2OWJA

Structure of an early-microsecond photolyzed state of co-bjfixlh, dark state
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
116
structure length
116
Chain Sequence
DAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRYRTTSDPHIIGIGRIVTGKRRDGTTFPMHLSIGEMQSGGEPYFTGFVRDLTEHQQTQARLQEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sensor protein fixL
publication title Time-resolved crystallographic studies of the heme domain of the oxygen sensor FixL: structural dynamics of ligand rebinding and their relation to signal transduction.
pubmed doi rcsb
source organism Bradyrhizobium japonicum
molecule tags Oxygen storage/transport
total genus 32
structure length 116
sequence length 116
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2007-02-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2owjA00
3LI9A 5A8BA 3ICYA 1S4RA 1XFQA 3LIEA 1P97A 3E4OA 1OTIA 3F1NB 4GW9A 2KDKA 3MQQA 3UMEA 3F1PB 5DKKA 2VV7A 4EESA 2CMNA 2HV1A 2V1BA 4GHIA 3CWFA 4HI4A 1ODVA 5TBMA 3IBRA 1P0ZA 4R70A 4HY8A 1S66L 2PDRA 3UB9A 2A24A 4EW7A 4LRZE 4JGRA 5F68A 2PR5A 4LLOB 2L1MA 3NJAA 4K08A 4BBTA 3EEHA 4HJ3A 1V9ZA 1OTAA 1KOUA 2V1AA 3LIFA 4I5SA 4RQ9A 4DJ2A 1DP9A 3BY9A 3H7WA 2VLGA 3UB7A 1T1CA 4HH2A 3LI8A 1UGUA 2PYPA 3NOUC 4R3AA 3ULFA 2L4RA 3C8CA 3P7NA 3MJQA 1V9YA 1TS0A 3GDIA 3K3DA 4WUJA 1D06A 4I39A 5HWTA 5HZHA 3UE6A 4HHDA 3F1OA 4HH3A 1WA9A 5DJTA 4R38A 1N9NA 5AVFA 2GJ3A 4WLAA 4EQ1A 2QKPA 4HOIA 2QJ5A 4BBVA 1DP6A 1LT0A 5J4EA 5G4YA 3EWKA 3GECA 3ZQ5A 4YWZA 4XT2A 1OT9A 3SW1A 1S67L 3IS2A 3HJIA 5AVEA 4PKYA 5HWVA 4LRYC 4E04A 2BASA 1N9LA 1T18A 1T1AA 1OTDA 4DJ3A 3T50A 2QWSA 2WKQA 1S1ZA 5HD5A 3A0RA 1LL8A 2PR6A 3CAXA 4MN6A 2JHEA 4HJ6A 1JNUA 3MR0A 2L0WA 4EERA 3RH8B 4NXEA 3UB6A 1T19A 4HQAA 2Z6DA 4PKYG 2ZOHA 1XJ2A 1BYWA 3VE4A 2EA9A 4F3LA 3OLOA 3E4QA 2R78A 2VV6A 4BBUA 1S4SA 1TS7A 1X0OA 3H82A 1OTBA 3FG8A 2K7SA 4NXFA 5HDSA 4GHIB 2VV8A 3LYXA 5TBMB 1XFNA 1GSVA 5F6AA 5F5YA 4H6JA 2V0UA 1LSVA 4L9EA 2PYRA 4GS9A 1T1BA 2WKPA 2A24B 3LICA 3MFXA 5HD3A 4I3IA 4EEUA 4I3AA 4MN5A 5HDDA 4LPZA 5HDCA 3F1NA 1XJ3A 1OJ5A 3FC7A 4KUOA 2Z6CA 3F1PA 3C2WA 5DJUA 4EXOA 5J7EA 3G6OA 3MXQA 4HP4A 3MQOA 1G28A 3LIBA 3H9WA 1NWZA 2V9AA 2W27A 3LUQA 3HJKA 1EW0A 4HIAA 1UWNX 1TS8A 3H7WB 3B33A 3NOTC 3D72A 2I9VA 1F98A 2D01A 1Y28A 1GSWA 4GCZA 5EFWA 4EETB 1LSXA 4B9OA 5HWWA 4HJ4A 2P7JA 4JGPA 2B02A 2KX6A 3F1OB 3VE3A 1N9OA 1LSWA 1DRMA 3NOPC 5KIZA 5IU1A 4NXGA 1XJ6A 3NHQA 5HSQA 1UWPX 4R6LA 2VEAA 3PHYA 1VB6A 2V0WA 4HNBA 1DP8A 2ZOIA 2OWHA 3CLOA 4WN5A 2YKHA 3UMDA 2D02A 1OT6A 1D7EA 4XT2B 4JGQA 5DKLA 4WL9A 3BY8A 3IS2B 5I5LA 1XJ4A 4I3JA 4L9GA 3LIAA 2OOLA 2PD7A 2M1CA 3A0VA 2QJ7A 1TS6A 5J3WA 2OWJA 2ZBBA 1OTEA 4JGOA 4KQDA 4KUKA 2H28A 2JN7A 4WF0A 3A0SA 2J80A 2W0NA 1F9IA 2YKFA 5F69A 4F3LB 4NXBA 3VOLA 3UB8A 5G4ZA 2QHKA 3LIDA 4M4XA 3H82B 3PYPA 2WKRA 3K3CA 3RTYA 3E4PA 3KX0X 5IS1A 1S1YA 1GSXA 4LRXC 4HP9A 4H6JB 4I38A 3BWLA 1MZUA 2PD8A 4EEPA 4GS9B 2PHYA 1OJGA 2INWA 4L9FA
chains in the Genus database with same CATH superfamily
3A3DA 3Q7VA 4KZ5A 3ICYA 1F2KA 3T4JA 1RCJA 1S4RA 1XFQA 2PU4A 2H0YA 3G2ZA 3TJZC 4JF5A 3B47A 1YM1A 2VV7A 2VZWA 2OSUA 2CMNA 4KQOA 2Y55A 1NLYA 3C4OA 4O0PA 4RA7A 1P0ZA 4L0LA 1KDWA 3N8SA 3LY3A 1S66L 2Y2PA 3HBRA 4JKTA 3LR0A 1RGZA 2WKHA 2WKEA 5EV0A 1NYMA 4II7A 5DTKA 4IHQA 4JGRA 2P74A 4CLCD 4LV0A 1L2SA 1GHMA 1LI0A 2R9WA 4GZBA 3EEHA 3NC8A 1Q2QA 2V1AA 3IHAA 5E2GA 4R0QA 3FZCA 1ZTUA 4B88A 4DJ2A 1H0MA 5L10A 4D2OA 2X01A 4LCMA 4GDNA 1K25A 3PXPA 3BY9A 3H7WA 4JPMA 1BULA 4HH2A 4X53A 4MMNA 5EOOA 3SS5A 2P9VB 2L4RA 4U3TA 3C7UA 2OAP1 1J9MA 4OKPA 3C8CA 2Y2HA 5HARA 5DFXA 4QPRA 2XROA 2HDQA 3CG5A 3N6IA 3O3VA 3MSHA 1V9YA 1TS0A 2XDMA 1GCEA 3GDIA 3HUOA 4OPZA 1ES4A 1WYCA 2W3GA 5HL1A 4C6YA 5DJTA 4R38A 1K55A 2WZZA 3BYDA 2GJ3A 4EQ1A 2QKPA 1EROA 2JKGA 5HPIA 4IUKA 1FCNA 5EUAA 3R7WA 1IYPA 4XUXA 3CI6A 3K2NA 1BLSA 3VFFA 4LENA 4LV2A 4YNRA 4P85A 1G68A 2E8JA 3GECA 2RCXA 3KSFA 1MXOA 5F82A 1MC0A 4RVAA 3B42A 2JKTI 4ARZA 3SW1A 2Y2GA 3PBRA 3LFVA 3WS4A 5FL3A 4LRYC 4OVDA 2ZQ9A 3VP4A 2JKRM 3T50A 3MZFA 2PR6A 5FI2A 3HREA 4HJ6A 2P04A 4OPQA 5HPFA 3UB6A 5GHXA 4DE3A 3Q7VB 4HQAA 1SCWA 4PKYG 3VE4A 4KZ8A 4FSFA 1CJFA 4FOFA 5CX7A 3PTEA 5AJGA 2B18A 4GJ4A 1MY8A 3Q07A 2HPBA 4Z9QA 1S4SA 1TS7A 2RL3A 5EVLA 4FH2A 1OTBA 4CQHA 3HLBA 1DJCA 4NXFA 2K31A 3SZTA 4MCWA 4KQQA 4E3MA 3GRJA 2Z2MB 4WEJA 1W79A 1JTGA 2J9PA 3JVUA 4R23A 3HLFA 1IKIA 4RX2A 2DMWA 1KDSA 3DWZA 4JXWA 1LSVA 2Y2KA 2Y2JA 3BLSA 4PM5A 2EWVA 3O86A 3ZVWA 2EFXA 3SH8A 3DTIA 1KGFA 3LICA 3HLGA 1O7EA 3LEZA 1RGYA 3IX4A 4EEUA 3U2AA 3ZG0A 4ETXA 4N9LA 5HDDA 5FQKA 1OJ5A 3ZHHA 3DW0A 2XQZA 5AQBA 4RX3A 3FC7A 3F1PA 1JWPA 5J7EA 3EGDC 3G6OA 1ZHHB 2QMIA 4S2IA 2Y2OA 4GB7A 3CUEA 2NUPC 4KQRA 3HJKA 3M6BA 4HEFA 3PBSA 1TS8A 3H7WB 1PWDA 3B33A 3WS1A 1SDNA 2VKSA 1PZPA 4OH0A 3CHWP 1Y28A 2W3HA 4GCZA 5EFWA 3A3JA 3CUEC 5EVIC 4PMAA 1YQSA 1E4DA 1I2SA 5FAPA 4B9OA 2ZMVA 5HWWA 1SKOA 5LBRA 1MKMA 4ZJ2A 3KO6A 5DTSA 5DFYA 2B02A 3TW8A 4UA9A 3CMZA 4LCLA 2Y8HA 2A49A 3BEBA 3VE3A 1XKZA 1N9OA 3C7VA 3O87A 3NOPC 4U0TA 3NHQA 3E98A 1XGJA 1ALQA 2ZM0A 1DJAA 3R7WB 2PBDP 1YT4A 1VB6A 3O5YA 1TDGA 2V0WA 2ZC7A 