2OWJA

Structure of an early-microsecond photolyzed state of co-bjfixlh, dark state
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
116
structure length
116
Chain Sequence
DAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRYRTTSDPHIIGIGRIVTGKRRDGTTFPMHLSIGEMQSGGEPYFTGFVRDLTEHQQTQARLQEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxygen storage/transport
molecule keywords Sensor protein fixL
publication title Time-resolved crystallographic studies of the heme domain of the oxygen sensor FixL: structural dynamics of ligand rebinding and their relation to signal transduction.
pubmed doi rcsb
source organism Bradyrhizobium japonicum
total genus 32
structure length 116
sequence length 116
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2007-02-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2owjA00
1UWPX 3BY8A 4HI4A 2GJ3A 1LSXA 3D72A 5F6AA 3LUQA 1T1BA 2R78A 3LI8A 2PDRA 3MXQA 2P7JA 5AVEA 2V0UA 3CAXA 1Y28A 2ZOHA 4HY8A 3NOTC 1OTAA 3K3CA 3UMEA 1LT0A 4NXGA 4R3AA 5HZHA 5A8BA 5DJTA 3LIDA 2A24B 3PHYA 2ZBBA 4F3LA 5G4YA 3MQQA 3ZQ5A 4PKYG 2PD7A 2V1AA 1WA9A 1X0OA 2QKPA 1N9LA 5DKKA 3EWKA 1OJ5A 1DP9A 4I38A 4I3JA 4H6JB 2QJ5A 3H82B 4R70A 1F9IA 4MN5A 5J3WA 1OJGA 4E04A 1TS6A 1DP8A 1VB6A 2EA9A 5TBMA 4LRYC 1S4SA 3NOPC 2INWA 4I3AA 5F69A 3T50A 4MN6A 2B02A 3MJQA 3ICYA 2PYRA 5HD3A 1LSWA 3SW1A 3E4OA 3NOUC 4JGRA 3LYXA 1UWNX 3HJKA 1BYWA 2VEAA 2L4RA 4HNBA 4KQDA 4HHDA 5HD5A 4HJ4A 3CLOA 1JNUA 3FG8A 5HDCA 1OTEA 3VOLA 5I5LA 4EXOA 1MZUA 4F3LB 3F1OA 4WUJA 5KIZA 3BWLA 5IU1A 2L1MA 3B33A 3BY9A 3NHQA 4HP9A 2WKRA 1OTDA 4WLAA 2PR5A 3H9WA 4DJ3A 1T1AA 1XJ6A 4I5SA 5G4ZA 1N9OA 4GCZA 1TS8A 4GW9A 1UGUA 5HDDA 5EFWA 2YKHA 2H28A 4EESA 4GHIA 4L9EA 5TBMB 1S66L 1XJ2A 4HIAA 1LSVA 3A0SA 4EEPA 5F5YA 3OLOA 5DKLA 4WF0A 1OT9A 1OTIA 2L0WA 2M1CA 2OWHA 4EQ1A 1N9NA 2D01A 2I9VA 4HJ3A 4HOIA 4GS9A 2PD8A 3UB7A 1F98A 3F1NA 2Z6CA 4HP4A 3HJIA 3LI9A 1LL8A 3K3DA 1S1ZA 3H7WA 3UB6A 2WKQA 4M4XA 4JGPA 3EEHA 2QHKA 3C2WA 3IS2A 4WL9A 4XT2A 4I3IA 4LPZA 4DJ2A 3F1OB 4NXBA 3P7NA 2JHEA 1S4RA 1S67L 3NJAA 1GSXA 2PYPA 4BBVA 3MFXA 5F68A 4HH3A 4RQ9A 2V9AA 3GDIA 3IBRA 4B9OA 5HWVA 4NXEA 3RH8B 5J4EA 1T19A 2QJ7A 1TS0A 3MQOA 1DP6A 5HSQA 5IS1A 4JGOA 4R6LA 1XFQA 2ZOIA 3GECA 4HH2A 1G28A 3FC7A 4PKYA 4GHIB 3F1PA 4EW7A 1V9ZA 3RTYA 4HQAA 1P0ZA 1XJ4A 3LIBA 1EW0A 4BBUA 1P97A 3A0RA 2OOLA 5AVFA 4KUOA 5DJUA 1TS7A 2HV1A 2Z6DA 3LIEA 2CMNA 1D7EA 4GS9B 1GSVA 3LICA 2OWJA 3F1NB 1XFNA 4HJ6A 4K08A 2W0NA 1KOUA 2VLGA 3H7WB 2QWSA 4LLOB 4BBTA 3UB8A 3C8CA 3IS2B 2K7SA 4XT2B 5HWTA 4JGQA 1NWZA 5HDSA 3E4QA 3UB9A 2BASA 4L9FA 3LIFA 3G6OA 3LIAA 2W27A 4WN5A 2KX6A 4EEUA 4KUKA 1S1YA 3KX0X 2A24A 4L9GA 2WKPA 2YKFA 3UMDA 1D06A 4R38A 4NXFA 3UE6A 1OTBA 1V9YA 3F1PB 4H6JA 1XJ3A 2VV8A 1GSWA 1ODVA 4EETB 2V1BA 2J80A 3H82A 3A0VA 3VE3A 4EERA 2VV6A 2PR6A 5HWWA 3CWFA 1DRMA 4YWZA 2JN7A 2KDKA 1T1CA 5J7EA 2V0WA 2VV7A 3ULFA 4LRXC 2PHYA 4LRZE 3VE4A 1T18A 3MR0A 1OT6A 3PYPA 3E4PA 2D02A 4I39A
chains in the Genus database with same CATH superfamily
3VFHA 1YLYA 2GX5A 3QP6A 4MN7A 3CPTA 4E3NA 3Q7VA 3KSFA 2W3FA 5HARA 3NBLA 2UV0E 1AWIA 2R78A 2P7JA 3KSGA 5AVEA 1MKIA 2HJ9C 4HY8A 3HLDA 4ME4A 3M2KA 1OTAA 1IFQA 3K3CA 5CERA 1P9RA 4R3AA 5FI7A 4P6ZS 1Y54A 5CTNA 1HTZA 2P04A 3ZG5A 2A3UA 4EBNA 4X1MA 3MQQA 1BSGA 3O88A 2ZMAA 1JVJA 2Y8HA 1MC0A 1YQSA 2V1AA 3NULA 1L0DA 3W4QA 2ZC3B 5GL9A 1MWTA 5DF9A 3GVBA 2E8IA 5CGWA 4K0XA 4DMZA 2Z2MB 4I38A 5EM0A 4H6JB 2J3TC 1D1JA 2ZQ7A 2HDUA 3Q07A 3H82B 5FAOA 1BT5A 3T4SA 4FUWA 4MN5A 4MNRA 3C7VA 5J3WA 1OJGA 1M40A 4E04A 3BLSA 4BMWA 3BM6A 3IHBA 2ZMFA 4EWFA 4D2OA 4ETZA 1YMSA 3BFEA 5TBMA 4DRTA 3N8SA 1H0MA 1KGGA 3RXWA 1JWPA 3T50A 2VGLM 5AQ7A 5TR7A 2PYRA 4UEYA 5A91A 3LEQA 4XUXA 1HVBA 2P9VB 5TFQA 1MWUA 5MC7A 3HCYA 3MXSA 3IF6B 4E6XA 3HJKA 2B18A 3DW0A 1FR1A 2PU2A 3G35A 2EXAA 3W2ZA 2Y2PA 3ZHHA 1MPLA 4KQDA 3E2LA 4HHDA 4HJ4A 1RP5A 2W3HA 3B47A 5FATA 2MJ6A 5I5LA 4EXOA 5BOHA 3K2NA 5EM1A 2M7VA 5GHXA 4P87A 1ES3A 5U47A 3NHQA 4WYYA 4QY5A 5CGXA 2WK0A 4WM9A 5HL1A 4IEDA 3H9WA 1MWRA 2ZC7A 1NRJA 3ZCZA 4OVDA 3IXHA 1O07A 5A90A 1YMXA 5F1GA 2DCFA 4S2IA 4BWIA 3S7PA 4EESA 1H3QA 2ZM8A 4QY6A 5FI6A 4GHIA 4L9EA 3ISGA 2C5WB 3VP0A 1GA0A 1CEGA 1LSVA 4JBFA 2NUPC 1LHYA 2HP6A 3ZG9B 4K0WA 2HP9A 2DNSA 2Y2QA 3L9KA 5KMWA 1OT9A 2OWHA 4IHQA 3ZNTA 2HPBA 4B88A 1Q2PA 1F98A 3DWKA 3F1NA 4HP4A 3HJIA 4JF5A 1XP4A 5AQ9A 3UB6A 2V1ZA 4OP8A 2WKQA 4PMAA 5EVLA 2QZ6A 5E2EA 3GQZA 5A92A 2WKIA 3PBSA 3IS2A 3HL9A 2W1RA 5HX9A 4G3WA 5EUAA 1JWVA 4GNUA 4DJ2A 1PRQA 3F1OB 3MXRA 2JHEA 4IUKA 1S67L 1FCNA 4R1GA 3MFXA 2J9OA 4HH3A 4RQ9A 5DFXA 2IWCA 3S22A 1KE4A 1LL9A 5L2FA 1PWDA 4ID4A 4N1XA 5JYPA 1MXOA 4NXEA 3NCKA 2H5SA 1TDLA 2VGKA 1K6SA 4ESPA 3D9YA 4KZ6A 4C6YA 5HSQA 2JCHA 1XFQA 2ZLYA 4HH2A 1G28A 4PKYA 3FC7A 2W3GA 4OOMA 3KYZA 4UQIS 4Y0TA 2EXBA 4HQAA 1P0ZA 3UPOA 5CXWA 3VP2A 5E2HA 4BBUA 5AVFA 3IX8A 4KQQA 1ES4A 3OCLA 2HV1A 3LIEA 1PI4A 5C5KA 4KZBA 4GS9B 2ZC5B 2OWJA 3UE3A 2ZQ9A 1CI8A 3DTMA 3IXDA 3HLCA 3PTEA 4FOFA 2Y79A 4NETA 1W79A 4BJPA 5HAPA 5HAQA 4N9LA 2K7SA 3UB5P 1XGJA 1K0KA 4YFMA 3FPVA 2IWBA 3C38A 1NWZA 4BL3A 3E4QA 3IHAA 4U3TA 4L9FA 5CGSA 5FQJA 3LIFA 