4IEDA

Crystal structure of fus-1 (oxa-85), a class d beta-lactamase from fusobacterium nucleatum subsp. polymorphum
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
242
structure length
241
Chain Sequence
NENQFMKEIFERKGLNGTFVVYDLKNDKIDYYNLDRANERFYPASSFIFNTLIGLENGIVKNVDEMFYYYDGSKVFLDSWAKDSNLRYAIKVSQVPAYKKLARELGKERMQEGLNKLNYGNKEIGSEIDKFWLEGPLKISAMEQVKLLNLLSQSKLPFKLENQEQVKDITILEKKDDFILHGKTGWATDNIVVPIGWFVGWIETSDNIYSFAINLDISDSKFLPKREEIVREYFKNINVIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Class D beta-lactamase
publication title Crystal Structure of FUS-1 (OXA-85), a Class D beta-lactamase from Fusobacterium nucleatum subsp. polymorphum
rcsb
source organism Fusobacterium nucleatum subsp. polymorphum
molecule tags Hydrolase
total genus 84
structure length 241
sequence length 242
chains with identical sequence B, C, D
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2012-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4iedA00
4OQIA 5EE8A 5HAIA 4GKUA 4L0LA 5F1FA 1WE4A 3MKFA 2Y91A 3BFGA 2DCFA 3A3EA 3CMZA 3NIAA 1W7FA 3EQVA 4DDYA 3G30A 2Y2PA 2ZJ9A 4GN2A 4GDBA 5CGSA 4KENB 5M19A 1OMEA 5FSRA 4OP5A 2GDNA 4NETA 4C6YA 3IF5A 4KZ9A 4PPRA 3IHBA 2ZMAA 2XQZA 1GHMA 2Y59A 5E2HA 3UPNA 4WZ4A 1EWZA 1XXMA 3P98A 5JYOA 4OQHA 4DDSA 4DXCA 1HVBA 3IWIA 1YLTA 4QY5A 4R3JA 4DE0A 3GR2A 4CPKA 5CTNA 4JF4A 3HVFA 1Y54A 3HUNA 4JXWA 1K25A 5EOOA 2XEPA 3ITBA 4WBGA 1G68A 2Y2OA 3IF6A 3PBTA 3Q82A 5TFQA 1O7EA 5EVID 5I94A 5KSHA 1IYQA 1K54C 4KQRA 4K0WA 3ZNYA 3GV9A 4K0XA 3UE0A 3VMAA 2Y2IA 3BFEA 4OKPA 2WAEA 5HAQA 3SH8A 4LV1A 3QNBA 5DTTA 2Y55A 1E25A 4F94A 5HFOA 1BSGA 1FR6A 3LEZA 2Y2LA 5DF9A 1YLJA 4FCFA 3PBSA 2WKEA 5FQMA 2H5SA 4LV3A 4P85A 2XDMA 4IEDA 1PWGA 5AQ9A 3ZNTA 5DF8A 3UPOA 2QMIA 4X55A 4KG5A 3GTCA 5A93A 4EQIA 1SCWA 1FSWA 1WYCA 2EX9A 1LHYA 1IYSA 3PBRA 3HREA 1NJ4A 5CGXA 5FA7A 1DJCA 5GLCA 2WADA 1K55A 1XA7A 4S2MA 3G32A 5FQJA 4KZ3A 1K4EA 4JXVA 3SH9A 4DE2A 4S2PA 3QHYA 1RCJA 1K4FA 3IXGA 4RX3A 1YLPA 5FASA 1L2SA 1E4DA 3FWLA 4WM9A 3OPHA 3UDFA 4JKTA 1KE0A 2XF3A 3BRMA 4OOLA 1BTLA 2B5RA 1YQSA 3N6IA 4ZDXA 1ZG6A 1JTGA 4KG2A 4U3TA 3B3XA 2J9PA 2XGNA 3OCLA 3VP0A 3G2YA 3UNWA 5CEBA 4B4XA 3GMWA 3FKVA 4R0QA 1HTZA 1YLYA 4E3OA 4KQQA 4WMCD 1LL9A 1KDWA 2CC1A 4QB8A 2Y2GA 3HLCA 3GSGA 4OQGA 4ZTKA 2PBYA 4ID4A 5EUAA 4EUZA 3IT9A 3ZG7B 3OPLA 1K6RA 1LI9A 3MXRA 3O86A 4IBXA 4N9KA 3IH8A 2ZC5B 4Y0UA 1TEMA 3C7UA 1H8ZA 3ZG8B 4E3MA 1NRFA 4QJGA 5KZHA 2R9WA 1CEGA 3WRTA 2E8IA 4S2KA 2V2FF 1MWSA 4WEKA 5U47A 3EQUA 4OLGA 3G4PA 2BLSA 3M2JA 4XXRA 5GLDA 2P9VB 4R1GA 4BENA 1JWVA 1J9MA 3CJMA 4QY6A 5FI2A 2Z2MB 3MFDA 2ZLYA 3A3FA 1RGZA 1QMFA 4GDNA 1MKIA 3BFCA 3HLEA 3V3RA 1NYMA 2Y2JA 2HP9A 2XD1A 4UA9A 3SOIA 2DRWA 2Q9MA 2ZQ8A 4GOGA 3G31A 4JF5A 2A3UA 1NYYA 1MWTA 1PZOA 3O88A 5EPHA 4S2JA 2C5WB 4QHCA 1MXOA 1G6AA 4Y7PA 5HARA 1KE3A 2EX8A 1L0DA 3P09A 3FKWA 4S2LA 1GCEA 1ERQA 3HUOA 1MPLA 1GHIA 3IXDA 4ZAMA 4FD8A 3DTMA 4PMAA 3Q7ZA 3G2ZA 3UE1A 1I5QA 5M1AA 4IVIA 1K38A 2WKIA 2WGWB 2XFTA 3Q7VB 3BFFA 1U60A 5M18A 3IH9A 4WZ5A 1DJBA 5CGWA 1K6SA 2BG1A 3IF6C 1RP5A 1ES5A 1KGFA 3Q1FA 2ZQ9A 1PWCA 1N4OA 2Y4AA 4E6XA 1PWDA 3HLFA 4WEJA 1MBLA 5DF7A 1ES2A 3G34A 5AQBA 1JVJA 2XD5A 4LCMA 1H8YA 2I72A 3N7WA 3S1YA 5GHXA 4D2OA 5FAQA 1W79A 1HD8A 3NBLA 1IKIA 2Y2KA 1IEMA 2WGVA 5FAOA 5GLBA 2H0TA 3ISGA 4MEZA 2OLUA 2UWXA 1K57A 5E43A 1TVFA 1IYOA 3TG9A 3W4OA 1FCMA 3IXBA 5FQQA 3OCNA 1FQGA 4OONA 3JYIA 2X02A 4S2IA 3VP1A 3ZG5A 2X01A 3W8KA 4EWFA 3FV7A 3HUMA 4OPZA 5BOHA 3E2KA 3VP4A 1PYYA 4PM8A 2PU4A 4BL2A 3ZDJA 4KZAA 5HW3A 2EXBA 1K55C 4RYEA 4OOYA 3ZG9B 2G2UA 3BEBA 2QPNA 2H0YA 3VP2A 4BL3A 4EBPA 2FFYA 3BYDA 4HEFA 4BLMA 5HL1A 4UHUA 5CXWA 1KDSA 4R23A 3UO9A 4NK3A 4U0TA 4DE1A 2ZC7A 3IWQA 2ZM2A 2A49A 2Y2NA 2EX6A 2ZQ7A 4P87A 4DXBA 4K91A 2VGJA 2ZD8A 3N8SA 2HDSA 1JWZA 1Z6FA 4MNRA 1L0GA 2WGIA 2V20A 2DNSA 4LV0A 5A90A 1IELA 3S4XA 5EVIA 3HLGA 4Z9QA 4JLFA 4XUXA 3LCEA 3V39A 1WYBA 3E2LA 4PM7A 5HAPA 1PZPA 2OLVA 4M3KA 4RX2A 4E3JA 1K56D 1W5DA 2Q9NA 4R4SA 4BJPA 3FZCA 1ERMA 1JTDA 1L0FA 2JCHA 2VGKA 3LY4A 3M2KA 1NZUA 1MWRA 4ZJ3A 3W4QA 4FH4A 4LV2A 1NY0A 3DWZA 3IF6B 3RXWA 2J7VA 2X71A 3VOYA 4DE3A 4Q8IA 1GA0A 3HLWA 5A92A 4KZ5A 3HLDA 3TOIA 2FFFB 1DJAA 4MBKA 3AGEA 3NDEA 4XUZA 2Y2MA 1XPBA 3GQZA 5F1GA 3V50A 4OH0A 5CRFA 4MBFA 4N1XA 2H10A 2EXAA 5FAPA 5DTSA 3NDGA 4LCLA 2V1ZA 3OPPA 4BD0A 4X68A 3PAEA 3UE3A 5DTKA 4E3IA 5GL9A 2XH9A 3AGFA 2JC7A 1RGYA 3UN7A 1ES4A 3PTEA 4OPQA 3WS0A 1NZOA 2XFSA 1LLBA 2EFXA 2ZQDA 4JXGA 3UDIA 3VSKA 3ZCZA 4X53A 5L2FA 2HDUA 4KZBA 2J9OA 1AXBA 4E3LA 1H5XA 4WZ5C 5EVLA 1ESIA 5EECA 1CK3A 4WMCA 3N4IA 3S22A 4KZ4A 1CI8A 1GA9A 4KG6A 2OSUA 4P6BA 5GLAA 3MBZA 3AGDA 5J8XA 2HPBA 4X69A 4EBNA 2IWDA 1M40A 3ZHHA 2ZQCA 2WKHA 5KSCA 1W8QA 5CHJA 1BLPA 1EROA 1PI4A 4OLDA 3N8LA 3PBNA 1PIOA 4R4RA 4YFMA 5E2GA 2ZQAA 4IBRA 1MY8A 1NXYA 1FR1A 3QNCA 5G18A 2JE5A 4HBTA 4E3NA 1ES3A 2JBFA 3N8RA 3D4FA 1KVLA 2EFUA 2WAFA 2Y2HA 2R9XA 2RL3A 4GB7A 2ZM0A 5F83A 3DWKA 3MXSA 4C75A 3Q81A 5FDHA 1S6RA 1YMXA 1ZC2A 2C6WB 5F82A 3WRZA 3OZHA 2XK1A 4S2NA 1VQQA 3CG5A 3RJUA 2Y2QA 3C4OA 1BUEA 1E3UA 1PW8A 2HDRA 2WK0A 2WUQA 2ZC3B 3O87A 4GNUA 2G2WA 4OPYA 3VOZA 4OOMA 1SDNA 3LY3A 3ZG0A 3UY6A 1O07A 5CEDA 1BZAA 1BT5A 4JXSA 4N92A 1JWPA 4FSFA 4HBUA 4QU3A 3ZFZA 5EVIC 4JF6A 3WS2A 4KZ6A 4WELA 4KZ8A 2WZZA 3NI9A 1TDGA 4ZBEA 3VFHA 2XLNA 5FI6A 2IWBA 3ITAA 4GZBA 1S0WA 3OPRA 5FQIA 3SH7A 3VFFA 4BD1A 4OQ0A 4PM5A 1W8YA 3HBRA 4JPMA 4DKIA 1ALQA 2QZ6A 5HX9A 3C4PA 4BQMA 3NCKA 3NY4A 3CZDA 1KGGA 1SDEA 2HDQA 4ZJ2A 2PU2A 5CHUA 3WS1A 5AQ7A 1QMEA 3HL9A 3SS3A 4E3KA 1YT4A 1KVMA 4JBFA 1YLWA 1XGIA 5CHMA 3IHAA 3O3VA 1ZG4A 3BLSA 5E2EA 3SS4A 3IXHA 1CEFA 3PBQA 3BLMA 4MBHA 3A3JA 3IQAA 2HP5A 5GHYA 1HZOA 5CERA 1PW1A 5JYPA 1MWUA 1C3BA 2Z2LB 1L0EA 1I2WA 3FYZA 3OC2A 1BLSA 5TR7A 1ZKJA 4C3QA 4UA6A 2EX2A 1BLCA 5CECA 5DVAA 1BLHA 1Q2PA 3VSLA 2ZM8A 1ESUA 1EI5A 1K54A 3BFDA 2J8YA 3MZFA 3C7VA 1I2SA 2OV5A 4PM9A 3C5AA 4E6WA 3WS4A 2P9VA 3BM6A 4Y0TA 5CTMA 3MKEA 1FOFA 3WS5A 1IYPA 2XR0A 3BECA 4HESA 4X6TA 4OVDA 3GRJA 3HLBA 4OPRA 5TGFA 1FCNA 4FH2A 2WZXA 1XKZA 4DF6A 2ZC6B 4ZJ1A 1N9BA 4UA7A 1K56A 5D3OA 3UPPA 4DRTA 3DW0A 4P0MA 1ONHA 3GVBA 3IWOA 4H8RA 3M6HA 2WGWA 1GHPA 1YLZA 3Q7VA 4N1HA 1YM1A 4OP8A 4RVAA 1KE4A 2HP6A 4Y0OA 5E2FA 4RA7A 4U0XA 3Q07A 5EVIB 1FCOA 4EBLA 3PBOA 5A91A 4S2OA 3ZVTA 1YMSA 4WYYA 3VP3A 5KMWA 3M6BA 3I7JA 4IVKA 3A3DA 3TSGA 3V3SA 4KZ7A 5GHZA 1PI5A 4CJNA 5FI7A 1LI0A 4EV4A 3PAGA 2WYXA 2ZC4B 1KGEA 1XP4A 1FSYA 4GD6A 4O7DA 4GD8A 3MZDA 4UAAA 3NC8A 5FATA 2IWCA 5FQ9A 1XA1A 2P74A 3UDXA 4N9LA 1SHVA 4S2NC 1XGJA 1VM1A 4X56A 5EOEA 4YINA 4PM6A 1BULA 1IKGA 3G35A 4B4ZA 4LENA 4R3BA 4KQOA 3ZVWA 1LL5A 1K57C 5IHVA 3W4PA 3RXXA 1CI9A 1M6KA 2RCXA 1XX2A 4A5RA 4QD4A 1SKFA 3SS5A 3A3IA 3V5MA 4B88A 3WWXA 3ZGAB 5AQAA 3LO7A 1DY6A 1ONGA 5FQKA 3MZEA 4MLLA 1E3UD 1Q2QA 1TDLA
chains in the Genus database with same CATH superfamily
