4IEDA

Crystal structure of fus-1 (oxa-85), a class d beta-lactamase from fusobacterium nucleatum subsp. polymorphum
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
242
structure length
241
Chain Sequence
NENQFMKEIFERKGLNGTFVVYDLKNDKIDYYNLDRANERFYPASSFIFNTLIGLENGIVKNVDEMFYYYDGSKVFLDSWAKDSNLRYAIKVSQVPAYKKLARELGKERMQEGLNKLNYGNKEIGSEIDKFWLEGPLKISAMEQVKLLNLLSQSKLPFKLENQEQVKDITILEKKDDFILHGKTGWATDNIVVPIGWFVGWIETSDNIYSFAINLDISDSKFLPKREEIVREYFKNINVIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Class D beta-lactamase
publication title Crystal Structure of FUS-1 (OXA-85), a Class D beta-lactamase from Fusobacterium nucleatum subsp. polymorphum
rcsb
source organism Fusobacterium nucleatum subsp. polymorphum
total genus 84
structure length 241
sequence length 242
chains with identical sequence B, C, D
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2012-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4iedA00
1KVLA 1MKIA 2JE5A 1KVMA 4KQOA 4UAAA 1WE4A 4ZAMA 3GR2A 3NBLA 3W4OA 4E3LA 3G4PA 4DF6A 3BLSA 4OLDA 3V39A 1L0EA 4DXCA 4PM6A 3SH9A 4Y0TA 3I7JA 2C5WB 4X53A 3UY6A 3VFHA 3ZG5A 3A3IA 3HL9A 2Y2QA 1C3BA 1GHPA 1N9BA 4WEJA 3HLBA 4LENA 1XGJA 3OZHA 3WS0A 5KZHA 4R4SA 4BJPA 4X6TA 5EOOA 1W8YA 1M40A 4P0MA 3ZG0A 1ERMA 1GA9A 2ZLYA 2BG1A 2J7VA 1NZUA 2OSUA 1PZPA 2R9WA 5FI7A 4O7DA 5HFOA 1YQSA 1YMXA 2J9PA 2P9VB 2Z2LB 5DTKA 5GHYA 5U47A 2ZC5B 1GCEA 1H8ZA 4R23A 2WAFA 4HBUA 1PW8A 2ZQCA 4B4ZA 1PI5A 5AQBA 3OPRA 5AQ9A 3HUMA 3A3EA 2GDNA 3O86A 4OH0A 1BLSA 2HDQA 4R3BA 3V50A 3BECA 4QD4A 2WGWA 1K38A 4U0TA 4WM9A 2EXAA 1L0GA 4EBNA 1YT4A 5M19A 5KSCA 1FSYA 1ZG4A 1K57A 3UPNA 1BTLA 1BSGA 4PM7A 4EV4A 1K54A 3Q7VA 1K57C 1WYCA 4OOLA 3Q1FA 3DWKA 4KZAA 4K91A 1K54C 1VM1A 3LY3A 4QU3A 1K55A 3JYIA 3SS3A 1XA1A 2ZC4B 3MZFA 2WZXA 3WS5A 1AXBA 1CK3A 2WK0A 5EOEA 1K55C 3G34A 3WS4A 5EPHA 5TGFA 1PWDA 4KZ8A 2XDMA 4B88A 1LI0A 4JF6A 3IQAA 1HD8A 3OCNA 5FQKA 3UPOA 2X71A 3IHAA 1E4DA 4MNRA 4X55A 2IWDA 4BD1A 3IWOA 2G2UA 4PMAA 5E2GA 3P98A 3TSGA 3HREA 1E25A 4WZ4A 1PI4A 2A3UA 4OQIA 4OLGA 5CHJA 4BLMA 4EBPA 1ONGA 4QB8A 3VP0A 4DE3A 1GA0A 2X01A 4PPRA 3OPHA 2FFFB 4PM5A 2EFXA 4S2KA 1QMEA 1PYYA 1I2WA 4BQMA 4FH4A 5GL9A 3UNWA 4FCFA 3C4PA 1K4FA 3IF6A 4KZBA 3W4QA 5DF9A 1DJCA 3OC2A 1LI9A 2ZQ7A 4MBFA 3NY4A 2Y2OA 4ZTKA 1KDWA 3A3JA 4DKIA 4UA6A 3IH9A 2IWCA 3Q07A 2WZZA 1MWTA 4E3MA 1YLWA 4OP5A 5E2FA 5FAPA 4KG2A 2WKIA 3BFEA 1QMFA 1SDNA 3C4OA 4GNUA 4X68A 4E3IA 2ZC3B 2QMIA 4KG6A 2B5RA 4LCMA 2QZ6A 4UA9A 5EVIA 2QPNA 4HEFA 4DXBA 1K56D 2H0YA 4RX3A 2JBFA 4E6WA 3DW0A 5D3OA 5E43A 5AQ7A 3ZG7B 5EVIC 5CEBA 3AGFA 2WUQA 1YLJA 1XP4A 3G2ZA 4R4RA 5IHVA 3EQVA 4Y0OA 3ZNTA 3ZG8B 1SCWA 2DRWA 4KG5A 3VSKA 1MXOA 4OPZA 3FYZA 4N9KA 3IH8A 4OQHA 4KENB 1Z6FA 2ZQ9A 3ZCZA 2XEPA 4NK3A 4KQRA 4DE0A 4GKUA 4RA7A 3UE0A 1O07A 3G30A 1BLCA 1JTDA 4KZ7A 4P6BA 4XUXA 3HUNA 3ZDJA 4EUZA 4ZJ1A 4E3OA 2Y2IA 5F82A 4E6XA 1MY8A 1CI8A 1FSWA 4KZ5A 1PW1A 3S1YA 2HDUA 2H5SA 3W8KA 2Q9NA 1YMSA 4DRTA 2EFUA 3C7VA 3PBRA 4HBTA 1PZOA 3UDIA 1G68A 4JKTA 1EWZA 4JF4A 4GOGA 3QHYA 3VFFA 4JXWA 3LEZA 3NDGA 1ES4A 1ES2A 4OQGA 1ESIA 1ONHA 2HPBA 3TG9A 3UN7A 3IWIA 2WGWB 5CGXA 3CMZA 5G18A 2XLNA 4GN2A 1XPBA 1HVBA 3VSLA 2Y91A 3V5MA 5L2FA 3DWZA 2PU4A 1W8QA 1Q2PA 3BRMA 2Y2GA 3O88A 4YFMA 5GLCA 2A49A 1FCMA 3G31A 3Q7VB 1NZOA 4OOMA 3QNBA 1ES5A 3WRZA 1W5DA 1M6KA 5FQMA 1U60A 3UPPA 2PU2A 1LLBA 3S4XA 5GLBA 3M6BA 2DCFA 4KQQA 3SS5A 3RXXA 4IBRA 3MBZA 1PWGA 1FOFA 1XX2A 1TDLA 2BLSA 3IHBA 4A5RA 2HP9A 1BUEA 1I2SA 3BEBA 2ZMAA 3SH7A 4Z9QA 4OPRA 1L0FA 1RGZA 3LY4A 2EX2A 4FH2A 5CRFA 5FAOA 4FD8A 2ZC7A 4XUZA 4KZ6A 1VQQA 1NXYA 4OPYA 3DTMA 2ZQAA 2ZC6B 1IKIA 4GDBA 3WS2A 2WKHA 2ZQ8A 4C6YA 5FQIA 3BYDA 3W4PA 4N1XA 4CJNA 1S0WA 4PM9A 2UWXA 3HLCA 4F94A 2ZD8A 2EX6A 3IF6B 4OKPA 1SHVA 3BFGA 4P87A 2Y55A 3N7WA 4N92A 1ZG6A 3GSGA 4C75A 1XA7A 3V3RA 2Y2PA 3SOIA 3FZCA 4UA7A 4X69A 4ID4A 5HX9A 3ZFZA 3G35A 3EQUA 2J9OA 3TOIA 1FCOA 1OMEA 3D4FA 3E2LA 4C3QA 2DNSA 1IYSA 3P09A 4ZJ2A 1JTGA 1DJBA 2X02A 1O7EA 3HLEA 5EVIB 5CERA 1YM1A 4S2LA 2H10A 1NJ4A 4WELA 1KGGA 5A92A 3VMAA 5HAPA 1DY6A 4RYEA 4S2MA 1CI9A 4DE1A 3GVBA 3N8LA 3PBNA 5DVAA 4OVDA 3S22A 3PBQA 5BOHA 5CEDA 4BL2A 1GHMA 3BFCA 2I72A 3M2JA 2VGKA 4RX2A 3MKFA 3UO9A 3G32A 2XGNA 3RJUA 3A3DA 4S2PA 2HP6A 5FI6A 3ZHHA 3NIAA 5EVID 3VOZA 3CG5A 3Q81A 4LCLA 1WYBA 1I5QA 2OV5A 2ZM0A 4KZ3A 4NETA 2XFTA 5CGWA 5EUAA 3SH8A 1HTZA 1L2SA 3CZDA 3IXGA 5DTSA 1HZOA 3WRTA 5GLAA 1K25A 5FI2A 4DE2A 4QJGA 5J8XA 4S2IA 4ZBEA 2WGVA 4JLFA 3OCLA 4WMCD 4X56A 5E2HA 4WZ5C 3WS1A 3FKVA 3O87A 2XQZA 4Y7PA 1FR1A 3A3FA 1MWRA 1K6RA 5A90A 4WMCA 1CEGA 1NY0A 5CHMA 3BLMA 2IWBA 3PAGA 3PBTA 3HLFA 4JPMA 3NI9A 5FQQA 1DJAA 4N1HA 1KGEA 3GQZA 1MBLA 2J8YA 3C7UA 2WKEA 1XKZA 1YLPA 3IF5A 1ZKJA 3NDEA 4JBFA 3WWXA 3SS4A 3MZDA 4QHCA 5GHXA 1KDSA 3VP1A 3CJMA 5HL1A 1JWZA 3B3XA 3ZVTA 2ZQDA 3FKWA 3MXSA 2ZJ9A 5CHUA 2V20A 5CECA 5A91A 1TVFA 4S2JA 5GHZA 4LV1A 1Y54A 5FA7A 5HAIA 4E3JA 3M6HA 5CTNA 5EE8A 4R0QA 5I94A 3BFFA 5HARA 3AGDA 2P74A 4QY5A 2VGJA 1EI5A 1NRFA 2JC7A 1BZAA 1JWPA 3Q7ZA 4E3KA 4MBHA 1JVJA 3GRJA 2H0TA 4EBLA 2Y2KA 1IKGA 2JCHA 3HVFA 2Y2NA 5GLDA 2HP5A 2Y2LA 5AQAA 3O3VA 1KE3A 5FAQA 4QY6A 2Y2HA 4MLLA 3ZGAB 1FCNA 1IELA 3VP2A 3MFDA 4U3TA 1W7FA 2OLVA 2CC1A 1GHIA 5F1GA 4IEDA 1YLTA 1BLPA 1IYPA 1PWCA 3PBSA 4GB7A 2C6WB 2WGIA 5DTTA 4EWFA 2XD5A 4LV3A 3N8RA 5CGSA 3HLWA 3MXRA 2Y2MA 3N8SA 1W79A 3UDFA 3N6IA 1H5XA 3MKEA 3NC8A 3GTCA 4IVIA 3PTEA 5FDHA 4WYYA 1H8YA 4WEKA 3VOYA 3V3SA 1J9MA 4ZJ3A 4D2OA 1NYYA 1BULA 4EQIA 2WAEA 1S6RA 3G2YA 3HBRA 5DF8A 4BL3A 4R1GA 3BFDA 3LCEA 3LO7A 1KGFA 3IXHA 5A93A 2G2WA 2WADA 3BM6A 4PM8A 3ISGA 5HW3A 2ZM8A 4H8RA 1IEMA 2HDSA 3QNCA 4KZ9A 4S2NA 2Z2MB 4XXRA 1ZC2A 3RXWA 3OPPA 4FSFA 2P9VA 2Y59A 4WBGA 3HLGA 2V1ZA 4S2NC 3FV7A 2PBYA 3IT9A 1FR6A 2XK1A 1FQGA 1N4OA 3ZVWA 4ZDXA 5F1FA 3E2KA 4Q8IA 1ERQA 1G6AA 3HLDA 2XH9A 1TDGA 1XXMA 1BLHA 5TFQA 2XF3A 1Q2QA 2EX9A 5EECA 5TR7A 4IBXA 1PIOA 4LV2A 1YLZA 4UHUA 2FFYA 1YLYA 1LHYA 4RVAA 4BD0A 1JWVA 4IVKA 3C5AA 4OQ0A 4GD8A 2ZM2A 3ITBA 1SDEA 5JYOA 2EX8A 4K0WA 4JXSA 5CTMA 1BT5A 4E3NA 4WZ5A 1MWSA 1TEMA 3FWLA 1E3UD 4R3JA 1ESUA 4BENA 1RP5A 4YINA 2XD1A 1KE0A 2EXBA 4DDYA 3IF6C 2HDRA 4LV0A 3HUOA 5E2EA 2RCXA 1IYQA 1LL9A 4GZBA 1E3UA 5KMWA 4KZ4A 3AGEA 1KE4A 5KSHA 4P85A 3N4IA 3UE1A 4U0XA 4JF5A 2RL3A 5FQJA 3M2KA 3MZEA 5CXWA 3Q82A 1CEFA 5DF7A 4L0LA 5EVLA 4K0XA 2Y2JA 5FATA 5JYPA 3VP3A 3IXDA 4GDNA 1NYMA 2XFSA 4MBKA 3NCKA 4OP8A 5FASA 4Y0UA 4JXGA 4OOYA 4MEZA 1ALQA 3PAEA 1K56A 4S2OA 3ZNYA 3GV9A 1SKFA 3PBOA 5HAQA 5M1AA 1ES3A 2OLUA 1MWUA 4OONA 4B4XA 1RGYA 1LL5A 1MPLA 5F83A 2Y4AA 2WYXA 3ZG9B 2V2FF 1K4EA 2R9XA 3GMWA 3UDXA 5M18A 4HESA 1IYOA 5FSRA 2Q9MA 3UE3A 4DDSA 4N9LA 3ITAA 4M3KA 3IWQA 4CPKA 2XR0A 4GD6A 4JXVA 1EROA 1K6SA 3VP4A 3IXBA 3OPLA 2E8IA 1L0DA 1RCJA 4OPQA 5FQ9A 1XGIA
chains in the Genus database with same CATH superfamily