2ZOIA 5C5KA 2Y2MA 4JXGA 3UMDA 1OT6A 3D9YA 1BLHA 4JGQA 4ARZB 2Y59A 4WL9A 5DKLA 3OBFA 1HZOA 3PBOA 3FKWA 3IQAA 2M1CA 3NECA 4PM9A 5GLAA 1STZA 1FCOA 4OPRA 3A0VA 3Q81A 3A3FA 5DTTA 4EUVA 1MWTA 4LGWA 4G3KA 1TS6A 4OP8A 4U0XA 2DNSA 2WGVA 1VM1A 4X25A 2ZQAA 4JGOA 2WKIA 4KUKA 4F94A 2JN7A 4GKUA 4EU0A 3AGEA 2OV5A 2W0NA 1FOFA 4WMCA 2YKFA 4RYEA 3BJNA 2VGLM 4NXBA 1OPXA 4Y17A 1BTLA 2QPNA 3VOLA 1NY0A 2A2LA 4BD0A 1YMSA 4WM9A 4BD1A 5GHYA 4LV1A 3K3CA 2O0YA 3EQVA 3FV7A 4MNRA 3MF0A 3KX0X 4P0MA 2H10A 4YOFA 2ZQDA 2O9AA 1GA9A 1S1YA 5FATA 1F5MA 2V1ZA 1MWSA 1YLTA 3MZDA 4HP9A 3BWLA 4L9FA 1L0EA 3S7OA 2G7UA 1FR6A 3WS0A 1PI5A 4QJGA 5HX9A 3E4OA 4GW9A 2KDKA 4AFIA 3F1PB 2WGWA 5DKKA 2EX8A 1HLUP 4D60A 5HW3A 4GHIA 5TBMA 1CEFA 2IA2A 4ID4A 4R70A 3FKVA 3V50A 3BFEA 2WGIA 1YKDA 4MLLA 1YSPA 2XRNA 3LEQA 2A24A 4EW7A 2ZMAA 4IUHA 2V2FF 1IYOA 2WYXA 1S0WA 1MBLA 1FIKA 2W1TB 2V8FA 1RP5A 1SKOB 3UN7A 2L1MA 3OZHA 1IEMA 3UE0A 2W1RA 3VFHA 3WS5A 5HFOA 5HAIA 4MDZA 4OQHA 2LB5A 1CK3A 5DF8A 3RXWA 3V3SA 2X71A 1U60A 4NEED 4YFMA 3T4LA 2ZLYA 1DP9A 3NI9A 1KVMA 2VLGA 1T1CA 3N4IA 4BENA 2LB9A 3T4KA 4R3AA 3ULFA 3QP5A 3SS4A 4GDBA 5FDSA 3IBJA 1XA1A 5HZHA 4PPRA 3V67A 3UE1A 2Q0OA 3UPOA 3ZG9B 3F1OA 4HH3A 3Q82A 4Y2FA 2FFFB 3OCLA 4FCFA 4HOIA 2G2WA 4BBVA 3KYEA 2J3TD 2XSSA 3G31A 5CRFA 4UQIS 2R9XA 4N92A 5K5BA 5J4EA 2J7VA 3NULA 4P87A 4ZDXA 1OJGA 3ZQ5A 4LFUA 4X55A 3W2ZA 4XT2A 4C3QA 1PRQA 2VA0A 1OT9A 4CLCA 4IBRA 3FYZA 4P6ZS 1GHPA 3LCEA 2P08A 5AVEA 3CITA 1L0GA 3HUNA 3LO7A 1OTDA 4DJ3A 2O99A 2HJEA 1W5DA 2QWSA 1S1ZA 3A0RA 1LL8A 3VP0A 3W4PA 3IWQA 4Y3IA 4CLCC 3RXXA 2HP9A 4IEDA 3MR0A 2L0WA 1BZAA 4O01A 4EERA 4ZJ3A 4NXEA 4FTXA 3BQAA 2Z6DA 1BLCA 1CEGA 2VJWA 4ZBEA 1KE0A 1PWGA 1XJ2A 1BYWA 3MFDA 1Y54A 5DVAA 2EA9A 4BMWA 3OLOA 2XFTA 3BFDA 5CXWA 4BBUA 3IT9A 4ESPA 4ZRRA 3NDEA 4R4SA 2WGWB 3NBLA 3FG8A 1J3WA 2ZMFA 2PT7A 1N4OA 2PAVP 3A3EA 3V5MA 2PU2A 4GHIB 4E3LA 1G5UA 5CHMA 3LYXA 5TBMB 2JBFA 1GSVA 5F6AA 5F5YA 2WAEA 5GLCA 2ZM8A 1MWRA 1L3LA 4BL2A 1ACFA 5L2FA 2A24B 5CEDA 3MFXA 5CEBA 3HLCA 3LR3A 1YLWA 2PRFA 3C30A 4KZ4A 3UB5P 3G30A 1ES2A 1PI4A 5HDCA 3F1NA 3ITAA 3S22A 3TSGA 3S1YA 2EXAA 1G6AA 3PAGA 4EXOA 1O07A 2XD5A 2ZQ7A 5CECA 3MXQA 4Q0HA 2W3FA 2UV0E 1G28A 3LIBA 1NWZA 5IT5A 3QNCA 1EW0A 4HIAA 1UWNX 1K55C 2I9VA 1LL5A 2PBYA 5U47A 2D01A 3IXGA 3I7JA 3WS2A 2EWWA 4OQ0A 2BLSA 2HP5A 4N1XA 2XK1A 2VGJA 2DRWA 4OOMA 4JGPA 3MMHA 1Y4OA 1SHVA 1ONGA 4DF6A 1IKGA 3M6HA 3OC2A 3F1OB 2GZAA 3V3RA 5L07A 4NXGA 4NETA 3DBAA 4X69A 5HSQA 2GX5A 1FQGA 1UWPX 2A3UA 5GLDA 1KGGA 1NXYA 3PBNA 4E3JA 4HNBA 5AQ9A 2OLUA 3ZFZA 4E6XA 3HVFA 3W8KA 3CLOA 4WN5A 2YKHA 2OAQ1 5AQ7A 4GOGA 1D7EA 2ZD8A 1PZOA 4XT2B 1LHYA 4CLCB 3TRCA 2JC7A 4FD8A 4KZ9A 3O88A 4HESA 2WAFA 2VK3A 3IF5A 4I3JA 5KSCA 3S4XA 3T1QB 3ISGA 5EE8A 2OLVA 3C4PA 2QJ7A 4KG2A 5FAOA 3GTCA 3DTEA 1PW1A 4KQDA 1WE4A 3PBTA 2EX6A 2H28A 1HD8A 3A0SA 2JKFA 2ZC3B 3C5AA 1ESUA 1F9IA 2IWDA 1JWVA 5G4ZA 3HCYA 4E3NA 3T4SA 4M4XA 1SDEA 4X56A 3VP3A 1CI9A 1Z09A 1VETA 3G35A 4Y7PA 3Q7ZA 3RTYA 1KGEA 5GHZA 4UHUA 3E4PA 4S2LA 4X6TA 5E2FA 4GD8A 5CHJA 5A92A 3GR2A 1W8YA 1AXBA 4EBNA 1GSXA 3FPVA 4LRXC 1H5XA 3SH7A 2WK0A 5KZHA 4QU3A 2K2NA 3DWKA 4EEPA 2C5WB 2Y2IA 3MS6A 2Q9MA 2INWA 1N9NA 1MWUA 2BTFP 3L7HA 5A8BA 1K6SA 3OCNA 3B3XA 3T4OA 4B93A 4OQIA 4R4RA 1OTIA 3F1NB 3MQQA 3MQ0A 3UMEA 4QY6A 2ACGA 3TG9A 4NKPA 4MBHA 2HV1A 2V1BA 3CWFA 4HI4A 1ODVA 3VV4A 5EVID 3IBRA 4BLMA 2HP6A 5J8XA 1I5QA 3DTMA 3FWLA 5IHVA 3VOYA 5DF9A 2J8YA 4LRZE 5TFQA 5TR7A 4S2JA 4QB8A 1GHIA 2ZC6B 3N8LA 2PR5A 4LLOB 2HDRA 3W4QA 3NJAA 4IVIA 5FDHA 2QZ6A 4PM7A 5EM0A 3MXSA 1V9ZA 1OTAA 2XA7M 1CF0A 1KOUA 4OOLA 2MJ6A 4K0XA 3LIFA 4RQ9A 5DF7A 4O8GA 4FH4A 3T1SA 3JVVA 1DY6A 4GD6A 3MZEA 2JKTM 1W63M 3Q1FA 2PYPA 5D3OA 1PFLA 4MBKA 3NOUC 4DXCA 1NYYA 5EOEA 4ZAMA 3BFGA 3P7NA 3N8RA 3GVBA 1D06A 4I39A 1H8ZA 3HLWA 3G34A 4HHDA 4NK3A 1WA9A 2XF3A 1KE4A 4XUZA 5AVFA 4WLAA 5KSHA 1PIOA 5TGFA 3TE8A 5E2HA 4OOYA 5BOHA 3MKEA 5HAQA 3EWKA 1TDLA 1NJ4A 3IXHA 4YWZA 3ZGAB 4UQIM 3KSHA 4B4ZA 1VETB 1S67L 1SZVA 3IS2A 2H0TA 1ZG4A 4PKYA 2VGKA 5FQQA 2XGNA 3EEAA 3CAXA 3G32A 4P6ZM 1TEMA 2O9BA 1KE3A 1NZOA 4G3WA 3DAVA 2Z2LB 5EECA 3D3OA 1T19A 1JWZA 5M1AA 2ZOHA 3UPNA 4S2MA 3SH9A 3G2YA 1TVFA 3H82A 5I94A 1JVJA 4WZ4A 1GA0A 3IX8A 3UY6A 1FSYA 2ZC5B 3T4QA 1CQAA 1XPBA 1K56D 2V0UA 4L9EA 3IXBA 4GS9A 3NIAA 4PM8A 2JKRI 3AGFA 2EX9A 2WKPA 1ERQA 4XXRA 4I3IA 1ZKJA 4I3AA 4MN5A 2HDUA 5CTNA 4LPZA 3U4LP 2FFYA 4S2OA 4WEKA 3CPTA 1BT5A 4EBLA 3C2WA 4G3VA 4HBUA 3W4OA 3VP1A 4OLDA 3OPRA 4HP4A 3ZNTA 4OQGA 3EQUA 3MQOA 3ZCZA 3QP8A 3H9WA 2V9AA 1FILA 5CGWA 4IJGA 4IBXA 1S6RA 4JF4A 1F98A 2WUQA 3BM6A 1GSWA 2X02A 3T1XA 4EETB 1LSXA 5FASA 2JE5A 4E3KA 4B4XA 1NLZA 1M40A 3WRTA 4EWFA 5GLBA 3JYIA 3R4KA 3M2KA 2GDNA 2KX6A 1E3UD 1OMEA 3CJMA 4BQMA 2EXBA 4N1HA 3VMAA 1LSWA 1DRMA 1LLBA 1YMXA 1K0KA 4KG5A 1MKIA 3QP1A 2JCHA 3HL9A 4BWIA 3WWXA 4R6LA 3PHYA 1IFQA 3IF6A 2M7UA 3BECA 2EFUA 3C38A 2V20A 3QP6A 2Q9NA 4Q8IA 1W63Q 1ES3A 1YLPA 3QP4A 2D02A 3E0YA 2HDSA 1P9RA 3SOIA 1XXMA 3NDGA 4DKIA 3BY8A 3IS2B 5I5LA 3RFBA 1P9WA 4Y0OA 3IF6C 1XJ4A 1YAXA 5FQMA 4L9GA 3LIAA 3ZG7B 2ZM2A 5CGSA 3EOIA 5A90A 1HTZA 1WYBA 2ZBBA 1OTEA 4JF6A 3KYQA 3BW6A 3VOZA 4WF0A 