5HAIA 1CF0A 1UWNX 4LLOB 1KOUA 3B33A 2XA7M 3EQVA 2Y2PA 2VZWA 2ZJ9A 2Q0OA 4OP5A 3CPTA 2INWA 3IF5A 3FG8A 2V8FA 5LBRA 2KLIA 1G28A 3P98A 1XXMA 3F1PB 2JKRI 4DXCA 4R3JA 4LRZE 4QY5A 3GR2A 3JPUA 2W1RA 3HUNA 1K25A 4F3LA 2XEPA 2Y2OA 1IYQA 4KQRA 3HJKA 2YKHA 3UMEA 4OKPA 4LV1A 3QNBA 4F94A 1BSGA 1FR6A 4O01A 3TJZC 1YLJA 3UB6A 2H5SA 4P85A 4IEDA 2MJ6A 2QMIA 1SCWA 1FSWA 1LHYA 1IYSA 3HREA 5GLCA 1K55A 1XA7A 5FQJA 4KZ3A 1K4EA 2W3FA 4CLCD 1YAXA 5FASA 1L2SA 1E4DA 3OPHA 4CLCE 4JKTA 1F98A 3BRMA 3PYPA 2UV0E 4HP4A 1ZG6A 3BJNA 2NUPC 1S4SA 3FKVA 1HTZA 2GNXA 4WMCD 1KDWA 2YKFA 1K6RA 1LI9A 4QJGA 4HJ6A 4E3MA 3A0SA 3IX8A 4S2KA 5U47A 3EQUA 3T12B 1RGZA 4GDNA 3C38A 2K7SA 2Q9MA 2H28A 4QHCA 3FKWA 1SKOA 5L09A 1GHIA 3IXDA 4ZAMA 5DKLA 2W27A 3S7OA 1I5QA 1K38A 2K31A 3Q7VB 3BFFA 5M18A 5HD5A 3IF6C 1RP5A 1KGFA 3Q1FA 1PWCA 4WEJA 3HLFA 4DN0A 2K2NA 1W79A 2L0WA 3NBLA 1IKIA 2WGVA 5GLBA 2H0TA 4MEZA 3TG9A 1FCMA 5FQQA 4OONA 2X02A 4S2IA 1NRJA 4EWFA 2HZ5A 1PYYA 1TD5A 2PU4A 1P9RA 5HW3A 1F9IA 2FZ0A 3DTKA 3VP2A 3GDIA 2VV8A 1CQAA 5HL1A 4UHUA 3CUEA 1G5UA 4DE1A 4U0TA 3KSFA 2LB9A 2A49A 4DXBA 1L0GA 2WGIA 1IELA 4Z9QA 4JLFA 5HAPA 1K56D 1ERMA 2JCHA 4QWOA 2V0WA 4LV2A 3H9WA 1NY0A 3IF6B 3RXWA 2X71A 3VOYA 3CHWP 3IS2B 4HJ4A 1DJAA 4MBKA 1OTEA 2XROA 2VGLS 3KO6A 4XUZA 5HDDA 2Y2MA 3T1RA 1XPBA 2O9CA 4OH0A 1T18A 2PDRA 3UB5P 2XH9A 4QPRA 4JXGA 3UDIA 2PT7A 5G4YA 2KOIA 4PKYG 1AXBA 5K5BA 2PD8A 2OOLA 3S22A 5C5KA 1MC0A 5GLAA 3AGDA 2HPBA 1JNUA 2IWDA 1M40A 1BLPA 2VLGA 3N8LA 3H82B 2ZQAA 1MY8A 1FR1A 5I5LA 2JE5A 4HBTA 2JBFA 4Y15A 1P9WA 1IFQA 5G4ZA 1PFLA 2R9XA 2RL3A 3QP6A 2XA7S 3Q81A 5FDHA 1S6RA 1ZC2A 3DTEA 2GX5A 2O99A 2EWVA 1VQQA 1GSVA 4S2NA 4GHIB 2Y2QA 3C4OA 2HDRA 2VX8A 4GNUA 3VOZA 4EU0A 5AVFA 4JXSA 4L9FA 4N92A 1JWPA 3ZFZA 5EVIC 4JF6A 1S67L 4KZ8A 5HL6A 3QP8A 2PD7A 2IWBA 3VFFA 4BD1A 4JPMA 1T1BA 4BQMA 3CITA 3CZDA 3KYZA 4M4XA 2HDQA 2PU2A 3WS1A 1QMEA 4E3KA 3T4QA 1XGIA 4GS9B 4LRYC 2HP5A 1HZOA 3FYZA 5TR7A 1ZKJA 2EX2A 1BLCA 4L9GA 1BLHA 3K3CA 1S1ZA 1K54A 4XT2A 2Z6CA 2P9VA 3BM6A 4Y0TA 1FOFA 3GRJA 3HLBA 3EGDC 2J3TC 2PYRA 3GECA 1XKZA 5FEGA 4G3VA 5F5YA 4DRTA 1ONHA 3T4TA 2J3TD 1T1CA 3V3RA 5E2FA 2HP6A 2V9AA 3KSGA 5EVIB 3ZVTA 3MFXA 5KMWA 1XFQA 4KUOA 5GHZA 4CJNA 1WA9A 2M7UA 3DTIA 1LSXA 1FSYA 1XP4A 4O7DA 5FQ9A 2QJ5A 4N9LA 5HDCA 1YSPA 1VM1A 2JKTI 3LIBA 4X56A 4PM6A 1BULA 1XJ6A 3KYEA 4LENA 2HF6A 3W4PA 2RCXA 4A5RA 3A3IA 3V5MA 4E04A 3D3OA 3LIAA 5FQKA 2W1TB 4EEPA 4L0LA 4WL9A 1XJ4A 2Y79A 2Y91A 3CMZA 1W7FA 4DDYA 4EEUA 4KENB 2GDNA 4NETA 5EM0A 3T4SA 5EFWA 3IHBA 2ZMAA 4DMZA 1GHMA 3UB8A 4X1LA 5E2HA 3UPNA 1EWZA 5JYOA 4DDSA 1YLTA 4DE0A 5DJUA 3QP5A 1G68A 3E4OA 4NEED 3ZNYA 3GV9A 4ME4A 2Y2IA 2WAEA 1OT9A 1PNEA 1LL8A 3KSIA 3IX4A 3LEZA 4UQIS 1DP6A 5DF9A 4FCFA 3PBSA 5FQMA 4CQHA 3K3DA 4LV3A 4O8GA 2Y8HA 2W3GA 5DF8A 4ARZB 4X55A 3A0RA 3F1OA 3PBRA 1DJCA 4PKYA 4S2MA 3G32A 3RTYA 3QHYA 3IXGA 3FWLA 2VGLM 3UDFA 4OOLA 1BTLA 1YQSA 1JTGA 4U3TA 3B3XA 2XGNA 3GMWA 4R0QA 1YLYA 4E3OA 3HLCA 4OQGA 3U2AA 4EUZA 3IT9A 3ZQ5A 2JKFA 3OPLA 5J3WA 1TEMA 3C7UA 1NRFA 2R9WA 1CEGA 3LUQA 1GSXA 4WEKA 3E4PA 4OLGA 4XXRA 3RH8B 3FPWA 1JWVA 3CJMA 3MFDA 2ZLYA 3A3FA 1NYMA 2Y2JA 3NULA 2DRWA 4JGRA 1L3LA 2PYPA 2A3UA 1NYYA 1MWTA 4S2JA 3P09A 4JGOA 2B95A 4UEYA 4PMAA 3UE1A 4IVIA 2WKIA 2WGWB 3DAVA 2JKGA 1K6SA 2BG1A 2KX6A 2ZQ9A 2NUTC 2Y4AA 1MBLA 1ES2A 2M1CA 4FUWA 1FIKA 2EWWA 5FAQA 1HD8A 1IEMA 5FAOA 3EOIA 3ISGA 5E43A 3W4OA 3IXBA 1FQGA 3JYIA 2HV1A 3W8KA 4JGPA 3VP4A 4PM8A 5J7EA 1K55C 4OOYA 2H0YA 4EBPA 2FFYA 3BYDA 4HEFA 3QP4A 1KDSA 4Y17A 5HSQA 1OTAA 3IWQA 5AVEA 2ZM2A 4HNBA 2OAP1 5DFYA 3C30A 3E98A 2ZL1A 4P87A 2VGJA 3N8SA 2HDSA 1OTIA 2DNSA 3CPTB 5A90A 5TBMA 3HLGA 4LGWA 3T50A 4NKPA 2OLVA 4Q0HA 3DBAA 5TJJA 2Q9NA 4R4SA 3FZCA 3MSHA 3LY4A 3M2KA 5HD3A 1NZUA 2WKPA 1MWRA 4F3LB 2J7VA 3UB9A 5A92A 4KZ5A 3HLDA 2FFFB 3NDEA 2JKTM 3GQZA 1EW0A 5FDSA 5FL3A 5DTSA 3NDGA 4CLCA 2V1ZA 4WLAA 1RGYA 3UN7A 1S1YA 3WS0A 1NZOA 2ZQDA 3VSKA 2HDUA 3TW8A 2BTFP 5EVLA 1CK3A 4WMCA 4LFUA 1CI8A 1GA9A 3MBZA 4X69A 2ZQCA 5DKKA 1W8QA 3NOUC 1Y28A 2WKRA 5E2GA 4IBRA 2GZAA 5G18A 4FOFA 1ES3A 4P6ZS 3FC7A 4AFIA 4GB7A 3MQ0A 5F83A 3DWKA 3OLOA 4DJ3A 5F82A 3OZHA 2XK1A 3CG5A 3CUEC 2BASA 4OPYA 1VHMA 2WK0A 2WUQA 3ULFA 4EQ1A 4OOMA 1O07A 5CEDA 1BZAA 1ZTUA 1BT5A 2D01A 1A0KA 4FSFA 3D72A 3LIDA 4QU3A 1SKOB 4KZ6A 4MN5A 3NI9A 1TDGA 3JVVA 5FI6A 3ITAA 1S0WA 4I38A 4OQ0A 1ALQA 2QZ6A 3C4PA 3NCKA 3NY4A 1KGGA 4UQIM 4ZJ2A 4I39A 4JBFA 3T4KA 1YLWA 5CHMA 5IU1A 4EESA 3O3VA 3O5YA 1ZG4A 5E2EA 4HH3A 3BLMA 3OBFA 3A3JA 4R70A 5JYPA 3IX3A 1L0EA 2IA2A 4C3QA 4UA6A 4Q0IA 4YWZA 3KYQA 5DVAA 2V1BA 4I3JA 2ZM8A 1ESUA 1EI5A 3BFDA 1I2SA 2V0UA 2OV5A 2B18A 3C5AA 3WS4A 5CTMA 3MKEA 1IYPA 2E8JA 4HESA 4X6TA 3R7WA 1YPRA 1FCNA 3UMDA 4ZJ1A 1K56A 3LR3A 3MQOA 3GVBA 3IWOA 3M6HA 4N1HA 1GHPA 2QKPA 4OP8A 1YM1A 3LIFA 1KE4A 4U0XA 4IUHA 4EBLA 2A24A 5EV0A 3TSGA 5L8MA 1LI0A 2ZC4B 4IHQA 4ETXA 1TF1A 4S2NC 2O9BA 2ZBBA 2JKRM 1K57C 3PXPA 3EEAA 2L4RA 1CI9A 1M6KA 1XX2A 4QD4A 3SS5A 4NXFA 3UB7A 4BBUA 1ONGA 4HY8A 1MZUA 1WE4A 3RFBA 3MKFA 1H3QA 5DFXA 3BFGA 3A3EA 3NIAA 4GDBA 5CGSA 5FSRA 2HGVA 4MN6A 4PPRA 3SW1A 2Y59A 4LPZA 4OQHA 5HPIA 3IWIA 5F69A 2VEAA 4CPKA 5CTNA 4JXWA 5EOOA 4D60A 2WKQA 4Q0JA 3PBTA 3Q82A 5I94A 5TFQA 1O7EA 5EVID 1K54C 3BFEA 5HAQA 2W3HA 4ZRRA 2Y55A 2WKEA 3MS6A 2CMNA 2OWHA 3ZYTA 1PWGA 5MC7A 3UPOA 3VV4A 2EX9A 1Z09A 1YKDA 1NJ4A 3BQ8A 5FA7A 1TS7A 3B42A 3SH9A 4DE2A 4RX3A 4H6JA 1YLPA 4Z1WA 4WM9A 3T1QB 1LSVA 2J9PA 3OCLA 3VP0A 1F5MA 3UNWA 1FILA 2CC1A 4QB8A 2Y2GA 3GSGA 1VB6A 2PBYA 4ID4A 4HP9A 5EUAA 1DP8A 3ZG7B 4HI4A 4IBXA 3MMHA 4N9KA 3IH8A 2ZC5B 4Y0UA 3ZG8B 5KZHA 1H8ZA 3H7WA 3WRTA 2W1TA 4NXBA 4XT2B 2V2FF 5GLDA 3G4PA 2BLSA 3M2JA 2P9VB 4BENA 5FI2A 5IS1A 2Z2MB 3F1NA 5A8BA 4GOGA 3G31A 3O88A 5EPHA 5HARA 1MXOA 4NXEA 1L0DA 4DJ2A 2W0NA 1MPLA 1XJ3A 4FD8A 3G2ZA 4P6ZM 1DP9A 2PHYA 4PHTA 3S7QA 4WZ5A 1DJBA 2W3DA 2JHEA 3IBJA 2VJWA 1ES5A 4E6XA 1PWDA 5DF7A 3G34A 4B9OA 2XD5A 1H8YA 2I72A 3N7WA 3S1YA 5GHXA 4D2OA 4R38A 2Y2KA 2UWXA 1VETA 1T19A 3NECA 3HCYA 1VEUA 2B02A 3VP1A 3FV7A 3HUMA 5BOHA 4L9EA 3LI9A 2J3WA 4BL2A 3ZDJA 3ZG9B 2G2UA 3SZTA 2AVXA 2VKSA 5CXWA 3UO9A 4NK3A 2EX6A 4I3AA 4K91A 2M7VA 1S4RA 4MNRA 2V20A 4LV0A 4FTXA 2V1AA 4XUXA 5AJGA 3LCEA 4BBTA 3V39A 1WYBA 3E2LA 4M3KA 4RX2A 1W5DA 1JTDA 3KSHA 3P7NA 4FH4A 5EVEA 1TS6A 3NOTC 3BWLA 3HLWA 4BBVA 2ACGA 2V8CA 3LR4A 3QP2A 3E0YA 3BW6A 5F1GA 5CRFA 4MBFA 1X0OA 2H10A 2EXAA 4BD0A 2QJ7A 5DTKA 3LR0A 1ES4A 4OPQA 2XFSA 2EFXA 3F1OB 5HWWA 4E3LA 1H5XA 4EW7A 1ESIA 5EECA 3G6OA 4KG6A 4EBNA 3F1PA 2WKHA 5KSCA 3MQQA 5CHJA 1PI4A 1PIOA 3C8CA 3OOVA 3QP1A 5IT5A 3QNCA 4E3NA 2HJEA 3D4FA 4O0PA 2EFUA 2WAFA 3JVUA 3MF0A 1J3WA 2ZM0A 1ODVA 3NJAA 3EGXC 1NWZA 1E3UA 1PW8A 2Z6DA 1STZA 2VA0A 3O87A 2ZC3B 2OAQ1 1SDNA 1DRMA 3D9YA 3LY3A 3ZG0A 1N9NA 2PBDP 1TS0A 3NOPC 3WS2A 1NLYA 4WELA 5CX7A 2FH5A 2WZZA 2GJ3A 1OTDA 4GZBA 5FQIA 3SH7A 1F2KA 4WF0A 1W8YA 4DKIA 1NLZA 5AQ7A 1YT4A 2O0YA 3BLSA 2QHKA 3PBQA 5GHYA 5CERA 1PW1A 1C3BA 2Z2LB 1I2WA 3OC2A 4MDZA 1BLSA 1Q2PA 3VSLA 4CLCC 2KDKA 3LYXA 2P08A 2J8YA 3C7VA 2XSSA 