3Q7VB

Beta-lactam-sensor domain of blar1 (apo) from staphylococcus aureus with carboxylated lys392
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
252
structure length
251
Chain Sequence
QSITDYNYKKPLHNDYQILDKSKIFGSNSGSFVMYSMAADAYYIYNEKESRKRYSPNSTYIYLAMFGLDRHIINDENSRMSWNHKHYPFDAWNKEQDLNTAMQNSVNWYFERISDQIPKNYTATQLKQLNYGNKNLGSYKSYWMEDSLKISNLEQVIVFKNMMEQNNHFSKKAKNQLSSSLLIKKNEKYELYGKTGTGIVNGKYNNGWFVGYVITNHDKYYFATHLSDGKPSGKNAELISEKILKEMGVLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase regulatory protein BlaR1
publication title Lysine Nzeta-decarboxylation switch and activation of the beta-lactam sensor domain of BlaR1 protein of methicillin-resistant Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase regulator
total genus 78
structure length 251
sequence length 252
ec nomenclature
pdb deposition date 2011-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3q7vB00
2XD5A 3UE1A 3WRZA 2DNSA 1LL9A 2X02A 3IF5A 1PYYA 2Y2NA 2XFSA 2WAEA 1JWZA 4GDBA 5E43A 3WWXA 3HVFA 3CJMA 5F1FA 2ZQ8A 4OPZA 4OLDA 3MBZA 3VP1A 3V50A 3AGEA 3GV9A 1GCEA 5EVIA 1ONGA 2QMIA 3UDXA 3UPNA 1VQQA 1L2SA 3HBRA 1XGJA 1N4OA 1E3UD 3LEZA 3E2KA 2DCFA 5F83A 2ZQ9A 1HVBA 3A3DA 2WKEA 3ZG0A 5FQKA 2WKIA 5GL9A 4KZ5A 4P0MA 1K54A 3IXBA 1M6KA 1EI5A 1WE4A 5CERA 3NY4A 4JPMA 5EOOA 4DRTA 1ES5A 3IF6C 3N4IA 3PBOA 4IEDA 4LENA 3GTCA 1PZPA 3MXRA 2I72A 3I7JA 3ITBA 4BJPA 4EV4A 2H5SA 4FD8A 1SDEA 5FAOA 1TEMA 5FQJA 4Y0OA 2BG1A 5EVIB 1VM1A 1MPLA 4QY5A 4RVAA 3MFDA 4ID4A 5FATA 1FOFA 1BLHA 1J9MA 1DY6A 4HBUA 4ZBEA 2IWBA 3UE0A 3LY3A 5FAPA 4PM9A 4A5RA 2JE5A 4RX3A 3GMWA 4WZ5C 4DE2A 3CZDA 1QMEA 5DF9A 1YLYA 1BT5A 1XP4A 1SCWA 4X6TA 3ZNTA 2JCHA 2WK0A 4WMCD 2HDQA 4U0XA 5AQAA 3IQAA 3QNCA 1KVLA 3HLCA 4ZJ1A 5M18A 4MNRA 2PBYA 1ES2A 5GLDA 1IYPA 4S2NA 3LCEA 1NZOA 2CC1A 1BSGA 2ZQ7A 