2OWJA

Structure of an early-microsecond photolyzed state of co-bjfixlh, dark state
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
116
structure length
116
Chain Sequence
DAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRYRTTSDPHIIGIGRIVTGKRRDGTTFPMHLSIGEMQSGGEPYFTGFVRDLTEHQQTQARLQEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Time-resolved crystallographic studies of the heme domain of the oxygen sensor FixL: structural dynamics of ligand rebinding and their relation to signal transduction.
pubmed doi rcsb
source organism Bradyrhizobium japonicum
molecule tags Oxygen storage/transport
molecule keywords Sensor protein fixL
total genus 32
structure length 116
sequence length 116
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2007-02-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2owjA00
1KOUA 2WKRA 4GW9A 3NJAA 3H7WB 1LL8A 3IBRA 3KX0X 2VV7A 1XJ2A 3IS2B 4GCZA 3D72A 4K08A 4MN5A 1XFQA 3MQQA 4I39A 3FC7A 4M4XA 5HD3A 5HWWA 4WLAA 4GHIB 2WKPA 5EFWA 1JNUA 1T1BA 2INWA 3NOTC 1NWZA 3P7NA 3E4QA 1MZUA 2PDRA 4JGOA 2VV8A 2WKQA 4YWZA 4F3LA 3BY8A 1EW0A 4NXBA 2J80A 1DP9A 3A0RA 3UMDA 3F1OA 2D02A 2PR5A 1OTEA 2QJ7A 2QHKA 5G4YA 2VV6A 1S67L 5A8BA 4KUKA 1OTIA 2L0WA 4NXGA 4RQ9A 4WUJA 1VB6A 4GHIA 5HWTA 3ZQ5A 2A24A 5AVEA 1LSXA 3C8CA 2OWJA 3A0SA 2PD7A 3RTYA 5J7EA 3GDIA 3MQOA 4E04A 4EW7A 5J4EA 2ZOIA 2Z6CA 1DP6A 3F1NB 3G6OA 1GSVA 3NHQA 3IS2A 1G28A 4LLOB 1ODVA 4H6JA 4LRXC 2V0UA 3F1PA 1S1ZA 2D01A 1UWNX 3H82A 3OLOA 4HJ4A 4KUOA 2CMNA 1Y28A 1V9YA 2I9VA 3LIAA 2EA9A 2PHYA 4HH2A 4I3JA 3LI8A 3NOPC 4PKYA 5TBMA 1TS7A 4B9OA 2V0WA 4I5SA 2VEAA 1OJGA 2W27A 3H9WA 3F1OB 1LSVA 5F68A 1TS6A 3CLOA 4HP4A 3UE6A 5IS1A 4I3AA 4EESA 3C2WA 3LIEA 4DJ2A 3LI9A 1D7EA 4HNBA 4R38A 5AVFA 1S66L 1TS8A 2H28A 4KQDA 3CWFA 4BBVA 5F5YA 4GS9B 1OTAA 4LRZE 3SW1A 1F98A 5HDDA 2ZBBA 4JGQA 4BBUA 5HSQA 4WN5A 5J3WA 5HDSA 3E4OA 3F1NA 5HDCA 4I3IA 4EEPA 2OOLA 3UB7A 2KDKA 4MN6A 4L9GA 4EEUA 3VOLA 2KX6A 1TS0A 3CAXA 1T19A 1UWPX 5DJUA 5HD5A 4H6JB 3MXQA 5HZHA 2GJ3A 3F1PB 2P7JA 2R78A 3VE4A 3K3DA 1LSWA 1N9OA 2V9AA 5IU1A 3UMEA 4R3AA 5HWVA 4EQ1A 1XJ6A 1X0OA 1F9IA 3LUQA 3E4PA 3UB9A 1N9LA 4WL9A 1GSXA 1LT0A 3K3CA 3RH8B 1DRMA 3NOUC 4HJ6A 4PKYG 3T50A 1P97A 4L9EA 1OJ5A 2BASA 2PD8A 4HY8A 2W0NA 2ZOHA 1OTDA 1S1YA 2PYRA 5I5LA 4HH3A 1OT9A 1S4RA 1XJ4A 5DKKA 5F6AA 4WF0A 3B33A 4GS9A 2JN7A 5G4ZA 5TBMB 1OT6A 1XJ3A 3LICA 2QWSA 3MFXA 3PYPA 4HHDA 2K7SA 1DP8A 1WA9A 3GECA 4L9FA 1T1AA 1T1CA 3H7WA 4R70A 5F69A 4EETB 3BY9A 4HI4A 4I38A 4NXEA 1S4SA 3LIDA 3PHYA 1V9ZA 3MJQA 4NXFA 2V1BA 5DJTA 4HJ3A 4R6LA 2L4RA 3MR0A 2YKFA 4EERA 3VE3A 2YKHA 2VLGA 3EEHA 2Z6DA 3A0VA 3LIBA 4F3LB 2QKPA 1T18A 4XT2B 1P0ZA 2B02A 4JGRA 4DJ3A 2OWHA 5KIZA 4HQAA 2PYPA 3LIFA 2M1CA 3LYXA 4HOIA 3BWLA 3HJKA 1D06A 1BYWA 2HV1A 3UB8A 2L1MA 1N9NA 2PR6A 3FG8A 3ULFA 3ICYA 3H82B 3UB6A 2JHEA 4JGPA 4LPZA 1UGUA 2A24B 3EWKA 4HP9A 4BBTA 4EXOA 4HIAA 4LRYC 1XFNA 2QJ5A 2V1AA 1OTBA 3HJIA 1GSWA 5DKLA 4XT2A
chains in the Genus database with same CATH superfamily
1WYCA 2Q9MA 3IS2B 3D72A 1CI8A 1MKIA 1IFQA 4Y0OA 1ERMA 4N9LA 4WMCD 4D60A 3G2ZA 4OQIA 5F1FA 4PHTA 3T4LA 3T1XA 4BMWA 4Y0UA 4WM9A 3C8CA 2PD7A 3GDIA 4DF6A 3M2KA 2V8CA 2Z6CA 3G6OA 3NHQA 5HAPA 4HJ4A 3OLOA 3IX4A 1NYMA 4ARZA 3GR2A 2V0WA 2P9VA 3ZVWA 1FCMA 3OBFA 4FH4A 3DTIA 1VQQA 3QP8A 4HNBA 4WZ5C 3NULA 5GHYA 2EXBA 1M6KA 4FOFA 5HSQA 5HDSA 3E4OA 5D3OA 2R9WA 2Z2LB 3BQAA 2B95A 1BT5A 4BQMA 3WS0A 2OV5A 3O3VA 1XP4A 1IKIA 3RXXA 2XFSA 3CMZA 4WL9A 4Y17A 1VETA 3GV9A 5L2FA 4JXWA 3V50A 5DFXA 1MWUA 4IBXA 2EX8A 5DVAA 3SS4A 4L0LA 4XUXA 5GHXA 5FAPA 2Y79A 1P9RA 1EWZA 2HDQA 2G2UA 3KYZA 4Z1WA 1K4FA 5DTTA 2UV0E 1K57A 4BWIA 2HV1A 3O88A 3ICYA 2JHEA 4NEED 4EXOA 3FWLA 2PAVP 4PM6A 4MBFA 4GCZA 4MN5A 5HWWA 3BW6A 2WK0A 2Y59A 4A5RA 4E3NA 3I7JA 2D02A 2Q9NA 1K4EA 4CPKA 3TRCA 1PWDA 3GQZA 1XX2A 3QP4A 5GLBA 4GOGA 1SKOB 4FCFA 5CGWA 1S1ZA 3KO6A 1RCJA 3NDEA 3OPLA 3NOPC 4I5SA 1WE4A 2HZ5A 4N92A 3F1OB 3CLOA 2FFFB 1BLHA 5FSRA 3VFFA 3S7OA 1OTAA 2ZBBA 2IA2A 2O9AA 3C30A 3G4PA 4DN0A 5G18A 5J8XA 3UB7A 1MBLA 5L10A 1K54C 3F1PB 1H5XA 4II7A 2WKEA 3WWXA 2JBFA 1GSXA 3V5MA 1BUEA 4X1LA 3SOIA 1ZTUA 1PI4A 5KSCA 2J3TD 4O0PA 4P6ZS 2WADA 3GECA 4U0XA 5CHJA 3MQ0A 5HAIA 1S4SA 4QD4A 3UB5P 4EUVA 5HX9A 1Z09A 3ITBA 5KIZA 2L1MA 1MWSA 4MNRA 3ULFA 3H82B 1L0EA 2X01A 2J3TC 3V3RA 2G2WA 2VV7A 2ZC6B 3NDGA 3BJNA 2PU4A 4WLAA 4WBGA 5FDHA 1CF0A 4F94A 1K25A 3MKFA 4R3BA 4P6BA 2EX9A 3B42A 4E3LA 2AVXA 2ZQ8A 3EGDC 3LO7A 1ESUA 4GDNA 2Y2PA 4M3KA 3VV4A 1YT4A 1LHYA 1V9YA 4WF0A 4G3WA 4HBUA 1MPLA 5F68A 3H9WA 1YLPA 5EV0A 2VGLM 2XH9A 4JKTA 5HDDA 4P85A 4WN5A 1LL5A 3ZNYA 3W2ZA 3AGEA 3VOLA 4ZRRA 5JYPA 3PTEA 3BLSA 5FI2A 1X0OA 3UPOA 1NRFA 1YKDA 5CGSA 2Y2GA 2Q0OA 1JTGA 2BASA 2BLSA 2ZMVA 5M18A 1OT9A 2EWVA 3UE3A 4HBTA 3G2YA 1S6RA 4N1XA 3UDXA 5L8MA 2OSUA 2ZMAA 3MMHA 4JGRA 4YOFA 3WS4A 4EBNA 3C7VA 2JCHA 1BSGA 3T4KA 1RGZA 4BBTA 5FEFA 1ESIA 1G6AA 4B93A 3BECA 3RJUA 2VK3A 2WKRA 3KX0X 3HUMA 1XFQA 3JYIA 1G6OA 4KZ9A 4S2PA 5GLDA 1MZUA 1NRJA 1SHVA 3EEAA 4UQIM 4JF6A 2Y2MA 5I94A 2VV6A 2L0WA 1VB6A 4GHIA 5BOHA 1HVBA 4KG2A 5CEBA 4E04A 1E25A 1AXBA 3SS3A 5IT5A 1HZOA 