4EQIA 2J80A 4HBTA 2B5RA 4IVKA 2I72A 4BJPA 4ME4A 4DDSA 2ZL1A 5HAPA 3UB8A 1H8YA 2EX2A 3N7WA 2Y2LA 3H82B 5CGXA 2WKRA 4UA6A 2ZJ9A 4GLQA 3NCKA 3PBQA 3BFCA 4R1GA 3V39A 3OPLA 1PNEA 3M2JA 4UAAA 5FQ9A 1YLJA 4Z1WA 1IOUA 1ONHA 2CC1A 4I38A 2M7VA 3S7QA 2PD8A 4GS9B 2PHYA 5FI7A 4BL3A 4HJ4A 5F83A 4CJNA 3LI9A 1VEUA 2BG1A 2WADA 3ITBA 3ZVTA 4DDYA 4OP5A 3LIEA 5AQAA 1P97A 3UDFA 3CPTB 1DJBA 2FH5A 4Q0IA 4N9KA 3MXRA 2HF6A 2UWXA 4EESA 1EI5A 3KYZA 1VQQA 4S2PA 2IWCA 2Y91A 4MBFA 2IWBA 4X1LA 4LV3A 3BQ8A 2XLNA 3AGDA 1YLYA 3KSIA 4HY8A 1YSQA 3JPUA 1NRFA 2XFSA 4JBFA 4O7DA 2PDRA 3UB9A 4KZ7A 1NRJA 5F68A 1NZUA 5A93A 4EBPA 3E2LA 4K08A 4BBTA 3LR4A 4DE1A 4OLGA 2ZC4B 2XD1A 4HJ3A 3ZNYA 1H3QA 1HVBA 5HL6A 3TOIA 4I5SA 3VP2A 3ZG8B 3VSLA 3KSGA 3UDIA 3IXDA 3NY4A 5CERA 1Q2PA 3IF6B 2GNXA 3UB7A 3LI8A 1UGUA 2E8IA 2Y2QA 3T12B 4K91A 3ZG5A 3HLDA 3UO9A 3QNBA 4MEZA 1K54A 5FAQA 2J3WA 3MJQA 4WELA 3K3DA 4S2KA 4WUJA 1E25A 5HWTA 4KZ3A 3UE6A 4P6BA 1IYSA 3PAEA 3MKFA 2VX8A 2XEPA 1K54C 1M6KA 4EV4A 2QJ5A 5L09A 4M3KA 4CLCE 3QHYA 3EGXC 3T1RA 5EVIA 1DP6A 1LT0A 2Y79A 1G6OA 2G2UA 3UDXA 4QY5A 5G4YA 4KG6A 2ZL1B 4WBGA 2H5SA 4S2NA 1K38A 4KENB 1BSGA 5FI6A 4QWOA 3MBZA 3BRMA 4OONA 3HJIA 2XH9A 2W1TA 3BLMA 1AWIA 4QD4A 2W3EA 3IWOA 5HWVA 4E04A 2BASA 1N9LA 1T18A 1T1AA 1SKFA 1BLPA 2ZQCA 2WKQA 3E2KA 4S2NC 4E6WA 5HD5A 4DE2A 1KVLA 1CI8A 4PHTA 4MN6A 2JHEA 1JNUA 3UPPA 1XGIA 3RH8B 4DRTA 4H8RA 1TF1A 1VEUB 4OPYA 1YPRA 1H8MA 4KZ6A 4Y0TA 4F3LA 4Y0UA 1Z6FA 3E4QA 2R78A 2VV6A 1IELA 1PWCA 3LY4A 1N9BA 5CHUA 1X0OA 4WYYA 4Y5FA 4YINA 3L9KA 2K7SA 4R3BA 2XR0A 1C3BA 3GQZA 5HDSA 4UA7A 3SS3A 2VV8A 5JYOA 1XFNA 2C6WB 3IH8A 4H6JA 2WZXA 1PW8A 3P01A 2PYRA 3FPWA 1K57A 1T1BA 5L8MA 4Y13A 3S7PA 2W3DA 1D1JA 3P09A 1QMEA 5HD3A 5TJJA 4Y15A 1LL9A 1ES5A 2HZ5A 4PAUA 3OPHA 1XJ3A 1A0KA 3RJUA 5M19A 1K57C 1VHMA 1QMFA 4KUOA 2QYBA 2Z6CA 5KMWA 5DJUA 1YLZA 3HUMA 2Y4AA 2HJ9C 3PR6A 3UNWA 1W8QA 1TD5A 1XX2A 2KOIA 2W27A 3LUQA 1ZG6A 3IX3A 2Y2NA 1K6RA 3GMWA 3QP2A 4A5RA 1W7FA 3LGOA 3NOTC 3D72A 4WMCD 4KZBA 1L0DA 2KLIA 5M18A 4NG2A 1XA7A 1BUEA 5F1GA 4JLFA 4R3JA 2P7JA 5F1FA 3GSGA 4ETZA 3IHBA 4JXSA 1K4EA 1FCMA 4X1MA 3IH9A 3BFFA 2O9CA 5FEGA 4E3IA 1FR1A 5MC7A 4ZTKA 5KIZA 5IU1A 1XJ6A 2NUTC 4DE0A 3G4PA 1EWZA 4X68A 4QHCA 3OPPA 1XP4A 5EVIB 2VEAA 5CTMA 1PYYA 4MN7A 4K0WA 1K56A 5E2EA 1FSWA 1DP8A 1ZC2A 3DTKA 5FSRA 1I2WA 1JTDA 2B95A 4ZJ1A 2OWHA 2P9VA 4JXVA 1ESIA 5E43A 2FZ0A 4CPKA 4UEYA 1L0FA 2XA7S 2DCFA 3LR5A 4KZAA 4PM6A 4C75A 1IYQA 5FQIA 5A91A 2J9OA 3P98A 2OOLA 2PD7A 3T4TA 5EVEA 5G18A 1LI9A 3UE3A 2AVXA 3D4FA 5FEFA 2HGVA 5J3WA 3A3IA 4GN2A 4Q0JA 2VGLS 2OWJA 3IWIA 3ZDJA 5FA7A 2ZQ8A 4WZ5A 3ZYTA 1MPLA 5FQJA 3HLEA 5JYPA 2V8CA 5F69A 3WRZA 4F3LB 4DN0A 2QHKA 3LIDA 4DMZA 2J3TC 5EM1A 3PYPA 4WZ5C 4FUWA 4EUZA 3CZDA 5GL9A 3GV9A 1E3UA 1ERMA 5IS1A 4GNUA 4H6JB 4E3OA 3S7NA 3VSKA 5EPHA 1MZUA 4DXBA 1K4FA 3OOVA
chains in the Genus database with same CATH topology
3S7OA 3LI9A 2G7UA 5A8BA 3ICYA 3OCNA 3T4JA 3T4OA 4B93A 1S4RA 1XFQA 3LIEA 1P97A 3E4OA 1OTIA 3F1NB 4GW9A 2KDKA 2FH5A 3MQQA 3MQ0A 4Q0IA 3TJZC 3UMEA 4AFIA 3B47A 3F1PB 2HF6A 5DKKA 2VV7A 4EESA 4NKPA 2VZWA 3KYZA 2CMNA 4KQOA 2HV1A 2V1BA 4GHIA 3CWFA 4HI4A 1NLYA 1ODVA 5TBMA 3BQ8A 4O0PA 3VV4A 2IA2A 3IBRA 3KSIA 1P0ZA 4L0LA 4R70A 4HY8A 1YSQA 1S66L 3LR0A 2PDRA 3UB9A 5DF9A 1YKDA 1YSPA 2XRNA 2A24A 4EW7A 4LRZE 4II7A 4IUHA 1NRJA 4IHQA 4JGRA 5F68A 4CLCD 2W1TB 2PR5A 4LLOB 2L1MA 3NJAA 4K08A 4BBTA 3LR4A 3EEHA 4HJ3A 2W1RA 1H3QA 5HL6A 1V9ZA 1OTAA 2XA7M 1KOUA 4OOLA 2MJ6A 2V1AA 4MDZA 3LIFA 4I5SA 4RQ9A 1ZTUA 3KSGA 4O8GA 2LB5A 4DJ2A 3JVVA 4NEED 3T4LA 3PXPA 1DP9A 3BY9A 3H7WA 2JKTM 1W63M 2VLGA 2GNXA 3UB7A 1T1CA 4HH2A 3LI8A 1UGUA 2PYPA 4MMNA 2LB9A 3NOUC 3T4KA 4R3AA 3ULFA 2L4RA 2OAP1 3C8CA 5DFXA 4QPRA 2XROA 2J3WA 3P7NA 3MJQA 1V9YA 1TS0A 3IBJA 4WELA 3GDIA 3K3DA 4WUJA 1D06A 4I39A 5HWTA 5HZHA 3V67A 3UE6A 4HHDA 2W3GA 3F1OA 4HH3A 1WA9A 2VX8A 5DJTA 4Y2FA 4R38A 1N9NA 5AVFA 2GJ3A 3OCLA 4WLAA 5KSHA 4EQ1A 2QKPA 4HOIA 2QJ5A 5HPIA 4IUKA 4CLCE 3TE8A 4BBVA 3EGXC 1DP6A 2J3TD 3R7WA 1LT0A 2XSSA 2Y79A 3CI6A 1G6OA 3K2NA 4UQIS 4YNRA 5K5BA 5J4EA 5G4YA 3EWKA 3GECA 3KSFA 3ZQ5A 4YWZA 3W2ZA 1MC0A 4XT2A 4UQIM 2VA0A 1OT9A 2JKTI 3B42A 3KSHA 4ARZA 4CLCA 3SW1A 1S67L 3IS2A 4P6ZS 3HJIA 2W1TA 3PBRA 3LFVA 2P08A 5AVEA 4PKYA 5FL3A 2W3EA 3CITA 5HWVA 4LRYC 4E04A 2BASA 1N9LA 1T18A 1T1AA 3EEAA 1OTDA 4DJ3A 2O99A 2HJEA 2JKRM 3T50A 2QWSA 2WKQA 1S1ZA 3A0RA 1LL8A 5HD5A 2PR6A 3CAXA 4P6ZM 2O9BA 4PHTA 4Y3IA 4CLCC 4MN6A 2JHEA 4HJ6A 1JNUA 3MR0A 2L0WA 2P04A 4O01A 4EERA 3RH8B 4G3WA 4NXEA 5HPFA 1TF1A 3BQAA 3UB6A 3D3OA 1T19A 4HQAA 2Z6DA 2VJWA 4PKYG 2ZOHA 1XJ2A 1BYWA 3VE4A 4FSFA 1H8MA 4FOFA 5CX7A 2EA9A 5AJGA 4F3LA 4BMWA 2B18A 3OLOA 4GJ4A 3E4QA 2R78A 2VV6A 4BBUA 1S4SA 1TS7A 1X0OA 3H82A 4ZRRA 4Y5FA 1OTBA 3FG8A 2ZMFA 4CQHA 2PT7A 2K7SA 4NXFA 5HDSA 2K31A 4GHIB 2VV8A 3LYXA 4MCWA 5TBMB 1XFNA 3JVUA 4WEJA 1GSVA 5F6AA 5F5YA 2DMWA 3T4QA 4H6JA 2V0UA 3P01A 1LSVA 4L9EA 2PYRA 2EWVA 3FPWA 4GS9A 2JKRI 1T1BA 5L8MA 2WKPA 2A24B 3LICA 3S7PA 2W3DA 3MFXA 3LR3A 5HD3A 5TJJA 3C30A 4I3IA 4EEUA 3U2AA 4ETXA 4PAUA 4I3AA 4MN5A 5HDDA 4LPZA 5HDCA 3F1NA 1XJ3A 1OJ5A 4WEKA 1VHMA 3FC7A 4KUOA 2QYBA 