4E3OA 3HLFA 3SH8A 4ZJ2A 1K38A 1LI9A 3VOZA 5FAQA 5M19A 4JKTA 4R23A 3Q1FA 5DF7A 2ZC5B 1FQGA 1YMSA 5FA7A 3UN7A 2HP5A 4JXWA 1BLSA 1YLJA 3VSKA 1BZAA 1DJBA 1XXMA 2XF3A 2ZJ9A 3G34A 5DTSA 4N92A 1WYBA 5KMWA 1H5XA 4Z9QA 3PTEA 5EVID 1MXOA 3DTMA 3HLEA 5CHMA 1K6SA 1ESUA 2BLSA 2WZZA 4KG5A 5E2EA 2WUQA 2V1ZA 3QHYA 4OONA 4KQRA 3O86A 2Q9NA 4QY6A 1ZG4A 3O87A 2XH9A 1WYCA 3GR2A 2X01A 1PW8A 4LV2A 2Z2MB 4NK3A 2Y2PA 4LV1A 2PU2A 3O88A 2G2UA 3LY4A 3SS5A 1I5QA 1KE3A 4JF5A 3WS0A 2EX8A 1ES4A 4P85A 4DF6A 1HTZA 2Y2IA 2Y2MA 2ZLYA 3G2YA 3OCNA 4U0TA 2JC7A 4NETA 1K55A 3FKVA 5HFOA 4OQIA 1XKZA 1XPBA 3ZVTA 4MEZA 1LL5A 4LV0A 4EQIA 5DTTA 3UO9A 1NZUA 1JWPA 4UHUA 5EVIC 3C7UA 1ONHA 4B4XA 1PZOA 1IEMA 5HARA 4LCLA 2Y2JA 4K91A 1PWDA 2Y91A 4MBFA 2Y4AA 1E4DA 3G2ZA 4N9LA 1K54C 5KSHA 5CGSA 3Q7ZA 4OVDA 4GN2A 4BQMA 4C6YA 2RL3A 1PI5A 4FH4A 3CMZA 4XUXA 3OPLA 1JVJA 3IWOA 3BM6A 4KZ6A 2Y2KA 1S0WA 3UNWA 1IYOA 4KQQA 1K4FA 4QD4A 3BYDA 3RXXA 2P74A 4KZBA 4H8RA 4FSFA 4MLLA 2Y2LA 1MWUA 4S2JA 1ZG6A 3M2KA 5U47A 1PI4A 1C3BA 4WBGA 2ZC6B 3G4PA 4OQGA 3IXDA 2WGIA 1SKFA 4X68A 4E3IA 1TDLA 1K6RA 4X55A 3HUMA 3V39A 5CECA 1FR6A 3UE3A 2RCXA 2ZM0A 3BRMA 1CI9A 4JF6A 3EQVA 5GHZA 3ZG9B 4KZ3A 1JWVA 5EUAA 4DE0A 4E3JA 4S2NC 1DJCA 2EXBA 2C6WB 2ZC4B 2G2WA 3IH8A 3DW0A 5HW3A 3SS3A 3PBQA 3UPPA 4DKIA 2E8IA 1G6AA 4KZAA 5E2HA 4BL3A 3IH9A 5EOEA 3G31A 2VGJA 3IXGA 4LV3A 2XEPA 2ZQAA 4X69A 4Y7PA 4UAAA 5FQ9A 4QHCA 5AQBA 4OH0A 3S22A 5A90A 5FQQA 3WRTA 2A3UA 2HP9A 5AQ7A 2ZQDA 1W8YA 3FKWA 4FH2A 4PMAA 4OPQA 2QZ6A 5CHJA 4E3KA 3UY6A 5CHUA 3ZVWA 2XD1A 2PU4A 1KGEA 1TVFA 3FYZA 3Q81A 5D3OA 3VSLA 4KENB 5F82A 5EECA 1KDSA 5BOHA 1I2SA 1MY8A 1YMXA 2H0TA 4BLMA 3EQUA 4XXRA 4X53A 1K57A 5IHVA 2GDNA 5FI7A 3GVBA 4UA9A 2JBFA 4KZ8A 1BULA 1IELA 5FDHA 4KZ4A 1JTGA 2P9VA 4IVIA 3HLDA 4RYEA 3NCKA 4YFMA 5I94A 2Y55A 2XGNA 3OPHA 3N6IA 1L0EA 