2Y2IA 3HLEA 1ODVA 4OVDA 2XEPA 3BYDA 4KQQA 1UWNX 4WUJA 2CMNA 2WAFA 1PNEA 2W27A 3VSLA 3T4TA 3PAEA 3VMAA 4O7DA 3M2JA 5GL9A 2XA7M 3OCLA 4GN2A 2EFUA 1D1JA 4AFIA 1IKGA 4IUHA 1KDWA 5EPHA 1IELA 2HJEA 4CLCA 4ZBEA 1IYSA 1XJ6A 1HD8A 3V67A 4KZ3A 4R1GA 5DF8A 3T50A 1F5MA 1BZAA 2ZMFA 5CECA 4MMNA 2W1RA 4GS9A 1OT6A 2K7SA 3FPVA 1ZC2A 3UNWA 3KSFA 3KYQA 3H7WA 4KG6A 5JYOA 2DCFA 2V8FA 5HPIA 2O9BA 4KZ8A 4KZ7A 1PZPA 3ZG9B 1H3QA 5FQKA 2H10A 1SDNA 2HGVA 2VZWA 2JC7A 4LRYC 4PM5A 3MXSA 2LB5A 5KMWA 2PRFA 4R23A 4S2LA 1LL8A 2P08A 3QP6A 5CTNA 3DWZA 3UDFA 4DXCA 4PM9A 3KYEA 4UHUA 5EVIB 3A3IA 4S2IA 4Y15A 1PW8A 3A0SA 3B3XA 4RA7A 3F1NB 2A49A 5E2EA 3IF6B 5HL1A 2W1TB 3BFGA 3FYZA 1H8ZA 4EESA 1IYOA 1PFLA 1TS8A 1YM1A 5F5YA 3HLWA 3T4SA 1K57C 4BBUA 3HLGA 3M6HA 4JPMA 3W4PA 3VOZA 2O0YA 4DE2A 1DJCA 4EQ1A 3R7WB 4HY8A 3EQVA 4RX2A 1LL9A 3ZFZA 3T4QA 5CHUA 1JWVA 2W3DA 3L7HA 3QNBA 5AQ7A 4NXFA 1NLZA 1W7FA 1W8QA 2J9PA 1P0ZA 5FASA 3A3FA 4OLGA 2HP9A 2M1CA 4HOIA 4WELA 3ZG8B 2WZXA 1PZOA 4KZ4A 3UB6A 1XA7A 1XJ2A 3MQQA 3P98A 5HD3A 1E3UD 4PM7A 4JGOA 1XKZA 4NXBA 2OAQ1 2QJ7A 1OTEA 4BENA 2XROA 4RQ9A 3WS5A 5HPFA 4KZ6A 4EW7A 3N6IA 1CI9A 4H6JA 4L9FA 3LIAA 2EA9A 2PHYA 1YMSA 4B9OA 1LSVA 1TS6A 3S22A 4I3AA 4UAAA 3LIEA 2XLNA 5GLCA 1S66L 3IBJA 3SW1A 3HL9A 5J3WA 3PBOA 3ISGA 4MN6A 4JLFA 2ACGA 3CAXA 1T19A 1UWPX 2Y2HA 2P7JA 3K3DA 4H8RA 1N9LA 5DF7A 3UY6A 2QMIA 3O86A 5TR7A 1XJ3A 2ZM0A 5M1AA 1NY0A 3CZDA 2XDMA 4GDBA 4FUWA 4KZ5A 4PAUA 5DTSA 3A0VA 2X71A 3ZYTA 2PYPA 4S2NC 1D06A 2RL3A 5EOOA 1N9NA 1W63M 2M7UA 4X53A 4GW9A 1SKOA 3OOVA 3NC8A 3EQUA 3T1SA 4GKUA 5KSHA 4ZJ3A 5EFWA 1KVMA 2HDSA 3P7NA 2BTFP 4F3LA 3FV7A 4ME4A 2V2FF 2WKIA 3R4KA 4IBRA 2OLVA 3M6BA 5AVEA 1LSXA 3NI9A 4NG2A 3N8LA 3MF0A 1GSVA 1NZOA 2ZJ9A 1LI9A 4MLLA 1GA0A 2Z2MB 3D3OA 5EOEA 3HLBA 1YAXA 4QU3A 4ZAMA 4BL3A 2VA0A 1AWIA 3QP1A 2ZQCA 2A2LA 4EUZA 4BD1A 2WAEA 5FI6A 4KZAA 5A92A 4L9GA 3G34A 3VOYA 1MC0A 4GD6A 3E0YA 4E3IA 4Z9QA 1YLJA 1BLSA 3AGDA 4E3OA 5I5LA 1XJ4A 3MBZA 2JN7A 5TBMB 3GSGA 3LEZA 3LICA 4UEYA 5CTMA 5LBRA 5F69A 4R0QA 2V1BA 4WEKA 4EERA 4B4ZA 4ETZA 3E98A 3P09A 3S1YA 2FH5A 3HREA 4HP9A 4HIAA 4LCMA 1KOUA 2ZQ9A 1KE0A 4I39A 3FC7A 3MXRA 4M4XA 3D4FA 1LI0A 4BL2A 1VHMA 4WEJA 5TFQA 3BY8A 2J80A 3Q7VB 3C4PA 2PR5A 1FQGA 3OPPA 3UPPA 2XQZA 1NYYA 4E6WA 1W63Q 2A24A 4EQIA 4E3MA 3JPUA 3RTYA 2J7VA 4PPRA 2CC1A 3DW0A 5E2HA 1VEUB 3IS2A 1JVJA 3PBTA 1I2SA 1W5DA 1HLUP 1IOUA 4X69A 1ES5A 3V3SA 2Y55A 1ES3A 2IWBA 3B47A 1BULA 5FAOA 3N8RA 3NY4A 3IXGA 4X68A 1Q2QA 4ESPA 1CEFA 1PWCA 3NBLA 4ID4A 3L9KA 3WRTA 2OOLA 3ZGAB 4GJ4A 3EGXC 3MXQA 4C75A 3VE4A 3UDIA 1PIOA 5HWVA 3UB9A 2VJWA 1LT0A 3JVVA 4HJ6A 4OPYA 4Y0TA 4LGWA 1K38A 4L9EA 1KE4A 4DXBA 1H0MA 1OTDA 4KQRA 4HH3A 1S4RA 3UN7A 5DKKA 1LLBA 1I2WA 3HBRA 4XUZA 3HLDA 3MFXA 4HHDA 5MC7A 1MXOA 1T1CA 2PU2A 1KGFA 2WZZA 3SS5A 3BY9A 3E2KA 1QMEA 5AQAA 1YLYA 1Y54A 4YFMA 1T18A 1S0WA 3Q82A 4GB7A 4HQAA 5EECA 5FDSA 5E43A 3HJKA 2B5RA 4LPZA 2R9XA 1XFNA 3A3EA 4Q8IA 1NWZA 3E4QA 1F2KA 3MZEA 1MWRA 4YWZA 1VM1A 1KE3A 2JKFA 4OQ0A 3A0RA 4KUKA 4OPZA 2ZM2A 3LGOA 4QY6A 3Q7VA 2VKSA 1DY6A 3SZTA 2QZ6A 4YNRA 3LY4A 5EUAA 1Y28A 3VSKA 4I3JA 2H5SA 5GHZA 2LB9A 2DMWA 4E3JA 1XGJA 4K0WA 2P74A 3PBSA 3GRJA 3ITAA 1DJBA 1JWZA 1D7EA 5AVFA 4D2OA 4OKPA 5KZHA 3VFHA 4B88A 4I3IA 3BQ8A 2FZ0A 1P9WA 1TS0A 3HUNA 4PMAA 4BD0A 5HZHA 1L3LA 1E4DA 3W4OA 1IEMA 3BRMA 2V9AA 2ZL1B 1MWTA 1DRMA 4E6XA 1EI5A 4LV2A 1CK3A 3MKEA 2K2NA 3IXHA 3TG9A 4GD8A 2HP5A 3LR0A 2QWSA 3U2AA 3PYPA 1JWPA 1WA9A 4KQOA 4DRTA 3S4XA 4I38A 4O01A 1KGGA 3VE3A 2Y2KA 1K6RA 1OMEA 2OWHA 3LIFA 2NUPC 1XXMA 2ZC4B 4DE3A 3SH9A 3EWKA 2V1AA 1YQSA 2WGVA 5J4EA 4DDYA 5DKLA 1K56D 4K08A 1YLTA 3N8SA 3CUEC 3PAGA 4CLCE 2XSSA 1YPRA 3CI6A 3PBQA 2WKQA 2W3HA 2Y2OA 4LFUA 3ZG5A 2WYXA 3O87A 4S2JA 3ZQ5A 5HWTA 4IUKA 4LV1A 2ZOIA 3WS2A 3SH8A 2KLIA 3ZHHA 3DTKA 1L0GA 2V0UA 4KUOA 4MEZA 3GVBA 1FIKA 4B4XA 3UE6A 1L2SA 1WYBA 2Y2QA 3ZG0A 4BBVA 3WRZA 3OPHA 4UA6A 5HDCA 2Y4AA 4EEUA 4JXGA 5F83A 4JXSA 1YLZA 1F9IA 3E4PA 1SDEA 3HLFA 3LR3A 2PD8A 3VP2A 2PYRA 4Q0IA 2IWDA 5CRFA 5G4ZA 4UA7A 1J3WA 4G3VA 3QP5A 2HF6A 5FQJA 4EETB 4OQGA 4ZJ1A 3LR4A 1J9MA 1V9ZA 3MJQA 2WGWA 2ZC5B 4HJ3A 3MR0A 2OLUA 3IT9A 1W79A 2Y2NA 1OPXA 4ETXA 1VEUA 1STZA 1A0KA 2ZQAA 2IWCA 3KSGA 3N7WA 3FG8A 3CITA 5FQMA 3S7QA 2MJ6A 1UGUA 4HESA 4MBHA 3IH9A 2J9OA 4WMCA 3HJIA 5E2GA 5CHMA 3IBRA 4IEDA 3G31A 1T1BA 1TVFA 2PDRA 3EOIA 3BFDA 1ZG4A 3QP2A 3F1OA 3W4QA 5AJGA 4LCLA 3O5YA 4R3JA 1RP5A 4N1HA 1U60A 2V20A 5FI7A 3ZCZA 4LLOB 1G28A 4QPRA 3DAVA 3IQAA 3A3JA 4EV4A 2VEAA 3FKWA 1PI5A 2H0TA 4KENB 1BTLA 4R38A 4K0XA 4KZBA 3T12B 2XD1A 3KSHA 3CHWP 2EXAA 1Y4OA 4JGQA 3FKVA 1SZVA 3PBRA 5A90A 2ZLYA 1QMFA 1GCEA 4JF5A 2RCXA 4R3AA 4ARZB 3CJMA 3RH8B 1TF1A 3NOUC 4DMZA 3DWKA 5DTKA 1P97A 3T1QB 4DKIA 1S1YA 3IH8A 4R4RA 1Z6FA 3B33A 2C6WB 4R70A 4PM8A 4BJPA 2NUTC 2YKFA 2W3FA 2YKHA 5CX7A 4F3LB 4QB8A 4WZ5A 4MDZA 4JGPA 4RYEA 4CJNA 4QHCA 4G3KA 1XGIA 1Q2PA 3BLMA 3IX8A 4X25A 4U0TA 1CQAA 3MFDA 1JTDA 1FSWA 2INWA 5L07A 2J8YA 1ALQA 2VV8A 3LY3A 3UMDA 4Y13A 4DE1A 1BLPA 1GHMA 1IYQA 5G4YA 4NXGA 4Y7PA 3MZFA 3GMWA 1KVLA 5GLAA 2P9VB 1DP6A 5AQBA 1O07A 5E2FA 2G7UA 3F1PA 2VGJA 3WS1A 3ZG7B 3U4LP 4LRZE 4EEPA 2JKGA 