5HAIA 3LIAA 1G68A 2W27A 3HUNA 3VSKA 2ACGA 2KX6A 2XQZA 2QPNA 3OPHA 1P9WA 2XD5A 5GLDA 2A24A 2WKPA 4KZ5A 2LB9A 1RCJA 2P08A 1OMEA 4UHUA 1ZKJA 4NXFA 3UE6A 4S2OA 4PM5A 1L0EA 1PI5A 2PAVP 4OPQA 4MLLA 1NJ4A 3DWZA 2X01A 1TDGA 3IWIA 1FSYA 2VV8A 4M3KA 2V1BA 2J80A 5KSHA 4GZBA 4EERA 2PR6A 3ZVWA 1K4EA 2VKSA 1RGZA 1SZVA 1EI5A 3ULFA 3C30A 3V5MA 1VETB 1T18A 3G30A 3OPRA 4R23A 3E4PA 5EPHA 5EV0A 4PM6A 4O0PA 3VOYA 4KG2A 4HI4A 1LSXA 3FPWA 3PXPA 3LUQA 3C4OA 3T4OA 1ZC2A 3D3OA 5M1AA 3LFVA 4PM7A 2JE5A 2PDRA 2XR0A 2V0UA 3D4FA 1ESUA 4NXGA 4CLCD 3MZFA 4LV0A 4PM8A 3O3VA 5HZHA 3FV7A 5A8BA 1IEMA 4RX3A 4JXSA 3OBFA 3LIDA 2XA7M 2XFTA 2JKTM 3OPPA 3PHYA 5L09A 1AXBA 2C6WB 4ZTKA 4WBGA 3HBRA 1YSPA 2ZBBA 4F3LA 4R3JA 5G4YA 3VP4A 3ZQ5A 4QWOA 3FKWA 1PIOA 3V50A 2EWWA 4GJ4A 1X0OA 1K38A 2O9BA 2HDQA 3N7WA 1OJ5A 3QP4A 4I3JA 1KVLA 4OP5A 2PBDP 3VFFA 4Y2FA 4E3JA 1ONGA 4IUHA 3V39A 1BLHA 1NYYA 4CLCA 1PZOA 3GV9A 3RXXA 3VOZA 3HREA 3T1QB 3TJZC 4OQIA 1TS6A 1NLYA 5HL6A 3NC8A 4BQMA 4LRYC 1ERQA 2B95A 1S4SA 3E0YA 3NOPC 4XUZA 4I3AA 2RL3A 2CC1A 1XA1A 1EROA 3CPTB 3G4PA 3MZEA 4BENA 4CJNA 4MN6A 4JXVA 3Q7VB 2FH5A 2XGNA 3ICYA 1DJBA 2GZAA 5FQQA 1LSWA 3NECA 3BYDA 1WYBA 1TVFA 3NOUC 3S7QA 3IBJA 3P01A 2Y2OA 2FFFB 1UWNX 4CQHA 2W1TA 3OC2A 1TF1A 4WZ4A 3MS6A 4R0QA 5FQIA 4C3QA 1MWSA 4HNBA 2OSUA 3CITA 2VJWA 5HD5A 3R7WA 5FQ9A 1Q2QA 4DDSA 3CLOA 1PFLA 1H8ZA 4IBRA 2VX8A 4X69A 3FG8A 3VOLA 1OTEA 4Q0HA 3IXBA 4FTXA 1G6OA 5EECA 2NUTC 4G3VA 1PNEA 1TEMA 2Q9MA 5KIZA 2DMWA 4E3KA 1YKDA 3B33A 3BY9A 5DTSA 1KDWA 2XH9A 4JF4A 5I94A 3MBZA 3MMHA 1WYCA 4FCFA 3MSHA 4X55A 2O9CA 4GCZA 3M2JA 1UGUA 2H0YA 4ZDXA 2Y2JA 2HGVA 2YKHA 1JTDA 4AFIA 2H28A 2BLSA 1YLPA 3IX4A 4Q0IA 4HESA 1KGEA 2EX2A 5TBMB 5GHYA 1K25A 3B42A 3PBQA 3UE1A 2OLVA 4QJGA 5IT5A 1PW8A 1BLSA 4KQRA 2Y2GA 3ITBA 1HZOA 5DKLA 3ZVTA 3GSGA 4WF0A 4JXGA 1VEUB 1XKZA 1PZPA 3OZHA 2OAP1 3ITAA 3T4JA 1W63Q 4E3MA 2K2NA 4GLQA 4QD4A 3LI9A 1BTLA 3SS3A 3H7WA 2H10A 4JGPA 1ERMA 1VHMA 3SOIA 4QPRA 3T12B 3C2WA 1NRFA 4B4ZA 2Y59A 4ZJ1A 4FD8A 4XT2A 2LB5A 4DE1A 5HPFA 3LR0A 4MBKA 2RCXA 4NXBA 1VEUA 2EX9A 2JKGA 3HVFA 3P7NA 1S4RA 3NJAA 1GSXA 4BBVA 5HW3A 1STZA 4DKIA 3MKEA 1F5MA 3BQ8A 1W7FA 3LR4A 1IYPA 4KZ3A 4WZ5C 2V2FF 5HWVA 1W63M 5J4EA 4IVIA 4Y0OA 3T1RA 3MQOA 5KSCA 5GLCA 3PAEA 4BD0A 3PBNA 3QP2A 4R6LA 5F1FA 4R3BA 4NK3A 4GHIB 1BLPA 3F1PA 3UE0A 4MBFA 2WGVA 2OLUA 3WS2A 1N9BA 4N1HA 3AGFA 1GCEA 3ZG8B 4OQGA 3M6HA 4Y5FA 3TSGA 1EW0A 1P97A 2A49A 1SKFA 3AGDA 3UY6A 3CZDA 4ZBEA 4NEED 4JKTA 2CMNA 2PRFA 3EEAA 1GSVA 3BEBA 2A2LA 1L0GA 3F1NB 2WGWA 4DE3A 4K08A 3P98A 2W0NA 2VLGA 2XRNA 3VV4A 1YLJA 3O87A 5GLAA 3IH9A 2BTFP 3ZG7B 4BBTA 1FILA 2VA0A 4C75A 1CI9A 1IYSA 1CF0A 5FDSA 3IS2B 5FA7A 3CMZA 1NZUA 5HDSA 3IWQA 3S1YA 1L2SA 4QU3A 4OKPA 2BASA 1NXYA 3N4IA 5A93A 5L10A 1YLTA 3T4KA 3EQUA 1S1YA 4KQOA 5CEDA 3KX0X 4HEFA 3UNWA 3WS0A 4L9GA 2XK1A 2YKFA 4Y7PA 2G2UA 2X71A 3BJNA 2WADA 3UMDA 4KZ8A 4JF6A 5M18A 1K56D 1E3UD 4IBXA 3ZDJA 3A3DA 4ARZA 5K5BA 3DTKA 2EFUA 4Q8IA 2VZWA 1CJFA 5CHMA 2V8FA 3OOVA 1XJ3A 1GSWA 4MEZA 3BECA 5HWWA 4S2NC 4G3KA 3HLBA 3G2YA 2KDKA 2O0YA 3T1XA 5J7EA 3CJMA 2XSSA 5FEFA 2PHYA 2ZC4B 4LRZE 3VE4A 1OT6A 1BUEA 3RJUA 1K56A 4CPKA 3S4XA 1E3UA 1IKGA 5F82A 4BLMA 1C3BA 2GJ3A 3MF0A 4WZ5A 4KG6A 1E4DA 3FKVA 3NDGA 1H8YA 4UAAA 1T1BA 4OPYA 3MXQA 3HLEA 4X6TA 4PHTA 1Y28A 2ZOHA 3NI9A 5TGFA 4LV3A 3NOTC 1FIKA 3UMEA 3BFDA 4OPZA 3HUOA 3CG5A 1J9MA 4II7A 2J9PA 5AJGA 5KZHA 5DJTA 4X1LA 3IT9A 2A24B 5HPIA 1SCWA 2WAEA 4Y13A 1FCMA 4CLCC 5EOOA 1BULA 2PD7A 1CEFA 3GMWA 1PWGA 3TOIA 3TW8A 3VP1A 3AGEA 4EQIA 1MY8A 2QJ5A 3BW6A 3UDXA 1Y4OA 2ZQCA 5FQKA 2ZM2A 3UDIA 4CLCE 1F9IA 3WRZA 4H8RA 1FCOA 3BFGA 3GRJA 3QNBA 5AQAA 2JC7A 3LGOA 2ZQAA 4IJGA 4K91A 4O7DA 4E3LA 1DP8A 1VB6A 3UPPA 3QNCA 2INWA 5CX7A 3ZFZA 5F69A 3KYQA 3WS4A 4Q0JA 2B02A 2XA7S 3MJQA 4GB7A 2B5RA 5HD3A 3E4OA 3SH8A 4JGRA 3LYXA 1ONHA 3KSIA 1BYWA 3M6BA 1W8YA 4WEJA 4KZ7A 1DJAA 4KZ9A 3S7OA 1SDNA 5E43A 3NY4A 3HLFA 1JNUA 5HDCA 4F3LB 3A3IA 3LEZA 4S2NA 5DF7A 4UA7A 4PM9A 4X56A 4N9KA 4HP9A 1OTDA 1JTGA 1XPBA 4WLAA 4Y0UA 2PR5A 1K54A 1K55C 1T1AA 4QB8A 2H0TA 2IWDA 3EOIA 1N9OA 3MQ0A 4I5SA 4Z1WA 1TS8A 4CLCB 1E25A 1Z09A 5FASA 2QMIA 4Y3IA 2XEPA 5EFWA 3QP1A 2WUQA 3KO6A 3Q81A 2XFSA 3FZCA 4IVKA 4GOGA 4N92A 4WMCD 4P6BA 3C5AA 4UA9A 5CRFA 2W3DA 2JKRI 1S0WA 5EVID 3KSHA 3ZNYA 4HIAA 3U2AA 3A0SA 3W4PA 4YINA 3OLOA 3G2ZA 5TJJA 4GN2A 2M1CA 1OTIA 4GKUA 4ETXA 4L0LA 1N9NA 1K6RA 2QYBA 2D01A 4HOIA 4RA7A 3V3SA 2W1TB 3UB7A 4LENA 4OH0A 2Z6CA 1ES2A 2I72A 1LL8A 1ZHHB 2ZMVA 3R7WB 4M4XA 1YT4A 4GD6A 3EEHA 2QHKA 1GHMA 2E8JA 5EVIA 1XGIA 1FSWA 1YLWA 1RGYA 2WKEA 4I3IA 4LPZA 2M7UA 4LFUA 4EU0A 3S7NA 2HJEA 4U0TA 3BLMA 1MKMA 1SKOA 1JWZA 3G34A 4DE2A 5F68A 1DY6A 1PYYA 3V67A 3JYIA 2X02A 3JVVA 3LR3A 1A0KA 4MMNA 1TD5A 3QP8A 5J8XA 1L3LA 4B9OA 3EGXC 1DJCA 4X25A 2V20A 2QJ7A 2WZXA 3IF6C 1TS0A 1I2SA 1DP6A 2ZL1A 3O86A 3N6IA 3GECA 1LLBA 1PW1A 4LV2A 1HLUP 3E2KA 4EW7A 3DTIA 2HDRA 3RTYA 5AQBA 4OLGA 2WZZA 4RX2A 4KZ4A 1FQGA 3WS5A 1VQQA 3LIBA 2VGLS 3A0RA 4UA6A 4KUOA 3NIAA 3Q82A 3E98A 2PU4A 2JKFA 3EQVA 1QMFA 2ZQDA 2AVXA 1S6RA 4EUVA 3DAVA 3LICA 4OOYA 2PBYA 4WEKA 1XFNA 2VGJA 4P85A 3LCEA 4GD8A 1KOUA 3H7WB 4LLOB 