3Q7VB

Beta-lactam-sensor domain of blar1 (apo) from staphylococcus aureus with carboxylated lys392
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
252
structure length
251
Chain Sequence
QSITDYNYKKPLHNDYQILDKSKIFGSNSGSFVMYSMAADAYYIYNEKESRKRYSPNSTYIYLAMFGLDRHIINDENSRMSWNHKHYPFDAWNKEQDLNTAMQNSVNWYFERISDQIPKNYTATQLKQLNYGNKNLGSYKSYWMEDSLKISNLEQVIVFKNMMEQNNHFSKKAKNQLSSSLLIKKNEKYELYGKTGTGIVNGKYNNGWFVGYVITNHDKYYFATHLSDGKPSGKNAELISEKILKEMGVLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase regulatory protein BlaR1
publication title Lysine Nzeta-decarboxylation switch and activation of the beta-lactam sensor domain of BlaR1 protein of methicillin-resistant Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase regulator
total genus 78
structure length 251
sequence length 252
ec nomenclature
pdb deposition date 2011-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3q7vB00
5E2FA 4BQMA 3ZGAB 2BG1A 4XUXA 4E3NA 1BT5A 4KG2A 5AQ9A 3IH8A 2Y91A 4OOLA 3O88A 4MEZA 1IYQA 1NXYA 5FI6A 1IYSA 5FAOA 1OMEA 3LO7A 3IHBA 1DJBA 5KSHA 3O87A 1SDEA 1FR6A 4DDYA 1XP4A 2GDNA 2Z2MB 3BLSA 1YLZA 2BLSA 3HL9A 4XUZA 4RX3A 3IWOA 1FQGA 5TGFA 1ES3A 3G2ZA 5GHYA 1MKIA 2C6WB 3IHAA 1IKGA 4QJGA 3PBNA 1XX2A 3C7UA 4S2KA 3UPNA 2Y2QA 3Q82A 1G68A 1NYYA 4LCLA 3ITBA 5E2GA 1XA7A 5G18A 5GLDA 3PBRA 1K6SA 3QNBA 1JVJA 1TDLA 3VOYA 1FCMA 1U60A 1DJCA 4OP5A 1YLWA 1K4EA 3C4OA 4CPKA 5DTKA 2H5SA 3Q07A 1MY8A 1MWSA 4U3TA 1E3UD 5FQKA 4WZ4A 4DDSA 1GCEA 3HUOA 5BOHA 5M19A 3N8RA 4JF4A 1K55A 2OLVA 2WGVA 1ERMA 3IWIA 3P09A 3VFHA 3BFGA 3ZG5A 2G2UA 2ZC6B 3BEBA 3LY4A 4KZ8A 5FQIA 4ZBEA 4E3IA 1GHMA 3NC8A 2HDUA 1ALQA 2V2FF 4OONA 4OPQA 3BRMA 1KGFA 1JWVA 2EX6A 5HAIA 3IF6B 2X02A 3CMZA 4KZ5A 2PU4A 3BECA 4QD4A 3OCNA 4R4RA 3MFDA 1ZG4A 5FATA 1NY0A 5GLBA 3IXGA 1KVMA 1K55C 4P85A 4JLFA 4E3KA 4KG5A 4PM7A 1ES2A 5FQJA 1PWCA 3GTCA 1CEFA 1MWRA 2QPNA 1QMEA 3LY3A 4X6TA 3O3VA 3OPPA 3OPLA 3RJUA 1MWUA 3Q7ZA 4R0QA 5EVIB 4EBLA 2XQZA 4EWFA 4GD6A 5DTTA 1EI5A 2WKHA 2P9VB 5FI7A 2ZM8A 5KMWA 1Z6FA 2ZQ8A 3BLMA 2PBYA 2Y2OA 5D3OA 3VP0A 4JPMA 1WE4A 3VSKA 2H10A 4P87A 2XH9A 3IXHA 1E4DA 5EOOA 4ZJ2A 5HARA 3VMAA 3OC2A 4QU3A 2XF3A 2HDRA 2XDMA 4KZBA 4P0MA 3WS0A 2XEPA 4IVIA 4QB8A 4WMCA 5CHJA 1KGGA 3GRJA 5FAQA 1BSGA 2HDSA 4ID4A 3UY6A 3HLBA 3ZVWA 4JF5A 4DE1A 5GHXA 5DF8A 1K54A 5CGWA 2UWXA 4LV2A 1W8QA 1L2SA 4U0XA 1LHYA 3TG9A 5EOEA 5A90A 2JC7A 2ZJ9A 3JYIA 4R3BA 2XD5A 1W7FA 4FD8A 1RGYA 5A93A 3PBOA 3GV9A 1JTGA 4JBFA 3ZG7B 2X01A 2ZD8A 3NY4A 4WEJA 3G32A 1L0EA 2Z2LB 4B88A 5FASA 4R4SA 2HPBA 4K0XA 3GSGA 4FSFA 4IBXA 3WRTA 1K54C 1RGZA 3HBRA 3IF5A 2DRWA 2G2WA 3O86A 2Y2IA 4WZ5A 4ZJ3A 5TR7A 3W4PA 1Q2PA 5EVLA 2ZQCA 5F83A 4LV3A 4DRTA 4EV4A 2ZQDA 5DF7A 1MWTA 3MZDA 3QHYA 3V3SA 1DJAA 3M2JA 2J9OA 1KDWA 1L0FA 3N8SA 4S2MA 4R23A 4JXWA 3A3DA 1FR1A 3MXSA 4IEDA 4DXBA 4PMAA 2Q9MA 1L0GA 4KG6A 4OLDA 3BFEA 1TDGA 1XKZA 4Q8IA 4PM6A 4Y7PA 2OSUA 3B3XA 1XGJA 4WZ5C 1JTDA 4X53A 1K4FA 3A3IA 4KQOA 2XK1A 3PBQA 5CTMA 3FV7A 3ZNTA 4OQ0A 1H5XA 2WYXA 1Y54A 4KZ3A 4E3MA 1KGEA 1PWGA 2ZC5B 4GN2A 4K0WA 2OV5A 4C75A 5CEDA 3C4PA 1RCJA 2I72A 3EQVA 4FH2A 3IT9A 1ESIA 2A3UA 2VGKA 3NDGA 4ZTKA 2V1ZA 1O07A 1IKIA 4KQQA 1BTLA 3M2KA 4HEFA 4OPZA 1Q2QA 3NCKA 2WUQA 3WS2A 5E2EA 5GHZA 5FAPA 1IYOA 1PZPA 4GDNA 3OPHA 5CXWA 3GR2A 4CJNA 3NBLA 3LEZA 4GKUA 1C3BA 4WELA 3N8LA 5CECA 2WZXA 3A3EA 5CRFA 3DTMA 3V3RA 4EUZA 4EBNA 3AGDA 3W4QA 2DNSA 1LL9A 4LV1A 1G6AA 1QMFA 1GA0A 4N92A 3WS4A 1TEMA 1FCOA 3WWXA 2WGWA 3MXRA 2FFFB 4NETA 3I7JA 1CI9A 3G31A 5CGXA 4FH4A 3E2KA 2ZQ7A 1NZUA 5GL9A 1L0DA 2QMIA 3OPRA 4OQIA 1BLHA 2IWCA 3HLWA 4YFMA 4LV0A 3CZDA 3VP3A 5E43A 5CHUA 4E3LA 5EECA 1LLBA 5FA7A 1ESUA 3GVBA 4L0LA 3ZHHA 5DVAA 1J9MA 3AGEA 1BZAA 4FCFA 1MPLA 3C5AA 4P6BA 5E2HA 1VM1A 3S4XA 4E3JA 2EX9A 2Y2KA 1XGIA 5A92A 2ZMAA 1BLPA 5A91A 4B4XA 2ZQAA 3UE3A 5CTNA 1PZOA 4MLLA 3CJMA 1I2SA 3MKEA 3SS3A 2ZM2A 1EROA 3G35A 4A5RA 5HAQA 2HP5A 1K56A 3UPPA 4DXCA 4E6XA 4OVDA 3GQZA 4Y0OA 4Y0TA 3MBZA 1M40A 4KZ6A 1H8YA 4Y0UA 5TFQA 1PYYA 1K25A 3G4PA 2XD1A 3A3FA 4Z9QA 4D2OA 4WMCD 3UDFA 2H0YA 3IXDA 2Y2GA 2WKIA 4KZ9A 3W4OA 1BLSA 2EFUA 3M6BA 4BD0A 4BL3A 4R1GA 3A3JA 1SHVA 4WBGA 3RXWA 3Q7VB 4HESA 2Y2HA 3TSGA 3NDEA 1YLTA 1CEGA 3IH9A 4ZJ1A 4OPRA 1BUEA 4XXRA 1NJ4A 4OOMA 5F1FA 2VGJA 1RP5A 4JXSA 1SCWA 1YT4A 1MXOA 5IHVA 3ZG0A 1JWZA 1HD8A 5HW3A 1ZG6A 3BFCA 3IF6A 4DE3A 2A49A 3IXBA 2OLUA 1I5QA 3IWQA 1I2WA 3OZHA 1FSYA 1S0WA 3SS4A 1NRFA 2JBFA 1DY6A 4HBTA 1BLCA 4IBRA 3PBTA 4LCMA 4OQGA 5FDHA 3V39A 1KDSA 3ZNYA 3HUMA 2R9WA 1KVLA 2ZC4B 3NIAA 4QY6A 5CERA 1W8YA 2Q9NA 1YLYA 3OCLA 4N1XA 3SH9A 4DE2A 4M3KA 5EUAA 5FQ9A 2JE5A 1FSWA 1YLPA 1N9BA 2JCHA 4OKPA 2EX2A 3RXXA 1FCNA 3IF6C 2J9PA 1ES5A 3WS5A 2J7VA 3UE0A 4WM9A 1S6RA 3NI9A 3TOIA 2J8YA 2PU2A 2ZQ9A 2EXAA 5EVIA 3G2YA 4DE0A 3E2LA 1GA9A 4S2JA 1W5DA 1AXBA 2HP6A 2P9VA 2WGWB 2ZC3B 3FYZA 3GMWA 3M6HA 4N1HA 4MNRA 4QHCA 4S2NA 1HVBA 4UA7A 3ZG8B 2IWDA 3HREA 4OPYA 3HLCA 3MZEA 4JKTA 4MBFA 3S1YA 4S2PA 1PWDA 4GNUA 1XA1A 4RA7A 1KE3A 1N4OA 3S22A 4RVAA 2XLNA 5EVIC 2Y59A 3VP4A 5HL1A 4JXVA 3HVFA 3UPOA 1VQQA 3WS1A 1PIOA 2B5RA 4S2NC 5I94A 1CK3A 4WEKA 3N6IA 4KQRA 2IWBA 4C6YA 4PM9A 2P74A 3BYDA 4C3QA 3LCEA 4GD8A 1LI0A 2WKEA 5FQQA 2EXBA 2Y2LA 5J8XA 2X71A 4LENA 4H8RA 1BULA 1PW8A 3DW0A 3HLGA 3VOZA 3UN7A 3HUNA 1YLJA 4GDBA 5AQAA 1GHIA 1O7EA 1H8ZA 4RYEA 4E6WA 3Q81A 3N4IA 3FKVA 3FKWA 4PPRA 1MBLA 2Y4AA 4EQIA 4ZDXA 1K38A 3IQAA 4MBKA 4UA6A 4KZAA 5JYPA 5HAPA 2RL3A 1ONGA 2C5WB 2ZC7A 3EQUA 3N7WA 3UO9A 1ERQA 3ITAA 1EWZA 2XFSA 4F94A 3MKFA 3VSLA 1K56D 3G34A 5DF9A 3WRZA 1PI5A 4BENA 1KE0A 4X56A 4GB7A 1IELA 2V20A 4UHUA 2WADA 4S2OA 3SH8A 3VP2A 4BL2A 2Y2MA 1E3UA 1IYPA 4X69A 4OOYA 3ZDJA 2H0TA 2ZM0A 2XGNA 4MBHA 3HLFA 4OH0A 3ISGA 4OQHA 3VFFA 1NZOA 4N9KA 4ZAMA 2XFTA 1CI8A 1LI9A 5F82A 2XR0A 4B4ZA 5CGSA 4GZBA 3UDXA 4BLMA 3DWZA 1YM1A 3PTEA 4OLGA 2WAEA 3AGFA 3FWLA 5CHMA 5AQ7A 1KE4A 2E8IA 2HDQA 1XXMA 4R3JA 5FQMA 1ES4A 4RX2A 5EE8A 2EX8A 2Y2PA 3PAEA 1LL5A 3C7VA 1ONHA 2QZ6A 5CEBA 5JYOA 2RCXA 1YQSA 2WZZA 3D4FA 3VP1A 4UAAA 2WK0A 5FSRA 2DCFA 3V5MA 2EFXA 5EPHA 4WYYA 3V50A 3SS5A 4PM8A 5F1GA 5U47A 4E3OA 4S2IA 4DKIA 3SOIA 4UA9A 4U0TA 3UNWA 4IVKA 5GLCA 1K6RA 1WYBA 3HLEA 1PI4A 3FZCA 3PAGA 3ZG9B 1IEMA 5AQBA 3UE1A 5M18A 1K57A 1ZC2A 2WGIA 2R9XA 1JWPA 1WYCA 4OP8A 5EVID 4K91A 4KENB 1HZOA 1W79A 3HLDA 5KSCA 1SKFA 1E25A 4O7DA 4GOGA 4S2LA 4EBPA 3BM6A 1M6KA 5DTSA 4PM5A 3BFFA 4HBUA 4JXGA 4X55A 3ZCZA 5HX9A 1SDNA 1GHPA 4BD1A 5GLAA 5M1AA 3ZVTA 4YINA 1PW1A 1TVFA 4X68A 1FOFA 4JF6A 3Q1FA 4QY5A 1XPBA 1ZKJA 1K57C 1YMSA 3UDIA 5KZHA 4N9LA 3MZFA 2WAFA 2FFYA 5HFOA 2Y2NA 4NK3A 3SH7A 1NYMA 2Y2JA 1YMXA 3BFDA 2ZLYA 3DWKA 2Y55A 4DF6A 3W8KA 3CG5A 3Q7VA 5FI2A 3ZFZA 4KZ7A 5L2FA 3P98A 4BJPA 2HP9A 2CC1A 4KZ4A 3PBSA 3G30A 1HTZA 3QNCA
chains in the Genus database with same CATH superfamily