1I5QA 2K31A 4JXVA 3C7UA 3OC2A 4CQHA 2O9CA 1G68A 4HP4A 1TEMA 1ERQA 2GX5A 1L0DA 5EM1A 3IWOA 1YSPA 1FCNA 4OPQA 2VGLS 5EE8A 3RXWA 1VETB 1N9OA 4P6ZM 4C6YA 2EFXA 1XPBA 3IWIA 1ZHHB 3UPNA 4PKYG 2W0NA 4S2MA 5EVID 4IVKA 4Y2FA 2JKTI 3BFEA 2DNSA 4QJGA 2XK1A 5DJTA 2EX6A 2L4RA 4OQHA 5IHVA 1K56A 3IXDA 3BWLA 3HCYA 4ZJ2A 3FPWA 4Y5FA 3IF6C 2A24B 2E8JA 4GZBA 1GHIA 2HP6A 4S2KA 3C38A 2A3UA 2ZQ7A 3S7NA 3NOTC 4CLCD 4U3TA 2WUQA 2XD5A 2HJ9C 3OZHA 5HFOA 1NLYA 2EX2A 1S67L 2XGNA 3OPRA 5FQIA 5A93A 3PR6A 2OWJA 3OCNA 4Y3IA 5J7EA 2XRNA 1TD5A 3HUOA 3FZCA 2VGKA 4UQIS 1TDGA 4X56A 3IF5A 2ZC7A 3DTEA 3VP1A 3CUEA 5EVEA 2I9VA 1FCOA 1O7EA 4HH2A 3UO9A 2I72A 4CLCB 1TS7A 5HW3A 4FD8A 1BLCA 4CLCC 3MS6A 5CERA 3C2WA 4NK3A 4X1MA 3GTCA 2WGWB 4KQDA 2W3EA 1ES4A 4WYYA 1PWGA 2KDKA 5HD5A 3W8KA 4KG5A 2GJ3A 3CG5A 1LSWA 3G32A 4K91A 2XA7S 5IU1A 3UMEA 5M19A 5C5KA 2JKRM 1ONHA 5DFYA 3VP0A 4JBFA 3TW8A 1G5UA 5L09A 2ZC3B 4Q0JA 2X02A 1ACFA 1SCWA 1DP8A 1E3UA 4OP5A 3A3DA 5FAQA 3LIDA 1K6SA 3PHYA 3RFBA 2OAP1 4FH2A 3NCKA 2Y8HA 3SH7A 3QNCA 3TE8A 5EVIA 4XXRA 2JE5A 4OONA 4NETA 1OTBA 1GSWA 1NJ4A 4JF4A 3T1RA 2WKPA 1JNUA 3IX3A 1ES2A 2JKRI 2VX8A 2QHKA 4IHQA 3Q7ZA 5FQQA 4BLMA 2V1ZA 3DTMA 5FATA 1MY8A 2GDNA 5DF9A 3MSHA 5EVLA 1ZKJA 1GA9A 2FFYA 2BG1A 3G30A 5HL6A 3BM6A 5TBMA 3VP4A 2QPNA 3ZNTA 1W8YA 3TSGA 1K55A 4ZDXA 3CWFA 4GS9B 1F98A 2ZD8A 4QWOA 3T4OA 3ZDJA 3UE0A 4O8GA 3IWQA 4OP8A 5CGXA 2GZAA 3LUQA 4OPRA 4YINA 1OJ5A 4LV0A 2ZOHA 1NXYA 1IYPA 5HARA 4EWFA 1H8MA 4OH0A 2PBDP 3LEQA 4QY5A 4IJGA 4MN7A 2XF3A 4NXEA 3CPTA 4OLDA 3EEHA 3LIBA 2Y91A 4XT2B 4DDSA 4MCWA 3KSIA 4GLQA 5FEGA 4LENA 1TDLA 3BEBA 3PBNA 1K55C 2PR6A 3R7WA 3IHBA 3Q07A 4FTXA 1MKMA 3H7WB 2EWWA 3IF6A 3P01A 4GHIB 1FR6A 2KOIA 3ZVTA 1N4OA 2QYBA 4DE0A 5FQ9A 4P87A 3Q1FA 5A8BA 4LV3A 4MBKA 3MQOA 4EBLA 2HPBA 2HDRA 3TOIA 4Q0HA 2D01A 3D9YA 1NZUA 3N4IA 4E3KA 3LI8A 4PKYA 1OJGA 4C3QA 2ZQDA 2GNXA 4DJ2A 3LI9A 3VP3A 1L0FA 1K54A 1YLWA 1K0KA 4WZ4A 2JKTM 4RVAA 4X55A 1DJAA 5EVIC 1HTZA 1YMXA 2H0YA 2KX6A 4N9KA 2ZM8A 3NECA 5DJUA 2Y2LA 2R78A 2B18A 3C4OA 3E2LA 5EM0A 1XA1A 2M7VA 4UA9A 2HDUA 4S2OA 5F6AA 1YSQA 3V39A 4FSFA 1T1AA 3LR5A 4X6TA 1FILA 2XR0A 4OOLA 2DRWA 4R6LA 5K5BA 2VLGA 2Z6DA 1EROA 4OOMA 5F1GA 1PW1A 3UB8A 3CPTB 3MZDA 4EBPA 3C5AA 3IHAA 4XT2A 5HAQA 3QHYA 3NJAA 1N9BA 3HVFA 4RX3A 1PRQA 2XFTA 3DBAA 1FSYA 1EW0A 5TGFA 3S7PA 2UWXA 1SKFA 1DP9A 2C5WB 1ONGA 2PT7A 5FA7A 2WKHA 1OTIA 3PXPA 3T4JA 2W1TA 2ZL1A 2Y2JA 3AGFA 4LRXC 1FR1A 3H82A 5A91A 3JVUA 3G35A 5U47A 1KDSA 3Q81A 4ZTKA 2O99A 3K2NA 5IS1A 4OOYA 5CXWA 1CJFA 1RGYA 2H28A 4R4SA 4S2NA 2J3WA 3F1NA 3BFCA 2P04A 1CEGA 4IVIA 4H6JB 1C3BA 3BFFA 4P0MA 3K3CA 3UE1A 1FOFA 4HEFA 4NKPA 5CEDA 5F82A 1GHPA 3LCEA 3TJZC 2E8IA 4HI4A 1PYYA 2WGIA 1KGEA 3IXBA 4GNUA 1ZG6A 2QKPA 5FL3A 2B02A 4DJ3A 1H8YA 3LYXA 1BYWA 2W3GA 1M40A 5TJJA 3NIAA 2PBYA 2QJ5A 5AQ9A 4EU0A 3LFVA 3HLCA
chains in the Genus database with same CATH topology
2LB5A 1LL8A 2P08A 3IS2B 3D72A 3S7NA 1IFQA 3NOTC 1NWZA 3E4QA 4CLCD 4YWZA 3A0RA 2HJ9C 4PHTA 3T4LA 1NLYA 4BMWA 1S67L 4KUKA 3PR6A 3C8CA 2OWJA 3OCNA 3A0SA 2PD7A 4Y3IA 5J7EA 2XRNA 3GDIA 1TD5A 2Z6CA 3F1NB 3G6OA 4UQIS 3NHQA 2VKSA 4YNRA 3CUEA 3OLOA 4HJ4A 2I9VA 1Y28A 2W1TB 4HH2A 4I3JA 4ARZA 2LB9A 1TS7A 4CLCB 2V0WA 2DMWA 4CLCC 3PBSA 3OBFA 4EESA 3C2WA 1D7EA 4HNBA 5AVFA 1TS8A 4KQDA 5F5YA 2W3EA 4FOFA 3T4SA 4BBUA 5HSQA 5HDSA 3E4OA 4I3IA 3BQ8A 2KDKA 2FZ0A 1P9WA 1TS0A 3BQAA 5HD5A 5HZHA 2GJ3A 2O0YA 1LSWA 2XA7S 2V9AA 5IU1A 3UMEA 5C5KA 4EQ1A 3R7WB 2JKRM 5DFYA 4WL9A 3TW8A 1DRMA 4HY8A 3EQVA 2K2NA 3LR0A 4Q0JA 3T4QA 2QWSA 3U2AA 3PYPA 5DFXA 1DP8A 1WA9A 4KQOA 2W3DA 4L0LA 4I38A 3LIDA 3PHYA 4NXFA 4O01A 3RFBA 2OAP1 2Y79A 1NLZA 1P9RA 2Y8HA 3VE3A 3TE8A 1P0ZA 3KYZA 4Z1WA 2OWHA 3LIFA 4WELA 2M1CA 4HOIA 4BWIA 2HV1A 2NUPC 3ICYA 3UB6A 2JHEA 3EWKA 4NEED 4EXOA 2V1AA 1OTBA 1GSWA 5J4EA 5DKLA 4K08A 1XJ2A 4MN5A 4GCZA 5HWWA 3MQQA 5HD3A 3CUEC 3BW6A 2WKPA 1JNUA 4CLCE 2XSSA 3CI6A 4JGOA 3PBQA 2WKQA 4NXBA 2OAQ1 2D02A 2JKRI 1OTEA 2QJ7A 2W3HA 2VX8A 2QHKA 2XROA 4IHQA 4RQ9A 3TRCA 3ZQ5A 5HWTA 5HPFA 4IUKA 4EW7A 5DF9A 2ZOIA 2KLIA 4H6JA 2V0UA 1S1ZA 3KO6A 4KUOA 4L9FA 3LIAA 2EA9A 2PHYA 5HL6A 4B9OA 3NOPC 5TBMA 4I5SA 3F1OB 1LSVA 1TS6A 3CLOA 3UE6A 4I3AA 3LIEA 3S7OA 1S66L 4BBVA 3CWFA 3IBJA 4GS9B 1OTAA 3SW1A 1F98A 2ZBBA 2IA2A 2O9AA 3C30A 5J3WA 4DN0A 5HDCA 3UB7A 3PBOA 4MN6A 4EEUA 3T4OA 3CAXA 1T19A 1UWPX 3F1PB 2P7JA 3K3DA 4O8GA 4II7A 2GZAA 3LUQA 1F9IA 3E4PA 1N9LA 1GSXA 3LR3A 1OJ5A 2PD8A 2ZOHA 2PYRA 4Q0IA 1ZTUA 2J3TD 4O0PA 5G4ZA 1H8MA 4P6ZS 1XJ3A 4IJGA 4G3VA 3GECA 4MN7A 2HF6A 4EETB 3LR4A 4NXEA 3MQ0A 1S4SA 1V9ZA 3MJQA 4EUVA 4HJ3A 3MR0A 4PAUA 3EEHA 3LIBA 3A0VA 4XT2B 4MCWA 3ZYTA 5KIZA 1OPXA 2PYPA 4ETXA 3KSIA 1STZA 4GLQA 1D06A 3KSGA 3PBNA 2L1MA 1N9NA 2PR6A 3FG8A 3CITA 3S7QA 1W63M 3H82B 3ULFA 2MJ6A 2M7UA 1UGUA 3R7WA 3HJIA 2J3TC 4GW9A 1MKMA 3OOVA 3H7WB 3IBRA 2EWWA 2VV7A 3P01A 3EQUA 3BJNA 4WLAA 5KSHA 4GHIB 5EFWA 1T1BA 2KOIA 3P7NA 2PDRA 3EOIA 4F3LA 2QYBA 4ME4A 3F1OA 5AJGA 5A8BA 3R4KA 3B42A 3O5YA 3EGDC 5AVEA 1LSXA 3MQOA 3MF0A 1GSVA 4LLOB 1G28A 4Q0HA 4QPRA 2D01A 3VV4A 1V9YA 4WF0A 3D3OA 3LI8A 4PKYA 3C38A 1YAXA 4G3WA 2VEAA 1OJGA 3H9WA 5F68A 2GNXA 2VA0A 