1MKIA 2JE5A 3UB6A 3NBLA 3W4OA 1JNUA 4BWIA 3UMDA 3BLSA 3LEQA 3V39A 4DXCA 4Y0TA 2C5WB 3UY6A 3H82A 3HL9A 1C3BA 1N9BA 3UE6A 4LENA 3EEAA 2WKQA 2ZLYA 2OSUA 2ZMVA 1TF1A 5GHYA 3KYZA 4H6JA 5TBMB 3JPUA 1H8ZA 4R23A 2WAFA 4B4ZA 1D7EA 5AQ9A 3HUMA 2GDNA 2HDQA 4R3BA 4QD4A 4L9EA 1K38A 4WUJA 4NXGA 4EBNA 5KSCA 4UQIS 3UPNA 2J3TD 1BSGA 5EM1A 1K54A 3Q7VA 3EGDC 3T4QA 2W3DA 3JYIA 2O99A 4KUKA 1AXBA 3F1OB 1K55C 3G34A 3WS4A 1F2KA 1PWDA 4KZ8A 1SZVA 4JF6A 3CAXA 3IQAA 2D02A 5E2GA 3P98A 3TSGA 1T1CA 3HREA 5CHJA 4BLMA 2X01A 4PPRA 2FFFB 2PAVP 1PYYA 4FCFA 3C4PA 4KZBA 2HJ9C 3W4QA 4DN0A 1DJCA 3LIFA 4F3LA 5HD3A 4PHTA 3A3JA 3ZQ5A 1XFQA 3Q07A 2WZZA 4E3MA 1YLWA 2W1TB 5HWWA 1DP6A 3RH8B 4X68A 3VOLA 2QMIA 4LCMA 3PXPA 1K56D 2JN7A 2W3GA 1LT0A 5EVIC 1VB6A 5IHVA 3EQVA 1SCWA 2O0YA 4KG5A 3H82B 3IH8A 3T4KA 4DE0A 2J3WA 3VE4A 4GKUA 3UE0A 4EUZA 4E6XA 1FSWA 4KZ5A 1PW1A 3S1YA 1HLUP 3W8KA 4H6JB 3C7VA 4HBTA 1PZOA 1G68A 3LEZA 1Y28A 1ES2A 1ONHA 2HPBA 5G18A 3VSLA 3V5MA 5L2FA 1DRMA 2PU4A 3O88A 2A49A 3Q7VB 4NXFA 3QNBA 4ESPA 2PU2A 2O9AA 4GHIA 2YKHA 4HY8A 3MBZA 1TDLA 3BQAA 2ZMAA 1L0FA 1RGZA 3LY4A 5CRFA 5FAOA 2ZC7A 3CPTA 2JHEA 4NG2A 2ZQAA 2ZC6B 4GDBA 3HJKA 5HD5A 2OWHA 2ZQ8A 3WS2A 3KX0X 1YSQA 1OT6A 4WN5A 5G4ZA 2EX6A 4OKPA 1SHVA 1YSPA 3N7WA 3BQ8A 4F3LB 2K31A 4B9OA 3A0VA 3TOIA 1OMEA 3P09A 2VK3A 3PYPA 3HLEA 5CX7A 2H10A 2LB9A 1KGGA 4Y17A 2GX5A 1DY6A 1NWZA 1CI9A 4DE1A 3GVBA 3C30A 3S22A 3PBNA 2VGKA 2HP6A 3VOZA 3IX8A 1I5QA 3LR3A 3SH8A 1G5UA 1HZOA 5GLAA 1VETB 5J8XA 3UB9A 2P04A 3O87A 5K5BA 1FR1A 3A3FA 1OTIA 4IUHA 2QYBA 5DKLA 2IWBA 2KDKA 3C2WA 1H3QA 4N1HA 3GQZA 3C7UA 2WKEA 1XKZA 1YLPA 3WWXA 4QHCA 5GHXA 4P6ZS 3VP1A 5HDSA 3KYQA 4GHIB 3B47A 4PKYA 3E4PA 1PFLA 1Y54A 4R0QA 3BFFA 2G7UA 1NRFA 3CPTB 1EW0A 3BY8A 1MC0A 4MBHA 3F1NA 3LR5A 2JCHA 4MMNA 5FAQA 4MLLA 1CQAA 3VP2A 3MFDA 4IEDA 5FL3A 2C6WB 3DBAA 4LV3A 3N8RA 3T4JA 3MXRA 3SZTA 4HP9A 3N6IA 3GTCA 1S66L 1J3WA 1H8YA 4WEKA 1J9MA 4ZJ3A 1PNEA 2V9AA 4EESA 4EQIA 3IXHA 4PM8A 2VGLS 2ZM8A 3QNCA 4XXRA 1ZC2A 1IFQA 4FSFA 2P9VA 5HDCA 3HLGA 2V1ZA 2Z6CA 3FV7A 1N4OA 5F6AA 5F1FA 1ERQA 4II7A 2XH9A 2XA7M 1DP8A 1XXMA 1Q2QA 2EX9A 2W3EA 5EECA 5TR7A 4HP4A 1PIOA 4LV2A 3UMEA 4Y15A 1LHYA 2V0UA 4BD0A 3S7PA 2B02A 3LIDA 3ITBA 4K0WA 3CUEA 4JXSA 4WZ5A 1TEMA 2XD1A 2EXBA 4LV0A 3HUOA 4GZBA 3FPWA 4FUWA 3D3OA 1KE4A 2UV0E 1GSXA 3CWFA 3MZEA 3Q82A 4RQ9A 4K0XA 3VP3A 4EUVA 3S7NA 2PBDP 3SW1A 4O8GA 4JXGA 3PAEA 1XJ3A 5F5YA 3H7WA 4B4XA 1LL5A 2WYXA 3GMWA 5FSRA 2Q9MA 4DDSA 2K2NA 2V8CA 3VP4A 1P9RA 1L0DA 4KQOA 5IT5A 1L0EA 3I7JA 3PHYA 1ODVA 2Y2QA 3D72A 4WEJA 3WS0A 3OZHA 5KZHA 3LI8A 4BJPA 5EOOA 1W8YA 1M40A 4P0MA 1ERMA 1NZUA 1PZPA 2VJWA 5FI7A 4O7DA 3UB8A 2J9PA 1YMXA 2P9VB 2PRFA 2ZMFA 2JKFA 2ZC5B 3LIEA 3DTKA 3O86A 3A3EA 1BLSA 1S4SA 2I9VA 1ZG4A 1K57A 4Y3IA 1BTLA 2QJ5A 2DMWA 1XJ6A 2FH5A 3DWKA 4QU3A 3LFVA 2WZXA 4EW7A 2WK0A 2FZ0A 3T1QB 5LBRA 3C8CA 1HD8A 5MC7A 3UPOA 4BD1A 3IWOA 4PMAA 4I3IA 2QJ7A 1E25A 1PI4A 4PM5A 4S2KA 1QMEA 1K4FA 3IX4A 2QWSA 3F1OA 1LL8A 2L1MA 1LI9A 2M7VA 2VKSA 3H7WB 5AJGA 2IWCA 4CQHA 1N9NA 4Q0HA 5E2FA 2PD7A 5FAPA 5A8BA 1QMFA 4E3IA 2H0YA 4RX3A 4HNBA 5DJTA 1XP4A 4R4RA 4Y0OA 3ZG8B 3VSKA 3FYZA 1STZA 4OQHA 4KENB 3LYXA 1T19A 4I38A 4KQRA 1BLCA 1JTDA 3HUNA 3ZDJA 1DP9A 4E3OA 1MY8A 1CI8A 2HDUA 2H5SA 2Q9NA 4DRTA 2EFUA 1F9IA 4UQIM 3K3DA 2O9BA 5L09A 5J4EA 3VFFA 3NDGA 1ES4A 3LR4A 3KYEA 1ESIA 2NUPC 2D01A 5CGXA 2Y91A 1W8QA 1Q2PA 4YFMA 2NUTC 1FCMA 4OOMA 5EM0A 1UGUA 1M6KA 3NJAA 1LLBA 5GLBA 5FEFA 3M6BA 4KQQA 1P9WA 4WL9A 4HQAA 1PWGA 4JGRA 1I2SA 4FH2A 4FD8A 4XUZA 4KZ6A 4OPYA 1IKIA 3W4PA 4N1XA 4CJNA 1S0WA 4PM9A 2V8FA 4K08A 4F94A 4Y2FA 4N92A 1PRQA 3MJQA 4C75A 1XA7A 3V3RA 2Y2PA 4ID4A 5HX9A 3G35A 4WLAA 2KLIA 3D4FA 1O7EA 5CERA 1YM1A 3L9KA 2M7UA 4EQ1A 1VHMA 4CLCD 2ACGA 4BBUA 3N8LA 3PBQA 5CEDA 3ZYTA 1GHMA 3LGOA 4RX2A 3MKFA 5G4YA 4O0PA 2XSSA 4S2PA 3CG5A 1OTDA 5EUAA 4EERA 1D06A 1N9LA 3VE3A 3P01A 2WGVA 5E2HA 1A0KA 4WZ5C 4FTXA 2P7JA 1MWRA 3BLMA 3PAGA 3PBTA 3HLFA 3NI9A 2EWWA 4I3JA 2J8YA 2LB5A 2BASA 4JBFA 3SS4A 3MZDA 4CLCE 1KDSA 3CJMA 1VETA 1JWZA 2ZJ9A 5CHUA 1TVFA 4S2JA 5FA7A 4HH2A 4E3JA 5CTNA 5EE8A 3QP1A 5HARA 2JC7A 2EA9A 1JVJA 3GRJA 2ZOHA 2Y2KA 4DJ3A 3HVFA 2Y2NA 5AQAA 3T50A 4EEUA 3T4SA 4XT2B 1FCNA 4Q0IA 4U3TA 1W7FA 2OLVA 2CC1A 1PWCA 2PYRA 3NOUC 5DTTA 4EWFA 3KSGA 5CGSA 4IUKA 4X1LA 3PTEA 3S7OA 2PYPA 3OLOA 2WAEA 3TE8A 5FEGA 5DF8A 4BL3A 4R1GA 3BFDA 3LCEA 5A93A 2VZWA 3BM6A 4I3AA 4H8RA 2V1AA 4KZ9A 3VV4A 3RXWA 2V1BA 4S2NC 2PBYA 1FR6A 2XK1A 1FQGA 3ZVWA 3MFXA 2J3TC 1OTEA 1F98A 1TS6A 1TDGA 1BLHA 5HDDA 4P6ZM 4IBXA 5EV0A 3R7WB 2OOLA 1OT9A 4IVKA 1T1AA 3JVVA 4OQ0A 2M1CA 5JYOA 4M4XA 2EX8A 3KSHA 3DTEA 1BT5A 1K0KA 1MWSA 4GS9A 3FWLA 1E3UD 1ESUA 1RP5A 1KE0A 4DDYA 4O01A 5E2EA 2RCXA 1LL9A 5KSHA 3AGEA 4P85A 3BY9A 4JF5A 4BBTA 1P0ZA 5FDSA 5EVLA 3QP5A 3IXDA 2JKTM 1NYMA 2INWA 4Y0UA 4OOYA 1ALQA 4R6LA 2H28A 3GV9A 5M1AA 2OLUA 1MWUA 2Y4AA 1K4EA 1IYOA 5I5LA 3ITAA 4M3KA 3FG8A 4CPKA 4JXVA 3IXBA 3OPLA 2E8IA 4OPQA 5FQ9A 1XGIA 1KVMA 1G28A 1WE4A 4ZAMA 4E3LA 4DJ2A 3IBRA 4DF6A 1TS0A 2VGLM 1CJFA 4OLDA 4PM6A 3SH9A 3A3IA 1GHPA 3HLBA 4R4SA 3GECA 3ZG0A 3P7NA 1GA9A 3KSFA 2J7VA 4GCZA 1OJGA 2R9WA 2XRNA 1YQSA 5DTKA 5U47A 2Z2LB 5HPIA 1PW8A 4KUOA 2ZQCA 5AQBA 4HIAA 3OPRA 4LGWA 3BECA 2WGWA 1L0GA 3T4TA 4IHQA 1FSYA 4MDZA 4EV4A 3C38A 4OOLA 3Q1FA 5DKKA 2JKRM 4KZAA 4K91A 1K54C 4DMZA 1K55A 1XA1A 3WS5A 4GS9B 1CK3A 3BW6A 1XFNA 5TGFA 1N9OA 2PR6A 3DAVA 3OCNA 4PKYG 5FQKA 2X71A 3IHAA 1E4DA 3QP6A 4MNRA 2IWDA 2G2UA 3DTIA 2BTFP 2HF6A 4WZ4A 2A3UA 4OQIA 4OLGA 3A0RA 1ONGA 4QB8A 1GA0A 5EVEA 3OPHA 2EFXA 4BQMA 4FH4A 5GL9A 3UNWA 3IF6A 4JGPA 5DF9A 4YNRA 3U2AA 1S67L 2ZQ7A 4MBFA 2Y2OA 4ZTKA 4DKIA 3IH9A 1MWTA 4KG2A 3EOIA 4KG6A 5EVIA 2OAP1 4HEFA 2JBFA 4YWZA 3DW0A 5D3OA 5AQ7A 2WUQA 3ZNTA 4OPZA 3G6OA 1Z6FA 4WF0A 3ZCZA 2XEPA 4NK3A 3G30A 4KZ7A 4XUXA 5AVEA 4P6BA 5DFXA 4I5SA 2Y2IA 1YMSA 3PBRA 1EWZA 4JF4A 4GOGA 2ZBBA 4D60A 4JXWA 4OQGA 3TG9A 2WGWB 1H8MA 4X1MA 2XLNA 4GN2A 3E0YA 1HVBA 1NLYA 3BRMA 2Y2GA 3G31A 3W2ZA 1ES5A 3WRZA 5FQMA 1U60A 3UPPA 3S4XA 2DCFA 3H9WA 4QWOA 4IBRA 1XX2A 3MQQA 4UEYA 1BUEA 2W3HA 3SH7A 4Z9QA 2EX2A 3MQ0A 4HI4A 3DTMA 1KOUA 2WKHA 4Y13A 1S1ZA 5FQIA 3BYDA 2ZD8A 3IF6B 4G3KA 3BFGA 4P87A 2Y55A 4Y5FA 2Y79A 3SOIA 3FZCA 3ZFZA 2HGVA 4C3QA 5IS1A 2DNSA 1IYSA 1DJBA 5EVIB 1NJ4A 2JKGA 5A92A 5HAPA 2A24B 3NOTC 4RYEA 5BOHA 1P97A 3BFCA 2I72A 3M2JA 4BBVA 3G32A 2XGNA 3LIBA 3O5YA 4CLCA 3A3DA 5FI6A 3ZHHA 5EVID 3Q81A 4LCLA 3BWLA 4KZ3A 4NETA 5CGWA 4EEPA 5IU1A 1HTZA 1L2SA 3CZDA 5EFWA 1K25A 4DE2A 4ZBEA 4WMCD 1BYWA 3FKVA 2XQZA 3JVUA 4YOFA 5A90A 1CEGA 2A2LA 5FQQA 3LICA 1ZKJA 2L4RA 5HL1A 3B3XA 3ZVTA 1OPXA 1CF0A 3FKWA 3MXSA 5HWTA 2V20A 5CECA 5A91A 3LUQA 4LV1A 3M6HA 5I94A 3PR6A 3AGDA 4NXBA 1BZAA 1JWPA 3CITA 4EBLA 1IKGA 4HH3A 5GLDA 2Y2LA 4NXEA 1KE3A 2W0NA 5L8MA 4QY6A 2Y2HA 5F1GA 1GHIA 5L07A 5KIZA 1IYPA 2WGIA 2XD5A 1XJ4A 3HLWA 2HJEA 2Y2MA 2AVXA 1H5XA 3MKEA 5FDHA 4WYYA 1L3LA 2VLGA 3VOYA 1G6OA 1AWIA 4XT2A 1S6RA 4HJ4A 2VV7A 1T18A 3HBRA 2R78A 4CLCB 1V9ZA 3ISGA 4GJ4A 3OBFA 2Z2MB 3OPPA 2K7SA 3E98A 4LRZE 5F69A 1W63Q 