3IH8A 4OOLA 3O88A 1IYQA 1NXYA 5FI6A 5FAOA 2J3TC 1SDEA 4DDYA 2B18A 2BLSA 4XUZA 3T4SA 1F98A 1UWPX 4RX3A 1FQGA 1ES3A 1IKGA 3C7UA 4S2KA 3UPNA 2Y2QA 1G68A 4LCLA 3PBRA 1TDLA 3RH8B 4EW7A 1U60A 1DJCA 2VV8A 3MFXA 1K4EA 1TS8A 2H5SA 1MY8A 3U4LP 4DDSA 4WZ4A 1K55A 3IWIA 3EEHA 4II7A 2G2UA 4KZ8A 3QP4A 1GHMA 4G3VA 2HDUA 1OT6A 1S1YA 1KGFA 2EX6A 5HAIA 3H82B 3VE4A 1ZG4A 5IS1A 1KVMA 3IX3A 1ES2A 2XSSA 3CPTB 1GSWA 3O3VA 3OPPA 4UQIS 2GNXA 2M1CA 5EVIB 3ULFA 4GD6A 5FI7A 1W63M 2PBDP 2W1RA 5KMWA 3BLMA 2PBYA 4JPMA 4JGRA 1WE4A 2XH9A 2HDRA 4IVIA 5CHJA 3UY6A 1G5UA 2XA7S 3UMEA 1SKOA 2PDRA 2VK3A 2D01A 1L2SA 2HJEA 3TG9A 5EOEA 2JC7A 2ZJ9A 3JYIA 1W7FA 1SZVA 4WEJA 3G32A 5L8MA 3IBRA 4R4SA 2HPBA 4FSFA 1JNUA 4IBXA 1K54C 1RGZA 2ZBBA 3O86A 3IF5A 4EEPA 2VV7A 3BW6A 5EVLA 3VV4A 2ZQCA 2W3GA 4DRTA 5DF7A 3V3SA 1DJAA 1KDWA 3A3DA 4M4XA 1FR1A 4DJ2A 4D60A 3F1OB 3B3XA 3DAVA 1JTDA 1TF1A 1OTAA 4OQ0A 1Y54A 4E3MA 3V67A 4FH2A 4UQIM 4F3LA 2V1ZA 4KQQA 1IKIA 3M2KA 4EETB 3NCKA 3T4TA 3TRCA 1IYOA 1PZPA 3GR2A 3LEZA 4IUHA 4LFUA 2Y8HA 1C3BA 3KYQA 4GKUA 1ZTUA 2HF6A 4EBNA 3PHYA 5HPIA 4YOFA 2XA7M 5CGXA 3E2KA 3T4JA 1BLHA 2W1TB 3D3OA 3VP3A 5CHUA 3VOLA 3GVBA 3ZHHA 1J9MA 1MPLA 4P6BA 5AVEA 5E2HA 1VM1A 3GECA 1MKMA 2EX9A 4E3JA 1XGIA 2ZMAA 5EVEA 5CTNA 3T1QB 4NXEA 5HAQA 4OVDA 4Y0OA 3T50A 2JKRI 1H8YA 4O01A 1DP6A 1K25A 2W3HA 2H0YA 1ODVA 2Y2GA 2JHEA 3FC7A 3W4OA 4ESPA 2W0NA 3H9WA 3M6BA 4WBGA 2Y2HA 2V1AA 4KQDA 1CEGA 3L7HA 3E4QA 3CLOA 4GS9B 1NJ4A 2VGJA 3CAXA 2Y79A 1AWIA 2DMWA 2ZOIA 3NULA 5HW3A 1ZG6A 3H82A 2A49A 4Y13A 3LICA 4MN5A 2QJ7A 3HUMA 1OTDA 2ZC4B 4DE2A 3EGDC 5CERA 4N1XA 4ZRRA 2J9PA 1ES5A 5F69A 3WS5A 3A0SA 3A0RA 5EVIA 3G2YA 3T1SA 3GMWA 4WUJA 4QHCA 1HVBA 3MQQA 4LPZA 4MBFA 5IU1A 3IS2B 3E98A 1XA1A 4YWZA 1KE3A 2O9AA 4RVAA 1CK3A 4G3KA 2H28A 4KQRA 4CLCD 1NLZA 4YNRA 4LRXC 4GD8A 5FQQA 2EXBA 2X71A 2OAQ1 3HLGA 3UN7A 4BBUA 1LSXA 1GHIA 4RYEA 4PPRA 4EQIA 4JGOA 3R7WB 5JYPA 4HIAA 5CX7A 2GZAA 1VETB 1NWZA 3N7WA 4DJ3A 3ITAA 1EWZA 3F1OA 4ETXA 3E0YA 3G34A 4LLOB 3WRZA 4BENA 1KE0A 3MF0A 2V20A 2ZM0A 2XGNA 1OPXA 4ZAMA 2E8JA 4B4ZA 4EQ1A 5CHMA 1KE4A 3S7OA 3TJZC 5JYOA 1LL8A 1YQSA 3KSGA 3VP1A 4UAAA 5FSRA 2DCFA 2W1TA 2J80A 5EPHA 4WYYA 3SS5A 4PM8A 3LUQA 4DKIA 2L1MA 3SOIA 5EFWA 3UMDA 5K5BA 1T1AA 2VV6A 3FZCA 3PAGA 3UE1A 1K57A 4OP8A 2R9XA 4R38A 1W79A 1SKFA 2W27A 4O7DA 4EBPA 5C5KA 1MC0A 3BM6A 4PM5A 3ZCZA 5HWWA 5HX9A 2LB5A 2WKQA 2ZMFA 1YPRA 4CLCB 4JF6A 1XPBA 3UDIA 4N9LA 3DTIA 2FFYA 3LGOA 2MJ6A 3BFDA 3T4KA 4KZ7A 2HP9A 2CC1A 3LIAA 3PBSA 3G30A 3QNCA 4GS9A 1IOUA 2BG1A 3T4OA 1NLYA 2Y91A 4H6JB 3BQ8A 4Z1WA 3BY9A 1OMEA 3LO7A 3IHBA 1DJBA 3O87A 1FR6A 1G6OA 2GDNA 4HJ4A 3BLSA 3UE6A 1YLZA 5HD3A 3KSFA 1H3QA 3BQAA 3ITBA 4HH3A 5E2GA 1XA7A 5G18A 5GLDA 4L9GA 3SW1A 5A8BA 1YLWA 3C4OA 2O9BA 1E3UD 2WGVA 3VFHA 5J7EA 3BFGA 2ZC6B 3JPUA 2V2FF 3BJNA 3IS2A 4OPQA 3EGXC 3IF6B 2X02A 3CMZA 3BECA 3KX0X 4R4RA 2D02A 5GLBA 1K55C 4JLFA 3NJAA 1PWCA 5DJUA 1MWRA 3G6OA 3LY3A 4X6TA 1MWUA 4WLAA 2JKFA 2XQZA 5HWVA 4EWFA 1EI5A 2WKHA 2ZM8A 3RTYA 1Z6FA 2ZQ8A 3VP0A 2Y2OA 3MS6A 4FTXA 3R7WA 1E4DA 2ZMVA 4QU3A 1VETA 2XF3A 4P0MA 3T4LA 2HDSA 4BBVA 3LR3A 4JF5A 5GHXA 5DF8A 5CGWA 2UWXA 1W8QA 3LYXA 2KOIA 1LSWA 1JTGA 2VGLS 2ZD8A 2Z2LB 3GSGA 4ZJ3A 4Y3IA 5F83A 3MZDA 4ME4A 3M2JA 2J9OA 3N8SA 4HP9A 4JXWA 5DFXA 4IEDA 2GJ3A 3IX4A 4OLDA 4Q8IA 3B42A 4PM6A 2GX5A 4LGWA 2XK1A 3PBQA 5CTMA 2G7UA 1KGEA 2ZC5B 1T1CA 5CEDA 3EQVA 2A3UA 3H7WB 3NDGA 4HEFA 1F5MA 4P6ZS 3WS2A 5E2EA 1CQAA 2UV0E 3N8LA 2ZOHA 5CRFA 3K2NA 3AGDA 4LV1A 1G6AA 4N92A 3WS4A 1UGUA 1FCOA 2WGWA 4CLCA 4NETA 5FEGA 1NZUA 1L0DA 4OQIA 3HLWA 4YFMA 4EERA 4E3LA 5EECA 1LLBA 5DJTA 2PRFA 4L0LA 5DVAA 3F1PB 3AGEA 2VJWA 2VGLM 3LEQA 3MSHA 2Y2KA 4H6JA 2EA9A 1OTBA 5A91A 1PNEA 2ZQAA 5HSQA 1PZOA 1I2SA 3E4PA 4A5RA 2HP5A 4EEUA 1S67L 2A2LA 2XROA 3MBZA 1M40A 2XD1A 2V9AA 4WMCD 4GJ4A 3UDFA 3CUEA 2WKIA 4NXBA 1DP9A 1VEUB 2EFUA 4BL3A 4R1GA 1SHVA 4X1LA 3NDEA 5HL6A 4P6ZM 4XXRA 5F1FA 4JXSA 1P9RA 1SCWA 1MXOA 2PYRA 3ZG0A 1JWZA 5AJGA 1HD8A 5AVFA 3BFCA 3IF6A 3IXBA 2OLUA 1I2WA 3SS4A 1FSYA 4LCMA 1DY6A 4OQGA 1BLCA 2R9WA 1KVLA 3NIAA 1W8YA 2Q9NA 3OCLA 4M3KA 1FSWA 1LSVA 4DN0A 1FCNA 3UE0A 1S6RA 2P04A 3E2LA 1GA9A 4S2JA 3SZTA 2HP6A 4JGQA 1W63Q 3CWFA 3ZG8B 3HLCA 3MZEA 3S1YA 4ARZA 2XLNA 5EVIC 3VP4A 5HL1A 4JXVA 3HVFA 1H0MA 1VQQA 1GSVA 5I94A 3KYZA 2K31A 3W2ZA 2P74A 3BYDA 4FOFA 3LCEA 1LI0A 2WKEA 2Y2LA 4LENA 1X0OA 3VOZA 3HUNA 1YLJA 1YAXA 1H8ZA 2J3WA 4NKPA 1MBLA 4ZDXA 1P9WA 5FEFA 4KZAA 5MC7A 4GW9A 1ONGA 3EQUA 2ZC7A 5F68A 1ERQA 3LIEA 3VSLA 3PR6A 1IELA 2WADA 4LRZE 3VP2A 2EWVA 4BL2A 2Y2MA 1E3UA 1IYPA 2H0TA 3HLFA 5DKKA 1WA9A 3ISGA 4EU0A 1NZOA 2XFTA 5F82A 3C38A 3DWZA 1YM1A 4OLGA 3FWLA 3AGFA 2M7UA 2Z6CA 5AQ7A 4HI4A 2HDQA 3LIFA 4R3JA 5FQMA 1TD5A 5L07A 4ETZA 2QZ6A 3LI8A 3LFVA 3QP2A 2EFXA 3LR5A 2OOLA 1LT0A 4S2IA 3F1PA 4UA9A 4U0TA 3UNWA 1K6RA 1WYBA 3HLEA 1PI4A 3LIBA 5DKLA 5AQBA 2WGIA 1Y28A 3IBJA 2R78A 2KLIA 1E25A 2QWSA 3CPTA 2QJ5A 5DTSA 2KDKA 3BFFA 1J3WA 4JXGA 3MXQA 3ZVTA 4YINA 1TVFA 4I3AA 1FOFA 1K57C 3LR0A 4CQHA 5KZHA 1Z09A 3UB9A 5HFOA 2Y2NA 3SH7A 1VEUA 2OAP1 2Y2JA 1YMXA 3DBAA 4IJGA 3CG5A 3ZFZA 2K2NA 1S66L 3P98A 3G2ZA 4R23A 5E2FA 4BQMA 3ZGAB 4XUXA 2VEAA 4E3NA 1BT5A 4KG2A 5AQ9A 4MEZA 4KUOA 1XJ2A 3S7NA 3DTEA 5KSHA 5HD5A 4WN5A 3HL9A 4IUKA 3IWOA 1T18A 5TGFA 1TS6A 1VHMA 2W3FA 5GHYA 1MKIA 2C6WB 3IHAA 2VA0A 4QJGA 3PBNA 4HH2A 3NOTC 3QNBA 1JVJA 4U3TA 3Q07A 1MWSA 5BOHA 3BY8A 1GCEA 3HUOA 2OLVA 3ZG5A 3C2WA 3P09A 3BEBA 3T4QA 5FQIA 4ZBEA 4E3IA 3EWKA 4OONA 3BRMA 1S1ZA 4Y15A 1XFQA 2PU4A 4UEYA 4QD4A 3OCNA 1NY0A 3IXGA 4P85A 4E3KA 5G4YA 4HJ6A 4PM7A 3GTCA 4BBTA 2QPNA 1QMEA 2JKTM 1N9LA 3CI6A 2M7VA 3RJUA 3Q7ZA 1OJGA 2L4RA 5DTTA 2JKGA 3QP6A 1STZA 2H10A 4R6LA 4ZJ2A 5HARA 2XDMA 2XEPA 4QB8A 4WMCA 1KGGA 5FAQA 1BSGA 3ZVWA 4LV2A 4U0XA 5A90A 2ZL1B 4R3BA 5TBMB 2XD5A 4FD8A 5A93A 3PBOA 4JBFA 4Y5FA 2J3TD 2X01A 3NY4A 1EW0A 1A0KA 4I38A 2DRWA 2G2WA 2Y2IA 4WZ5A 5TR7A 3W4PA 2WKRA 1Q2PA 1GSXA 4R70A 4LV3A 4EV4A 2ZQDA 4HJ3A 1MWTA 2QYBA 5J4EA 1BYWA 4S2MA 3MXSA 1OTIA 2EWWA 4PMAA 1L0GA 4KG6A 3BFEA 1K0KA 4Y7PA 4X53A 3ZNTA 3FV7A 4KZ3A 1PWGA 4GN2A 2OV5A 4C75A 3C4PA 1RCJA 3IT9A 1ESIA 2VGKA 1F2KA 4ZTKA 4OPZA 1Q2QA 4L9FA 2WUQA 5GHZA 4GDNA 3OPHA 1PRQA 5CXWA 2PYPA 3NBLA 1F9IA 4WELA 3D72A 3DTMA 2HV1A 3V3RA 4EUZA 2PD8A 4PHTA 3W4QA 4X1MA 4EUVA 4HP4A 1P97A 1QMFA 2VKSA 1MZUA 3BWLA 3WWXA 4WF0A 1CI9A 3UB8A 5GL9A 2IWCA 2K7SA 4LV0A 3CZDA 5E43A 5FA7A 4HQAA 4BWIA 4FCFA 3F1NB 4CLCC 3S4XA 5A92A 1BLPA 4B4XA 4EXOA 4MLLA 1PFLA 3CJMA 2P7JA 4NEED 3FG8A 2YKHA 3SS3A 2ZM2A 1EROA 4E6XA 3MMHA 2P08A 3GQZA 4Y0TA 3K3CA 4Y0UA 1PYYA 3G4PA 3A3FA 4FUWA 4D2OA 1BLSA 3RXWA 4K08A 3Q7VB 4GCZA 3TSGA 4XT2B 1YLTA 3R4KA 5F6AA 3IH9A 4ZJ1A 4OPRA 3T12B 4OOMA 1ACFA 1RP5A 3CUEC 1YT4A 1V9YA 1N9OA 4DE3A 1CF0A 1I5QA 2V8CA 1S0WA 4BMWA 4IBRA 1YSPA 5FDHA 1VB6A 3PBTA 4CLCE 2Z6DA 4MDZA 2O99A 3SH9A 1YLYA 5EUAA 5FQ9A 2JE5A 4OKPA 2JCHA 3IF6C 3HCYA 2J7VA 4WM9A 3NI9A 1CJFA 2L0WA 2EXAA 1W5DA 2ZC3B 3FYZA 2VLGA 4GLQA 5EM1A 4N1HA 4S2NA 3HREA 4OPYA 1D1JA 4JKTA 3FPVA 3MQ0A 1PWDA 4GNUA 4RA7A 1N4OA 3GDIA 3WS1A 1PIOA 2B5RA 4WEKA 2W3EA 