2Z6CA 3F1PA 3C2WA 4G3VA 5DJUA 4EXOA 3EGDC 5J7EA 3G6OA 1ZHHB 2HJ9C 3PR6A 3MXQA 4HP4A 1TD5A 4Q0HA 2W3FA 3CUEA 2NUPC 3EQUA 3MQOA 1G28A 2KOIA 3LIBA 3H9WA 1NWZA 2V9AA 2W27A 3LUQA 5IT5A 3HJKA 3PBSA 1EW0A 4HIAA 1UWNX 1TS8A 3H7WB 3B33A 3NOTC 3D72A 4IJGA 2I9VA 1F98A 2VKSA 2D01A 2KLIA 1Y28A 1GSWA 2W3HA 2EWWA 4GCZA 5EFWA 3CUEC 4EETB 1LSXA 4B9OA 2ZMVA 5HWWA 1NLZA 5LBRA 1MKMA 4OOMA 4HJ4A 3R4KA 2P7JA 3KO6A 4JGPA 3MMHA 4ETZA 5DFYA 2B02A 2KX6A 3TW8A 2Y8HA 2O9CA 3OC2A 3F1OB 2GZAA 3VE3A 1N9OA 1LSWA 5MC7A 1DRMA 3NOPC 5KIZA 5IU1A 4NXGA 1XJ6A 3NHQA 3DBAA 2NUTC 5HSQA 3E98A 2GX5A 4BWIA 1UWPX 4R6LA 2VEAA 3PHYA 3R7WB 4L9FA 1IFQA 4MN7A 1VB6A 3PBNA 2M7UA 3O5YA 2V0WA 4HNBA 1DP8A 3C38A 2ZOIA 5C5KA 2OWHA 3CLOA 4WN5A 1W63Q 2YKHA 2OAQ1 3UMDA 2FZ0A 2D02A 1OT6A 1D7EA 4UEYA 3E0YA 4XT2B 1P9RA 4JGQA 4CLCB 3TRCA 5DKLA 4WL9A 4ARZB 3OBFA 3BY8A 2XA7S 3IS2B 5I5LA 1P9WA 3RFBA 3LR5A 1XJ4A 1YAXA 4I3JA 4L9GA 3PBOA 3LIAA 2OOLA 2PD7A 2M1CA 3T4TA 1STZA 3EOIA 3UE3A 3A0VA 4EUVA 4G3KA 2QJ7A 1TS6A 2HGVA 5J3WA 4Q0JA 2VGLS 2OWJA 2ZBBA 1OTEA 4JGOA 4KQDA 4KUKA 3PBTA 3KYQA 2H28A 3BW6A 2JN7A 4WF0A 4EU0A 3A0SA 3ZYTA 2J80A 2W0NA 1F9IA 2YKFA 4BJPA 4ME4A 3BJNA 5F69A 2VGLM 4F3LB 4NXBA 1OPXA 3VOLA 3UB8A 5G4ZA 2QHKA 3HCYA 4DN0A 2A2LA 3LIDA 3T4SA 4DMZA 2J3TC 4M4XA 3H82B 3PYPA 2WKRA 4GLQA 3K3CA 3PBQA 3RTYA 3E4PA 2O0YA 3EQVA 3MF0A 3KX0X 4YOFA 2O9AA 5IS1A 1S1YA 1F5MA 4Z1WA 1GSXA 3FPVA 1IOUA 4LRXC 4HP9A 4H6JB 2K2NA 3S7NA 4I38A 3BWLA 2M7VA 3S7QA 1MZUA 2PD8A 4EEPA 4GS9B 2PHYA 1OJGA 2INWA 3OOVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LI9 A;  5A8B A;  3ICY A;  1S4R A;  1XFQ A;  3LIE A;  1P97 A;  3E4O A;  1OTI A;  3F1N B;  4GW9 A;  2KDK A;  3MQQ A;  3UME A;  3F1P B;  5DKK A;  2VV7 A;  4EES A;  2CMN A;  2HV1 A;  2V1B A;  4GHI A;  3CWF A;  4HI4 A;  1ODV A;  5TBM A;  3IBR A;  1P0Z A;  4R70 A;  4HY8 A;  1S66 L;  2PDR A;  3UB9 A;  2A24 A;  4EW7 A;  4LRZ E;  4JGR A;  5F68 A;  2PR5 A;  4LLO B;  2L1M A;  3NJA A;  4K08 A;  4BBT A;  3EEH A;  4HJ3 A;  1V9Z A;  1OTA A;  1KOU A;  2V1A A;  3LIF A;  4I5S A;  4RQ9 A;  4DJ2 A;  1DP9 A;  3BY9 A;  3H7W A;  2VLG A;  3UB7 A;  1T1C A;  4HH2 A;  3LI8 A;  1UGU A;  2PYP A;  3NOU C;  4R3A A;  3ULF A;  2L4R A;  3C8C A;  3P7N A;  3MJQ A;  1V9Y A;  1TS0 A;  3GDI A;  3K3D A;  4WUJ A;  1D06 A;  4I39 A;  5HWT A;  5HZH A;  3UE6 A;  4HHD A;  3F1O A;  4HH3 A;  1WA9 A;  5DJT A;  4R38 A;  1N9N A;  5AVF A;  2GJ3 A;  4WLA A;  4EQ1 A;  2QKP A;  4HOI A;  2QJ5 A;  4BBV A;  1DP6 A;  1LT0 A;  5J4E A;  5G4Y A;  3EWK A;  3GEC A;  3ZQ5 A;  4YWZ A;  4XT2 A;  1OT9 A;  3SW1 A;  1S67 L;  3IS2 A;  3HJI A;  5AVE A;  4PKY A;  5HWV A;  4LRY C;  4E04 A;  2BAS A;  1N9L A;  1T18 A;  1T1A A;  1OTD A;  4DJ3 A;  3T50 A;  2QWS A;  2WKQ A;  1S1Z A;  5HD5 A;  3A0R A;  1LL8 A;  2PR6 A;  3CAX A;  4MN6 A;  2JHE A;  4HJ6 A;  1JNU A;  3MR0 A;  2L0W A;  4EER A;  3RH8 B;  4NXE A;  3UB6 A;  1T19 A;  4HQA A;  2Z6D A;  4PKY G;  2ZOH A;  1XJ2 A;  1BYW A;  3VE4 A;  2EA9 A;  4F3L A;  3OLO A;  3E4Q A;  2R78 A;  2VV6 A;  4BBU A;  1S4S A;  1TS7 A;  1X0O A;  3H82 A;  1OTB A;  3FG8 A;  2K7S A;  4NXF A;  5HDS A;  4GHI B;  2VV8 A;  3LYX A;  5TBM B;  1XFN A;  1GSV A;  5F6A A;  5F5Y A;  4H6J A;  2V0U A;  1LSV A;  4L9E A;  2PYR A;  4GS9 A;  1T1B A;  2WKP A;  2A24 B;  3LIC A;  3MFX A;  5HD3 A;  4I3I A;  4EEU A;  4I3A A;  4MN5 A;  5HDD A;  4LPZ A;  5HDC A;  3F1N A;  1XJ3 A;  1OJ5 A;  3FC7 A;  4KUO A;  2Z6C A;  3F1P A;  3C2W A;  5DJU A;  4EXO A;  5J7E A;  3G6O A;  3MXQ A;  4HP4 A;  3MQO A;  1G28 A;  3LIB A;  3H9W A;  1NWZ A;  2V9A A;  2W27 A;  3LUQ A;  3HJK A;  1EW0 A;  4HIA A;  1UWN X;  1TS8 A;  3H7W B;  3B33 A;  3NOT C;  3D72 A;  2I9V A;  1F98 A;  2D01 A;  1Y28 A;  1GSW A;  4GCZ A;  5EFW A;  4EET B;  1LSX A;  4B9O A;  5HWW A;  4HJ4 A;  2P7J A;  4JGP A;  2B02 A;  2KX6 A;  3F1O B;  3VE3 A;  1N9O A;  1LSW A;  1DRM A;  3NOP C;  5KIZ A;  5IU1 A;  4NXG A;  1XJ6 A;  3NHQ A;  5HSQ A;  1UWP X;  4R6L A;  2VEA A;  3PHY A;  1VB6 A;  2V0W A;  4HNB A;  1DP8 A;  2ZOI A;  2OWH A;  3CLO A;  4WN5 A;  2YKH A;  3UMD A;  2D02 A;  1OT6 A;  1D7E A;  4XT2 B;  4JGQ A;  5DKL A;  4WL9 A;  3BY8 A;  3IS2 B;  5I5L A;  1XJ4 A;  4I3J A;  4L9G A;  3LIA A;  2OOL A;  2PD7 A;  2M1C A;  3A0V A;  2QJ7 A;  1TS6 A;  5J3W A;  2OWJ A;  2ZBB A;  1OTE A;  4JGO A;  4KQD A;  4KUK A;  2H28 A;  2JN7 A;  4WF0 A;  3A0S A;  2J80 A;  2W0N A;  1F9I A;  2YKF A;  5F69 A;  4F3L B;  4NXB A;  3VOL A;  3UB8 A;  5G4Z A;  2QHK A;  3LID A;  4M4X A;  3H82 B;  3PYP A;  2WKR A;  3K3C A;  3RTY A;  3E4P A;  3KX0 X;  5IS1 A;  1S1Y A;  1GSX A;  4LRX C;  4HP9 A;  4H6J B;  4I38 A;  3BWL A;  1MZU A;  2PD8 A;  4EEP A;  4GS9 B;  2PHY A;  1OJG A;  2INW A;  4L9F A; 
#chains in the Genus database with same CATH topology
