3Q7VB

Beta-lactam-sensor domain of blar1 (apo) from staphylococcus aureus with carboxylated lys392
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
252
structure length
251
Chain Sequence
QSITDYNYKKPLHNDYQILDKSKIFGSNSGSFVMYSMAADAYYIYNEKESRKRYSPNSTYIYLAMFGLDRHIINDENSRMSWNHKHYPFDAWNKEQDLNTAMQNSVNWYFERISDQIPKNYTATQLKQLNYGNKNLGSYKSYWMEDSLKISNLEQVIVFKNMMEQNNHFSKKAKNQLSSSLLIKKNEKYELYGKTGTGIVNGKYNNGWFVGYVITNHDKYYFATHLSDGKPSGKNAELISEKILKEMGVLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase regulator
molecule keywords Beta-lactamase regulatory protein BlaR1
publication title Lysine Nzeta-decarboxylation switch and activation of the beta-lactam sensor domain of BlaR1 protein of methicillin-resistant Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 78
structure length 251
sequence length 252
ec nomenclature
pdb deposition date 2011-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3q7vB00
4E3KA 1CEFA 1K25A 1E4DA 3QHYA 3OPHA 4KZ5A 1FSWA 3BYDA 1XGIA 3SOIA 4K91A 1ZC2A 3GR2A 3WS2A 3VP3A 2JC7A 5EOEA 4PM8A 2A3UA 2XD5A 3SH8A 1KGFA 3QNCA 1K55C 1PIOA 5A92A 4ID4A 5FASA 4FH4A 1TVFA 3FKVA 5E2GA 1MWSA 1ALQA 4E3MA 2OLVA 1SCWA 4EQIA 1C3BA 3A3FA 1BULA 4WYYA 4QHCA 5FI7A 3V39A 3W4QA 1JTDA 2EFUA 5F1GA 3UPPA 4GZBA 3VSLA 5EUAA 4GD6A 3ZG0A 4E3NA 4S2PA 4KZ7A 2ZC4B 4P0MA 2ZLYA 3IWIA 2WADA 4JLFA 2ZM2A 3V3RA 3EQUA 1U60A 4OPRA 2IWBA 1QMEA 2EX2A 4LV0A 4PM9A 4XXRA 3DWKA 2Y2IA 1ZKJA 2XDMA 2ZQ7A 1E3UA 5M18A 4R23A 1MBLA 1LI9A 3IF6A 4WBGA 3IH9A 1I5QA 3O86A 2ZQDA 3BFCA 1H8YA 3G35A 5FQMA 2QMIA 3HLEA 3C7VA 2Q9NA 1YLZA 4OOLA 1IELA 1YLYA 3IXDA 3IWOA 4DDYA 1ESUA 5DTSA 2WKHA 4CPKA 1PYYA 3ZG9B 3VSKA 4HEFA 4E3LA 1HD8A 4LV1A 1PZOA 5F82A 2BLSA 5EVIA 3VP1A 2XLNA 4DE0A 3UPOA 3OCNA 4ZTKA 5FAQA 2H5SA 2WUQA 1NZUA 4BENA 1XP4A 3OZHA 1Q2QA 3IHAA 1MWRA 3ITBA 3HUMA 1L0FA 5A91A 2C5WB 3UPNA 1PZPA 2J8YA 4ZJ1A 2ZD8A 3HVFA 3LY3A 3O88A 1BLHA 4MBFA 5E2EA 3MZEA 5CTNA 4K0WA 2RCXA 3RJUA 2ZC5B 3W4PA 4BD0A 2Y55A 2ZM0A 4KQOA 4RX2A 4X56A 4LCLA 3P09A 2ZMAA 4B4ZA 4EWFA 1BTLA 2WZZA 3IH8A 5EVIC 5F83A 2RL3A 3Q07A 3C4OA 2WKEA 1JWVA 5FQKA 3GQZA 2GDNA 1EROA 1YLWA 2VGKA 3FKWA 1PI5A 1IYSA 3WWXA 2EX9A 5FQQA 2WZXA 1M6KA 4JKTA 4N92A 1O7EA 3LY4A 3BFDA 4GD8A 2EXBA 4XUXA 1PWGA 3HLWA 3SS3A 3W8KA 1ESIA 1TDGA 2CC1A 5FQJA 1NYYA 2WGIA 1KGEA 2WYXA 3ZHHA 2HDQA 2V20A 1RCJA 1GA9A 4NK3A 2Y2GA 5HAPA 2ZM8A 4KENB 3FV7A 3ZG5A 3TOIA 1M40A 2EX8A 3ITAA 1KVMA 4DE2A 3GV9A 3ZVWA 4E6WA 4QU3A 1PW8A 1E25A 4X55A 3S4XA 3ZNYA 1FCOA 4Y0OA 2ZQCA 1GHIA 3AGFA 1ERMA 3Q1FA 2ZQAA 3AGEA 3VFHA 2IWDA 2ZC7A 3W4OA 3A3JA 1XA7A 1MPLA 3HLBA 4GB7A 4R3BA 1VM1A 1TDLA 3IQAA 4S2OA 3BFGA 4Y7PA 3UDXA 4X53A 1ES5A 2XK1A 5BOHA 1FOFA 5FQ9A 5FATA 5FAOA 2Y2PA 4JXVA 2QZ6A 1VQQA 4DKIA 1K38A 4KG5A 5EPHA 4QB8A 5TFQA 4P87A 2EXAA 1KE4A 3IF6B 5IHVA 1S0WA 3PTEA 3WRTA 2PU4A 5DTKA 4QY6A 2UWXA 4JF6A 2Y59A 3NC8A 3PAGA 1ZG4A 5E43A 2WKIA 4LV2A 4OPQA 4JXGA 5CXWA 3HLGA 4Z9QA 1FCMA 1KE3A 3ZG8B 1WYBA 3MXSA 3FWLA 3IXHA 3C4PA 1W8YA 1ES4A 3PBNA 2HPBA 4GDNA 1K56A 4KZ4A 1GHMA 5EOOA 3B3XA 4U3TA 3IF5A 3C7UA 5EVIB 1N4OA 4OKPA 5CERA 4Y0UA 4C75A 2J9PA 4WELA 3VP4A 3FZCA 4D2OA 4Y0TA 3IT9A 1K57A 1WE4A 1LI0A 2XQZA 3VP2A 4O7DA 5A93A 2ZC3B 5M19A 1JWPA 5CGXA 3N6IA 5TR7A 4IBXA 1NXYA 1PI4A 2Y2QA 1XXMA 4EBPA 2EX6A 1LL9A 2V1ZA 3VOZA 5AQ9A 3PAEA 5JYPA 1O07A 5GLCA 3BM6A 3RXXA 3V50A 4DF6A 3VOYA 4C3QA 4R0QA 3WS1A 2C6WB 3A3IA 3NDEA 4KQRA 3HUNA 1FR1A 1IYOA 3TSGA 1K57C 3FYZA 5KMWA 1EI5A 2HDSA 2OLUA 3HBRA 1KVLA 1SKFA 3RXWA 4GDBA 4S2NA 3A3DA 4KZ6A 5AQAA 5FA7A 3PBSA 4PMAA 2X02A 2WGWA 3M2JA 2XFTA 3M6HA 4OQGA 3ZCZA 4DE3A 4P6BA 3S22A 2XH9A 2Y2MA 2P74A 4E6XA 1G68A 3PBTA 5M1AA 5GLAA 2HDRA 1MY8A 1YMSA 5CGWA 3OPLA 3IF6C 5F1FA 4X68A 3BFEA 2DRWA 5CHUA 1SDNA 1ONHA 3WS5A 4IEDA 1IYPA 3G2YA 2G2UA 2OSUA 5CEDA 3LEZA 3MKFA 5FQIA 4S2NC 3G4PA 1W8QA 2XD1A 4LV3A 3VMAA 5GHXA 3SH7A 4B88A 3UO9A 1K4EA 3Q81A 1K56D 4ZAMA 2HP5A 1FR6A 4F94A 5J8XA 5CHMA 1HTZA 1W79A 4OH0A 4BL2A 3QNBA 4JPMA 3N8SA 1NYMA 2ZQ9A 2IWCA 2QPNA 2PU2A 1YT4A 4ZJ2A 3MKEA 3NCKA 4N9KA 1KDWA 4RA7A 4WZ5A 5HAIA 1W7FA 3N7WA 3DTMA 4WZ4A 4UHUA 3UN7A 4GOGA 4KG6A 1K6SA 1CK3A 5EVLA 4BLMA 2P9VA 1DJAA 4C6YA 3E2KA 3AGDA 4S2KA 2HP9A 1IEMA 3HL9A 4FD8A 5CGSA 4OP5A 4R4SA 3MZDA 3NDGA 3OPPA 5AQBA 3GTCA 3WRZA 4IBRA 3SH9A 4E3JA 5DF7A 1YLPA 2FFFB 2Y2LA 2ZJ9A 4IVKA 4N9LA 4NETA 4UAAA 1LL5A 4WZ5C 5CTMA 4XUZA 3VP0A 5FDHA 5E2HA 4K0XA 3GMWA 4OQIA 4R1GA 2H0TA 4Q8IA 3G32A 4S2MA 1CEGA 5KZHA 1K6RA 3HLDA 2ZQ8A 3MFDA 1QMFA 4QD4A 2H10A 4RX3A 4RVAA 3GVBA 1FQGA 2XEPA 5CECA 1GHPA 1KGGA 3NY4A 3G30A 4JXSA 3GSGA 3BFFA 1DJCA 4ZDXA 5G18A 1NRFA 3Q7VA 4KZ9A 4UA9A 3CJMA 3P98A 4S2IA 1HZOA 4MLLA 3SS4A 1WYCA 4ZBEA 3BRMA 4X69A 1OMEA 4UA7A 2Y2HA 3UNWA 2G2WA 3ZNTA 4EV4A 1Q2PA 3ZVTA 4U0TA 4FCFA 3LCEA 1L0DA 5FSRA 4MEZA 1BZAA 4BL3A 5EE8A 5CHJA 2XGNA 4KG2A 3I7JA 1I2WA 3BLMA 4L0LA 3OC2A 1ZG6A 4CJNA 1FSYA 1DJBA 4N1HA 3OPRA 1YLTA 1MXOA 1J9MA 1JVJA 2WGWB 4OLDA 4S2LA 1BLPA 3MZFA 2HDUA 1CI9A 1XKZA 3MXRA 4JBFA 1PWCA 3ZDJA 3ZFZA 5HARA 2H0YA 4B4XA 4LCMA 1GA0A 2BG1A 2Y2NA 3UY6A 4P85A 1S6RA 1NY0A 2V2FF 1BLCA 4HESA 4KZ8A 3S1YA 4E3IA 4UA6A 1BT5A 5GHYA 4X6TA 2ZC6B 2DNSA 3GRJA 3HLCA 2I72A 4BJPA 4R4RA 4PM6A 5KSCA 5HX9A 4FSFA 3NI9A 1IKGA 1HVBA 5HFOA 4BQMA 3N8LA 2EFXA 5TGFA 3O87A 1PWDA 1YM1A 2Y2KA 4R3JA 1MWUA 4YINA 1NJ4A 4OP8A 4DXCA 5HL1A 2FFYA 5DVAA 5I94A 3BECA 3DW0A 1FCNA 5GLDA 3N4IA 2WK0A 4WM9A 5FI6A 5CEBA 2Z2LB 1XA1A 4MNRA 2P9VB 5DTTA 2A49A 4OONA 3HUOA 1XX2A 4ZJ3A 2XFSA 4LENA 2X01A 2VGJA 1L0EA 4H8RA 4QY5A 4OVDA 5U47A 4JF4A 4M3KA 5FI2A 3WS4A 3M2KA 4WEKA 5KSHA 2X71A 3M6BA 3D4FA 4WMCA 4E3OA 2OV5A 2JE5A 1CI8A 1L0GA 3V5MA 1NZOA 3UE0A 1K4FA 1LHYA 2J9OA 4OOYA 4OQHA 1BUEA 4GKUA 3IXBA 5GLBA 3VFFA 5HAQA 1I2SA 2WAFA 1JTGA 4HBUA 3G31A 5D3OA 5GL9A 2Y4AA 3OCLA 4DXBA 2DCFA 1BLSA 1PW1A 1AXBA 1GCEA 4OPZA 1K54A 2XF3A 1ES3A 3ISGA 2Y91A 3IXGA 3IWQA 3Q7ZA 1IKIA 2Z2MB 4OLGA 1W5DA 3BLSA 4U0XA 4PM7A 3Q7VB 4QJGA 3UDIA 1Y54A 4KZAA 2E8IA 1SHVA 3O3VA 1H5XA 1YQSA 3DWZA 4OQ0A 2B5RA 3G2ZA 3PBOA 4PPRA 2Q9MA 4EBLA 4JF5A 1KE0A 3ZGAB 3HREA 1KDSA 4GNUA 5CRFA 2WGVA 1LLBA 1DY6A 1MKIA 1SDEA 4S2JA 5FAPA 4DE1A 1K54C 1N9BA 3WS0A 1ERQA 1MWTA 3CG5A 1RGZA 4OPYA 5EECA 2R9WA 5E2FA 1TEMA 4YFMA 4A5RA 2J7VA 4DDSA 4MBHA 4N1XA 1RGYA 2R9XA 4OOMA 3V3SA 3TG9A 3MBZA 3PBRA 4FH2A 3UDFA 1XPBA 2HP6A 3A3EA 5JYOA 3PBQA 3G34A 4BD1A 5AQ7A 4RYEA 1YLJA 5HW3A 3NBLA 3NIAA 1E3UD 5GHZA 3CZDA 1H8ZA 1JWZA 4PM5A 4WMCD 3C5AA 1ONGA 2Y2OA 2XR0A 3UE3A 2Y2JA 5L2FA 2PBYA 4KQQA 3ZG7B 1IYQA 5A90A 4DRTA 1XGJA 3JYIA 2WAEA 1BSGA 3LO7A 1G6AA 3SS5A 4HBTA 4KZ3A 4GN2A 5DF9A 4EUZA 3E2LA 4EBNA 5DF8A 1RP5A 4WEJA 1K55A 3UE1A 3IHBA 5EVID 3CMZA 4JXWA 3N8RA 1Z6FA 3Q82A 2JBFA 1ES2A 3HLFA 1YMXA 3BEBA 1EWZA 2JCHA 3EQVA 4KZBA 4MBKA 4IVIA 1L2SA
chains in the Genus database with same CATH superfamily