3N6IA 2IWBA 2B95A 4C6YA 4PM9A 3MR0A 2ZL1A 5TBMA 3P7NA 5J8XA 4H8RA 3DW0A 3QP8A 4GDBA 1O7EA 4E6WA 4HOIA 3FKWA 5IT5A 2OWJA 2Y4AA 3IQAA 5HAPA 3TW8A 3MJQA 2RL3A 2C5WB 1YKDA 2JKTI 4Q0HA 3B33A 1L3LA 1V9ZA 1K56D 4KUKA 3UB7A 4S2OA 3SH8A 3LI9A 4PAUA 3ZDJA 4MBHA 4OH0A 4PKYA 5L09A 5CGSA 5HZHA 3PTEA 4L9EA 4WL9A 4NXFA 1ES4A 2EX8A 1LL5A 2RCXA 2WZZA 2XRNA 3QP1A 4O0PA 2V0UA 2WK0A 5FDSA 3V50A 5KIZA 2CMNA 5G4ZA 5U47A 5HDSA 4HNBA 3F1NA 1XJ6A 5GLCA 4JGPA 2PAVP 1FILA 1IEMA 3JVVA 1ZC2A 1JWPA 2ACGA 4KENB 3HLDA 5KSCA 3U2AA 1M6KA 3TE8A 2O9CA 1SDNA 2B02A 4BD1A 5GLAA 5M1AA 1S4SA 1PW1A 2PD7A 4X68A 1ZKJA 1YMSA 2A24B 3MZFA 2LB9A 2WAFA 3C8CA 4NK3A 1D7EA 1NYMA 5HPFA 2ZLYA 3DWKA 2Y55A 4DF6A 3Q7VA 5FI2A 4XT2A 4KZ4A 1HTZA 4B9OA 1NRJA 4O8GA 4E04A 1IYSA 3KO6A 3O5YA 3A0VA 2HZ5A 1XP4A 2Z2MB 5LBRA 3S7QA 1XX2A 3Q82A 1NYYA 3ICYA 1K6SA 3VOYA 1FCMA 1XFNA 1HLUP 4OP5A 4CPKA 5DTKA 5FQKA 5M19A 4QPRA 1TS0A 3FPWA 3N8RA 3LIDA 4JF4A 1ERMA 1H8MA 3LY4A 3NC8A 1ALQA 3MQOA 1JWVA 4KZ5A 3H7WA 2HGVA 3MFDA 3VE3A 4MMNA 5FATA 3LR4A 4I3IA 3KSIA 4KG5A 5FQJA 1CEFA 4X25A 1T19A 3OPLA 3EOIA 4R0QA 4EBLA 1N9NA 3QP5A 2P9VB 1DRMA 5D3OA 3K3DA 3VSKA 4P87A 2BASA 3IXHA 4DMZA 5EOOA 3VMAA 3OC2A 4KZBA 3WS0A 3GRJA 5DFYA 3PYPA 4ID4A 3HLBA 3S7PA 4DE1A 4I39A 1K54A 2V1BA 2IA2A 1LHYA 3OBFA 2V0WA 2KX6A 1RGYA 3GV9A 3ZG7B 4Y2FA 1L0EA 4B88A 5FASA 4K0XA 3WRTA 2QHKA 3HBRA 2V8FA 1S4RA 4MN7A 1FIKA 3D9YA 3QHYA 3NECA 2QKPA 1L0FA 3KSHA 3NHQA 2O0YA 4DXBA 5J3WA 2Q9MA 1TDGA 1XKZA 2PR6A 2OSUA 1XGJA 4WZ5C 1K4FA 3A3IA 4KQOA 2W3DA 1H5XA 2WYXA 3NOPC 4K0WA 2BTFP 2I72A 1O07A 1BTLA 5FAPA 4CJNA 5CECA 2WZXA 3A3EA 3OOVA 2DNSA 1LL9A 4Y17A 1GA0A 1TEMA 3MXRA 2FFFB 3I7JA 3G31A 2A24A 4FH4A 2ZQ7A 2QMIA 3OPRA 1Y4OA 5FL3A 2JN7A 3HJIA 1KOUA 1OTEA 1ESUA 3IX8A 5HDDA 1BZAA 3C5AA 4GHIB 1ZHHB 4I3JA 3HJKA 5EV0A 3UE3A 5TJJA 3EEAA 3MKEA 3G35A 1K56A 3UPPA 4DXCA 2PR5A 1UWNX 5TFQA 4KZ6A 1D06A 4Z9QA 3IXDA 2NUPC 4KZ9A 3P01A 3DTKA 4BD0A 3A3JA 4HESA 4Q0JA 4MN6A 1G28A 1BUEA 2NUTC 5IHVA 4RQ9A 3NOUC 3IWQA 3OZHA 1NRFA 2JBFA 4HBTA 3V39A 1KDSA 3ZNYA 4QY6A 3OLOA 3ZQ5A 1YLPA 1N9BA 2EX2A 4PKYG 3RXXA 3L9KA 1YSQA 3TOIA 2J8YA 2PU2A 2ZQ9A 4DE0A 2P9VA 1AXBA 2WGWB 3M6HA 4MNRA 4UA7A 2IWDA 3CHWP 1DP8A 4IHQA 4S2PA 3S22A 4HHDA 2FZ0A 2Y59A 3RFBA 3UPOA 4S2NC 5I5LA 4MCWA 4C3QA 4I5SA 1BULA 1PW8A 4EESA 1OJ5A 3C30A 2WKPA 5AQAA 3Q81A 3N4IA 3FKVA 2VZWA 3T1XA 1P0ZA 1K38A 3UB6A 4MBKA 4UA6A 4B93A 4G3WA 3UO9A 2XFSA 4F94A 3MKFA 5DF9A 1SKOB 1OT9A 1PI5A 4X56A 4GB7A 4UHUA 1XJ3A 4X69A 4OOYA 3UB5P 4OQHA 3VFFA 2AVXA 3CITA 4N9KA 1CI8A 1LI9A 2XR0A 4GZBA 3UDXA 4BLMA 2HJ9C 2WAEA 4Q0IA 1TS7A 2E8IA 1XXMA 2YKFA 4RX2A 5EE8A 2Q0OA 2Y2PA 3PAEA 3C7VA 3JVUA 1ONHA 5CEBA 3E4OA 3D4FA 1T1BA 3V5MA 5F1GA 2INWA 4E3OA 3KYEA 2JKRM 2FH5A 3PXPA 4ARZB 4GHIA 4IVKA 4F3LB 4NXGA 2PT7A 3ZG9B 5M18A 2OWHA 1WYCA 5EVID 4QWOA 4K91A 4HY8A 5F5YA 4AFIA 1HZOA 4S2LA 4GOGA 4LRYC 4R3AA 2I9VA 5L10A 4HBUA 4X55A 1GHPA 1IFQA 3Q1FA 4QY5A 4NG2A 5HWTA 2VX8A 3B47A 3ZYTA 3T1RA 5L2FA 4BJPA 1XJ4A 5EM0A 3W8KA 5HDCA 2PHYA
chains in the Genus database with same CATH topology
5E2FA 4BQMA 3ZGAB 2BG1A 4XUXA 4E3NA 1BT5A 4KG2A 5AQ9A 3IH8A 2Y91A 4OOLA 3O88A 4MEZA 1IYQA 1NXYA 5FI6A 1IYSA 5FAOA 1OMEA 3LO7A 3IHBA 1DJBA 5KSHA 3O87A 1SDEA 1FR6A 4DDYA 1XP4A 2GDNA 2Z2MB 3BLSA 1YLZA 2BLSA 3HL9A 4XUZA 4RX3A 3IWOA 1FQGA 5TGFA 1ES3A 3G2ZA 5GHYA 1MKIA 2C6WB 3IHAA 1IKGA 4QJGA 3PBNA 1XX2A 3C7UA 4S2KA 3UPNA 2Y2QA 3Q82A 1G68A 1NYYA 4LCLA 3ITBA 5E2GA 1XA7A 5G18A 5GLDA 3PBRA 1K6SA 3QNBA 1JVJA 1TDLA 3VOYA 1FCMA 1U60A 1DJCA 4OP5A 1YLWA 1K4EA 3C4OA 4CPKA 5DTKA 2H5SA 3Q07A 1MY8A 1MWSA 4U3TA 1E3UD 5FQKA 4WZ4A 4DDSA 1GCEA 3HUOA 5BOHA 5M19A 3N8RA 4JF4A 1K55A 2OLVA 2WGVA 1ERMA 3IWIA 3P09A 3VFHA 3BFGA 3ZG5A 2G2UA 2ZC6B 3BEBA 3LY4A 4KZ8A 5FQIA 4ZBEA 4E3IA 1GHMA 3NC8A 2HDUA 1ALQA 2V2FF 4OONA 4OPQA 3BRMA 1KGFA 1JWVA 2EX6A 5HAIA 3IF6B 2X02A 3CMZA 4KZ5A 2PU4A 3BECA 4QD4A 3OCNA 4R4RA 3MFDA 1ZG4A 5FATA 1NY0A 5GLBA 3IXGA 1KVMA 1K55C 4P85A 4JLFA 4E3KA 4KG5A 4PM7A 1ES2A 5FQJA 1PWCA 3GTCA 1CEFA 1MWRA 2QPNA 1QMEA 3LY3A 4X6TA 3O3VA 3OPPA 3OPLA 3RJUA 1MWUA 3Q7ZA 4R0QA 5EVIB 4EBLA 2XQZA 4EWFA 4GD6A 5DTTA 1EI5A 2WKHA 2P9VB 5FI7A 2ZM8A 5KMWA 1Z6FA 2ZQ8A 3BLMA 2PBYA 2Y2OA 5D3OA 3VP0A 4JPMA 1WE4A 3VSKA 2H10A 4P87A 2XH9A 3IXHA 1E4DA 5EOOA 4ZJ2A 5HARA 3VMAA 3OC2A 4QU3A 2XF3A 2HDRA 2XDMA 4KZBA 4P0MA 3WS0A 2XEPA 4IVIA 4QB8A 4WMCA 5CHJA 1KGGA 3GRJA 5FAQA 1BSGA 2HDSA 4ID4A 3UY6A 3HLBA 3ZVWA 4JF5A 4DE1A 5GHXA 5DF8A 1K54A 5CGWA 2UWXA 4LV2A 1W8QA 1L2SA 4U0XA 1LHYA 3TG9A 5EOEA 5A90A 2JC7A 2ZJ9A 3JYIA 4R3BA 2XD5A 1W7FA 4FD8A 1RGYA 5A93A 3PBOA 3GV9A 1JTGA 4JBFA 3ZG7B 2X01A 2ZD8A 3NY4A 4WEJA 3G32A 1L0EA 2Z2LB 4B88A 5FASA 4R4SA 2HPBA 4K0XA 3GSGA 4FSFA 4IBXA 3WRTA 1K54C 1RGZA 3HBRA 3IF5A 2DRWA 2G2WA 3O86A 2Y2IA 4WZ5A 4ZJ3A 5TR7A 3W4PA 1Q2PA 5EVLA 2ZQCA 5F83A 4LV3A 4DRTA 4EV4A 2ZQDA 5DF7A 1MWTA 3MZDA 3QHYA 3V3SA 1DJAA 3M2JA 2J9OA 1KDWA 1L0FA 3N8SA 4S2MA 4R23A 4JXWA 3A3DA 1FR1A 3MXSA 4IEDA 4DXBA 4PMAA 2Q9MA 1L0GA 4KG6A 4OLDA 3BFEA 1TDGA 1XKZA 4Q8IA 4PM6A 4Y7PA 2OSUA 3B3XA 1XGJA 4WZ5C 1JTDA 4X53A 1K4FA 3A3IA 4KQOA 2XK1A 3PBQA 5CTMA 3FV7A 3ZNTA 4OQ0A 1H5XA 2WYXA 1Y54A 4KZ3A 4E3MA 1KGEA 1PWGA 2ZC5B 4GN2A 4K0WA 2OV5A 4C75A 5CEDA 3C4PA 1RCJA 2I72A 3EQVA 4FH2A 3IT9A 1ESIA 2A3UA 2VGKA 3NDGA 4ZTKA 2V1ZA 1O07A 1IKIA 4KQQA 1BTLA 3M2KA 4HEFA 4OPZA 1Q2QA 3NCKA 2WUQA 3WS2A 5E2EA 5GHZA 5FAPA 1IYOA 1PZPA 4GDNA 3OPHA 5CXWA 3GR2A 4CJNA 3NBLA 3LEZA 4GKUA 1C3BA 4WELA 3N8LA 5CECA 2WZXA 3A3EA 5CRFA 3DTMA 3V3RA 4EUZA 4EBNA 3AGDA 3W4QA 2DNSA 1LL9A 4LV1A 1G6AA 1QMFA 1GA0A 4N92A 3WS4A 1TEMA 1FCOA 3WWXA 2WGWA 3MXRA 2FFFB 4NETA 3I7JA 1CI9A 3G31A 5CGXA 4FH4A 3E2KA 2ZQ7A 1NZUA 5GL9A 1L0DA 2QMIA 3OPRA 4OQIA 1BLHA 2IWCA 3HLWA 4YFMA 4LV0A 3CZDA 3VP3A 5E43A 5CHUA 4E3LA 5EECA 1LLBA 5FA7A 1ESUA 3GVBA 4L0LA 3ZHHA 5DVAA 1J9MA 3AGEA 1BZAA 4FCFA 1MPLA 3C5AA 4P6BA 5E2HA 1VM1A 3S4XA 4E3JA 2EX9A 2Y2KA 1XGIA 5A92A 2ZMAA 1BLPA 5A91A 4B4XA 2ZQAA 3UE3A 5CTNA 1PZOA 4MLLA 3CJMA 1I2SA 3MKEA 3SS3A 2ZM2A 1EROA 3G35A 4A5RA 5HAQA 2HP5A 1K56A 3UPPA 4DXCA 4E6XA 4OVDA 3GQZA 4Y0OA 4Y0TA 3MBZA 1M40A 4KZ6A 1H8YA 4Y0UA 5TFQA 1PYYA 1K25A 3G4PA 2XD1A 3A3FA 4Z9QA 4D2OA 4WMCD 3UDFA 2H0YA 3IXDA 2Y2GA 2WKIA 4KZ9A 3W4OA 1BLSA 2EFUA 3M6BA 4BD0A 4BL3A 4R1GA 3A3JA 1SHVA 4WBGA 3RXWA 3Q7VB 4HESA 2Y2HA 3TSGA 3NDEA 1YLTA 1CEGA 3IH9A 4ZJ1A 4OPRA 1BUEA 4XXRA 1NJ4A 4OOMA 5F1FA 2VGJA 1RP5A 4JXSA 1SCWA 1YT4A 1MXOA 5IHVA 3ZG0A 1JWZA 1HD8A 5HW3A 1ZG6A 3BFCA 3IF6A 4DE3A 2A49A 3IXBA 2OLUA 1I5QA 3IWQA 1I2WA 3OZHA 1FSYA 1S0WA 3SS4A 1NRFA 2JBFA 1DY6A 4HBTA 1BLCA 4IBRA 3PBTA 4LCMA 4OQGA 5FDHA 3V39A 1KDSA 3ZNYA 3HUMA 2R9WA 1KVLA 2ZC4B 3NIAA 4QY6A 5CERA 1W8YA 2Q9NA 1YLYA 3OCLA 4N1XA 3SH9A 4DE2A 4M3KA 5EUAA 5FQ9A 2JE5A 1FSWA 1YLPA 1N9BA 2JCHA 4OKPA 2EX2A 3RXXA 1FCNA 3IF6C 2J9PA 1ES5A 3WS5A 2J7VA 3UE0A 4WM9A 1S6RA 3NI9A 3TOIA 2J8YA 2PU2A 2ZQ9A 2EXAA 5EVIA 3G2YA 4DE0A 3E2LA 1GA9A 4S2JA 1W5DA 