4BL2A 5E2FA 3PBTA 2GNXA 3UB8A 3IH8A 1SHVA 1K55A 2Y2KA 3C8CA 1U60A 3L7HA 3A3JA 1KGFA 4R4RA 4XT2B 5HWTA 4DXBA 4JGQA 2DRWA 3UB9A 3ZG0A 4E3IA 3CI6A 5FSRA 4PAUA 3QHYA 1YPRA 5E2GA 4EEUA 3N8LA 4JPMA 3V3RA 4WELA 3T1SA 1YAXA 1IYQA 3TE8A 4R38A 1K4FA 3N8RA 1CQAA 1ALQA 5FQMA 3F1PB 1IKIA 3IWOA 1MBLA 4H6JA 1NLZA 4OONA 3MZDA 4EETB 3H82A 3A0VA 2JBFA 3VE3A 5FAPA 4P6ZM 5FDHA 2G2WA 1WE4A 3CWFA 3VMAA 1DRMA 4YWZA 4LCLA 4LGWA 1T1CA 4DE0A 2V0WA 1FOFA 5DTTA 2Z2LB 4GDNA 2JKRM 4JLFA 3OCNA 5LBRA 3UDFA 3IXGA 2D02A 2WGWB 3ZGAB 5GLBA 3T4LA 5L8MA 3P09A 1UWPX 3CUEC 3W8KA 1XX2A 3BY8A 1KVMA 3SS4A 3D72A 1LL5A 5F6AA 4MDZA 4RVAA 1ESIA 3RFBA 2P9VA 3LR5A 4S2MA 3LI8A 2G7UA 3IF6A 3CAXA 1O7EA 2Y2LA 1LT0A 5DVAA 1ACFA 2XLNA 3MKFA 5M19A 3HLWA 5FAQA 5HFOA 4XXRA 2R9WA 2O9AA 4EBPA 2J3WA 2UWXA 2Y2IA 4S2KA 3JPUA 4OQ0A 1NZOA 4PKYG 1WA9A 2J3TD 4ARZB 3GTCA 2QKPA 3A3EA 1N9LA 3BQAA 1YSQA 5DKKA 2Q9NA 3EWKA 3TRCA 1DP9A 4OOLA 1XA7A 1CK3A 4NKPA 1F2KA 3EGDC 1GA9A 2Y2HA 4R70A 3SZTA 4EV4A 3W4OA 4KZAA 2V8CA 2W3EA 2XROA 1ZG6A 2PT7A 3OPLA 2EA9A 4P0MA 4KENB 1YLZA 5F83A 4Y17A 2IA2A 2EX8A 1Z6FA 2JKTI 2WYXA 5DF8A 3QP5A 3SW1A 2Y2NA 4NG2A 3IF5A 1K57C 4S2PA 3T4QA 1IYOA 2VEAA 2L4RA 3LO7A 2KLIA 2HZ5A 3WS1A 1K54C 1SDEA 2ZJ9A 3FWLA 4RYEA 4DN0A 2EX6A 2HF6A 5EOEA 3PAGA 5JYOA 3DBAA 1MZUA 2FFYA 3UPNA 1VM1A 3F1OA 1GHPA 2XD1A 1PWCA 4WUJA 1W5DA 3PBOA 3BWLA 5EVEA 3I7JA 2KOIA 4OLDA 5IU1A 2L1MA 5FI2A 4YNRA 2WGIA 1IELA 2WKRA 4X68A 5CEBA 4PPRA 4DJ3A 4Z9QA 3CUEA 1XJ6A 2K31A 5G4ZA 3SH7A 4GW9A 4FSFA 3B3XA 5HDDA 4EUZA 1LI0A 1KDSA 2Q0OA 4FH2A 1S66L 4O8GA 1XJ2A 4HBUA 1NYMA 1H8MA 4EEPA 3BRMA 4B93A 5F5YA 4YOFA 5EVIC 2WAFA 1ZTUA 3Q1FA 2L0WA 3C4PA 4Y15A 4EQ1A 2P74A 4ZRRA 2I9VA 4HJ3A 4GS9A 3IQAA 2PD8A 5CHUA 1QMEA 5IHVA 4X53A 3BFCA 4UQIM 3PBRA 3JVUA 4HBTA 4R4SA 3K3DA 1S1ZA 3VSLA 1IOUA 2OAQ1 2HDSA 1M6KA 2EFXA 3VP3A 2ZM0A 5D3OA 4OQHA 2O99A 4WL9A 4S2JA 2Y2MA 3UO9A 3BFFA 5EE8A 2FZ0A 4KG5A 3DTEA 2PYPA 4F94A 2GDNA 5FL3A 4QHCA 1LI9A 2V9AA 4E3OA 1H5XA 3GDIA 1GHIA 3IBRA 5DTKA 2J8YA 3RH8B 1I5QA 1T19A 2J7VA 2BG1A 3G32A 5IS1A 3UN7A 4MCWA 4JGOA 2XDMA 3SS5A 2ZOIA 2R9XA 1K57A 4O01A 3KYEA 2Y55A 4JXWA 4BD1A 1I2WA 1V9ZA 1FR6A 4DF6A 3R4KA 1BZAA 5CTMA 4LV1A 1XJ4A 5GHZA 1KE3A 2OOLA 1ZG4A 3PR6A 5DJUA 3U4LP 1TS7A 2Z6DA 1N4OA 1W8QA 1D7EA 5G18A 1VETA 4OPRA 3SH9A 1G5UA 3HLGA 4HJ6A 5CHJA 3CHWP 2QWSA 5CECA 3TG9A 3WWXA 5FEGA 2Y4AA 2Y91A 5EVIB 5L07A 1EWZA 4S2LA 3A3FA 1NY0A 1SKOB 1ES5A 2OV5A 2ZC6B 3LY3A 3G6OA 1OPXA 4DDYA 4WN5A 1BLCA 4KUKA 3G31A 3IX3A 1L0FA 1HD8A 4B4XA 3HUMA 2XF3A 4WMCA 2WKHA 3C7UA 1G6AA 1YM1A 1D06A 4EBLA 3NDEA 3FYZA 2EWVA 2ZL1B 1OTBA 1KE0A 2ZQ8A 1V9YA 4LCMA 1J3WA 4ZJ2A 4D60A 1XXMA 4FH4A 3O5YA 3MFDA 4DXCA 3WRTA 4MBHA 4E6WA 2HP5A 4ZAMA 1ODVA 4A5RA 4U0XA 4ZJ3A 2VV6A 3T4TA 2VK3A 3LY4A 5DFYA 2JN7A 4GDBA 2VV7A 3Q7ZA 2ZD8A 3GR2A 4LRXC 3MR0A 3ZYTA 3PYPA 4I39A
chains in the Genus database with same CATH topology
3T4LA 5L8MA 2GX5A 1UWPX 3CUEC 4MN7A 4O0PA 3BY8A 4HI4A 2GJ3A 3MF0A 1LSXA 3D72A 3KSFA 2W3FA 3FPWA 3PXPA 5F6AA 3LUQA 4MDZA 3T4OA 3D3OA 3RFBA 3LR5A 1T1BA 2R78A 3LFVA 3LI8A 2PDRA 2G7UA 3MXQA 2P7JA 3KSGA 5AVEA 2V0UA 3CAXA 4PHTA 1Y28A 2HJ9C 2ZOHA 4HY8A 4ME4A 3NOTC 1OTAA 1IFQA 3K3CA 3UMEA 1LT0A 4NXGA 4CLCD 4II7A 1P9RA 5AJGA 4R3AA 5HZHA 5A8BA 5DJTA 3OBFA 3LIDA 2XA7M 2JKTM 2A24B 3PHYA 5HPIA 4P6ZS 4CLCC 1YSPA 2O9AA 2J3WA 2ZBBA 4F3LA 2P04A 5G4YA 3MQQA 3ZQ5A 4PKYG 2EWWA 2PD7A 2Y8HA 1MC0A 2V1AA 1WA9A 4GJ4A 1X0OA 2J3TD 4ARZB 2QKPA 1N9LA 3BQAA 5DF9A 1YSQA 3TW8A 2O9BA 4DMZA 5DKKA 3EWKA 3TRCA 1OJ5A 1DP9A 4OOLA 4I38A 4I3JA 4H6JB 2J3TC 4NKPA 2QJ5A 3BW6A 3EGDC 3H82B 4Y2FA 4IUHA 4CLCE 4CLCA 3T4SA 4R70A 1F9IA 4MN5A 2W3EA 5J3WA 1OJGA 4E04A 4IJGA 3TJZC 4BMWA 2XROA 1TS6A 1NLYA 5HL6A 2PT7A 2ZMFA 4ETZA 1DP8A 1VB6A 2EA9A 5TBMA 4LRYC 1S4SA 3E0YA 3NOPC 2INWA 5CX7A 4I3AA 5F69A 3KYQA 2IA2A 3T50A 2VGLM 4MN6A 4Q0JA 2FH5A 2B02A 2XA7S 2JKTI 3MJQA 3ICYA 2PYRA 4UEYA 5HD3A 2GZAA 1LSWA 3SW1A 3E4OA 5MC7A 3NOUC 4JGRA 3S7QA 3IBJA 3HCYA 3LYXA 3T4QA 3P01A 3KSIA 1UWNX 3HJKA 1BYWA 4CQHA 2W1TA 2VEAA 3OC2A 4WEJA 2B18A 1TF1A 2L4RA 2KLIA 3S7OA 4HNBA 3W2ZA 3CITA 2VJWA 4KQDA 4HHDA 5HD5A 4HJ4A 3R7WA 3CLOA 2W3HA 1JNUA 4DN0A 2VX8A 2HF6A 3FG8A 5HDCA 1OTEA 3VOLA 3B47A 4Q0HA 2MJ6A 5I5LA 4EXOA 3K2NA 3DBAA 1MZUA 4F3LB 2M7VA 3F1OA 1G6OA 2NUTC 4G3VA 4WUJA 5KIZA 3PBOA 3BWLA 2DMWA 1YKDA 2KOIA 5IU1A 2L1MA 3B33A 3BY9A 3NHQA 4YNRA 4HP9A 3MMHA 2WKRA 1OTDA 4WLAA 2PR5A 3H9WA 4DJ3A 1NRJA 3CUEA 1T1AA 2O9CA 1XJ6A 2K31A 4I5SA 3MQ0A 3EOIA 1N9OA 4GCZA 5G4ZA 4Z1WA 1TS8A 4CLCB 4GW9A 1UGUA 4FSFA 5HDDA 4Y3IA 4BWIA 2HGVA 2YKHA 5EFWA 3S7PA 2H28A 3KO6A 1H3QA 4AFIA 4EESA 4GHIA 4Q0IA 4L9EA 2W3DA 2JKRI 5TBMB 3KSHA 3B42A 3PBQA 1S66L 4O8GA 1XJ2A 4HIAA 3U2AA 5IT5A 1H8MA 1LSVA 3A0SA 4EEPA 4B93A 5F5YA 2NUPC 3OLOA 4YOFA 5TJJA 5DKLA 1ZTUA 4WF0A 1OT9A 1OTIA 2L0WA 2M1CA 2OWHA 4EQ1A 4ETXA 4IHQA 1N9NA 4L0LA 2QYBA 4ZRRA 2D01A 2I9VA 4HJ3A 4HOIA 4GS9A 2OAP1 2PD8A 2W1TB 3UB7A 3T4JA 1F98A 1W63Q 2K2NA 3F1NA 2Z6CA 4HP4A 4GLQA 3HJIA 4UQIM 3LI9A 3PBRA 3JVUA 1LL8A 3K3DA 1S1ZA 1IOUA 1ZHHB 3H7WA 2ZMVA 2OAQ1 3UB6A 2WKQA 3R7WB 4M4XA 4JGPA 3EEHA 1VHMA 2QHKA 4QPRA 3C2WA 3IS2A 3PBSA 