY A;  3ZDJ A;  3ZFZ A;  3VSL A;  2H5S A;  4DE0 A;  4QD4 A;  4BQM A;  3UDX A;  4Y0U A;  5L2F A;  3Q07 A;  2ZC5 B;  5CEC A;  3AGD A;  1FSW A;  1CEG A;  1ERO A;  3G35 A;  3CMZ A;  4PM6 A;  4OPR A;  1BLP A;  3LCE A;  3RJU A;  4DRT A;  3PAG A;  1PI4 A;  2WAE A;  4ZTK A;  5M19 A;  1LL9 A;  3G32 A;  1C3B A;  3VSK A;  4JF4 A;  2ZLY A;  2BG1 A;  3NBL A;  4UA7 A;  3V3R A;  3DWK A;  4GKU A;  4EUZ A;  3N8L A;  3TSG A;  3UPO A;  3PBN A;  2Y2J A;  3EQV A;  3WS1 A;  4K0W A;  3SOI A;  1ESU A;  2ZC7 A;  4E3L A;  4LV3 A;  3G2Z A;  4BLM A;  3DWZ A;  3ZHH A;  4LV0 A;  2ZM8 A;  5GHY A;  4R23 A;  3SS4 A;  4LEN A;  1PIO A;  5FI6 A;  4R1G A;  2Y55 A;  4ZJ2 A;  2Y2K A;  5CEB A;  5F1F A;  1HTZ A;  3HLC A;  3PAE A;  1LHY A;  2Y59 A;  4JPM A;  4S2M A;  4WMC D;  3UPN A;  1KE4 A;  2ZMA A;  3G4P A;  4IVI A;  1LI0 A;  1MPL A;  2X01 A;  1W8Y A;  4R4S A;  4PM9 A;  5A91 A;  5HW3 A;  3M2K A;  1SDN A;  5CED A;  1K38 A;  4S2P A;  3GV9 A;  3W4Q A;  1IYP A;  4OQ0 A;  3UPP A;  4FCF A;  4OH0 A;  4JF5 A;  4ID4 A;  4PPR A;  3ZVW A;  1L0E A;  4PM8 A;  5A92 A;  5GLB A;  3HUM A;  3HBR A;  4U0T A;  3OPH A;  2HP9 A;  5KMW A;  5J8X A;  4D2O A;  3V5M A;  1PWC A;  1K6R A;  3O87 A;  3FKV A;  3S4X A;  4X6T A;  1FR6 A;  4ZAM A;  1LI9 A;  1BLC A;  1PI5 A;  3IQA A;  4S2O A;  5EE8 A;  1RP5 A;  1VQQ A;  2ZQ9 A;  5AQ7 A;  2BLS A;  3M2J A;  3IH8 A;  3MBZ A;  1ESI A;  1ZKJ A;  3MFD A;  5CGS A;  4CPK A;  2P9V B;  1CI8 A;  1AXB A;  3ZNY A;  3C5A A;  4RYE A;  5F82 A;  1W7F A;  2HDS A;  3IF6 C;  3CJM A;  2V2F F;  5E43 A;  2ZQC A;  3AGE A;  3GTC A;  3PTE A;  4M3K A;  1LL5 A;  1O7E A;  1G6A A;  2EX8 A;  5G18 A;  1GA9 A;  1TDG A;  4QJG A;  3UN7 A;  1KVM A;  4E3M A;  1EWZ A;  3VFH A;  4DXC A;  1IEM A;  1JWV A;  3C4O A;  1MWR A;  4H8R A;  4IBX A;  4JXV A;  4N9K A;  4OOY A;  3VP4 A;  3ZG8 B;  4RVA A;  1QMF A;  3A3D A;  4WM9 A;  4EQI A;  3QNC A;  4DF6 A;  2OSU A;  3I7J A;  1PYY A;  4KG5 A;  3JYI A;  4EV4 A;  3BEB A;  4WBG A;  4GD6 A;  4KZ9 A;  5EVI A;  4K91 A;  5FQM A;  3HLF A;  3NI9 A;  5AQA A;  3QNB A;  4JBF A;  4MBH A;  1NZU A;  5HAP A;  4B88 A;  4IVK A;  5FQQ A;  1G68 A;  1WYC A;  2EXB A;  3ZG0 A;  3IWO A;  3NY4 A;  4OLG A;  3V39 A;  4OON A;  1CEF A;  1L0F A;  3VP1 A;  2XK1 A;  4JKT A;  4YFM A;  2HDU A;  3OCN A;  3ISG A;  1HD8 A;  5FSR A;  1M40 A;  3VFF A;  3IHA A;  2PU2 A;  1BSG A;  3ZNT A;  1NXY A;  3BFC A;  4KEN B;  1K57 A;  1JWZ A;  1OME A;  1TEM A;  1NYM A;  4FD8 A;  3OPP A;  4GZB A;  5A93 A;  4O7D A;  2EXA A;  1O07 A;  2OLU A;  3BFD A;  3ZVT A;  4MLL A;  5CER A;  1IYS A;  3GRJ A;  1BLH A;  3LEZ A;  5I94 A;  1GHM A;  3MXR A;  3OPL A;  5FA7 A;  2H0Y A;  2ZQD A;  2H0T A;  3HVF A;  5CXW A;  1XPB A;  2Y91 A;  1K6S A;  4DE3 A;  4BJP A;  3N6I A;  2FFF B;  3UO9 A;  5HL1 A;  2Z2L B;  2J8Y A;  2Y2Q A;  2EX9 A;  2V20 A;  4JXW A;  1BLS A;  1MWT A;  1NYY A;  2IWD A;  4X53 A;  4B4X A;  1TDL A;  3SS5 A;  4JLF A;  5M1A A;  2X02 A;  5GL9 A;  1IEL A;  1KDS A;  4UAA A;  2VGK A;  5FAP A;  1GA0 A;  3FWL A;  3WRZ A;  1YMS A;  4WEK A;  1M6K A;  3G34 A;  2ZM0 A;  4HES A;  4EBP A;  4MBK A;  1W79 A;  4QU3 A;  3S22 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...