1AXBA 2HP6A 2P9VA 2WGWB 2ZC3B 3FYZA 3GMWA 3M6HA 4N1HA 4MNRA 4QHCA 4S2NA 1HVBA 4UA7A 3ZG8B 2IWDA 3HREA 4OPYA 3HLCA 3MZEA 4JKTA 4MBFA 3S1YA 4S2PA 1PWDA 4GNUA 1XA1A 4RA7A 1KE3A 1N4OA 3S22A 4RVAA 2XLNA 5EVIC 2Y59A 3VP4A 5HL1A 4JXVA 3HVFA 3UPOA 1VQQA 3WS1A 1PIOA 2B5RA 4S2NC 5I94A 1CK3A 4WEKA 3N6IA 4KQRA 2IWBA 4C6YA 4PM9A 2P74A 3BYDA 4C3QA 3LCEA 4GD8A 1LI0A 2WKEA 5FQQA 2EXBA 2Y2LA 5J8XA 2X71A 4LENA 4H8RA 1BULA 1PW8A 3DW0A 3HLGA 3VOZA 3UN7A 3HUNA 1YLJA 4GDBA 5AQAA 1GHIA 1O7EA 1H8ZA 4RYEA 4E6WA 3Q81A 3N4IA 3FKVA 3FKWA 4PPRA 1MBLA 2Y4AA 4EQIA 4ZDXA 1K38A 3IQAA 4MBKA 4UA6A 4KZAA 5JYPA 5HAPA 2RL3A 1ONGA 2C5WB 2ZC7A 3EQUA 3N7WA 3UO9A 1ERQA 3ITAA 1EWZA 2XFSA 4F94A 3MKFA 3VSLA 1K56D 3G34A 5DF9A 3WRZA 1PI5A 4BENA 1KE0A 4X56A 4GB7A 1IELA 2V20A 4UHUA 2WADA 4S2OA 3SH8A 3VP2A 4BL2A 2Y2MA 1E3UA 1IYPA 4X69A 4OOYA 3ZDJA 2H0TA 2ZM0A 2XGNA 4MBHA 3HLFA 4OH0A 3ISGA 4OQHA 3VFFA 1NZOA 4N9KA 4ZAMA 2XFTA 1CI8A 1LI9A 5F82A 2XR0A 4B4ZA 5CGSA 4GZBA 3UDXA 4BLMA 3DWZA 1YM1A 3PTEA 4OLGA 2WAEA 3AGFA 3FWLA 5CHMA 5AQ7A 1KE4A 2E8IA 2HDQA 1XXMA 4R3JA 5FQMA 1ES4A 4RX2A 5EE8A 2EX8A 2Y2PA 3PAEA 1LL5A 3C7VA 1ONHA 2QZ6A 5CEBA 5JYOA 2RCXA 1YQSA 2WZZA 3D4FA 3VP1A 4UAAA 2WK0A 5FSRA 2DCFA 3V5MA 2EFXA 5EPHA 4WYYA 3V50A 3SS5A 4PM8A 5F1GA 5U47A 4E3OA 4S2IA 4DKIA 3SOIA 4UA9A 4U0TA 3UNWA 4IVKA 5GLCA 1K6RA 1WYBA 3HLEA 1PI4A 3FZCA 3PAGA 3ZG9B 1IEMA 5AQBA 3UE1A 5M18A 1K57A 1ZC2A 2WGIA 2R9XA 1JWPA 1WYCA 4OP8A 5EVID 4K91A 4KENB 1HZOA 1W79A 3HLDA 5KSCA 1SKFA 1E25A 4O7DA 4GOGA 4S2LA 4EBPA 3BM6A 1M6KA 5DTSA 4PM5A 3BFFA 4HBUA 4JXGA 4X55A 3ZCZA 5HX9A 1SDNA 1GHPA 4BD1A 5GLAA 5M1AA 3ZVTA 4YINA 1PW1A 1TVFA 4X68A 1FOFA 4JF6A 3Q1FA 4QY5A 1XPBA 1ZKJA 1K57C 1YMSA 3UDIA 5KZHA 4N9LA 3MZFA 2WAFA 2FFYA 5HFOA 2Y2NA 4NK3A 3SH7A 1NYMA 2Y2JA 1YMXA 3BFDA 2ZLYA 3DWKA 2Y55A 4DF6A 3W8KA 3CG5A 3Q7VA 5FI2A 3ZFZA 4KZ7A 5L2FA 3P98A 4BJPA 2HP9A 2CC1A 4KZ4A 3PBSA 3G30A 1HTZA 3QNCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E2F A;  4BQM A;  3ZGA B;  2BG1 A;  4XUX A;  4E3N A;  1BT5 A;  4KG2 A;  5AQ9 A;  3IH8 A;  2Y91 A;  4OOL A;  3O88 A;  4MEZ A;  1IYQ A;  1NXY A;  5FI6 A;  1IYS A;  5FAO A;  1OME A;  3LO7 A;  3IHB A;  1DJB A;  5KSH A;  3O87 A;  1SDE A;  1FR6 A;  4DDY A;  1XP4 A;  2GDN A;  2Z2M B;  3BLS A;  1YLZ A;  2BLS A;  3HL9 A;  4XUZ A;  4RX3 A;  3IWO A;  1FQG A;  5TGF A;  1ES3 A;  3G2Z A;  5GHY A;  1MKI A;  2C6W B;  3IHA A;  1IKG A;  4QJG A;  3PBN A;  1XX2 A;  3C7U A;  4S2K A;  3UPN A;  2Y2Q A;  3Q82 A;  1G68 A;  1NYY A;  4LCL A;  3ITB A;  5E2G A;  1XA7 A;  5G18 A;  5GLD A;  3PBR A;  1K6S A;  3QNB A;  1JVJ A;  1TDL A;  3VOY A;  1FCM A;  1U60 A;  1DJC A;  4OP5 A;  1YLW A;  1K4E A;  3C4O A;  4CPK A;  5DTK A;  2H5S A;  3Q07 A;  1MY8 A;  1MWS A;  4U3T A;  1E3U D;  5FQK A;  4WZ4 A;  4DDS A;  1GCE A;  3HUO A;  5BOH A;  5M19 A;  3N8R A;  4JF4 A;  1K55 A;  2OLV A;  2WGV A;  1ERM A;  3IWI A;  3P09 A;  3VFH A;  3BFG A;  3ZG5 A;  2G2U A;  2ZC6 B;  3BEB A;  3LY4 A;  4KZ8 A;  5FQI A;  4ZBE A;  4E3I A;  1GHM A;  3NC8 A;  2HDU A;  1ALQ A;  2V2F F;  4OON A;  4OPQ A;  3BRM A;  1KGF A;  1JWV A;  2EX6 A;  5HAI A;  3IF6 B;  2X02 A;  3CMZ A;  4KZ5 A;  2PU4 A;  3BEC A;  4QD4 A;  3OCN A;  4R4R A;  3MFD A;  1ZG4 A;  5FAT A;  1NY0 A;  5GLB A;  3IXG A;  1KVM A;  1K55 C;  4P85 A;  4JLF A;  4E3K A;  4KG5 A;  4PM7 A;  1ES2 A;  5FQJ A;  1PWC A;  3GTC A;  1CEF A;  1MWR A;  2QPN A;  1QME A;  3LY3 A;  4X6T A;  3O3V A;  3OPP A;  3OPL A;  3RJU A;  1MWU A;  3Q7Z A;  4R0Q A;  5EVI B;  4EBL A;  2XQZ A;  4EWF A;  4GD6 A;  5DTT A;  1EI5 A;  2WKH A;  2P9V B;  5FI7 A;  2ZM8 A;  5KMW A;  1Z6F A;  2ZQ8 A;  3BLM A;  2PBY A;  2Y2O A;  5D3O A;  3VP0 A;  4JPM A;  1WE4 A;  3VSK A;  2H10 A;  4P87 A;  2XH9 A;  3IXH A;  1E4D A;  5EOO A;  4ZJ2 A;  5HAR A;  3VMA A;  3OC2 A;  4QU3 A;  2XF3 A;  2HDR A;  2XDM A;  4KZB A;  4P0M A;  3WS0 A;  2XEP A;  4IVI A;  4QB8 A;  4WMC A;  5CHJ A;  1KGG A;  3GRJ A;  5FAQ A;  1BSG A;  2HDS A;  4ID4 A;  3UY6 A;  3HLB A;  3ZVW A;  4JF5 A;  4DE1 A;  5GHX A;  5DF8 A;  1K54 A;  5CGW A;  2UWX A;  4LV2 A;  1W8Q A;  1L2S A;  4U0X A;  1LHY A;  3TG9 A;  5EOE A;  5A90 A;  2JC7 A;  2ZJ9 A;  3JYI A;  4R3B A;  2XD5 A;  1W7F A;  4FD8 A;  1RGY A;  5A93 A;  3PBO A;  3GV9 A;  1JTG A;  4JBF A;  3ZG7 B;  2X01 A;  2ZD8 A;  3NY4 A;  4WEJ A;  3G32 A;  1L0E A;  2Z2L B;  4B88 A;  5FAS A;  4R4S A;  2HPB A;  4K0X A;  3GSG A;  4FSF A;  4IBX A;  3WRT A;  1K54 C;  1RGZ A;  3HBR A;  3IF5 A;  2DRW A;  2G2W A;  3O86 A;  2Y2I A;  4WZ5 A;  4ZJ3 A;  5TR7 A;  3W4P A;  1Q2P A;  5EVL A;  2ZQC A;  5F83 A;  4LV3 A;  4DRT A;  4EV4 A;  2ZQD A;  5DF7 A;  1MWT A;  3MZD A;  3QHY A;  3V3S A;  1DJA A;  3M2J A;  2J9O A;  1KDW A;  1L0F A;  3N8S A;  4S2M A;  4R23 A;  4JXW A;  3A3D A;  1FR1 A;  3MXS A;  4IED A;  4DXB A;  4PMA A;  2Q9M A;  1L0G A;  4KG6 A;  4OLD A;  3BFE A;  1TDG A;  1XKZ A;  4Q8I A;  4PM6 A;  4Y7P A;  2OSU A;  3B3X A;  1XGJ A;  4WZ5 C;  1JTD A;  4X53 A;  1K4F A;  3A3I A;  4KQO A;  2XK1 A;  3PBQ A;  5CTM A;  3FV7 A;  3ZNT A;  4OQ0 A;  1H5X A;  2WYX A;  1Y54 A;  4KZ3 A;  4E3M A;  1KGE A;  1PWG A;  2ZC5 B;  4GN2 A;  4K0W A;  2OV5 A;  4C75 A;  5CED A;  3C4P A;  1RCJ A;  2I72 A;  3EQV A;  4FH2 A;  3IT9 A;  1ESI A;  2A3U A;  2VGK A;  3NDG A;  4ZTK A;  2V1Z A;  1O07 A;  1IKI A;  4KQQ A;  1BTL A;  3M2K A;  4HEF A;  4OPZ A;  1Q2Q A;  3NCK A;  2WUQ A;  3WS2 A;  5E2E A;  5GHZ A;  5FAP A;  1IYO A;  1PZP A;  4GDN A;  3OPH A;  5CXW A;  3GR2 A;  4CJN A;  3NBL A;  3LEZ A;  4GKU A;  1C3B A;  4WEL A;  3N8L A;  5CEC A;  2WZX A;  3A3E A;  5CRF A;  3DTM A;  3V3R A;  4EUZ A;  4EBN A;  3AGD A;  3W4Q A;  2DNS A;  1LL9 A;  4LV1 A;  1G6A A;  1QMF A;  1GA0 A;  4N92 A;  3WS4 A;  1TEM A;  1FCO A;  3WWX A;  2WGW A;  3MXR A;  2FFF B;  4NET A;  3I7J A;  1CI9 A;  3G31 A;  5CGX A;  4FH4 A;  3E2K A;  2ZQ7 A;  1NZU A;  5GL9 A;  1L0D A;  2QMI A;  3OPR A;  4OQI A;  1BLH A;  2IWC A;  3HLW A;  4YFM A;  4LV0 A;  3CZD A;  3VP3 A;  5E43 A;  5CHU A;  4E3L A;  5EEC A;  1LLB A;  5FA7 A;  1ESU A;  3GVB A;  4L0L A;  3ZHH A;  5DVA A;  1J9M A;  3AGE A;  1BZA A;  4FCF A;  1MPL A;  3C5A A;  4P6B A;  5E2H A;  1VM1 A;  3S4X A;  4E3J A;  2EX9 A;  2Y2K A;  1XGI A;  5A92 A;  2ZMA A;  1BLP A;  5A91 A;  4B4X A;  2ZQA A;  3UE3 A;  5CTN A;  1PZO A;  4MLL A;  3CJM A;  1I2S A;  3MKE A;  3SS3 A;  2ZM2 A;  1ERO A;  3G35 A;  4A5R A;  5HAQ A;  2HP5 A;  1K56 A;  3UPP A;  4DXC A;  4E6X A;  4OVD A;  3GQZ A;  4Y0O A;  4Y0T A;  3MBZ A;  1M40 A;  4KZ6 A;  1H8Y A;  4Y0U A;  5TFQ A;  1PYY A;  1K25 A;  3G4P A;  2XD1 A;  3A3F A;  4Z9Q A;  4D2O A;  4WMC D;  3UDF A;  2H0Y A;  3IXD A;  2Y2G A;  2WKI A;  4KZ9 A;  3W4O A;  1BLS A;  2EFU A;  3M6B A;  4BD0 A;  4BL3 A;  4R1G A;  3A3J A;  1SHV A;  4WBG A;  3RXW A;  3Q7V B;  4HES A;  2Y2H A;  3TSG A;  3NDE A;  1YLT A;  1CEG A;  3IH9 A;  4ZJ1 A;  4OPR A;  1BUE A;  4XXR A;  1NJ4 