2IWCA 1GHPA 4DDYA 4CJNA 4OLGA 5HL1A 3A3EA 1W8QA 3HLGA 4EBLA 2HDSA 3A3JA 2R9WA 2X71A 3ZNYA 3V3RA 3V5MA 1MWRA 2XFTA 3FWLA 4QB8A 4P87A 4HBTA 4N1XA 4OOYA 4BD1A 2OSUA 4E6XA 5HX9A 1YLPA 2B5RA 2DRWA 4JXSA 3P98A 2XK1A 4R3JA 1RGZA 4OPYA 2EX6A 1PIOA 2P9VB 5CXWA 4ZJ3A 1QMFA 3ZG8B 3BFFA 2HPBA 2ZM8A 4C75A 4EBNA 2V2FF 4JXVA 1XA1A 4IBRA 4PM8A 3SH7A 3ZDJA 4QJGA 3OC2A 4JBFA 2WADA 1IKIA 3TSGA 3PAEA 4GB7A 5GLBA 1GA9A 2WGVA 2QPNA 2HDUA 3NDEA 4GKUA 4DXBA 3G35A 3N8RA 1AXBA 3OPRA 4R4SA 4UA7A 4E3MA 4MBHA 2WYXA 5A91A 4Y0TA 3ZG5A 1YLWA 5E2GA 2ZMAA 1BLCA 3ZGAB 3RXWA 3C4PA 2H0YA 3IWQA 4N1HA 5E2FA 4UA6A 4EWFA 4ZDXA 5AQ9A 3ZFZA 3W8KA 4HESA 3G30A 1KVMA 3IHAA 1O07A 3D4FA 1CK3A 1U60A 3MZDA 4GD8A 4E3LA 3LO7A 3IHBA 5A92A 5FQMA 3A3FA 4S2PA 3Q7VA 4OQHA 1NYMA 4R0QA 4U3TA 3VFFA 2J9OA 1KGGA 3OZHA 3NDGA 4DE3A 4DXCA 5FASA 3JYIA 1RGYA 4JF4A 3S4XA 5A93A 5EVLA 3VMAA 1YLZA 3C4OA 1K25A 1FCMA 4GOGA 4DE1A 4CPKA 1IYQA 1NXYA 1FCNA 4OOLA 4B88A 5L2FA 2Y59A 4GD6A 1ERMA 1EWZA 2C5WB 3N8LA 3ZHHA 1Q2PA 2VGKA 4D2OA 4EBPA 3QNBA 3ZG7B 1XA7A 2WAFA 2XLNA 1ERQA 1Y54A 1PWCA 3Q82A 3VP4A 3BLMA 1EROA 2OLUA 2EFXA 1SDNA 3ZCZA 3UDFA 4KG6A 5CGXA 3S1YA 1FSWA 3Q7VB 3A3IA 3Q07A 2ZC7A 3HREA 4KQOA 2EFUA 4JXGA 1ZKJA 5HAPA 1W5DA 1K4EA 1RP5A 2ZC3B 5EE8A 2WZXA 4OP5A 1K57C 5CGWA 2OLVA 3BFEA 3NI9A 2Y2GA 3VOYA 1BTLA 2Z2LB 4KG2A 5KZHA 2IWDA 2UWXA 2Y2QA 3HLBA 3TG9A 3NC8A 3WS5A 4FCFA 4WM9A 4KZ9A 3PBNA 2H10A 4MBKA 3WS2A 1ALQA 2V20A 3HL9A 1E25A 5J8XA 4C3QA 3GRJA 3MKFA 4S2MA 1FCOA 1XGIA 4ZTKA 5GLCA 4IVKA 3BFCA 5M1AA 1DJAA 3IWIA 4IBXA 4Y0UA 3PBSA 3W4PA 1BUEA 4OQ0A 3OPPA 5FI2A 3SOIA 3BFDA 4ZAMA 5CRFA 2EX2A 4BENA 3RJUA 1OMEA 1ZC2A 1KGFA 3E2LA 2HP6A 3ITAA 5CTNA 4BD0A 4WEJA 1Q2QA 1JTDA 4O7DA 3O3VA 4RA7A 1W79A 1GHMA 1NJ4A 2R9XA 3SS4A 2A49A 3BLSA 3ISGA 5CTMA 4EUZA 2FFYA 3IXHA 5JYOA 4OKPA 4Q8IA 4K0WA 3M2JA 