2ZMVA 3BY9A 4PM9A 4E6WA 5F68A 1BYWA 3BQAA 3B47A 4EETB 4OPRA 3A0VA 5TGFA 2WZXA 4R6LA 1PRQA 4DF6A 2ZC6B 2I9VA 5D3OA 3UPPA 2ZL1B 3DW0A 3S7NA 3S7PA 4GJ4A 4H8RA 1D7EA 3E4QA 3P01A 3Q7VA 1HLUP 5TBMB 3Q07A 3PBOA 4WYYA 3VP3A 3M6BA 3I7JA 5FI7A 4EV4A 4IUKA 3CLOA 4GD6A 4GD8A 4HIAA 3MZDA 4UAAA 5FATA 2IWCA 1XA1A 3UDXA 1SHVA 1XGJA 5EOEA 3G35A 2EA9A 3ZVWA 1OJGA 5IHVA 4WUJA 1SKFA 4B88A 3WWXA 3ZGAB 4WN5A 4MLLA 1Q2QA 4CLCB 4YINA 4OQIA 3PR6A 5EE8A 5F1FA 4GKUA 4X25A 4HHDA 2DCFA 3G30A 4GN2A 2PR5A 5M19A 1OMEA 4C6YA 3MJQA 2D02A 5L07A 4G3WA 4KZ9A 2XQZA 2VV7A 4WZ4A 4EERA 3MR0A 1HVBA 4Y2FA 2PR6A 4JF4A 3HVFA 1Y54A 3ITBA 4WBGA 4R3AA 3IF6A 5KSHA 4K0WA 2L1MA 2ZMFA 3IS2A 3LEQA 4K0XA 3UE0A 3VMAA 5HZHA 2JN7A 3SH8A 5DTTA 1E25A 5HFOA 3LICA 2Y2LA 2XDMA 5AQ9A 3ZNTA 4KG5A 3GTCA 5A93A 4EQIA 1WYCA 1OTBA 5CGXA 5DJTA 3IBRA 4B93A 2WADA 4JXVA 4S2PA 1RCJA 1K4FA 3NHQA 1KE0A 2XF3A 2B5RA 3N6IA 4ZDXA 5HPFA 4KG2A 1AWIA 4Y13A 3HJIA 3G2YA 3H82A 5CEBA 4B4XA 4I3IA 4KQQA 1W63M 1LL9A 2ZOHA 3EEHA 5F6AA 4ZTKA 3MXRA 3O86A 2ZOIA 2P7JA 2E8IA 4GHIA 1MWSA 4K08A 3ICYA 2VK3A 4GCZA 4R1GA 1J9MA 4QY6A 1QMFA 1MKIA 3R7WB 3BFCA 3HLEA 4UA9A 2HP9A 2XD1A 3SOIA 3CWFA 2ZQ8A 4JF5A 4GLQA 1PZOA 2C5WB 1G6AA 4Y7PA 1KE3A 2EX8A 4IJGA 4S2LA 1GCEA 1ERQA 3HUOA 1GSWA 3DTMA 3Q7ZA 4HJ3A 5M1AA 2VV6A 2XFTA 1U60A 3IH9A 2A24B 2DMWA 5EM1A 5CGWA 4I5SA 5KIZA 1N4OA 5AQBA 4GS9A 1JVJA 3CAXA 4LCMA 1S66L 3VE4A 1OT6A 2OLUA 1K57A 1TVFA 1IYOA 4MMNA 3C2WA 3OCNA 4X1MA 3CI6A 3LIEA 3ZG5A 2X01A 1D1JA 4OPZA 3TRCA 3E2KA 4LRXC 1OPXA 2G7UA 4KZAA 2EXBA 4RYEA 3BEBA 2QPNA 4BL3A 4BLMA 4BWIA 4R23A 2ZC7A 2LB5A 2Y2NA 4PAUA 2P04A 2ZQ7A 3R4KA 5HWVA 2ZD8A 1JWZA 1Z6FA 4EXOA 3EWKA 3S4XA 5EVIA 1CJFA 1K0KA 1G6OA 4PM7A 3V67A 1PZPA 1V9ZA 4E3JA 1XFNA 4BJPA 5HWTA 1L0FA 2VGKA 4GW9A 4ZJ3A 3W4QA 4NG2A 3DWZA 4Q8IA 1ZHHB 4DE3A 1GA0A 3TOIA 1P0ZA 2W3EA 4ETZA 3VOLA 3AGEA 3LI8A 3KX0X 3FPVA 3T1SA 3V50A 3LGOA 1H8MA 4N1XA 5FAPA 3PHYA 4LCLA 3OPPA 4YNRA 4X68A 3PAEA 3UE3A 3L9KA 4E3IA 2R78A 5GL9A 3AGFA 2JC7A 4EUVA 1ACFA 3PTEA 2XRNA 1LLBA 3ZCZA 4X53A 5L2FA 5HDSA 4KZBA 2J9OA 1P97A 3T4LA 3T1XA 4WZ5C 1YSQA 3N4IA 4KZ4A 4H6JB 1D06A 2OSUA 4P6BA 1SZVA 5J8XA 3W2ZA 3ZHHA 2QYBA 1EROA 4MCWA 4OLDA 3PBNA 1XJ2A 4JGQA 4R4RA 4YFMA 1NXYA 2HJ9C 3N8RA 1KVLA 2Y2HA 1TS8A 4II7A 3MXSA 1UWPX 4C75A 4G3KA 1YMXA 2C6WB 3H7WB 3WRZA 3RJUA 1BUEA 1UGUA 3UE6A 2OWJA 4ARZA 3T4JA 1LSWA 2G2WA 3F1NB 3UY6A 1Y4OA 2PAVP 3TE8A 3LR5A 4HBUA 4ESPA 3MXQA 1N9OA 4ZBEA 4HH2A 3VFHA 2XLNA 5FEFA 3OPRA 4PM5A 3HBRA 5HX9A 1T1AA 1SDEA 3U4LP 1V9YA 5CHUA 3HL9A 3SS3A 1KVMA 4Y3IA 3IHAA 3SS4A 4NXGA 3IXHA 1CEFA 4MBHA 3IQAA 1MWUA 5J4EA 5CECA 1VETB 4YOFA 3T4OA 2J80A 1VEUB 3MZFA 3WS5A 3BY8A 2XR0A 1W63Q 3BECA 4OVDA 4FH2A 4KUKA 3LFVA 2O9AA 4KQDA 1N9BA 4UA7A 3L7HA 4P0MA 4HQAA 2PRFA 2WGWA 1YLZA 1IOUA 4RVAA 4Y0OA 2QWSA 3VE3A 4RA7A 4Y5FA 1FCOA 5A91A 4S2OA 1LT0A 1YMSA 3K2NA 4IVKA 3A3DA 3V3SA 4HOIA 4KZ7A 1PI5A 3PAGA 2WYXA 2A2LA 1KGEA 3NC8A 2P74A 4RQ9A 1IKGA 4B4ZA 4R3BA 4KQOA 1LL5A 4BMWA 3RXXA 1OJ5A 5L10A 5AQAA 4MN7A 3LO7A 1DY6A 1MKMA 1H0MA 3MZEA 1E3UD 1TDLA 1N9LA
chains in the Genus database with same CATH topology
4OQIA 5EE8A 5HAIA 4GKUA 4L0LA 5F1FA 1WE4A 3MKFA 2Y91A 3BFGA 2DCFA 3A3EA 3CMZA 3NIAA 1W7FA 3EQVA 4DDYA 3G30A 2Y2PA 2ZJ9A 4GN2A 4GDBA 5CGSA 4KENB 5M19A 1OMEA 5FSRA 4OP5A 2GDNA 4NETA 4C6YA 3IF5A 4KZ9A 4PPRA 3IHBA 2ZMAA 2XQZA 1GHMA 2Y59A 5E2HA 3UPNA 4WZ4A 1EWZA 1XXMA 3P98A 5JYOA 4OQHA 4DDSA 4DXCA 1HVBA 3IWIA 1YLTA 4QY5A 4R3JA 4DE0A 3GR2A 4CPKA 5CTNA 4JF4A 3HVFA 1Y54A 3HUNA 4JXWA 1K25A 5EOOA 2XEPA 3ITBA 4WBGA 1G68A 2Y2OA 3IF6A 3PBTA 3Q82A 5TFQA 1O7EA 5EVID 5I94A 5KSHA 1IYQA 1K54C 4KQRA 4K0WA 3ZNYA 3GV9A 4K0XA 3UE0A 3VMAA 2Y2IA 3BFEA 4OKPA 2WAEA 5HAQA 3SH8A 4LV1A 3QNBA 5DTTA 2Y55A 1E25A 4F94A 5HFOA 1BSGA 1FR6A 3LEZA 2Y2LA 5DF9A 1YLJA 4FCFA 3PBSA 2WKEA 5FQMA 2H5SA 4LV3A 4P85A 2XDMA 4IEDA 1PWGA 5AQ9A 3ZNTA 5DF8A 3UPOA 2QMIA 4X55A 4KG5A 3GTCA 5A93A 4EQIA 1SCWA 1FSWA 1WYCA 2EX9A 1LHYA 1IYSA 3PBRA 3HREA 1NJ4A 5CGXA 5FA7A 1DJCA 5GLCA 2WADA 1K55A 1XA7A 4S2MA 3G32A 5FQJA 4KZ3A 1K4EA 4JXVA 3SH9A 4DE2A 4S2PA 3QHYA 1RCJA 1K4FA 3IXGA 4RX3A 1YLPA 5FASA 1L2SA 1E4DA 3FWLA 4WM9A 3OPHA 3UDFA 4JKTA 1KE0A 2XF3A 3BRMA 4OOLA 1BTLA 2B5RA 1YQSA 3N6IA 4ZDXA 1ZG6A 1JTGA 4KG2A 4U3TA 3B3XA 2J9PA 2XGNA 3OCLA 3VP0A 3G2YA 3UNWA 5CEBA 4B4XA 3GMWA 3FKVA 4R0QA 1HTZA 1YLYA 4E3OA 4KQQA 4WMCD 1LL9A 1KDWA 2CC1A 4QB8A 2Y2GA 3HLCA 3GSGA 4OQGA 4ZTKA 2PBYA 4ID4A 5EUAA 4EUZA 3IT9A 3ZG7B 3OPLA 1K6RA 1LI9A 3MXRA 3O86A 4IBXA 4N9KA 3IH8A 2ZC5B 4Y0UA 1TEMA 3C7UA 1H8ZA 3ZG8B 4E3MA 1NRFA 4QJGA 5KZHA 2R9WA 1CEGA 3WRTA 2E8IA 4S2KA 2V2FF 1MWSA 4WEKA 5U47A 3EQUA 4OLGA 3G4PA 2BLSA 3M2JA 4XXRA 5GLDA 2P9VB 4R1GA 4BENA 1JWVA 1J9MA 3CJMA 4QY6A 5FI2A 2Z2MB 3MFDA 2ZLYA 3A3FA 1RGZA 1QMFA 4GDNA 1MKIA 3BFCA 3HLEA 3V3RA 1NYMA 2Y2JA 2HP9A 2XD1A 4UA9A 3SOIA 2DRWA 2Q9MA 2ZQ8A 4GOGA 3G31A 4JF5A 2A3UA 1NYYA 1MWTA 1PZOA 3O88A 5EPHA 4S2JA 2C5WB 4QHCA 1MXOA 1G6AA 4Y7PA 5HARA 1KE3A 2EX8A 1L0DA 3P09A 3FKWA 4S2LA 1GCEA 1ERQA 3HUOA 1MPLA 1GHIA 3IXDA 4ZAMA 4FD8A 3DTMA 4PMAA 3Q7ZA 3G2ZA 3UE1A 1I5QA 5M1AA 4IVIA 1K38A 2WKIA 2WGWB 2XFTA 3Q7VB 3BFFA 1U60A 5M18A 3IH9A 4WZ5A 1DJBA 5CGWA 1K6SA 2BG1A 3IF6C 1RP5A 1ES5A 1KGFA 3Q1FA 2ZQ9A 1PWCA 1N4OA 2Y4AA 4E6XA 1PWDA 3HLFA 4WEJA 1MBLA 5DF7A 1ES2A 3G34A 5AQBA 1JVJA 2XD5A 4LCMA 1H8YA 2I72A 3N7WA 3S1YA 5GHXA 4D2OA 5FAQA 1W79A 1HD8A 3NBLA 1IKIA 2Y2KA 1IEMA 2WGVA 5FAOA 5GLBA 2H0TA 3ISGA 4MEZA 2OLUA 2UWXA 1K57A 5E43A 1TVFA 1IYOA 3TG9A 3W4OA 1FCMA 3IXBA 5FQQA 3OCNA 1FQGA 4OONA 3JYIA 2X02A 4S2IA 3VP1A 3ZG5A 2X01A 3W8KA 4EWFA 3FV7A 3HUMA 4OPZA 5BOHA 3E2KA 3VP4A 1PYYA 4PM8A 2PU4A 4BL2A 3ZDJA 4KZAA 5HW3A 2EXBA 1K55C 4RYEA 4OOYA 3ZG9B 2G2UA 3BEBA 2QPNA 2H0YA 3VP2A 4BL3A 4EBPA 2FFYA 3BYDA 4HEFA 4BLMA 5HL1A 4UHUA 5CXWA 1KDSA 4R23A 3UO9A 4NK3A 4U0TA 4DE1A 2ZC7A 3IWQA 2ZM2A 2A49A 2Y2NA 2EX6A 2ZQ7A 4P87A 4DXBA 4K91A 2VGJA 2ZD8A 3N8SA 2HDSA 1JWZA 1Z6FA 4MNRA 1L0GA 2WGIA 2V20A 2DNSA 4LV0A 5A90A 1IELA 3S4XA 5EVIA 3HLGA 4Z9QA 4JLFA 4XUXA 3LCEA 3V39A 1WYBA 3E2LA 4PM7A 5HAPA 1PZPA 2OLVA 4M3KA 4RX2A 4E3JA 1K56D 1W5DA 2Q9NA 4R4SA 4BJPA 3FZCA 1ERMA 1JTDA 1L0FA 2JCHA 2VGKA 3LY4A 3M2KA 1NZUA 1MWRA 4ZJ3A 3W4QA 4FH4A 4LV2A 1NY0A 3DWZA 3IF6B 3RXWA 2J7VA 2X71A 3VOYA 4DE3A 4Q8IA 1GA0A 3HLWA 5A92A 4KZ5A 3HLDA 3TOIA 2FFFB 1DJAA 4MBKA 3AGEA 3NDEA 4XUZA 2Y2MA 1XPBA 3GQZA 5F1GA 3V50A 4OH0A 5CRFA 4MBFA 4N1XA 2H10A 2EXAA 5FAPA 5DTSA 3NDGA 4LCLA 2V1ZA 3OPPA 4BD0A 4X68A 3PAEA 3UE3A 5DTKA 4E3IA 5GL9A 2XH9A 3AGFA 2JC7A 1RGYA 3UN7A 1ES4A 3PTEA 4OPQA 3WS0A 1NZOA 2XFSA 1LLBA 2EFXA 2ZQDA 4JXGA 3UDIA 3VSKA 3ZCZA 4X53A 5L2FA 2HDUA 4KZBA 2J9OA 1AXBA 4E3LA 1H5XA 4WZ5C 5EVLA 1ESIA 5EECA 1CK3A 4WMCA 3N4IA 3S22A 4KZ4A 1CI8A 1GA9A 4KG6A 2OSUA 4P6BA 5GLAA 3MBZA 3AGDA 5J8XA 2HPBA 4X69A 4EBNA 2IWDA 1M40A 3ZHHA 2ZQCA 2WKHA 5KSCA 1W8QA 5CHJA 1BLPA 1EROA 1PI4A 4OLDA 3N8LA 3PBNA 1PIOA 4R4RA 4YFMA 5E2GA 2ZQAA 4IBRA 1MY8A 1NXYA 