A;  4OOM A;  5F1F A;  2VGJ A;  1RP5 A;  4JXS A;  1SCW A;  1YT4 A;  1MXO A;  5IHV A;  3ZG0 A;  1JWZ A;  1HD8 A;  5HW3 A;  1ZG6 A;  3BFC A;  3IF6 A;  4DE3 A;  2A49 A;  3IXB A;  2OLU A;  1I5Q A;  3IWQ A;  1I2W A;  3OZH A;  1FSY A;  1S0W A;  3SS4 A;  1NRF A;  2JBF A;  1DY6 A;  4HBT A;  1BLC A;  4IBR A;  3PBT A;  4LCM A;  4OQG A;  5FDH A;  3V39 A;  1KDS A;  3ZNY A;  3HUM A;  2R9W A;  1KVL A;  2ZC4 B;  3NIA A;  4QY6 A;  5CER A;  1W8Y A;  2Q9N A;  1YLY A;  3OCL A;  4N1X A;  3SH9 A;  4DE2 A;  4M3K A;  5EUA A;  5FQ9 A;  2JE5 A;  1FSW A;  1YLP A;  1N9B A;  2JCH A;  4OKP A;  2EX2 A;  3RXX A;  1FCN A;  3IF6 C;  2J9P A;  1ES5 A;  3WS5 A;  2J7V A;  3UE0 A;  4WM9 A;  1S6R A;  3NI9 A;  3TOI A;  2J8Y A;  2PU2 A;  2ZQ9 A;  2EXA A;  5EVI A;  3G2Y A;  4DE0 A;  3E2L A;  1GA9 A;  4S2J A;  1W5D A;  1AXB A;  2HP6 A;  2P9V A;  2WGW B;  2ZC3 B;  3FYZ A;  3GMW A;  3M6H A;  4N1H A;  4MNR A;  4QHC A;  4S2N A;  1HVB A;  4UA7 A;  3ZG8 B;  2IWD A;  3HRE A;  4OPY A;  3HLC A;  3MZE A;  4JKT A;  4MBF A;  3S1Y A;  4S2P A;  1PWD A;  4GNU A;  1XA1 A;  4RA7 A;  1KE3 A;  1N4O A;  3S22 A;  4RVA A;  2XLN A;  5EVI C;  2Y59 A;  3VP4 A;  5HL1 A;  4JXV A;  3HVF A;  3UPO A;  1VQQ A;  3WS1 A;  1PIO A;  2B5R A;  4S2N C;  5I94 A;  1CK3 A;  4WEK A;  3N6I A;  4KQR A;  2IWB A;  4C6Y A;  4PM9 A;  2P74 A;  3BYD A;  4C3Q A;  3LCE A;  4GD8 A;  1LI0 A;  2WKE A;  5FQQ A;  2EXB A;  2Y2L A;  5J8X A;  2X71 A;  4LEN A;  4H8R A;  1BUL A;  1PW8 A;  3DW0 A;  3HLG A;  3VOZ A;  3UN7 A;  3HUN A;  1YLJ A;  4GDB A;  5AQA A;  1GHI A;  1O7E A;  1H8Z A;  4RYE A;  4E6W A;  3Q81 A;  3N4I A;  3FKV A;  3FKW A;  4PPR A;  1MBL A;  2Y4A A;  4EQI A;  4ZDX A;  1K38 A;  3IQA A;  4MBK A;  4UA6 A;  4KZA A;  5JYP A;  5HAP A;  2RL3 A;  1ONG A;  2C5W B;  2ZC7 A;  3EQU A;  3N7W A;  3UO9 A;  1ERQ A;  3ITA A;  1EWZ A;  2XFS A;  4F94 A;  3MKF A;  3VSL A;  1K56 D;  3G34 A;  5DF9 A;  3WRZ A;  1PI5 A;  4BEN A;  1KE0 A;  4X56 A;  4GB7 A;  1IEL A;  2V20 A;  4UHU A;  2WAD A;  4S2O A;  3SH8 A;  3VP2 A;  4BL2 A;  2Y2M A;  1E3U A;  1IYP A;  4X69 A;  4OOY A;  3ZDJ A;  2H0T A;  2ZM0 A;  2XGN A;  4MBH A;  3HLF A;  4OH0 A;  3ISG A;  4OQH A;  3VFF A;  1NZO A;  4N9K A;  4ZAM A;  2XFT A;  1CI8 A;  1LI9 A;  5F82 A;  2XR0 A;  4B4Z A;  5CGS A;  4GZB A;  3UDX A;  4BLM A;  3DWZ A;  1YM1 A;  3PTE A;  4OLG A;  2WAE A;  3AGF A;  3FWL A;  5CHM A;  5AQ7 A;  1KE4 A;  2E8I A;  2HDQ A;  1XXM A;  4R3J A;  5FQM A;  1ES4 A;  4RX2 A;  5EE8 A;  2EX8 A;  2Y2P A;  3PAE A;  1LL5 A;  3C7V A;  1ONH A;  2QZ6 A;  5CEB A;  5JYO A;  2RCX A;  1YQS A;  2WZZ A;  3D4F A;  3VP1 A;  4UAA A;  2WK0 A;  5FSR A;  2DCF A;  3V5M A;  2EFX A;  5EPH A;  4WYY A;  3V50 A;  3SS5 A;  4PM8 A;  5F1G A;  5U47 A;  4E3O A;  4S2I A;  4DKI A;  3SOI A;  4UA9 A;  4U0T A;  3UNW A;  4IVK A;  5GLC A;  1K6R A;  1WYB A;  3HLE A;  1PI4 A;  3FZC A;  3PAG A;  3ZG9 B;  1IEM A;  5AQB A;  3UE1 A;  5M18 A;  1K57 A;  1ZC2 A;  2WGI A;  2R9X A;  1JWP A;  1WYC A;  4OP8 A;  5EVI D;  4K91 A;  4KEN B;  1HZO A;  1W79 A;  3HLD A;  5KSC A;  1SKF A;  1E25 A;  4O7D A;  4GOG A;  4S2L A;  4EBP A;  3BM6 A;  1M6K A;  5DTS A;  4PM5 A;  3BFF A;  4HBU A;  4JXG A;  4X55 A;  3ZCZ A;  5HX9 A;  1SDN A;  1GHP A;  4BD1 A;  5GLA A;  5M1A A;  3ZVT A;  4YIN A;  1PW1 A;  1TVF A;  4X68 A;  1FOF A;  4JF6 A;  3Q1F A;  4QY5 A;  1XPB A;  1ZKJ A;  1K57 C;  1YMS A;  3UDI A;  5KZH A;  4N9L A;  3MZF A;  2WAF A;  2FFY A;  5HFO A;  2Y2N A;  4NK3 A;  3SH7 A;  1NYM A;  2Y2J A;  1YMX A;  3BFD A;  2ZLY A;  3DWK A;  2Y55 A;  4DF6 A;  3W8K A;  3CG5 A;  3Q7V A;  5FI2 A;  3ZFZ A;  4KZ7 A;  5L2F A;  3P98 A;  4BJP A;  2HP9 A;  2CC1 A;  4KZ4 A;  3PBS A;  3G30 A;  1HTZ A;  3QNC A; 
#chains in the Genus database with same CATH topology
 3IH8 A;  4OOL A;  3O88 A;  1IYQ A;  1NXY A;  5FI6 A;  5FAO A;  2J3T C;  1SDE A;  4DDY A;  2B18 A;  2BLS A;  4XUZ A;  3T4S A;  1F98 A;  1UWP X;  4RX3 A;  1FQG A;  1ES3 A;  1IKG A;  3C7U A;  4S2K A;  3UPN A;  2Y2Q A;  1G68 A;  4LCL A;  3PBR A;  1TDL A;  3RH8 B;  4EW7 A;  1U60 A;  1DJC A;  2VV8 A;  3MFX A;  1K4E A;  1TS8 A;  2H5S A;  1MY8 A;  3U4L P;  4DDS A;  4WZ4 A;  1K55 A;  3IWI A;  3EEH A;  4II7 A;  2G2U A;  4KZ8 A;  3QP4 A;  1GHM A;  4G3V A;  2HDU A;  1OT6 A;  1S1Y A;  1KGF A;  2EX6 A;  5HAI A;  3H82 B;  3VE4 A;  1ZG4 A;  5IS1 A;  1KVM A;  3IX3 A;  1ES2 A;  2XSS A;  3CPT B;  1GSW A;  3O3V A;  3OPP A;  4UQI S;  2GNX A;  2M1C A;  5EVI B;  3ULF A;  4GD6 A;  5FI7 A;  1W63 M;  2PBD P;  2W1R A;  5KMW A;  3BLM A;  2PBY A;  4JPM A;  4JGR A;  1WE4 A;  2XH9 A;  2HDR A;  4IVI A;  5CHJ A;  3UY6 A;  1G5U A;  2XA7 S;  3UME A;  1SKO A;  2PDR A;  2VK3 A;  2D01 A;  1L2S A;  2HJE A;  3TG9 A;  5EOE A;  2JC7 A;  2ZJ9 A;  3JYI A;  1W7F A;  1SZV A;  4WEJ A;  3G32 A;  5L8M A;  3IBR A;  4R4S A;  2HPB A;  4FSF A;  1JNU A;  4IBX A;  1K54 C;  1RGZ A;  2ZBB A;  3O86 A;  3IF5 A;  4EEP A;  2VV7 A;  3BW6 A;  5EVL A;  3VV4 A;  2ZQC A;  2W3G A;  4DRT A;  5DF7 A;  3V3S A;  1DJA A;  1KDW A;  3A3D A;  4M4X A;  1FR1 A;  4DJ2 A;  4D60 A;  3F1O B;  3B3X A;  3DAV A;  1JTD A;  1TF1 A;  1OTA A;  4OQ0 A;  1Y54 A;  4E3M A;  3V67 A;  4FH2 A;  4UQI M;  4F3L A;  2V1Z A;  4KQQ A;  1IKI A;  3M2K A;  4EET B;  3NCK A;  3T4T A;  3TRC A;  1IYO A;  1PZP A;  3GR2 A;  3LEZ A;  4IUH A;  4LFU A;  2Y8H A;  1C3B A;  3KYQ A;  4GKU A;  1ZTU A;  2HF6 A;  4EBN A;  3PHY A;  5HPI A;  4YOF A;  2XA7 M;  5CGX A;  3E2K A;  3T4J A;  1BLH A;  2W1T B;  3D3O A;  3VP3 A;  5CHU A;  3VOL A;  3GVB A;  3ZHH A;  1J9M A;  1MPL A;  4P6B A;  5AVE A;  5E2H A;  1VM1 A;  3GEC A;  1MKM A;  2EX9 A;  4E3J A;  1XGI A;  2ZMA A;  5EVE A;  5CTN A;  3T1Q B;  4NXE A;  5HAQ A;  4OVD A;  4Y0O A;  3T50 A;  2JKR I;  1H8Y A;  4O01 A;  1DP6 A;  1K25 A;  2W3H A;  2H0Y A;  1ODV A;  2Y2G A;  2JHE A;  3FC7 A;  3W4O A;  4ESP A;  2W0N A;  3H9W A;  3M6B A;  4WBG A;  2Y2H A;  2V1A A;  4KQD A;  1CEG A;  3L7H A;  3E4Q A;  3CLO A;  4GS9 B;  1NJ4 A;  2VGJ A;  3CAX A;  2Y79 A;  1AWI A;  2DMW A;  2ZOI A;  3NUL A;  5HW3 A;  1ZG6 A;  3H82 A;  2A49 A;  4Y13 A;  3LIC A;  4MN5 A;  2QJ7 A;  3HUM A;  1OTD A;  2ZC4 B;  4DE2 A;  3EGD C;  5CER A;  4N1X A;  4ZRR A;  2J9P A;  1ES5 A;  5F69 A;  3WS5 A;  3A0S A;  3A0R A;  5EVI A;  3G2Y A;  3T1S A;  3GMW A;  4WUJ A;  4QHC A;  1HVB A;  3MQQ A;  4LPZ A;  4MBF A;  5IU1 A;  3IS2 B;  3E98 A;  1XA1 A;  4YWZ A;  1KE3 A;  2O9A A;  4RVA A;  1CK3 A;  4G3K A;  2H28 A;  4KQR A;  4CLC D;  1NLZ A;  4YNR A;  4LRX C;  4GD8 A;  5FQQ A;  2EXB A;  2X71 A;  2OAQ 1;  3HLG A;  3UN7 A;  4BBU A;  1LSX A;  1GHI A;  4RYE A;  4PPR A;  4EQI A;  4JGO A;  3R7W B;  5JYP A;  4HIA A;  5CX7 A;  2GZA A;  1VET B;  1NWZ A;  3N7W A;  4DJ3 A;  3ITA A;  1EWZ A;  3F1O A;  4ETX A;  3E0Y A;  3G34 A;  4LLO B;  3WRZ A;  4BEN A;  1KE0 A;  3MF0 A;  2V20 A;  2ZM0 A;  2XGN A;  1OPX A;  4ZAM A;  2E8J A;  4B4Z A;  4EQ1 A;  5CHM