2HDRA 5DVAA 4WYYA 4E6WA 3B3XA 5HAQA 3C5AA 1GA0A 3SH9A 1NY0A 1CEGA 4K0XA 5TR7A 4L0LA 2J8YA 1GHIA 4QU3A 1ESIA 3IF6A 1RCJA 4S2LA 1BLPA 4WELA 1KE0A 1L0GA 1MWSA 1H8ZA 1K55C 1CEFA 1Z6FA 3WS1A 1K56A 5GLAA 3GSGA 3M6BA 5FSRA 4YINA 3PAGA 3FZCA 1LI0A 3BEBA 3C7VA 3MZFA 4GZBA 3G32A 4R1GA 1LLBA 5DTKA 3V3SA 3P09A 4KZ7A 3UPOA 5GHXA 4WEKA 1FSYA 2J7VA 1NYYA 4OPRA 1H8YA 4WZ5A 4E3NA 1YQSA 5DF8A 1N9BA 3DWZA 3AGDA 3IT9A 1E3UA 3OCLA 4N9KA 1LHYA 1M40A 4RX2A 3VFHA 2Q9MA 4BL2A 4DDSA 3IF6B 2ZD8A 1SHVA 4PPRA 2FFFB 3PBRA 3NIAA 1S6RA 1YLTA 4GNUA 4S2OA 2ZQCA 5JYPA 4S2IA 3AGFA 2WGWA 5EPHA 3WS4A 2EX9A 5CEDA 4M3KA 1KE4A 4GDNA 1NRFA 1YT4A 1FR1A 3HUOA 3NBLA 1MKIA 3W4QA 3VP0A 4OOMA 1XX2A 3MZEA 2ZM2A 3MXSA 4R3BA 3UDIA 5KSCA 1G68A 2J9PA 3W4OA 1ES3A 3BFGA 3PBTA 4PM7A 1PWGA 4HEFA 3HLWA 5F1GA 4P6BA 5CEBA 4B4ZA 1W7FA 2Y2OA 1I2WA 3N7WA 4X56A 3TOIA 1IKGA 5FQIA 4LCMA 2OV5A 1O7EA 3M6HA 3HUNA 4OP8A 1MWTA 5FI6A 1TDGA 4PM6A 3GQZA 1YM1A 4WZ4A 5HAIA 1CI8A 3MKEA 4WMCA 2EXAA 4R4RA 1MBLA 3BECA 3DWKA 2WKHA 1PW1A 3VP3A 2XQZA 4XUZA 3VP2A 1L0FA 2WGWB 4S2KA 1KDWA 2XR0A 4JLFA 1HD8A 1L0DA 3CG5A 1K56D 2XDMA 4PM5A 3N8SA 1IYSA 3FV7A 4F94A 1HZOA 5G18A 5TFQA 2Y2HA 5GHYA 5TGFA
chains in the Genus database with same CATH superfamily
2XD5A 3KYEA 3UE1A 3WRZA 3JPUA 1PYYA 2Y2NA 3MR0A 2QYBA 1N9NA 3W2ZA 2J3TC 1GCEA 3H7WB 4EUVA 3E0YA 2B18A 5F83A 5DKKA 1HVBA 5FQKA 2WKIA 1K54A 1FILA 2G7UA 1CF0A 2PD8A 3CI6A 3NY4A 4JPMA 5EOOA 3ZYTA 4WLAA 4Y2FA 4LENA 1PZPA 2I72A 4BJPA 2PT7A 1TEMA 3K3CA 4ID4A 3LEQA 1NRJA 1FOFA 2O9AA 3LY3A 4PM9A 2JE5A 4DE2A 2BASA 3CZDA 1QMEA 2ZMFA 1XP4A 2JCHA 1LSXA 5M18A 3BW6A 4Z1WA 1ZHHB 3HLFA 3VOZA 4R23A 3Q1FA 2ZC5B 1F2KA 1YMSA 5FA7A 3UN7A 1BLSA 4I3JA 3G34A 4BBVA 1H5XA 4Z9QA 2MJ6A 3HLEA 2Z6CA 2WZZA 4LRZE 5E2EA 2WUQA 3KO6A 2Q9NA 4QY6A 2V0UA 4LV2A 4I3IA 2FZ0A 4LV1A 2PU2A 3O88A 