 3A3D A;  3Q7V A;  4KZ5 A;  3ICY A;  1F2K A;  3T4J A;  1RCJ A;  1S4R A;  1XFQ A;  2PU4 A;  2H0Y A;  3G2Z A;  3TJZ C;  4JF5 A;  3B47 A;  1YM1 A;  2VV7 A;  2VZW A;  2OSU A;  2CMN A;  4KQO A;  2Y55 A;  1NLY A;  3C4O A;  4O0P A;  4RA7 A;  1P0Z A;  4L0L A;  1KDW A;  3N8S A;  3LY3 A;  1S66 L;  2Y2P A;  3HBR A;  4JKT A;  3LR0 A;  1RGZ A;  2WKH A;  2WKE A;  5EV0 A;  1NYM A;  4II7 A;  5DTK A;  4IHQ A;  4JGR A;  2P74 A;  4CLC D;  4LV0 A;  1L2S A;  1GHM A;  1LI0 A;  2R9W A;  4GZB A;  3EEH A;  3NC8 A;  1Q2Q A;  2V1A A;  3IHA A;  5E2G A;  4R0Q A;  3FZC A;  1ZTU A;  4B88 A;  4DJ2 A;  1H0M A;  5L10 A;  4D2O A;  2X01 A;  4LCM A;  4GDN A;  1K25 A;  3PXP A;  3BY9 A;  3H7W A;  4JPM A;  1BUL A;  4HH2 A;  4X53 A;  4MMN A;  5EOO A;  3SS5 A;  2P9V B;  2L4R A;  4U3T A;  3C7U A;  2OAP 1;  1J9M A;  4OKP A;  3C8C A;  2Y2H A;  5HAR A;  5DFX A;  4QPR A;  2XRO A;  2HDQ A;  3CG5 A;  3N6I A;  3O3V A;  3MSH A;  1V9Y A;  1TS0 A;  2XDM A;  1GCE A;  3GDI A;  3HUO A;  4OPZ A;  1ES4 A;  1WYC A;  2W3G A;  5HL1 A;  4C6Y A;  5DJT A;  4R38 A;  1K55 A;  2WZZ A;  3BYD A;  2GJ3 A;  4EQ1 A;  2QKP A;  1ERO A;  2JKG A;  5HPI A;  4IUK A;  1FCN A;  5EUA A;  3R7W A;  1IYP A;  4XUX A;  3CI6 A;  3K2N A;  1BLS A;  3VFF A;  4LEN A;  4LV2 A;  4YNR A;  4P85 A;  1G68 A;  2E8J A;  3GEC A;  2RCX A;  3KSF A;  1MXO A;  5F82 A;  1MC0 A;  4RVA A;  3B42 A;  2JKT I;  4ARZ A;  3SW1 A;  2Y2G A;  3PBR A;  3LFV A;  3WS4 A;  5FL3 A;  4LRY C;  4OVD A;  2ZQ9 A;  3VP4 A;  2JKR M;  3T50 A;  3MZF A;  2PR6 A;  5FI2 A;  3HRE A;  4HJ6 A;  2P04 A;  4OPQ A;  5HPF A;  3UB6 A;  5GHX A;  4DE3 A;  3Q7V B;  4HQA A;  1SCW A;  4PKY G;  3VE4 A;  4KZ8 A;  4FSF A;  1CJF A;  4FOF A;  5CX7 A;  3PTE A;  5AJG A;  2B18 A;  4GJ4 A;  1MY8 A;  3Q07 A;  2HPB A;  4Z9Q A;  1S4S A;  1TS7 A;  2RL3 A;  5EVL A;  4FH2 A;  1OTB A;  4CQH A;  3HLB A;  1DJC A;  4NXF A;  2K31 A;  3SZT A;  4MCW A;  4KQQ A;  4E3M A;  3GRJ A;  2Z2M B;  4WEJ A;  1W79 A;  1JTG A;  2J9P A;  3JVU A;  4R23 A;  3HLF A;  1IKI A;  4RX2 A;  2DMW A;  1KDS A;  3DWZ A;  4JXW A;  1LSV A;  2Y2K A;  2Y2J A;  3BLS A;  4PM5 A;  2EWV A;  3O86 A;  3ZVW A;  2EFX A;  3SH8 A;  3DTI A;  1KGF A;  3LIC A;  3HLG A;  1O7E A;  3LEZ A;  1RGY A;  3IX4 A;  4EEU A;  3U2A A;  3ZG0 A;  4ETX A;  4N9L A;  5HDD A;  5FQK A;  1OJ5 A;  3ZHH A;  3DW0 A;  2XQZ A;  5AQB A;  4RX3 A;  3FC7 A;  3F1P A;  1JWP A;  5J7E A;  3EGD C;  3G6O A;  1ZHH B;  2QMI A;  4S2I A;  2Y2O A;  4GB7 A;  3CUE A;  2NUP C;  4KQR A;  3HJK A;  3M6B A;  4HEF A;  3PBS A;  1TS8 A;  3H7W B;  1PWD A;  3B33 A;  3WS1 A;  1SDN A;  2VKS A;  1PZP A;  4OH0 A;  3CHW P;  1Y28 A;  2W3H A;  4GCZ A;  5EFW A;  3A3J A;  3CUE C;  5EVI C;  4PMA A;  1YQS A;  1E4D A;  1I2S A;  5FAP A;  4B9O A;  2ZMV A;  5HWW A;  1SKO A;  5LBR A;  1MKM A;  4ZJ2 A;  3KO6 A;  5DTS A;  5DFY A;  2B02 A;  3TW8 A;  4UA9 A;  3CMZ A;  4LCL A;  2Y8H A;  2A49 A;  3BEB A;  3VE3 A;  1XKZ A;  1N9O A;  3C7V A;  3O87 A;  3NOP C;  4U0T A;  3NHQ A;  3E98 A;  1XGJ A;  1ALQ A;  2ZM0 A;  1DJA A;  3R7W B;  2PBD P;  1YT4 A;  1VB6 A;  3O5Y A;  1TDG A;  2V0W A;  2ZC7 A;  2ZOI A;  5C5K A;  2Y2M A;  4JXG A;  3UMD A;  1OT6 A;  3D9Y A;  1BLH A;  4JGQ A;  4ARZ B;  2Y59 A;  4WL9 A;  5DKL A;  3OBF A;  1HZO A;  3PBO A;  3FKW A;  3IQA A;  2M1C A;  3NEC A;  4PM9 A;  5GLA A;  1STZ A;  1FCO A;  4OPR A;  3A0V A;  3Q81 A;  3A3F A;  5DTT A;  4EUV A;  1MWT A;  4LGW A;  4G3K A;  1TS6 A;  4OP8 A;  4U0X A;  2DNS A;  2WGV A;  1VM1 A;  4X25 A;  2ZQA A;  4JGO A;  2WKI A;  4KUK A;  4F94 A;  2JN7 A;  4GKU A;  4EU0 A;  3AGE A;  2OV5 A;  2W0N A;  1FOF A;  4WMC A;  2YKF A;  4RYE A;  3BJN A;  2VGL M;  4NXB A;  1OPX A;  4Y17 A;  1BTL A;  2QPN A;  3VOL A;  1NY0 A;  2A2L A;  4BD0 A;  1YMS A;  4WM9 A;  4BD1 A;  5GHY A;  4LV1 A;  3K3C A;  2O0Y A;  3EQV A;  3FV7 A;  4MNR A;  3MF0 A;  3KX0 X;  4P0M A;  2H10 A;  4YOF A;  2ZQD A;  2O9A A;  1GA9 A;  1S1Y A;  5FAT A;  1F5M A;  2V1Z A;  1MWS A;  1YLT A;  3MZD A;  4HP9 A;  3BWL A;  4L9F A;  1L0E A;  3S7O A;  2G7U A;  1FR6 A;  3WS0 A;  1PI5 A;  4QJG A;  5HX9 A;  3E4O A;  4GW9 A;  2KDK A;  4AFI A;  3F1P B;  2WGW A;  5DKK A;  2EX8 A;  1HLU P;  4D60 A;  5HW3 A;  4GHI A;  5TBM A;  1CEF A;  2IA2 A;  4ID4 A;  4R70 A;  3FKV A;  3V50 A;  3BFE A;  2WGI A;  1YKD A;  4MLL A;  1YSP A;  2XRN A;  3LEQ A;  2A24 A;  4EW7 A;  2ZMA A;  4IUH A;  2V2F F;  1IYO A;  2WYX A;  1S0W A;  1MBL A;  1FIK A;  2W1T B;  2V8F A;  1RP5 A;  1SKO B;  3UN7 A;  2L1M A;  3OZH A;  1IEM A;  3UE0 A;  2W1R A;  3VFH A;  3WS5 A;  5HFO A;  5HAI A;  4MDZ A;  4OQH A;  2LB5 A;  1CK3 A;  5DF8 A;  3RXW A;  3V3S A;  2X71 A;  1U60 A;  4NEE D;  4YFM A;  3T4L A;  2ZLY A;  1DP9 A;  3NI9 A;  1KVM A;  2VLG A;  1T1C A;  3N4I A;  4BEN A;  2LB9 A;  3T4K A;  4R3A A;  3ULF A;  3QP5 A;  3SS4 A;  4GDB A;  5FDS A;  3IBJ A;  1XA1 A;  5HZH A;  4PPR A;  3V67 A;  3UE1 A;  2Q0O A;  3UPO A;  3ZG9 B;  3F1O A;  4HH3 A;  3Q82 A;  4Y2F A;  2FFF B;  3OCL A;  4FCF A;  4HOI A;  2G2W A;  4BBV A;  3KYE A;  2J3T D;  2XSS A;  3G31 A;  5CRF A;  4UQI S;  2R9X A;  4N92 A;  5K5B A;  5J4E A;  2J7V A;  3NUL A;  4P87 A;  4ZDX A;  1OJG A;  3ZQ5 A;  4LFU A;  4X55 A;  3W2Z A;  4XT2 A;  4C3Q A;  1PRQ A;  2VA0 A;  1OT9 A;  4CLC A;  4IBR A;  3FYZ A;  4P6Z S;  1GHP A;  3LCE A;  2P08 A;  5AVE A;  3CIT A;  1L0G A;  3HUN A;  3LO7 A;  1OTD A;  4DJ3 A;  2O99 A;  2HJE A;  1W5D A;  2QWS A;  1S1Z A;  3A0R A;  1LL8 A;  3VP0 