4DJ2A 2VGLM 3LI9A 4R38A 2A2LA 3KSHA 5HDDA 2JKTM 4JGQA 4WN5A 3PBRA 4L9GA 3VOLA 2KX6A 3W2ZA 5DJUA 4ZRRA 1MC0A 2R78A 2B18A 3E0YA 4R3AA 4ARZB 1X0OA 1YKDA 3RH8B 1TF1A 3NOUC 4DMZA 1P97A 2BASA 2M7VA 2ZMVA 1S1YA 5I5LA 1OT9A 1XJ4A 5F6AA 3B33A 2JN7A 5TBMB 2EWVA 3UE3A 3LICA 4UEYA 1YSQA 4FSFA 5LBRA 1T1AA 3LR5A 4R70A 5F69A 4OOLA 2V1BA 4WEKA 4BJPA 5K5BA 4R6LA 2NUTC 2YKFA 4EERA 5L8MA 2W3FA 2VLGA 2YKHA 2Z6DA 5CX7A 4F3LB 3MMHA 4ETZA 4JGRA 3E98A 4YOFA 4OOMA 2FH5A 3UB8A 4MDZA 3T4KA 4JGPA 4BBTA 4HP9A 4G3KA 4HIAA 4B93A 4XT2A 1KOUA 2WKRA 3NJAA 3KX0X 1XFQA 4I39A 3FC7A 4M4XA 1G6OA 2INWA 1VHMA 1MZUA 3DBAA 4WEJA 2VV8A 3BY8A 1EW0A 1NRJA 3S7PA 2J80A 1DP9A 3EEAA 3UMDA 2PT7A 4UQIM 2PR5A 5G4YA 2VV6A 1OTIA 2L0WA 4NXGA 3PXPA 1VB6A 4GHIA 2W1TA 1W63Q 3T4JA 2A24A 3RTYA 4E04A 1DP6A 5IT5A 3IS2A 1ODVA 3PBTA 2G7UA 4LRXC 3F1PA 1UWNX 3H82A 4WUJA 4LRZE 2CMNA 1IOUA 3JVUA 4EEPA 2K31A 3B47A 3OC2A 2O99A 3K2NA 4CQHA 2W27A 2O9CA 5IS1A 4HP4A 3T4TA 2GX5A 2H28A 2XA7M 2J3WA 3OCLA 3F1NA 1YSPA 2OOLA 2P04A 4GJ4A 4AFIA 3EGXC 2VGLS 4IUHA 4H6JB 3MXQA 3VE4A 2HJEA 1N9OA 4P6ZM 4CLCA 5HWVA 1XJ6A 3UB9A 2VJWA 3V67A 1LT0A 3K3CA 1ZHHB 3JVVA 4HJ6A 4PKYG 3T50A 1F5MA 4L9EA 2W0NA 1OTDA 2ZMFA 4HH3A 1S4RA 4MMNA 5DKKA 2W1RA 4GS9A 1OT6A 3MFXA 4NKPA 4Y2FA 4HHDA 2K7SA 3FPVA 5MC7A 2JKTI 3KSFA 3KYQA 1T1CA 3H7WA 3BY9A 3TJZC 2O9BA 5HPIA 4HI4A 5DJTA 2L4RA 1H3QA 2QKPA 1T18A 5FL3A 2B02A 4DJ3A 4HQAA 3LYXA 3BWLA 2HGVA 3HJKA 1BYWA 3HCYA 2W3GA 3FPWA 4Y5FA 4LPZA 2A24B 2VZWA 5TJJA 4LRYC 1XFNA 2QJ5A 4EU0A 3LFVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KOU A;  2WKR A;  4GW9 A;  3NJA A;  3H7W B;  1LL8 A;  3IBR A;  3KX0 X;  2VV7 A;  1XJ2 A;  3IS2 B;  4GCZ A;  3D72 A;  4K08 A;  4MN5 A;  1XFQ A;  3MQQ A;  4I39 A;  3FC7 A;  4M4X A;  5HD3 A;  5HWW A;  4WLA A;  4GHI B;  2WKP A;  5EFW A;  1JNU A;  1T1B A;  2INW A;  3NOT C;  1NWZ A;  3P7N A;  3E4Q A;  1MZU A;  2PDR A;  4JGO A;  2VV8 A;  2WKQ A;  4YWZ A;  4F3L A;  3BY8 A;  1EW0 A;  4NXB A;  2J80 A;  1DP9 A;  3A0R A;  3UMD A;  3F1O A;  2D02 A;  2PR5 A;  1OTE A;  2QJ7 A;  2QHK A;  5G4Y A;  2VV6 A;  1S67 L;  5A8B A;  4KUK A;  1OTI A;  2L0W A;  4NXG A;  4RQ9 A;  4WUJ A;  1VB6 A;  4GHI A;  5HWT A;  3ZQ5 A;  2A24 A;  5AVE A;  1LSX A;  3C8C A;  2OWJ A;  3A0S A;  2PD7 A;  3RTY A;  5J7E A;  3GDI A;  3MQO A;  4E04 A;  4EW7 A;  5J4E A;  2ZOI A;  2Z6C A;  1DP6 A;  3F1N B;  3G6O A;  1GSV A;  3NHQ A;  3IS2 A;  1G28 A;  4LLO B;  1ODV A;  4H6J A;  4LRX C;  2V0U A;  3F1P A;  1S1Z A;  2D01 A;  1UWN X;  3H82 A;  3OLO A;  4HJ4 A;  4KUO A;  2CMN A;  1Y28 A;  1V9Y A;  2I9V A;  3LIA A;  2EA9 A;  2PHY A;  4HH2 A;  4I3J A;  3LI8 A;  3NOP C;  4PKY A;  5TBM A;  1TS7 A;  4B9O A;  2V0W A;  4I5S A;  2VEA A;  1OJG A;  2W27 A;  3H9W A;  3F1O B;  1LSV A;  5F68 A;  1TS6 A;  3CLO A;  4HP4 A;  3UE6 A;  5IS1 A;  4I3A A;  4EES A;  3C2W A;  3LIE A;  4DJ2 A;  3LI9 A;  1D7E A;  4HNB A;  4R38 A;  5AVF A;  1S66 L;  1TS8 A;  2H28 A;  4KQD A;  3CWF A;  4BBV A;  5F5Y A;  4GS9 B;  1OTA A;  4LRZ E;  3SW1 A;  1F98 A;  5HDD A;  2ZBB A;  4JGQ A;  4BBU A;  5HSQ A;  4WN5 A;  5J3W A;  5HDS A;  3E4O A;  3F1N A;  5HDC A;  4I3I A;  4EEP A;  2OOL A;  3UB7 A;  2KDK A;  4MN6 A;  4L9G A;  4EEU A;  3VOL A;  2KX6 A;  1TS0 A;  3CAX A;  1T19 A;  1UWP X;  5DJU A;  5HD5 A;  4H6J B;  3MXQ A;  5HZH A;  2GJ3 A;  3F1P B;  2P7J A;  2R78 A;  3VE4 A;  3K3D A;  1LSW A;  1N9O A;  2V9A A;  5IU1 A;  3UME A;  4R3A A;  5HWV A;  4EQ1 A;  1XJ6 A;  1X0O A;  1F9I A;  3LUQ A;  3E4P A;  3UB9 A;  1N9L A;  4WL9 A;  1GSX A;  1LT0 A;  3K3C A;  3RH8 B;  1DRM A;  3NOU C;  4HJ6 A;  4PKY G;  3T50 A;  1P97 A;  4L9E A;  1OJ5 A;  2BAS A;  2PD8 A;  4HY8 A;  2W0N A;  2ZOH A;  1OTD A;  1S1Y A;  2PYR A;  5I5L A;  4HH3 A;  1OT9 A;  1S4R A;  1XJ4 A;  5DKK A;  5F6A A;  4WF0 A;  3B33 A;  4GS9 A;  2JN7 A;  5G4Z A;  5TBM B;  1OT6 A;  1XJ3 A;  3LIC A;  2QWS A;  3MFX A;  3PYP A;  4HHD A;  2K7S A;  1DP8 A;  1WA9 A;  3GEC A;  4L9F A;  1T1A A;  1T1C A;  3H7W A;  4R70 A;  5F69 A;  4EET B;  3BY9 A;  4HI4 A;  4I38 A;  4NXE A;  1S4S A;  3LID A;  3PHY A;  1V9Z A;  3MJQ A;  4NXF A;  2V1B A;  5DJT A;  4HJ3 A;  4R6L A;  2L4R A;  3MR0 A;  2YKF A;  4EER A;  3VE3 A;  2YKH A;  2VLG A;  3EEH A;  2Z6D A;  3A0V A;  3LIB A;  4F3L B;  2QKP A;  1T18 A;  4XT2 B;  1P0Z A;  2B02 A;  4JGR A;  4DJ3 A;  2OWH A;  5KIZ A;  4HQA A;  2PYP A;  3LIF A;  2M1C A;  3LYX A;  4HOI A;  3BWL A;  3HJK A;  1D06 A;  1BYW A;  2HV1 A;  3UB8 A;  2L1M A;  1N9N A;  2PR6 A;  3FG8 A;  3ULF A;  3ICY A;  3H82 B;  3UB6 A;  2JHE A;  4JGP A;  4LPZ A;  1UGU A;  2A24 B;  3EWK A;  4HP9 A;  4BBT A;  4EXO A;  4HIA A;  4LRY C;  1XFN A;  2QJ5 A;  2V1A A;  1OTB A;  3HJI A;  1GSW A;  5DKL A;  4XT2 A; 
#chains in the Genus database with same CATH topology