2YKFA 4ZDXA 2EWVA 3E2KA 3IS2B 4Q8IA 1G6AA 3HLDA 3TJZC 3UB5P 2ZL1A 3B42A 5TFQA 2XF3A 1ACFA 1Y4OA 4NEED 4L9GA 1X0OA 1JWVA 2CMNA 2ZM2A 1SDEA 3RTYA 2PDRA 1IOUA 4E3NA 5J7EA 3CUEC 4YINA 1NRJA 1F5MA 3IF6C 1VEUA 1IYQA 2OWJA 3QP4A 2J80A 1E3UA 2JKTI 4AFIA 5FQJA 3M2KA 5CXWA 3R7WA 1CEFA 2E8JA 4L0LA 2PT7A 5FATA 4EU0A 3GDIA 2W1RA 2PD8A 2XFSA 2B18A 3NCKA 3CHWP 3EGXC 2XROA 2P08A 3ZNYA 3PBOA 3MMHA 1TD5A 2O9CA 1RGYA 2PR5A 3ZG9B 2R9XA 3IWQA 4GD6A 1EROA 1K6SA 5L10A 1RCJA 1KVLA 3HCYA 4UAAA 4JGQA 2VX8A 3GR2A 3G4PA 4X53A 3ZG5A 3VFHA 4ETXA 1XGJA 4ME4A 3IBJA 4X6TA 4I39A 3KSIA 1LSWA 2BG1A 5HFOA 1YKDA 1GCEA 4HBUA 1PI5A 1W63M 1TS7A 3T4LA 1SKOA 2QHKA 4OH0A 3S7QA 1UWPX 2VEAA 4ZRRA 3V50A 2ZL1B 4U0TA 4WM9A 2EXAA 1YT4A 5M19A 2JKRI 4PM7A 1K57C 1WYCA 4G3VA 2GZAA 1D1JA 1VM1A 3LY3A 3SS3A 2ZC4B 3B33A 3CI6A 3MZFA 1FIKA 4MCWA 5EOEA 1OJ5A 5EPHA 3ULFA 1VEUB 2XDMA 4B88A 1LI0A 4BMWA 4X55A 1NLZA 5F68A 2MJ6A 4EBPA 4DE3A 3VP0A 3T12B 1I2WA 3QP8A 4G3WA 3EWKA 3HJIA 3OC2A 3NY4A 1MKMA 1KDWA 4UA6A 3T1SA 4OP5A 1ZHHB 4CLCC 2WKIA 3BFEA 4GNUA 1SDNA 3C4OA 3MQOA 2ZC3B 4UA9A 2B5RA 2QZ6A 2QPNA 2Z6DA 4DXBA 4E6WA 5E43A 4LLOB 3ZG7B 5CEBA 3AGFA 4GLQA 1YLJA 3G2ZA 2KX6A 3LIAA 4MN6A 2DRWA 5HWVA 1MXOA 4N9KA 4KQDA 2HV1A 2ZQ9A 4RA7A 1O07A 2IA2A 4ZJ1A 3RFBA 5F82A 4IJGA 3FPVA 2QKPA 2KOIA 3UDIA 4Q0JA 3IX3A 4JKTA 4R3AA 4ETZA 3QHYA 1SKOB 1Z09A 3UN7A 1H0MA 3IWIA 3CMZA 4EETB 1XPBA 3DWZA 3T4OA 2V0WA 5GLCA 1NZOA 3NOPC 3CLOA 1W5DA 2HZ5A 3NHQA 3D9YA 3FC7A 2L0WA 4QPRA 3SS5A 3RXXA 5HSQA 1FOFA 2BLSA 2W3FA 3IHBA 4A5RA 2HP9A 3BEBA 2VV6A 3MXQA 4OPRA 1S4RA 5J3WA 1VQQA 1NXYA 2VA0A 2WKPA 4C6YA 2UWXA 3HLCA 4FOFA 4B93A 1FILA 1WA9A 1ZG6A 3GSGA 2OAQ1 4UA7A 4X69A 3EQUA 2J9OA 3TRCA 4ARZA 1FCOA 3E2LA 4HOIA 4L9FA 5C5KA 4ZJ2A 1JTGA 2X02A 1YPRA 4S2LA 4WELA 3VMAA 4S2MA 2ZOIA 5DVAA 4OVDA 4BL2A 3UO9A 3QP2A 3RJUA 3NIAA 1WYBA 2OV5A 2ZM0A 2XFTA 3MSHA 5HPFA 3IXGA 5DTSA 3WRTA 4LRYC 5FI2A 2A24A 4QJGA 4S2IA 4JLFA 3OCLA 4X56A 3WS1A 1OTAA 3F1PA 3L7HA 3NECA 4Y7PA 3K2NA 5HZHA 4HJ6A 1K6RA 4WMCA 1NY0A 5CHMA 5TJJA 1XJ2A 4JPMA 1MZUA 4LPZA 1DJAA 2PHYA 1KGEA 1MBLA 1LSVA 3IF5A 3F1NB 3NDEA 3TW8A 2XA7S 4Z1WA 3OOVA 2VV8A 4R70A 4EXOA 3ICYA 2ZQDA 3T1RA 4X25A 5GHZA 5HAIA 1TS8A 1UWNX 4JGOA 2P74A 4QY5A 2VGJA 1S1YA 1EI5A 2Y8HA 3Q7ZA 4E3KA 5DFYA 2H0TA 2HP5A 3O3VA 3MS6A 3ZGAB 1IELA 1V9YA 1YLTA 1BLPA 3E4OA 3PBSA 4GB7A 1GSWA 3BJNA 4ARZB 1OTBA 2Q0OA 3N8SA 1W79A 3UDFA 3V67A 3NC8A 4IVIA 4MN7A 4LRXC 3UB7A 1ZTUA 3MR0A 3V3SA 1LSXA 4D2OA 1NYYA 1BULA 3G2YA 1T1BA 1KGFA 3LO7A 2G2WA 2WADA 5AVFA 3EEHA 5HW3A 3T1XA 1IEMA 2HDSA 4MN5A 4S2NA 3U4LP 2Y59A 4WBGA 5TBMA 3NULA 3IT9A 1YAXA 2GNXA 4NKPA 3F1PB 2W27A 1YLZA 4E04A 4UHUA 2FFYA 1YLYA 4RVAA 3C5AA 3KO6A 4GD8A 5DJUA 5CTMA 3LI9A 4R3JA 1GSVA 4BENA 2B95A 3IS2A 2HDRA 5KMWA 4KZ4A 3N4IA 3UE1A 4U0XA 2RL3A 5DF7A 2WKRA 2Y2JA 5JYPA 4GDNA 2GJ3A 4MBKA 4OP8A 5FASA 3E4QA 3MF0A 4MEZA 3A0SA 1K56A 4S2OA 4LFUA 1SKFA 5HAQA 5HL6A 1ES3A 4OONA 1MPLA 3K3CA 5F83A 5M18A 4HJ3A 2V2FF 3R4KA 3LR0A 2W1TA 4HHDA 3UDXA 4HESA 3UE3A 4N9LA 2XR0A 4PAUA 4R38A 4GW9A
chains in the Genus database with same CATH topology
1KVLA 1MKIA 2JE5A 1KVMA 4KQOA 4UAAA 1WE4A 4ZAMA 3GR2A 3NBLA 3W4OA 4E3LA 3G4PA 4DF6A 3BLSA 4OLDA 3V39A 1L0EA 4DXCA 4PM6A 3SH9A 4Y0TA 3I7JA 2C5WB 4X53A 3UY6A 3VFHA 3ZG5A 3A3IA 3HL9A 2Y2QA 1C3BA 1GHPA 1N9BA 4WEJA 3HLBA 4LENA 1XGJA 3OZHA 3WS0A 5KZHA 4R4SA 4BJPA 4X6TA 5EOOA 1W8YA 1M40A 4P0MA 3ZG0A 1ERMA 1GA9A 2ZLYA 2BG1A 2J7VA 1NZUA 2OSUA 1PZPA 2R9WA 5FI7A 4O7DA 5HFOA 1YQSA 1YMXA 2J9PA 2P9VB 2Z2LB 5DTKA 5GHYA 5U47A 2ZC5B 1GCEA 1H8ZA 4R23A 2WAFA 4HBUA 1PW8A 2ZQCA 4B4ZA 1PI5A 5AQBA 3OPRA 5AQ9A 3HUMA 3A3EA 2GDNA 3O86A 4OH0A 1BLSA 2HDQA 4R3BA 3V50A 3BECA 4QD4A 2WGWA 1K38A 4U0TA 4WM9A 2EXAA 1L0GA 4EBNA 1YT4A 5M19A 5KSCA 1FSYA 1ZG4A 1K57A 3UPNA 1BTLA 1BSGA 4PM7A 4EV4A 1K54A 3Q7VA 1K57C 1WYCA 4OOLA 3Q1FA 3DWKA 4KZAA 4K91A 1K54C 1VM1A 3LY3A 4QU3A 1K55A 3JYIA 3SS3A 1XA1A 2ZC4B 3MZFA 2WZXA 3WS5A 1AXBA 1CK3A 2WK0A 5EOEA 1K55C 3G34A 3WS4A 5EPHA 5TGFA 1PWDA 4KZ8A 2XDMA 4B88A 1LI0A 4JF6A 3IQAA 1HD8A 3OCNA 5FQKA 3UPOA 2X71A 3IHAA 1E4DA 4MNRA 4X55A 2IWDA 4BD1A 3IWOA 2G2UA 4PMAA 5E2GA 3P98A 3TSGA 3HREA 1E25A 4WZ4A 1PI4A 2A3UA 4OQIA 4OLGA 5CHJA 4BLMA 4EBPA 1ONGA 4QB8A 3VP0A 4DE3A 1GA0A 2X01A 4PPRA 3OPHA 2FFFB 4PM5A 2EFXA 4S2KA 1QMEA 1PYYA 1I2WA 4BQMA 4FH4A 5GL9A 3UNWA 4FCFA 3C4PA 1K4FA 3IF6A 4KZBA 3W4QA 5DF9A 1DJCA 3OC2A 1LI9A 2ZQ7A 4MBFA 3NY4A 2Y2OA 4ZTKA 1KDWA 3A3JA 4DKIA 4UA6A 3IH9A 2IWCA 3Q07A 2WZZA 1MWTA 4E3MA 1YLWA 4OP5A 5E2FA 5FAPA 4KG2A 2WKIA 3BFEA 1QMFA 1SDNA 3C4OA 4GNUA 4X68A 4E3IA 2ZC3B 2QMIA 4KG6A 2B5RA 4LCMA 2QZ6A 4UA9A 5EVIA 2QPNA 4HEFA 4DXBA 1K56D 2H0YA 4RX3A 2JBFA 4E6WA 3DW0A 5D3OA 5E43A 5AQ7A 3ZG7B 5EVIC 5CEBA 3AGFA 2WUQA 1YLJA 1XP4A 3G2ZA 4R4RA 5IHVA 3EQVA 4Y0OA 3ZNTA 3ZG8B 1SCWA 2DRWA 4KG5A 3VSKA 1MXOA 4OPZA 3FYZA 4N9KA 3IH8A 4OQHA 4KENB 1Z6FA 2ZQ9A 3ZCZA 2XEPA 4NK3A 4KQRA 4DE0A 4GKUA 4RA7A 3UE0A 1O07A 3G30A 1BLCA 1JTDA 4KZ7A 4P6BA 4XUXA 3HUNA 3ZDJA 4EUZA 4ZJ1A 4E3OA 2Y2IA 5F82A 4E6XA 1MY8A 1CI8A 1FSWA 4KZ5A 1PW1A 3S1YA 2HDUA 2H5SA 3W8KA 2Q9NA 1YMSA 4DRTA 2EFUA 3C7VA 3PBRA 4HBTA 1PZOA 3UDIA 1G68A 4JKTA 1EWZA 4JF4A 4GOGA 3QHYA 3VFFA 4JXWA 3LEZA 3NDGA 1ES4A 1ES2A 4OQGA 1ESIA 1ONHA 2HPBA 3TG9A 3UN7A 3IWIA 2WGWB 5CGXA 3CMZA 5G18A 2XLNA 4GN2A 1XPBA 1HVBA 3VSLA 2Y91A 3V5MA 5L2FA 3DWZA 2PU4A 1W8QA 1Q2PA 3BRMA 2Y2GA 3O88A 4YFMA 5GLCA 2A49A 1FCMA 3G31A 3Q7VB 1NZOA 4OOMA 3QNBA 1ES5A 3WRZA 1W5DA 1M6KA 5FQMA 1U60A 3UPPA 2PU2A 1LLBA 3S4XA 5GLBA 3M6BA 2DCFA 4KQQA 3SS5A 3RXXA 4IBRA 3MBZA 1PWGA 1FOFA 1XX2A 1TDLA 2BLSA 3IHBA 4A5RA 2HP9A 1BUEA 1I2SA 3BEBA 2ZMAA 3SH7A 4Z9QA 4OPRA 1L0FA 1RGZA 3LY4A 2EX2A 4FH2A 5CRFA 5FAOA 4FD8A 2ZC7A 4XUZA 4KZ6A 1VQQA 1NXYA 4OPYA 3DTMA 2ZQAA 2ZC6B 1IKIA 4GDBA 3WS2A 2WKHA 2ZQ8A 4C6YA 5FQIA 3BYDA 3W4PA 4N1XA 4CJNA 1S0WA 4PM9A 2UWXA 3HLCA 4F94A 2ZD8A 2EX6A 3IF6B 4OKPA 1SHVA 3BFGA 4P87A 2Y55A 3N7WA 4N92A 1ZG6A 3GSGA 4C75A 1XA7A 3V3RA 2Y2PA 3SOIA 3FZCA 4UA7A 4X69A 4ID4A 5HX9A 3ZFZA 3G35A 3EQUA 2J9OA 3TOIA 1FCOA 1OMEA 3D4FA 3E2LA 4C3QA 2DNSA 1IYSA 3P09A 4ZJ2A 1JTGA 1DJBA 2X02A 1O7EA 3HLEA 5EVIB 5CERA 1YM1A 4S2LA 2H10A 1NJ4A 4WELA 1KGGA 5A92A 3VMAA 5HAPA 1DY6A 4RYEA 4S2MA 1CI9A 4DE1A 3GVBA 3N8LA 3PBNA 5DVAA 4OVDA 3S22A 3PBQA 5BOHA 5CEDA 4BL2A 1GHMA 3BFCA 2I72A 3M2JA 2VGKA 4RX2A 3MKFA 3UO9A 3G32A 2XGNA 3RJUA 3A3DA 4S2PA 2HP6A 5FI6A 3ZHHA 3NIAA 5EVID 3VOZA 3CG5A 3Q81A 4LCLA 1WYBA 1I5QA 2OV5A 2ZM0A 4KZ3A 4NETA 2XFTA 5CGWA 5EUAA 3SH8A 1HTZA 1L2SA 3CZDA 3IXGA 5DTSA 1HZOA 3WRTA 5GLAA 1K25A 5FI2A 4DE2A 4QJGA 5J8XA 4S2IA 4ZBEA 2WGVA 4JLFA 3OCLA 4WMCD 4X56A 5E2HA 4WZ5C 3WS1A 3FKVA 3O87A 2XQZA 4Y7PA 1FR1A 3A3FA 1MWRA 1K6RA 5A90A 4WMCA 1CEGA 1NY0A 5CHMA 3BLMA 2IWBA 3PAGA 3PBTA 3HLFA 4JPMA 3NI9A 5FQQA 1DJAA 4N1HA 1KGEA 3GQZA 1MBLA 2J8YA 3C7UA 2WKEA 1XKZA 1YLPA 3IF5A 1ZKJA 3NDEA 4JBFA 3WWXA 3SS4A 3MZDA 4QHCA 5GHXA 1KDSA 3VP1A 3CJMA 5HL1A 1JWZA 3B3XA 