2W1RA 4G3WA 2O99A 4WL9A 4XT2A 2LB5A 4I3IA 4LPZA 4DJ2A 2M7UA 4EU0A 5HPFA 3LR0A 3S7NA 3F1OB 4NXBA 2HJEA 3P7NA 2JHEA 2FZ0A 4IUKA 1MKMA 1S4RA 1S67L 3NJAA 1GSXA 2PYPA 4BBVA 1STZA 3MFXA 5FL3A 5F68A 4HH3A 4RQ9A 5DFXA 3V67A 2V9AA 1F5MA 3BQ8A 3JVVA 3LR4A 3LR3A 4MMNA 3GDIA 1TD5A 3IBRA 4B9OA 3EGXC 5HWVA 1W63M 4NXEA 3RH8B 5J4EA 1T19A 2QJ7A 1TS0A 3MQOA 1DP6A 5HSQA 3PBNA 5IS1A 4MCWA 4JGOA 4R6LA 1XFQA 2ZOIA 3GECA 4HH2A 4O01A 1G28A 3FC7A 4PKYA 4GHIB 2W3GA 3F1PA 4OOMA 3KYZA 4EW7A 4UQIS 1V9ZA 3RTYA 4HQAA 1P0ZA 3R4KA 1XJ4A 4Y5FA 3LIBA 1EW0A 4BBUA 1P97A 2VGLS 3A0RA 2OOLA 5AVFA 4KUOA 3PR6A 5DJUA 3E98A 3OCLA 1TS7A 2HV1A 2Z6DA 3LIEA 4NEED 3EQVA 2CMNA 1D7EA 5C5KA 3EEAA 4GS9B 1GSVA 4EUVA 3LICA 2A2LA 4WEKA 2OWJA 3F1NB 1XFNA 3UE3A 4HJ6A 4K08A 2W0NA 1KOUA 2VLGA 3H7WB 2QWSA 2XRNA 3VV4A 4LLOB 3PBTA 4FOFA 2GNXA 4BBTA 2Y79A 2VA0A 3UB8A 4BJPA 3C8CA 3IS2B 2K7SA 4XT2B 5HWTA 4JGQA 3FPVA 3C38A 1NWZA 5HDSA 3E4QA 3UB9A 2BASA 4L9FA 3LIFA 3G6OA 1OPXA 3LIAA 3CI6A 2W27A 4PAUA 4WN5A 2KX6A 4EEUA 3T4KA 1P9WA 4KUKA 3EQUA 1S1YA 4KQOA 3KX0X 4WELA 2A24A 4L9GA 2WKPA 2YKFA 2LB9A 2P08A 3BJNA 3UMDA 1YAXA 1D06A 3TE8A 4R38A 2EWVA 4NXFA 3UE6A 1OTBA 1V9YA 4ARZA 5K5BA 3F1PB 3O5YA 2VZWA 3OOVA 4H6JA 1XJ3A 2VV8A 1GSWA 1NLZA 1ODVA 4EETB 2V1BA 2J80A 5KSHA 3H82A 3A0VA 3VE3A 4EERA 2VV6A 2PR6A 3T4TA 4P6ZM 5HWWA 3CWFA 1DRMA 4YWZA 4G3KA 5DFYA 2JN7A 2KDKA 2O0YA 2VKSA 1T1CA 5J7EA 2V0WA 2VV7A 2XSSA 3ULFA 3C30A 4LRXC 2PHYA 4LRZE 3VE4A 1T18A 2JKRM 3MR0A 3OCNA 1OT6A 3ZYTA 3PYPA 3E4PA 5LBRA 2D02A 4I39A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UWP X;  3BY8 A;  4HI4 A;  2GJ3 A;  1LSX A;  3D72 A;  5F6A A;  3LUQ A;  1T1B A;  2R78 A;  3LI8 A;  2PDR A;  3MXQ A;  2P7J A;  5AVE A;  2V0U A;  3CAX A;  1Y28 A;  2ZOH A;  4HY8 A;  3NOT C;  1OTA A;  3K3C A;  3UME A;  1LT0 A;  4NXG A;  4R3A A;  5HZH A;  5A8B A;  5DJT A;  3LID A;  2A24 B;  3PHY A;  2ZBB A;  4F3L A;  5G4Y A;  3MQQ A;  3ZQ5 A;  4PKY G;  2PD7 A;  2V1A A;  1WA9 A;  1X0O A;  2QKP A;  1N9L A;  5DKK A;  3EWK A;  1OJ5 A;  1DP9 A;  4I38 A;  4I3J A;  4H6J B;  2QJ5 A;  3H82 B;  4R70 A;  1F9I A;  4MN5 A;  5J3W A;  1OJG A;  4E04 A;  1TS6 A;  1DP8 A;  1VB6 A;  2EA9 A;  5TBM A;  4LRY C;  1S4S A;  3NOP C;  2INW A;  4I3A A;  5F69 A;  3T50 A;  4MN6 A;  2B02 A;  3MJQ A;  3ICY A;  2PYR A;  5HD3 A;  1LSW A;  3SW1 A;  3E4O A;  3NOU C;  4JGR A;  3LYX A;  1UWN X;  3HJK A;  1BYW A;  2VEA A;  2L4R A;  4HNB A;  4KQD A;  4HHD A;  5HD5 A;  4HJ4 A;  3CLO A;  1JNU A;  3FG8 A;  5HDC A;  1OTE A;  3VOL A;  5I5L A;  4EXO A;  1MZU A;  4F3L B;  3F1O A;  4WUJ A;  5KIZ A;  3BWL A;  5IU1 A;  2L1M A;  3B33 A;  3BY9 A;  3NHQ A;  4HP9 A;  2WKR A;  1OTD A;  4WLA A;  2PR5 A;  3H9W A;  4DJ3 A;  1T1A A;  1XJ6 A;  4I5S A;  5G4Z A;  1N9O A;  4GCZ A;  1TS8 A;  4GW9 A;  1UGU A;  5HDD A;  5EFW A;  2YKH A;  2H28 A;  4EES A;  4GHI A;  4L9E A;  5TBM B;  1S66 L;  1XJ2 A;  4HIA A;  1LSV A;  3A0S A;  4EEP A;  5F5Y A;  3OLO A;  5DKL A;  4WF0 A;  1OT9 A;  1OTI A;  2L0W A;  2M1C A;  2OWH A;  4EQ1 A;  1N9N A;  2D01 A;  2I9V A;  4HJ3 A;  4HOI A;  4GS9 A;  2PD8 A;  3UB7 A;  1F98 A;  3F1N A;  2Z6C A;  4HP4 A;  3HJI A;  3LI9 A;  1LL8 A;  3K3D A;  1S1Z A;  3H7W A;  3UB6 A;  2WKQ A;  4M4X A;  4JGP A;  3EEH A;  2QHK A;  3C2W A;  3IS2 A;  4WL9 A;  4XT2 A;  4I3I A;  4LPZ A;  4DJ2 A;  3F1O B;  4NXB A;  3P7N A;  2JHE A;  1S4R A;  1S67 L;  3NJA A;  1GSX A;  2PYP A;  4BBV A;  3MFX A;  5F68 A;  4HH3 A;  4RQ9 A;  2V9A A;  3GDI A;  3IBR A;  4B9O A;  5HWV A;  4NXE A;  3RH8 B;  5J4E A;  1T19 A;  2QJ7 A;  1TS0 A;  3MQO A;  1DP6 A;  5HSQ A;  5IS1 A;  4JGO A;  4R6L A;  1XFQ A;  2ZOI A;  3GEC A;  4HH2 A;  1G28 A;  3FC7 A;  4PKY A;  4GHI B;  3F1P A;  4EW7 A;  1V9Z A;  3RTY A;  4HQA A;  1P0Z A;  1XJ4 A;  3LIB A;  1EW0 A;  4BBU A;  1P97 A;  3A0R A;  2OOL A;  5AVF A;  4KUO A;  5DJU A;  1TS7 A;  2HV1 A;  2Z6D A;  3LIE A;  2CMN A;  1D7E A;  4GS9 B;  1GSV A;  3LIC A;  2OWJ A;  3F1N B;  1XFN A;  4HJ6 A;  4K08 A;  2W0N A;  1KOU A;  2VLG A;  3H7W B;  2QWS A;  4LLO B;  4BBT A;  3UB8 A;  3C8C A;  3IS2 B;  2K7S A;  4XT2 B;  5HWT A;  4JGQ A;  1NWZ A;  5HDS A;  3E4Q A;  3UB9 A;  2BAS A;  4L9F A;  3LIF A;  3G6O A;  3LIA A;  2W27 A;  4WN5 A;  2KX6 A;  4EEU A;  4KUK A;  1S1Y A;  3KX0 X;  2A24 A;  4L9G A;  2WKP A;  2YKF A;  3UMD A;  1D06 A;  4R38 A;  4NXF A;  3UE6 A;  1OTB A;  1V9Y A;  3F1P B;  4H6J A;  1XJ3 A;  2VV8 A;  1GSW A;  1ODV A;  4EET B;  2V1B A;  2J80 A;  3H82 A;  3A0V A;  3VE3 A;  4EER A;  2VV6 A;  2PR6 A;  5HWW A;  3CWF A;  1DRM A;  4YWZ A;  2JN7 A;  2KDK A;  1T1C A;  5J7E A;  2V0W A;  2VV7 A;  3ULF A;  4LRX C;  2PHY A;  4LRZ E;  3VE4 A;  1T18 A;  3MR0 A;  1OT6 A;  3PYP A;  3E4P A;  2D02 A;  4I39 A; 
#chains in the Genus database with same CATH topology