A;  3W4P A;  3IWQ A;  4Y3I A;  4CLC C;  3RXX A;  2HP9 A;  4IED A;  3MR0 A;  2L0W A;  1BZA A;  4O01 A;  4EER A;  4ZJ3 A;  4NXE A;  4FTX A;  3BQA A;  2Z6D A;  1BLC A;  1CEG A;  2VJW A;  4ZBE A;  1KE0 A;  1PWG A;  1XJ2 A;  1BYW A;  3MFD A;  1Y54 A;  5DVA A;  2EA9 A;  4BMW A;  3OLO A;  2XFT A;  3BFD A;  5CXW A;  4BBU A;  3IT9 A;  4ESP A;  4ZRR A;  3NDE A;  4R4S A;  2WGW B;  3NBL A;  3FG8 A;  1J3W A;  2ZMF A;  2PT7 A;  1N4O A;  2PAV P;  3A3E A;  3V5M A;  2PU2 A;  4GHI B;  4E3L A;  1G5U A;  5CHM A;  3LYX A;  5TBM B;  2JBF A;  1GSV A;  5F6A A;  5F5Y A;  2WAE A;  5GLC A;  2ZM8 A;  1MWR A;  1L3L A;  4BL2 A;  1ACF A;  5L2F A;  2A24 B;  5CED A;  3MFX A;  5CEB A;  3HLC A;  3LR3 A;  1YLW A;  2PRF A;  3C30 A;  4KZ4 A;  3UB5 P;  3G30 A;  1ES2 A;  1PI4 A;  5HDC A;  3F1N A;  3ITA A;  3S22 A;  3TSG A;  3S1Y A;  2EXA A;  1G6A A;  3PAG A;  4EXO A;  1O07 A;  2XD5 A;  2ZQ7 A;  5CEC A;  3MXQ A;  4Q0H A;  2W3F A;  2UV0 E;  1G28 A;  3LIB A;  1NWZ A;  5IT5 A;  3QNC A;  1EW0 A;  4HIA A;  1UWN X;  1K55 C;  2I9V A;  1LL5 A;  2PBY A;  5U47 A;  2D01 A;  3IXG A;  3I7J A;  3WS2 A;  2EWW A;  4OQ0 A;  2BLS A;  2HP5 A;  4N1X A;  2XK1 A;  2VGJ A;  2DRW A;  4OOM A;  4JGP A;  3MMH A;  1Y4O A;  1SHV A;  1ONG A;  4DF6 A;  1IKG A;  3M6H A;  3OC2 A;  3F1O B;  2GZA A;  3V3R A;  5L07 A;  4NXG A;  4NET A;  3DBA A;  4X69 A;  5HSQ A;  2GX5 A;  1FQG A;  1UWP X;  2A3U A;  5GLD A;  1KGG A;  1NXY A;  3PBN A;  4E3J A;  4HNB A;  5AQ9 A;  2OLU A;  3ZFZ A;  4E6X A;  3HVF A;  3W8K A;  3CLO A;  4WN5 A;  2YKH A;  2OAQ 1;  5AQ7 A;  4GOG A;  1D7E A;  2ZD8 A;  1PZO A;  4XT2 B;  1LHY A;  4CLC B;  3TRC A;  2JC7 A;  4FD8 A;  4KZ9 A;  3O88 A;  4HES A;  2WAF A;  2VK3 A;  3IF5 A;  4I3J A;  5KSC A;  3S4X A;  3T1Q B;  3ISG A;  5EE8 A;  2OLV A;  3C4P A;  2QJ7 A;  4KG2 A;  5FAO A;  3GTC A;  3DTE A;  1PW1 A;  4KQD A;  1WE4 A;  3PBT A;  2EX6 A;  2H28 A;  1HD8 A;  3A0S A;  2JKF A;  2ZC3 B;  3C5A A;  1ESU A;  1F9I A;  2IWD A;  1JWV A;  5G4Z A;  3HCY A;  4E3N A;  3T4S A;  4M4X A;  1SDE A;  4X56 A;  3VP3 A;  1CI9 A;  1Z09 A;  1VET A;  3G35 A;  4Y7P A;  3Q7Z A;  3RTY A;  1KGE A;  5GHZ A;  4UHU A;  3E4P A;  4S2L A;  4X6T A;  5E2F A;  4GD8 A;  5CHJ A;  5A92 A;  3GR2 A;  1W8Y A;  1AXB A;  4EBN A;  1GSX A;  3FPV A;  4LRX C;  1H5X A;  3SH7 A;  2WK0 A;  5KZH A;  4QU3 A;  2K2N A;  3DWK A;  4EEP A;  2C5W B;  2Y2I A;  3MS6 A;  2Q9M A;  2INW A;  1N9N A;  1MWU A;  2BTF P;  3L7H A;  5A8B A;  1K6S A;  3OCN A;  3B3X A;  3T4O A;  4B93 A;  4OQI A;  4R4R A;  1OTI A;  3F1N B;  3MQQ A;  3MQ0 A;  3UME A;  4QY6 A;  2ACG A;  3TG9 A;  4NKP A;  4MBH A;  2HV1 A;  2V1B A;  3CWF A;  4HI4 A;  1ODV A;  3VV4 A;  5EVI D;  3IBR A;  4BLM A;  2HP6 A;  5J8X A;  1I5Q A;  3DTM A;  3FWL A;  5IHV A;  3VOY A;  5DF9 A;  2J8Y A;  4LRZ E;  5TFQ A;  5TR7 A;  4S2J A;  4QB8 A;  1GHI A;  2ZC6 B;  3N8L A;  2PR5 A;  4LLO B;  2HDR A;  3W4Q A;  3NJA A;  4IVI A;  5FDH A;  2QZ6 A;  4PM7 A;  5EM0 A;  3MXS A;  1V9Z A;  1OTA A;  2XA7 M;  1CF0 A;  1KOU A;  4OOL A;  2MJ6 A;  4K0X A;  3LIF A;  4RQ9 A;  5DF7 A;  4O8G A;  4FH4 A;  3T1S A;  3JVV A;  1DY6 A;  4GD6 A;  3MZE A;  2JKT M;  1W63 M;  3Q1F A;  2PYP A;  5D3O A;  1PFL A;  4MBK A;  3NOU C;  4DXC A;  1NYY A;  5EOE A;  4ZAM A;  3BFG A;  3P7N A;  3N8R A;  3GVB A;  1D06 A;  4I39 A;  1H8Z A;  3HLW A;  3G34 A;  4HHD A;  4NK3 A;  1WA9 A;  2XF3 A;  1KE4 A;  4XUZ A;  5AVF A;  4WLA A;  5KSH A;  1PIO A;  5TGF A;  3TE8 A;  5E2H A;  4OOY A;  5BOH A;  3MKE A;  5HAQ A;  3EWK A;  1TDL A;  1NJ4 A;  3IXH A;  4YWZ A;  3ZGA B;  4UQI M;  3KSH A;  4B4Z A;  1VET B;  1S67 L;  1SZV A;  3IS2 A;  2H0T A;  1ZG4 A;  4PKY A;  2VGK A;  5FQQ A;  2XGN A;  3EEA A;  3CAX A;  3G32 A;  4P6Z M;  1TEM A;  2O9B A;  1KE3 A;  1NZO A;  4G3W A;  3DAV A;  2Z2L B;  5EEC A;  3D3O A;  1T19 A;  1JWZ A;  5M1A A;  2ZOH A;  3UPN A;  4S2M A;  3SH9 A;  3G2Y A;  1TVF A;  3H82 A;  5I94 A;  1JVJ A;  4WZ4 A;  1GA0 A;  3IX8 A;  3UY6 A;  1FSY A;  2ZC5 B;  3T4Q A;  1CQA A;  1XPB A;  1K56 D;  2V0U A;  4L9E A;  3IXB A;  4GS9 A;  3NIA A;  4PM8 A;  2JKR I;  3AGF A;  2EX9 A;  2WKP A;  1ERQ A;  4XXR A;  4I3I A;  1ZKJ A;  4I3A A;  4MN5 A;  2HDU A;  5CTN A;  4LPZ A;  3U4L P;  2FFY A;  4S2O A;  4WEK A;  3CPT A;  1BT5 A;  4EBL A;  3C2W A;  4G3V A;  4HBU A;  3W4O A;  3VP1 A;  4OLD A;  3OPR A;  4HP4 A;  3ZNT A;  4OQG A;  3EQU A;  3MQO A;  3ZCZ A;  3QP8 A;  3H9W A;  2V9A A;  1FIL A;  5CGW A;  4IJG A;  4IBX A;  1S6R A;  4JF4 A;  1F98 A;  2WUQ A;  3BM6 A;  1GSW A;  2X02 A;  3T1X A;  4EET B;  1LSX A;  5FAS A;  2JE5 A;  4E3K A;  4B4X A;  1NLZ A;  1M40 A;  3WRT A;  4EWF A;  5GLB A;  3JYI A;  3R4K A;  3M2K A;  2GDN A;  2KX6 A;  1E3U D;  1OME A;  3CJM A;  4BQM A;  2EXB A;  4N1H A;  3VMA A;  1LSW A;  1DRM A;  1LLB A;  1YMX A;  1K0K A;  4KG5 A;  1MKI A;  3QP1 A;  2JCH A;  3HL9 A;  4BWI A;  3WWX A;  4R6L A;  3PHY A;  1IFQ A;  3IF6 A;  2M7U A;  3BEC A;  2EFU A;  3C38 A;  2V20 A;  3QP6 A;  2Q9N A;  4Q8I A;  1W63 Q;  1ES3 A;  1YLP A;  3QP4 A;  2D02 A;  3E0Y A;  2HDS A;  1P9R A;  3SOI A;  1XXM A;  3NDG A;  4DKI A;  3BY8 A;  3IS2 