 1WYC A;  2Q9M A;  3IS2 B;  3D72 A;  1CI8 A;  1MKI A;  1IFQ A;  4Y0O A;  1ERM A;  4N9L A;  4WMC D;  4D60 A;  3G2Z A;  4OQI A;  5F1F A;  4PHT A;  3T4L A;  3T1X A;  4BMW A;  4Y0U A;  4WM9 A;  3C8C A;  2PD7 A;  3GDI A;  4DF6 A;  3M2K A;  2V8C A;  2Z6C A;  3G6O A;  3NHQ A;  5HAP A;  4HJ4 A;  3OLO A;  3IX4 A;  1NYM A;  4ARZ A;  3GR2 A;  2V0W A;  2P9V A;  3ZVW A;  1FCM A;  3OBF A;  4FH4 A;  3DTI A;  1VQQ A;  3QP8 A;  4HNB A;  4WZ5 C;  3NUL A;  5GHY A;  2EXB A;  1M6K A;  4FOF A;  5HSQ A;  5HDS A;  3E4O A;  5D3O A;  2R9W A;  2Z2L B;  3BQA A;  2B95 A;  1BT5 A;  4BQM A;  3WS0 A;  2OV5 A;  3O3V A;  1XP4 A;  1IKI A;  3RXX A;  2XFS A;  3CMZ A;  4WL9 A;  4Y17 A;  1VET A;  3GV9 A;  5L2F A;  4JXW A;  3V50 A;  5DFX A;  1MWU A;  4IBX A;  2EX8 A;  5DVA A;  3SS4 A;  4L0L A;  4XUX A;  5GHX A;  5FAP A;  2Y79 A;  1P9R A;  1EWZ A;  2HDQ A;  2G2U A;  3KYZ A;  4Z1W A;  1K4F A;  5DTT A;  2UV0 E;  1K57 A;  4BWI A;  2HV1 A;  3O88 A;  3ICY A;  2JHE A;  4NEE D;  4EXO A;  3FWL A;  2PAV P;  4PM6 A;  4MBF A;  4GCZ A;  4MN5 A;  5HWW A;  3BW6 A;  2WK0 A;  2Y59 A;  4A5R A;  4E3N A;  3I7J A;  2D02 A;  2Q9N A;  1K4E A;  4CPK A;  3TRC A;  1PWD A;  3GQZ A;  1XX2 A;  3QP4 A;  5GLB A;  4GOG A;  1SKO B;  4FCF A;  5CGW A;  1S1Z A;  3KO6 A;  1RCJ A;  3NDE A;  3OPL A;  3NOP C;  4I5S A;  1WE4 A;  2HZ5 A;  4N92 A;  3F1O B;  3CLO A;  2FFF B;  1BLH A;  5FSR A;  3VFF A;  3S7O A;  1OTA A;  2ZBB A;  2IA2 A;  2O9A A;  3C30 A;  3G4P A;  4DN0 A;  5G18 A;  5J8X A;  3UB7 A;  1MBL A;  5L10 A;  1K54 C;  3F1P B;  1H5X A;  4II7 A;  2WKE A;  3WWX A;  2JBF A;  1GSX A;  3V5M A;  1BUE A;  4X1L A;  3SOI A;  1ZTU A;  1PI4 A;  5KSC A;  2J3T D;  4O0P A;  4P6Z S;  2WAD A;  3GEC A;  4U0X A;  5CHJ A;  3MQ0 A;  5HAI A;  1S4S A;  4QD4 A;  3UB5 P;  4EUV A;  5HX9 A;  1Z09 A;  3ITB A;  5KIZ A;  2L1M A;  1MWS A;  4MNR A;  3ULF A;  3H82 B;  1L0E A;  2X01 A;  2J3T C;  3V3R A;  2G2W A;  2VV7 A;  2ZC6 B;  3NDG A;  3BJN A;  2PU4 A;  4WLA A;  4WBG A;  5FDH A;  1CF0 A;  4F94 A;  1K25 A;  3MKF A;  4R3B A;  4P6B A;  2EX9 A;  3B42 A;  4E3L A;  2AVX A;  2ZQ8 A;  3EGD C;  3LO7 A;  1ESU A;  4GDN A;  2Y2P A;  4M3K A;  3VV4 A;  1YT4 A;  1LHY A;  1V9Y A;  4WF0 A;  4G3W A;  4HBU A;  1MPL A;  5F68 A;  3H9W A;  1YLP A;  5EV0 A;  2VGL M;  2XH9 A;  4JKT A;  5HDD A;  4P85 A;  4WN5 A;  1LL5 A;  3ZNY A;  3W2Z A;  3AGE A;  3VOL A;  4ZRR A;  5JYP A;  3PTE A;  3BLS A;  5FI2 A;  1X0O A;  3UPO A;  1NRF A;  1YKD A;  5CGS A;  2Y2G A;  2Q0O A;  1JTG A;  2BAS A;  2BLS A;  2ZMV A;  5M18 A;  1OT9 A;  2EWV A;  3UE3 A;  4HBT A;  3G2Y A;  1S6R A;  4N1X A;  3UDX A;  5L8M A;  2OSU A;  2ZMA A;  3MMH A;  4JGR A;  4YOF A;  3WS4 A;  4EBN A;  3C7V A;  2JCH A;  1BSG A;  3T4K A;  1RGZ A;  4BBT A;  5FEF A;  1ESI A;  1G6A A;  4B93 A;  3BEC A;  3RJU A;  2VK3 A;  2WKR A;  3KX0 X;  3HUM A;  1XFQ A;  3JYI A;  1G6O A;  4KZ9 A;  4S2P A;  5GLD A;  1MZU A;  1NRJ A;  1SHV A;  3EEA A;  4UQI M;  4JF6 A;  2Y2M A;  5I94 A;  2VV6 A;  2L0W A;  1VB6 A;  4GHI A;  5BOH A;  1HVB A;  4KG2 A;  5CEB A;  4E04 A;  1E25 A;  1AXB A;  3SS3 A;  5IT5 A;  1HZO A;  2Y2I A;  3HLE A;  1ODV A;  4OVD A;  2XEP A;  3BYD A;  4KQQ A;  1UWN X;  4WUJ A;  2CMN A;  2WAF A;  1PNE A;  2W27 A;  3VSL A;  3T4T A;  3PAE A;  3VMA A;  4O7D A;  3M2J A;  5GL9 A;  2XA7 M;  3OCL A;  4GN2 A;  2EFU A;  1D1J A;  4AFI A;  1IKG A;  4IUH A;  1KDW A;  5EPH A;  1IEL A;  2HJE A;  4CLC A;  4ZBE A;  1IYS A;  1XJ6 A;  1HD8 A;  3V67 A;  4KZ3 A;  4R1G A;  5DF8 A;  3T50 A;  1F5M A;  1BZA A;  2ZMF A;  5CEC A;  4MMN A;  2W1R A;  4GS9 A;  1OT6 A;  2K7S A;  3FPV A;  1ZC2 A;  3UNW A;  3KSF A;  3KYQ A;  3H7W A;  4KG6 A;  5JYO A;  2DCF A;  2V8F A;  5HPI A;  2O9B A;  4KZ8 A;  4KZ7 A;  1PZP A;  3ZG9 B;  1H3Q A;  5FQK A;  2H10 A;  1SDN A;  2HGV A;  2VZW A;  2JC7 A;  4LRY C;  4PM5 A;  3MXS A;  2LB5 A;  5KMW A;  2PRF A;  4R23 A;  4S2L A;  1LL8 A;  2P08 A;  3QP6 A;  5CTN A;  3DWZ A;  3UDF A;  4DXC A;  4PM9 A;  3KYE A;  4UHU A;  5EVI B;  3A3I A;  4S2I A;  4Y15 A;  1PW8 A;  3A0S A;  3B3X A;  4RA7 A;  3F1N B;  2A49 A;  5E2E A;  3IF6 B;  5HL1 A;  2W1T B;  3BFG A;  3FYZ A;  1H8Z A;  4EES A;  1IYO A;  1PFL A;  1TS8 A;  1YM1 A;  5F5Y A;  3HLW A;  3T4S A;  1K57 C;  4BBU A;  3HLG A;  3M6H A;  4JPM A;  3W4P A;  3VOZ A;  2O0Y A;  4DE2 A;  1DJC A;  4EQ1 A;  3R7W B;  4HY8 A;  3EQV A;  4RX2 A;  1LL9 A;  3ZFZ A;  3T4Q A;  5CHU A;  1JWV A;  2W3D A;  3L7H A;  3QNB A;  5AQ7 A;  4NXF A;  1NLZ A;  1W7F A;  1W8Q A;  2J9P A;  1P0Z A;  5FAS A;  3A3F A;  4OLG A;  2HP9 A;  2M1C A;  4HOI A;  4WEL A;  3ZG8 B;  2WZX A;  1PZO A;  4KZ4 A;  3UB6 A;  1XA7 A;  1XJ2 A;  3MQQ A;  3P98 A;  5HD3 A;  1E3U D;  4PM7 A;  4JGO A;  1XKZ A;  4NXB A;  2OAQ 1;  2QJ7 A;  1OTE A;  4BEN A;  2XRO A;  4RQ9 A;  3WS5 A;  5HPF A;  4KZ6 A;  4EW7 A;  3N6I A;  1CI9 A;  4H6J A;  4L9F A;  3LIA A;  2EA9 A;  2PHY A;  1YMS A;  4B9O A;  1LSV A;  1TS6 A;  3S22 A;  4I3A A;  4UAA A;  3LIE A;  2XLN A;  5GLC A;  1S66 L;  3IBJ A;  3SW1 A;  3HL9 A;  5J3W A;  3PBO A;  3ISG A;  4MN6 A;  4JLF A;  2ACG A;  3CAX A;  1T19 A;  1UWP X;  2Y2H A;  2P7J A;  3K3D A;  4H8R A;  1N9L A;  5DF7 A;  3UY6 A;  2QMI A;  3O86 A;  5TR7 A;  1XJ3 A;  2ZM0 A;  5M1A A;  1NY0 A;  3CZD A;  2XDM A;  4GDB A;  4FUW A;  4KZ5 A;  4PAU A;  5DTS A;  3A0V A;  2X71 A;  3ZYT A;  2PYP A;  4S2N C;  1D06 A;  2RL3 A;  5EOO A;  1N9N A;  1W63 M;  2M7U A;  4X53 A;  4GW9 A;  1SKO A;  3OOV