 3VFH A;  1YLY A;  2GX5 A;  3QP6 A;  4MN7 A;  3CPT A;  4E3N A;  3Q7V A;  3KSF A;  2W3F A;  5HAR A;  3NBL A;  2UV0 E;  1AWI A;  2R78 A;  2P7J A;  3KSG A;  5AVE A;  1MKI A;  2HJ9 C;  4HY8 A;  3HLD A;  4ME4 A;  3M2K A;  1OTA A;  1IFQ A;  3K3C A;  5CER A;  1P9R A;  4R3A A;  5FI7 A;  4P6Z S;  1Y54 A;  5CTN A;  1HTZ A;  2P04 A;  3ZG5 A;  2A3U A;  4EBN A;  4X1M A;  3MQQ A;  1BSG A;  3O88 A;  2ZMA A;  1JVJ A;  2Y8H A;  1MC0 A;  1YQS A;  2V1A A;  3NUL A;  1L0D A;  3W4Q A;  2ZC3 B;  5GL9 A;  1MWT A;  5DF9 A;  3GVB A;  2E8I A;  5CGW A;  4K0X A;  4DMZ A;  2Z2M B;  4I38 A;  5EM0 A;  4H6J B;  2J3T C;  1D1J A;  2ZQ7 A;  2HDU A;  3Q07 A;  3H82 B;  5FAO A;  1BT5 A;  3T4S A;  4FUW A;  4MN5 A;  4MNR A;  3C7V A;  5J3W A;  1OJG A;  1M40 A;  4E04 A;  3BLS A;  4BMW A;  3BM6 A;  3IHB A;  2ZMF A;  4EWF A;  4D2O A;  4ETZ A;  1YMS A;  3BFE A;  5TBM A;  4DRT A;  3N8S A;  1H0M A;  1KGG A;  3RXW A;  1JWP A;  3T50 A;  2VGL M;  5AQ7 A;  5TR7 A;  2PYR A;  4UEY A;  5A91 A;  3LEQ A;  4XUX A;  1HVB A;  2P9V B;  5TFQ A;  1MWU A;  5MC7 A;  3HCY A;  3MXS A;  3IF6 B;  4E6X A;  3HJK A;  2B18 A;  3DW0 A;  1FR1 A;  2PU2 A;  3G35 A;  2EXA A;  3W2Z A;  2Y2P A;  3ZHH A;  1MPL A;  4KQD A;  3E2L A;  4HHD A;  4HJ4 A;  1RP5 A;  2W3H A;  3B47 A;  5FAT A;  2MJ6 A;  5I5L A;  4EXO A;  5BOH A;  3K2N A;  5EM1 A;  2M7V A;  5GHX A;  4P87 A;  1ES3 A;  5U47 A;  3NHQ A;  4WYY A;  4QY5 A;  5CGX A;  2WK0 A;  4WM9 A;  5HL1 A;  4IED A;  3H9W A;  1MWR A;  2ZC7 A;  1NRJ A;  3ZCZ A;  4OVD A;  3IXH A;  1O07 A;  5A90 A;  1YMX A;  5F1G A;  2DCF A;  4S2I A;  4BWI A;  3S7P A;  4EES A;  1H3Q A;  2ZM8 A;  4QY6 A;  5FI6 A;  4GHI A;  4L9E A;  3ISG A;  2C5W B;  3VP0 A;  1GA0 A;  1CEG A;  1LSV A;  4JBF A;  2NUP C;  1LHY A;  2HP6 A;  3ZG9 B;  4K0W A;  2HP9 A;  2DNS A;  2Y2Q A;  3L9K A;  5KMW A;  1OT9 A;  2OWH A;  4IHQ A;  3ZNT A;  2HPB A;  4B88 A;  1Q2P A;  1F98 A;  3DWK A;  3F1N A;  4HP4 A;  3HJI A;  4JF5 A;  1XP4 A;  5AQ9 A;  3UB6 A;  2V1Z A;  4OP8 A;  2WKQ A;  4PMA A;  5EVL A;  2QZ6 A;  5E2E A;  3GQZ A;  5A92 A;  2WKI A;  3PBS A;  3IS2 A;  3HL9 A;  2W1R A;  5HX9 A;  4G3W A;  5EUA A;  1JWV A;  4GNU A;  4DJ2 A;  1PRQ A;  3F1O B;  3MXR A;  2JHE A;  4IUK A;  1S67 L;  1FCN A;  4R1G A;  3MFX A;  2J9O A;  4HH3 A;  4RQ9 A;  5DFX A;  2IWC A;  3S22 A;  1KE4 A;  1LL9 A;  5L2F A;  1PWD A;  4ID4 A;  4N1X A;  5JYP A;  1MXO A;  4NXE A;  3NCK A;  2H5S A;  1TDL A;  2VGK A;  1K6S A;  4ESP A;  3D9Y A;  4KZ6 A;  4C6Y A;  5HSQ A;  2JCH A;  1XFQ A;  2ZLY A;  4HH2 A;  1G28 A;  4PKY A;  3FC7 A;  2W3G A;  4OOM A;  3KYZ A;  4UQI S;  4Y0T A;  2EXB A;  4HQA A;  1P0Z A;  3UPO A;  5CXW A;  3VP2 A;  5E2H A;  4BBU A;  5AVF A;  3IX8 A;  4KQQ A;  1ES4 A;  3OCL A;  2HV1 A;  3LIE A;  1PI4 A;  5C5K A;  4KZB A;  4GS9 B;  2ZC5 B;  2OWJ A;  3UE3 A;  2ZQ9 A;  1CI8 A;  3DTM A;  3IXD A;  3HLC A;  3PTE A;  4FOF A;  2Y79 A;  4NET A;  1W79 A;  4BJP A;  5HAP A;  5HAQ A;  4N9L A;  2K7S A;  3UB5 P;  1XGJ A;  1K0K A;  4YFM A;  3FPV A;  2IWB A;  3C38 A;  1NWZ A;  4BL3 A;  3E4Q A;  3IHA A;  4U3T A;  4L9F A;  5CGS A;  5FQJ A;  3LIF A;  5HAI A;  3LIA A;  1G68 A;  2W27 A;  3HUN A;  3VSK A;  2ACG A;  2KX6 A;  2XQZ A;  2QPN A;  3OPH A;  1P9W A;  2XD5 A;  5GLD A;  2A24 A;  2WKP A;  4KZ5 A;  2LB9 A;  1RCJ A;  2P08 A;  1OME A;  4UHU A;  1ZKJ A;  4NXF A;  3UE6 A;  4S2O A;  4PM5 A;  1L0E A;  1PI5 A;  2PAV P;  4OPQ A;  4MLL A;  1NJ4 A;  3DWZ A;  2X01 A;  1TDG A;  3IWI A;  1FSY A;  2VV8 A;  4M3K A;  2V1B A;  2J80 A;  5KSH A;  4GZB A;  4EER A;  2PR6 A;  3ZVW A;  1K4E A;  2VKS A;  1RGZ A;  1SZV A;  1EI5 A;  3ULF A;  3C30 A;  3V5M A;  1VET B;  1T18 A;  3G30 A;  3OPR A;  4R23 A;  3E4P A;  5EPH A;  5EV0 A;  4PM6 A;  4O0P A;  3VOY A;  4KG2 A;  4HI4 A;  1LSX A;  3FPW A;  3PXP A;  3LUQ A;  3C4O A;  3T4O A;  1ZC2 A;  3D3O A;  5M1A A;  3LFV A;  4PM7 A;  2JE5 A;  2PDR A;  2XR0 A;  2V0U A;  3D4F A;  1ESU A;  4NXG A;  4CLC D;  3MZF A;  4LV0 A;  4PM8 A;  3O3V A;  5HZH A;  3FV7 A;  5A8B A;  1IEM A;  4RX3 A;  4JXS A;  3OBF A;  3LID A;  2XA7 M;  2XFT A;  2JKT M;  3OPP A;  3PHY A;  5L09 A;  1AXB A;  2C6W B;  4ZTK A;  4WBG A;  3HBR A;  1YSP A;  2ZBB A;  4F3L A;  4R3J A;  5G4Y A;  3VP4 A;  3ZQ5 A;  4QWO A;  3FKW A;  1PIO A;  3V50 A;  2EWW A;  4GJ4 A;  1X0O A;  1K38 A;  2O9B A;  2HDQ A;  3N7W A;  1OJ5 A;  3QP4 A;  4I3J A;  1KVL A;  4OP5 A;  2PBD P;  3VFF A;  4Y2F A;  4E3J A;  1ONG A;  4IUH A;  3V39 A;  1BLH A;  1NYY A;  4CLC A;  1PZO A;  3GV9 A;  3RXX A;  3VOZ A;  3HRE A;  3T1Q B;  3TJZ C;  4OQI A;  1TS6 A;  1NLY A;  5HL6 A;  3NC8 A;  4BQM A;  4LRY C;  1ERQ A;  2B95 A;  1S4S A;  3E0Y A;  3NOP C;  4XUZ A;  4I3A A;  2RL3 A;  2CC1 A;  1XA1 A;  1ERO A;  3CPT B;  3G4P A;  3MZE A;  4BEN A;  4CJN A;  4MN6 A;  4JXV A;  3Q7V B;  2FH5 A;  2XGN A;  3ICY A;  1DJB A;  2GZA A;  5FQQ A;  1LSW A;  3NEC A;  3BYD A;  1WYB A;  1TVF A;  3NOU C;  3S7Q A;  3IBJ A;  3P01 A;  2Y2O A;  2FFF B;  1UWN X;  4CQH A;  2W1T A;  3OC2 A;  1TF1 A;  4WZ4 A;  3MS6 A;  4R0Q A;  5FQI A;  4C3Q A;  1MWS A;  4HNB A;  2OSU A;  3CIT A;  2VJW A;  5HD5 A;  3R7W A;  5FQ9 A;  1Q2Q A;  4DDS A;  3CLO A;  1PFL A;  1H8Z A;  4IBR A;  2VX8 A;  4X69 A;  3FG8 A;  3VOL A;  1OTE A;  4Q0H A;  3IXB A;  4FTX A;  1G6O A;  5EEC A;  2NUT C;  4G3V A;  1PNE A;  1TEM A;  2Q9M A;  5KIZ A;  2DMW A;  4E3K A;  1YKD A;  3B33 A;  3BY9 A;  5DTS A;  1KDW A;  2XH9 A;  4JF4 A;  5I94 A;  3MBZ A;  3MMH