B;  5I5L A;  3RFB A;  1P9W A;  4Y0O A;  3IF6 C;  1XJ4 A;  1YAX A;  5FQM A;  4L9G A;  3LIA A;  3ZG7 B;  2ZM2 A;  5CGS A;  3EOI A;  5A90 A;  1HTZ A;  1WYB A;  2ZBB A;  1OTE A;  4JF6 A;  3KYQ A;  3BW6 A;  3VOZ A;  4WF0 A;  4EQI A;  2J80 A;  4HBT A;  2B5R A;  4IVK A;  2I72 A;  4BJP A;  4ME4 A;  4DDS A;  2ZL1 A;  5HAP A;  3UB8 A;  1H8Y A;  2EX2 A;  3N7W A;  2Y2L A;  3H82 B;  5CGX A;  2WKR A;  4UA6 A;  2ZJ9 A;  4GLQ A;  3NCK A;  3PBQ A;  3BFC A;  4R1G A;  3V39 A;  3OPL A;  1PNE A;  3M2J A;  4UAA A;  5FQ9 A;  1YLJ A;  4Z1W A;  1IOU A;  1ONH A;  2CC1 A;  4I38 A;  2M7V A;  3S7Q A;  2PD8 A;  4GS9 B;  2PHY A;  5FI7 A;  4BL3 A;  4HJ4 A;  5F83 A;  4CJN A;  3LI9 A;  1VEU A;  2BG1 A;  2WAD A;  3ITB A;  3ZVT A;  4DDY A;  4OP5 A;  3LIE A;  5AQA A;  1P97 A;  3UDF A;  3CPT B;  1DJB A;  2FH5 A;  4Q0I A;  4N9K A;  3MXR A;  2HF6 A;  2UWX A;  4EES A;  1EI5 A;  3KYZ A;  1VQQ A;  4S2P A;  2IWC A;  2Y91 A;  4MBF A;  2IWB A;  4X1L A;  4LV3 A;  3BQ8 A;  2XLN A;  3AGD A;  1YLY A;  3KSI A;  4HY8 A;  1YSQ A;  3JPU A;  1NRF A;  2XFS A;  4JBF A;  4O7D A;  2PDR A;  3UB9 A;  4KZ7 A;  1NRJ A;  5F68 A;  1NZU A;  5A93 A;  4EBP A;  3E2L A;  4K08 A;  4BBT A;  3LR4 A;  4DE1 A;  4OLG A;  2ZC4 B;  2XD1 A;  4HJ3 A;  3ZNY A;  1H3Q A;  1HVB A;  5HL6 A;  3TOI A;  4I5S A;  3VP2 A;  3ZG8 B;  3VSL A;  3KSG A;  3UDI A;  3IXD A;  3NY4 A;  5CER A;  1Q2P A;  3IF6 B;  2GNX A;  3UB7 A;  3LI8 A;  1UGU A;  2E8I A;  2Y2Q A;  3T12 B;  4K91 A;  3ZG5 A;  3HLD A;  3UO9 A;  3QNB A;  4MEZ A;  1K54 A;  5FAQ A;  2J3W A;  3MJQ A;  4WEL A;  3K3D A;  4S2K A;  4WUJ A;  1E25 A;  5HWT A;  4KZ3 A;  3UE6 A;  4P6B A;  1IYS A;  3PAE A;  3MKF A;  2VX8 A;  2XEP A;  1K54 C;  1M6K A;  4EV4 A;  2QJ5 A;  5L09 A;  4M3K A;  4CLC E;  3QHY A;  3EGX C;  3T1R A;  5EVI A;  1DP6 A;  1LT0 A;  2Y79 A;  1G6O A;  2G2U A;  3UDX A;  4QY5 A;  5G4Y A;  4KG6 A;  2ZL1 B;  4WBG A;  2H5S A;  4S2N A;  1K38 A;  4KEN B;  1BSG A;  5FI6 A;  4QWO A;  3MBZ A;  3BRM A;  4OON A;  3HJI A;  2XH9 A;  2W1T A;  3BLM A;  1AWI A;  4QD4 A;  2W3E A;  3IWO A;  5HWV A;  4E04 A;  2BAS A;  1N9L A;  1T18 A;  1T1A A;  1SKF A;  1BLP A;  2ZQC A;  2WKQ A;  3E2K A;  4S2N C;  4E6W A;  5HD5 A;  4DE2 A;  1KVL A;  1CI8 A;  4PHT A;  4MN6 A;  2JHE A;  1JNU A;  3UPP A;  1XGI A;  3RH8 B;  4DRT A;  4H8R A;  1TF1 A;  1VEU B;  4OPY A;  1YPR A;  1H8M A;  4KZ6 A;  4Y0T A;  4F3L A;  4Y0U A;  1Z6F A;  3E4Q A;  2R78 A;  2VV6 A;  1IEL A;  1PWC A;  3LY4 A;  1N9B A;  5CHU A;  1X0O A;  4WYY A;  4Y5F A;  4YIN A;  3L9K A;  2K7S A;  4R3B A;  2XR0 A;  1C3B A;  3GQZ A;  5HDS A;  4UA7 A;  3SS3 A;  2VV8 A;  5JYO A;  1XFN A;  2C6W B;  3IH8 A;  4H6J A;  2WZX A;  1PW8 A;  3P01 A;  2PYR A;  3FPW A;  1K57 A;  1T1B A;  5L8M A;  4Y13 A;  3S7P A;  2W3D A;  1D1J A;  3P09 A;  1QME A;  5HD3 A;  5TJJ A;  4Y15 A;  1LL9 A;  1ES5 A;  2HZ5 A;  4PAU A;  3OPH A;  1XJ3 A;  1A0K A;  3RJU A;  5M19 A;  1K57 C;  1VHM A;  1QMF A;  4KUO A;  2QYB A;  2Z6C A;  5KMW A;  5DJU A;  1YLZ A;  3HUM A;  2Y4A A;  2HJ9 C;  3PR6 A;  3UNW A;  1W8Q A;  1TD5 A;  1XX2 A;  2KOI A;  2W27 A;  3LUQ A;  1ZG6 A;  3IX3 A;  2Y2N A;  1K6R A;  3GMW A;  3QP2 A;  4A5R A;  1W7F A;  3LGO A;  3NOT C;  3D72 A;  4WMC D;  4KZB A;  1L0D A;  2KLI A;  5M18 A;  4NG2 A;  1XA7 A;  1BUE A;  5F1G A;  4JLF A;  4R3J A;  2P7J A;  5F1F A;  3GSG A;  4ETZ A;  3IHB A;  4JXS A;  1K4E A;  1FCM A;  4X1M A;  3IH9 A;  3BFF A;  2O9C A;  5FEG A;  4E3I A;  1FR1 A;  5MC7 A;  4ZTK A;  5KIZ A;  5IU1 A;  1XJ6 A;  2NUT C;  4DE0 A;  3G4P A;  1EWZ A;  4X68 A;  4QHC A;  3OPP A;  1XP4 A;  5EVI B;  2VEA A;  5CTM A;  1PYY A;  4MN7 A;  4K0W A;  1K56 A;  5E2E A;  1FSW A;  1DP8 A;  1ZC2 A;  3DTK A;  5FSR A;  1I2W A;  1JTD A;  2B95 A;  4ZJ1 A;  2OWH A;  2P9V A;  4JXV A;  1ESI A;  5E43 A;  2FZ0 A;  4CPK A;  4UEY A;  1L0F A;  2XA7 S;  2DCF A;  3LR5 A;  4KZA A;  4PM6 A;  4C75 A;  1IYQ A;  5FQI A;  5A91 A;  2J9O A;  3P98 A;  2OOL A;  2PD7 A;  3T4T A;  5EVE A;  5G18 A;  1LI9 A;  3UE3 A;  2AVX A;  3D4F A;  5FEF A;  2HGV A;  5J3W A;  3A3I A;  4GN2 A;  4Q0J A;  2VGL S;  2OWJ A;  3IWI A;  3ZDJ A;  5FA7 A;  2ZQ8 A;  4WZ5 A;  3ZYT A;  1MPL A;  5FQJ A;  3HLE A;  5JYP A;  2V8C A;  5F69 A;  3WRZ A;  4F3L B;  4DN0 A;  2QHK A;  3LID A;  4DMZ A;  2J3T C;  5EM1 A;  3PYP A;  4WZ5 C;  4FUW A;  4EUZ A;  3CZD A;  5GL9 A;  3GV9 A;  1E3U A;  1ERM A;  5IS1 A;  4GNU A;  4H6J B;  4E3O A;  3S7N A;  3VSK A;  5EPH A;  1MZU A;  4DXB A;  1K4F A;  3OOV A; 
#chains in the Genus database with same CATH homology