A;  1KE4 A;  3S7O A;  3TJZ C;  5JYO A;  1LL8 A;  1YQS A;  3KSG A;  3VP1 A;  4UAA A;  5FSR A;  2DCF A;  2W1T A;  2J80 A;  5EPH A;  4WYY A;  3SS5 A;  4PM8 A;  3LUQ A;  4DKI A;  2L1M A;  3SOI A;  5EFW A;  3UMD A;  5K5B A;  1T1A A;  2VV6 A;  3FZC A;  3PAG A;  3UE1 A;  1K57 A;  4OP8 A;  2R9X A;  4R38 A;  1W79 A;  1SKF A;  2W27 A;  4O7D A;  4EBP A;  5C5K A;  1MC0 A;  3BM6 A;  4PM5 A;  3ZCZ A;  5HWW A;  5HX9 A;  2LB5 A;  2WKQ A;  2ZMF A;  1YPR A;  4CLC B;  4JF6 A;  1XPB A;  3UDI A;  4N9L A;  3DTI A;  2FFY A;  3LGO A;  2MJ6 A;  3BFD A;  3T4K A;  4KZ7 A;  2HP9 A;  2CC1 A;  3LIA A;  3PBS A;  3G30 A;  3QNC A;  4GS9 A;  1IOU A;  2BG1 A;  3T4O A;  1NLY A;  2Y91 A;  4H6J B;  3BQ8 A;  4Z1W A;  3BY9 A;  1OME A;  3LO7 A;  3IHB A;  1DJB A;  3O87 A;  1FR6 A;  1G6O A;  2GDN A;  4HJ4 A;  3BLS A;  3UE6 A;  1YLZ A;  5HD3 A;  3KSF A;  1H3Q A;  3BQA A;  3ITB A;  4HH3 A;  5E2G A;  1XA7 A;  5G18 A;  5GLD A;  4L9G A;  3SW1 A;  5A8B A;  1YLW A;  3C4O A;  2O9B A;  1E3U D;  2WGV A;  3VFH A;  5J7E A;  3BFG A;  2ZC6 B;  3JPU A;  2V2F F;  3BJN A;  3IS2 A;  4OPQ A;  3EGX C;  3IF6 B;  2X02 A;  3CMZ A;  3BEC A;  3KX0 X;  4R4R A;  2D02 A;  5GLB A;  1K55 C;  4JLF A;  3NJA A;  1PWC A;  5DJU A;  1MWR A;  3G6O A;  3LY3 A;  4X6T A;  1MWU A;  4WLA A;  2JKF A;  2XQZ A;  5HWV A;  4EWF A;  1EI5 A;  2WKH A;  2ZM8 A;  3RTY A;  1Z6F A;  2ZQ8 A;  3VP0 A;  2Y2O A;  3MS6 A;  4FTX A;  3R7W A;  1E4D A;  2ZMV A;  4QU3 A;  1VET A;  2XF3 A;  4P0M A;  3T4L A;  2HDS A;  4BBV A;  3LR3 A;  4JF5 A;  5GHX A;  5DF8 A;  5CGW A;  2UWX A;  1W8Q A;  3LYX A;  2KOI A;  1LSW A;  1JTG A;  2VGL S;  2ZD8 A;  2Z2L B;  3GSG A;  4ZJ3 A;  4Y3I A;  5F83 A;  3MZD A;  4ME4 A;  3M2J A;  2J9O A;  3N8S A;  4HP9 A;  4JXW A;  5DFX A;  4IED A;  2GJ3 A;  3IX4 A;  4OLD A;  4Q8I A;  3B42 A;  4PM6 A;  2GX5 A;  4LGW A;  2XK1 A;  3PBQ A;  5CTM A;  2G7U A;  1KGE A;  2ZC5 B;  1T1C A;  5CED A;  3EQV A;  2A3U A;  3H7W B;  3NDG A;  4HEF A;  1F5M A;  4P6Z S;  3WS2 A;  5E2E A;  1CQA A;  2UV0 E;  3N8L A;  2ZOH A;  5CRF A;  3K2N A;  3AGD A;  4LV1 A;  1G6A A;  4N92 A;  3WS4 A;  1UGU A;  1FCO A;  2WGW A;  4CLC A;  4NET A;  5FEG A;  1NZU A;  1L0D A;  4OQI A;  3HLW A;  4YFM A;  4EER A;  4E3L A;  5EEC A;  1LLB A;  5DJT A;  2PRF A;  4L0L A;  5DVA A;  3F1P B;  3AGE A;  2VJW A;  2VGL M;  3LEQ A;  3MSH A;  2Y2K A;  4H6J A;  2EA9 A;  1OTB A;  5A91 A;  1PNE A;  2ZQA A;  5HSQ A;  1PZO A;  1I2S A;  3E4P A;  4A5R A;  2HP5 A;  4EEU A;  1S67 L;  2A2L A;  2XRO A;  3MBZ A;  1M40 A;  2XD1 A;  2V9A A;  4WMC D;  4GJ4 A;  3UDF A;  3CUE A;  2WKI A;  4NXB A;  1DP9 A;  1VEU B;  2EFU A;  4BL3 A;  4R1G A;  1SHV A;  4X1L A;  3NDE A;  5HL6 A;  4P6Z M;  4XXR A;  5F1F A;  4JXS A;  1P9R A;  1SCW A;  1MXO A;  2PYR A;  3ZG0 A;  1JWZ A;  5AJG A;  1HD8 A;  5AVF A;  3BFC A;  3IF6 A;  3IXB A;  2OLU A;  1I2W A;  3SS4 A;  1FSY A;  4LCM A;  1DY6 A;  4OQG A;  1BLC A;  2R9W A;  1KVL A;  3NIA A;  1W8Y A;  2Q9N A;  3OCL A;  4M3K A;  1FSW A;  1LSV A;  4DN0 A;  1FCN A;  3UE0 A;  1S6R A;  2P04 A;  3E2L A;  1GA9 A;  4S2J A;  3SZT A;  2HP6 A;  4JGQ A;  1W63 Q;  3CWF A;  3ZG8 B;  3HLC A;  3MZE A;  3S1Y A;  4ARZ A;  2XLN A;  5EVI C;  3VP4 A;  5HL1 A;  4JXV A;  3HVF A;  1H0M A;  1VQQ A;  1GSV A;  5I94 A;  3KYZ A;  2K31 A;  3W2Z A;  2P74 A;  3BYD A;  4FOF A;  3LCE A;  1LI0 A;  2WKE A;  2Y2L A;  4LEN A;  1X0O A;  3VOZ A;  3HUN A;  1YLJ A;  1YAX A;  1H8Z A;  2J3W A;  4NKP A;  1MBL A;  4ZDX A;  1P9W A;  5FEF A;  4KZA A;  5MC7 A;  4GW9 A;  1ONG A;  3EQU A;  2ZC7 A;  5F68 A;  1ERQ A;  3LIE A;  3VSL A;  3PR6 A;  1IEL A;  2WAD A;  4LRZ E;  3VP2 A;  2EWV A;  4BL2 A;  2Y2M A;  1E3U A;  1IYP A;  2H0T A;  3HLF A;  5DKK A;  1WA9 A;  3ISG A;  4EU0 A;  1NZO A;  2XFT A;  5F82 A;  3C38 A;  3DWZ A;  1YM1 A;  4OLG A;  3FWL A;  3AGF A;  2M7U A;  2Z6C A;  5AQ7 A;  4HI4 A;  2HDQ A;  3LIF A;  4R3J A;  5FQM A;  1TD5 A;  5L07 A;  4ETZ A;  2QZ6 A;  3LI8 A;  3LFV A;  3QP2 A;  2EFX A;  3LR5 A;  2OOL A;  1LT0 A;  4S2I A;  3F1P A;  4UA9 A;  4U0T A;  3UNW A;  1K6R A;  1WYB A;  3HLE A;  1PI4 A;  3LIB A;  5DKL A;  5AQB A;  2WGI A;  1Y28 A;  3IBJ A;  2R78 A;  2KLI A;  1E25 A;  2QWS A;  3CPT A;  2QJ5 A;  5DTS A;  2KDK A;  3BFF A;  1J3W A;  4JXG A;  3MXQ A;  3ZVT A;  4YIN A;  1TVF A;  4I3A A;  1FOF A;  1K57 C;  3LR0 A;  4CQH A;  5KZH A;  1Z09 A;  3UB9 A;  5HFO A;  2Y2N A;  3SH7 A;  1VEU A;  2OAP 1;  2Y2J A;  1YMX A;  3DBA A;  4IJG A;  3CG5 A;  3ZFZ A;  2K2N A;  1S66 L;  3P98 A;  3G2Z A;  4R23 A;  5E2F A;  4BQM A;  3ZGA B;  4XUX A;  2VEA A;  4E3N A;  1BT5 A;  4KG2 A;  5AQ9 A;  4MEZ A;  4KUO A;  1XJ2 A;  3S7N A;  3DTE A;  5KSH A;  5HD5 A;  4WN5 A;  3HL9 A;  4IUK A;  3IWO A;  1T18 A;  5TGF A;  1TS6 A;  1VHM A;  2W3F A;  5GHY A;  1MKI A;  2C6W B;  3IHA A;  2VA0 A;  4QJG A;  3PBN A;  4HH2 A;  3NOT C;  3QNB A;  1JVJ A;  4U3T A;  3Q07 A;  1MWS A;  5BOH A;  3BY8 A;  1GCE A;  3HUO A;  2OLV A;  3ZG5 A;  3C2W A;  3P09 A;  3BEB A;  3T4Q A;  5FQI A;  4ZBE A;  4E3I A;  3EWK A;  4OON A;  3BRM A;  1S1Z A;  4Y15 A;  1XFQ A;  2PU4 A;  4UEY A;  4QD4 A;  3OCN A;  1NY0 A;  3IXG A;  4P85 A;  4E3K A;  5G4Y A;  4HJ6 A;  4PM7 A;  3GTC A;  4BBT A;  2QPN A;  1QME A;  2JKT M;  1N9L A;  3CI6 A;  2M7V A;  3RJU A;  3Q7Z A;  1OJG A;  2L4R A;  5DTT A;  2JKG A;  3QP6 A;  1STZ A;  2H10 A;  4R6L A;  4ZJ2 A;  5HAR A;  2XDM A;  2XEP A;  4QB8 A;  4WMC A;  1KGG A;  5FAQ A;  1BSG A;  3ZVW A;  4LV2 A;  4U0X A;  5A90 A;  2ZL1 B;  4R3B A;  5TBM B;  2XD5 A;  4FD8 A;  5A93 A;  3PBO A;  4JBF A;  4Y5F A;  2J3T D;  2X01 A;  3NY4 A;  1EW0 A;  1A0K A;  4I38 A;  2DRW A;  2G2W A;  2Y2I A;  4WZ5 A;  5TR7 A;  3W4P A;  2WKR A;  1Q2P A;  1GSX A;  4R70 A;  4LV3 A;  4EV4 A;  2ZQD A;  4HJ3 A;  1MWT A;  2QYB A;  5J4E A;  1BYW A;  4S2M A;  3MXS A;  1OTI A;  2EWW A;  4PMA A;  1L0G A;  4KG6 A;  3BFE A;  1K0K A;  4Y7P A;  4X53 A;  3ZNT A;  3FV7 A;  4KZ3 A;  1PWG A;  4GN2 A;  2OV5 A;  4C75 A;  3C4P A;  1RCJ A;  3IT9 A;  1ESI A;  2VGK A;  1F2K A;  4ZTK A;  4OPZ A;  1Q2Q A;  4L9F A;  2WUQ A;  5GHZ A;  4GDN A;  3OPH A;  1PRQ A;  5CXW A;  2PYP A;  3NBL A;  1F9I A;  4WEL A;  3D72 A;  3DTM A;  2HV1 A;  3V3R A;  4EUZ A;  2PD8 A;  4PHT A;  3W4Q A;  4X1M A;  4EUV A;  4HP4 A;  1P97 A;  1QMF A;  2VKS A;  1MZU A;  3BWL A;  3WWX A;  4WF0 A;  1CI9 A;  3UB8 A;  5GL9 A;  2IWC A;  2K7S A;  4LV0 A;  3CZD A;  5E43 A;  5FA7 A;  4HQA A;  4BWI A;  4FCF A;  3F1N B;  4CLC C;  3S4X A;  5A92 A;  1BLP A;  4B4X A;  4EXO A;  4MLL A;  1PFL A;  3CJM A;  2P7J A;  4NEE D;  3FG8 A;  2YKH A;  3SS3 A;  2ZM2 A;  1ERO A;  4E6X A;  3MMH A;  2P08 A;  3GQZ A;  4Y0T A;  3K3C A;  4Y0U A;  1PYY A;  3G4P A;  3A3F A;  4FUW A;  4D2O A;  1BLS A;  3RXW A;  4K08 A;  3Q7V B;  4GCZ A;  3TSG A;  4XT2 B;  1YLT A;  3R4K A;  5F6A A;  3IH9 A;  4ZJ1 A;  4OPR A;  3T12 B;  4OOM A;  1ACF A;  1RP5 A;  3CUE C;  1YT4 A;  