1FR1A 3QNCA 5G18A 2JE5A 4HBTA 4E3NA 1ES3A 2JBFA 3N8RA 3D4FA 1KVLA 2EFUA 2WAFA 2Y2HA 2R9XA 2RL3A 4GB7A 2ZM0A 5F83A 3DWKA 3MXSA 4C75A 3Q81A 5FDHA 1S6RA 1YMXA 1ZC2A 2C6WB 5F82A 3WRZA 3OZHA 2XK1A 4S2NA 1VQQA 3CG5A 3RJUA 2Y2QA 3C4OA 1BUEA 1E3UA 1PW8A 2HDRA 2WK0A 2WUQA 2ZC3B 3O87A 4GNUA 2G2WA 4OPYA 3VOZA 4OOMA 1SDNA 3LY3A 3ZG0A 3UY6A 1O07A 5CEDA 1BZAA 1BT5A 4JXSA 4N92A 1JWPA 4FSFA 4HBUA 4QU3A 3ZFZA 5EVIC 4JF6A 3WS2A 4KZ6A 4WELA 4KZ8A 2WZZA 3NI9A 1TDGA 4ZBEA 3VFHA 2XLNA 5FI6A 2IWBA 3ITAA 4GZBA 1S0WA 3OPRA 5FQIA 3SH7A 3VFFA 4BD1A 4OQ0A 4PM5A 1W8YA 3HBRA 4JPMA 4DKIA 1ALQA 2QZ6A 5HX9A 3C4PA 4BQMA 3NCKA 3NY4A 3CZDA 1KGGA 1SDEA 2HDQA 4ZJ2A 2PU2A 5CHUA 3WS1A 5AQ7A 1QMEA 3HL9A 3SS3A 4E3KA 1YT4A 1KVMA 4JBFA 1YLWA 1XGIA 5CHMA 3IHAA 3O3VA 1ZG4A 3BLSA 5E2EA 3SS4A 3IXHA 1CEFA 3PBQA 3BLMA 4MBHA 3A3JA 3IQAA 2HP5A 5GHYA 1HZOA 5CERA 1PW1A 5JYPA 1MWUA 1C3BA 2Z2LB 1L0EA 1I2WA 3FYZA 3OC2A 1BLSA 5TR7A 1ZKJA 4C3QA 4UA6A 2EX2A 1BLCA 5CECA 5DVAA 1BLHA 1Q2PA 3VSLA 2ZM8A 1ESUA 1EI5A 1K54A 3BFDA 2J8YA 3MZFA 3C7VA 1I2SA 2OV5A 4PM9A 3C5AA 4E6WA 3WS4A 2P9VA 3BM6A 4Y0TA 5CTMA 3MKEA 1FOFA 3WS5A 1IYPA 2XR0A 3BECA 4HESA 4X6TA 4OVDA 3GRJA 3HLBA 4OPRA 5TGFA 1FCNA 4FH2A 2WZXA 1XKZA 4DF6A 2ZC6B 4ZJ1A 1N9BA 4UA7A 1K56A 5D3OA 3UPPA 4DRTA 3DW0A 4P0MA 1ONHA 3GVBA 3IWOA 4H8RA 3M6HA 2WGWA 1GHPA 1YLZA 3Q7VA 4N1HA 1YM1A 4OP8A 4RVAA 1KE4A 2HP6A 4Y0OA 5E2FA 4RA7A 4U0XA 3Q07A 5EVIB 1FCOA 4EBLA 3PBOA 5A91A 4S2OA 3ZVTA 1YMSA 4WYYA 3VP3A 5KMWA 3M6BA 3I7JA 4IVKA 3A3DA 3TSGA 3V3SA 4KZ7A 5GHZA 1PI5A 4CJNA 5FI7A 1LI0A 4EV4A 3PAGA 2WYXA 2ZC4B 1KGEA 1XP4A 1FSYA 4GD6A 4O7DA 4GD8A 3MZDA 4UAAA 3NC8A 5FATA 2IWCA 5FQ9A 1XA1A 2P74A 3UDXA 4N9LA 1SHVA 4S2NC 1XGJA 1VM1A 4X56A 5EOEA 4YINA 4PM6A 1BULA 1IKGA 3G35A 4B4ZA 4LENA 4R3BA 4KQOA 3ZVWA 1LL5A 1K57C 5IHVA 3W4PA 3RXXA 1CI9A 1M6KA 2RCXA 1XX2A 4A5RA 4QD4A 1SKFA 3SS5A 3A3IA 3V5MA 4B88A 3WWXA 3ZGAB 5AQAA 3LO7A 1DY6A 1ONGA 5FQKA 3MZEA 4MLLA 1E3UD 1Q2QA 1TDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OQI A;  5EE8 A;  5HAI A;  4GKU A;  4L0L A;  5F1F A;  1WE4 A;  3MKF A;  2Y91 A;  3BFG A;  2DCF A;  3A3E A;  3CMZ A;  3NIA A;  1W7F A;  3EQV A;  4DDY A;  3G30 A;  2Y2P A;  2ZJ9 A;  4GN2 A;  4GDB A;  5CGS A;  4KEN B;  5M19 A;  1OME A;  5FSR A;  4OP5 A;  2GDN A;  4NET A;  4C6Y A;  3IF5 A;  4KZ9 A;  4PPR A;  3IHB A;  2ZMA A;  2XQZ A;  1GHM A;  2Y59 A;  5E2H A;  3UPN A;  4WZ4 A;  1EWZ A;  1XXM A;  3P98 A;  5JYO A;  4OQH A;  4DDS A;  4DXC A;  1HVB A;  3IWI A;  1YLT A;  4QY5 A;  4R3J A;  4DE0 A;  3GR2 A;  4CPK A;  5CTN A;  4JF4 A;  3HVF A;  1Y54 A;  3HUN A;  4JXW A;  1K25 A;  5EOO A;  2XEP A;  3ITB A;  4WBG A;  1G68 A;  2Y2O A;  3IF6 A;  3PBT A;  3Q82 A;  5TFQ A;  1O7E A;  5EVI D;  5I94 A;  5KSH A;  1IYQ A;  1K54 C;  4KQR A;  4K0W A;  3ZNY A;  3GV9 A;  4K0X A;  3UE0 A;  3VMA A;  2Y2I A;  3BFE A;  4OKP A;  2WAE A;  5HAQ A;  3SH8 A;  4LV1 A;  3QNB A;  5DTT A;  2Y55 A;  1E25 A;  4F94 A;  5HFO A;  1BSG A;  1FR6 A;  3LEZ A;  2Y2L A;  5DF9 A;  1YLJ A;  4FCF A;  3PBS A;  2WKE A;  5FQM A;  2H5S A;  4LV3 A;  4P85 A;  2XDM A;  4IED A;  1PWG A;  5AQ9 A;  3ZNT A;  5DF8 A;  3UPO A;  2QMI A;  4X55 A;  4KG5 A;  3GTC A;  5A93 A;  4EQI A;  1SCW A;  1FSW A;  1WYC A;  2EX9 A;  1LHY A;  1IYS A;  3PBR A;  3HRE A;  1NJ4 A;  5CGX A;  5FA7 A;  1DJC A;  5GLC A;  2WAD A;  1K55 A;  1XA7 A;  4S2M A;  3G32 A;  5FQJ A;  4KZ3 A;  1K4E A;  4JXV A;  3SH9 A;  4DE2 A;  4S2P A;  3QHY A;  1RCJ A;  1K4F A;  3IXG A;  4RX3 A;  1YLP A;  5FAS A;  1L2S A;  1E4D A;  3FWL A;  4WM9 A;  3OPH A;  3UDF A;  4JKT A;  1KE0 A;  2XF3 A;  3BRM A;  4OOL A;  1BTL A;  2B5R A;  1YQS A;  3N6I A;  4ZDX A;  1ZG6 A;  1JTG A;  4KG2 A;  4U3T A;  3B3X A;  2J9P A;  2XGN A;  3OCL A;  3VP0 A;  3G2Y A;  3UNW A;  5CEB A;  4B4X A;  3GMW A;  3FKV A;  4R0Q A;  1HTZ A;  1YLY A;  4E3O A;  4KQQ A;  4WMC D;  1LL9 A;  1KDW A;  2CC1 A;  4QB8 A;  2Y2G A;  3HLC A;  3GSG A;  4OQG A;  4ZTK A;  2PBY A;  4ID4 A;  5EUA A;  4EUZ A;  3IT9 A;  3ZG7 B;  3OPL A;  1K6R A;  1LI9 A;  3MXR A;  3O86 A;  4IBX A;  4N9K A;  3IH8 A;  2ZC5 B;  4Y0U A;  1TEM A;  3C7U A;  1H8Z A;  3ZG8 B;  4E3M A;  1NRF A;  4QJG A;  5KZH A;  2R9W A;  1CEG A;  3WRT A;  2E8I A;  4S2K A;  2V2F F;  1MWS A;  4WEK A;  5U47 A;  3EQU A;  4OLG A;  3G4P A;  2BLS A;  3M2J A;  4XXR A;  5GLD A;  2P9V B;  4R1G A;  4BEN A;  1JWV A;  1J9M A;  3CJM A;  4QY6 A;  5FI2 A;  2Z2M B;  3MFD A;  2ZLY A;  3A3F A;  1RGZ A;  1QMF A;  4GDN A;  1MKI A;  3BFC A;  3HLE A;  3V3R A;  1NYM A;  2Y2J A;  2HP9 A;  2XD1 A;  4UA9 A;  3SOI A;  2DRW A;  2Q9M A;  2ZQ8 A;  4GOG A;  3G31 A;  4JF5 A;  2A3U A;  1NYY A;  1MWT A;  1PZO A;  3O88 A;  5EPH A;  4S2J A;  2C5W B;  4QHC A;  1MXO A;  1G6A A;  4Y7P A;  5HAR A;  1KE3 A;  2EX8 A;  1L0D A;  3P09 A;  3FKW A;  4S2L A;  1GCE A;  1ERQ A;  3HUO A;  1MPL A;  1GHI A;  3IXD A;  4ZAM A;  4FD8 A;  3DTM A;  4PMA A;  3Q7Z A;  3G2Z A;  3UE1 A;  1I5Q A;  5M1A A;  4IVI A;  1K38 A;  2WKI A;  2WGW B;  2XFT A;  3Q7V B;  3BFF A;  1U60 A;  5M18 A;  3IH9 A;  4WZ5 A;  1DJB A;  5CGW A;  1K6S A;  2BG1 A;  3IF6 C;  1RP5 A;  1ES5 A;  1KGF A;  3Q1F A;  2ZQ9 A;  1PWC A;  1N4O A;  2Y4A A;  4E6X A;  1PWD A;  3HLF A;  4WEJ A;  1MBL A;  5DF7 A;  1ES2 A;  3G34 A;  5AQB A;  1JVJ A;  2XD5 A;  4LCM A;  1H8Y A;  2I72 A;  3N7W A;  3S1Y A;  5GHX A;  4D2O A;  5FAQ A;  1W79 A;  1HD8 A;  3NBL A;  1IKI A;  2Y2K A;  1IEM A;  2WGV A;  5FAO A;  5GLB A;  2H0T A;  3ISG A;  4MEZ A;  2OLU A;  2UWX A;  1K57 A;  5E43 A;  1TVF A;  1IYO A;  3TG9 A;  3W4O A;  1FCM A;  3IXB A;  5FQQ A;  3OCN A;  1FQG A;  4OON A;  3JYI A;  2X02 A;  4S2I A;  3VP1 A;  3ZG5 A;  2X01 A;  3W8K A;  4EWF A;  3FV7 A;  3HUM A;  4OPZ A;  5BOH A;  3E2K A;  3VP4 A;  1PYY A;  4PM8 A;  2PU4 A;  4BL2 A;  3ZDJ A;  4KZA A;  5HW3 A;  2EXB A;  1K55 C;  4RYE A;  4OOY A;  3ZG9 B;  2G2U A;  3BEB A;  2QPN A;  2H0Y A;  3VP2 A;  4BL3 A;  4EBP A;  2FFY A;  3BYD A;  4HEF A;  4BLM A;  5HL1 A;  4UHU A;  5CXW A;  1KDS A;  4R23 A;  3UO9 A;  4NK3 A;  4U0T A;  4DE1 A;  2ZC7 A;  3IWQ A;  2ZM2 A;  2A49 A;  2Y2N A;  2EX6 A;  2ZQ7 A;  4P87 A;  4DXB A;  4K91 A;  2VGJ A;  2ZD8 A;  3N8S A;  2HDS A;  1JWZ A;  1Z6F A;  4MNR A;  1L0G A;  2WGI A;  2V20 A;  2DNS A;  4LV0 A;  5A90 A;  1IEL A;  3S4X A;  5EVI A;  3HLG A;  4Z9Q A;  4JLF A;  4XUX A;  3LCE A;  3V39 A;  1WYB A;  3E2L A;  4PM7 A;  5HAP A;  1PZP A;  2OLV A;  4M3K A;  4RX2 A;  4E3J A;  1K56 D;  1W5D A;  2Q9N A;  4R4S A;  4BJP A;  3FZC A;  1ERM A;  1JTD A;  1L0F A;  2JCH A;  2VGK A;  3LY4 A;  3M2K A;  1NZU A;  1MWR A;  4ZJ3 A;  3W4Q A;  4FH4 A;  4LV2 A;  1NY0 A;  3DWZ A;  3IF6 B;  3RXW A;  2J7V A;  2X71 A;  3VOY A;  4DE3 A;  4Q8I A;  1GA0 A;  3HLW A;  5A92 A;  4KZ5 A;  3HLD A;  3TOI A;  2FFF B;  1DJA A;  4MBK A;  3AGE A;  3NDE A;  4XUZ A;  2Y2M A;  1XPB A;  3GQZ A;  5F1G A;  3V50 A;  4OH0 A;  5CRF A;  4MBF A;  4N1X A;  