A;  3NC8 A;  3EQU A;  3T1S A;  4GKU A;  5KSH A;  4ZJ3 A;  5EFW A;  1KVM A;  2HDS A;  3P7N A;  2BTF P;  4F3L A;  3FV7 A;  4ME4 A;  2V2F F;  2WKI A;  3R4K A;  4IBR A;  2OLV A;  3M6B A;  5AVE A;  1LSX A;  3NI9 A;  4NG2 A;  3N8L A;  3MF0 A;  1GSV A;  1NZO A;  2ZJ9 A;  1LI9 A;  4MLL A;  1GA0 A;  2Z2M B;  3D3O A;  5EOE A;  3HLB A;  1YAX A;  4QU3 A;  4ZAM A;  4BL3 A;  2VA0 A;  1AWI A;  3QP1 A;  2ZQC A;  2A2L A;  4EUZ A;  4BD1 A;  2WAE A;  5FI6 A;  4KZA A;  5A92 A;  4L9G A;  3G34 A;  3VOY A;  1MC0 A;  4GD6 A;  3E0Y A;  4E3I A;  4Z9Q A;  1YLJ A;  1BLS A;  3AGD A;  4E3O A;  5I5L A;  1XJ4 A;  3MBZ A;  2JN7 A;  5TBM B;  3GSG A;  3LEZ A;  3LIC A;  4UEY A;  5CTM A;  5LBR A;  5F69 A;  4R0Q A;  2V1B A;  4WEK A;  4EER A;  4B4Z A;  4ETZ A;  3E98 A;  3P09 A;  3S1Y A;  2FH5 A;  3HRE A;  4HP9 A;  4HIA A;  4LCM A;  1KOU A;  2ZQ9 A;  1KE0 A;  4I39 A;  3FC7 A;  3MXR A;  4M4X A;  3D4F A;  1LI0 A;  4BL2 A;  1VHM A;  4WEJ A;  5TFQ A;  3BY8 A;  2J80 A;  3Q7V B;  3C4P A;  2PR5 A;  1FQG A;  3OPP A;  3UPP A;  2XQZ A;  1NYY A;  4E6W A;  1W63 Q;  2A24 A;  4EQI A;  4E3M A;  3JPU A;  3RTY A;  2J7V A;  4PPR A;  2CC1 A;  3DW0 A;  5E2H A;  1VEU B;  3IS2 A;  1JVJ A;  3PBT A;  1I2S A;  1W5D A;  1HLU P;  1IOU A;  4X69 A;  1ES5 A;  3V3S A;  2Y55 A;  1ES3 A;  2IWB A;  3B47 A;  1BUL A;  5FAO A;  3N8R A;  3NY4 A;  3IXG A;  4X68 A;  1Q2Q A;  4ESP A;  1CEF A;  1PWC A;  3NBL A;  4ID4 A;  3L9K A;  3WRT A;  2OOL A;  3ZGA B;  4GJ4 A;  3EGX C;  3MXQ A;  4C75 A;  3VE4 A;  3UDI A;  1PIO A;  5HWV A;  3UB9 A;  2VJW A;  1LT0 A;  3JVV A;  4HJ6 A;  4OPY A;  4Y0T A;  4LGW A;  1K38 A;  4L9E A;  1KE4 A;  4DXB A;  1H0M A;  1OTD A;  4KQR A;  4HH3 A;  1S4R A;  3UN7 A;  5DKK A;  1LLB A;  1I2W A;  3HBR A;  4XUZ A;  3HLD A;  3MFX A;  4HHD A;  5MC7 A;  1MXO A;  1T1C A;  2PU2 A;  1KGF A;  2WZZ A;  3SS5 A;  3BY9 A;  3E2K A;  1QME A;  5AQA A;  1YLY A;  1Y54 A;  4YFM A;  1T18 A;  1S0W A;  3Q82 A;  4GB7 A;  4HQA A;  5EEC A;  5FDS A;  5E43 A;  3HJK A;  2B5R A;  4LPZ A;  2R9X A;  1XFN A;  3A3E A;  4Q8I A;  1NWZ A;  3E4Q A;  1F2K A;  3MZE A;  1MWR A;  4YWZ A;  1VM1 A;  1KE3 A;  2JKF A;  4OQ0 A;  3A0R A;  4KUK A;  4OPZ A;  2ZM2 A;  3LGO A;  4QY6 A;  3Q7V A;  2VKS A;  1DY6 A;  3SZT A;  2QZ6 A;  4YNR A;  3LY4 A;  5EUA A;  1Y28 A;  3VSK A;  4I3J A;  2H5S A;  5GHZ A;  2LB9 A;  2DMW A;  4E3J A;  1XGJ A;  4K0W A;  2P74 A;  3PBS A;  3GRJ A;  3ITA A;  1DJB A;  1JWZ A;  1D7E A;  5AVF A;  4D2O A;  4OKP A;  5KZH A;  3VFH A;  4B88 A;  4I3I A;  3BQ8 A;  2FZ0 A;  1P9W A;  1TS0 A;  3HUN A;  4PMA A;  4BD0 A;  5HZH A;  1L3L A;  1E4D A;  3W4O A;  1IEM A;  3BRM A;  2V9A A;  2ZL1 B;  1MWT A;  1DRM A;  4E6X A;  1EI5 A;  4LV2 A;  1CK3 A;  3MKE A;  2K2N A;  3IXH A;  3TG9 A;  4GD8 A;  2HP5 A;  3LR0 A;  2QWS A;  3U2A A;  3PYP A;  1JWP A;  1WA9 A;  4KQO A;  4DRT A;  3S4X A;  4I38 A;  4O01 A;  1KGG A;  3VE3 A;  2Y2K A;  1K6R A;  1OME A;  2OWH A;  3LIF A;  2NUP C;  1XXM A;  2ZC4 B;  4DE3 A;  3SH9 A;  3EWK A;  2V1A A;  1YQS A;  2WGV A;  5J4E A;  4DDY A;  5DKL A;  1K56 D;  4K08 A;  1YLT A;  3N8S A;  3CUE C;  3PAG A;  4CLC E;  2XSS A;  1YPR A;  3CI6 A;  3PBQ A;  2WKQ A;  2W3H A;  2Y2O A;  4LFU A;  3ZG5 A;  2WYX A;  3O87 A;  4S2J A;  3ZQ5 A;  5HWT A;  4IUK A;  4LV1 A;  2ZOI A;  3WS2 A;  3SH8 A;  2KLI A;  3ZHH A;  3DTK A;  1L0G A;  2V0U A;  4KUO A;  4MEZ A;  3GVB A;  1FIK A;  4B4X A;  3UE6 A;  1L2S A;  1WYB A;  2Y2Q A;  3ZG0 A;  4BBV A;  3WRZ A;  3OPH A;  4UA6 A;  5HDC A;  2Y4A A;  4EEU A;  4JXG A;  5F83 A;  4JXS A;  1YLZ A;  1F9I A;  3E4P A;  1SDE A;  3HLF A;  3LR3 A;  2PD8 A;  3VP2 A;  2PYR A;  4Q0I A;  2IWD A;  5CRF A;  5G4Z A;  4UA7 A;  1J3W A;  4G3V A;  3QP5 A;  2HF6 A;  5FQJ A;  4EET B;  4OQG A;  4ZJ1 A;  3LR4 A;  1J9M A;  1V9Z A;  3MJQ A;  2WGW A;  2ZC5 B;  4HJ3 A;  3MR0 A;  2OLU A;  3IT9 A;  1W79 A;  2Y2N A;  1OPX A;  4ETX A;  1VEU A;  1STZ A;  1A0K A;  2ZQA A;  2IWC A;  3KSG A;  3N7W A;  3FG8 A;  3CIT A;  5FQM A;  3S7Q A;  2MJ6 A;  1UGU A;  4HES A;  4MBH A;  3IH9 A;  2J9O A;  4WMC A;  3HJI A;  5E2G A;  5CHM A;  3IBR A;  4IED A;  3G31 A;  1T1B A;  1TVF A;  2PDR A;  3EOI A;  3BFD A;  1ZG4 A;  3QP2 A;  3F1O A;  3W4Q A;  5AJG A;  4LCL A;  3O5Y A;  4R3J A;  1RP5 A;  4N1H A;  1U60 A;  2V20 A;  5FI7 A;  3ZCZ A;  4LLO B;  1G28 A;  4QPR A;  3DAV A;  3IQA A;  3A3J A;  4EV4 A;  2VEA A;  3FKW A;  1PI5 A;  2H0T A;  4KEN B;  1BTL A;  4R38 A;  4K0X A;  4KZB A;  3T12 B;  2XD1 A;  3KSH A;  3CHW P;  2EXA A;  1Y4O A;  4JGQ A;  3FKV A;  1SZV A;  3PBR A;  5A90 A;  2ZLY A;  1QMF A;  1GCE A;  4JF5 A;  2RCX A;  4R3A A;  4ARZ B;  3CJM A;  3RH8 B;  1TF1 A;  3NOU C;  4DMZ A;  3DWK A;  5DTK A;  1P97 A;  3T1Q B;  4DKI A;  1S1Y A;  3IH8 A;  4R4R A;  1Z6F A;  3B33 A;  2C6W B;  4R70 A;  4PM8 A;  4BJP A;  2NUT C;  2YKF A;  2W3F A;  2YKH A;  5CX7 A;  4F3L B;  4QB8 A;  4WZ5 A;  4MDZ A;  4JGP A;  4RYE A;  4CJN A;  4QHC A;  4G3K A;  1XGI A;  1Q2P A;  3BLM A;  3IX8 A;  4X25 A;  4U0T A;  1CQA A;  3MFD A;  1JTD A;  1FSW A;  2INW A;  5L07 A;  2J8Y A;  1ALQ A;  2VV8 A;  3LY3 A;  3UMD A;  4Y13 A;  4DE1 