A;  1WYC A;  4FCF A;  3MSH A;  4X55 A;  2O9C A;  4GCZ A;  3M2J A;  1UGU A;  2H0Y A;  4ZDX A;  2Y2J A;  2HGV A;  2YKH A;  1JTD A;  4AFI A;  2H28 A;  2BLS A;  1YLP A;  3IX4 A;  4Q0I A;  4HES A;  1KGE A;  2EX2 A;  5TBM B;  5GHY A;  1K25 A;  3B42 A;  3PBQ A;  3UE1 A;  2OLV A;  4QJG A;  5IT5 A;  1PW8 A;  1BLS A;  4KQR A;  2Y2G A;  3ITB A;  1HZO A;  5DKL A;  3ZVT A;  3GSG A;  4WF0 A;  4JXG A;  1VEU B;  1XKZ A;  1PZP A;  3OZH A;  2OAP 1;  3ITA A;  3T4J A;  1W63 Q;  4E3M A;  2K2N A;  4GLQ A;  4QD4 A;  3LI9 A;  1BTL A;  3SS3 A;  3H7W A;  2H10 A;  4JGP A;  1ERM A;  1VHM A;  3SOI A;  4QPR A;  3T12 B;  3C2W A;  1NRF A;  4B4Z A;  2Y59 A;  4ZJ1 A;  4FD8 A;  4XT2 A;  2LB5 A;  4DE1 A;  5HPF A;  3LR0 A;  4MBK A;  2RCX A;  4NXB A;  1VEU A;  2EX9 A;  2JKG A;  3HVF A;  3P7N A;  1S4R A;  3NJA A;  1GSX A;  4BBV A;  5HW3 A;  1STZ A;  4DKI A;  3MKE A;  1F5M A;  3BQ8 A;  1W7F A;  3LR4 A;  1IYP A;  4KZ3 A;  4WZ5 C;  2V2F F;  5HWV A;  1W63 M;  5J4E A;  4IVI A;  4Y0O A;  3T1R A;  3MQO A;  5KSC A;  5GLC A;  3PAE A;  4BD0 A;  3PBN A;  3QP2 A;  4R6L A;  5F1F A;  4R3B A;  4NK3 A;  4GHI B;  1BLP A;  3F1P A;  3UE0 A;  4MBF A;  2WGV A;  2OLU A;  3WS2 A;  1N9B A;  4N1H A;  3AGF A;  1GCE A;  3ZG8 B;  4OQG A;  3M6H A;  4Y5F A;  3TSG A;  1EW0 A;  1P97 A;  2A49 A;  1SKF A;  3AGD A;  3UY6 A;  3CZD A;  4ZBE A;  4NEE D;  4JKT A;  2CMN A;  2PRF A;  3EEA A;  1GSV A;  3BEB A;  2A2L A;  1L0G A;  3F1N B;  2WGW A;  4DE3 A;  4K08 A;  3P98 A;  2W0N A;  2VLG A;  2XRN A;  3VV4 A;  1YLJ A;  3O87 A;  5GLA A;  3IH9 A;  2BTF P;  3ZG7 B;  4BBT A;  1FIL A;  2VA0 A;  4C75 A;  1CI9 A;  1IYS A;  1CF0 A;  5FDS A;  3IS2 B;  5FA7 A;  3CMZ A;  1NZU A;  5HDS A;  3IWQ A;  3S1Y A;  1L2S A;  4QU3 A;  4OKP A;  2BAS A;  1NXY A;  3N4I A;  5A93 A;  5L10 A;  1YLT A;  3T4K A;  3EQU A;  1S1Y A;  4KQO A;  5CED A;  3KX0 X;  4HEF A;  3UNW A;  3WS0 A;  4L9G A;  2XK1 A;  2YKF A;  4Y7P A;  2G2U A;  2X71 A;  3BJN A;  2WAD A;  3UMD A;  4KZ8 A;  4JF6 A;  5M18 A;  1K56 D;  1E3U D;  4IBX A;  3ZDJ A;  3A3D A;  4ARZ A;  5K5B A;  3DTK A;  2EFU A;  4Q8I A;  2VZW A;  1CJF A;  5CHM A;  2V8F A;  3OOV A;  1XJ3 A;  1GSW A;  4MEZ A;  3BEC A;  5HWW A;  4S2N C;  4G3K A;  3HLB A;  3G2Y A;  2KDK A;  2O0Y A;  3T1X A;  5J7E A;  3CJM A;  2XSS A;  5FEF A;  2PHY A;  2ZC4 B;  4LRZ E;  3VE4 A;  1OT6 A;  1BUE A;  3RJU A;  1K56 A;  4CPK A;  3S4X A;  1E3U A;  1IKG A;  5F82 A;  4BLM A;  1C3B A;  2GJ3 A;  3MF0 A;  4WZ5 A;  4KG6 A;  1E4D A;  3FKV A;  3NDG A;  1H8Y A;  4UAA A;  1T1B A;  4OPY A;  3MXQ A;  3HLE A;  4X6T A;  4PHT A;  1Y28 A;  2ZOH A;  3NI9 A;  5TGF A;  4LV3 A;  3NOT C;  1FIK A;  3UME A;  3BFD A;  4OPZ A;  3HUO A;  3CG5 A;  1J9M A;  4II7 A;  2J9P A;  5AJG A;  5KZH A;  5DJT A;  4X1L A;  3IT9 A;  2A24 B;  5HPI A;  1SCW A;  2WAE A;  4Y13 A;  1FCM A;  4CLC C;  5EOO A;  1BUL A;  2PD7 A;  1CEF A;  3GMW A;  1PWG A;  3TOI A;  3TW8 A;  3VP1 A;  3AGE A;  4EQI A;  1MY8 A;  2QJ5 A;  3BW6 A;  3UDX A;  1Y4O A;  2ZQC A;  5FQK A;  2ZM2 A;  3UDI A;  4CLC E;  1F9I A;  3WRZ A;  4H8R A;  1FCO A;  3BFG A;  3GRJ A;  3QNB A;  5AQA A;  2JC7 A;  3LGO A;  2ZQA A;  4IJG A;  4K91 A;  4O7D A;  4E3L A;  1DP8 A;  1VB6 A;  3UPP A;  3QNC A;  2INW A;  5CX7 A;  3ZFZ A;  5F69 A;  3KYQ A;  3WS4 A;  4Q0J A;  2B02 A;  2XA7 S;  3MJQ A;  4GB7 A;  2B5R A;  5HD3 A;  3E4O A;  3SH8 A;  4JGR A;  3LYX A;  1ONH A;  3KSI A;  1BYW A;  3M6B A;  1W8Y A;  4WEJ A;  4KZ7 A;  1DJA A;  4KZ9 A;  3S7O A;  1SDN A;  5E43 A;  3NY4 A;  3HLF A;  1JNU A;  5HDC A;  4F3L B;  3A3I A;  3LEZ A;  4S2N A;  5DF7 A;  4UA7 A;  4PM9 A;  4X56 A;  4N9K A;  4HP9 A;  1OTD A;  1JTG A;  1XPB A;  4WLA A;  4Y0U A;  2PR5 A;  1K54 A;  1K55 C;  1T1A A;  4QB8 A;  2H0T A;  2IWD A;  3EOI A;  1N9O A;  3MQ0 A;  4I5S A;  4Z1W A;  1TS8 A;  4CLC B;  1E25 A;  1Z09 A;  5FAS A;  2QMI A;  4Y3I A;  2XEP A;  5EFW A;  3QP1 A;  2WUQ A;  3KO6 A;  3Q81 A;  2XFS A;  3FZC A;  4IVK A;  4GOG A;  4N92 A;  4WMC D;  4P6B A;  3C5A A;  4UA9 A;  5CRF A;  2W3D A;  2JKR I;  1S0W A;  5EVI D;  3KSH A;  3ZNY A;  4HIA A;  3U2A A;  3A0S A;  3W4P A;  4YIN A;  3OLO A;  3G2Z A;  5TJJ A;  4GN2 A;  2M1C A;  1OTI A;  4GKU A;  4ETX A;  4L0L A;  1N9N A;  1K6R A;  2QYB A;  2D01 A;  4HOI A;  4RA7 A;  3V3S A;  2W1T B;  3UB7 A;  4LEN A;  4OH0 A;  2Z6C A;  1ES2 A;  2I72 A;  1LL8 A;  1ZHH B;  2ZMV A;  3R7W B;  4M4X A;  1YT4 A;  4GD6 A;  3EEH A;  2QHK A;  1GHM A;  2E8J A;  5EVI A;  1XGI A;  1FSW A;  1YLW A;  1RGY A;  2WKE A;  4I3I A;  4LPZ A;  2M7U A;  4LFU A;  4EU0 A;  3S7N A;  2HJE A;  4U0T A;  3BLM A;  1MKM A;  1SKO A;  1JWZ A;  3G34 A;  4DE2 A;  5F68 A;  1DY6 A;  1PYY A;  3V67 A;  3JYI A;  2X02 A;  3JVV A;  3LR3 A;  1A0K A;  4MMN A;  1TD5 A;  3QP8 A;  5J8X A;  1L3L A;  4B9O A;  3EGX C;  1DJC A;  4X25 A;  2V20 A;  2QJ7 A;  2WZX A;  3IF6 C;  1TS0 A;  1I2S A;  1DP6 A;  2ZL1 A;  3O86 A;  3N6I A;  3GEC A;  1LLB A;  1PW1 A;  4LV2 A;  1HLU P;  3E2K A;  4EW7 A;  3DTI A;  2HDR A;  3RTY A;  5AQB A;  4OLG A;  2WZZ A;  4RX2 A;  4KZ4 A;  1FQG A;  3WS5 A;  1VQQ A;  3LIB A;  2VGL S;  3A0R A;  4UA6 A;  4KUO