1V9Y A;  1N9O A;  4DE3 A;  1CF0 A;  1I5Q A;  2V8C A;  1S0W A;  4BMW A;  4IBR A;  1YSP A;  5FDH A;  1VB6 A;  3PBT A;  4CLC E;  2Z6D A;  4MDZ A;  2O99 A;  3SH9 A;  1YLY A;  5EUA A;  5FQ9 A;  2JE5 A;  4OKP A;  2JCH A;  3IF6 C;  3HCY A;  2J7V A;  4WM9 A;  3NI9 A;  1CJF A;  2L0W A;  2EXA A;  1W5D A;  2ZC3 B;  3FYZ A;  2VLG A;  4GLQ A;  5EM1 A;  4N1H A;  4S2N A;  3HRE A;  4OPY A;  1D1J A;  4JKT A;  3FPV A;  3MQ0 A;  1PWD A;  4GNU A;  4RA7 A;  1N4O A;  3GDI A;  3WS1 A;  1PIO A;  2B5R A;  4WEK A;  2W3E A;  3N6I A;  2IWB A;  2B95 A;  4C6Y A;  4PM9 A;  3MR0 A;  2ZL1 A;  5TBM A;  3P7N A;  5J8X A;  4H8R A;  3DW0 A;  3QP8 A;  4GDB A;  1O7E A;  4E6W A;  4HOI A;  3FKW A;  5IT5 A;  2OWJ A;  2Y4A A;  3IQA A;  5HAP A;  3TW8 A;  3MJQ A;  2RL3 A;  2C5W B;  1YKD A;  2JKT I;  4Q0H A;  3B33 A;  1L3L A;  1V9Z A;  1K56 D;  4KUK A;  3UB7 A;  4S2O A;  3SH8 A;  3LI9 A;  4PAU A;  3ZDJ A;  4MBH A;  4OH0 A;  4PKY A;  5L09 A;  5CGS A;  5HZH A;  3PTE A;  4L9E A;  4WL9 A;  4NXF A;  1ES4 A;  2EX8 A;  1LL5 A;  2RCX A;  2WZZ A;  2XRN A;  3QP1 A;  4O0P A;  2V0U A;  2WK0 A;  5FDS A;  3V50 A;  5KIZ A;  2CMN A;  5G4Z A;  5U47 A;  5HDS A;  4HNB A;  3F1N A;  1XJ6 A;  5GLC A;  4JGP A;  2PAV P;  1FIL A;  1IEM A;  3JVV A;  1ZC2 A;  1JWP A;  2ACG A;  4KEN B;  3HLD A;  5KSC A;  3U2A A;  1M6K A;  3TE8 A;  2O9C A;  1SDN A;  2B02 A;  4BD1 A;  5GLA A;  5M1A A;  1S4S A;  1PW1 A;  2PD7 A;  4X68 A;  1ZKJ A;  1YMS A;  2A24 B;  3MZF A;  2LB9 A;  2WAF A;  3C8C A;  4NK3 A;  1D7E A;  1NYM A;  5HPF A;  2ZLY A;  3DWK A;  2Y55 A;  4DF6 A;  3Q7V A;  5FI2 A;  4XT2 A;  4KZ4 A;  1HTZ A;  4B9O A;  1NRJ A;  4O8G A;  4E04 A;  1IYS A;  3KO6 A;  3O5Y A;  3A0V A;  2HZ5 A;  1XP4 A;  2Z2M B;  5LBR A;  3S7Q A;  1XX2 A;  3Q82 A;  1NYY A;  3ICY A;  1K6S A;  3VOY A;  1FCM A;  1XFN A;  1HLU P;  4OP5 A;  4CPK A;  5DTK A;  5FQK A;  5M19 A;  4QPR A;  1TS0 A;  3FPW A;  3N8R A;  3LID A;  4JF4 A;  1ERM A;  1H8M A;  3LY4 A;  3NC8 A;  1ALQ A;  3MQO A;  1JWV A;  4KZ5 A;  3H7W A;  2HGV A;  3MFD A;  3VE3 A;  4MMN A;  5FAT A;  3LR4 A;  4I3I A;  3KSI A;  4KG5 A;  5FQJ A;  1CEF A;  4X25 A;  1T19 A;  3OPL A;  3EOI A;  4R0Q A;  4EBL A;  1N9N A;  3QP5 A;  2P9V B;  1DRM A;  5D3O A;  3K3D A;  3VSK A;  4P87 A;  2BAS A;  3IXH A;  4DMZ A;  5EOO A;  3VMA A;  3OC2 A;  4KZB A;  3WS0 A;  3GRJ A;  5DFY A;  3PYP A;  4ID4 A;  3HLB A;  3S7P A;  4DE1 A;  4I39 A;  1K54 A;  2V1B A;  2IA2 A;  1LHY A;  3OBF A;  2V0W A;  2KX6 A;  1RGY A;  3GV9 A;  3ZG7 B;  4Y2F A;  1L0E A;  4B88 A;  5FAS A;  4K0X A;  3WRT A;  2QHK A;  3HBR A;  2V8F A;  1S4R A;  4MN7 A;  1FIK A;  3D9Y A;  3QHY A;  3NEC A;  2QKP A;  1L0F A;  3KSH A;  3NHQ A;  2O0Y A;  4DXB A;  5J3W A;  2Q9M A;  1TDG A;  1XKZ A;  2PR6 A;  2OSU A;  1XGJ A;  4WZ5 C;  1K4F A;  3A3I A;  4KQO A;  2W3D A;  1H5X A;  2WYX A;  3NOP C;  4K0W A;  2BTF P;  2I72 A;  1O07 A;  1BTL A;  5FAP A;  4CJN A;  5CEC A;  2WZX A;  3A3E A;  3OOV A;  2DNS A;  1LL9 A;  4Y17 A;  1GA0 A;  1TEM A;  3MXR A;  2FFF B;  3I7J A;  3G31 A;  2A24 A;  4FH4 A;  2ZQ7 A;  2QMI A;  3OPR A;  1Y4O A;  5FL3 A;  2JN7 A;  3HJI A;  1KOU A;  1OTE A;  1ESU A;  3IX8 A;  5HDD A;  1BZA A;  3C5A A;  4GHI B;  1ZHH B;  4I3J A;  3HJK A;  5EV0 A;  3UE3 A;  5TJJ A;  3EEA A;  3MKE A;  3G35 A;  1K56 A;  3UPP A;  4DXC A;  2PR5 A;  1UWN X;  5TFQ A;  4KZ6 A;  1D06 A;  4Z9Q A;  3IXD A;  2NUP C;  4KZ9 A;  3P01 A;  3DTK A;  4BD0 A;  3A3J A;  4HES A;  4Q0J A;  4MN6 A;  1G28 A;  1BUE A;  2NUT C;  5IHV A;  4RQ9 A;  3NOU C;  3IWQ A;  3OZH A;  1NRF A;  2JBF A;  4HBT A;  3V39 A;  1KDS A;  3ZNY A;  4QY6 A;  3OLO A;  3ZQ5 A;  1YLP A;  1N9B A;  2EX2 A;  4PKY G;  3RXX A;  3L9K A;  1YSQ A;  3TOI A;  2J8Y A;  2PU2 A;  2ZQ9 A;  4DE0 A;  2P9V A;  1AXB A;  2WGW B;  3M6H A;  4MNR A;  4UA7 A;  2IWD A;  3CHW P;  1DP8 A;  4IHQ A;  4S2P A;  3S22 A;  4HHD A;  2FZ0 A;  2Y59 A;  3RFB A;  3UPO A;  4S2N C;  5I5L A;  4MCW A;  4C3Q A;  4I5S A;  1BUL A;  1PW8 A;  4EES A;  1OJ5 A;  3C30 A;  2WKP A;  5AQA A;  3Q81 A;  3N4I A;  3FKV A;  2VZW A;  3T1X A;  1P0Z A;  1K38 A;  3UB6 A;  4MBK A;  4UA6 A;  4B93 A;  4G3W A;  3UO9 A;  2XFS A;  4F94 A;  3MKF A;  5DF9 A;  1SKO B;  1OT9 A;  1PI5 A;  4X56 A;  4GB7 A;  4UHU A;  1XJ3 A;  4X69 A;  4OOY A;  3UB5 P;  4OQH A;  3VFF A;  2AVX A;  3CIT A;  4N9K A;  1CI8 A;  1LI9 A;  2XR0 A;  4GZB A;  3UDX A;  4BLM A;  2HJ9 C;  2WAE A;  4Q0I A;  1TS7 A;  2E8I A;  1XXM A;  2YKF A;  4RX2 A;  5EE8 A;  2Q0O A;  2Y2P A;  3PAE A;  3C7V A;  3JVU A;  1ONH A;  5CEB A;  3E4O A;  3D4F A;  1T1B A;  3V5M A;  5F1G A;  2INW A;  4E3O A;  3KYE A;  2JKR M;  2FH5 A;  3PXP A;  4ARZ B;  4GHI A;  4IVK A;  4F3L B;  4NXG A;  2PT7 A;  3ZG9 B;  5M18 A;  2OWH A;  1WYC A;  5EVI D;  4QWO A;  4K91 A;  4HY8 A;  5F5Y A;  4AFI A;  1HZO A;  4S2L A;  4GOG A;  4LRY C;  4R3A A;  2I9V A;  5L10 A;  4HBU A;  4X55 A;  1GHP A;  1IFQ A;  3Q1F A;  4QY5 A;  4NG2 A;  5HWT A;  2VX8 A;  3B47 A;  3ZYT A;  3T1R A;  5L2F A;  4BJP A;  1XJ4 A;  5EM0 A;  3W8K A;  5HDC A;  2PHY A; 
#chains in the Genus database with same CATH homology
 5E2F A;  4BQM A;  3ZGA B;  2BG1 A;  4XUX A;  4E3N A;  1BT5 A;  4KG2 A;  5AQ9 A;  3IH8 A;  2Y91 A;  4OOL A;  3O88 A;  4MEZ A;  1IYQ A;  1NXY A;  5FI6 A;  1IYS A;  5FAO A;  1OME A;  3LO7 A;  3IHB A;  1DJB A;  5KSH A;  3O87 A;  1SDE A;  1FR6 A;  4DDY A;  1XP4 A;  2GDN A;  2Z2M B;  3BLS A;  1YLZ A;  2BLS A;  3HL9 A;  4XUZ A;  4RX3 A;  3IWO A;  1FQG A;  5TGF A;  1ES3 A;  3G2Z A;  5GHY A;  1MKI A;  2C6W B;  3IHA A;  1IKG A;  4QJG A;  3PBN A;  1XX2 A;  3C7U A;  4S2K A;  3UPN A;  2Y2Q A;  3Q82 A;  1G68 A;  1NYY A;  4LCL A;  3ITB A;  5E2G A;  1XA7 A;  5G18 A;  5GLD A;  3PBR A;  1K6S A;  3QNB A;  1JVJ A;  1TDL A;  3VOY A;  1FCM A;  1U60 A;  1DJC A;  4OP5 A;  1YLW A;  1K4E A;  3C4O A;  4CPK A;  5DTK A;  2H5S A;  3Q07 A;  1MY8 A;  1MWS A;  4U3T A;  1E3U D;  5FQK A;  4WZ4 A;  4DDS A;  1GCE A;  3HUO A;  5BOH A;  5M19 A;  3N8R A;  4JF4 A;  1K55 A;  2OLV A;  2WGV A;  1ERM A;  3IWI A;  3P09 A;  3VFH A;  3BFG A;  3ZG5 A;  2G2U A;  2ZC6 B;  3BEB A;  3LY4 A;  4KZ8 A;  5FQI A;  4ZBE A;  4E3I A;  1GHM A;  3NC8 A;  2HDU A;  1ALQ A;  2V2F F;  4OON A;  4OPQ A;  3BRM A;  1KGF A;  1JWV A;  2EX6 A;  5HAI A;  3IF6 B;  2X02 A;  3CMZ A;  4KZ5 A;  2PU4 A;  3BEC A;  4QD4 A;  3OCN A;  4R4R A;  3MFD A;  1ZG4 A;  5FAT A;  1NY0 A;  5GLB A;  3IXG A;  1KVM A;  1K55 C;  4P85 A;  4JLF A;  4E3K A;  4KG5 A;  4PM7 A;  1ES2 A;  5FQJ A;  1PWC A;  3GTC A;  1CEF A;  1MWR A;  2QPN A;  1QME A;  3LY3 A;  4X6T A;  3O3V A;  3OPP A;  3OPL A;  3RJU A;  1MWU A;  3Q7Z A;  4R0Q A;  5EVI B;  4EBL A;  2XQZ A;  4EWF A;  4GD6 A;  5DTT A;  1EI5 A;  2WKH A;  2P9V B;  5FI7 A;  2ZM8 A;  5KMW A;  1Z6F A;  2ZQ8 A;  3BLM A;  2PBY A;  2Y2O A;  5D3O A;  3VP0 A;  4JPM A;  1WE4 A;  3VSK A;  2H10 A;  4P87 A;  2XH9 A;  3IXH A;  1E4D A;  5EOO A;  