2G2UA 1KE3A 1ES4A 4DF6A 4MN7A 2R78A 3T4OA 5DTTA 1JWPA 5EVIC 3C7UA 5K5BA 1UWPX 1CQAA 5CGSA 3LIFA 5KIZA 2LB9A 3MFXA 1JVJA 3IWOA 4IHQA 3UNWA 2VJWA 4L9EA 2P74A 4HHDA 3E4PA 3IXDA 3QP4A 2WGIA 4HY8A 5HD5A 1TDLA 1BYWA 4X55A 3UE3A 1VHMA 2RCXA 3SZTA 4E3JA 3IX4A 2EXBA 2ZC4B 5HW3A 3PBQA 3VE3A 4DKIA 3MQ0A 4YNRA 5EOEA 3G31A 2VGJA 3IXGA 2XEPA 2ZQAA 5L10A 3S22A 4R38A 3TE8A 2A3UA 4NXFA 3WRTA 5AQ7A 2O99A 2VKSA 2VV8A 4E3KA 2XD1A 3FYZA 3K2NA 2PYRA 3D3OA 4JGRA 5HD3A 1I2SA 3EQUA 3LIAA 5IHVA 2GDNA 4UA9A 4UQIS 4JGQA 1BULA 5HWTA 2OAQ1 3UE6A 2P9VA 4RYEA 3CUEA 4NXEA 3N6IA 3FG8A 2J3WA 2IWCA 4KUOA 2OWJA 4OLGA 4PKYG 3ZNYA 3FWLA 3QP1A 4HH2A 1RGZA 4OPYA 2P9VB 1QMFA 3MF0A 3C38A 3KYQA 3LUQA 1XA1A 4IBRA 4PM8A 3OC2A 2WADA 5L07A 3R7WA 3DTEA 2WGVA 3KYZA 2HDUA 4B9OA 3N8RA 1AXBA 2K7SA 4II7A 1CJFA 2O0YA 5E2GA 4EETB 1BLCA 2I9VA 3NULA 3C4PA 2H0YA 3IWQA 4DMZA 4ZDXA 4EWFA 5AVFA 5AQ9A 3ZFZA 1JNUA 4E3LA 1ODVA 1IFQA 5A92A 3A3FA 3RFBA 3OZHA 4DXCA 4DE3A 3R7WB 5FASA 3S4XA 2JKRM 5FEGA 4UQIM 2EWVA 3C4OA 4ESPA 1EW0A 3BQ8A 4WUJA 3LI8A 1G5UA 5I5LA 3N8LA 3UB6A 2W27A 3QNBA 4EEPA 1XA7A 2O9BA 1PWCA 2EFXA 4XT2A 3CPTA 4Y17A 3A3IA 3Q07A 2ZC7A 4JXGA 3FPWA 5HAPA 1K4EA 1K57C 2D01A 5KZHA 4KG2A 2IWDA 3NC8A 4FCFA 3PBNA 4LRYC 2H10A 4BBUA 1ALQA 3HL9A 2M7UA 3E4OA 2PDRA 2QHKA 1FCOA 1XGIA 3LR4A 5J7EA 4XT2B 1DJAA 3CPTB 4IBXA 3W4PA 4OQ0A 1H3QA 5FI2A 3BFDA 1SKOA 4ZAMA 3RJUA 3BJNA 1ZC2A 4WEJA 4RA7A 1LSVA 3D9YA 5CX7A 5DJTA 2A49A 3ISGA 4K0WA 3M2JA 2VEAA 4WYYA 3B3XA 5HAQA 3IX3A 1NY0A 4QU3A 2PAVP 3EEHA 2XSSA 1ESIA 1RCJA 1K55C 1Z6FA 2HGVA 3WS1A 5GLAA 4IJGA 5FSRA 1SKOB 4R1GA 3P09A 3LIEA 1FSYA 4WZ5A 5HDCA 3DWZA 3OCLA 1LHYA 3IBRA 1SHVA 3T4TA 3DTKA 4S2OA 1GSVA 3AGFA 4S2IA 3WS4A 2AVXA 5CEDA 1KE4A 3E98A 1NRFA 1YT4A 1FR1A 1NLYA 3P01A 3VP0A 1XX2A 3UDIA 1G68A 2J9PA 1ES3A 3PBTA 1PWGA 5F1GA 2E8JA 5CEBA 