A;  3NIA A;  3Q82 A;  3E98 A;  2PU4 A;  2JKF A;  3EQV A;  1QMF A;  2ZQD A;  2AVX A;  1S6R A;  4EUV A;  3DAV A;  3LIC A;  4OOY A;  2PBY A;  4WEK A;  1XFN A;  2VGJ A;  4P85 A;  3LCE A;  4GD8 A;  1KOU A;  3H7W B;  4LLO B;  4BL2 A;  5E2F A;  3PBT A;  2GNX A;  3UB8 A;  3IH8 A;  1SHV A;  1K55 A;  2Y2K A;  3C8C A;  1U60 A;  3L7H A;  3A3J A;  1KGF A;  4R4R A;  4XT2 B;  5HWT A;  4DXB A;  4JGQ A;  2DRW A;  3UB9 A;  3ZG0 A;  4E3I A;  3CI6 A;  5FSR A;  4PAU A;  3QHY A;  1YPR A;  5E2G A;  4EEU A;  3N8L A;  4JPM A;  3V3R A;  4WEL A;  3T1S A;  1YAX A;  1IYQ A;  3TE8 A;  4R38 A;  1K4F A;  3N8R A;  1CQA A;  1ALQ A;  5FQM A;  3F1P B;  1IKI A;  3IWO A;  1MBL A;  4H6J A;  1NLZ A;  4OON A;  3MZD A;  4EET B;  3H82 A;  3A0V A;  2JBF A;  3VE3 A;  5FAP A;  4P6Z M;  5FDH A;  2G2W A;  1WE4 A;  3CWF A;  3VMA A;  1DRM A;  4YWZ A;  4LCL A;  4LGW A;  1T1C A;  4DE0 A;  2V0W A;  1FOF A;  5DTT A;  2Z2L B;  4GDN A;  2JKR M;  4JLF A;  3OCN A;  5LBR A;  3UDF A;  3IXG A;  2D02 A;  2WGW B;  3ZGA B;  5GLB A;  3T4L A;  5L8M A;  3P09 A;  1UWP X;  3CUE C;  3W8K A;  1XX2 A;  3BY8 A;  1KVM A;  3SS4 A;  3D72 A;  1LL5 A;  5F6A A;  4MDZ A;  4RVA A;  1ESI A;  3RFB A;  2P9V A;  3LR5 A;  4S2M A;  3LI8 A;  2G7U A;  3IF6 A;  3CAX A;  1O7E A;  2Y2L A;  1LT0 A;  5DVA A;  1ACF A;  2XLN A;  3MKF A;  5M19 A;  3HLW A;  5FAQ A;  5HFO A;  4XXR A;  2R9W A;  2O9A A;  4EBP A;  2J3W A;  2UWX A;  2Y2I A;  4S2K A;  3JPU A;  4OQ0 A;  1NZO A;  4PKY G;  1WA9 A;  2J3T D;  4ARZ B;  3GTC A;  2QKP A;  3A3E A;  1N9L A;  3BQA A;  1YSQ A;  5DKK A;  2Q9N A;  3EWK A;  3TRC A;  1DP9 A;  4OOL A;  1XA7 A;  1CK3 A;  4NKP A;  1F2K A;  3EGD C;  1GA9 A;  2Y2H A;  4R70 A;  3SZT A;  4EV4 A;  3W4O A;  4KZA A;  2V8C A;  2W3E A;  2XRO A;  1ZG6 A;  2PT7 A;  3OPL A;  2EA9 A;  4P0M A;  4KEN B;  1YLZ A;  5F83 A;  4Y17 A;  2IA2 A;  2EX8 A;  1Z6F A;  2JKT I;  2WYX A;  5DF8 A;  3QP5 A;  3SW1 A;  2Y2N A;  4NG2 A;  3IF5 A;  1K57 C;  4S2P A;  3T4Q A;  1IYO A;  2VEA A;  2L4R A;  3LO7 A;  2KLI A;  2HZ5 A;  3WS1 A;  1K54 C;  1SDE A;  2ZJ9 A;  3FWL A;  4RYE A;  4DN0 A;  2EX6 A;  2HF6 A;  5EOE A;  3PAG A;  5JYO A;  3DBA A;  1MZU A;  2FFY A;  3UPN A;  1VM1 A;  3F1O A;  1GHP A;  2XD1 A;  1PWC A;  4WUJ A;  1W5D A;  3PBO A;  3BWL A;  5EVE A;  3I7J A;  2KOI A;  4OLD A;  5IU1 A;  2L1M A;  5FI2 A;  4YNR A;  2WGI A;  1IEL A;  2WKR A;  4X68 A;  5CEB A;  4PPR A;  4DJ3 A;  4Z9Q A;  3CUE A;  1XJ6 A;  2K31 A;  5G4Z A;  3SH7 A;  4GW9 A;  4FSF A;  3B3X A;  5HDD A;  4EUZ A;  1LI0 A;  1KDS A;  2Q0O A;  4FH2 A;  1S66 L;  4O8G A;  1XJ2 A;  4HBU A;  1NYM A;  1H8M A;  4EEP A;  3BRM A;  4B93 A;  5F5Y A;  4YOF A;  5EVI C;  2WAF A;  1ZTU A;  3Q1F A;  2L0W A;  3C4P A;  4Y15 A;  4EQ1 A;  2P74 A;  4ZRR A;  2I9V A;  4HJ3 A;  4GS9 A;  3IQA A;  2PD8 A;  5CHU A;  1QME A;  5IHV A;  4X53 A;  3BFC A;  4UQI M;  3PBR A;  3JVU A;  4HBT A;  4R4S A;  3K3D A;  1S1Z A;  3VSL A;  1IOU A;  2OAQ 1;  2HDS A;  1M6K A;  2EFX A;  3VP3 A;  2ZM0 A;  5D3O A;  4OQH A;  2O99 A;  4WL9 A;  4S2J A;  2Y2M A;  3UO9 A;  3BFF A;  5EE8 A;  2FZ0 A;  4KG5 A;  3DTE A;  2PYP A;  4F94 A;  2GDN A;  5FL3 A;  4QHC A;  1LI9 A;  2V9A A;  4E3O A;  1H5X A;  3GDI A;  1GHI A;  3IBR A;  5DTK A;  2J8Y A;  3RH8 B;  1I5Q A;  1T19 A;  2J7V A;  2BG1 A;  3G32 A;  5IS1 A;  3UN7 A;  4MCW A;  4JGO A;  2XDM A;  3SS5 A;  2ZOI A;  2R9X A;  1K57 A;  4O01 A;  3KYE A;  2Y55 A;  4JXW A;  4BD1 A;  1I2W A;  1V9Z A;  1FR6 A;  4DF6 A;  3R4K A;  1BZA A;  5CTM A;  4LV1 A;  1XJ4 A;  5GHZ A;  1KE3 A;  2OOL A;  1ZG4 A;  3PR6 A;  5DJU A;  3U4L P;  1TS7 A;  2Z6D A;  1N4O A;  1W8Q A;  1D7E A;  5G18 A;  1VET A;  4OPR A;  3SH9 A;  1G5U A;  3HLG A;  4HJ6 A;  5CHJ A;  3CHW P;  2QWS A;  5CEC A;  3TG9 A;  3WWX A;  5FEG A;  2Y4A A;  2Y91 A;  5EVI B;  5L07 A;  1EWZ A;  4S2L A;  3A3F A;  1NY0 A;  1SKO B;  1ES5 A;  2OV5 A;  2ZC6 B;  3LY3 A;  3G6O A;  1OPX A;  4DDY A;  4WN5 A;  1BLC A;  4KUK A;  3G31 A;  3IX3 A;  1L0F A;  1HD8 A;  4B4X A;  3HUM A;  2XF3 A;  4WMC A;  2WKH A;  3C7U A;  1G6A A;  1YM1 A;  1D06 A;  4EBL A;  3NDE A;  3FYZ A;  2EWV A;  2ZL1 B;  1OTB A;  1KE0 A;  2ZQ8 A;  1V9Y A;  4LCM A;  1J3W A;  4ZJ2 A;  4D60 A;  1XXM A;  4FH4 A;  3O5Y A;  3MFD A;  4DXC A;  3WRT A;  4MBH A;  4E6W A;  2HP5 A;  4ZAM A;  1ODV A;  4A5R A;  4U0X A;  4ZJ3 A;  2VV6 A;  3T4T A;  2VK3 A;  3LY4 A;  5DFY A;  2JN7 A;  4GDB A;  2VV7 A;  3Q7Z A;  2ZD8 A;  3GR2 A;  4LRX C;  3MR0 A;  3ZYT A;  3PYP A;  4I39 A; 
#chains in the Genus database with same CATH homology