5HD5A 1CEFA 1K25A 3SOIA 3WS2A 2JC7A 5EOEA 1NWZA 2A3UA 3SH8A 1KGFA 2O99A 5HD3A 3FKVA 4UQIM 4E3MA 2OLVA 2R78A 3BY9A 5DKLA 2M7UA 4WL9A 4QHCA 4HQAA 2EFUA 4GD6A 3ZG0A 4S2PA 2JKGA 4Y2FA 1F5MA 3VOLA 2V8CA 4JLFA 5J7EA 2ZM2A 3GDIA 2IWBA 1QMEA 2ZL1A 2EX2A 4PM9A 3LYXA 2XDMA 1XJ2A 1E3UA 4R23A 1MBLA 3S7NA 3O86A 3BFCA 2QMIA 3B47A 4OOLA 2L1MA 4DDYA 1PYYA 1D1JA 4HEFA 4LV1A 3VP1A 3UPOA 2MJ6A 2H5SA 3OZHA 4MDZA 2AVXA 3HUMA 3UPNA 5LBRA 4ZJ1A 1BLHA 5E2EA 3MZEA 3F1NB 2OAQ1 1TD5A 2ZC5B 2ZM0A 5DFYA 5L09A 2ZMAA 4EWFA 1OT6A 4QPRA 2WKEA 3EWKA 3E0YA 3E4OA 5EFWA 1YLWA 2VGKA 1IYSA 3WWXA 1GSVA 2EX9A 2WZXA 3VE3A 3W8KA 1PWGA 1TDGA 5FQJA 4I5SA 1RCJA 1GA9A 5HAPA 4G3WA 3TOIA 1S66L 2EX8A 4E6WA 3ZNYA 4Y0OA 1ERMA 3IS2B 3AGEA 3MSHA 1L3LA 3W4OA 3A0VA 1TDLA 4S2OA 1FILA 1PRQA 5EM0A 5FATA 2Y2PA 2EWVA 3S7QA 2QZ6A 3MFXA 4DKIA 5EPHA 4P87A 4Y3IA 5FL3A 1KE4A 3WRTA 1S0WA 4NXGA 2YKHA 4QY6A 4EQ1A 1CF0A 1FCMA 1WYBA 3MXSA 3CAXA 2WKPA 3VV4A 5EVIB 5CERA 1G5UA 1N4OA 4OKPA 2J9PA 4WELA 1ACFA 4D2OA 3P7NA 3IT9A 3VP2A 1JWPA 1X0OA 3LEQA 5TR7A 1PI4A 3LICA 5AQ9A 4XT2B 3PAEA 5J3WA 4ESPA 2INWA 3RXXA 4DF6A 2IA2A 3WS1A 3NDEA 2OLUA 3LIBA 1KVLA 1MZUA 4S2NA 4KZ6A 1T19A 3ZCZA 3M2JA 4OQGA 1VEUA 4RQ9A 3T4QA 2XH9A 2QWSA 1G68A 1YMSA 2PYPA 4NXEA 1OTAA 1IYPA 2OSUA 5CEDA 2D02A 4S2NC 4LV3A 2XD1A 3VMAA 5GHXA 3IX3A 1K56D 3MQ0A 5J8XA 4LRYC 3CI6A 3N8SA 3QP6A 3KYEA 3NCKA 5FEFA 3KYZA 1KDWA 3ZYTA 3NOTC 4UHUA 5EVLA 4DN0A 2P9VA 3KSIA 4C6YA 2HP9A 4OP5A 4R4SA 1LSWA 3GTCA 3TW8A 4Z1WA 3SH9A 4IVKA 4N9LA 3T4LA 3VP0A 4R1GA 4OQIA 3UMDA 2ACGA 3QP5A 4EESA 5KZHA 1K6RA 2ZQ8A 2H10A 4RX3A 3GVBA 1FQGA 3UB9A 3NY4A 3ULFA 4HP9A 5G18A 4UA9A 3KYQA 3Q7VA 3CJMA 3SS4A 1WYCA 1XJ3A 1CJFA 1YAXA 2YKFA 4FCFA 1L0DA 5FSRA 4BL3A 5EE8A 4KG2A 3I7JA 3OC2A 1Z09A 4X1MA 2W27A 4NXFA 1YLTA 2WGWB 1J9MA 2K31A 1CI9A 4WF0A 3MXRA 3ZDJA 2QYBA 5HARA 2H0YA 4LCMA 1GA0A 4LFUA 2V2FF 3S1YA 3F1PB 4KUKA 1BT5A 4ETZA 4QWOA 4EXOA 2PBDP 2NUPC 4PM6A 5HX9A 4FSFA 3JPUA 1IKGA 3NI9A 4Q0JA 5TGFA 1JNUA 4FOFA 1YM1A 2HJEA 4OP8A 4DXCA 2FFYA 3BECA 2P7JA 4YNRA 3N4IA 3LIFA 4GW9A 1OPXA 2WK0A 3U4LP 5FI6A 3L9KA 2B02A 4OONA 3HUOA 2XFSA 4LENA 1L0EA 2PDRA 3K3CA 5U47A 5FI2A 4WEKA 5KSHA 2X71A 4PAUA 3M6BA 4WMCA 4HOIA 1N9LA 1CI8A 1L0GA 1DRMA 1K4FA 2J9OA 4OOYA 4I3JA 4OQHA 2GX5A 5AVFA 4GS9A 1I2SA 2PR6A 3G31A 1S67L 1V9YA 4DXBA 3Q7ZA 2VV7A 1IKIA 2VEAA 4GJ4A 4P6ZS 4KZAA 4L9FA 3O3VA 1YQSA 4ARZB 3HREA 1KDSA 3QP4A 4GNUA 1G28A 5FAPA 1MKIA 3A0RA 3EEAA 5EM1A 3UB7A 5FDSA 3WS0A 3BQ8A 3PHYA 4IHQA 3TE8A 5HSQA 2J7VA 4N1XA 3V3SA 3PBRA 1UWPX 4EEPA 3PBQA 1YLJA 1OTIA 1ZTUA 5GHZA 2JKFA 3CZDA 5C5KA 1JWZA 1STZA 1NLYA 3LIEA 4KQQA 4FTXA 5A90A 4DRTA 2WAEA 3LO7A 4HBTA 4KZ3A 5DF8A 1RP5A 5TJJA 3NULA 3IX4A 3Q82A 1ES2A 3LI8A 3GECA 2JCHA 1H0MA 4IVIA 2VZWA 3QHYA 4KZ5A 1FSWA 1XGIA 4K91A 4ZRRA 3LR5A 1S1ZA 3QNCA 5A92A 3CPTB 4EUVA 3EOIA 4EQIA 1C3BA 3H9WA 2V1AA 2W1TA 5FI7A 4BBUA 3W4QA 1JTDA 1WA9A 2JKTI 3TJZC 3VSLA 5IS1A 4E3NA 2G7UA 2ZC4B 1ODVA 4P0MA 2WADA 1PFLA 3V3RA 1VETB 1F98A 1AWIA 4XXRA 3SZTA 3D72A 4GLQA 5M18A 3IF6A 4WBGA 4NKPA 3G35A 4LLOB 5FQMA 1IELA 3IXDA 3IWOA 2W1RA 2Z6DA 1ESUA 4CPKA 5FEGA 3ZG9B 3RH8B 4PHTA 4O8GA 4ZTKA 2WUQA 1NZUA 1XP4A 3IHAA 1MWRA 3ITBA 2C5WB 4P6ZM 1PZPA 3U2AA 1N9NA 3QP2A 3RJUA 2VA0A 3O5YA 3W4PA 4BD0A 4X56A 3P09A 4MCWA 1BTLA 2WZZA 5F83A 3Q07A 3GQZA 2GDNA 1EROA 4F3LA 5FQQA 2DMWA 4JKTA 3BFDA 4L9GA 1NYYA 2WYXA 3ZHHA 2HDQA 3QP8A 2HGVA 3MF0A 2ZM8A 5EV0A 1NRJA 3R4KA 3ITAA 1KVMA 3CWFA 3GV9A 4H6JA 3FPWA 3A3JA 1XA7A 4R3BA 5L10A 3BFGA 4Y7PA 3LGOA 3UDXA 1G6OA 1ES5A 2WKQA 3K3DA 4JXVA 2ZL1B 1T18A 2EXAA 3PTEA 2PU4A 5HWWA 4JF6A 3NC8A 3PAGA 1D06A 4PKYA 2JKRI 2WKIA 4JXGA 4Z9QA 1KE3A 3FWLA 3PYPA 3IF5A 4C75A 3VP4A 4Y0TA 1S1YA 2XQZA 5A93A 4EBPA 3HJIA 4IJGA 1F9IA 1O07A 5DJUA 5HDSA 3HCYA 4C3QA 2C6WB 1FR1A 1IYOA 3FYZA 2HDSA 2P08A 4GDBA 4PMAA 3M6HA 4P6BA 3S22A 3A0SA 3P01A 5L07A 5M1AA 3PBTA 1F2KA 3OPLA 5F1FA 5K5BA 4X68A 1XFNA 5CHUA 1SDNA 1ONHA 3OLOA 4O01A 1W8QA 2UV0E 1K4EA 3Q81A 4ZAMA 3F1OA 1MKMA 3BJNA 1S4SA 4BL2A 2PAVP 4JPMA 4LRZE 2IWCA 4RA7A 4I39A 4WZ5A 3S7OA 4WZ4A 4GOGA 5L8MA 1K6SA 1CK3A 3K2NA 1GSXA 3LIAA 3MZDA 5AQBA 2E8JA 4IBRA 2Y2LA 2ZJ9A 3ZQ5A 4WZ5C 2VJWA 5FDHA 3CLOA 4K0XA 3GMWA 3G32A 2PRFA 3HLDA 4QD4A 4RVAA 3LR4A 3EGDC 5CECA 1GHPA 1KGGA 3C30A 3G30A 3NOPC 2KDKA 3TRCA 4KZ9A 3P98A 4S2IA 1BYWA 1HZOA 4ZBEA 4L9EA 3UNWA 4X69A 1OMEA 2Y2HA 3EEHA 4EV4A 1Q2PA 5HDCA 3ZVTA 4U0TA 3NOUC 3LCEA 4I3IA 1I2WA 3G6OA 3BLMA 2WKRA 1ZG6A 1SKOA 1FSYA 4N1HA 3OPRA 4X1LA 1JVJA 1OJGA 4I3AA 1BLPA 3MZFA 4MN5A 1VEUB 2HV1A 4JBFA 1PWCA 3LI9A 4B4XA 4JGOA 2Y2NA 4HESA 2ZBBA 5GHYA 4X6TA 2OAP1 2ZC6B 3GRJA 3HLCA 2ZMFA 3SW1A 5KSCA 4BQMA 3CUEA 2EFXA 4R3JA 1MWUA 4YINA 3DW0A 1FIKA 3OOVA 4KUOA 5IT5A 3QP1A 2P9VB 2A49A 2L4RA 1XX2A 3LIDA 4QY5A 4E3OA 2OV5A 4I38A 4KQDA 1BUEA 3T1QB 5HAQA 2WAFA 4HBUA 4ETXA 2Y4AA 4WUJA 4OPZA 1ES3A 3IXGA 2O9AA 3DTIA 3Q7VB 4QJGA 3UDIA 2PT7A 1SHVA 4PKYG 3G2ZA 2Q9MA 4JF5A 1H8MA 3ZGAB 4Y15A 1LLBA 3LR3A 4E04A 5EECA 2VV8A 3LUQA 4OOMA 3TG9A 3MBZA 3UDFA 2HP6A 3A3EA 5JYOA 5AQ7A 4RYEA 1OT9A 5HW3A 3NIAA 3JVVA 4WMCD 1ONGA 3E98A 3UE3A 1NLZA 5L2FA 1XGJA 1BSGA 2A24A 4YOFA 3SS5A 4EETB 3FC7A 4GN2A 1IFQA 3KX0X 4JXWA 2LB5A 3N8RA 3R7WA 1YMXA 2XRNA 3BEBA 3EQVA 3IBJA 4NXBA 3UB6A 1E4DA 4GHIA 3BYDA 1CQAA 2XD5A 1TF1A 1T1CA 1PIOA 1W63M 2HZ5A 2PD8A 4ID4A 5FASA 4FH4A 1TVFA 5E2GA 1MWSA 1SCWA 4GS9B 3A3FA 4WYYA 5F1GA 3UPPA 5EUAA 4JGQA 5G4YA 2ZLYA 3MMHA 1Y4OA 3BW6A 3EQUA 4OPRA 1SZVA 4LV0A 1ZKJA 4CLCE 1LI9A 3MJQA 2ZQDA 2Y79A 3HLEA 2Q9NA 1YLYA 4B9OA 4WLAA 5DTSA 2WKHA 3VSKA 1HD8A 1PZOA 1PNEA 2BLSA 5F82A 4DE0A 3MXQA 4EEUA 1Q2QA 1L0FA 1D7EA 2ZD8A 3O88A 4BBVA 2EWWA 2RCXA 4KQOA 4RX2A 4LCLA 3IH8A 5DKKA 1XJ6A 1JWVA 5FQKA 4EW7A 3FKWA 4DJ3A 1M6KA 3T50A 2JKTM 3LY4A 2EXBA 4XUXA 2CC1A 5MC7A 2WGIA 2V20A 4K08A 3OBFA 3ZG5A 3DAVA 3ZVWA 4QU3A 3H7WA 3B42A 5EVEA 1E25A 2W1TB 4X55A 3S4XA 3NECA 2ZQCA 1GHIA 5IU1A 3Q1FA 2ZC7A 1MPLA 3IBRA 1VM1A 3IQAA 2O0YA 2XK1A 1FOFA 4M4XA 5FQ9A 4HH2A 1Y28A 4QB8A 2A2LA 3IF6B 5TBMA 5DTKA 2UWXA 2Y59A 1ZG4A 5E43A 4LV2A 4OPQA 5CXWA 3HLGA 4FUWA 3PBNA 1ES4A 2HPBA 4GDNA 5F69A 4KZ4A 5EOOA 3B3XA 4U3TA 3C7UA 4Y0UA 4B93A 1UWNX 1K57A 1LI0A 5F6AA 2ZC3B 2V1BA 5M19A 2W3EA 3N6IA 4IBXA 1NXYA 2KX6A 2Y2QA 4HIAA 2EX6A 3EGXC 3BM6A 3PXPA 3VOYA 4R0QA 3CITA 3A3IA 5HWVA 4KQRA 1VB6A 4HJ6A 5KMWA 1K57C 4HHDA 3HBRA 4F3LB 3RXWA 5FA7A 3PBSA 4DE3A 2X02A 1KOUA 2OOLA 5GLAA 2HDRA 1MY8A 3BWLA 3IF6C 2DRWA 1MC0A 4H6JB 5KIZA 1YSPA 3L7HA 3MKFA 5FQIA 3SH7A 2NUTC 3T1SA 2HP5A 1FR6A 3DTKA 4G3KA 1HTZA 3NHQA 2W3HA 4CLCA 1NYMA 2ZQ9A 2GJ3A 3LR0A 1YT4A 1W7FA 1YPRA 3N7WA 3DTMA 3UN7A 3E2KA 3AGDA 1IEMA 5CGSA 3OPPA 3C8CA 3UMEA 5DF7A 2FFFB 2K7SA 4NETA 4UAAA 5CTMA 4XUZA 2XSSA 4Q8IA 2H0TA 3E4PA 3T4JA 1CEGA 2FH5A 2K2NA 1QMFA 4YWZA 2XEPA 3NJAA 3GSGA 3BFFA 1DJCA 4ZDXA 3E4QA 1ZHHB 2B18A 2VK3A 4MLLA 2J3TD 2G2WA 3FPVA 4MEZA 3H82A 3T1XA 4IUHA 4CJNA 1DJBA 4S2LA 4OLDA 2HDUA 1XKZA 3ZFZA 3ICYA 4P85A 1BLCA 4KZ8A 2DNSA 4BJPA 1DP8A 4Q0HA 5HFOA 1HVBA 4HY8A 3F1OB 3N8LA 3BY8A 1NJ4A 5HL1A 1FCNA 3JVUA 1XFQA 5GLDA 4DJ2A 4WM9A 1OTDA 4MNRA 