2H10 A;  2EXA A;  5FAP A;  5DTS A;  3NDG A;  4LCL A;  2V1Z A;  3OPP A;  4BD0 A;  4X68 A;  3PAE A;  3UE3 A;  5DTK A;  4E3I A;  5GL9 A;  2XH9 A;  3AGF A;  2JC7 A;  1RGY A;  3UN7 A;  1ES4 A;  3PTE A;  4OPQ A;  3WS0 A;  1NZO A;  2XFS A;  1LLB A;  2EFX A;  2ZQD A;  4JXG A;  3UDI A;  3VSK A;  3ZCZ A;  4X53 A;  5L2F A;  2HDU A;  4KZB A;  2J9O A;  1AXB A;  4E3L A;  1H5X A;  4WZ5 C;  5EVL A;  1ESI A;  5EEC A;  1CK3 A;  4WMC A;  3N4I A;  3S22 A;  4KZ4 A;  1CI8 A;  1GA9 A;  4KG6 A;  2OSU A;  4P6B A;  5GLA A;  3MBZ A;  3AGD A;  5J8X A;  2HPB A;  4X69 A;  4EBN A;  2IWD A;  1M40 A;  3ZHH A;  2ZQC A;  2WKH A;  5KSC A;  1W8Q A;  5CHJ A;  1BLP A;  1ERO A;  1PI4 A;  4OLD A;  3N8L A;  3PBN A;  1PIO A;  4R4R A;  4YFM A;  5E2G A;  2ZQA A;  4IBR A;  1MY8 A;  1NXY A;  1FR1 A;  3QNC A;  5G18 A;  2JE5 A;  4HBT A;  4E3N A;  1ES3 A;  2JBF A;  3N8R A;  3D4F A;  1KVL A;  2EFU A;  2WAF A;  2Y2H A;  2R9X A;  2RL3 A;  4GB7 A;  2ZM0 A;  5F83 A;  3DWK A;  3MXS A;  4C75 A;  3Q81 A;  5FDH A;  1S6R A;  1YMX A;  1ZC2 A;  2C6W B;  5F82 A;  3WRZ A;  3OZH A;  2XK1 A;  4S2N A;  1VQQ A;  3CG5 A;  3RJU A;  2Y2Q A;  3C4O A;  1BUE A;  1E3U A;  1PW8 A;  2HDR A;  2WK0 A;  2WUQ A;  2ZC3 B;  3O87 A;  4GNU A;  2G2W A;  4OPY A;  3VOZ A;  4OOM A;  1SDN A;  3LY3 A;  3ZG0 A;  3UY6 A;  1O07 A;  5CED A;  1BZA A;  1BT5 A;  4JXS A;  4N92 A;  1JWP A;  4FSF A;  4HBU A;  4QU3 A;  3ZFZ A;  5EVI C;  4JF6 A;  3WS2 A;  4KZ6 A;  4WEL A;  4KZ8 A;  2WZZ A;  3NI9 A;  1TDG A;  4ZBE A;  3VFH A;  2XLN A;  5FI6 A;  2IWB A;  3ITA A;  4GZB A;  1S0W A;  3OPR A;  5FQI A;  3SH7 A;  3VFF A;  4BD1 A;  4OQ0 A;  4PM5 A;  1W8Y A;  3HBR A;  4JPM A;  4DKI A;  1ALQ A;  2QZ6 A;  5HX9 A;  3C4P A;  4BQM A;  3NCK A;  3NY4 A;  3CZD A;  1KGG A;  1SDE A;  2HDQ A;  4ZJ2 A;  2PU2 A;  5CHU A;  3WS1 A;  5AQ7 A;  1QME A;  3HL9 A;  3SS3 A;  4E3K A;  1YT4 A;  1KVM A;  4JBF A;  1YLW A;  1XGI A;  5CHM A;  3IHA A;  3O3V A;  1ZG4 A;  3BLS A;  5E2E A;  3SS4 A;  3IXH A;  1CEF A;  3PBQ A;  3BLM A;  4MBH A;  3A3J A;  3IQA A;  2HP5 A;  5GHY A;  1HZO A;  5CER A;  1PW1 A;  5JYP A;  1MWU A;  1C3B A;  2Z2L B;  1L0E A;  1I2W A;  3FYZ A;  3OC2 A;  1BLS A;  5TR7 A;  1ZKJ A;  4C3Q A;  4UA6 A;  2EX2 A;  1BLC A;  5CEC A;  5DVA A;  1BLH A;  1Q2P A;  3VSL A;  2ZM8 A;  1ESU A;  1EI5 A;  1K54 A;  3BFD A;  2J8Y A;  3MZF A;  3C7V A;  1I2S A;  2OV5 A;  4PM9 A;  3C5A A;  4E6W A;  3WS4 A;  2P9V A;  3BM6 A;  4Y0T A;  5CTM A;  3MKE A;  1FOF A;  3WS5 A;  1IYP A;  2XR0 A;  3BEC A;  4HES A;  4X6T A;  4OVD A;  3GRJ A;  3HLB A;  4OPR A;  5TGF A;  1FCN A;  4FH2 A;  2WZX A;  1XKZ A;  4DF6 A;  2ZC6 B;  4ZJ1 A;  1N9B A;  4UA7 A;  1K56 A;  5D3O A;  3UPP A;  4DRT A;  3DW0 A;  4P0M A;  1ONH A;  3GVB A;  3IWO A;  4H8R A;  3M6H A;  2WGW A;  1GHP A;  1YLZ A;  3Q7V A;  4N1H A;  1YM1 A;  4OP8 A;  4RVA A;  1KE4 A;  2HP6 A;  4Y0O A;  5E2F A;  4RA7 A;  4U0X A;  3Q07 A;  5EVI B;  1FCO A;  4EBL A;  3PBO A;  5A91 A;  4S2O A;  3ZVT A;  1YMS A;  4WYY A;  3VP3 A;  5KMW A;  3M6B A;  3I7J A;  4IVK A;  3A3D A;  3TSG A;  3V3S A;  4KZ7 A;  5GHZ A;  1PI5 A;  4CJN A;  5FI7 A;  1LI0 A;  4EV4 A;  3PAG A;  2WYX A;  2ZC4 B;  1KGE A;  1XP4 A;  1FSY A;  4GD6 A;  4O7D A;  4GD8 A;  3MZD A;  4UAA A;  3NC8 A;  5FAT A;  2IWC A;  5FQ9 A;  1XA1 A;  2P74 A;  3UDX A;  4N9L A;  1SHV A;  4S2N C;  1XGJ A;  1VM1 A;  4X56 A;  5EOE A;  4YIN A;  4PM6 A;  1BUL A;  1IKG A;  3G35 A;  4B4Z A;  4LEN A;  4R3B A;  4KQO A;  3ZVW A;  1LL5 A;  1K57 C;  5IHV A;  3W4P A;  3RXX A;  1CI9 A;  1M6K A;  2RCX A;  1XX2 A;  4A5R A;  4QD4 A;  1SKF A;  3SS5 A;  3A3I A;  3V5M A;  4B88 A;  3WWX A;  3ZGA B;  5AQA A;  3LO7 A;  1DY6 A;  1ONG A;  5FQK A;  3MZE A;  4MLL A;  1E3U D;  1Q2Q A;  1TDL A; 
#chains in the Genus database with same CATH topology
 5HAI A;  1CF0 A;  1UWN X;  4LLO B;  1KOU A;  3B33 A;  2XA7 M;  3EQV A;  2Y2P A;  2VZW A;  2ZJ9 A;  2Q0O A;  4OP5 A;  3CPT A;  2INW A;  3IF5 A;  3FG8 A;  2V8F A;  5LBR A;  2KLI A;  1G28 A;  3P98 A;  1XXM A;  3F1P B;  2JKR I;  4DXC A;  4R3J A;  4LRZ E;  4QY5 A;  3GR2 A;  3JPU A;  2W1R A;  3HUN A;  1K25 A;  4F3L A;  2XEP A;  2Y2O A;  1IYQ A;  4KQR A;  3HJK A;  2YKH A;  3UME A;  4OKP A;  4LV1 A;  3QNB A;  4F94 A;  1BSG A;  1FR6 A;  4O01 A;  3TJZ C;  1YLJ A;  3UB6 A;  2H5S A;  4P85 A;  4IED A;  2MJ6 A;  2QMI A;  1SCW A;  1FSW A;  1LHY A;  1IYS A;  3HRE A;  5GLC A;  1K55 A;  1XA7 A;  5FQJ A;  4KZ3 A;  1K4E A;  2W3F A;  4CLC D;  1YAX A;  5FAS A;  1L2S A;  1E4D A;  3OPH A;  4CLC E;  4JKT A;  1F98 A;  3BRM A;  3PYP A;  2UV0 E;  4HP4 A;  1ZG6 A;  3BJN A;  2NUP C;  1S4S A;  3FKV A;  1HTZ A;  2GNX A;  4WMC D;  1KDW A;  2YKF A;  1K6R A;  1LI9 A;  4QJG A;  4HJ6 A;  4E3M A;  3A0S A;  3IX8 A;  4S2K A;  5U47 A;  3EQU A;  3T12 B;  1RGZ A;  4GDN A;  3C38 A;  2K7S A;  2Q9M A;  2H28 A;  4QHC A;  3FKW A;  1SKO A;  5L09 A;  1GHI A;  3IXD A;  4ZAM A;  5DKL A;  2W27 A;  3S7O A;  1I5Q A;  1K38 A;  2K31 A;  3Q7V B;  3BFF A;  5M18 A;  5HD5 A;  3IF6 C;  1RP5 A;  1KGF A;  3Q1F A;  1PWC A;  4WEJ A;  3HLF A;  4DN0 A;  2K2N A;  1W79 A;  2L0W A;  3NBL A;  1IKI A;  2WGV A;  5GLB A;  2H0T A;  4MEZ A;  3TG9 A;  1FCM A;  5FQQ A;  4OON A;  2X02 A;  4S2I A;  1NRJ A;  4EWF A;  2HZ5 A;  1PYY A;  1TD5 A;  2PU4 A;  1P9R A;  5HW3 A;  1F9I A;  2FZ0 A;  3DTK A;  3VP2 A;  3GDI A;  2VV8 A;  1CQA A;  5HL1 A;  4UHU A;  3CUE A;  1G5U A;  4DE1 A;  4U0T A;  3KSF A;  2LB9 A;  2A49 A;  4DXB A;  1L0G A;  2WGI A;  1IEL A;  4Z9Q A;  4JLF A;  5HAP A;  1K56 D;  1ERM A;  2JCH A;  4QWO A;  2V0W A;  4LV2 A;  3H9W A;  1NY0 A;  3IF6 B;  3RXW A;  2X71 A;  3VOY A;  3CHW P;  3IS2 B;  4HJ4 A;  1DJA A;  4MBK A;  1OTE A;  2XRO A;  2VGL S;  3KO6 A;  4XUZ A;  5HDD A;  2Y2M A;  3T1R A;  1XPB A;  2O9C A;  4OH0 A;  1T18 A;  2PDR A;  3UB5 P;  2XH9 A;  4QPR A;  4JXG A;  3UDI A;  2PT7 A;  5G4Y A;  2KOI A;  4PKY G;  1AXB A;  5K5B A;  2PD8 A;  2OOL A;  3S22 A;  5C5K A;  1MC0 A;  5GLA A;  3AGD A;  2HPB A;  1JNU A;  2IWD A;  1M40 A;  1BLP A;  2VLG A;  3N8L A;  3H82 B;  2ZQA A;  1MY8 A;  1FR1 A;  5I5L A;  2JE5 A;  4HBT A;  2JBF A;  4Y15 A;  1P9W A;  1IFQ A;  5G4Z A;  1PFL A;  2R9X A;  2RL3 A;  3QP6 A;  2XA7 S;  3Q81 A;  5FDH A;  1S6R A;  1ZC2 A;  3DTE A;  2GX5 A;  2O99 A;  2EWV A;  1VQQ A;  1GSV A;  4S2N A;  4GHI B;  2Y2Q A;  3C4O A;  2HDR A;  2VX8 A;  4GNU A;  3VOZ A;  4EU0 A;  5AVF A;  4JXS A;  4L9F A;  4N92 A;  1JWP A;  3ZFZ A;  5EVI C;  4JF6 A;  1S67 L;  4KZ8 A;  5HL6 A;  3QP8 A;  2PD7 A;  2IWB A;  3VFF A;  4BD1 A;  4JPM A;  1T1B A;  4BQM A;  3CIT A;  3CZD A;  3KYZ A;  4M4X A;  2HDQ A;  2PU2 A;  3WS1 A;  1QME A;  4E3K A;  3T4Q A;  1XGI A;  4GS9 B;  4LRY C;  2HP5 A;  1HZO A;  3FYZ A;  5TR7 A;  1ZKJ A;  2EX2 A;  1BLC A;  4L9G A;  1BLH A;  3K3C A;  1S1Z A;  1K54 A;  4XT2 A;  2Z6C A;  2P9V A;  3BM6 A;  4Y0T A;  1FOF A;  3GRJ A;  3HLB A;  3EGD C;  2J3T C;  2PYR