 3S7O A;  3LI9 A;  2G7U A;  5A8B A;  3ICY A;  3OCN A;  3T4J A;  3T4O A;  4B93 A;  1S4R A;  1XFQ A;  3LIE A;  1P97 A;  3E4O A;  1OTI A;  3F1N B;  4GW9 A;  2KDK A;  2FH5 A;  3MQQ A;  3MQ0 A;  4Q0I A;  3TJZ C;  3UME A;  4AFI A;  3B47 A;  3F1P B;  2HF6 A;  5DKK A;  2VV7 A;  4EES A;  4NKP A;  2VZW A;  3KYZ A;  2CMN A;  4KQO A;  2HV1 A;  2V1B A;  4GHI A;  3CWF A;  4HI4 A;  1NLY A;  1ODV A;  5TBM A;  3BQ8 A;  4O0P A;  3VV4 A;  2IA2 A;  3IBR A;  3KSI A;  1P0Z A;  4L0L A;  4R70 A;  4HY8 A;  1YSQ A;  1S66 L;  3LR0 A;  2PDR A;  3UB9 A;  5DF9 A;  1YKD A;  1YSP A;  2XRN A;  2A24 A;  4EW7 A;  4LRZ E;  4II7 A;  4IUH A;  1NRJ A;  4IHQ A;  4JGR A;  5F68 A;  4CLC D;  2W1T B;  2PR5 A;  4LLO B;  2L1M A;  3NJA A;  4K08 A;  4BBT A;  3LR4 A;  3EEH A;  4HJ3 A;  2W1R A;  1H3Q A;  5HL6 A;  1V9Z A;  1OTA A;  2XA7 M;  1KOU A;  4OOL A;  2MJ6 A;  2V1A A;  4MDZ A;  3LIF A;  4I5S A;  4RQ9 A;  1ZTU A;  3KSG A;  4O8G A;  2LB5 A;  4DJ2 A;  3JVV A;  4NEE D;  3T4L A;  3PXP A;  1DP9 A;  3BY9 A;  3H7W A;  2JKT M;  1W63 M;  2VLG A;  2GNX A;  3UB7 A;  1T1C A;  4HH2 A;  3LI8 A;  1UGU A;  2PYP A;  4MMN A;  2LB9 A;  3NOU C;  3T4K A;  4R3A A;  3ULF A;  2L4R A;  2OAP 1;  3C8C A;  5DFX A;  4QPR A;  2XRO A;  2J3W A;  3P7N A;  3MJQ A;  1V9Y A;  1TS0 A;  3IBJ A;  4WEL A;  3GDI A;  3K3D A;  4WUJ A;  1D06 A;  4I39 A;  5HWT A;  5HZH A;  3V67 A;  3UE6 A;  4HHD A;  2W3G A;  3F1O A;  4HH3 A;  1WA9 A;  2VX8 A;  5DJT A;  4Y2F A;  4R38 A;  1N9N A;  5AVF A;  2GJ3 A;  3OCL A;  4WLA A;  5KSH A;  4EQ1 A;  2QKP A;  4HOI A;  2QJ5 A;  5HPI A;  4IUK A;  4CLC E;  3TE8 A;  4BBV A;  3EGX C;  1DP6 A;  2J3T D;  3R7W A;  1LT0 A;  2XSS A;  2Y79 A;  3CI6 A;  1G6O A;  3K2N A;  4UQI S;  4YNR A;  5K5B A;  5J4E A;  5G4Y A;  3EWK A;  3GEC A;  3KSF A;  3ZQ5 A;  4YWZ A;  3W2Z A;  1MC0 A;  4XT2 A;  4UQI M;  2VA0 A;  1OT9 A;  2JKT I;  3B42 A;  3KSH A;  4ARZ A;  4CLC A;  3SW1 A;  1S67 L;  3IS2 A;  4P6Z S;  3HJI A;  2W1T A;  3PBR A;  3LFV A;  2P08 A;  5AVE A;  4PKY A;  5FL3 A;  2W3E A;  3CIT A;  5HWV A;  4LRY C;  4E04 A;  2BAS A;  1N9L A;  1T18 A;  1T1A A;  3EEA A;  1OTD A;  4DJ3 A;  2O99 A;  2HJE A;  2JKR M;  3T50 A;  2QWS A;  2WKQ A;  1S1Z A;  3A0R A;  1LL8 A;  5HD5 A;  2PR6 A;  3CAX A;  4P6Z M;  2O9B A;  4PHT A;  4Y3I A;  4CLC C;  4MN6 A;  2JHE A;  4HJ6 A;  1JNU A;  3MR0 A;  2L0W A;  2P04 A;  4O01 A;  4EER A;  3RH8 B;  4G3W A;  4NXE A;  5HPF A;  1TF1 A;  3BQA A;  3UB6 A;  3D3O A;  1T19 A;  4HQA A;  2Z6D A;  2VJW A;  4PKY G;  2ZOH A;  1XJ2 A;  1BYW A;  3VE4 A;  4FSF A;  1H8M A;  4FOF A;  5CX7 A;  2EA9 A;  5AJG A;  4F3L A;  4BMW A;  2B18 A;  3OLO A;  4GJ4 A;  3E4Q A;  2R78 A;  2VV6 A;  4BBU A;  1S4S A;  1TS7 A;  1X0O A;  3H82 A;  4ZRR A;  4Y5F A;  1OTB A;  3FG8 A;  2ZMF A;  4CQH A;  2PT7 A;  2K7S A;  4NXF A;  5HDS A;  2K31 A;  4GHI B;  2VV8 A;  3LYX A;  4MCW A;  5TBM B;  1XFN A;  3JVU A;  4WEJ A;  1GSV A;  5F6A A;  5F5Y A;  2DMW A;  3T4Q A;  4H6J A;  2V0U A;  3P01 A;  1LSV A;  4L9E A;  2PYR A;  2EWV A;  3FPW A;  4GS9 A;  2JKR I;  1T1B A;  5L8M A;  2WKP A;  2A24 B;  3LIC A;  3S7P A;  2W3D A;  3MFX A;  3LR3 A;  5HD3 A;  5TJJ A;  3C30 A;  4I3I A;  4EEU A;  3U2A A;  4ETX A;  4PAU A;  4I3A A;  4MN5 A;  5HDD A;  4LPZ A;  5HDC A;  3F1N A;  1XJ3 A;  1OJ5 A;  4WEK A;  1VHM A;  3FC7 A;  4KUO A;  2QYB A;  2Z6C A;  3F1P A;  3C2W A;  4G3V A;  5DJU A;  4EXO A;  3EGD C;  5J7E A;  3G6O A;  1ZHH B;  2HJ9 C;  3PR6 A;  3MXQ A;  4HP4 A;  1TD5 A;  4Q0H A;  2W3F A;  3CUE A;  2NUP C;  3EQU A;  3MQO A;  1G28 A;  2KOI A;  3LIB A;  3H9W A;  1NWZ A;  2V9A A;  2W27 A;  3LUQ A;  5IT5 A;  3HJK A;  3PBS A;  1EW0 A;  4HIA A;  1UWN X;  1TS8 A;  3H7W B;  3B33 A;  3NOT C;  3D72 A;  4IJG A;  2I9V A;  1F98 A;  2VKS A;  2D01 A;  2KLI A;  1Y28 A;  1GSW A;  2W3H A;  2EWW A;  4GCZ A;  5EFW A;  3CUE C;  4EET B;  1LSX A;  4B9O A;  2ZMV A;  5HWW A;  1NLZ A;  5LBR A;  1MKM A;  4OOM A;  4HJ4 A;  3R4K A;  2P7J A;  3KO6 A;  4JGP A;  3MMH A;  4ETZ A;  5DFY A;  2B02 A;  2KX6 A;  3TW8 A;  2Y8H A;  2O9C A;  3OC2 A;  3F1O B;  2GZA A;  3VE3 A;  1N9O A;  1LSW A;  5MC7 A;  1DRM A;  3NOP C;  5KIZ A;  5IU1 A;  4NXG A;  1XJ6 A;  3NHQ A;  3DBA A;  2NUT C;  5HSQ A;  3E98 A;  2GX5 A;  4BWI A;  1UWP X;  4R6L A;  2VEA A;  3PHY A;  3R7W B;  4L9F A;  1IFQ A;  4MN7 A;  1VB6 A;  3PBN A;  2M7U A;  3O5Y A;  2V0W A;  4HNB A;  1DP8 A;  3C38 A;  2ZOI A;  5C5K A;  2OWH A;  3CLO A;  4WN5 A;  1W63 Q;  2YKH A;  2OAQ 1;  3UMD A;  2FZ0 A;  2D02 A;  1OT6 A;  1D7E A;  4UEY A;  3E0Y A;  4XT2 B;  1P9R A;  4JGQ A;  4CLC B;  3TRC A;  5DKL A;  4WL9 A;  4ARZ B;  3OBF A;  3BY8 A;  2XA7 S;  3IS2 B;  5I5L A;  1P9W A;  3RFB A;  3LR5 A;  1XJ4 A;  1YAX A;  4I3J A;  4L9G A;  3PBO A;  3LIA A;  2OOL A;  2PD7 A;  2M1C A;  3T4T A;  1STZ A;  3EOI A;  3UE3 A;  3A0V A;  4EUV A;  4G3K A;  2QJ7 A;  1TS6 A;  2HGV A;  5J3W A;  4Q0J A;  2VGL S;  2OWJ A;  2ZBB A;  1OTE A;  4JGO A;  4KQD A;  4KUK A;  3PBT A;  3KYQ A;  2H28 A;  3BW6 A;  2JN7 A;  4WF0 A;  4EU0 A;  3A0S A;  3ZYT A;  2J80 A;  2W0N A;  1F9I A;  2YKF A;  4BJP A;  4ME4 A;  3BJN A;  5F69 A;  2VGL M;  4F3L B;  4NXB A;  1OPX A;  3VOL A;  3UB8 A;  5G4Z A;  2QHK A;  3HCY A;  4DN0 A;  2A2L A;  3LID A;  3T4S A;  4DMZ A;  2J3T C;  4M4X A;  3H82 B;  3PYP A;  2WKR A;  4GLQ A;  3K3C A;  3PBQ A;  3RTY A;  3E4P A;  2O0Y A;  3EQV A;  3MF0 A;  3KX0 X;  4YOF A;  2O9A A;  5IS1 A;  1S1Y A;  1F5M A;  4Z1W A;  1GSX A;  3FPV A;  1IOU A;  4LRX C;  4HP9 A;  4H6J B;  2K2N A;  3S7N A;  4I38 A;  3BWL A;  2M7V A;  3S7Q A;  1MZU A;  2PD8 A;  4EEP A;  4GS9 B;  2PHY A;  1OJG A;  2INW A;  3OOV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...