2X01A 2VGJA 1EW0A 2VKSA 4M3KA 2Z6CA 2OWJA 5DFXA 2JE5A 5J4EA 2OWHA 1LHYA 5F5YA 2W3DA 2Y8HA 2VX8A 5GLBA 3VFFA 1A0KA 5GL9A 4R3AA 4O0PA 3OCLA 2DCFA 5HDDA 3IWQA 3ISGA 1K54A 2I9VA 2XF3A 2Z2MB 4Y5FA 3BLSA 2JN7A 1H3QA 4BBTA 4GCZA 2J3TC 1H5XA 4OQ0A 1OTEA 5CRFA 1SDEA 4DE1A 1K54C 1SKOB 1MWTA 5HPFA 2R9WA 5E2FA 5HL6A 1TEMA 1VHMA 4MBHA 2R9XA 3D9YA 4FH2A 1XPBA 3G34A 4BD1A 1P0ZA 3NBLA 2QHKA 5G4ZA 1H8ZA 4PM5A 2HF6A 2XR0A 2ZMVA 3JYIA 2VLGA 3MQQA 3F1NA 4EBNA 4HJ3A 1LT0A 3VE4A 2O9CA 1K55A 3IHBA 5EVID 2PR5A 1Z6FA 2JBFA 3DTEA 2W0NA 4HP4A 1L2SA 4E3KA 3OPHA 1ZC2A 3GR2A 3VP3A 4PM8A 5F68A 1K55C 3RTYA 2ZOIA 1ALQA 3CHWP 5DJTA 1BULA 4Y13A 4JGRA 3V39A 3IS2A 4GZBA 4KZ7A 2LB9A 2XA7S 2BASA 3IWIA 3KSFA 3CUEC 1U60A 1HLUP 3DWKA 2Y2IA 3T4KA 4JGPA 2ZQ7A 4HI4A 3IH9A 1I5QA 1H8YA 3C7VA 2QKPA 1YLZA 1GSWA 2JHEA 3PR6A 4E3LA 5EVIA 2XLNA 3OCNA 5FAQA 3KSHA 2V9AA 4BENA 5A91A 4AFIA 2VGLS 1TS6A 2J8YA 2A24B 3HVFA 4Y17A 3LY3A 4NEED 4MBFA 5CTNA 4K0WA 2FZ0A 4XT2A 1P9RA 2Q0OA 2Y55A 2CMNA 4B4ZA 3R7WB 5EVIC 5I5LA 2RL3A 4HJ4A 3C4OA 3KSGA 1PI5A 4GHIB 4N92A 1O7EA 4GD8A 3SS3A 3HLWA 4D60A 2GNXA 1ESIA 2EA9A 1KGEA 4NK3A 2Y2GA 3C38A 4KENB 5HPIA 3FV7A 1TS8A 3UE6A 1M40A 1T1BA 4DE2A 1PW8A 1FCOA 3AGFA 3VFHA 2ZQAA 2IWDA 4ME4A 3HLBA 4GB7A 4G3VA 4Q0IA 1T1AA 4X53A 5BOHA 2W3FA 2H28A 5FAOA 2HJ9C 1VQQA 1K38A 4KG5A 5TFQA 5A8BA 2V0WA 5IHVA 4BWIA 3ZG8B 3IXHA 2O9BA 3C4PA 1W8YA 2J80A 1K56A 2PHYA 1GHMA 1OJ5A 3FZCA 2BTFP 3FG8A 1WE4A 4O7DA 2XA7M 5CGXA 3S7PA 1LL8A 1S4RA 1XXMA 1LL9A 2V1ZA 3VOZA 1W63Q 4CQHA 5JYPA 1TS0A 5GLCA 3V50A 1DP9A 3HUNA 3TSGA 1EI5A 1SKFA 3A3DA 5AQAA 4BMWA 2WGWA 2XFTA 4MN7A 3T4OA 2ZOHA 2Y2MA 2PYRA 2P74A 4E6XA 5CGWA 3BFEA 3F1PA 4MN6A 3WS5A 4IEDA 3G2YA 2G2UA 3H7WB 3LEZA 2VGLM 4DMZA 3G4PA 4B88A 3UO9A 4F94A 5CHMA 1W79A 4OH0A 3QNBA 4IUKA 2B95A 2J3WA 2QPNA 2PU2A 4ZJ2A 3MKEA 4N9KA 4UEYA 1LSVA 3LFVA 5HAIA 2VV6A 2PD7A 4KG6A 4BLMA 1DJAA 3T4TA 4S2KA 3HL9A 4FD8A 5TBMB 3NDGA 3WRZA 4E3JA 1XJ4A 3UB5P 1YLPA 2XROA 1LL5A 3BQAA 3V67A 2QJ5A 3RFBA 3KO6A 3UB8A 5E2HA 4S2MA 1DP6A 3T4SA 3MFDA 4EU0A 2KOIA 4JXSA 1NRFA 4MMNA 4LRXC 3BRMA 4UA7A 3ZNTA 3D3OA 1BZAA 4ARZA 2W3GA 1N9OA 5CHJA 4CLCD 2XGNA 4L0LA 2M7VA 5HZHA 3HJKA 5AJGA 1MXOA 3IX8A 1YKDA 4LGWA 2V8FA 2BG1A 3UY6A 4II7A 1S6RA 1NY0A 4E3IA 4UA6A 4WN5A 4UQIS 2I72A 2QJ7A 4R4RA 3W2ZA 1V9ZA 3O87A 1PWDA 2Y2KA 2GZAA 4CLCB 5DVAA 5I94A 1YSQA 4EERA 2P04A 4R38A 1OTBA 5CEBA 2Z2LB 1XA1A 5DTTA 4HH3A 4HNBA 4ZJ3A 4H8RA 1J3WA 1IOUA 4OVDA 5HWTA 4JF4A 4LPZA 3WS4A 3M2KA 4R70A 3D4FA 1TS7A 3B33A 3CPTA 1P97A 3V5MA 1NZOA 3UE0A 3MR0A 1UGUA 4GKUA 3T12B 3IXBA 5D3OA 1JTGA 1BLSA 1PW1A 1AXBA 2JKRM 1GCEA 2D01A 2Y91A 4OLGA 1W5DA 4U0XA 4PM7A 1Y54A 1P9WA 2E8IA 1VETA 3DWZA 2V0UA 2B5RA 3PBOA 4PPRA 4EBLA 3H82B 1KE0A 3DBAA 4NG2A 3MQOA 4CLCC 2WGVA 1LSXA 1DY6A 4S2JA 1N9BA 1ERQA 3CG5A 1RGZA 4OPYA 4YFMA 4A5RA 4DDSA 1RGYA 2M1CA 3T1RA 5AVEA 1E3UD 4R6LA 3C5AA 2Y2OA 2Y2JA 2PBYA 3ZG7B 1IYQA 1G6AA 5DF9A 1K0KA 4EUZA 3E2LA 3MS6A 4WEJA 3UE1A 5CX7A 3CMZA 2KLIA 3HLFA 1EWZA 2L0WA 4KZBA 4X25A 3C2WA 4MBKA
chains in the Genus database with same CATH topology
4E3KA 1CEFA 1K25A 1E4DA 3QHYA 3OPHA 4KZ5A 1FSWA 3BYDA 1XGIA 3SOIA 4K91A 1ZC2A 3GR2A 3WS2A 3VP3A 2JC7A 5EOEA 4PM8A 2A3UA 2XD5A 3SH8A 1KGFA 3QNCA 1K55C 1PIOA 5A92A 4ID4A 5FASA 4FH4A 1TVFA 3FKVA 5E2GA 1MWSA 1ALQA 4E3MA 2OLVA 1SCWA 4EQIA 1C3BA 3A3FA 1BULA 4WYYA 4QHCA 5FI7A 3V39A 3W4QA 1JTDA 2EFUA 5F1GA 3UPPA 4GZBA 3VSLA 5EUAA 4GD6A 3ZG0A 4E3NA 4S2PA 4KZ7A 2ZC4B 4P0MA 2ZLYA 3IWIA 2WADA 4JLFA 2ZM2A 3V3RA 3EQUA 1U60A 4OPRA 2IWBA 1QMEA 2EX2A 4LV0A 4PM9A 4XXRA 3DWKA 2Y2IA 1ZKJA 2XDMA 2ZQ7A 1E3UA 5M18A 4R23A 1MBLA 1LI9A 3IF6A 4WBGA 3IH9A 1I5QA 3O86A 2ZQDA 3BFCA 1H8YA 3G35A 5FQMA 2QMIA 3HLEA 3C7VA 2Q9NA 1YLZA 4OOLA 1IELA 1YLYA 3IXDA 3IWOA 4DDYA 1ESUA 5DTSA 2WKHA 4CPKA 1PYYA 3ZG9B 3VSKA 4HEFA 4E3LA 1HD8A 4LV1A 1PZOA 5F82A 2BLSA 5EVIA 3VP1A 2XLNA 4DE0A 3UPOA 3OCNA 4ZTKA 5FAQA 2H5SA 2WUQA 1NZUA 4BENA 1XP4A 3OZHA 1Q2QA 3IHAA 1MWRA 3ITBA 3HUMA 1L0FA 5A91A 2C5WB 3UPNA 1PZPA 2J8YA 4ZJ1A 2ZD8A 3HVFA 3LY3A 3O88A 1BLHA 4MBFA 5E2EA 3MZEA 5CTNA 4K0WA 2RCXA 3RJUA 2ZC5B 3W4PA 4BD0A 2Y55A 2ZM0A 4KQOA 4RX2A 4X56A 4LCLA 3P09A 2ZMAA 4B4ZA 4EWFA 1BTLA 2WZZA 3IH8A 5EVIC 5F83A 2RL3A 3Q07A 3C4OA 2WKEA 1JWVA 5FQKA 3GQZA 2GDNA 1EROA 1YLWA 2VGKA 3FKWA 1PI5A 1IYSA 3WWXA 2EX9A 5FQQA 2WZXA 1M6KA 4JKTA 4N92A 1O7EA 3LY4A 3BFDA 4GD8A 2EXBA 4XUXA 1PWGA 3HLWA 3SS3A 3W8KA 1ESIA 1TDGA 2CC1A 5FQJA 1NYYA 2WGIA 1KGEA 2WYXA 3ZHHA 2HDQA 2V20A 1RCJA 1GA9A 4NK3A 2Y2GA 5HAPA 2ZM8A 4KENB 3FV7A 3ZG5A 3TOIA 1M40A 2EX8A 3ITAA 1KVMA 4DE2A 3GV9A 3ZVWA 4E6WA 4QU3A 1PW8A 1E25A 4X55A 3S4XA 3ZNYA 1FCOA 4Y0OA 2ZQCA 1GHIA 3AGFA 1ERMA 3Q1FA 2ZQAA 3AGEA 3VFHA 2IWDA 2ZC7A 3W4OA 3A3JA 1XA7A 1MPLA 3HLBA 4GB7A 4R3BA 1VM1A 1TDLA 3IQAA 4S2OA 3BFGA 4Y7PA 3UDXA 4X53A 1ES5A 2XK1A 5BOHA 1FOFA 5FQ9A 5FATA 5FAOA 2Y2PA 4JXVA 2QZ6A 1VQQA 4DKIA 1K38A 4KG5A 5EPHA 4QB8A 5TFQA 4P87A 2EXAA 1KE4A 3IF6B 5IHVA 1S0WA 3PTEA 3WRTA 2PU4A 5DTKA 4QY6A 2UWXA 4JF6A 2Y59A 3NC8A 3PAGA 1ZG4A 5E43A 2WKIA 4LV2A 4OPQA 4JXGA 5CXWA 3HLGA 4Z9QA 1FCMA 1KE3A 3ZG8B 1WYBA 3MXSA 3FWLA 3IXHA 3C4PA 1W8YA 1ES4A 3PBNA 2HPBA 4GDNA 1K56A 4KZ4A 1GHMA 5EOOA 3B3XA 4U3TA 3IF5A 3C7UA 5EVIB 1N4OA 4OKPA 5CERA 4Y0UA 4C75A 2J9PA 4WELA 3VP4A 3FZCA 4D2OA 4Y0TA 3IT9A 1K57A 1WE4A 1LI0A 2XQZA 3VP2A 4O7DA 5A93A 2ZC3B 5M19A 1JWPA 5CGXA 3N6IA 5TR7A 4IBXA 1NXYA 1PI4A 2Y2QA 1XXMA 4EBPA 2EX6A 1LL9A 2V1ZA 3VOZA 5AQ9A 3PAEA 5JYPA 1O07A 5GLCA 3BM6A 3RXXA 3V50A 4DF6A 3VOYA 4C3QA 4R0QA 3WS1A 2C6WB 3A3IA 3NDEA 4KQRA 3HUNA 1FR1A 1IYOA 3TSGA 1K57C 3FYZA 5KMWA 1EI5A 2HDSA 2OLUA 3HBRA 1KVLA 1SKFA 3RXWA 4GDBA 4S2NA 3A3DA 4KZ6A 5AQAA 5FA7A 3PBSA 4PMAA 2X02A 2WGWA 3M2JA 2XFTA 3M6HA 4OQGA 3ZCZA 4DE3A 4P6BA 3S22A 2XH9A 2Y2MA 2P74A 4E6XA 1G68A 3PBTA 5M1AA 5GLAA 2HDRA 1MY8A 1YMSA 5CGWA 3OPLA 3IF6C 5F1FA 4X68A 3BFEA 2DRWA 5CHUA 1SDNA 1ONHA 3WS5A 4IEDA 1IYPA 3G2YA 2G2UA 2OSUA 5CEDA 3LEZA 3MKFA 5FQIA 4S2NC 3G4PA 1W8QA 2XD1A 4LV3A 3VMAA 5GHXA 3SH7A 4B88A 3UO9A 1K4EA 3Q81A 1K56D 4ZAMA 2HP5A 1FR6A 4F94A 5J8XA 5CHMA 1HTZA 1W79A 4OH0A 4BL2A 3QNBA 4JPMA 3N8SA 1NYMA 2ZQ9A 2IWCA 2QPNA 2PU2A 1YT4A 4ZJ2A 3MKEA 3NCKA 4N9KA 1KDWA 4RA7A 4WZ5A 5HAIA 1W7FA 3N7WA 3DTMA 4WZ4A 4UHUA 3UN7A 4GOGA 4KG6A 1K6SA 1CK3A 5EVLA 4BLMA 2P9VA 1DJAA 4C6YA 3E2KA 3AGDA 4S2KA 2HP9A 1IEMA 3HL9A 4FD8A 5CGSA 4OP5A 4R4SA 3MZDA 3NDGA 3OPPA 5AQBA 3GTCA 3WRZA 4IBRA 3SH9A 4E3JA 5DF7A 1YLPA 2FFFB 2Y2LA 2ZJ9A 4IVKA 4N9LA 4NETA 4UAAA 1LL5A 4WZ5C 5CTMA 4XUZA 3VP0A 5FDHA 5E2HA 4K0XA 3GMWA 4OQIA 4R1GA 2H0TA 4Q8IA 3G32A 4S2MA 1CEGA 5KZHA 1K6RA 3HLDA 2ZQ8A 3MFDA 1QMFA 4QD4A 2H10A 4RX3A 4RVAA 3GVBA 1FQGA 2XEPA 5CECA 1GHPA 1KGGA 3NY4A 3G30A 4JXSA 3GSGA 3BFFA 1DJCA 4ZDXA 5G18A 1NRFA 3Q7VA 4KZ9A 4UA9A 3CJMA 3P98A 4S2IA 1HZOA 4MLLA 3SS4A 1WYCA 4ZBEA 3BRMA 4X69A 1OMEA 4UA7A 2Y2HA 3UNWA 2G2WA 3ZNTA 4EV4A 1Q2PA 3ZVTA 4U0TA 4FCFA 3LCEA 1L0DA 5FSRA 4MEZA 1BZAA 4BL3A 