A;  3GEC A;  1XKZ A;  5FEG A;  4G3V A;  5F5Y A;  4DRT A;  1ONH A;  3T4T A;  2J3T D;  1T1C A;  3V3R A;  5E2F A;  2HP6 A;  2V9A A;  3KSG A;  5EVI B;  3ZVT A;  3MFX A;  5KMW A;  1XFQ A;  4KUO A;  5GHZ A;  4CJN A;  1WA9 A;  2M7U A;  3DTI A;  1LSX A;  1FSY A;  1XP4 A;  4O7D A;  5FQ9 A;  2QJ5 A;  4N9L A;  5HDC A;  1YSP A;  1VM1 A;  2JKT I;  3LIB A;  4X56 A;  4PM6 A;  1BUL A;  1XJ6 A;  3KYE A;  4LEN A;  2HF6 A;  3W4P A;  2RCX A;  4A5R A;  3A3I A;  3V5M A;  4E04 A;  3D3O A;  3LIA A;  5FQK A;  2W1T B;  4EEP A;  4L0L A;  4WL9 A;  1XJ4 A;  2Y79 A;  2Y91 A;  3CMZ A;  1W7F A;  4DDY A;  4EEU A;  4KEN B;  2GDN A;  4NET A;  5EM0 A;  3T4S A;  5EFW A;  3IHB A;  2ZMA A;  4DMZ A;  1GHM A;  3UB8 A;  4X1L A;  5E2H A;  3UPN A;  1EWZ A;  5JYO A;  4DDS A;  1YLT A;  4DE0 A;  5DJU A;  3QP5 A;  1G68 A;  3E4O A;  4NEE D;  3ZNY A;  3GV9 A;  4ME4 A;  2Y2I A;  2WAE A;  1OT9 A;  1PNE A;  1LL8 A;  3KSI A;  3IX4 A;  3LEZ A;  4UQI S;  1DP6 A;  5DF9 A;  4FCF A;  3PBS A;  5FQM A;  4CQH A;  3K3D A;  4LV3 A;  4O8G A;  2Y8H A;  2W3G A;  5DF8 A;  4ARZ B;  4X55 A;  3A0R A;  3F1O A;  3PBR A;  1DJC A;  4PKY A;  4S2M A;  3G32 A;  3RTY A;  3QHY A;  3IXG A;  3FWL A;  2VGL M;  3UDF A;  4OOL A;  1BTL A;  1YQS A;  1JTG A;  4U3T A;  3B3X A;  2XGN A;  3GMW A;  4R0Q A;  1YLY A;  4E3O A;  3HLC A;  4OQG A;  3U2A A;  4EUZ A;  3IT9 A;  3ZQ5 A;  2JKF A;  3OPL A;  5J3W A;  1TEM A;  3C7U A;  1NRF A;  2R9W A;  1CEG A;  3LUQ A;  1GSX A;  4WEK A;  3E4P A;  4OLG A;  4XXR A;  3RH8 B;  3FPW A;  1JWV A;  3CJM A;  3MFD A;  2ZLY A;  3A3F A;  1NYM A;  2Y2J A;  3NUL A;  2DRW A;  4JGR A;  1L3L A;  2PYP A;  2A3U A;  1NYY A;  1MWT A;  4S2J A;  3P09 A;  4JGO A;  2B95 A;  4UEY A;  4PMA A;  3UE1 A;  4IVI A;  2WKI A;  2WGW B;  3DAV A;  2JKG A;  1K6S A;  2BG1 A;  2KX6 A;  2ZQ9 A;  2NUT C;  2Y4A A;  1MBL A;  1ES2 A;  2M1C A;  4FUW A;  1FIK A;  2EWW A;  5FAQ A;  1HD8 A;  1IEM A;  5FAO A;  3EOI A;  3ISG A;  5E43 A;  3W4O A;  3IXB A;  1FQG A;  3JYI A;  2HV1 A;  3W8K A;  4JGP A;  3VP4 A;  4PM8 A;  5J7E A;  1K55 C;  4OOY A;  2H0Y A;  4EBP A;  2FFY A;  3BYD A;  4HEF A;  3QP4 A;  1KDS A;  4Y17 A;  5HSQ A;  1OTA A;  3IWQ A;  5AVE A;  2ZM2 A;  4HNB A;  2OAP 1;  5DFY A;  3C30 A;  3E98 A;  2ZL1 A;  4P87 A;  2VGJ A;  3N8S A;  2HDS A;  1OTI A;  2DNS A;  3CPT B;  5A90 A;  5TBM A;  3HLG A;  4LGW A;  3T50 A;  4NKP A;  2OLV A;  4Q0H A;  3DBA A;  5TJJ A;  2Q9N A;  4R4S A;  3FZC A;  3MSH A;  3LY4 A;  3M2K A;  5HD3 A;  1NZU A;  2WKP A;  1MWR A;  4F3L B;  2J7V A;  3UB9 A;  5A92 A;  4KZ5 A;  3HLD A;  2FFF B;  3NDE A;  2JKT M;  3GQZ A;  1EW0 A;  5FDS A;  5FL3 A;  5DTS A;  3NDG A;  4CLC A;  2V1Z A;  4WLA A;  1RGY A;  3UN7 A;  1S1Y A;  3WS0 A;  1NZO A;  2ZQD A;  3VSK A;  2HDU A;  3TW8 A;  2BTF P;  5EVL A;  1CK3 A;  4WMC A;  4LFU A;  1CI8 A;  1GA9 A;  3MBZ A;  4X69 A;  2ZQC A;  5DKK A;  1W8Q A;  3NOU C;  1Y28 A;  2WKR A;  5E2G A;  4IBR A;  2GZA A;  5G18 A;  4FOF A;  1ES3 A;  4P6Z S;  3FC7 A;  4AFI A;  4GB7 A;  3MQ0 A;  5F83 A;  3DWK A;  3OLO A;  4DJ3 A;  5F82 A;  3OZH A;  2XK1 A;  3CG5 A;  3CUE C;  2BAS A;  4OPY A;  1VHM A;  2WK0 A;  2WUQ A;  3ULF A;  4EQ1 A;  4OOM A;  1O07 A;  5CED A;  1BZA A;  1ZTU A;  1BT5 A;  2D01 A;  1A0K A;  4FSF A;  3D72 A;  3LID A;  4QU3 A;  1SKO B;  4KZ6 A;  4MN5 A;  3NI9 A;  1TDG A;  3JVV A;  5FI6 A;  3ITA A;  1S0W A;  4I38 A;  4OQ0 A;  1ALQ A;  2QZ6 A;  3C4P A;  3NCK A;  3NY4 A;  1KGG A;  4UQI M;  4ZJ2 A;  4I39 A;  4JBF A;  3T4K A;  1YLW A;  5CHM A;  5IU1 A;  4EES A;  3O3V A;  3O5Y A;  1ZG4 A;  5E2E A;  4HH3 A;  3BLM A;  3OBF A;  3A3J A;  4R70 A;  5JYP A;  3IX3 A;  1L0E A;  2IA2 A;  4C3Q A;  4UA6 A;  4Q0I A;  4YWZ A;  3KYQ A;  5DVA A;  2V1B A;  4I3J A;  2ZM8 A;  1ESU A;  1EI5 A;  3BFD A;  1I2S A;  2V0U A;  2OV5 A;  2B18 A;  3C5A A;  3WS4 A;  5CTM A;  3MKE A;  1IYP A;  2E8J A;  4HES A;  4X6T A;  3R7W A;  1YPR A;  1FCN A;  3UMD A;  4ZJ1 A;  1K56 A;  3LR3 A;  3MQO A;  3GVB A;  3IWO A;  3M6H A;  4N1H A;  1GHP A;  2QKP A;  4OP8 A;  1YM1 A;  3LIF A;  1KE4 A;  4U0X A;  4IUH A;  4EBL A;  2A24 A;  5EV0 A;  3TSG A;  5L8M A;  1LI0 A;  2ZC4 B;  4IHQ A;  4ETX A;  1TF1 A;  4S2N C;  2O9B A;  2ZBB A;  2JKR M;  1K57 C;  3PXP A;  3EEA A;  2L4R A;  1CI9 A;  1M6K A;  1XX2 A;  4QD4 A;  3SS5 A;  4NXF A;  3UB7 A;  4BBU A;  1ONG A;  4HY8 A;  1MZU A;  1WE4 A;  3RFB A;  3MKF A;  1H3Q A;  5DFX A;  3BFG A;  3A3E A;  3NIA A;  4GDB A;  5CGS A;  5FSR A;  2HGV A;  4MN6 A;  4PPR A;  3SW1 A;  2Y59 A;  4LPZ A;  4OQH A;  5HPI A;  3IWI A;  5F69 A;  2VEA A;  4CPK A;  5CTN A;  4JXW A;  5EOO A;  4D60 A;  2WKQ A;  4Q0J A;  3PBT A;  3Q82 A;  5I94 A;  5TFQ A;  1O7E A;  5EVI D;  1K54 C;  3BFE A;  5HAQ A;  2W3H A;  4ZRR A;  2Y55 A;  2WKE A;  3MS6 A;  2CMN A;  2OWH A;  3ZYT A;  1PWG A;  5MC7 A;  3UPO A;  3VV4 A;  2EX9 A;  1Z09 A;  1YKD A;  1NJ4 A;  3BQ8 A;  5FA7 A;  1TS7 A;  3B42 A;  3SH9 A;  4DE2 A;  4RX3 A;  4H6J A;  1YLP A;  4Z1W A;  4WM9 A;  3T1Q B;  1LSV A;  2J9P A;  3OCL A;  3VP0 A;  1F5M A;  3UNW A;  1FIL A;  2CC1 A;  4QB8 A;  2Y2G A;  3GSG A;  1VB6 A;  2PBY A;  4ID4 A;  4HP9 A;  5EUA A;  1DP8 A;  3ZG7 B;  4HI4 A;  4IBX A;  3MMH A;  4N9K A;  3IH8 A;  2ZC5 B;  4Y0U A;  3ZG8 B;  5KZH A;  1H8Z A;  3H7W A;  3WRT A;  2W1T A;  4NXB A;  4XT2 B;  2V2F F;  5GLD A;  3G4P A;  2BLS A;  3M2J A;  2P9V B;  4BEN A;  5FI2 A;  5IS1 A;  2Z2M B;  3F1N A;  5A8B A;  4GOG A;  3G31 A;  3O88 A;  5EPH A;  5HAR A;  1MXO A;  4NXE A;  1L0D A;  4DJ2 A;  2W0N A;  1MPL A;  1XJ3 A;  4FD8 A;  3G2Z A;  4P6Z M;  1DP9 A;  2PHY A;  4PHT A;  3S7Q A;  4WZ5 A;  1DJB A;  2W3D A;  2JHE A;  3IBJ A;  2VJW A;  1ES5 A;  4E6X A;  1PWD A;  5DF7 A;  3G34 A;  4B9O A;  2XD5 A;  1H8Y A;  2I72 A;  3N7W A;  3S1Y A;  5GHX A;  4D2O A;  4R38 A;  2Y2K A;  2UWX A;  1VET A;  1T19 A;  3NEC A;  3HCY A;  1VEU A;  2B02 A;  3VP1 A;  3FV7 A;  3HUM A;  5BOH A;  4L9E A;  3LI9 A;  2J3W A;  4BL2 A;  3ZDJ A;  3ZG9 B;  2G2U A;  3SZT A;  2AVX A;  2VKS A;  5CXW A;  3UO9 A;  4NK3 A;  2EX6 A;  4I3A A;  4K91 A;  2M7V A;  1S4R A;  4MNR A;  2V20 A;  4LV0 A;  4FTX A;  2V1A A;  4XUX A;  5AJG A;  3LCE A;  4BBT A;  3V39 A;  1WYB A;  3E2L A;  4M3K A;  4RX2 A;  1W5D A;  1JTD A;  3KSH A;  3P7N A;  4FH4 A;  5EVE A;  1TS6 A;  3NOT C;  3BWL A;  3HLW A;  4BBV A;  2ACG A;  2V8C A;  3LR4 A;  3QP2 A;  3E0Y A;  3BW6 A;  5F1G A;  5CRF A;  4MBF A;  1X0O A;  2H10 A;  2EXA A;  4BD0 A;  2QJ7 A;  5DTK A;  3LR0 A;  1ES4 A;  4OPQ A;  2XFS A;  2EFX A;  3F1O B;  5HWW A;  4E3L A;  1H5X A;  4EW7 A;  1ESI A;  5EEC A;  3G6O A;  4KG6 A;  4EBN A;  3F1P A;  2WKH A;  5KSC A;  3MQQ A;  5CHJ A;  1PI4 A;  1PIO A;  3C8C A;  3OOV A;  3QP1 A;  5IT5 A;  3QNC A;  4E3N A;  2HJE A;  3D4F A;  4O0P A;  2EFU A;  2WAF A;  3JVU A;  3MF0 A;  1J3W A;  2ZM0 A;  1ODV A;  3NJA A;  3EGX C;  1NWZ A;  1E3U A;  1PW8 A;  2Z6D A;  1STZ A;  2VA0 A;  3O87 A;  2ZC3 B;  2OAQ 