3ZVTA 2ZQDA 3FKWA 3MXSA 2ZJ9A 5CHUA 2V20A 5CECA 5A91A 1TVFA 4S2JA 5GHZA 4LV1A 1Y54A 5FA7A 5HAIA 4E3JA 3M6HA 5CTNA 5EE8A 4R0QA 5I94A 3BFFA 5HARA 3AGDA 2P74A 4QY5A 2VGJA 1EI5A 1NRFA 2JC7A 1BZAA 1JWPA 3Q7ZA 4E3KA 4MBHA 1JVJA 3GRJA 2H0TA 4EBLA 2Y2KA 1IKGA 2JCHA 3HVFA 2Y2NA 5GLDA 2HP5A 2Y2LA 5AQAA 3O3VA 1KE3A 5FAQA 4QY6A 2Y2HA 4MLLA 3ZGAB 1FCNA 1IELA 3VP2A 3MFDA 4U3TA 1W7FA 2OLVA 2CC1A 1GHIA 5F1GA 4IEDA 1YLTA 1BLPA 1IYPA 1PWCA 3PBSA 4GB7A 2C6WB 2WGIA 5DTTA 4EWFA 2XD5A 4LV3A 3N8RA 5CGSA 3HLWA 3MXRA 2Y2MA 3N8SA 1W79A 3UDFA 3N6IA 1H5XA 3MKEA 3NC8A 3GTCA 4IVIA 3PTEA 5FDHA 4WYYA 1H8YA 4WEKA 3VOYA 3V3SA 1J9MA 4ZJ3A 4D2OA 1NYYA 1BULA 4EQIA 2WAEA 1S6RA 3G2YA 3HBRA 5DF8A 4BL3A 4R1GA 3BFDA 3LCEA 3LO7A 1KGFA 3IXHA 5A93A 2G2WA 2WADA 3BM6A 4PM8A 3ISGA 5HW3A 2ZM8A 4H8RA 1IEMA 2HDSA 3QNCA 4KZ9A 4S2NA 2Z2MB 4XXRA 1ZC2A 3RXWA 3OPPA 4FSFA 2P9VA 2Y59A 4WBGA 3HLGA 2V1ZA 4S2NC 3FV7A 2PBYA 3IT9A 1FR6A 2XK1A 1FQGA 1N4OA 3ZVWA 4ZDXA 5F1FA 3E2KA 4Q8IA 1ERQA 1G6AA 3HLDA 2XH9A 1TDGA 1XXMA 1BLHA 5TFQA 2XF3A 1Q2QA 2EX9A 5EECA 5TR7A 4IBXA 1PIOA 4LV2A 1YLZA 4UHUA 2FFYA 1YLYA 1LHYA 4RVAA 4BD0A 1JWVA 4IVKA 3C5AA 4OQ0A 4GD8A 2ZM2A 3ITBA 1SDEA 5JYOA 2EX8A 4K0WA 4JXSA 5CTMA 1BT5A 4E3NA 4WZ5A 1MWSA 1TEMA 3FWLA 1E3UD 4R3JA 1ESUA 4BENA 1RP5A 4YINA 2XD1A 1KE0A 2EXBA 4DDYA 3IF6C 2HDRA 4LV0A 3HUOA 5E2EA 2RCXA 1IYQA 1LL9A 4GZBA 1E3UA 5KMWA 4KZ4A 3AGEA 1KE4A 5KSHA 4P85A 3N4IA 3UE1A 4U0XA 4JF5A 2RL3A 5FQJA 3M2KA 3MZEA 5CXWA 3Q82A 1CEFA 5DF7A 4L0LA 5EVLA 4K0XA 2Y2JA 5FATA 5JYPA 3VP3A 3IXDA 4GDNA 1NYMA 2XFSA 4MBKA 3NCKA 4OP8A 5FASA 4Y0UA 4JXGA 4OOYA 4MEZA 1ALQA 3PAEA 1K56A 4S2OA 3ZNYA 3GV9A 1SKFA 3PBOA 5HAQA 5M1AA 1ES3A 2OLUA 1MWUA 4OONA 4B4XA 1RGYA 1LL5A 1MPLA 5F83A 2Y4AA 2WYXA 3ZG9B 2V2FF 1K4EA 2R9XA 3GMWA 3UDXA 5M18A 4HESA 1IYOA 5FSRA 2Q9MA 3UE3A 4DDSA 4N9LA 3ITAA 4M3KA 3IWQA 4CPKA 2XR0A 4GD6A 4JXVA 1EROA 1K6SA 3VP4A 3IXBA 3OPLA 2E8IA 1L0DA 1RCJA 4OPQA 5FQ9A 1XGIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KVL A;  1MKI A;  2JE5 A;  1KVM A;  4KQO A;  4UAA A;  1WE4 A;  4ZAM A;  3GR2 A;  3NBL A;  3W4O A;  4E3L A;  3G4P A;  4DF6 A;  3BLS A;  4OLD A;  3V39 A;  1L0E A;  4DXC A;  4PM6 A;  3SH9 A;  4Y0T A;  3I7J A;  2C5W B;  4X53 A;  3UY6 A;  3VFH A;  3ZG5 A;  3A3I A;  3HL9 A;  2Y2Q A;  1C3B A;  1GHP A;  1N9B A;  4WEJ A;  3HLB A;  4LEN A;  1XGJ A;  3OZH A;  3WS0 A;  5KZH A;  4R4S A;  4BJP A;  4X6T A;  5EOO A;  1W8Y A;  1M40 A;  4P0M A;  3ZG0 A;  1ERM A;  1GA9 A;  2ZLY A;  2BG1 A;  2J7V A;  1NZU A;  2OSU A;  1PZP A;  2R9W A;  5FI7 A;  4O7D A;  5HFO A;  1YQS A;  1YMX A;  2J9P A;  2P9V B;  2Z2L B;  5DTK A;  5GHY A;  5U47 A;  2ZC5 B;  1GCE A;  1H8Z A;  4R23 A;  2WAF A;  4HBU A;  1PW8 A;  2ZQC A;  4B4Z A;  1PI5 A;  5AQB A;  3OPR A;  5AQ9 A;  3HUM A;  3A3E A;  2GDN A;  3O86 A;  4OH0 A;  1BLS A;  2HDQ A;  4R3B A;  3V50 A;  3BEC A;  4QD4 A;  2WGW A;  1K38 A;  4U0T A;  4WM9 A;  2EXA A;  1L0G A;  4EBN A;  1YT4 A;  5M19 A;  5KSC A;  1FSY A;  1ZG4 A;  1K57 A;  3UPN A;  1BTL A;  1BSG A;  4PM7 A;  4EV4 A;  1K54 A;  3Q7V A;  1K57 C;  1WYC A;  4OOL A;  3Q1F A;  3DWK A;  4KZA A;  4K91 A;  1K54 C;  1VM1 A;  3LY3 A;  4QU3 A;  1K55 A;  3JYI A;  3SS3 A;  1XA1 A;  2ZC4 B;  3MZF A;  2WZX A;  3WS5 A;  1AXB A;  1CK3 A;  2WK0 A;  5EOE A;  1K55 C;  3G34 A;  3WS4 A;  5EPH A;  5TGF A;  1PWD A;  4KZ8 A;  2XDM A;  4B88 A;  1LI0 A;  4JF6 A;  3IQA A;  1HD8 A;  3OCN A;  5FQK A;  3UPO A;  2X71 A;  3IHA A;  1E4D A;  4MNR A;  4X55 A;  2IWD A;  4BD1 A;  3IWO A;  2G2U A;  4PMA A;  5E2G A;  3P98 A;  3TSG A;  3HRE A;  1E25 A;  4WZ4 A;  1PI4 A;  2A3U A;  4OQI A;  4OLG A;  5CHJ A;  4BLM A;  4EBP A;  1ONG A;  4QB8 A;  3VP0 A;  4DE3 A;  1GA0 A;  2X01 A;  4PPR A;  3OPH A;  2FFF B;  4PM5 A;  2EFX A;  4S2K A;  1QME A;  1PYY A;  1I2W A;  4BQM A;  4FH4 A;  5GL9 A;  3UNW A;  4FCF A;  3C4P A;  1K4F A;  3IF6 A;  4KZB A;  3W4Q A;  5DF9 A;  1DJC A;  3OC2 A;  1LI9 A;  2ZQ7 A;  4MBF A;  3NY4 A;  2Y2O A;  4ZTK A;  1KDW A;  3A3J A;  4DKI A;  4UA6 A;  3IH9 A;  2IWC A;  3Q07 A;  2WZZ A;  1MWT A;  4E3M A;  1YLW A;  4OP5 A;  5E2F A;  5FAP A;  4KG2 A;  2WKI A;  3BFE A;  1QMF A;  1SDN A;  3C4O A;  4GNU A;  4X68 A;  4E3I A;  2ZC3 B;  2QMI A;  4KG6 A;  2B5R A;  4LCM A;  2QZ6 A;  4UA9 A;  5EVI A;  2QPN A;  4HEF A;  4DXB A;  1K56 D;  2H0Y A;  4RX3 A;  2JBF A;  4E6W A;  3DW0 A;  5D3O A;  5E43 A;  5AQ7 A;  3ZG7 B;  5EVI C;  5CEB A;  3AGF A;  2WUQ A;  1YLJ A;  1XP4 A;  3G2Z A;  4R4R A;  5IHV A;  3EQV A;  4Y0O A;  3ZNT A;  3ZG8 B;  1SCW A;  2DRW A;  4KG5 A;  3VSK A;  1MXO A;  4OPZ A;  3FYZ A;  4N9K A;  3IH8 A;  4OQH A;  4KEN B;  1Z6F A;  2ZQ9 A;  3ZCZ A;  2XEP A;  4NK3 A;  4KQR A;  4DE0 A;  4GKU A;  4RA7 A;  3UE0 A;  1O07 A;  3G30 A;  1BLC A;  1JTD A;  4KZ7 A;  4P6B A;  4XUX A;  3HUN A;  3ZDJ A;  4EUZ A;  4ZJ1 A;  4E3O A;  2Y2I A;  5F82 A;  4E6X A;  1MY8 A;  1CI8 A;  1FSW A;  4KZ5 A;  1PW1 A;  3S1Y A;  2HDU A;  2H5S A;  3W8K A;  2Q9N A;  1YMS A;  4DRT A;  2EFU A;  3C7V A;  3PBR A;  4HBT A;  1PZO A;  3UDI A;  1G68 A;  4JKT A;  1EWZ A;  4JF4 A;  4GOG A;  3QHY A;  3VFF A;  4JXW A;  3LEZ A;  3NDG A;  1ES4 A;  1ES2 A;  4OQG A;  1ESI A;  1ONH A;  2HPB A;  3TG9 A;  3UN7 A;  3IWI A;  2WGW B;  5CGX A;  3CMZ A;  5G18 A;  2XLN A;  4GN2 A;  1XPB A;  1HVB A;  3VSL A;  2Y91 A;  3V5M A;  5L2F A;  3DWZ A;  2PU4 A;  1W8Q A;  1Q2P A;  3BRM A;  2Y2G A;  3O88 A;  4YFM A;  5GLC A;  2A49 A;  1FCM A;  3G31 A;  3Q7V B;  1NZO A;  4OOM A;  3QNB A;  1ES5 A;  3WRZ A;  1W5D A;  1M6K A;  5FQM A;  1U60 A;  3UPP A;  2PU2 A;  1LLB A;  3S4X A;  5GLB A;  3M6B A;  2DCF A;  4KQQ A;  3SS5 A;  3RXX A;  4IBR A;  3MBZ A;  1PWG A;  1FOF A;  1XX2 A;  1TDL A;  2BLS A;  3IHB A;  4A5R A;  2HP9 A;  1BUE A;  1I2S A;  3BEB A;  2ZMA A;  3SH7 A;  4Z9Q A;  4OPR A;  1L0F A;  1RGZ A;  3LY4 A;  2EX2 A;  4FH2 A;  5CRF A;  5FAO A;  4FD8 A;  2ZC7 A;  4XUZ A;  4KZ6 A;  1VQQ A;  1NXY A;  4OPY A;  3DTM A;  2ZQA A;  2ZC6 B;  1IKI A;  4GDB A;  3WS2 A;  2WKH A;  2ZQ8 A;  4C6Y A;  5FQI A;  3BYD A;  3W4P A;  4N1X A;  4CJN A;  1S0W A;  4PM9 A;  2UWX A;  3HLC A;  4F94 A;  2ZD8 A;  2EX6 A;  3IF6 B;  4OKP A;  1SHV A;  3BFG A;  4P87 A;  2Y55 A;  3N7W A;  4N92 A;  1ZG6 A;  3GSG A;  4C75 A;  1XA7 A;  3V3R A;  2Y2P A;  3SOI A;  3FZC A;  4UA7 A;  4X69 A;  4ID4 A;  5HX9 A;  3ZFZ A;  3G35 A;  3EQU A;  2J9O A;  3TOI A;  1FCO A;  1OME A;  3D4F A;  3E2L A;  4C3Q A;  2DNS A;  1IYS A;  3P09 A;  4ZJ2 A;  1JTG A;  1DJB A;  2X02 A;  1O7E A;  3HLE A;  5EVI B;  5CER A;  1YM1 A;  4S2L A;  2H10 A;  1NJ4 A;  4WEL A;  1KGG A;  5A92 A;  3VMA A;  5HAP A;  1DY6 A;  4RYE A;  4S2M A;  1CI9 A;  4DE1 A;  3GVB A;  3N8L A;  3PBN A;  5DVA A;  4OVD A;  3S22 A;  3PBQ A;  5BOH A;  5CED A;  4BL2 A;  1GHM A;  3BFC A;  2I72 A;  3M2J A;  2VGK A;  4RX2 A;  3MKF A;  3UO9 A;  3G32 A;  2XGN A;  3RJU A;  3A3D A;  4S2P A;  2HP6 A;  5FI6 A;  3ZHH