A;  1BLP A;  1GHM A;  1IYQ A;  5G4Y A;  4NXG A;  4Y7P A;  3MZF A;  3GMW A;  1KVL A;  5GLA A;  2P9V B;  1DP6 A;  5AQB A;  1O07 A;  5E2F A;  2G7U A;  3F1P A;  2VGJ A;  3WS1 A;  3ZG7 B;  3U4L P;  4LRZ E;  4EEP A;  2JKG A;  1I5Q A;  2K31 A;  4JXV A;  3C7U A;  3OC2 A;  4CQH A;  2O9C A;  1G68 A;  4HP4 A;  1TEM A;  1ERQ A;  2GX5 A;  1L0D A;  5EM1 A;  3IWO A;  1YSP A;  1FCN A;  4OPQ A;  2VGL S;  5EE8 A;  3RXW A;  1VET B;  1N9O A;  4P6Z M;  4C6Y A;  2EFX A;  1XPB A;  3IWI A;  1ZHH B;  3UPN A;  4PKY G;  2W0N A;  4S2M A;  5EVI D;  4IVK A;  4Y2F A;  2JKT I;  3BFE A;  2DNS A;  4QJG A;  2XK1 A;  5DJT A;  2EX6 A;  2L4R A;  4OQH A;  5IHV A;  1K56 A;  3IXD A;  3BWL A;  3HCY A;  4ZJ2 A;  3FPW A;  4Y5F A;  3IF6 C;  2A24 B;  2E8J A;  4GZB A;  1GHI A;  2HP6 A;  4S2K A;  3C38 A;  2A3U A;  2ZQ7 A;  3S7N A;  3NOT C;  4CLC D;  4U3T A;  2WUQ A;  2XD5 A;  2HJ9 C;  3OZH A;  5HFO A;  1NLY A;  2EX2 A;  1S67 L;  2XGN A;  3OPR A;  5FQI A;  5A93 A;  3PR6 A;  2OWJ A;  3OCN A;  4Y3I A;  5J7E A;  2XRN A;  1TD5 A;  3HUO A;  3FZC A;  2VGK A;  4UQI S;  1TDG A;  4X56 A;  3IF5 A;  2ZC7 A;  3DTE A;  3VP1 A;  3CUE A;  5EVE A;  2I9V A;  1FCO A;  1O7E A;  4HH2 A;  3UO9 A;  2I72 A;  4CLC B;  1TS7 A;  5HW3 A;  4FD8 A;  1BLC A;  4CLC C;  3MS6 A;  5CER A;  3C2W A;  4NK3 A;  4X1M A;  3GTC A;  2WGW B;  4KQD A;  2W3E A;  1ES4 A;  4WYY A;  1PWG A;  2KDK A;  5HD5 A;  3W8K A;  4KG5 A;  2GJ3 A;  3CG5 A;  1LSW A;  3G32 A;  4K91 A;  2XA7 S;  5IU1 A;  3UME A;  5M19 A;  5C5K A;  2JKR M;  1ONH A;  5DFY A;  3VP0 A;  4JBF A;  3TW8 A;  1G5U A;  5L09 A;  2ZC3 B;  4Q0J A;  2X02 A;  1ACF A;  1SCW A;  1DP8 A;  1E3U A;  4OP5 A;  3A3D A;  5FAQ A;  3LID A;  1K6S A;  3PHY A;  3RFB A;  2OAP 1;  4FH2 A;  3NCK A;  2Y8H A;  3SH7 A;  3QNC A;  3TE8 A;  5EVI A;  4XXR A;  2JE5 A;  4OON A;  4NET A;  1OTB A;  1GSW A;  1NJ4 A;  4JF4 A;  3T1R A;  2WKP A;  1JNU A;  3IX3 A;  1ES2 A;  2JKR I;  2VX8 A;  2QHK A;  4IHQ A;  3Q7Z A;  5FQQ A;  4BLM A;  2V1Z A;  3DTM A;  5FAT A;  1MY8 A;  2GDN A;  5DF9 A;  3MSH A;  5EVL A;  1ZKJ A;  1GA9 A;  2FFY A;  2BG1 A;  3G30 A;  5HL6 A;  3BM6 A;  5TBM A;  3VP4 A;  2QPN A;  3ZNT A;  1W8Y A;  3TSG A;  1K55 A;  4ZDX A;  3CWF A;  4GS9 B;  1F98 A;  2ZD8 A;  4QWO A;  3T4O A;  3ZDJ A;  3UE0 A;  4O8G A;  3IWQ A;  4OP8 A;  5CGX A;  2GZA A;  3LUQ A;  4OPR A;  4YIN A;  1OJ5 A;  4LV0 A;  2ZOH A;  1NXY A;  1IYP A;  5HAR A;  4EWF A;  1H8M A;  4OH0 A;  2PBD P;  3LEQ A;  4QY5 A;  4IJG A;  4MN7 A;  2XF3 A;  4NXE A;  3CPT A;  4OLD A;  3EEH A;  3LIB A;  2Y91 A;  4XT2 B;  4DDS A;  4MCW A;  3KSI A;  4GLQ A;  5FEG A;  4LEN A;  1TDL A;  3BEB A;  3PBN A;  1K55 C;  2PR6 A;  3R7W A;  3IHB A;  3Q07 A;  4FTX A;  1MKM A;  3H7W B;  2EWW A;  3IF6 A;  3P01 A;  4GHI B;  1FR6 A;  2KOI A;  3ZVT A;  1N4O A;  2QYB A;  4DE0 A;  5FQ9 A;  4P87 A;  3Q1F A;  5A8B A;  4LV3 A;  4MBK A;  3MQO A;  4EBL A;  2HPB A;  2HDR A;  3TOI A;  4Q0H A;  2D01 A;  3D9Y A;  1NZU A;  3N4I A;  4E3K A;  3LI8 A;  4PKY A;  1OJG A;  4C3Q A;  2ZQD A;  2GNX A;  4DJ2 A;  3LI9 A;  3VP3 A;  1L0F A;  1K54 A;  1YLW A;  1K0K A;  4WZ4 A;  2JKT M;  4RVA A;  4X55 A;  1DJA A;  5EVI C;  1HTZ A;  1YMX A;  2H0Y A;  2KX6 A;  4N9K A;  2ZM8 A;  3NEC A;  5DJU A;  2Y2L A;  2R78 A;  2B18 A;  3C4O A;  3E2L A;  5EM0 A;  1XA1 A;  2M7V A;  4UA9 A;  2HDU A;  4S2O A;  5F6A A;  1YSQ A;  3V39 A;  4FSF A;  1T1A A;  3LR5 A;  4X6T A;  1FIL A;  2XR0 A;  4OOL A;  2DRW A;  4R6L A;  5K5B A;  2VLG A;  2Z6D A;  1ERO A;  4OOM A;  5F1G A;  1PW1 A;  3UB8 A;  3CPT B;  3MZD A;  4EBP A;  3C5A A;  3IHA A;  4XT2 A;  5HAQ A;  3QHY A;  3NJA A;  1N9B A;  3HVF A;  4RX3 A;  1PRQ A;  2XFT A;  3DBA A;  1FSY A;  1EW0 A;  5TGF A;  3S7P A;  2UWX A;  1SKF A;  1DP9 A;  2C5W B;  1ONG A;  2PT7 A;  5FA7 A;  2WKH A;  1OTI A;  3PXP A;  3T4J A;  2W1T A;  2ZL1 A;  2Y2J A;  3AGF A;  4LRX C;  1FR1 A;  3H82 A;  5A91 A;  3JVU A;  3G35 A;  5U47 A;  1KDS A;  3Q81 A;  4ZTK A;  2O99 A;  3K2N A;  5IS1 A;  4OOY A;  5CXW A;  1CJF A;  1RGY A;  2H28 A;  4R4S A;  4S2N A;  2J3W A;  3F1N A;  3BFC A;  2P04 A;  1CEG A;  4IVI A;  4H6J B;  1C3B A;  3BFF A;  4P0M A;  3K3C A;  3UE1 A;  1FOF A;  4HEF A;  4NKP A;  5CED A;  5F82 A;  1GHP A;  3LCE A;  3TJZ C;  2E8I A;  4HI4 A;  1PYY A;  2WGI A;  1KGE A;  3IXB A;  4GNU A;  1ZG6 A;  2QKP A;  5FL3 A;  2B02 A;  4DJ3 A;  1H8Y A;  3LYX A;  1BYW A;  2W3G A;  1M40 A;  5TJJ A;  3NIA A;  2PBY A;  2QJ5 A;  5AQ9 A;  4EU0 A;  3LFV A;  3HLC A; 
#chains in the Genus database with same CATH homology