1;  1SDN A;  1DRM A;  3D9Y A;  3LY3 A;  3ZG0 A;  1N9N A;  2PBD P;  1TS0 A;  3NOP C;  3WS2 A;  1NLY A;  4WEL A;  5CX7 A;  2FH5 A;  2WZZ A;  2GJ3 A;  1OTD A;  4GZB A;  5FQI A;  3SH7 A;  1F2K A;  4WF0 A;  1W8Y A;  4DKI A;  1NLZ A;  5AQ7 A;  1YT4 A;  2O0Y A;  3BLS A;  2QHK A;  3PBQ A;  5GHY A;  5CER A;  1PW1 A;  1C3B A;  2Z2L B;  1I2W A;  3OC2 A;  4MDZ A;  1BLS A;  1Q2P A;  3VSL A;  4CLC C;  2KDK A;  3LYX A;  2P08 A;  2J8Y A;  3C7V A;  2XSS A;  2ZMV A;  3BY9 A;  4PM9 A;  4E6W A;  5F68 A;  1BYW A;  3BQA A;  3B47 A;  4EET B;  4OPR A;  3A0V A;  5TGF A;  2WZX A;  4R6L A;  1PRQ A;  4DF6 A;  2ZC6 B;  2I9V A;  5D3O A;  3UPP A;  2ZL1 B;  3DW0 A;  3S7N A;  3S7P A;  4GJ4 A;  4H8R A;  1D7E A;  3E4Q A;  3P01 A;  3Q7V A;  1HLU P;  5TBM B;  3Q07 A;  3PBO A;  4WYY A;  3VP3 A;  3M6B A;  3I7J A;  5FI7 A;  4EV4 A;  4IUK A;  3CLO A;  4GD6 A;  4GD8 A;  4HIA A;  3MZD A;  4UAA A;  5FAT A;  2IWC A;  1XA1 A;  3UDX A;  1SHV A;  1XGJ A;  5EOE A;  3G35 A;  2EA9 A;  3ZVW A;  1OJG A;  5IHV A;  4WUJ A;  1SKF A;  4B88 A;  3WWX A;  3ZGA B;  4WN5 A;  4MLL A;  1Q2Q A;  4CLC B;  4YIN A;  4OQI A;  3PR6 A;  5EE8 A;  5F1F A;  4GKU A;  4X25 A;  4HHD A;  2DCF A;  3G30 A;  4GN2 A;  2PR5 A;  5M19 A;  1OME A;  4C6Y A;  3MJQ A;  2D02 A;  5L07 A;  4G3W A;  4KZ9 A;  2XQZ A;  2VV7 A;  4WZ4 A;  4EER A;  3MR0 A;  1HVB A;  4Y2F A;  2PR6 A;  4JF4 A;  3HVF A;  1Y54 A;  3ITB A;  4WBG A;  4R3A A;  3IF6 A;  5KSH A;  4K0W A;  2L1M A;  2ZMF A;  3IS2 A;  3LEQ A;  4K0X A;  3UE0 A;  3VMA A;  5HZH A;  2JN7 A;  3SH8 A;  5DTT A;  1E25 A;  5HFO A;  3LIC A;  2Y2L A;  2XDM A;  5AQ9 A;  3ZNT A;  4KG5 A;  3GTC A;  5A93 A;  4EQI A;  1WYC A;  1OTB A;  5CGX A;  5DJT A;  3IBR A;  4B93 A;  2WAD A;  4JXV A;  4S2P A;  1RCJ A;  1K4F A;  3NHQ A;  1KE0 A;  2XF3 A;  2B5R A;  3N6I A;  4ZDX A;  5HPF A;  4KG2 A;  1AWI A;  4Y13 A;  3HJI A;  3G2Y A;  3H82 A;  5CEB A;  4B4X A;  4I3I A;  4KQQ A;  1W63 M;  1LL9 A;  2ZOH A;  3EEH A;  5F6A A;  4ZTK A;  3MXR A;  3O86 A;  2ZOI A;  2P7J A;  2E8I A;  4GHI A;  1MWS A;  4K08 A;  3ICY A;  2VK3 A;  4GCZ A;  4R1G A;  1J9M A;  4QY6 A;  1QMF A;  1MKI A;  3R7W B;  3BFC A;  3HLE A;  4UA9 A;  2HP9 A;  2XD1 A;  3SOI A;  3CWF A;  2ZQ8 A;  4JF5 A;  4GLQ A;  1PZO A;  2C5W B;  1G6A A;  4Y7P A;  1KE3 A;  2EX8 A;  4IJG A;  4S2L A;  1GCE A;  1ERQ A;  3HUO A;  1GSW A;  3DTM A;  3Q7Z A;  4HJ3 A;  5M1A A;  2VV6 A;  2XFT A;  1U60 A;  3IH9 A;  2A24 B;  2DMW A;  5EM1 A;  5CGW A;  4I5S A;  5KIZ A;  1N4O A;  5AQB A;  4GS9 A;  1JVJ A;  3CAX A;  4LCM A;  1S66 L;  3VE4 A;  1OT6 A;  2OLU A;  1K57 A;  1TVF A;  1IYO A;  4MMN A;  3C2W A;  3OCN A;  4X1M A;  3CI6 A;  3LIE A;  3ZG5 A;  2X01 A;  1D1J A;  4OPZ A;  3TRC A;  3E2K A;  4LRX C;  1OPX A;  2G7U A;  4KZA A;  2EXB A;  4RYE A;  3BEB A;  2QPN A;  4BL3 A;  4BLM A;  4BWI A;  4R23 A;  2ZC7 A;  2LB5 A;  2Y2N A;  4PAU A;  2P04 A;  2ZQ7 A;  3R4K A;  5HWV A;  2ZD8 A;  1JWZ A;  1Z6F A;  4EXO A;  3EWK A;  3S4X A;  5EVI A;  1CJF A;  1K0K A;  1G6O A;  4PM7 A;  3V67 A;  1PZP A;  1V9Z A;  4E3J A;  1XFN A;  4BJP A;  5HWT A;  1L0F A;  2VGK A;  4GW9 A;  4ZJ3 A;  3W4Q A;  4NG2 A;  3DWZ A;  4Q8I A;  1ZHH B;  4DE3 A;  1GA0 A;  3TOI A;  1P0Z A;  2W3E A;  4ETZ A;  3VOL A;  3AGE A;  3LI8 A;  3KX0 X;  3FPV A;  3T1S A;  3V50 A;  3LGO A;  1H8M A;  4N1X A;  5FAP A;  3PHY A;  4LCL A;  3OPP A;  4YNR A;  4X68 A;  3PAE A;  3UE3 A;  3L9K A;  4E3I A;  2R78 A;  5GL9 A;  3AGF A;  2JC7 A;  4EUV A;  1ACF A;  3PTE A;  2XRN A;  1LLB A;  3ZCZ A;  4X53 A;  5L2F A;  5HDS A;  4KZB A;  2J9O A;  1P97 A;  3T4L A;  3T1X A;  4WZ5 C;  1YSQ A;  3N4I A;  4KZ4 A;  4H6J B;  1D06 A;  2OSU A;  4P6B A;  1SZV A;  5J8X A;  3W2Z A;  3ZHH A;  2QYB A;  1ERO A;  4MCW A;  4OLD A;  3PBN A;  1XJ2 A;  4JGQ A;  4R4R A;  4YFM A;  1NXY A;  2HJ9 C;  3N8R A;  1KVL A;  2Y2H A;  1TS8 A;  4II7 A;  3MXS A;  1UWP X;  4C75 A;  4G3K A;  1YMX A;  2C6W B;  3H7W B;  3WRZ A;  3RJU A;  1BUE A;  1UGU A;  3UE6 A;  2OWJ A;  4ARZ A;  3T4J A;  1LSW A;  2G2W A;  3F1N B;  3UY6 A;  1Y4O A;  2PAV P;  3TE8 A;  3LR5 A;  4HBU A;  4ESP A;  3MXQ A;  1N9O A;  4ZBE A;  4HH2 A;  3VFH A;  2XLN A;  5FEF A;  3OPR A;  4PM5 A;  3HBR A;  5HX9 A;  1T1A A;  1SDE A;  3U4L P;  1V9Y A;  5CHU A;  3HL9 A;  3SS3 A;  1KVM A;  4Y3I A;  3IHA A;  3SS4 A;  4NXG A;  3IXH A;  1CEF A;  4MBH A;  3IQA A;  1MWU A;  5J4E A;  5CEC A;  1VET B;  4YOF A;  3T4O A;  2J80 A;  1VEU B;  3MZF A;  3WS5 A;  3BY8 A;  2XR0 A;  1W63 Q;  3BEC A;  4OVD A;  4FH2 A;  4KUK A;  3LFV A;  2O9A A;  4KQD A;  1N9B A;  4UA7 A;  3L7H A;  4P0M A;  4HQA A;  2PRF A;  2WGW A;  1YLZ A;  1IOU A;  4RVA A;  4Y0O A;  2QWS A;  3VE3 A;  4RA7 A;  4Y5F A;  1FCO A;  5A91 A;  4S2O A;  1LT0 A;  1YMS A;  3K2N A;  4IVK A;  3A3D A;  3V3S A;  4HOI A;  4KZ7 A;  1PI5 A;  3PAG A;  2WYX A;  2A2L A;  1KGE A;  3NC8 A;  2P74 A;  4RQ9 A;  1IKG A;  4B4Z A;  4R3B A;  4KQO A;  1LL5 A;  4BMW A;  3RXX A;  1OJ5 A;  5L10 A;  5AQA A;  4MN7 A;  3LO7 A;  1DY6 A;  1MKM A;  1H0M A;  3MZE A;  1E3U D;  1TDL A;  1N9L A; 
#chains in the Genus database with same CATH homology
 4OQI A;  5EE8 A;  5HAI A;  4GKU A;  4L0L A;  5F1F A;  1WE4 A;  3MKF A;  2Y91 A;  3BFG A;  2DCF A;  3A3E A;  3CMZ A;  3NIA A;  1W7F A;  3EQV A;  4DDY A;  3G30 A;  2Y2P A;  2ZJ9 A;  4GN2 A;  4GDB A;  5CGS A;  4KEN B;  5M19 A;  1OME A;  5FSR A;  4OP5 A;  2GDN A;  4NET A;  4C6Y A;  3IF5 A;  4KZ9 A;  4PPR A;  3IHB A;  2ZMA A;  2XQZ A;  1GHM A;  2Y59 A;  5E2H A;  3UPN A;  4WZ4 A;  1EWZ A;  1XXM A;  3P98 A;  5JYO A;  4OQH A;  4DDS A;  4DXC A;  1HVB A;  3IWI A;  1YLT A;  4QY5 A;  4R3J A;  4DE0 A;  3GR2 A;  4CPK A;  5CTN A;  4JF4 A;  3HVF A;  1Y54 A;  3HUN A;  4JXW A;  1K25 A;  5EOO A;  2XEP A;  3ITB A;  4WBG A;  1G68 A;  2Y2O A;  3IF6 A;  3PBT A;  3Q82 A;  5TFQ A;  1O7E A;  5EVI D;  5I94 A;  5KSH A;  1IYQ A;  1K54 C;  4KQR A;  4K0W A;  3ZNY A;  3GV9 A;  4K0X A;  3UE0 A;  3VMA A;  2Y2I A;  3BFE A;  4OKP A;  2WAE A;  5HAQ A;  3SH8 A;  4LV1 A;  3QNB A;  5DTT A;  2Y55 A;  1E25 A;  4F94 A;  5HFO A;  1BSG A;  1FR6 A;  3LEZ A;  2Y2L A;  5DF9 A;  1YLJ A;  4FCF A;  3PBS A;  2WKE A;  5FQM A;  2H5S A;  4LV3 A;  4P85 A;  2XDM A;  4IED A;  1PWG A;  5AQ9 A;  3ZNT A;  5DF8 A;  3UPO A;  2QMI A;  4X55 A;  4KG5 A;  3GTC A;  5A93 A;  4EQI A;  1SCW A;  1FSW A;  1WYC A;  2EX9 A;  1LHY A;  1IYS A;  3PBR A;  3HRE A;  1NJ4 A;  5CGX A;  5FA7 A;  1DJC A;  5GLC A;  2WAD A;  1K55 A;  1XA7 A;  4S2M A;  3G32 A;  5FQJ A;  4KZ3 A;  1K4E A;  4JXV A;  3SH9 A;  4DE2 A;  4S2P A;  3QHY A;  1RCJ A;  1K4F A;  3IXG A;  4RX3 A;  1YLP A;  5FAS A;  1L2S A;  1E4D A;  3FWL A;  4WM9 A;  3OPH A;  3UDF A;  4JKT A;  1KE0 A;  2XF3 A;  3BRM A;  4OOL A;  1BTL A;  2B5R A;  1YQS A;  3N6I A;  4ZDX A;  1ZG6 A;  1JTG A;  4KG2 A;  4U3T A;  3B3X A;  2J9P A;  2XGN A;  3OCL A;  3VP0 A;  3G2Y A;  3UNW A;  5CEB A;  4B4X A;  3GMW A;  