A;  3NIA A;  5EVI D;  3VOZ A;  3CG5 A;  3Q81 A;  4LCL A;  1WYB A;  1I5Q A;  2OV5 A;  2ZM0 A;  4KZ3 A;  4NET A;  2XFT A;  5CGW A;  5EUA A;  3SH8 A;  1HTZ A;  1L2S A;  3CZD A;  3IXG A;  5DTS A;  1HZO A;  3WRT A;  5GLA A;  1K25 A;  5FI2 A;  4DE2 A;  4QJG A;  5J8X A;  4S2I A;  4ZBE A;  2WGV A;  4JLF A;  3OCL A;  4WMC D;  4X56 A;  5E2H A;  4WZ5 C;  3WS1 A;  3FKV A;  3O87 A;  2XQZ A;  4Y7P A;  1FR1 A;  3A3F A;  1MWR A;  1K6R A;  5A90 A;  4WMC A;  1CEG A;  1NY0 A;  5CHM A;  3BLM A;  2IWB A;  3PAG A;  3PBT A;  3HLF A;  4JPM A;  3NI9 A;  5FQQ A;  1DJA A;  4N1H A;  1KGE A;  3GQZ A;  1MBL A;  2J8Y A;  3C7U A;  2WKE A;  1XKZ A;  1YLP A;  3IF5 A;  1ZKJ A;  3NDE A;  4JBF A;  3WWX A;  3SS4 A;  3MZD A;  4QHC A;  5GHX A;  1KDS A;  3VP1 A;  3CJM A;  5HL1 A;  1JWZ A;  3B3X A;  3ZVT A;  2ZQD A;  3FKW A;  3MXS A;  2ZJ9 A;  5CHU A;  2V20 A;  5CEC A;  5A91 A;  1TVF A;  4S2J A;  5GHZ A;  4LV1 A;  1Y54 A;  5FA7 A;  5HAI A;  4E3J A;  3M6H A;  5CTN A;  5EE8 A;  4R0Q A;  5I94 A;  3BFF A;  5HAR A;  3AGD A;  2P74 A;  4QY5 A;  2VGJ A;  1EI5 A;  1NRF A;  2JC7 A;  1BZA A;  1JWP A;  3Q7Z A;  4E3K A;  4MBH A;  1JVJ A;  3GRJ A;  2H0T A;  4EBL A;  2Y2K A;  1IKG A;  2JCH A;  3HVF A;  2Y2N A;  5GLD A;  2HP5 A;  2Y2L A;  5AQA A;  3O3V A;  1KE3 A;  5FAQ A;  4QY6 A;  2Y2H A;  4MLL A;  3ZGA B;  1FCN A;  1IEL A;  3VP2 A;  3MFD A;  4U3T A;  1W7F A;  2OLV A;  2CC1 A;  1GHI A;  5F1G A;  4IED A;  1YLT A;  1BLP A;  1IYP A;  1PWC A;  3PBS A;  4GB7 A;  2C6W B;  2WGI A;  5DTT A;  4EWF A;  2XD5 A;  4LV3 A;  3N8R A;  5CGS A;  3HLW A;  3MXR A;  2Y2M A;  3N8S A;  1W79 A;  3UDF A;  3N6I A;  1H5X A;  3MKE A;  3NC8 A;  3GTC A;  4IVI A;  3PTE A;  5FDH A;  4WYY A;  1H8Y A;  4WEK A;  3VOY A;  3V3S A;  1J9M A;  4ZJ3 A;  4D2O A;  1NYY A;  1BUL A;  4EQI A;  2WAE A;  1S6R A;  3G2Y A;  3HBR A;  5DF8 A;  4BL3 A;  4R1G A;  3BFD A;  3LCE A;  3LO7 A;  1KGF A;  3IXH A;  5A93 A;  2G2W A;  2WAD A;  3BM6 A;  4PM8 A;  3ISG A;  5HW3 A;  2ZM8 A;  4H8R A;  1IEM A;  2HDS A;  3QNC A;  4KZ9 A;  4S2N A;  2Z2M B;  4XXR A;  1ZC2 A;  3RXW A;  3OPP A;  4FSF A;  2P9V A;  2Y59 A;  4WBG A;  3HLG A;  2V1Z A;  4S2N C;  3FV7 A;  2PBY A;  3IT9 A;  1FR6 A;  2XK1 A;  1FQG A;  1N4O A;  3ZVW A;  4ZDX A;  5F1F A;  3E2K A;  4Q8I A;  1ERQ A;  1G6A A;  3HLD A;  2XH9 A;  1TDG A;  1XXM A;  1BLH A;  5TFQ A;  2XF3 A;  1Q2Q A;  2EX9 A;  5EEC A;  5TR7 A;  4IBX A;  1PIO A;  4LV2 A;  1YLZ A;  4UHU A;  2FFY A;  1YLY A;  1LHY A;  4RVA A;  4BD0 A;  1JWV A;  4IVK A;  3C5A A;  4OQ0 A;  4GD8 A;  2ZM2 A;  3ITB A;  1SDE A;  5JYO A;  2EX8 A;  4K0W A;  4JXS A;  5CTM A;  1BT5 A;  4E3N A;  4WZ5 A;  1MWS A;  1TEM A;  3FWL A;  1E3U D;  4R3J A;  1ESU A;  4BEN A;  1RP5 A;  4YIN A;  2XD1 A;  1KE0 A;  2EXB A;  4DDY A;  3IF6 C;  2HDR A;  4LV0 A;  3HUO A;  5E2E A;  2RCX A;  1IYQ A;  1LL9 A;  4GZB A;  1E3U A;  5KMW A;  4KZ4 A;  3AGE A;  1KE4 A;  5KSH A;  4P85 A;  3N4I A;  3UE1 A;  4U0X A;  4JF5 A;  2RL3 A;  5FQJ A;  3M2K A;  3MZE A;  5CXW A;  3Q82 A;  1CEF A;  5DF7 A;  4L0L A;  5EVL A;  4K0X A;  2Y2J A;  5FAT A;  5JYP A;  3VP3 A;  3IXD A;  4GDN A;  1NYM A;  2XFS A;  4MBK A;  3NCK A;  4OP8 A;  5FAS A;  4Y0U A;  4JXG A;  4OOY A;  4MEZ A;  1ALQ A;  3PAE A;  1K56 A;  4S2O A;  3ZNY A;  3GV9 A;  1SKF A;  3PBO A;  5HAQ A;  5M1A A;  1ES3 A;  2OLU A;  1MWU A;  4OON A;  4B4X A;  1RGY A;  1LL5 A;  1MPL A;  5F83 A;  2Y4A A;  2WYX A;  3ZG9 B;  2V2F F;  1K4E A;  2R9X A;  3GMW A;  3UDX A;  5M18 A;  4HES A;  1IYO A;  5FSR A;  2Q9M A;  3UE3 A;  4DDS A;  4N9L A;  3ITA A;  4M3K A;  3IWQ A;  4CPK A;  2XR0 A;  4GD6 A;  4JXV A;  1ERO A;  1K6S A;  3VP4 A;  3IXB A;  3OPL A;  2E8I A;  1L0D A;  1RCJ A;  4OPQ A;  5FQ9 A;  1XGI A; 
#chains in the Genus database with same CATH topology
 1MKI A;  2JE5 A;  3UB6 A;  3NBL A;  3W4O A;  1JNU A;  4BWI A;  3UMD A;  3BLS A;  3LEQ A;  3V39 A;  4DXC A;  4Y0T A;  2C5W B;  3UY6 A;  3H82 A;  3HL9 A;  1C3B A;  1N9B A;  3UE6 A;  4LEN A;  3EEA A;  2WKQ A;  2ZLY A;  2OSU A;  2ZMV A;  1TF1 A;  5GHY A;  3KYZ A;  4H6J A;  5TBM B;  3JPU A;  1H8Z A;  4R23 A;  2WAF A;  4B4Z A;  1D7E A;  5AQ9 A;  3HUM A;  2GDN A;  2HDQ A;  4R3B A;  4QD4 A;  4L9E A;  1K38 A;  4WUJ A;  4NXG A;  4EBN A;  5KSC A;  4UQI S;  3UPN A;  2J3T D;  1BSG A;  5EM1 A;  1K54 A;  3Q7V A;  3EGD C;  3T4Q A;  2W3D A;  3JYI A;  2O99 A;  4KUK A;  1AXB A;  3F1O B;  1K55 C;  3G34 A;  3WS4 A;  1F2K A;  1PWD A;  4KZ8 A;  1SZV A;  4JF6 A;  3CAX A;  3IQA A;  2D02 A;  5E2G A;  3P98 A;  3TSG A;  1T1C A;  3HRE A;  5CHJ A;  4BLM A;  2X01 A;  4PPR A;  2FFF B;  2PAV P;  1PYY A;  4FCF A;  3C4P A;  4KZB A;  2HJ9 C;  3W4Q A;  4DN0 A;  1DJC A;  3LIF A;  4F3L A;  5HD3 A;  4PHT A;  3A3J A;  3ZQ5 A;  1XFQ A;  3Q07 A;  2WZZ A;  4E3M A;  1YLW A;  2W1T B;  5HWW A;  1DP6 A;  3RH8 B;  4X68 A;  3VOL A;  2QMI A;  4LCM A;  3PXP A;  1K56 D;  2JN7 A;  2W3G A;  1LT0 A;  5EVI C;  1VB6 A;  5IHV A;  3EQV A;  1SCW A;  2O0Y A;  4KG5 A;  3H82 B;  3IH8 A;  3T4K A;  4DE0 A;  2J3W A;  3VE4 A;  4GKU A;  3UE0 A;  4EUZ A;  4E6X A;  1FSW A;  4KZ5 A;  1PW1 A;  3S1Y A;  1HLU P;  3W8K A;  4H6J B;  3C7V A;  4HBT A;  1PZO A;  1G68 A;  3LEZ A;  1Y28 A;  1ES2 A;  1ONH A;  2HPB A;  5G18 A;  3VSL A;  3V5M A;  5L2F A;  1DRM A;  2PU4 A;  3O88 A;  2A49 A;  3Q7V B;  4NXF A;  3QNB A;  4ESP A;  2PU2 A;  2O9A A;  4GHI A;  2YKH A;  4HY8 A;  3MBZ A;  1TDL A;  3BQA A;  2ZMA A;  1L0F A;  1RGZ A;  3LY4 A;  5CRF A;  5FAO A;  2ZC7 A;  3CPT A;  2JHE A;  4NG2 A;  2ZQA A;  2ZC6 B;  4GDB A;  3HJK A;  5HD5 A;  2OWH A;  2ZQ8 A;  3WS2 A;  3KX0 X;  1YSQ A;  1OT6 A;  4WN5 A;  5G4Z A;  2EX6 A;  4OKP A;  1SHV A;  1YSP A;  3N7W A;  3BQ8 A;  4F3L B;  2K31 A;  4B9O A;  3A0V A;  3TOI A;  1OME A;  3P09 A;  2VK3 A;  3PYP A;  3HLE A;  5CX7 A;  2H10 A;  2LB9 A;  1KGG A;  4Y17 A;  2GX5 A;  1DY6 A;  1NWZ A;  1CI9 A;  4DE1 A;  3GVB A;  3C30 A;  3S22 A;  3PBN A;  2VGK A;  2HP6 A;  3VOZ A;  3IX8 A;  1I5Q A;  3LR3 A;  3SH8 A;  1G5U A;  1HZO A;  5GLA A;  1VET B;  5J8X A;  3UB9 A;  2P04 A;  3O87 A;  5K5B A;  1FR1 A;  3A3F A;  1OTI A;  4IUH A;  2QYB A;  5DKL A;  2IWB A;  2KDK A;  3C2W A;  1H3Q A;  4N1H A;  3GQZ A;  3C7U A;  2WKE A;  1XKZ A;  1YLP A;  3WWX A;  4QHC A;  5GHX A;  4P6Z S;  3VP1 A;  5HDS A;  3KYQ A;  4GHI B;  3B47 A;  4PKY A;  3E4P A;  1PFL A;  1Y54 A;  4R0Q A;  3BFF A;  2G7U A;  1NRF A;  3CPT B;  1EW0 A;  3BY8 A;  1MC0 A;  4MBH A;  3F1N A;  3LR5 A;  2JCH A;  4MMN A;  5FAQ A;  4MLL A;  1CQA A;  3VP2 A;  3MFD A;  4IED A;  5FL3 A;  2C6W B;  3DBA A;  4LV3 A;  3N8R A;  3T4J A;  3MXR A;  3SZT A;  4HP9 A;  3N6I A;  3GTC A;  1S66 L;  1J3W A;  1H8Y A;  4WEK A;  1J9M A;  4ZJ3 A;  1PNE A;  2V9A A;  4EES A;  4EQI A;  3IXH A;  4PM8 A;  2VGL S;  2ZM8 A;  3QNC A;  4XXR A;  1ZC2 A;  1IFQ A;  4FSF A;  2P9V A;  5HDC A;  3HLG A;  2V1Z A;  2Z6C A;  3FV7 A;  1N4O A;  5F6A A;  5F1F