5EE8A 5CHJA 2XGNA 4KG2A 3I7JA 1I2WA 3BLMA 4L0LA 3OC2A 1ZG6A 4CJNA 1FSYA 1DJBA 4N1HA 3OPRA 1YLTA 1MXOA 1J9MA 1JVJA 2WGWB 4OLDA 4S2LA 1BLPA 3MZFA 2HDUA 1CI9A 1XKZA 3MXRA 4JBFA 1PWCA 3ZDJA 3ZFZA 5HARA 2H0YA 4B4XA 4LCMA 1GA0A 2BG1A 2Y2NA 3UY6A 4P85A 1S6RA 1NY0A 2V2FF 1BLCA 4HESA 4KZ8A 3S1YA 4E3IA 4UA6A 1BT5A 5GHYA 4X6TA 2ZC6B 2DNSA 3GRJA 3HLCA 2I72A 4BJPA 4R4RA 4PM6A 5KSCA 5HX9A 4FSFA 3NI9A 1IKGA 1HVBA 5HFOA 4BQMA 3N8LA 2EFXA 5TGFA 3O87A 1PWDA 1YM1A 2Y2KA 4R3JA 1MWUA 4YINA 1NJ4A 4OP8A 4DXCA 5HL1A 2FFYA 5DVAA 5I94A 3BECA 3DW0A 1FCNA 5GLDA 3N4IA 2WK0A 4WM9A 5FI6A 5CEBA 2Z2LB 1XA1A 4MNRA 2P9VB 5DTTA 2A49A 4OONA 3HUOA 1XX2A 4ZJ3A 2XFSA 4LENA 2X01A 2VGJA 1L0EA 4H8RA 4QY5A 4OVDA 5U47A 4JF4A 4M3KA 5FI2A 3WS4A 3M2KA 4WEKA 5KSHA 2X71A 3M6BA 3D4FA 4WMCA 4E3OA 2OV5A 2JE5A 1CI8A 1L0GA 3V5MA 1NZOA 3UE0A 1K4FA 1LHYA 2J9OA 4OOYA 4OQHA 1BUEA 4GKUA 3IXBA 5GLBA 3VFFA 5HAQA 1I2SA 2WAFA 1JTGA 4HBUA 3G31A 5D3OA 5GL9A 2Y4AA 3OCLA 4DXBA 2DCFA 1BLSA 1PW1A 1AXBA 1GCEA 4OPZA 1K54A 2XF3A 1ES3A 3ISGA 2Y91A 3IXGA 3IWQA 3Q7ZA 1IKIA 2Z2MB 4OLGA 1W5DA 3BLSA 4U0XA 4PM7A 3Q7VB 4QJGA 3UDIA 1Y54A 4KZAA 2E8IA 1SHVA 3O3VA 1H5XA 1YQSA 3DWZA 4OQ0A 2B5RA 3G2ZA 3PBOA 4PPRA 2Q9MA 4EBLA 4JF5A 1KE0A 3ZGAB 3HREA 1KDSA 4GNUA 5CRFA 2WGVA 1LLBA 1DY6A 1MKIA 1SDEA 4S2JA 5FAPA 4DE1A 1K54C 1N9BA 3WS0A 1ERQA 1MWTA 3CG5A 1RGZA 4OPYA 5EECA 2R9WA 5E2FA 1TEMA 4YFMA 4A5RA 2J7VA 4DDSA 4MBHA 4N1XA 1RGYA 2R9XA 4OOMA 3V3SA 3TG9A 3MBZA 3PBRA 4FH2A 3UDFA 1XPBA 2HP6A 3A3EA 5JYOA 3PBQA 3G34A 4BD1A 5AQ7A 4RYEA 1YLJA 5HW3A 3NBLA 3NIAA 1E3UD 5GHZA 3CZDA 1H8ZA 1JWZA 4PM5A 4WMCD 3C5AA 1ONGA 2Y2OA 2XR0A 3UE3A 2Y2JA 5L2FA 2PBYA 4KQQA 3ZG7B 1IYQA 5A90A 4DRTA 1XGJA 3JYIA 2WAEA 1BSGA 3LO7A 1G6AA 3SS5A 4HBTA 4KZ3A 4GN2A 5DF9A 4EUZA 3E2LA 4EBNA 5DF8A 1RP5A 4WEJA 1K55A 3UE1A 3IHBA 5EVID 3CMZA 4JXWA 3N8RA 1Z6FA 3Q82A 2JBFA 1ES2A 3HLFA 1YMXA 3BEBA 1EWZA 2JCHA 3EQVA 4KZBA 4MBKA 4IVIA 1L2SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E3K A;  1CEF A;  1K25 A;  1E4D A;  3QHY A;  3OPH A;  4KZ5 A;  1FSW A;  3BYD A;  1XGI A;  3SOI A;  4K91 A;  1ZC2 A;  3GR2 A;  3WS2 A;  3VP3 A;  2JC7 A;  5EOE A;  4PM8 A;  2A3U A;  2XD5 A;  3SH8 A;  1KGF A;  3QNC A;  1K55 C;  1PIO A;  5A92 A;  4ID4 A;  5FAS A;  4FH4 A;  1TVF A;  3FKV A;  5E2G A;  1MWS A;  1ALQ A;  4E3M A;  2OLV A;  1SCW A;  4EQI A;  1C3B A;  3A3F A;  1BUL A;  4WYY A;  4QHC A;  5FI7 A;  3V39 A;  3W4Q A;  1JTD A;  2EFU A;  5F1G A;  3UPP A;  4GZB A;  3VSL A;  5EUA A;  4GD6 A;  3ZG0 A;  4E3N A;  4S2P A;  4KZ7 A;  2ZC4 B;  4P0M A;  2ZLY A;  3IWI A;  2WAD A;  4JLF A;  2ZM2 A;  3V3R A;  3EQU A;  1U60 A;  4OPR A;  2IWB A;  1QME A;  2EX2 A;  4LV0 A;  4PM9 A;  4XXR A;  3DWK A;  2Y2I A;  1ZKJ A;  2XDM A;  2ZQ7 A;  1E3U A;  5M18 A;  4R23 A;  1MBL A;  1LI9 A;  3IF6 A;  4WBG A;  3IH9 A;  1I5Q A;  3O86 A;  2ZQD A;  3BFC A;  1H8Y A;  3G35 A;  5FQM A;  2QMI A;  3HLE A;  3C7V A;  2Q9N A;  1YLZ A;  4OOL A;  1IEL A;  1YLY A;  3IXD A;  3IWO A;  4DDY A;  1ESU A;  5DTS A;  2WKH A;  4CPK A;  1PYY A;  3ZG9 B;  3VSK A;  4HEF A;  4E3L A;  1HD8 A;  4LV1 A;  1PZO A;  5F82 A;  2BLS A;  5EVI A;  3VP1 A;  2XLN A;  4DE0 A;  3UPO A;  3OCN A;  4ZTK A;  5FAQ A;  2H5S A;  2WUQ A;  1NZU A;  4BEN A;  1XP4 A;  3OZH A;  1Q2Q A;  3IHA A;  1MWR A;  3ITB A;  3HUM A;  1L0F A;  5A91 A;  2C5W B;  3UPN A;  1PZP A;  2J8Y A;  4ZJ1 A;  2ZD8 A;  3HVF A;  3LY3 A;  3O88 A;  1BLH A;  4MBF A;  5E2E A;  3MZE A;  5CTN A;  4K0W A;  2RCX A;  3RJU A;  2ZC5 B;  3W4P A;  4BD0 A;  2Y55 A;  2ZM0 A;  4KQO A;  4RX2 A;  4X56 A;  4LCL A;  3P09 A;  2ZMA A;  4B4Z A;  4EWF A;  1BTL A;  2WZZ A;  3IH8 A;  5EVI C;  5F83 A;  2RL3 A;  3Q07 A;  3C4O A;  2WKE A;  1JWV A;  5FQK A;  3GQZ A;  2GDN A;  1ERO A;  1YLW A;  2VGK A;  3FKW A;  1PI5 A;  1IYS A;  3WWX A;  2EX9 A;  5FQQ A;  2WZX A;  1M6K A;  4JKT A;  4N92 A;  1O7E A;  3LY4 A;  3BFD A;  4GD8 A;  2EXB A;  4XUX A;  1PWG A;  3HLW A;  3SS3 A;  3W8K A;  1ESI A;  1TDG A;  2CC1 A;  5FQJ A;  1NYY A;  2WGI A;  1KGE A;  2WYX A;  3ZHH A;  2HDQ A;  2V20 A;  1RCJ A;  1GA9 A;  4NK3 A;  2Y2G A;  5HAP A;  2ZM8 A;  4KEN B;  3FV7 A;  3ZG5 A;  3TOI A;  1M40 A;  2EX8 A;  3ITA A;  1KVM A;  4DE2 A;  3GV9 A;  3ZVW A;  4E6W A;  4QU3 A;  1PW8 A;  1E25 A;  4X55 A;  3S4X A;  3ZNY A;  1FCO A;  4Y0O A;  2ZQC A;  1GHI A;  3AGF A;  1ERM A;  3Q1F A;  2ZQA A;  3AGE A;  3VFH A;  2IWD A;  2ZC7 A;  3W4O A;  3A3J A;  1XA7 A;  1MPL A;  3HLB A;  4GB7 A;  4R3B A;  1VM1 A;  1TDL A;  3IQA A;  4S2O A;  3BFG A;  4Y7P A;  3UDX A;  4X53 A;  1ES5 A;  2XK1 A;  5BOH A;  1FOF A;  5FQ9 A;  5FAT A;  5FAO A;  2Y2P A;  4JXV A;  2QZ6 A;  1VQQ A;  4DKI A;  1K38 A;  4KG5 A;  5EPH A;  4QB8 A;  5TFQ A;  4P87 A;  2EXA A;  1KE4 A;  3IF6 B;  5IHV A;  1S0W A;  3PTE A;  3WRT A;  2PU4 A;  5DTK A;  4QY6 A;  2UWX A;  4JF6 A;  2Y59 A;  3NC8 A;  3PAG A;  1ZG4 A;  5E43 A;  2WKI A;  4LV2 A;  4OPQ A;  4JXG A;  5CXW A;  3HLG A;  4Z9Q A;  1FCM A;  1KE3 A;  3ZG8 B;  1WYB A;  3MXS A;  3FWL A;  3IXH A;  3C4P A;  1W8Y A;  1ES4 A;  3PBN A;  2HPB A;  4GDN A;  1K56 A;  4KZ4 A;  1GHM A;  5EOO A;  3B3X A;  4U3T A;  3IF5 A;  3C7U A;  5EVI B;  1N4O A;  4OKP A;  5CER A;  4Y0U A;  4C75 A;  2J9P A;  4WEL A;  3VP4 A;  3FZC A;  4D2O A;  4Y0T A;  3IT9 A;  1K57 A;  1WE4 A;  1LI0 A;  2XQZ A;  3VP2 A;  4O7D A;  5A93 A;  2ZC3 B;  5M19 A;  1JWP A;  5CGX A;  3N6I A;  5TR7 A;  4IBX A;  1NXY A;  1PI4 A;  2Y2Q A;  1XXM A;  4EBP A;  2EX6 A;  1LL9 A;  2V1Z A;  3VOZ A;  5AQ9 A;  3PAE A;  5JYP A;  1O07 A;  5GLC A;  3BM6 A;  3RXX A;  3V50 A;  4DF6 A;  3VOY A;  4C3Q A;  4R0Q A;  3WS1 A;  2C6W B;  3A3I A;  3NDE A;  4KQR A;  3HUN A;  1FR1 A;  1IYO A;  3TSG A;  1K57 C;  3FYZ A;  5KMW A;  1EI5 A;  2HDS A;  2OLU A;  3HBR A;  1KVL A;  1SKF A;  3RXW A;  4GDB A;  4S2N A;  3A3D A;  4KZ6 A;  5AQA A;  5FA7 A;  3PBS A;  4PMA A;  2X02 A;  2WGW A;  3M2J A;  2XFT A;  3M6H A;  4OQG A;  3ZCZ A;  4DE3 A;  4P6B A;  3S22 A;  2XH9 A;  2Y2M A;  2P74 A;  4E6X A;  1G68 A;  3PBT A;  5M1A A;  5GLA A;  2HDR A;  1MY8 A;  1YMS A;  5CGW A;  3OPL A;  3IF6 C;  5F1F A;  4X68 A;  3BFE A;  2DRW A;  5CHU A;  1SDN A;  1ONH A;  3WS5 A;  4IED A;  1IYP A;  3G2Y A;  2G2U A;  2OSU A;  5CED A;  3LEZ A;  3MKF A;  5FQI A;  4S2N C;  3G4P A;  1W8Q A;  2XD1 A;  4LV3 A;  3VMA A;  5GHX A;  3SH7 A;  4B88 A;  3UO9 A;  1K4E A;  3Q81 A;  1K56 D;  4ZAM A;  2HP5 A;  1FR6 A;  4F94 A;  5J8X A;  5CHM A;  1HTZ A;  1W79 A;  4OH0 A;  4BL2 A;  3QNB A;  4JPM A;  3N8S A;  1NYM A;  2ZQ9 A;  2IWC A;  2QPN A;  2PU2 A;  1YT4 A;  4ZJ2 A;  3MKE A;  3NCK A;  4N9K A;  1KDW A;  4RA7 A;  4WZ5 A;  5HAI A;  1W7F A;  3N7W A;  3DTM A;  4WZ4 A;  4UHU A;  3UN7 A;  4GOG A;  4KG6 A;  1K6S A;  1CK3 A;  5EVL A;  4BLM A;  2P9V A;  1DJA A;  4C6Y A;  3E2K A;  3AGD A;  4S2K A;  2HP9 A;  1IEM A;  3HL9 A;  4FD8 A;  5CGS A;  4OP5 A;  4R4S A;  3MZD A;  3NDG A;  3OPP