4YOFA 3M6HA 3HUNA 4WZ4A 3MKEA 1MBLA 3VE4A 3BECA 4XUZA 3VP2A 1L0FA 4S2KA 4JGOA 1S1ZA 3HJIA 2XDMA 4KUKA 4P6ZS 5G18A 2X02A 3UMDA 5E43A 2W3GA 1JWZA 3WWXA 3HVFA 3CJMA 5F5YA 2V9AA 4OLDA 3JVVA 2GNXA 2QMIA 3UDXA 1N4OA 1E3UD 3LEZA 3E2KA 4K08A 1S4SA 4MN6A 2ZQ9A 3VOLA 4P0MA 2PBDP 4IEDA 1S67L 2V8CA 4PAUA 4EV4A 3ITBA 2H5SA 1SDEA 4E04A 2NUPC 3QP5A 5FQJA 4Y0OA 1VM1A 4RVAA 3MFDA 5FATA 1BLHA 3GMWA 3OLOA 1H0MA 1YLYA 2V1AA 1SCWA 2ZBBA 4WMCD 2HDQA 2FH5A 1KVLA 2W3DA 4D60A 2PBYA 1ES2A 2P08A 3LCEA 1BSGA 3SH8A 4O0PA 2WKRA 2HP5A 1YLJA 1XJ3A 1DJBA 1XXMA 2XF3A 4P6ZM 4G3VA 1MXOA 1K6SA 3DBAA 4KG5A 2H28A 1ZG4A 3O87A 3KSHA 2O9CA 5DKLA 3SS5A 4JF5A 3WS0A 4GW9A 1P9WA 3G2YA 2JC7A 3QP6A 4OQIA 5HFOA 4L9FA 3ZVTA 4EQIA 3UO9A 1DP6A 4UHUA 1ONHA 3B33A 3PXPA 4K91A 1PRQA 5EV0A 3G2ZA 1K54C 4LFUA 3RH8B 2INWA 3K3DA 2LB5A 2RL3A 2Y79A 3CWFA 4XUXA 3OPLA 4KZ6A 1S0WA 1YPRA 3HJKA 4KQQA 3BYDA 4MN5A 4KZBA 1MWUA 1OPXA 1ZG6A 5U47A 4WBGA 4OQGA 1SKFA 1TD5A 2GX5A 2W1TA 4EQ1A 3IX8A 3BRMA 3EQVA 4H6JA 4KZ3A 5EUAA 2OOLA 1DJCA 3SS3A 1G6AA 5E2HA 3IH9A 4QHCA 4OH0A 2M1CA 1KOUA 3PR6A 2HP9A 1Y4OA 3QP8A 2QZ6A 5CHJA 3UY6A 1TS6A 2W1TB 3DTIA 3VSLA 2GZAA 2IA2A 3NECA 1KDSA 1S66L 5BOHA 4HP4A 4HH3A 1MY8A 4H6JB 4Y3IA 5FI7A 2JBFA 4KZ8A 3V67A 5FDHA 1JTGA 3HLDA 4CLCD 3RTYA 1F5MA 2WKQA 2Y55A 3OPHA 5HWWA 1OTDA 2J80A 4BMWA 3A3EA 4EBLA 1W63M 2X71A 4P87A 4HBTA 4HJ3A 4E6XA 5HX9A 3CAXA 1MKMA 3T4SA 2DRWA 4JXSA 1PIOA 2ZM8A 4C75A 4EBNA 4JXVA 3SH7A 4QJGA 1OTBA 3TSGA 3PAEA 4EU0A 4EESA 4GKUA 4DXBA 4HNBA 1DRMA 3OOVA 3OPRA 1HLUP 1DP9A 4MBHA 2WYXA 1YSQA 1YLWA 3JVUA 5G4ZA 3ULFA 4EXOA 5E2FA 4UA6A 2PHYA 1VEUA 3MS6A 1KVMA 1O07A 4GD8A 4R70A 3Q7VA 4OQHA 4R0QA 4U3TA 2OWHA 1RGYA 5EFWA 1YLZA 2UV0E 1K25A 4CPKA 1IYQA 2P04A 2Y59A 4GD6A 1ERMA 3ZHHA 3ZG7B 2HZ5A 1Y54A 1VEUB 3Q82A 3VP4A 2ZOHA 2OLUA 3UDFA 4KG6A 3E4QA 3MMHA 