A;  1ERQ A;  4II7 A;  2XH9 A;  2XA7 M;  1DP8 A;  1XXM A;  1Q2Q A;  2EX9 A;  2W3E A;  5EEC A;  5TR7 A;  4HP4 A;  1PIO A;  4LV2 A;  3UME A;  4Y15 A;  1LHY A;  2V0U A;  4BD0 A;  3S7P A;  2B02 A;  3LID A;  3ITB A;  4K0W A;  3CUE A;  4JXS A;  4WZ5 A;  1TEM A;  2XD1 A;  2EXB A;  4LV0 A;  3HUO A;  4GZB A;  3FPW A;  4FUW A;  3D3O A;  1KE4 A;  2UV0 E;  1GSX A;  3CWF A;  3MZE A;  3Q82 A;  4RQ9 A;  4K0X A;  3VP3 A;  4EUV A;  3S7N A;  2PBD P;  3SW1 A;  4O8G A;  4JXG A;  3PAE A;  1XJ3 A;  5F5Y A;  3H7W A;  4B4X A;  1LL5 A;  2WYX A;  3GMW A;  5FSR A;  2Q9M A;  4DDS A;  2K2N A;  2V8C A;  3VP4 A;  1P9R A;  1L0D A;  4KQO A;  5IT5 A;  1L0E A;  3I7J A;  3PHY A;  1ODV A;  2Y2Q A;  3D72 A;  4WEJ A;  3WS0 A;  3OZH A;  5KZH A;  3LI8 A;  4BJP A;  5EOO A;  1W8Y A;  1M40 A;  4P0M A;  1ERM A;  1NZU A;  1PZP A;  2VJW A;  5FI7 A;  4O7D A;  3UB8 A;  2J9P A;  1YMX A;  2P9V B;  2PRF A;  2ZMF A;  2JKF A;  2ZC5 B;  3LIE A;  3DTK A;  3O86 A;  3A3E A;  1BLS A;  1S4S A;  2I9V A;  1ZG4 A;  1K57 A;  4Y3I A;  1BTL A;  2QJ5 A;  2DMW A;  1XJ6 A;  2FH5 A;  3DWK A;  4QU3 A;  3LFV A;  2WZX A;  4EW7 A;  2WK0 A;  2FZ0 A;  3T1Q B;  5LBR A;  3C8C A;  1HD8 A;  5MC7 A;  3UPO A;  4BD1 A;  3IWO A;  4PMA A;  4I3I A;  2QJ7 A;  1E25 A;  1PI4 A;  4PM5 A;  4S2K A;  1QME A;  1K4F A;  3IX4 A;  2QWS A;  3F1O A;  1LL8 A;  2L1M A;  1LI9 A;  2M7V A;  2VKS A;  3H7W B;  5AJG A;  2IWC A;  4CQH A;  1N9N A;  4Q0H A;  5E2F A;  2PD7 A;  5FAP A;  5A8B A;  1QMF A;  4E3I A;  2H0Y A;  4RX3 A;  4HNB A;  5DJT A;  1XP4 A;  4R4R A;  4Y0O A;  3ZG8 B;  3VSK A;  3FYZ A;  1STZ A;  4OQH A;  4KEN B;  3LYX A;  1T19 A;  4I38 A;  4KQR A;  1BLC A;  1JTD A;  3HUN A;  3ZDJ A;  1DP9 A;  4E3O A;  1MY8 A;  1CI8 A;  2HDU A;  2H5S A;  2Q9N A;  4DRT A;  2EFU A;  1F9I A;  4UQI M;  3K3D A;  2O9B A;  5L09 A;  5J4E A;  3VFF A;  3NDG A;  1ES4 A;  3LR4 A;  3KYE A;  1ESI A;  2NUP C;  2D01 A;  5CGX A;  2Y91 A;  1W8Q A;  1Q2P A;  4YFM A;  2NUT C;  1FCM A;  4OOM A;  5EM0 A;  1UGU A;  1M6K A;  3NJA A;  1LLB A;  5GLB A;  5FEF A;  3M6B A;  4KQQ A;  1P9W A;  4WL9 A;  4HQA A;  1PWG A;  4JGR A;  1I2S A;  4FH2 A;  4FD8 A;  4XUZ A;  4KZ6 A;  4OPY A;  1IKI A;  3W4P A;  4N1X A;  4CJN A;  1S0W A;  4PM9 A;  2V8F A;  4K08 A;  4F94 A;  4Y2F A;  4N92 A;  1PRQ A;  3MJQ A;  4C75 A;  1XA7 A;  3V3R A;  2Y2P A;  4ID4 A;  5HX9 A;  3G35 A;  4WLA A;  2KLI A;  3D4F A;  1O7E A;  5CER A;  1YM1 A;  3L9K A;  2M7U A;  4EQ1 A;  1VHM A;  4CLC D;  2ACG A;  4BBU A;  3N8L A;  3PBQ A;  5CED A;  3ZYT A;  1GHM A;  3LGO A;  4RX2 A;  3MKF A;  5G4Y A;  4O0P A;  2XSS A;  4S2P A;  3CG5 A;  1OTD A;  5EUA A;  4EER A;  1D06 A;  1N9L A;  3VE3 A;  3P01 A;  2WGV A;  5E2H A;  1A0K A;  4WZ5 C;  4FTX A;  2P7J A;  1MWR A;  3BLM A;  3PAG A;  3PBT A;  3HLF A;  3NI9 A;  2EWW A;  4I3J A;  2J8Y A;  2LB5 A;  2BAS A;  4JBF A;  3SS4 A;  3MZD A;  4CLC E;  1KDS A;  3CJM A;  1VET A;  1JWZ A;  2ZJ9 A;  5CHU A;  1TVF A;  4S2J A;  5FA7 A;  4HH2 A;  4E3J A;  5CTN A;  5EE8 A;  3QP1 A;  5HAR A;  2JC7 A;  2EA9 A;  1JVJ A;  3GRJ A;  2ZOH A;  2Y2K A;  4DJ3 A;  3HVF A;  2Y2N A;  5AQA A;  3T50 A;  4EEU A;  3T4S A;  4XT2 B;  1FCN A;  4Q0I A;  4U3T A;  1W7F A;  2OLV A;  2CC1 A;  1PWC A;  2PYR A;  3NOU C;  5DTT A;  4EWF A;  3KSG A;  5CGS A;  4IUK A;  4X1L A;  3PTE A;  3S7O A;  2PYP A;  3OLO A;  2WAE A;  3TE8 A;  5FEG A;  5DF8 A;  4BL3 A;  4R1G A;  3BFD A;  3LCE A;  5A93 A;  2VZW A;  3BM6 A;  4I3A A;  4H8R A;  2V1A A;  4KZ9 A;  3VV4 A;  3RXW A;  2V1B A;  4S2N C;  2PBY A;  1FR6 A;  2XK1 A;  1FQG A;  3ZVW A;  3MFX A;  2J3T C;  1OTE A;  1F98 A;  1TS6 A;  1TDG A;  1BLH A;  5HDD A;  4P6Z M;  4IBX A;  5EV0 A;  3R7W B;  2OOL A;  1OT9 A;  4IVK A;  1T1A A;  3JVV A;  4OQ0 A;  2M1C A;  5JYO A;  4M4X A;  2EX8 A;  3KSH A;  3DTE A;  1BT5 A;  1K0K A;  1MWS A;  4GS9 A;  3FWL A;  1E3U D;  1ESU A;  1RP5 A;  1KE0 A;  4DDY A;  4O01 A;  5E2E A;  2RCX A;  1LL9 A;  5KSH A;  3AGE A;  4P85 A;  3BY9 A;  4JF5 A;  4BBT A;  1P0Z A;  5FDS A;  5EVL A;  3QP5 A;  3IXD A;  2JKT M;  1NYM A;  2INW A;  4Y0U A;  4OOY A;  1ALQ A;  4R6L A;  2H28 A;  3GV9 A;  5M1A A;  2OLU A;  1MWU A;  2Y4A A;  1K4E A;  1IYO A;  5I5L A;  3ITA A;  4M3K A;  3FG8 A;  4CPK A;  4JXV A;  3IXB A;  3OPL A;  2E8I A;  4OPQ A;  5FQ9 A;  1XGI A;  1KVM A;  1G28 A;  1WE4 A;  4ZAM A;  4E3L A;  4DJ2 A;  3IBR A;  4DF6 A;  1TS0 A;  2VGL M;  1CJF A;  4OLD A;  4PM6 A;  3SH9 A;  3A3I A;  1GHP A;  3HLB A;  4R4S A;  3GEC A;  3ZG0 A;  3P7N A;  1GA9 A;  3KSF A;  2J7V A;  4GCZ A;  1OJG A;  2R9W A;  2XRN A;  1YQS A;  5DTK A;  5U47 A;  2Z2L B;  5HPI A;  1PW8 A;  4KUO A;  2ZQC A;  5AQB A;  4HIA A;  3OPR A;  4LGW A;  3BEC A;  2WGW A;  1L0G A;  3T4T A;  4IHQ A;  1FSY A;  4MDZ A;  4EV4 A;  3C38 A;  4OOL A;  3Q1F A;  5DKK A;  2JKR M;  4KZA A;  4K91 A;  1K54 C;  4DMZ A;  1K55 A;  1XA1 A;  3WS5 A;  4GS9 B;  1CK3 A;  3BW6 A;  1XFN A;  5TGF A;  1N9O A;  2PR6 A;  3DAV A;  3OCN A;  4PKY G;  5FQK A;  2X71 A;  3IHA A;  1E4D A;  3QP6 A;  4MNR A;  2IWD A;  2G2U A;  3DTI A;  2BTF P;  2HF6 A;  4WZ4 A;  2A3U A;  4OQI A;  4OLG A;  3A0R A;  1ONG A;  4QB8 A;  1GA0 A;  5EVE A;  3OPH A;  2EFX A;  4BQM A;  4FH4 A;  5GL9 A;  3UNW A;  3IF6 A;  4JGP A;  5DF9 A;  4YNR A;  3U2A A;  1S67 L;  2ZQ7 A;  4MBF A;  2Y2O A;  4ZTK A;  4DKI A;  3IH9 A;  1MWT A;  4KG2 A;  3EOI A;  4KG6 A;  5EVI A;  2OAP 1;  4HEF A;  2JBF A;  4YWZ A;  3DW0 A;  5D3O A;  5AQ7 A;  2WUQ A;  3ZNT A;  4OPZ A;  3G6O A;  1Z6F A;  4WF0 A;  3ZCZ A;  2XEP A;  4NK3 A;  3G30 A;  4KZ7 A;  4XUX A;  5AVE A;  4P6B A;  5DFX A;  4I5S A;  2Y2I A;  1YMS A;  3PBR A;  1EWZ A;  4JF4 A;  4GOG A;  2ZBB A;  4D60 A;  4JXW A;  4OQG A;  3TG9 A;  2WGW B;  1H8M A;  4X1M A;  2XLN A;  4GN2 A;  3E0Y A;  1HVB A;  1NLY A;  3BRM A;  2Y2G A;  3G31 A;  3W2Z A;  1ES5 A;  3WRZ A;  5FQM A;  1U60 A;  3UPP A;  3S4X A;  2DCF A;  3H9W A;  4QWO A;  4IBR A;  1XX2 A;  3MQQ A;  4UEY A;  1BUE A;  2W3H A;  3SH7 A;  4Z9Q A;  2EX2 A;  3MQ0 A;  4HI4 A;  3DTM A;  1KOU A;  2WKH A;  4Y13 A;  1S1Z A;  5FQI A;  3BYD A;  2ZD8 A;  3IF6 B;  4G3K A;  3BFG A;  4P87 A;  2Y55 A;  4Y5F A;  2Y79 A;  3SOI A;  3FZC A;  3ZFZ A;  2HGV A;  4C3Q A;  5IS1 A;  2DNS A;  1IYS A;  1DJB A;  5EVI B;  1NJ4 A;  2JKG A;  5A92 A;  5HAP A;  2A24 B;  3NOT C;  4RYE A;  5BOH A;  1P97 A;  3BFC A;  2I72 A;  3M2J A;  4BBV A;  3G32 A;  2XGN A;  3LIB A;  3O5Y A;  4CLC A;  3A3D A;  5FI6 A;  3ZHH A;  5EVI D;  3Q81 A;  4LCL A;  3BWL A;  4KZ3 A;  4NET A;  5CGW A;  4EEP A;  5IU1 A;  1HTZ A;  1L2S A;  3CZD A;  5EFW A;  1K25 A;  4DE2 A;  4ZBE A;  4WMC D;  1BYW A;  3FKV A;  2XQZ A;  3JVU A;  4YOF A;  5A90 A;  1CEG A;  2A2L A;  5FQQ A;  3LIC A;  1ZKJ A;  2L4R A;  5HL1 A;  3B3X A;  3ZVT A;  1OPX A;  1CF0 A;  3FKW A;  3MXS A;  5HWT A;  2V20 A;  5CEC A;  5A91 A;  3LUQ A;  4LV1 A;  3M6H A;  5I94 A;  3PR6 A;  3AGD A;  4NXB A;  1BZA A;  1JWP A;  