A;  5AQB A;  3GTC A;  3WRZ A;  4IBR A;  3SH9 A;  4E3J A;  5DF7 A;  1YLP A;  2FFF B;  2Y2L A;  2ZJ9 A;  4IVK A;  4N9L A;  4NET A;  4UAA A;  1LL5 A;  4WZ5 C;  5CTM A;  4XUZ A;  3VP0 A;  5FDH A;  5E2H A;  4K0X A;  3GMW A;  4OQI A;  4R1G A;  2H0T A;  4Q8I A;  3G32 A;  4S2M A;  1CEG A;  5KZH A;  1K6R A;  3HLD A;  2ZQ8 A;  3MFD A;  1QMF A;  4QD4 A;  2H10 A;  4RX3 A;  4RVA A;  3GVB A;  1FQG A;  2XEP A;  5CEC A;  1GHP A;  1KGG A;  3NY4 A;  3G30 A;  4JXS A;  3GSG A;  3BFF A;  1DJC A;  4ZDX A;  5G18 A;  1NRF A;  3Q7V A;  4KZ9 A;  4UA9 A;  3CJM A;  3P98 A;  4S2I A;  1HZO A;  4MLL A;  3SS4 A;  1WYC A;  4ZBE A;  3BRM A;  4X69 A;  1OME A;  4UA7 A;  2Y2H A;  3UNW A;  2G2W A;  3ZNT A;  4EV4 A;  1Q2P A;  3ZVT A;  4U0T A;  4FCF A;  3LCE A;  1L0D A;  5FSR A;  4MEZ A;  1BZA A;  4BL3 A;  5EE8 A;  5CHJ A;  2XGN A;  4KG2 A;  3I7J A;  1I2W A;  3BLM A;  4L0L A;  3OC2 A;  1ZG6 A;  4CJN A;  1FSY A;  1DJB A;  4N1H A;  3OPR A;  1YLT A;  1MXO A;  1J9M A;  1JVJ A;  2WGW B;  4OLD A;  4S2L A;  1BLP A;  3MZF A;  2HDU A;  1CI9 A;  1XKZ A;  3MXR A;  4JBF A;  1PWC A;  3ZDJ A;  3ZFZ A;  5HAR A;  2H0Y A;  4B4X A;  4LCM A;  1GA0 A;  2BG1 A;  2Y2N A;  3UY6 A;  4P85 A;  1S6R A;  1NY0 A;  2V2F F;  1BLC A;  4HES A;  4KZ8 A;  3S1Y A;  4E3I A;  4UA6 A;  1BT5 A;  5GHY A;  4X6T A;  2ZC6 B;  2DNS A;  3GRJ A;  3HLC A;  2I72 A;  4BJP A;  4R4R A;  4PM6 A;  5KSC A;  5HX9 A;  4FSF A;  3NI9 A;  1IKG A;  1HVB A;  5HFO A;  4BQM A;  3N8L A;  2EFX A;  5TGF A;  3O87 A;  1PWD A;  1YM1 A;  2Y2K A;  4R3J A;  1MWU A;  4YIN A;  1NJ4 A;  4OP8 A;  4DXC A;  5HL1 A;  2FFY A;  5DVA A;  5I94 A;  3BEC A;  3DW0 A;  1FCN A;  5GLD A;  3N4I A;  2WK0 A;  4WM9 A;  5FI6 A;  5CEB A;  2Z2L B;  1XA1 A;  4MNR A;  2P9V B;  5DTT A;  2A49 A;  4OON A;  3HUO A;  1XX2 A;  4ZJ3 A;  2XFS A;  4LEN A;  2X01 A;  2VGJ A;  1L0E A;  4H8R A;  4QY5 A;  4OVD A;  5U47 A;  4JF4 A;  4M3K A;  5FI2 A;  3WS4 A;  3M2K A;  4WEK A;  5KSH A;  2X71 A;  3M6B A;  3D4F A;  4WMC A;  4E3O A;  2OV5 A;  2JE5 A;  1CI8 A;  1L0G A;  3V5M A;  1NZO A;  3UE0 A;  1K4F A;  1LHY A;  2J9O A;  4OOY A;  4OQH A;  1BUE A;  4GKU A;  3IXB A;  5GLB A;  3VFF A;  5HAQ A;  1I2S A;  2WAF A;  1JTG A;  4HBU A;  3G31 A;  5D3O A;  5GL9 A;  2Y4A A;  3OCL A;  4DXB A;  2DCF A;  1BLS A;  1PW1 A;  1AXB A;  1GCE A;  4OPZ A;  1K54 A;  2XF3 A;  1ES3 A;  3ISG A;  2Y91 A;  3IXG A;  3IWQ A;  3Q7Z A;  1IKI A;  2Z2M B;  4OLG A;  1W5D A;  3BLS A;  4U0X A;  4PM7 A;  3Q7V B;  4QJG A;  3UDI A;  1Y54 A;  4KZA A;  2E8I A;  1SHV A;  3O3V A;  1H5X A;  1YQS A;  3DWZ A;  4OQ0 A;  2B5R A;  3G2Z A;  3PBO A;  4PPR A;  2Q9M A;  4EBL A;  4JF5 A;  1KE0 A;  3ZGA B;  3HRE A;  1KDS A;  4GNU A;  5CRF A;  2WGV A;  1LLB A;  1DY6 A;  1MKI A;  1SDE A;  4S2J A;  5FAP A;  4DE1 A;  1K54 C;  1N9B A;  3WS0 A;  1ERQ A;  1MWT A;  3CG5 A;  1RGZ A;  4OPY A;  5EEC A;  2R9W A;  5E2F A;  1TEM A;  4YFM A;  4A5R A;  2J7V A;  4DDS A;  4MBH A;  4N1X A;  1RGY A;  2R9X A;  4OOM A;  3V3S A;  3TG9 A;  3MBZ A;  3PBR A;  4FH2 A;  3UDF A;  1XPB A;  2HP6 A;  3A3E A;  5JYO A;  3PBQ A;  3G34 A;  4BD1 A;  5AQ7 A;  4RYE A;  1YLJ A;  5HW3 A;  3NBL A;  3NIA A;  1E3U D;  5GHZ A;  3CZD A;  1H8Z A;  1JWZ A;  4PM5 A;  4WMC D;  3C5A A;  1ONG A;  2Y2O A;  2XR0 A;  3UE3 A;  2Y2J A;  5L2F A;  2PBY A;  4KQQ A;  3ZG7 B;  1IYQ A;  5A90 A;  4DRT A;  1XGJ A;  3JYI A;  2WAE A;  1BSG A;  3LO7 A;  1G6A A;  3SS5 A;  4HBT A;  4KZ3 A;  4GN2 A;  5DF9 A;  4EUZ A;  3E2L A;  4EBN A;  5DF8 A;  1RP5 A;  4WEJ A;  1K55 A;  3UE1 A;  3IHB A;  5EVI D;  3CMZ A;  4JXW A;  3N8R A;  1Z6F A;  3Q82 A;  2JBF A;  1ES2 A;  3HLF A;  1YMX A;  3BEB A;  1EWZ A;  2JCH A;  3EQV A;  4KZB A;  4MBK A;  4IVI A;  1L2S A; 
#chains in the Genus database with same CATH topology
 5HD5 A;  1CEF A;  1K25 A;  3SOI A;  3WS2 A;  2JC7 A;  5EOE A;  1NWZ A;  2A3U A;  3SH8 A;  1KGF A;  2O99 A;  5HD3 A;  3FKV A;  4UQI M;  4E3M A;  2OLV A;  2R78 A;  3BY9 A;  5DKL A;  2M7U A;  4WL9 A;  4QHC A;  4HQA A;  2EFU A;  4GD6 A;  3ZG0 A;  4S2P A;  2JKG A;  4Y2F A;  1F5M A;  3VOL A;  2V8C A;  4JLF A;  5J7E A;  2ZM2 A;  3GDI A;  2IWB A;  1QME A;  2ZL1 A;  2EX2 A;  4PM9 A;  3LYX A;  2XDM A;  1XJ2 A;  1E3U A;  4R23 A;  1MBL A;  3S7N A;  3O86 A;  3BFC A;  2QMI A;  3B47 A;  4OOL A;  2L1M A;  4DDY A;  1PYY A;  1D1J A;  4HEF A;  4LV1 A;  3VP1 A;  3UPO A;  2MJ6 A;  2H5S A;  3OZH A;  4MDZ A;  2AVX A;  3HUM A;  3UPN A;  5LBR A;  4ZJ1 A;  1BLH A;  5E2E A;  3MZE A;  3F1N B;  2OAQ 1;  1TD5 A;  2ZC5 B;  2ZM0 A;  5DFY A;  5L09 A;  2ZMA A;  4EWF A;  1OT6 A;  4QPR A;  2WKE A;  3EWK A;  3E0Y A;  3E4O A;  5EFW A;  1YLW A;  2VGK A;  1IYS A;  3WWX A;  1GSV A;  2EX9 A;  2WZX A;  3VE3 A;  3W8K A;  1PWG A;  1TDG A;  5FQJ A;  4I5S A;  1RCJ A;  1GA9 A;  5HAP A;  4G3W A;  3TOI A;  1S66 L;  2EX8 A;  4E6W A;  3ZNY A;  4Y0O A;  1ERM A;  3IS2 B;  3AGE A;  3MSH A;  1L3L A;  3W4O A;  3A0V A;  1TDL A;  4S2O A;  1FIL A;  1PRQ A;  5EM0 A;  5FAT A;  2Y2P A;  2EWV A;  3S7Q A;  2QZ6 A;  3MFX A;  4DKI A;  5EPH A;  4P87 A;  4Y3I A;  5FL3 A;  1KE4 A;  3WRT A;  1S0W A;  4NXG A;  2YKH A;  4QY6 A;  4EQ1 A;  1CF0 A;  1FCM A;  1WYB A;  3MXS A;  3CAX A;  2WKP A;  3VV4 A;  5EVI B;  5CER A;  1G5U A;  1N4O A;  4OKP A;  2J9P A;  4WEL A;  1ACF A;  4D2O A;  3P7N A;  3IT9 A;  3VP2 A;  1JWP A;  1X0O A;  3LEQ A;  5TR7 A;  1PI4 A;  3LIC A;  5AQ9 A;  4XT2 B;  3PAE A;  5J3W A;  4ESP A;  2INW A;  3RXX A;  4DF6 A;  2IA2 A;  3WS1 A;  3NDE A;  2OLU A;  3LIB A;  1KVL A;  1MZU A;  4S2N A;  4KZ6 A;  1T19 A;  3ZCZ A;  3M2J A;  4OQG A;  1VEU A;  4RQ9 A;  3T4Q A;  2XH9 A;  2QWS A;  1G68 A;  1YMS A;  2PYP A;  4NXE A;  1OTA A;  1IYP A;  2OSU A;  5CED A;  2D02 A;  4S2N C;  4LV3 A;  2XD1 A;  3VMA A;  5GHX A;  3IX3 A;  1K56 D;  3MQ0 A;  5J8X A;  4LRY C;  3CI6 A;  3N8S A;  3QP6 A;  3KYE A;  3NCK A;  5FEF A;  3KYZ A;  1KDW A;  3ZYT A;  3NOT C;  4UHU A;  5EVL A;  4DN0 A;  2P9V A;  3KSI A;  4C6Y A;  2HP9 A;  4OP5 A;  4R4S A;  1LSW A;  3GTC A;  3TW8 A;  4Z1W A;  3SH9 A;  4IVK A;  4N9L A;  3T4L A;  3VP0 A;  4R1G A;  4OQI A;  3UMD A;  2ACG A;  3QP5 A;  4EES A;  5KZH A;  1K6R A;  2ZQ8 A;  2H10 A;  4RX3 A;  3GVB A;  1FQG A;  3UB9 A;  3NY4 A;  3ULF A;  4HP9 A;  5G18 A;  4UA9 A;  3KYQ A;  3Q7V A;  3CJM A;  3SS4 A;  1WYC A;  1XJ3 A;  1CJF A;  1YAX A;  2YKF A;  4FCF A;  1L0D A;  5FSR A;  4BL3 A;  5EE8 A;  4KG2 A;  3I7J A;  3OC2 A;  1Z09 A;  4X1M A;  2W27 A;  4NXF A;  1YLT A;  2WGW B;  1J9M A;  2K31 A;  1CI9 A;  4WF0 A;  3MXR A;  3ZDJ A;  2QYB A;  5HAR A;  2H0Y A;  4LCM A;  1GA0 A;  4LFU A;  2V2F F;  3S1Y A;  3F1P B;  4KUK A;  1BT5 A;  4ETZ A;  4QWO A;  4EXO A;  2PBD P;  2NUP C;  4PM6 A;  5HX9 A;  4FSF A;  3JPU A;  1IKG A;  3NI9 A;  4Q0J A;  5TGF A;  1JNU A;  4FOF A;  1YM1 A;  2HJE A;  4OP8 A;  4DXC A;  2FFY A;  3BEC A;  2P7J A;  4YNR A;  3N4I A;  3LIF A;  4GW9 A;  1OPX A;  2WK0 