 3T4L A;  5L8M A;  2GX5 A;  1UWP X;  3CUE C;  4MN7 A;  4O0P A;  3BY8 A;  4HI4 A;  2GJ3 A;  3MF0 A;  1LSX A;  3D72 A;  3KSF A;  2W3F A;  3FPW A;  3PXP A;  5F6A A;  3LUQ A;  4MDZ A;  3T4O A;  3D3O A;  3RFB A;  3LR5 A;  1T1B A;  2R78 A;  3LFV A;  3LI8 A;  2PDR A;  2G7U A;  3MXQ A;  2P7J A;  3KSG A;  5AVE A;  2V0U A;  3CAX A;  4PHT A;  1Y28 A;  2HJ9 C;  2ZOH A;  4HY8 A;  4ME4 A;  3NOT C;  1OTA A;  1IFQ A;  3K3C A;  3UME A;  1LT0 A;  4NXG A;  4CLC D;  4II7 A;  1P9R A;  5AJG A;  4R3A A;  5HZH A;  5A8B A;  5DJT A;  3OBF A;  3LID A;  2XA7 M;  2JKT M;  2A24 B;  3PHY A;  5HPI A;  4P6Z S;  4CLC C;  1YSP A;  2O9A A;  2J3W A;  2ZBB A;  4F3L A;  2P04 A;  5G4Y A;  3MQQ A;  3ZQ5 A;  4PKY G;  2EWW A;  2PD7 A;  2Y8H A;  1MC0 A;  2V1A A;  1WA9 A;  4GJ4 A;  1X0O A;  2J3T D;  4ARZ B;  2QKP A;  1N9L A;  3BQA A;  5DF9 A;  1YSQ A;  3TW8 A;  2O9B A;  4DMZ A;  5DKK A;  3EWK A;  3TRC A;  1OJ5 A;  1DP9 A;  4OOL A;  4I38 A;  4I3J A;  4H6J B;  2J3T C;  4NKP A;  2QJ5 A;  3BW6 A;  3EGD C;  3H82 B;  4Y2F A;  4IUH A;  4CLC E;  4CLC A;  3T4S A;  4R70 A;  1F9I A;  4MN5 A;  2W3E A;  5J3W A;  1OJG A;  4E04 A;  4IJG A;  3TJZ C;  4BMW A;  2XRO A;  1TS6 A;  1NLY A;  5HL6 A;  2PT7 A;  2ZMF A;  4ETZ A;  1DP8 A;  1VB6 A;  2EA9 A;  5TBM A;  4LRY C;  1S4S A;  3E0Y A;  3NOP C;  2INW A;  5CX7 A;  4I3A A;  5F69 A;  3KYQ A;  2IA2 A;  3T50 A;  2VGL M;  4MN6 A;  4Q0J A;  2FH5 A;  2B02 A;  2XA7 S;  2JKT I;  3MJQ A;  3ICY A;  2PYR A;  4UEY A;  5HD3 A;  2GZA A;  1LSW A;  3SW1 A;  3E4O A;  5MC7 A;  3NOU C;  4JGR A;  3S7Q A;  3IBJ A;  3HCY A;  3LYX A;  3T4Q A;  3P01 A;  3KSI A;  1UWN X;  3HJK A;  1BYW A;  4CQH A;  2W1T A;  2VEA A;  3OC2 A;  4WEJ A;  2B18 A;  1TF1 A;  2L4R A;  2KLI A;  3S7O A;  4HNB A;  3W2Z A;  3CIT A;  2VJW A;  4KQD A;  4HHD A;  5HD5 A;  4HJ4 A;  3R7W A;  3CLO A;  2W3H A;  1JNU A;  4DN0 A;  2VX8 A;  2HF6 A;  3FG8 A;  5HDC A;  1OTE A;  3VOL A;  3B47 A;  4Q0H A;  2MJ6 A;  5I5L A;  4EXO A;  3K2N A;  3DBA A;  1MZU A;  4F3L B;  2M7V A;  3F1O A;  1G6O A;  2NUT C;  4G3V A;  4WUJ A;  5KIZ A;  3PBO A;  3BWL A;  2DMW A;  1YKD A;  2KOI A;  5IU1 A;  2L1M A;  3B33 A;  3BY9 A;  3NHQ A;  4YNR A;  4HP9 A;  3MMH A;  2WKR A;  1OTD A;  4WLA A;  2PR5 A;  3H9W A;  4DJ3 A;  1NRJ A;  3CUE A;  1T1A A;  2O9C A;  1XJ6 A;  2K31 A;  4I5S A;  3MQ0 A;  3EOI A;  1N9O A;  4GCZ A;  5G4Z A;  4Z1W A;  1TS8 A;  4CLC B;  4GW9 A;  1UGU A;  4FSF A;  5HDD A;  4Y3I A;  4BWI A;  2HGV A;  2YKH A;  5EFW A;  3S7P A;  2H28 A;  3KO6 A;  1H3Q A;  4AFI A;  4EES A;  4GHI A;  4Q0I A;  4L9E A;  2W3D A;  2JKR I;  5TBM B;  3KSH A;  3B42 A;  3PBQ A;  1S66 L;  4O8G A;  1XJ2 A;  4HIA A;  3U2A A;  5IT5 A;  1H8M A;  1LSV A;  3A0S A;  4EEP A;  4B93 A;  5F5Y A;  2NUP C;  3OLO A;  4YOF A;  5TJJ A;  5DKL A;  1ZTU A;  4WF0 A;  1OT9 A;  1OTI A;  2L0W A;  2M1C A;  2OWH A;  4EQ1 A;  4ETX A;  4IHQ A;  1N9N A;  4L0L A;  2QYB A;  4ZRR A;  2D01 A;  2I9V A;  4HJ3 A;  4HOI A;  4GS9 A;  2OAP 1;  2PD8 A;  2W1T B;  3UB7 A;  3T4J A;  1F98 A;  1W63 Q;  2K2N A;  3F1N A;  2Z6C A;  4HP4 A;  4GLQ A;  3HJI A;  4UQI M;  3LI9 A;  3PBR A;  3JVU A;  1LL8 A;  3K3D A;  1S1Z A;  1IOU A;  1ZHH B;  3H7W A;  2ZMV A;  2OAQ 1;  3UB6 A;  2WKQ A;  3R7W B;  4M4X A;  4JGP A;  3EEH A;  1VHM A;  2QHK A;  4QPR A;  3C2W A;  3IS2 A;  3PBS A;  2W1R A;  4G3W A;  2O99 A;  4WL9 A;  4XT2 A;  2LB5 A;  4I3I A;  4LPZ A;  4DJ2 A;  2M7U A;  4EU0 A;  5HPF A;  3LR0 A;  3S7N A;  3F1O B;  4NXB A;  2HJE A;  3P7N A;  2JHE A;  2FZ0 A;  4IUK A;  1MKM A;  1S4R A;  1S67 L;  3NJA A;  1GSX A;  2PYP A;  4BBV A;  1STZ A;  3MFX A;  5FL3 A;  5F68 A;  4HH3 A;  4RQ9 A;  5DFX A;  3V67 A;  2V9A A;  1F5M A;  3BQ8 A;  3JVV A;  3LR4 A;  3LR3 A;  4MMN A;  3GDI A;  1TD5 A;  3IBR A;  4B9O A;  3EGX C;  5HWV A;  1W63 M;  4NXE A;  3RH8 B;  5J4E A;  1T19 A;  2QJ7 A;  1TS0 A;  3MQO A;  1DP6 A;  5HSQ A;  3PBN A;  5IS1 A;  4MCW A;  4JGO A;  4R6L A;  1XFQ A;  2ZOI A;  3GEC A;  4HH2 A;  4O01 A;  1G28 A;  3FC7 A;  4PKY A;  4GHI B;  2W3G A;  3F1P A;  4OOM A;  3KYZ A;  4EW7 A;  4UQI S;  1V9Z A;  3RTY A;  4HQA A;  1P0Z A;  3R4K A;  1XJ4 A;  4Y5F A;  3LIB A;  1EW0 A;  4BBU A;  1P97 A;  2VGL S;  3A0R A;  2OOL A;  5AVF A;  4KUO A;  3PR6 A;  5DJU A;  3E98 A;  3OCL A;  1TS7 A;  2HV1 A;  2Z6D A;  3LIE A;  4NEE D;  3EQV A;  2CMN A;  1D7E A;  5C5K A;  3EEA A;  4GS9 B;  1GSV A;  4EUV A;  3LIC A;  2A2L A;  4WEK A;  2OWJ A;  3F1N B;  1XFN A;  3UE3 A;  4HJ6 A;  4K08 A;  2W0N A;  1KOU A;  2VLG A;  3H7W B;  2QWS A;  2XRN A;  3VV4 A;  4LLO B;  3PBT A;  4FOF A;  2GNX A;  4BBT A;  2Y79 A;  2VA0 A;  3UB8 A;  4BJP A;  3C8C A;  3IS2 B;  2K7S A;  4XT2 B;  5HWT A;  4JGQ A;  3FPV A;  3C38 A;  1NWZ A;  5HDS A;  3E4Q A;  3UB9 A;  2BAS A;  4L9F A;  3LIF A;  3G6O A;  1OPX A;  3LIA A;  3CI6 A;  2W27 A;  4PAU A;  4WN5 A;  2KX6 A;  4EEU A;  3T4K A;  1P9W A;  4KUK A;  3EQU A;  1S1Y A;  4KQO A;  3KX0 X;  4WEL A;  2A24 A;  4L9G A;  2WKP A;  2YKF A;  2LB9 A;  2P08 A;  3BJN A;  3UMD A;  1YAX A;  1D06 A;  3TE8 A;  4R38 A;  2EWV A;  4NXF A;  3UE6 A;  1OTB A;  1V9Y A;  4ARZ A;  5K5B A;  3F1P B;  3O5Y A;  2VZW A;  3OOV A;  4H6J A;  1XJ3 A;  2VV8 A;  1GSW A;  1NLZ A;  1ODV A;  4EET B;  2V1B A;  2J80 A;  5KSH A;  3H82 A;  3A0V A;  3VE3 A;  4EER A;  2VV6 A;  2PR6 A;  3T4T A;  4P6Z M;  5HWW A;  3CWF A;  1DRM A;  4YWZ A;  4G3K A;  5DFY A;  2JN7 A;  2KDK A;  2O0Y A;  2VKS A;  1T1C A;  5J7E A;  2V0W A;  2VV7 A;  2XSS A;  3ULF A;  3C30 A;  4LRX C;  2PHY A;  4LRZ E;  3VE4 A;  1T18 A;  2JKR M;  3MR0 A;  3OCN A;  1OT6 A;  3ZYT A;  3PYP A;  3E4P A;  5LBR A;  2D02 A;  4I39 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...