3CIT A;  4EBL A;  1IKG A;  4HH3 A;  5GLD A;  2Y2L A;  4NXE A;  1KE3 A;  2W0N A;  5L8M A;  4QY6 A;  2Y2H A;  5F1G A;  1GHI A;  5L07 A;  5KIZ A;  1IYP A;  2WGI A;  2XD5 A;  1XJ4 A;  3HLW A;  2HJE A;  2Y2M A;  2AVX A;  1H5X A;  3MKE A;  5FDH A;  4WYY A;  1L3L A;  2VLG A;  3VOY A;  1G6O A;  1AWI A;  4XT2 A;  1S6R A;  4HJ4 A;  2VV7 A;  1T18 A;  3HBR A;  2R78 A;  4CLC B;  1V9Z A;  3ISG A;  4GJ4 A;  3OBF A;  2Z2M B;  3OPP A;  2K7S A;  3E98 A;  4LRZ E;  5F69 A;  1W63 Q;  2YKF A;  4ZDX A;  2EWV A;  3E2K A;  3IS2 B;  4Q8I A;  1G6A A;  3HLD A;  3TJZ C;  3UB5 P;  2ZL1 A;  3B42 A;  5TFQ A;  2XF3 A;  1ACF A;  1Y4O A;  4NEE D;  4L9G A;  1X0O A;  1JWV A;  2CMN A;  2ZM2 A;  1SDE A;  3RTY A;  2PDR A;  1IOU A;  4E3N A;  5J7E A;  3CUE C;  4YIN A;  1NRJ A;  1F5M A;  3IF6 C;  1VEU A;  1IYQ A;  2OWJ A;  3QP4 A;  2J80 A;  1E3U A;  2JKT I;  4AFI A;  5FQJ A;  3M2K A;  5CXW A;  3R7W A;  1CEF A;  2E8J A;  4L0L A;  2PT7 A;  5FAT A;  4EU0 A;  3GDI A;  2W1R A;  2PD8 A;  2XFS A;  2B18 A;  3NCK A;  3CHW P;  3EGX C;  2XRO A;  2P08 A;  3ZNY A;  3PBO A;  3MMH A;  1TD5 A;  2O9C A;  1RGY A;  2PR5 A;  3ZG9 B;  2R9X A;  3IWQ A;  4GD6 A;  1ERO A;  1K6S A;  5L10 A;  1RCJ A;  1KVL A;  3HCY A;  4UAA A;  4JGQ A;  2VX8 A;  3GR2 A;  3G4P A;  4X53 A;  3ZG5 A;  3VFH A;  4ETX A;  1XGJ A;  4ME4 A;  3IBJ A;  4X6T A;  4I39 A;  3KSI A;  1LSW A;  2BG1 A;  5HFO A;  1YKD A;  1GCE A;  4HBU A;  1PI5 A;  1W63 M;  1TS7 A;  3T4L A;  1SKO A;  2QHK A;  4OH0 A;  3S7Q A;  1UWP X;  2VEA A;  4ZRR A;  3V50 A;  2ZL1 B;  4U0T A;  4WM9 A;  2EXA A;  1YT4 A;  5M19 A;  2JKR I;  4PM7 A;  1K57 C;  1WYC A;  4G3V A;  2GZA A;  1D1J A;  1VM1 A;  3LY3 A;  3SS3 A;  2ZC4 B;  3B33 A;  3CI6 A;  3MZF A;  1FIK A;  4MCW A;  5EOE A;  1OJ5 A;  5EPH A;  3ULF A;  1VEU B;  2XDM A;  4B88 A;  1LI0 A;  4BMW A;  4X55 A;  1NLZ A;  5F68 A;  2MJ6 A;  4EBP A;  4DE3 A;  3VP0 A;  3T12 B;  1I2W A;  3QP8 A;  4G3W A;  3EWK A;  3HJI A;  3OC2 A;  3NY4 A;  1MKM A;  1KDW A;  4UA6 A;  3T1S A;  4OP5 A;  1ZHH B;  4CLC C;  2WKI A;  3BFE A;  4GNU A;  1SDN A;  3C4O A;  3MQO A;  2ZC3 B;  4UA9 A;  2B5R A;  2QZ6 A;  2QPN A;  2Z6D A;  4DXB A;  4E6W A;  5E43 A;  4LLO B;  3ZG7 B;  5CEB A;  3AGF A;  4GLQ A;  1YLJ A;  3G2Z A;  2KX6 A;  3LIA A;  4MN6 A;  2DRW A;  5HWV A;  1MXO A;  4N9K A;  4KQD A;  2HV1 A;  2ZQ9 A;  4RA7 A;  1O07 A;  2IA2 A;  4ZJ1 A;  3RFB A;  5F82 A;  4IJG A;  3FPV A;  2QKP A;  2KOI A;  3UDI A;  4Q0J A;  3IX3 A;  4JKT A;  4R3A A;  4ETZ A;  3QHY A;  1SKO B;  1Z09 A;  3UN7 A;  1H0M A;  3IWI A;  3CMZ A;  4EET B;  1XPB A;  3DWZ A;  3T4O A;  2V0W A;  5GLC A;  1NZO A;  3NOP C;  3CLO A;  1W5D A;  2HZ5 A;  3NHQ A;  3D9Y A;  3FC7 A;  2L0W A;  4QPR A;  3SS5 A;  3RXX A;  5HSQ A;  1FOF A;  2BLS A;  2W3F A;  3IHB A;  4A5R A;  2HP9 A;  3BEB A;  2VV6 A;  3MXQ A;  4OPR A;  1S4R A;  5J3W A;  1VQQ A;  1NXY A;  2VA0 A;  2WKP A;  4C6Y A;  2UWX A;  3HLC A;  4FOF A;  4B93 A;  1FIL A;  1WA9 A;  1ZG6 A;  3GSG A;  2OAQ 1;  4UA7 A;  4X69 A;  3EQU A;  2J9O A;  3TRC A;  4ARZ A;  1FCO A;  3E2L A;  4HOI A;  4L9F A;  5C5K A;  4ZJ2 A;  1JTG A;  2X02 A;  1YPR A;  4S2L A;  4WEL A;  3VMA A;  4S2M A;  2ZOI A;  5DVA A;  4OVD A;  4BL2 A;  3UO9 A;  3QP2 A;  3RJU A;  3NIA A;  1WYB A;  2OV5 A;  2ZM0 A;  2XFT A;  3MSH A;  5HPF A;  3IXG A;  5DTS A;  3WRT A;  4LRY C;  5FI2 A;  2A24 A;  4QJG A;  4S2I A;  4JLF A;  3OCL A;  4X56 A;  3WS1 A;  1OTA A;  3F1P A;  3L7H A;  3NEC A;  4Y7P A;  3K2N A;  5HZH A;  4HJ6 A;  1K6R A;  4WMC A;  1NY0 A;  5CHM A;  5TJJ A;  1XJ2 A;  4JPM A;  1MZU A;  4LPZ A;  1DJA A;  2PHY A;  1KGE A;  1MBL A;  1LSV A;  3IF5 A;  3F1N B;  3NDE A;  3TW8 A;  2XA7 S;  4Z1W A;  3OOV A;  2VV8 A;  4R70 A;  4EXO A;  3ICY A;  2ZQD A;  3T1R A;  4X25 A;  5GHZ A;  5HAI A;  1TS8 A;  1UWN X;  4JGO A;  2P74 A;  4QY5 A;  2VGJ A;  1S1Y A;  1EI5 A;  2Y8H A;  3Q7Z A;  4E3K A;  5DFY A;  2H0T A;  2HP5 A;  3O3V A;  3MS6 A;  3ZGA B;  1IEL A;  1V9Y A;  1YLT A;  1BLP A;  3E4O A;  3PBS A;  4GB7 A;  1GSW A;  3BJN A;  4ARZ B;  1OTB A;  2Q0O A;  3N8S A;  1W79 A;  3UDF A;  3V67 A;  3NC8 A;  4IVI A;  4MN7 A;  4LRX C;  3UB7 A;  1ZTU A;  3MR0 A;  3V3S A;  1LSX A;  4D2O A;  1NYY A;  1BUL A;  3G2Y A;  1T1B A;  1KGF A;  3LO7 A;  2G2W A;  2WAD A;  5AVF A;  3EEH A;  5HW3 A;  3T1X A;  1IEM A;  2HDS A;  4MN5 A;  4S2N A;  3U4L P;  2Y59 A;  4WBG A;  5TBM A;  3NUL A;  3IT9 A;  1YAX A;  2GNX A;  4NKP A;  3F1P B;  2W27 A;  1YLZ A;  4E04 A;  4UHU A;  2FFY A;  1YLY A;  4RVA A;  3C5A A;  3KO6 A;  4GD8 A;  5DJU A;  5CTM A;  3LI9 A;  4R3J A;  1GSV A;  4BEN A;  2B95 A;  3IS2 A;  2HDR A;  5KMW A;  4KZ4 A;  3N4I A;  3UE1 A;  4U0X A;  2RL3 A;  5DF7 A;  2WKR A;  2Y2J A;  5JYP A;  4GDN A;  2GJ3 A;  4MBK A;  4OP8 A;  5FAS A;  3E4Q A;  3MF0 A;  4MEZ A;  3A0S A;  1K56 A;  4S2O A;  4LFU A;  1SKF A;  5HAQ A;  5HL6 A;  1ES3 A;  4OON A;  1MPL A;  3K3C A;  5F83 A;  5M18 A;  4HJ3 A;  2V2F F;  3R4K A;  3LR0 A;  2W1T A;  4HHD A;  3UDX A;  4HES A;  3UE3 A;  4N9L A;  2XR0 A;  4PAU A;  4R38 A;  4GW9 A; 
#chains in the Genus database with same CATH homology
 1KVL A;  1MKI A;  2JE5 A;  1KVM A;  4KQO A;  4UAA A;  1WE4 A;  4ZAM A;  3GR2 A;  3NBL A;  3W4O A;  4E3L A;  3G4P A;  4DF6 A;  3BLS A;  4OLD A;  3V39 A;  1L0E A;  4DXC A;  4PM6 A;  3SH9 A;  4Y0T A;  3I7J A;  2C5W B;  4X53 A;  3UY6 A;  3VFH A;  3ZG5 A;  3A3I A;  3HL9 A;  2Y2Q A;  1C3B A;  1GHP A;  1N9B A;  4WEJ A;  3HLB A;  4LEN A;  1XGJ A;  3OZH A;  3WS0 A;  5KZH A;  4R4S A;  4BJP A;  4X6T A;  5EOO A;  1W8Y A;  1M40 A;  4P0M A;  3ZG0 A;  1ERM A;  1GA9 A;  2ZLY A;  2BG1 A;  2J7V A;  1NZU A;  2OSU A;  1PZP A;  2R9W A;  5FI7 A;  4O7D A;  5HFO A;  1YQS A;  1YMX A;  2J9P A;  2P9V B;  2Z2L B;  5DTK A;  5GHY A;  5U47 A;  2ZC5 B;  1GCE A;  1H8Z A;  4R23 A;  2WAF A;  4HBU A;  1PW8 A;  2ZQC A;  4B4Z A;  1PI5 A;  5AQB A;  3OPR A;  5AQ9 A;  3HUM A;  3A3E A;  2GDN A;  3O86 A;  4OH0 A;  1BLS A;  2HDQ A;  4R3B A;  3V50 A;  3BEC A;  4QD4 A;  2WGW A;  1K38 A;  4U0T A;  4WM9 A;  2EXA A;  1L0G A;  4EBN A;  1YT4 A;  5M19 A;  5KSC A;  1FSY A;  1ZG4 A;  1K57 A;  3UPN A;  1BTL A;  1BSG A;  4PM7 A;  4EV4 A;  1K54 A;  3Q7V A;  1K57 C;  1WYC A;  4OOL A;  3Q1F A;  3DWK A;  4KZA A;  4K91 A;  1K54 C;  1VM1 A;  3LY3 A;  4QU3 A;  1K55 A;  3JYI A;  3SS3 A;  1XA1 A;  2ZC4 B;  3MZF A;  2WZX A;  3WS5 A;  1AXB A;  1CK3 A;  2WK0 A;  5EOE A;  1K55 C;  3G34 A;  3WS4 A;  5EPH A;  5TGF A;  1PWD A;  4KZ8 A;  2XDM A;  4B88 A;  1LI0 A;  4JF6 A;  3IQA A;  1HD8 A;  3OCN A;  5FQK A;  3UPO A;  2X71 A;  3IHA A;  1E4D A;  4MNR A;  4X55 A;  2IWD A;  4BD1 A;  3IWO A;  2G2U A;  4PMA A;  5E2G A;  3P98 A;  3TSG A;  3HRE A;  1E25 A;  4WZ4 A;  1PI4 A;  2A3U A;  4OQI A;  4OLG A;  5CHJ A;  4BLM A;  4EBP A;  1ONG A;  4QB8 A;  3VP0 A;  4DE3 A;  1GA0 A;  2X01 A;  4PPR A;  3OPH A;  2FFF B;  4PM5 A;  2EFX A;  4S2K A;  1QME A;  1PYY