A;  3U4L P;  5FI6 A;  3L9K A;  2B02 A;  4OON A;  3HUO A;  2XFS A;  4LEN A;  1L0E A;  2PDR A;  3K3C A;  5U47 A;  5FI2 A;  4WEK A;  5KSH A;  2X71 A;  4PAU A;  3M6B A;  4WMC A;  4HOI A;  1N9L A;  1CI8 A;  1L0G A;  1DRM A;  1K4F A;  2J9O A;  4OOY A;  4I3J A;  4OQH A;  2GX5 A;  5AVF A;  4GS9 A;  1I2S A;  2PR6 A;  3G31 A;  1S67 L;  1V9Y A;  4DXB A;  3Q7Z A;  2VV7 A;  1IKI A;  2VEA A;  4GJ4 A;  4P6Z S;  4KZA A;  4L9F A;  3O3V A;  1YQS A;  4ARZ B;  3HRE A;  1KDS A;  3QP4 A;  4GNU A;  1G28 A;  5FAP A;  1MKI A;  3A0R A;  3EEA A;  5EM1 A;  3UB7 A;  5FDS A;  3WS0 A;  3BQ8 A;  3PHY A;  4IHQ A;  3TE8 A;  5HSQ A;  2J7V A;  4N1X A;  3V3S A;  3PBR A;  1UWP X;  4EEP A;  3PBQ A;  1YLJ A;  1OTI A;  1ZTU A;  5GHZ A;  2JKF A;  3CZD A;  5C5K A;  1JWZ A;  1STZ A;  1NLY A;  3LIE A;  4KQQ A;  4FTX A;  5A90 A;  4DRT A;  2WAE A;  3LO7 A;  4HBT A;  4KZ3 A;  5DF8 A;  1RP5 A;  5TJJ A;  3NUL A;  3IX4 A;  3Q82 A;  1ES2 A;  3LI8 A;  3GEC A;  2JCH A;  1H0M A;  4IVI A;  2VZW A;  3QHY A;  4KZ5 A;  1FSW A;  1XGI A;  4K91 A;  4ZRR A;  3LR5 A;  1S1Z A;  3QNC A;  5A92 A;  3CPT B;  4EUV A;  3EOI A;  4EQI A;  1C3B A;  3H9W A;  2V1A A;  2W1T A;  5FI7 A;  4BBU A;  3W4Q A;  1JTD A;  1WA9 A;  2JKT I;  3TJZ C;  3VSL A;  5IS1 A;  4E3N A;  2G7U A;  2ZC4 B;  1ODV A;  4P0M A;  2WAD A;  1PFL A;  3V3R A;  1VET B;  1F98 A;  1AWI A;  4XXR A;  3SZT A;  3D72 A;  4GLQ A;  5M18 A;  3IF6 A;  4WBG A;  4NKP A;  3G35 A;  4LLO B;  5FQM A;  1IEL A;  3IXD A;  3IWO A;  2W1R A;  2Z6D A;  1ESU A;  4CPK A;  5FEG A;  3ZG9 B;  3RH8 B;  4PHT A;  4O8G A;  4ZTK A;  2WUQ A;  1NZU A;  1XP4 A;  3IHA A;  1MWR A;  3ITB A;  2C5W B;  4P6Z M;  1PZP A;  3U2A A;  1N9N A;  3QP2 A;  3RJU A;  2VA0 A;  3O5Y A;  3W4P A;  4BD0 A;  4X56 A;  3P09 A;  4MCW A;  1BTL A;  2WZZ A;  5F83 A;  3Q07 A;  3GQZ A;  2GDN A;  1ERO A;  4F3L A;  5FQQ A;  2DMW A;  4JKT A;  3BFD A;  4L9G A;  1NYY A;  2WYX A;  3ZHH A;  2HDQ A;  3QP8 A;  2HGV A;  3MF0 A;  2ZM8 A;  5EV0 A;  1NRJ A;  3R4K A;  3ITA A;  1KVM A;  3CWF A;  3GV9 A;  4H6J A;  3FPW A;  3A3J A;  1XA7 A;  4R3B A;  5L10 A;  3BFG A;  4Y7P A;  3LGO A;  3UDX A;  1G6O A;  1ES5 A;  2WKQ A;  3K3D A;  4JXV A;  2ZL1 B;  1T18 A;  2EXA A;  3PTE A;  2PU4 A;  5HWW A;  4JF6 A;  3NC8 A;  3PAG A;  1D06 A;  4PKY A;  2JKR I;  2WKI A;  4JXG A;  4Z9Q A;  1KE3 A;  3FWL A;  3PYP A;  3IF5 A;  4C75 A;  3VP4 A;  4Y0T A;  1S1Y A;  2XQZ A;  5A93 A;  4EBP A;  3HJI A;  4IJG A;  1F9I A;  1O07 A;  5DJU A;  5HDS A;  3HCY A;  4C3Q A;  2C6W B;  1FR1 A;  1IYO A;  3FYZ A;  2HDS A;  2P08 A;  4GDB A;  4PMA A;  3M6H A;  4P6B A;  3S22 A;  3A0S A;  3P01 A;  5L07 A;  5M1A A;  3PBT A;  1F2K A;  3OPL A;  5F1F A;  5K5B A;  4X68 A;  1XFN A;  5CHU A;  1SDN A;  1ONH A;  3OLO A;  4O01 A;  1W8Q A;  2UV0 E;  1K4E A;  3Q81 A;  4ZAM A;  3F1O A;  1MKM A;  3BJN A;  1S4S A;  4BL2 A;  2PAV P;  4JPM A;  4LRZ E;  2IWC A;  4RA7 A;  4I39 A;  4WZ5 A;  3S7O A;  4WZ4 A;  4GOG A;  5L8M A;  1K6S A;  1CK3 A;  3K2N A;  1GSX A;  3LIA A;  3MZD A;  5AQB A;  2E8J A;  4IBR A;  2Y2L A;  2ZJ9 A;  3ZQ5 A;  4WZ5 C;  2VJW A;  5FDH A;  3CLO A;  4K0X A;  3GMW A;  3G32 A;  2PRF A;  3HLD A;  4QD4 A;  4RVA A;  3LR4 A;  3EGD C;  5CEC A;  1GHP A;  1KGG A;  3C30 A;  3G30 A;  3NOP C;  2KDK A;  3TRC A;  4KZ9 A;  3P98 A;  4S2I A;  1BYW A;  1HZO A;  4ZBE A;  4L9E A;  3UNW A;  4X69 A;  1OME A;  2Y2H A;  3EEH A;  4EV4 A;  1Q2P A;  5HDC A;  3ZVT A;  4U0T A;  3NOU C;  3LCE A;  4I3I A;  1I2W A;  3G6O A;  3BLM A;  2WKR A;  1ZG6 A;  1SKO A;  1FSY A;  4N1H A;  3OPR A;  4X1L A;  1JVJ A;  1OJG A;  4I3A A;  1BLP A;  3MZF A;  4MN5 A;  1VEU B;  2HV1 A;  4JBF A;  1PWC A;  3LI9 A;  4B4X A;  4JGO A;  2Y2N A;  4HES A;  2ZBB A;  5GHY A;  4X6T A;  2OAP 1;  2ZC6 B;  3GRJ A;  3HLC A;  2ZMF A;  3SW1 A;  5KSC A;  4BQM A;  3CUE A;  2EFX A;  4R3J A;  1MWU A;  4YIN A;  3DW0 A;  1FIK A;  3OOV A;  4KUO A;  5IT5 A;  3QP1 A;  2P9V B;  2A49 A;  2L4R A;  1XX2 A;  3LID A;  4QY5 A;  4E3O A;  2OV5 A;  4I38 A;  4KQD A;  1BUE A;  3T1Q B;  5HAQ A;  2WAF A;  4HBU A;  4ETX A;  2Y4A A;  4WUJ A;  4OPZ A;  1ES3 A;  3IXG A;  2O9A A;  3DTI A;  3Q7V B;  4QJG A;  3UDI A;  2PT7 A;  1SHV A;  4PKY G;  3G2Z A;  2Q9M A;  4JF5 A;  1H8M A;  3ZGA B;  4Y15 A;  1LLB A;  3LR3 A;  4E04 A;  5EEC A;  2VV8 A;  3LUQ A;  4OOM A;  3TG9 A;  3MBZ A;  3UDF A;  2HP6 A;  3A3E A;  5JYO A;  5AQ7 A;  4RYE A;  1OT9 A;  5HW3 A;  3NIA A;  3JVV A;  4WMC D;  1ONG A;  3E98 A;  3UE3 A;  1NLZ A;  5L2F A;  1XGJ A;  1BSG A;  2A24 A;  4YOF A;  3SS5 A;  4EET B;  3FC7 A;  4GN2 A;  1IFQ A;  3KX0 X;  4JXW A;  2LB5 A;  3N8R A;  3R7W A;  1YMX A;  2XRN A;  3BEB A;  3EQV A;  3IBJ A;  4NXB A;  3UB6 A;  1E4D A;  4GHI A;  3BYD A;  1CQA A;  2XD5 A;  1TF1 A;  1T1C A;  1PIO A;  1W63 M;  2HZ5 A;  2PD8 A;  4ID4 A;  5FAS A;  4FH4 A;  1TVF A;  5E2G A;  1MWS A;  1SCW A;  4GS9 B;  3A3F A;  4WYY A;  5F1G A;  3UPP A;  5EUA A;  4JGQ A;  5G4Y A;  2ZLY A;  3MMH A;  1Y4O A;  3BW6 A;  3EQU A;  4OPR A;  1SZV A;  4LV0 A;  1ZKJ A;  4CLC E;  1LI9 A;  3MJQ A;  2ZQD A;  2Y79 A;  3HLE A;  2Q9N A;  1YLY A;  4B9O A;  4WLA A;  5DTS A;  2WKH A;  3VSK A;  1HD8 A;  1PZO A;  1PNE A;  2BLS A;  5F82 A;  4DE0 A;  3MXQ A;  4EEU A;  1Q2Q A;  1L0F A;  1D7E A;  2ZD8 A;  3O88 A;  4BBV A;  2EWW A;  2RCX A;  4KQO A;  4RX2 A;  4LCL A;  3IH8 A;  5DKK A;  1XJ6 A;  1JWV A;  5FQK A;  4EW7 A;  3FKW A;  4DJ3 A;  1M6K A;  3T50 A;  2JKT M;  3LY4 A;  2EXB A;  4XUX A;  2CC1 A;  5MC7 A;  2WGI A;  2V20 A;  4K08 A;  3OBF A;  3ZG5 A;  3DAV A;  3ZVW A;  4QU3 A;  3H7W A;  3B42 A;  5EVE A;  1E25 A;  2W1T B;  4X55 A;  3S4X A;  3NEC A;  2ZQC A;  1GHI A;  5IU1 A;  3Q1F A;  2ZC7 A;  1MPL A;  3IBR A;  1VM1 A;  3IQA A;  2O0Y A;  2XK1 A;  1FOF A;  4M4X A;  5FQ9 A;  4HH2 A;  1Y28 A;  4QB8 A;  2A2L A;  3IF6 B;  5TBM A;  5DTK A;  2UWX A;  2Y59 A;  1ZG4 A;  5E43 A;  4LV2 A;  4OPQ A;  5CXW A;  3HLG A;  4FUW A;  3PBN A;  1ES4 A;  2HPB A;  4GDN A;  5F69 A;  4KZ4 A;  5EOO A;  3B3X A;  4U3T A;  3C7U A;  4Y0U A;  4B93 A;  1UWN X;  1K57 A;  1LI0 A;  5F6A A;  2ZC3 B;  2V1B A;  5M19 A;  2W3E A;  3N6I A;  4IBX A;  1NXY A;  2KX6 A;  2Y2Q A;  4HIA A;  2EX6 A;  3EGX C;  3BM6 A;  3PXP A;  3VOY A;  4R0Q A;  3CIT A;  3A3I A;  5HWV A;  4KQR A;  1VB6 A;  4HJ6 A;  5KMW A;  1K57 C;  4HHD A;  3HBR A;  4F3L B;  3RXW A;  5FA7 A;  3PBS A;  4DE3 A;  2X02 A;  1KOU A;  2OOL A;  5GLA A;  2HDR A;  1MY8 A;  3BWL A;  3IF6 C;  2DRW A;  1MC0 A;  4H6J B;  5KIZ A;  1YSP A;  3L7H A;  3MKF A;  5FQI A;  3SH7 A;  2NUT C;  3T1S A;  2HP5 A;  1FR6 A;  3DTK A;  4G3K A;  1HTZ A;  3NHQ A;  2W3H A;  4CLC A;  1NYM A;  2ZQ9 A;  2GJ3 A;  3LR0 A;  1YT4 A;  1W7F A;  1YPR A;  3N7W A;  3DTM A;  3UN7 A;  3E2K A;  3AGD A;  1IEM A;  5CGS A;  3OPP A;  3C8C A;  3UME A;  5DF7 A;  2FFF B;  2K7S A;  4NET A;  4UAA A;  5CTM A;  4XUZ A;  2XSS A;  4Q8I A;  2H0T A;  3E4P A;  3T4J