 2LB5 A;  1LL8 A;  2P08 A;  3IS2 B;  3D72 A;  3S7N A;  1IFQ A;  3NOT C;  1NWZ A;  3E4Q A;  4CLC D;  4YWZ A;  3A0R A;  2HJ9 C;  4PHT A;  3T4L A;  1NLY A;  4BMW A;  1S67 L;  4KUK A;  3PR6 A;  3C8C A;  2OWJ A;  3OCN A;  3A0S A;  2PD7 A;  4Y3I A;  5J7E A;  2XRN A;  3GDI A;  1TD5 A;  2Z6C A;  3F1N B;  3G6O A;  4UQI S;  3NHQ A;  2VKS A;  4YNR A;  3CUE A;  3OLO A;  4HJ4 A;  2I9V A;  1Y28 A;  2W1T B;  4HH2 A;  4I3J A;  4ARZ A;  2LB9 A;  1TS7 A;  4CLC B;  2V0W A;  2DMW A;  4CLC C;  3PBS A;  3OBF A;  4EES A;  3C2W A;  1D7E A;  4HNB A;  5AVF A;  1TS8 A;  4KQD A;  5F5Y A;  2W3E A;  4FOF A;  3T4S A;  4BBU A;  5HSQ A;  5HDS A;  3E4O A;  4I3I A;  3BQ8 A;  2KDK A;  2FZ0 A;  1P9W A;  1TS0 A;  3BQA A;  5HD5 A;  5HZH A;  2GJ3 A;  2O0Y A;  1LSW A;  2XA7 S;  2V9A A;  5IU1 A;  3UME A;  5C5K A;  4EQ1 A;  3R7W B;  2JKR M;  5DFY A;  4WL9 A;  3TW8 A;  1DRM A;  4HY8 A;  3EQV A;  2K2N A;  3LR0 A;  4Q0J A;  3T4Q A;  2QWS A;  3U2A A;  3PYP A;  5DFX A;  1DP8 A;  1WA9 A;  4KQO A;  2W3D A;  4L0L A;  4I38 A;  3LID A;  3PHY A;  4NXF A;  4O01 A;  3RFB A;  2OAP 1;  2Y79 A;  1NLZ A;  1P9R A;  2Y8H A;  3VE3 A;  3TE8 A;  1P0Z A;  3KYZ A;  4Z1W A;  2OWH A;  3LIF A;  4WEL A;  2M1C A;  4HOI A;  4BWI A;  2HV1 A;  2NUP C;  3ICY A;  3UB6 A;  2JHE A;  3EWK A;  4NEE D;  4EXO A;  2V1A A;  1OTB A;  1GSW A;  5J4E A;  5DKL A;  4K08 A;  1XJ2 A;  4MN5 A;  4GCZ A;  5HWW A;  3MQQ A;  5HD3 A;  3CUE C;  3BW6 A;  2WKP A;  1JNU A;  4CLC E;  2XSS A;  3CI6 A;  4JGO A;  3PBQ A;  2WKQ A;  4NXB A;  2OAQ 1;  2D02 A;  2JKR I;  1OTE A;  2QJ7 A;  2W3H A;  2VX8 A;  2QHK A;  2XRO A;  4IHQ A;  4RQ9 A;  3TRC A;  3ZQ5 A;  5HWT A;  5HPF A;  4IUK A;  4EW7 A;  5DF9 A;  2ZOI A;  2KLI A;  4H6J A;  2V0U A;  1S1Z A;  3KO6 A;  4KUO A;  4L9F A;  3LIA A;  2EA9 A;  2PHY A;  5HL6 A;  4B9O A;  3NOP C;  5TBM A;  4I5S A;  3F1O B;  1LSV A;  1TS6 A;  3CLO A;  3UE6 A;  4I3A A;  3LIE A;  3S7O A;  1S66 L;  4BBV A;  3CWF A;  3IBJ A;  4GS9 B;  1OTA A;  3SW1 A;  1F98 A;  2ZBB A;  2IA2 A;  2O9A A;  3C30 A;  5J3W A;  4DN0 A;  5HDC A;  3UB7 A;  3PBO A;  4MN6 A;  4EEU A;  3T4O A;  3CAX A;  1T19 A;  1UWP X;  3F1P B;  2P7J A;  3K3D A;  4O8G A;  4II7 A;  2GZA A;  3LUQ A;  1F9I A;  3E4P A;  1N9L A;  1GSX A;  3LR3 A;  1OJ5 A;  2PD8 A;  2ZOH A;  2PYR A;  4Q0I A;  1ZTU A;  2J3T D;  4O0P A;  5G4Z A;  1H8M A;  4P6Z S;  1XJ3 A;  4IJG A;  4G3V A;  3GEC A;  4MN7 A;  2HF6 A;  4EET B;  3LR4 A;  4NXE A;  3MQ0 A;  1S4S A;  1V9Z A;  3MJQ A;  4EUV A;  4HJ3 A;  3MR0 A;  4PAU A;  3EEH A;  3LIB A;  3A0V A;  4XT2 B;  4MCW A;  3ZYT A;  5KIZ A;  1OPX A;  2PYP A;  4ETX A;  3KSI A;  1STZ A;  4GLQ A;  1D06 A;  3KSG A;  3PBN A;  2L1M A;  1N9N A;  2PR6 A;  3FG8 A;  3CIT A;  3S7Q A;  1W63 M;  3H82 B;  3ULF A;  2MJ6 A;  2M7U A;  1UGU A;  3R7W A;  3HJI A;  2J3T C;  4GW9 A;  1MKM A;  3OOV A;  3H7W B;  3IBR A;  2EWW A;  2VV7 A;  3P01 A;  3EQU A;  3BJN A;  4WLA A;  5KSH A;  4GHI B;  5EFW A;  1T1B A;  2KOI A;  3P7N A;  2PDR A;  3EOI A;  4F3L A;  2QYB A;  4ME4 A;  3F1O A;  5AJG A;  5A8B A;  3R4K A;  3B42 A;  3O5Y A;  3EGD C;  5AVE A;  1LSX A;  3MQO A;  3MF0 A;  1GSV A;  4LLO B;  1G28 A;  4Q0H A;  4QPR A;  2D01 A;  3VV4 A;  1V9Y A;  4WF0 A;  3D3O A;  3LI8 A;  4PKY A;  3C38 A;  1YAX A;  4G3W A;  2VEA A;  1OJG A;  3H9W A;  5F68 A;  2GNX A;  2VA0 A;  4DJ2 A;  2VGL M;  3LI9 A;  4R38 A;  2A2L A;  3KSH A;  5HDD A;  2JKT M;  4JGQ A;  4WN5 A;  3PBR A;  4L9G A;  3VOL A;  2KX6 A;  3W2Z A;  5DJU A;  4ZRR A;  1MC0 A;  2R78 A;  2B18 A;  3E0Y A;  4R3A A;  4ARZ B;  1X0O A;  1YKD A;  3RH8 B;  1TF1 A;  3NOU C;  4DMZ A;  1P97 A;  2BAS A;  2M7V A;  2ZMV A;  1S1Y A;  5I5L A;  1OT9 A;  1XJ4 A;  5F6A A;  3B33 A;  2JN7 A;  5TBM B;  2EWV A;  3UE3 A;  3LIC A;  4UEY A;  1YSQ A;  4FSF A;  5LBR A;  1T1A A;  3LR5 A;  4R70 A;  5F69 A;  4OOL A;  2V1B A;  4WEK A;  4BJP A;  5K5B A;  4R6L A;  2NUT C;  2YKF A;  4EER A;  5L8M A;  2W3F A;  2VLG A;  2YKH A;  2Z6D A;  5CX7 A;  4F3L B;  3MMH A;  4ETZ A;  4JGR A;  3E98 A;  4YOF A;  4OOM A;  2FH5 A;  3UB8 A;  4MDZ A;  3T4K A;  4JGP A;  4BBT A;  4HP9 A;  4G3K A;  4HIA A;  4B93 A;  4XT2 A;  1KOU A;  2WKR A;  3NJA A;  3KX0 X;  1XFQ A;  4I39 A;  3FC7 A;  4M4X A;  1G6O A;  2INW A;  1VHM A;  1MZU A;  3DBA A;  4WEJ A;  2VV8 A;  3BY8 A;  1EW0 A;  1NRJ A;  3S7P A;  2J80 A;  1DP9 A;  3EEA A;  3UMD A;  2PT7 A;  4UQI M;  2PR5 A;  5G4Y A;  2VV6 A;  1OTI A;  2L0W A;  4NXG A;  3PXP A;  1VB6 A;  4GHI A;  2W1T A;  1W63 Q;  3T4J A;  2A24 A;  3RTY A;  4E04 A;  1DP6 A;  5IT5 A;  3IS2 A;  1ODV A;  3PBT A;  2G7U A;  4LRX C;  3F1P A;  1UWN X;  3H82 A;  4WUJ A;  4LRZ E;  2CMN A;  1IOU A;  3JVU A;  4EEP A;  2K31 A;  3B47 A;  3OC2 A;  2O99 A;  3K2N A;  4CQH A;  2W27 A;  2O9C A;  5IS1 A;  4HP4 A;  3T4T A;  2GX5 A;  2H28 A;  2XA7 M;  2J3W A;  3OCL A;  3F1N A;  1YSP A;  2OOL A;  2P04 A;  4GJ4 A;  4AFI A;  3EGX C;  2VGL S;  4IUH A;  4H6J B;  3MXQ A;  3VE4 A;  2HJE A;  1N9O A;  4P6Z M;  4CLC A;  5HWV A;  1XJ6 A;  3UB9 A;  2VJW A;  3V67 A;  1LT0 A;  3K3C A;  1ZHH B;  3JVV A;  4HJ6 A;  4PKY G;  3T50 A;  1F5M A;  4L9E A;  2W0N A;  1OTD A;  2ZMF A;  4HH3 A;  1S4R A;  4MMN A;  5DKK A;  2W1R A;  4GS9 A;  1OT6 A;  3MFX A;  4NKP A;  4Y2F A;  4HHD A;  2K7S A;  3FPV A;  5MC7 A;  2JKT I;  3KSF A;  3KYQ A;  1T1C A;  3H7W A;  3BY9 A;  3TJZ C;  2O9B A;  5HPI A;  4HI4 A;  5DJT A;  2L4R A;  1H3Q A;  2QKP A;  1T18 A;  5FL3 A;  2B02 A;  4DJ3 A;  4HQA A;  3LYX A;  3BWL A;  2HGV A;  3HJK A;  1BYW A;  3HCY A;  2W3G A;  3FPW A;  4Y5F A;  4LPZ A;  2A24 B;  2VZW A;  5TJJ A;  4LRY C;  1XFN A;  2QJ5 A;  4EU0 A;  3LFV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...