A;  1I2W A;  4BQM A;  4FH4 A;  5GL9 A;  3UNW A;  4FCF A;  3C4P A;  1K4F A;  3IF6 A;  4KZB A;  3W4Q A;  5DF9 A;  1DJC A;  3OC2 A;  1LI9 A;  2ZQ7 A;  4MBF A;  3NY4 A;  2Y2O A;  4ZTK A;  1KDW A;  3A3J A;  4DKI A;  4UA6 A;  3IH9 A;  2IWC A;  3Q07 A;  2WZZ A;  1MWT A;  4E3M A;  1YLW A;  4OP5 A;  5E2F A;  5FAP A;  4KG2 A;  2WKI A;  3BFE A;  1QMF A;  1SDN A;  3C4O A;  4GNU A;  4X68 A;  4E3I A;  2ZC3 B;  2QMI A;  4KG6 A;  2B5R A;  4LCM A;  2QZ6 A;  4UA9 A;  5EVI A;  2QPN A;  4HEF A;  4DXB A;  1K56 D;  2H0Y A;  4RX3 A;  2JBF A;  4E6W A;  3DW0 A;  5D3O A;  5E43 A;  5AQ7 A;  3ZG7 B;  5EVI C;  5CEB A;  3AGF A;  2WUQ A;  1YLJ A;  1XP4 A;  3G2Z A;  4R4R A;  5IHV A;  3EQV A;  4Y0O A;  3ZNT A;  3ZG8 B;  1SCW A;  2DRW A;  4KG5 A;  3VSK A;  1MXO A;  4OPZ A;  3FYZ A;  4N9K A;  3IH8 A;  4OQH A;  4KEN B;  1Z6F A;  2ZQ9 A;  3ZCZ A;  2XEP A;  4NK3 A;  4KQR A;  4DE0 A;  4GKU A;  4RA7 A;  3UE0 A;  1O07 A;  3G30 A;  1BLC A;  1JTD A;  4KZ7 A;  4P6B A;  4XUX A;  3HUN A;  3ZDJ A;  4EUZ A;  4ZJ1 A;  4E3O A;  2Y2I A;  5F82 A;  4E6X A;  1MY8 A;  1CI8 A;  1FSW A;  4KZ5 A;  1PW1 A;  3S1Y A;  2HDU A;  2H5S A;  3W8K A;  2Q9N A;  1YMS A;  4DRT A;  2EFU A;  3C7V A;  3PBR A;  4HBT A;  1PZO A;  3UDI A;  1G68 A;  4JKT A;  1EWZ A;  4JF4 A;  4GOG A;  3QHY A;  3VFF A;  4JXW A;  3LEZ A;  3NDG A;  1ES4 A;  1ES2 A;  4OQG A;  1ESI A;  1ONH A;  2HPB A;  3TG9 A;  3UN7 A;  3IWI A;  2WGW B;  5CGX A;  3CMZ A;  5G18 A;  2XLN A;  4GN2 A;  1XPB A;  1HVB A;  3VSL A;  2Y91 A;  3V5M A;  5L2F A;  3DWZ A;  2PU4 A;  1W8Q A;  1Q2P A;  3BRM A;  2Y2G A;  3O88 A;  4YFM A;  5GLC A;  2A49 A;  1FCM A;  3G31 A;  3Q7V B;  1NZO A;  4OOM A;  3QNB A;  1ES5 A;  3WRZ A;  1W5D A;  1M6K A;  5FQM A;  1U60 A;  3UPP A;  2PU2 A;  1LLB A;  3S4X A;  5GLB A;  3M6B A;  2DCF A;  4KQQ A;  3SS5 A;  3RXX A;  4IBR A;  3MBZ A;  1PWG A;  1FOF A;  1XX2 A;  1TDL A;  2BLS A;  3IHB A;  4A5R A;  2HP9 A;  1BUE A;  1I2S A;  3BEB A;  2ZMA A;  3SH7 A;  4Z9Q A;  4OPR A;  1L0F A;  1RGZ A;  3LY4 A;  2EX2 A;  4FH2 A;  5CRF A;  5FAO A;  4FD8 A;  2ZC7 A;  4XUZ A;  4KZ6 A;  1VQQ A;  1NXY A;  4OPY A;  3DTM A;  2ZQA A;  2ZC6 B;  1IKI A;  4GDB A;  3WS2 A;  2WKH A;  2ZQ8 A;  4C6Y A;  5FQI A;  3BYD A;  3W4P A;  4N1X A;  4CJN A;  1S0W A;  4PM9 A;  2UWX A;  3HLC A;  4F94 A;  2ZD8 A;  2EX6 A;  3IF6 B;  4OKP A;  1SHV A;  3BFG A;  4P87 A;  2Y55 A;  3N7W A;  4N92 A;  1ZG6 A;  3GSG A;  4C75 A;  1XA7 A;  3V3R A;  2Y2P A;  3SOI A;  3FZC A;  4UA7 A;  4X69 A;  4ID4 A;  5HX9 A;  3ZFZ A;  3G35 A;  3EQU A;  2J9O A;  3TOI A;  1FCO A;  1OME A;  3D4F A;  3E2L A;  4C3Q A;  2DNS A;  1IYS A;  3P09 A;  4ZJ2 A;  1JTG A;  1DJB A;  2X02 A;  1O7E A;  3HLE A;  5EVI B;  5CER A;  1YM1 A;  4S2L A;  2H10 A;  1NJ4 A;  4WEL A;  1KGG A;  5A92 A;  3VMA A;  5HAP A;  1DY6 A;  4RYE A;  4S2M A;  1CI9 A;  4DE1 A;  3GVB A;  3N8L A;  3PBN A;  5DVA A;  4OVD A;  3S22 A;  3PBQ A;  5BOH A;  5CED A;  4BL2 A;  1GHM A;  3BFC A;  2I72 A;  3M2J A;  2VGK A;  4RX2 A;  3MKF A;  3UO9 A;  3G32 A;  2XGN A;  3RJU A;  3A3D A;  4S2P A;  2HP6 A;  5FI6 A;  3ZHH A;  3NIA A;  5EVI D;  3VOZ A;  3CG5 A;  3Q81 A;  4LCL A;  1WYB A;  1I5Q A;  2OV5 A;  2ZM0 A;  4KZ3 A;  4NET A;  2XFT A;  5CGW A;  5EUA A;  3SH8 A;  1HTZ A;  1L2S A;  3CZD A;  3IXG A;  5DTS A;  1HZO A;  3WRT A;  5GLA A;  1K25 A;  5FI2 A;  4DE2 A;  4QJG A;  5J8X A;  4S2I A;  4ZBE A;  2WGV A;  4JLF A;  3OCL A;  4WMC D;  4X56 A;  5E2H A;  4WZ5 C;  3WS1 A;  3FKV A;  3O87 A;  2XQZ A;  4Y7P A;  1FR1 A;  3A3F A;  1MWR A;  1K6R A;  5A90 A;  4WMC A;  1CEG A;  1NY0 A;  5CHM A;  3BLM A;  2IWB A;  3PAG A;  3PBT A;  3HLF A;  4JPM A;  3NI9 A;  5FQQ A;  1DJA A;  4N1H A;  1KGE A;  3GQZ A;  1MBL A;  2J8Y A;  3C7U A;  2WKE A;  1XKZ A;  1YLP A;  3IF5 A;  1ZKJ A;  3NDE A;  4JBF A;  3WWX A;  3SS4 A;  3MZD A;  4QHC A;  5GHX A;  1KDS A;  3VP1 A;  3CJM A;  5HL1 A;  1JWZ A;  3B3X A;  3ZVT A;  2ZQD A;  3FKW A;  3MXS A;  2ZJ9 A;  5CHU A;  2V20 A;  5CEC A;  5A91 A;  1TVF A;  4S2J A;  5GHZ A;  4LV1 A;  1Y54 A;  5FA7 A;  5HAI A;  4E3J A;  3M6H A;  5CTN A;  5EE8 A;  4R0Q A;  5I94 A;  3BFF A;  5HAR A;  3AGD A;  2P74 A;  4QY5 A;  2VGJ A;  1EI5 A;  1NRF A;  2JC7 A;  1BZA A;  1JWP A;  3Q7Z A;  4E3K A;  4MBH A;  1JVJ A;  3GRJ A;  2H0T A;  4EBL A;  2Y2K A;  1IKG A;  2JCH A;  3HVF A;  2Y2N A;  5GLD A;  2HP5 A;  2Y2L A;  5AQA A;  3O3V A;  1KE3 A;  5FAQ A;  4QY6 A;  2Y2H A;  4MLL A;  3ZGA B;  1FCN A;  1IEL A;  3VP2 A;  3MFD A;  4U3T A;  1W7F A;  2OLV A;  2CC1 A;  1GHI A;  5F1G A;  4IED A;  1YLT A;  1BLP A;  1IYP A;  1PWC A;  3PBS A;  4GB7 A;  2C6W B;  2WGI A;  5DTT A;  4EWF A;  2XD5 A;  4LV3 A;  3N8R A;  5CGS A;  3HLW A;  3MXR A;  2Y2M A;  3N8S A;  1W79 A;  3UDF A;  3N6I A;  1H5X A;  3MKE A;  3NC8 A;  3GTC A;  4IVI A;  3PTE A;  5FDH A;  4WYY A;  1H8Y A;  4WEK A;  3VOY A;  3V3S A;  1J9M A;  4ZJ3 A;  4D2O A;  1NYY A;  1BUL A;  4EQI A;  2WAE A;  1S6R A;  3G2Y A;  3HBR A;  5DF8 A;  4BL3 A;  4R1G A;  3BFD A;  3LCE A;  3LO7 A;  1KGF A;  3IXH A;  5A93 A;  2G2W A;  2WAD A;  3BM6 A;  4PM8 A;  3ISG A;  5HW3 A;  2ZM8 A;  4H8R A;  1IEM A;  2HDS A;  3QNC A;  4KZ9 A;  4S2N A;  2Z2M B;  4XXR A;  1ZC2 A;  3RXW A;  3OPP A;  4FSF A;  2P9V A;  2Y59 A;  4WBG A;  3HLG A;  2V1Z A;  4S2N C;  3FV7 A;  2PBY A;  3IT9 A;  1FR6 A;  2XK1 A;  1FQG A;  1N4O A;  3ZVW A;  4ZDX A;  5F1F A;  3E2K A;  4Q8I A;  1ERQ A;  1G6A A;  3HLD A;  2XH9 A;  1TDG A;  1XXM A;  1BLH A;  5TFQ A;  2XF3 A;  1Q2Q A;  2EX9 A;  5EEC A;  5TR7 A;  4IBX A;  1PIO A;  4LV2 A;  1YLZ A;  4UHU A;  2FFY A;  1YLY A;  1LHY A;  4RVA A;  4BD0 A;  1JWV A;  4IVK A;  3C5A A;  4OQ0 A;  4GD8 A;  2ZM2 A;  3ITB A;  1SDE A;  5JYO A;  2EX8 A;  4K0W A;  4JXS A;  5CTM A;  1BT5 A;  4E3N A;  4WZ5 A;  1MWS A;  1TEM A;  3FWL A;  1E3U D;  4R3J A;  1ESU A;  4BEN A;  1RP5 A;  4YIN A;  2XD1 A;  1KE0 A;  2EXB A;  4DDY A;  3IF6 C;  2HDR A;  4LV0 A;  3HUO A;  5E2E A;  2RCX A;  1IYQ A;  1LL9 A;  4GZB A;  1E3U A;  5KMW A;  4KZ4 A;  3AGE A;  1KE4 A;  5KSH A;  4P85 A;  3N4I A;  3UE1 A;  4U0X A;  4JF5 A;  2RL3 A;  5FQJ A;  3M2K A;  3MZE A;  5CXW A;  3Q82 A;  1CEF A;  5DF7 A;  4L0L A;  5EVL A;  4K0X A;  2Y2J A;  5FAT A;  5JYP A;  3VP3 A;  3IXD A;  4GDN A;  1NYM A;  2XFS A;  4MBK A;  3NCK A;  4OP8 A;  5FAS A;  4Y0U A;  4JXG A;  4OOY A;  4MEZ A;  1ALQ A;  3PAE A;  1K56 A;  4S2O A;  3ZNY A;  3GV9 A;  1SKF A;  3PBO A;  5HAQ A;  5M1A A;  1ES3 A;  2OLU A;  1MWU A;  4OON A;  4B4X A;  1RGY A;  1LL5 A;  1MPL A;  5F83 A;  2Y4A A;  2WYX A;  3ZG9 B;  2V2F F;  1K4E A;  2R9X A;  3GMW A;  3UDX A;  5M18 A;  4HES A;  1IYO A;  5FSR A;  2Q9M A;  3UE3 A;  4DDS A;  4N9L A;  3ITA A;  4M3K A;  3IWQ A;  4CPK A;  2XR0 A;  4GD6 A;  4JXV A;  1ERO A;  1K6S A;  3VP4 A;  3IXB A;  3OPL A;  2E8I A;  1L0D A;  1RCJ A;  4OPQ A;  5FQ9 A;  1XGI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...