A;  1CEG A;  2FH5 A;  2K2N A;  1QMF A;  4YWZ A;  2XEP A;  3NJA A;  3GSG A;  3BFF A;  1DJC A;  4ZDX A;  3E4Q A;  1ZHH B;  2B18 A;  2VK3 A;  4MLL A;  2J3T D;  2G2W A;  3FPV A;  4MEZ A;  3H82 A;  3T1X A;  4IUH A;  4CJN A;  1DJB A;  4S2L A;  4OLD A;  2HDU A;  1XKZ A;  3ZFZ A;  3ICY A;  4P85 A;  1BLC A;  4KZ8 A;  2DNS A;  4BJP A;  1DP8 A;  4Q0H A;  5HFO A;  1HVB A;  4HY8 A;  3F1O B;  3N8L A;  3BY8 A;  1NJ4 A;  5HL1 A;  1FCN A;  3JVU A;  1XFQ A;  5GLD A;  4DJ2 A;  4WM9 A;  1OTD A;  4MNR A;  2X01 A;  2VGJ A;  1EW0 A;  2VKS A;  4M3K A;  2Z6C A;  2OWJ A;  5DFX A;  2JE5 A;  5J4E A;  2OWH A;  1LHY A;  5F5Y A;  2W3D A;  2Y8H A;  2VX8 A;  5GLB A;  3VFF A;  1A0K A;  5GL9 A;  4R3A A;  4O0P A;  3OCL A;  2DCF A;  5HDD A;  3IWQ A;  3ISG A;  1K54 A;  2I9V A;  2XF3 A;  2Z2M B;  4Y5F A;  3BLS A;  2JN7 A;  1H3Q A;  4BBT A;  4GCZ A;  2J3T C;  1H5X A;  4OQ0 A;  1OTE A;  5CRF A;  1SDE A;  4DE1 A;  1K54 C;  1SKO B;  1MWT A;  5HPF A;  2R9W A;  5E2F A;  5HL6 A;  1TEM A;  1VHM A;  4MBH A;  2R9X A;  3D9Y A;  4FH2 A;  1XPB A;  3G34 A;  4BD1 A;  1P0Z A;  3NBL A;  2QHK A;  5G4Z A;  1H8Z A;  4PM5 A;  2HF6 A;  2XR0 A;  2ZMV A;  3JYI A;  2VLG A;  3MQQ A;  3F1N A;  4EBN A;  4HJ3 A;  1LT0 A;  3VE4 A;  2O9C A;  1K55 A;  3IHB A;  5EVI D;  2PR5 A;  1Z6F A;  2JBF A;  3DTE A;  2W0N A;  4HP4 A;  1L2S A;  4E3K A;  3OPH A;  1ZC2 A;  3GR2 A;  3VP3 A;  4PM8 A;  5F68 A;  1K55 C;  3RTY A;  2ZOI A;  1ALQ A;  3CHW P;  5DJT A;  1BUL A;  4Y13 A;  4JGR A;  3V39 A;  3IS2 A;  4GZB A;  4KZ7 A;  2LB9 A;  2XA7 S;  2BAS A;  3IWI A;  3KSF A;  3CUE C;  1U60 A;  1HLU P;  3DWK A;  2Y2I A;  3T4K A;  4JGP A;  2ZQ7 A;  4HI4 A;  3IH9 A;  1I5Q A;  1H8Y A;  3C7V A;  2QKP A;  1YLZ A;  1GSW A;  2JHE A;  3PR6 A;  4E3L A;  5EVI A;  2XLN A;  3OCN A;  5FAQ A;  3KSH A;  2V9A A;  4BEN A;  5A91 A;  4AFI A;  2VGL S;  1TS6 A;  2J8Y A;  2A24 B;  3HVF A;  4Y17 A;  3LY3 A;  4NEE D;  4MBF A;  5CTN A;  4K0W A;  2FZ0 A;  4XT2 A;  1P9R A;  2Q0O A;  2Y55 A;  2CMN A;  4B4Z A;  3R7W B;  5EVI C;  5I5L A;  2RL3 A;  4HJ4 A;  3C4O A;  3KSG A;  1PI5 A;  4GHI B;  4N92 A;  1O7E A;  4GD8 A;  3SS3 A;  3HLW A;  4D60 A;  2GNX A;  1ESI A;  2EA9 A;  1KGE A;  4NK3 A;  2Y2G A;  3C38 A;  4KEN B;  5HPI A;  3FV7 A;  1TS8 A;  3UE6 A;  1M40 A;  1T1B A;  4DE2 A;  1PW8 A;  1FCO A;  3AGF A;  3VFH A;  2ZQA A;  2IWD A;  4ME4 A;  3HLB A;  4GB7 A;  4G3V A;  4Q0I A;  1T1A A;  4X53 A;  5BOH A;  2W3F A;  2H28 A;  5FAO A;  2HJ9 C;  1VQQ A;  1K38 A;  4KG5 A;  5TFQ A;  5A8B A;  2V0W A;  5IHV A;  4BWI A;  3ZG8 B;  3IXH A;  2O9B A;  3C4P A;  1W8Y A;  2J80 A;  1K56 A;  2PHY A;  1GHM A;  1OJ5 A;  3FZC A;  2BTF P;  3FG8 A;  1WE4 A;  4O7D A;  2XA7 M;  5CGX A;  3S7P A;  1LL8 A;  1S4R A;  1XXM A;  1LL9 A;  2V1Z A;  3VOZ A;  1W63 Q;  4CQH A;  5JYP A;  1TS0 A;  5GLC A;  3V50 A;  1DP9 A;  3HUN A;  3TSG A;  1EI5 A;  1SKF A;  3A3D A;  5AQA A;  4BMW A;  2WGW A;  2XFT A;  4MN7 A;  3T4O A;  2ZOH A;  2Y2M A;  2PYR A;  2P74 A;  4E6X A;  5CGW A;  3BFE A;  3F1P A;  4MN6 A;  3WS5 A;  4IED A;  3G2Y A;  2G2U A;  3H7W B;  3LEZ A;  2VGL M;  4DMZ A;  3G4P A;  4B88 A;  3UO9 A;  4F94 A;  5CHM A;  1W79 A;  4OH0 A;  3QNB A;  4IUK A;  2B95 A;  2J3W A;  2QPN A;  2PU2 A;  4ZJ2 A;  3MKE A;  4N9K A;  4UEY A;  1LSV A;  3LFV A;  5HAI A;  2VV6 A;  2PD7 A;  4KG6 A;  4BLM A;  1DJA A;  3T4T A;  4S2K A;  3HL9 A;  4FD8 A;  5TBM B;  3NDG A;  3WRZ A;  4E3J A;  1XJ4 A;  3UB5 P;  1YLP A;  2XRO A;  1LL5 A;  3BQA A;  3V67 A;  2QJ5 A;  3RFB A;  3KO6 A;  3UB8 A;  5E2H A;  4S2M A;  1DP6 A;  3T4S A;  3MFD A;  4EU0 A;  2KOI A;  4JXS A;  1NRF A;  4MMN A;  4LRX C;  3BRM A;  4UA7 A;  3ZNT A;  3D3O A;  1BZA A;  4ARZ A;  2W3G A;  1N9O A;  5CHJ A;  4CLC D;  2XGN A;  4L0L A;  2M7V A;  5HZH A;  3HJK A;  5AJG A;  1MXO A;  3IX8 A;  1YKD A;  4LGW A;  2V8F A;  2BG1 A;  3UY6 A;  4II7 A;  1S6R A;  1NY0 A;  4E3I A;  4UA6 A;  4WN5 A;  4UQI S;  2I72 A;  2QJ7 A;  4R4R A;  3W2Z A;  1V9Z A;  3O87 A;  1PWD A;  2Y2K A;  2GZA A;  4CLC B;  5DVA A;  5I94 A;  1YSQ A;  4EER A;  2P04 A;  4R38 A;  1OTB A;  5CEB A;  2Z2L B;  1XA1 A;  5DTT A;  4HH3 A;  4HNB A;  4ZJ3 A;  4H8R A;  1J3W A;  1IOU A;  4OVD A;  5HWT A;  4JF4 A;  4LPZ A;  3WS4 A;  3M2K A;  4R70 A;  3D4F A;  1TS7 A;  3B33 A;  3CPT A;  1P97 A;  3V5M A;  1NZO A;  3UE0 A;  3MR0 A;  1UGU A;  4GKU A;  3T12 B;  3IXB A;  5D3O A;  1JTG A;  1BLS A;  1PW1 A;  1AXB A;  2JKR M;  1GCE A;  2D01 A;  2Y91 A;  4OLG A;  1W5D A;  4U0X A;  4PM7 A;  1Y54 A;  1P9W A;  2E8I A;  1VET A;  3DWZ A;  2V0U A;  2B5R A;  3PBO A;  4PPR A;  4EBL A;  3H82 B;  1KE0 A;  3DBA A;  4NG2 A;  3MQO A;  4CLC C;  2WGV A;  1LSX A;  1DY6 A;  4S2J A;  1N9B A;  1ERQ A;  3CG5 A;  1RGZ A;  4OPY A;  4YFM A;  4A5R A;  4DDS A;  1RGY A;  2M1C A;  3T1R A;  5AVE A;  1E3U D;  4R6L A;  3C5A A;  2Y2O A;  2Y2J A;  2PBY A;  3ZG7 B;  1IYQ A;  1G6A A;  5DF9 A;  1K0K A;  4EUZ A;  3E2L A;  3MS6 A;  4WEJ A;  3UE1 A;  5CX7 A;  3CMZ A;  2KLI A;  3HLF A;  1EWZ A;  2L0W A;  4KZB A;  4X25 A;  3C2W A;  4MBK A; 
#chains in the Genus database with same CATH homology
 4E3K A;  1CEF A;  1K25 A;  1E4D A;  3QHY A;  3OPH A;  4KZ5 A;  1FSW A;  3BYD A;  1XGI A;  3SOI A;  4K91 A;  1ZC2 A;  3GR2 A;  3WS2 A;  3VP3 A;  2JC7 A;  5EOE A;  4PM8 A;  2A3U A;  2XD5 A;  3SH8 A;  1KGF A;  3QNC A;  1K55 C;  1PIO A;  5A92 A;  4ID4 A;  5FAS A;  4FH4 A;  1TVF A;  3FKV A;  5E2G A;  1MWS A;  1ALQ A;  4E3M A;  2OLV A;  1SCW A;  4EQI A;  1C3B A;  3A3F A;  1BUL A;  4WYY A;  4QHC A;  5FI7 A;  3V39 A;  3W4Q A;  1JTD A;  2EFU A;  5F1G A;  3UPP A;  4GZB A;  3VSL A;  5EUA A;  4GD6 A;  3ZG0 A;  4E3N A;  4S2P A;  4KZ7 A;  2ZC4 B;  4P0M A;  2ZLY A;  3IWI A;  2WAD A;  4JLF A;  2ZM2 A;  3V3R A;  3EQU A;  1U60 A;  4OPR A;  2IWB A;  1QME A;  2EX2 A;  4LV0 A;  4PM9 A;  4XXR A;  3DWK A;  2Y2I A;  1ZKJ A;  2XDM A;  2ZQ7 A;  1E3U A;  5M18 A;  4R23 A;  1MBL A;  1LI9 A;  3IF6 A;  4WBG A;  3IH9 A;  1I5Q A;  3O86 A;  2ZQD A;  3BFC A;  1H8Y A;  3G35 A;  5FQM A;  2QMI A;  3HLE A;  3C7V A;  2Q9N A;  1YLZ A;  4OOL A;  1IEL A;  1YLY A;  3IXD A;  3IWO A;  4DDY A;  1ESU A;  5DTS A;  2WKH A;  4CPK A;  1PYY A;  3ZG9 B;  3VSK A;  4HEF A;  4E3L A;  1HD8 A;  4LV1 A;  1PZO A;  5F82 A;  2BLS A;  5EVI A;  3VP1 A;  2XLN A;  4DE0 A;  3UPO A;  3OCN A;  4ZTK A;  5FAQ A;  2H5S A;  2WUQ A;  1NZU A;  4BEN A;  1XP4 A;  3OZH A;  1Q2Q A;  3IHA A;  1MWR A;  3ITB A;  3HUM A;  1L0F A;  5A91 A;  2C5W B;  3UPN A;  1PZP A;  2J8Y A;  4ZJ1 A;  2ZD8 A;  3HVF A;  3LY3 A;  3O88 A;  1BLH A;  4MBF A;  5E2E A;  3MZE A;  5CTN A;  4K0W A;  2RCX A;  3RJU A;  2ZC5 B;  3W4P A;  4BD0 A;  2Y55 A;  2ZM0 A;  4KQO A;  4RX2 A;  4X56 A;  4LCL A;  3P09 A;  2ZMA A;  4B4Z A;  4EWF A;  1BTL A;  2WZZ A;  3IH8 A;  5EVI C;  5F83 A;  2RL3 A;  3Q07 A;  3C4O A;  2WKE A;  1JWV A;  5FQK A;  3GQZ A;  2GDN A;  1ERO A;  1YLW A;  2VGK A;  3FKW