4ZJ2 A;  5HAR A;  3VMA A;  3OC2 A;  4QU3 A;  2XF3 A;  2HDR A;  2XDM A;  4KZB A;  4P0M A;  3WS0 A;  2XEP A;  4IVI A;  4QB8 A;  4WMC A;  5CHJ A;  1KGG A;  3GRJ A;  5FAQ A;  1BSG A;  2HDS A;  4ID4 A;  3UY6 A;  3HLB A;  3ZVW A;  4JF5 A;  4DE1 A;  5GHX A;  5DF8 A;  1K54 A;  5CGW A;  2UWX A;  4LV2 A;  1W8Q A;  1L2S A;  4U0X A;  1LHY A;  3TG9 A;  5EOE A;  5A90 A;  2JC7 A;  2ZJ9 A;  3JYI A;  4R3B A;  2XD5 A;  1W7F A;  4FD8 A;  1RGY A;  5A93 A;  3PBO A;  3GV9 A;  1JTG A;  4JBF A;  3ZG7 B;  2X01 A;  2ZD8 A;  3NY4 A;  4WEJ A;  3G32 A;  1L0E A;  2Z2L B;  4B88 A;  5FAS A;  4R4S A;  2HPB A;  4K0X A;  3GSG A;  4FSF A;  4IBX A;  3WRT A;  1K54 C;  1RGZ A;  3HBR A;  3IF5 A;  2DRW A;  2G2W A;  3O86 A;  2Y2I A;  4WZ5 A;  4ZJ3 A;  5TR7 A;  3W4P A;  1Q2P A;  5EVL A;  2ZQC A;  5F83 A;  4LV3 A;  4DRT A;  4EV4 A;  2ZQD A;  5DF7 A;  1MWT A;  3MZD A;  3QHY A;  3V3S A;  1DJA A;  3M2J A;  2J9O A;  1KDW A;  1L0F A;  3N8S A;  4S2M A;  4R23 A;  4JXW A;  3A3D A;  1FR1 A;  3MXS A;  4IED A;  4DXB A;  4PMA A;  2Q9M A;  1L0G A;  4KG6 A;  4OLD A;  3BFE A;  1TDG A;  1XKZ A;  4Q8I A;  4PM6 A;  4Y7P A;  2OSU A;  3B3X A;  1XGJ A;  4WZ5 C;  1JTD A;  4X53 A;  1K4F A;  3A3I A;  4KQO A;  2XK1 A;  3PBQ A;  5CTM A;  3FV7 A;  3ZNT A;  4OQ0 A;  1H5X A;  2WYX A;  1Y54 A;  4KZ3 A;  4E3M A;  1KGE A;  1PWG A;  2ZC5 B;  4GN2 A;  4K0W A;  2OV5 A;  4C75 A;  5CED A;  3C4P A;  1RCJ A;  2I72 A;  3EQV A;  4FH2 A;  3IT9 A;  1ESI A;  2A3U A;  2VGK A;  3NDG A;  4ZTK A;  2V1Z A;  1O07 A;  1IKI A;  4KQQ A;  1BTL A;  3M2K A;  4HEF A;  4OPZ A;  1Q2Q A;  3NCK A;  2WUQ A;  3WS2 A;  5E2E A;  5GHZ A;  5FAP A;  1IYO A;  1PZP A;  4GDN A;  3OPH A;  5CXW A;  3GR2 A;  4CJN A;  3NBL A;  3LEZ A;  4GKU A;  1C3B A;  4WEL A;  3N8L A;  5CEC A;  2WZX A;  3A3E A;  5CRF A;  3DTM A;  3V3R A;  4EUZ A;  4EBN A;  3AGD A;  3W4Q A;  2DNS A;  1LL9 A;  4LV1 A;  1G6A A;  1QMF A;  1GA0 A;  4N92 A;  3WS4 A;  1TEM A;  1FCO A;  3WWX A;  2WGW A;  3MXR A;  2FFF B;  4NET A;  3I7J A;  1CI9 A;  3G31 A;  5CGX A;  4FH4 A;  3E2K A;  2ZQ7 A;  1NZU A;  5GL9 A;  1L0D A;  2QMI A;  3OPR A;  4OQI A;  1BLH A;  2IWC A;  3HLW A;  4YFM A;  4LV0 A;  3CZD A;  3VP3 A;  5E43 A;  5CHU A;  4E3L A;  5EEC A;  1LLB A;  5FA7 A;  1ESU A;  3GVB A;  4L0L A;  3ZHH A;  5DVA A;  1J9M A;  3AGE A;  1BZA A;  4FCF A;  1MPL A;  3C5A A;  4P6B A;  5E2H A;  1VM1 A;  3S4X A;  4E3J A;  2EX9 A;  2Y2K A;  1XGI A;  5A92 A;  2ZMA A;  1BLP A;  5A91 A;  4B4X A;  2ZQA A;  3UE3 A;  5CTN A;  1PZO A;  4MLL A;  3CJM A;  1I2S A;  3MKE A;  3SS3 A;  2ZM2 A;  1ERO A;  3G35 A;  4A5R A;  5HAQ A;  2HP5 A;  1K56 A;  3UPP A;  4DXC A;  4E6X A;  4OVD A;  3GQZ A;  4Y0O A;  4Y0T A;  3MBZ A;  1M40 A;  4KZ6 A;  1H8Y A;  4Y0U A;  5TFQ A;  1PYY A;  1K25 A;  3G4P A;  2XD1 A;  3A3F A;  4Z9Q A;  4D2O A;  4WMC D;  3UDF A;  2H0Y A;  3IXD A;  2Y2G A;  2WKI A;  4KZ9 A;  3W4O A;  1BLS A;  2EFU A;  3M6B A;  4BD0 A;  4BL3 A;  4R1G A;  3A3J A;  1SHV A;  4WBG A;  3RXW A;  3Q7V B;  4HES A;  2Y2H A;  3TSG A;  3NDE A;  1YLT A;  1CEG A;  3IH9 A;  4ZJ1 A;  4OPR A;  1BUE A;  4XXR A;  1NJ4 A;  4OOM A;  5F1F A;  2VGJ A;  1RP5 A;  4JXS A;  1SCW A;  1YT4 A;  1MXO A;  5IHV A;  3ZG0 A;  1JWZ A;  1HD8 A;  5HW3 A;  1ZG6 A;  3BFC A;  3IF6 A;  4DE3 A;  2A49 A;  3IXB A;  2OLU A;  1I5Q A;  3IWQ A;  1I2W A;  3OZH A;  1FSY A;  1S0W A;  3SS4 A;  1NRF A;  2JBF A;  1DY6 A;  4HBT A;  1BLC A;  4IBR A;  3PBT A;  4LCM A;  4OQG A;  5FDH A;  3V39 A;  1KDS A;  3ZNY A;  3HUM A;  2R9W A;  1KVL A;  2ZC4 B;  3NIA A;  4QY6 A;  5CER A;  1W8Y A;  2Q9N A;  1YLY A;  3OCL A;  4N1X A;  3SH9 A;  4DE2 A;  4M3K A;  5EUA A;  5FQ9 A;  2JE5 A;  1FSW A;  1YLP A;  1N9B A;  2JCH A;  4OKP A;  2EX2 A;  3RXX A;  1FCN A;  3IF6 C;  2J9P A;  1ES5 A;  3WS5 A;  2J7V A;  3UE0 A;  4WM9 A;  1S6R A;  3NI9 A;  3TOI A;  2J8Y A;  2PU2 A;  2ZQ9 A;  2EXA A;  5EVI A;  3G2Y A;  4DE0 A;  3E2L A;  1GA9 A;  4S2J A;  1W5D A;  1AXB A;  2HP6 A;  2P9V A;  2WGW B;  2ZC3 B;  3FYZ A;  3GMW A;  3M6H A;  4N1H A;  4MNR A;  4QHC A;  4S2N A;  1HVB A;  4UA7 A;  3ZG8 B;  2IWD A;  3HRE A;  4OPY A;  3HLC A;  3MZE A;  4JKT A;  4MBF A;  3S1Y A;  4S2P A;  1PWD A;  4GNU A;  1XA1 A;  4RA7 A;  1KE3 A;  1N4O A;  3S22 A;  4RVA A;  2XLN A;  5EVI C;  2Y59 A;  3VP4 A;  5HL1 A;  4JXV A;  3HVF A;  3UPO A;  1VQQ A;  3WS1 A;  1PIO A;  2B5R A;  4S2N C;  5I94 A;  1CK3 A;  4WEK A;  3N6I A;  4KQR A;  2IWB A;  4C6Y A;  4PM9 A;  2P74 A;  3BYD A;  4C3Q A;  3LCE A;  4GD8 A;  1LI0 A;  2WKE A;  5FQQ A;  2EXB A;  2Y2L A;  5J8X A;  2X71 A;  4LEN A;  4H8R A;  1BUL A;  1PW8 A;  3DW0 A;  3HLG A;  3VOZ A;  3UN7 A;  3HUN A;  1YLJ A;  4GDB A;  5AQA A;  1GHI A;  1O7E A;  1H8Z A;  4RYE A;  4E6W A;  3Q81 A;  3N4I A;  3FKV A;  3FKW A;  4PPR A;  1MBL A;  2Y4A A;  4EQI A;  4ZDX A;  1K38 A;  3IQA A;  4MBK A;  4UA6 A;  4KZA A;  5JYP A;  5HAP A;  2RL3 A;  1ONG A;  2C5W B;  2ZC7 A;  3EQU A;  3N7W A;  3UO9 A;  1ERQ A;  3ITA A;  1EWZ A;  2XFS A;  4F94 A;  3MKF A;  3VSL A;  1K56 D;  3G34 A;  5DF9 A;  3WRZ A;  1PI5 A;  4BEN A;  1KE0 A;  4X56 A;  4GB7 A;  1IEL A;  2V20 A;  4UHU A;  2WAD A;  4S2O A;  3SH8 A;  3VP2 A;  4BL2 A;  2Y2M A;  1E3U A;  1IYP A;  4X69 A;  4OOY A;  3ZDJ A;  2H0T A;  2ZM0 A;  2XGN A;  4MBH A;  3HLF A;  4OH0 A;  3ISG A;  4OQH A;  3VFF A;  1NZO A;  4N9K A;  4ZAM A;  2XFT A;  1CI8 A;  1LI9 A;  5F82 A;  2XR0 A;  4B4Z A;  5CGS A;  4GZB A;  3UDX A;  4BLM A;  3DWZ A;  1YM1 A;  3PTE A;  4OLG A;  2WAE A;  3AGF A;  3FWL A;  5CHM A;  5AQ7 A;  1KE4 A;  2E8I A;  2HDQ A;  1XXM A;  4R3J A;  5FQM A;  1ES4 A;  4RX2 A;  5EE8 A;  2EX8 A;  2Y2P A;  3PAE A;  1LL5 A;  3C7V A;  1ONH A;  2QZ6 A;  5CEB A;  5JYO A;  2RCX A;  1YQS A;  2WZZ A;  3D4F A;  3VP1 A;  4UAA A;  2WK0 A;  5FSR A;  2DCF A;  3V5M A;  2EFX A;  5EPH A;  4WYY A;  3V50 A;  3SS5 A;  4PM8 A;  5F1G A;  5U47 A;  4E3O A;  4S2I A;  4DKI A;  3SOI A;  4UA9 A;  4U0T A;  3UNW A;  4IVK A;  5GLC A;  1K6R A;  1WYB A;  3HLE A;  1PI4 A;  3FZC A;  3PAG A;  3ZG9 B;  1IEM A;  5AQB A;  3UE1 A;  5M18 A;  1K57 A;  1ZC2 A;  2WGI A;  2R9X A;  1JWP A;  1WYC A;  4OP8 A;  5EVI D;  4K91 A;  4KEN B;  1HZO A;  1W79 A;  3HLD A;  5KSC A;  1SKF A;  1E25 A;  4O7D A;  4GOG A;  4S2L A;  4EBP A;  3BM6 A;  1M6K A;  5DTS A;  4PM5 A;  3BFF A;  4HBU A;  4JXG A;  4X55 A;  3ZCZ A;  5HX9 A;  1SDN A;  1GHP A;  4BD1 A;  5GLA A;  5M1A A;  3ZVT A;  4YIN A;  1PW1 A;  1TVF A;  4X68 A;  1FOF A;  4JF6 A;  3Q1F A;  4QY5 A;  1XPB A;  1ZKJ A;  1K57 C;  1YMS A;  3UDI A;  5KZH A;  4N9L A;  3MZF A;  2WAF A;  2FFY A;  5HFO A;  2Y2N A;  4NK3 A;  3SH7 A;  1NYM A;  2Y2J A;  1YMX A;  3BFD A;  2ZLY A;  3DWK A;  2Y55 A;  4DF6 A;  3W8K A;  3CG5 A;  3Q7V A;  5FI2 A;  3ZFZ A;  4KZ7 A;  5L2F A;  3P98 A;  4BJP A;  2HP9 A;  2CC1 A;  4KZ4 A;  3PBS A;  3G30 A;  1HTZ A;  3QNC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...