3FKV A;  4R0Q A;  1HTZ A;  1YLY A;  4E3O A;  4KQQ A;  4WMC D;  1LL9 A;  1KDW A;  2CC1 A;  4QB8 A;  2Y2G A;  3HLC A;  3GSG A;  4OQG A;  4ZTK A;  2PBY A;  4ID4 A;  5EUA A;  4EUZ A;  3IT9 A;  3ZG7 B;  3OPL A;  1K6R A;  1LI9 A;  3MXR A;  3O86 A;  4IBX A;  4N9K A;  3IH8 A;  2ZC5 B;  4Y0U A;  1TEM A;  3C7U A;  1H8Z A;  3ZG8 B;  4E3M A;  1NRF A;  4QJG A;  5KZH A;  2R9W A;  1CEG A;  3WRT A;  2E8I A;  4S2K A;  2V2F F;  1MWS A;  4WEK A;  5U47 A;  3EQU A;  4OLG A;  3G4P A;  2BLS A;  3M2J A;  4XXR A;  5GLD A;  2P9V B;  4R1G A;  4BEN A;  1JWV A;  1J9M A;  3CJM A;  4QY6 A;  5FI2 A;  2Z2M B;  3MFD A;  2ZLY A;  3A3F A;  1RGZ A;  1QMF A;  4GDN A;  1MKI A;  3BFC A;  3HLE A;  3V3R A;  1NYM A;  2Y2J A;  2HP9 A;  2XD1 A;  4UA9 A;  3SOI A;  2DRW A;  2Q9M A;  2ZQ8 A;  4GOG A;  3G31 A;  4JF5 A;  2A3U A;  1NYY A;  1MWT A;  1PZO A;  3O88 A;  5EPH A;  4S2J A;  2C5W B;  4QHC A;  1MXO A;  1G6A A;  4Y7P A;  5HAR A;  1KE3 A;  2EX8 A;  1L0D A;  3P09 A;  3FKW A;  4S2L A;  1GCE A;  1ERQ A;  3HUO A;  1MPL A;  1GHI A;  3IXD A;  4ZAM A;  4FD8 A;  3DTM A;  4PMA A;  3Q7Z A;  3G2Z A;  3UE1 A;  1I5Q A;  5M1A A;  4IVI A;  1K38 A;  2WKI A;  2WGW B;  2XFT A;  3Q7V B;  3BFF A;  1U60 A;  5M18 A;  3IH9 A;  4WZ5 A;  1DJB A;  5CGW A;  1K6S A;  2BG1 A;  3IF6 C;  1RP5 A;  1ES5 A;  1KGF A;  3Q1F A;  2ZQ9 A;  1PWC A;  1N4O A;  2Y4A A;  4E6X A;  1PWD A;  3HLF A;  4WEJ A;  1MBL A;  5DF7 A;  1ES2 A;  3G34 A;  5AQB A;  1JVJ A;  2XD5 A;  4LCM A;  1H8Y A;  2I72 A;  3N7W A;  3S1Y A;  5GHX A;  4D2O A;  5FAQ A;  1W79 A;  1HD8 A;  3NBL A;  1IKI A;  2Y2K A;  1IEM A;  2WGV A;  5FAO A;  5GLB A;  2H0T A;  3ISG A;  4MEZ A;  2OLU A;  2UWX A;  1K57 A;  5E43 A;  1TVF A;  1IYO A;  3TG9 A;  3W4O A;  1FCM A;  3IXB A;  5FQQ A;  3OCN A;  1FQG A;  4OON A;  3JYI A;  2X02 A;  4S2I A;  3VP1 A;  3ZG5 A;  2X01 A;  3W8K A;  4EWF A;  3FV7 A;  3HUM A;  4OPZ A;  5BOH A;  3E2K A;  3VP4 A;  1PYY A;  4PM8 A;  2PU4 A;  4BL2 A;  3ZDJ A;  4KZA A;  5HW3 A;  2EXB A;  1K55 C;  4RYE A;  4OOY A;  3ZG9 B;  2G2U A;  3BEB A;  2QPN A;  2H0Y A;  3VP2 A;  4BL3 A;  4EBP A;  2FFY A;  3BYD A;  4HEF A;  4BLM A;  5HL1 A;  4UHU A;  5CXW A;  1KDS A;  4R23 A;  3UO9 A;  4NK3 A;  4U0T A;  4DE1 A;  2ZC7 A;  3IWQ A;  2ZM2 A;  2A49 A;  2Y2N A;  2EX6 A;  2ZQ7 A;  4P87 A;  4DXB A;  4K91 A;  2VGJ A;  2ZD8 A;  3N8S A;  2HDS A;  1JWZ A;  1Z6F A;  4MNR A;  1L0G A;  2WGI A;  2V20 A;  2DNS A;  4LV0 A;  5A90 A;  1IEL A;  3S4X A;  5EVI A;  3HLG A;  4Z9Q A;  4JLF A;  4XUX A;  3LCE A;  3V39 A;  1WYB A;  3E2L A;  4PM7 A;  5HAP A;  1PZP A;  2OLV A;  4M3K A;  4RX2 A;  4E3J A;  1K56 D;  1W5D A;  2Q9N A;  4R4S A;  4BJP A;  3FZC A;  1ERM A;  1JTD A;  1L0F A;  2JCH A;  2VGK A;  3LY4 A;  3M2K A;  1NZU A;  1MWR A;  4ZJ3 A;  3W4Q A;  4FH4 A;  4LV2 A;  1NY0 A;  3DWZ A;  3IF6 B;  3RXW A;  2J7V A;  2X71 A;  3VOY A;  4DE3 A;  4Q8I A;  1GA0 A;  3HLW A;  5A92 A;  4KZ5 A;  3HLD A;  3TOI A;  2FFF B;  1DJA A;  4MBK A;  3AGE A;  3NDE A;  4XUZ A;  2Y2M A;  1XPB A;  3GQZ A;  5F1G A;  3V50 A;  4OH0 A;  5CRF A;  4MBF A;  4N1X A;  2H10 A;  2EXA A;  5FAP A;  5DTS A;  3NDG A;  4LCL A;  2V1Z A;  3OPP A;  4BD0 A;  4X68 A;  3PAE A;  3UE3 A;  5DTK A;  4E3I A;  5GL9 A;  2XH9 A;  3AGF A;  2JC7 A;  1RGY A;  3UN7 A;  1ES4 A;  3PTE A;  4OPQ A;  3WS0 A;  1NZO A;  2XFS A;  1LLB A;  2EFX A;  2ZQD A;  4JXG A;  3UDI A;  3VSK A;  3ZCZ A;  4X53 A;  5L2F A;  2HDU A;  4KZB A;  2J9O A;  1AXB A;  4E3L A;  1H5X A;  4WZ5 C;  5EVL A;  1ESI A;  5EEC A;  1CK3 A;  4WMC A;  3N4I A;  3S22 A;  4KZ4 A;  1CI8 A;  1GA9 A;  4KG6 A;  2OSU A;  4P6B A;  5GLA A;  3MBZ A;  3AGD A;  5J8X A;  2HPB A;  4X69 A;  4EBN A;  2IWD A;  1M40 A;  3ZHH A;  2ZQC A;  2WKH A;  5KSC A;  1W8Q A;  5CHJ A;  1BLP A;  1ERO A;  1PI4 A;  4OLD A;  3N8L A;  3PBN A;  1PIO A;  4R4R A;  4YFM A;  5E2G A;  2ZQA A;  4IBR A;  1MY8 A;  1NXY A;  1FR1 A;  3QNC A;  5G18 A;  2JE5 A;  4HBT A;  4E3N A;  1ES3 A;  2JBF A;  3N8R A;  3D4F A;  1KVL A;  2EFU A;  2WAF A;  2Y2H A;  2R9X A;  2RL3 A;  4GB7 A;  2ZM0 A;  5F83 A;  3DWK A;  3MXS A;  4C75 A;  3Q81 A;  5FDH A;  1S6R A;  1YMX A;  1ZC2 A;  2C6W B;  5F82 A;  3WRZ A;  3OZH A;  2XK1 A;  4S2N A;  1VQQ A;  3CG5 A;  3RJU A;  2Y2Q A;  3C4O A;  1BUE A;  1E3U A;  1PW8 A;  2HDR A;  2WK0 A;  2WUQ A;  2ZC3 B;  3O87 A;  4GNU A;  2G2W A;  4OPY A;  3VOZ A;  4OOM A;  1SDN A;  3LY3 A;  3ZG0 A;  3UY6 A;  1O07 A;  5CED A;  1BZA A;  1BT5 A;  4JXS A;  4N92 A;  1JWP A;  4FSF A;  4HBU A;  4QU3 A;  3ZFZ A;  5EVI C;  4JF6 A;  3WS2 A;  4KZ6 A;  4WEL A;  4KZ8 A;  2WZZ A;  3NI9 A;  1TDG A;  4ZBE A;  3VFH A;  2XLN A;  5FI6 A;  2IWB A;  3ITA A;  4GZB A;  1S0W A;  3OPR A;  5FQI A;  3SH7 A;  3VFF A;  4BD1 A;  4OQ0 A;  4PM5 A;  1W8Y A;  3HBR A;  4JPM A;  4DKI A;  1ALQ A;  2QZ6 A;  5HX9 A;  3C4P A;  4BQM A;  3NCK A;  3NY4 A;  3CZD A;  1KGG A;  1SDE A;  2HDQ A;  4ZJ2 A;  2PU2 A;  5CHU A;  3WS1 A;  5AQ7 A;  1QME A;  3HL9 A;  3SS3 A;  4E3K A;  1YT4 A;  1KVM A;  4JBF A;  1YLW A;  1XGI A;  5CHM A;  3IHA A;  3O3V A;  1ZG4 A;  3BLS A;  5E2E A;  3SS4 A;  3IXH A;  1CEF A;  3PBQ A;  3BLM A;  4MBH A;  3A3J A;  3IQA A;  2HP5 A;  5GHY A;  1HZO A;  5CER A;  1PW1 A;  5JYP A;  1MWU A;  1C3B A;  2Z2L B;  1L0E A;  1I2W A;  3FYZ A;  3OC2 A;  1BLS A;  5TR7 A;  1ZKJ A;  4C3Q A;  4UA6 A;  2EX2 A;  1BLC A;  5CEC A;  5DVA A;  1BLH A;  1Q2P A;  3VSL A;  2ZM8 A;  1ESU A;  1EI5 A;  1K54 A;  3BFD A;  2J8Y A;  3MZF A;  3C7V A;  1I2S A;  2OV5 A;  4PM9 A;  3C5A A;  4E6W A;  3WS4 A;  2P9V A;  3BM6 A;  4Y0T A;  5CTM A;  3MKE A;  1FOF A;  3WS5 A;  1IYP A;  2XR0 A;  3BEC A;  4HES A;  4X6T A;  4OVD A;  3GRJ A;  3HLB A;  4OPR A;  5TGF A;  1FCN A;  4FH2 A;  2WZX A;  1XKZ A;  4DF6 A;  2ZC6 B;  4ZJ1 A;  1N9B A;  4UA7 A;  1K56 A;  5D3O A;  3UPP A;  4DRT A;  3DW0 A;  4P0M A;  1ONH A;  3GVB A;  3IWO A;  4H8R A;  3M6H A;  2WGW A;  1GHP A;  1YLZ A;  3Q7V A;  4N1H A;  1YM1 A;  4OP8 A;  4RVA A;  1KE4 A;  2HP6 A;  4Y0O A;  5E2F A;  4RA7 A;  4U0X A;  3Q07 A;  5EVI B;  1FCO A;  4EBL A;  3PBO A;  5A91 A;  4S2O A;  3ZVT A;  1YMS A;  4WYY A;  3VP3 A;  5KMW A;  3M6B A;  3I7J A;  4IVK A;  3A3D A;  3TSG A;  3V3S A;  4KZ7 A;  5GHZ A;  1PI5 A;  4CJN A;  5FI7 A;  1LI0 A;  4EV4 A;  3PAG A;  2WYX A;  2ZC4 B;  1KGE A;  1XP4 A;  1FSY A;  4GD6 A;  4O7D A;  4GD8 A;  3MZD A;  4UAA A;  3NC8 A;  5FAT A;  2IWC A;  5FQ9 A;  1XA1 A;  2P74 A;  3UDX A;  4N9L A;  1SHV A;  4S2N C;  1XGJ A;  1VM1 A;  4X56 A;  5EOE A;  4YIN A;  4PM6 A;  1BUL A;  1IKG A;  3G35 A;  4B4Z A;  4LEN A;  4R3B A;  4KQO A;  3ZVW A;  1LL5 A;  1K57 C;  5IHV A;  3W4P A;  3RXX A;  1CI9 A;  1M6K A;  2RCX A;  1XX2 A;  4A5R A;  4QD4 A;  1SKF A;  3SS5 A;  3A3I A;  3V5M A;  4B88 A;  3WWX A;  3ZGA B;  5AQA A;  3LO7 A;  1DY6 A;  1ONG A;  5FQK A;  3MZE A;  4MLL A;  1E3U D;  1Q2Q A;  1TDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...