A;  1PI5 A;  1IYS A;  3WWX A;  2EX9 A;  5FQQ A;  2WZX A;  1M6K A;  4JKT A;  4N92 A;  1O7E A;  3LY4 A;  3BFD A;  4GD8 A;  2EXB A;  4XUX A;  1PWG A;  3HLW A;  3SS3 A;  3W8K A;  1ESI A;  1TDG A;  2CC1 A;  5FQJ A;  1NYY A;  2WGI A;  1KGE A;  2WYX A;  3ZHH A;  2HDQ A;  2V20 A;  1RCJ A;  1GA9 A;  4NK3 A;  2Y2G A;  5HAP A;  2ZM8 A;  4KEN B;  3FV7 A;  3ZG5 A;  3TOI A;  1M40 A;  2EX8 A;  3ITA A;  1KVM A;  4DE2 A;  3GV9 A;  3ZVW A;  4E6W A;  4QU3 A;  1PW8 A;  1E25 A;  4X55 A;  3S4X A;  3ZNY A;  1FCO A;  4Y0O A;  2ZQC A;  1GHI A;  3AGF A;  1ERM A;  3Q1F A;  2ZQA A;  3AGE A;  3VFH A;  2IWD A;  2ZC7 A;  3W4O A;  3A3J A;  1XA7 A;  1MPL A;  3HLB A;  4GB7 A;  4R3B A;  1VM1 A;  1TDL A;  3IQA A;  4S2O A;  3BFG A;  4Y7P A;  3UDX A;  4X53 A;  1ES5 A;  2XK1 A;  5BOH A;  1FOF A;  5FQ9 A;  5FAT A;  5FAO A;  2Y2P A;  4JXV A;  2QZ6 A;  1VQQ A;  4DKI A;  1K38 A;  4KG5 A;  5EPH A;  4QB8 A;  5TFQ A;  4P87 A;  2EXA A;  1KE4 A;  3IF6 B;  5IHV A;  1S0W A;  3PTE A;  3WRT A;  2PU4 A;  5DTK A;  4QY6 A;  2UWX A;  4JF6 A;  2Y59 A;  3NC8 A;  3PAG A;  1ZG4 A;  5E43 A;  2WKI A;  4LV2 A;  4OPQ A;  4JXG A;  5CXW A;  3HLG A;  4Z9Q A;  1FCM A;  1KE3 A;  3ZG8 B;  1WYB A;  3MXS A;  3FWL A;  3IXH A;  3C4P A;  1W8Y A;  1ES4 A;  3PBN A;  2HPB A;  4GDN A;  1K56 A;  4KZ4 A;  1GHM A;  5EOO A;  3B3X A;  4U3T A;  3IF5 A;  3C7U A;  5EVI B;  1N4O A;  4OKP A;  5CER A;  4Y0U A;  4C75 A;  2J9P A;  4WEL A;  3VP4 A;  3FZC A;  4D2O A;  4Y0T A;  3IT9 A;  1K57 A;  1WE4 A;  1LI0 A;  2XQZ A;  3VP2 A;  4O7D A;  5A93 A;  2ZC3 B;  5M19 A;  1JWP A;  5CGX A;  3N6I A;  5TR7 A;  4IBX A;  1NXY A;  1PI4 A;  2Y2Q A;  1XXM A;  4EBP A;  2EX6 A;  1LL9 A;  2V1Z A;  3VOZ A;  5AQ9 A;  3PAE A;  5JYP A;  1O07 A;  5GLC A;  3BM6 A;  3RXX A;  3V50 A;  4DF6 A;  3VOY A;  4C3Q A;  4R0Q A;  3WS1 A;  2C6W B;  3A3I A;  3NDE A;  4KQR A;  3HUN A;  1FR1 A;  1IYO A;  3TSG A;  1K57 C;  3FYZ A;  5KMW A;  1EI5 A;  2HDS A;  2OLU A;  3HBR A;  1KVL A;  1SKF A;  3RXW A;  4GDB A;  4S2N A;  3A3D A;  4KZ6 A;  5AQA A;  5FA7 A;  3PBS A;  4PMA A;  2X02 A;  2WGW A;  3M2J A;  2XFT A;  3M6H A;  4OQG A;  3ZCZ A;  4DE3 A;  4P6B A;  3S22 A;  2XH9 A;  2Y2M A;  2P74 A;  4E6X A;  1G68 A;  3PBT A;  5M1A A;  5GLA A;  2HDR A;  1MY8 A;  1YMS A;  5CGW A;  3OPL A;  3IF6 C;  5F1F A;  4X68 A;  3BFE A;  2DRW A;  5CHU A;  1SDN A;  1ONH A;  3WS5 A;  4IED A;  1IYP A;  3G2Y A;  2G2U A;  2OSU A;  5CED A;  3LEZ A;  3MKF A;  5FQI A;  4S2N C;  3G4P A;  1W8Q A;  2XD1 A;  4LV3 A;  3VMA A;  5GHX A;  3SH7 A;  4B88 A;  3UO9 A;  1K4E A;  3Q81 A;  1K56 D;  4ZAM A;  2HP5 A;  1FR6 A;  4F94 A;  5J8X A;  5CHM A;  1HTZ A;  1W79 A;  4OH0 A;  4BL2 A;  3QNB A;  4JPM A;  3N8S A;  1NYM A;  2ZQ9 A;  2IWC A;  2QPN A;  2PU2 A;  1YT4 A;  4ZJ2 A;  3MKE A;  3NCK A;  4N9K A;  1KDW A;  4RA7 A;  4WZ5 A;  5HAI A;  1W7F A;  3N7W A;  3DTM A;  4WZ4 A;  4UHU A;  3UN7 A;  4GOG A;  4KG6 A;  1K6S A;  1CK3 A;  5EVL A;  4BLM A;  2P9V A;  1DJA A;  4C6Y A;  3E2K A;  3AGD A;  4S2K A;  2HP9 A;  1IEM A;  3HL9 A;  4FD8 A;  5CGS A;  4OP5 A;  4R4S A;  3MZD A;  3NDG A;  3OPP A;  5AQB A;  3GTC A;  3WRZ A;  4IBR A;  3SH9 A;  4E3J A;  5DF7 A;  1YLP A;  2FFF B;  2Y2L A;  2ZJ9 A;  4IVK A;  4N9L A;  4NET A;  4UAA A;  1LL5 A;  4WZ5 C;  5CTM A;  4XUZ A;  3VP0 A;  5FDH A;  5E2H A;  4K0X A;  3GMW A;  4OQI A;  4R1G A;  2H0T A;  4Q8I A;  3G32 A;  4S2M A;  1CEG A;  5KZH A;  1K6R A;  3HLD A;  2ZQ8 A;  3MFD A;  1QMF A;  4QD4 A;  2H10 A;  4RX3 A;  4RVA A;  3GVB A;  1FQG A;  2XEP A;  5CEC A;  1GHP A;  1KGG A;  3NY4 A;  3G30 A;  4JXS A;  3GSG A;  3BFF A;  1DJC A;  4ZDX A;  5G18 A;  1NRF A;  3Q7V A;  4KZ9 A;  4UA9 A;  3CJM A;  3P98 A;  4S2I A;  1HZO A;  4MLL A;  3SS4 A;  1WYC A;  4ZBE A;  3BRM A;  4X69 A;  1OME A;  4UA7 A;  2Y2H A;  3UNW A;  2G2W A;  3ZNT A;  4EV4 A;  1Q2P A;  3ZVT A;  4U0T A;  4FCF A;  3LCE A;  1L0D A;  5FSR A;  4MEZ A;  1BZA A;  4BL3 A;  5EE8 A;  5CHJ A;  2XGN A;  4KG2 A;  3I7J A;  1I2W A;  3BLM A;  4L0L A;  3OC2 A;  1ZG6 A;  4CJN A;  1FSY A;  1DJB A;  4N1H A;  3OPR A;  1YLT A;  1MXO A;  1J9M A;  1JVJ A;  2WGW B;  4OLD A;  4S2L A;  1BLP A;  3MZF A;  2HDU A;  1CI9 A;  1XKZ A;  3MXR A;  4JBF A;  1PWC A;  3ZDJ A;  3ZFZ A;  5HAR A;  2H0Y A;  4B4X A;  4LCM A;  1GA0 A;  2BG1 A;  2Y2N A;  3UY6 A;  4P85 A;  1S6R A;  1NY0 A;  2V2F F;  1BLC A;  4HES A;  4KZ8 A;  3S1Y A;  4E3I A;  4UA6 A;  1BT5 A;  5GHY A;  4X6T A;  2ZC6 B;  2DNS A;  3GRJ A;  3HLC A;  2I72 A;  4BJP A;  4R4R A;  4PM6 A;  5KSC A;  5HX9 A;  4FSF A;  3NI9 A;  1IKG A;  1HVB A;  5HFO A;  4BQM A;  3N8L A;  2EFX A;  5TGF A;  3O87 A;  1PWD A;  1YM1 A;  2Y2K A;  4R3J A;  1MWU A;  4YIN A;  1NJ4 A;  4OP8 A;  4DXC A;  5HL1 A;  2FFY A;  5DVA A;  5I94 A;  3BEC A;  3DW0 A;  1FCN A;  5GLD A;  3N4I A;  2WK0 A;  4WM9 A;  5FI6 A;  5CEB A;  2Z2L B;  1XA1 A;  4MNR A;  2P9V B;  5DTT A;  2A49 A;  4OON A;  3HUO A;  1XX2 A;  4ZJ3 A;  2XFS A;  4LEN A;  2X01 A;  2VGJ A;  1L0E A;  4H8R A;  4QY5 A;  4OVD A;  5U47 A;  4JF4 A;  4M3K A;  5FI2 A;  3WS4 A;  3M2K A;  4WEK A;  5KSH A;  2X71 A;  3M6B A;  3D4F A;  4WMC A;  4E3O A;  2OV5 A;  2JE5 A;  1CI8 A;  1L0G A;  3V5M A;  1NZO A;  3UE0 A;  1K4F A;  1LHY A;  2J9O A;  4OOY A;  4OQH A;  1BUE A;  4GKU A;  3IXB A;  5GLB A;  3VFF A;  5HAQ A;  1I2S A;  2WAF A;  1JTG A;  4HBU A;  3G31 A;  5D3O A;  5GL9 A;  2Y4A A;  3OCL A;  4DXB A;  2DCF A;  1BLS A;  1PW1 A;  1AXB A;  1GCE A;  4OPZ A;  1K54 A;  2XF3 A;  1ES3 A;  3ISG A;  2Y91 A;  3IXG A;  3IWQ A;  3Q7Z A;  1IKI A;  2Z2M B;  4OLG A;  1W5D A;  3BLS A;  4U0X A;  4PM7 A;  3Q7V B;  4QJG A;  3UDI A;  1Y54 A;  4KZA A;  2E8I A;  1SHV A;  3O3V A;  1H5X A;  1YQS A;  3DWZ A;  4OQ0 A;  2B5R A;  3G2Z A;  3PBO A;  4PPR A;  2Q9M A;  4EBL A;  4JF5 A;  1KE0 A;  3ZGA B;  3HRE A;  1KDS A;  4GNU A;  5CRF A;  2WGV A;  1LLB A;  1DY6 A;  1MKI A;  1SDE A;  4S2J A;  5FAP A;  4DE1 A;  1K54 C;  1N9B A;  3WS0 A;  1ERQ A;  1MWT A;  3CG5 A;  1RGZ A;  4OPY A;  5EEC A;  2R9W A;  5E2F A;  1TEM A;  4YFM A;  4A5R A;  2J7V A;  4DDS A;  4MBH A;  4N1X A;  1RGY A;  2R9X A;  4OOM A;  3V3S A;  3TG9 A;  3MBZ A;  3PBR A;  4FH2 A;  3UDF A;  1XPB A;  2HP6 A;  3A3E A;  5JYO A;  3PBQ A;  3G34 A;  4BD1 A;  5AQ7 A;  4RYE A;  1YLJ A;  5HW3 A;  3NBL A;  3NIA A;  1E3U D;  5GHZ A;  3CZD A;  1H8Z A;  1JWZ A;  4PM5 A;  4WMC D;  3C5A A;  1ONG A;  2Y2O A;  2XR0 A;  3UE3 A;  2Y2J A;  5L2F A;  2PBY A;  4KQQ A;  3ZG7 B;  1IYQ A;  5A90 A;  4DRT A;  1XGJ A;  3JYI A;  2WAE A;  1BSG A;  3LO7 A;  1G6A A;  3SS5 A;  4HBT A;  4KZ3 A;  4GN2 A;  5DF9 A;  4EUZ A;  3E2L A;  4EBN A;  5DF8 A;  1RP5 A;  4WEJ A;  1K55 A;  3UE1 A;  3IHB A;  5EVI D;  3CMZ A;  4JXW A;  3N8R A;  1Z6F A;  3Q82 A;  2JBF A;  1ES2 A;  3HLF A;  1YMX A;  3BEB A;  1EWZ A;  2JCH A;  3EQV A;  4KZB A;  4MBK A;  4IVI A;  1L2S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...