3Q7VB 1YAXA 3HREA 4KQOA 1W5DA 2ZC3B 2WZXA 5CGWA 3BFEA 3NI9A 3VOYA 1BTLA 2Z2LB 2Y2QA 3HLBA 3TG9A 3LYXA 1G28A 4WL9A 3WS2A 5J8XA 4Y13A 3GRJA 4IVKA 2K2NA 5F68A 4Y0UA 3PBSA 4EEUA 4BENA 2EX2A 3F1OA 1OMEA 3E2LA 1TS8A 3UB8A 2V8FA 1NJ4A 3SS4A 3BLSA 5JYOA 4Q8IA 2PR6A 5DVAA 2Z6DA 4E6WA 1GA0A 3SH9A 2J8YA 2A24A 3IF6A 4WELA 1KE0A 3P7NA 1CEFA 4GJ4A 3M6BA 2B02A 3LR5A 3F1OB 3MZFA 4HOIA 3G32A 5DTKA 3V3SA 3UPOA 1TF1A 5GHXA 4HQAA 4OPRA 5LBRA 4E3NA 4Q0HA 1YQSA 2QJ5A 1E3UA 5TJJA 4RX2A 2A24B 4AFIA 4DDSA 3IF6B 1S4RA 1OJGA 3GDIA 3PHYA 1S6RA 3G6OA 3UMEA 1OTAA 2WGWA 5L8MA 4M3KA 4GDNA 3LICA 3W4QA 2J3TD 5KSCA 2ZM2A 3MXSA 4DJ2A 1P97A 3BFGA 1A0KA 4P6BA 3R4KA 4X56A 5FQIA 1O7EA 4OP8A 5FI6A 3TW8A 3GQZA 1YM1A 5HAIA 4WMCA 4R4RA 3F1PA 2WGWB 2XR0A 4JLFA 3CG5A 1FIKA 3NOUC 3H9WA 3N8SA 1AWIA 4HJ4A 3EEAA 5TFQA 5GHYA 2EWWA 3TRCA 4GDBA 2XFSA 5HPIA 5HL6A 1YSPA 1P9RA 4OPZA 3MBZA 3VP1A 3V50A 3GV9A 3UPNA 5DJUA 1VQQA 1L2SA 3HBRA 1XGJA 4NXGA 4QWOA 2DCFA 2WKEA 3F1PB 1OJ5A 5GL9A 3KSGA 5HDDA 1EI5A 3HCYA 1WE4A 5CERA 4DRTA 3N4IA 3PBOA 3MXRA 3C30A 3I7JA 2QWSA 4QY5A 3BWLA 5G4YA 1DY6A 2IWBA 5J4EA 3T50A 4A5RA 1XJ4A 2VZWA 4RX3A 4WZ5C 4HJ6A 5DF9A 5J3WA 1N9LA 2PR5A 3LFVA 4MCWA 2PRFA 3QNCA 4ZJ1A 4MNRA 5GLDA 5IT5A 3T4KA 1IYPA 4S2NA 5HPFA 4RQ9A 1NZOA 2CC1A 2ZQ7A 1K38A 1LI9A 5FAQA 3L7HA 2W3FA 1FQGA 4JXWA 4GS9A 3BY9A 1BZAA 5DTSA 2ZJ9A 3FC7A 4N92A 5KMWA 2B95A 3PTEA 5EVID 5A8BA 3DTMA 2BLSA 3U4LP 4FTXA 4OONA 2XH9A 2YKFA 2HV1A 3GR2A 2X01A 1PW8A 3NOTC 2Z2MB 1T1AA 2Y2PA 1GSXA 1T1CA 3LY4A 4GS9B 2Q0OA 1I5QA 4ME4A 1HTZA 2ZLYA 4NETA 1K55A 3FKVA 4DN0A 1XKZA 4MEZA 1LL5A 4WN5A 3CHWP 3C8CA 2QJ7A 5F69A 4NG2A 2XROA 3H82A 4B4XA 3UB5P 4LCLA 4MBFA 3NHQA 1E4DA 1WA9A 4JGPA 2A2LA 5KSHA 1V9YA 4CLCA 4GN2A 4BQMA 4I38A 1W63Q 4FH4A 3CMZA 4DJ3A 4X1LA 1K4FA 4O8GA 3RXXA 3T1RA 4H8RA 1L3LA 4MLLA 2Y2LA 1V9ZA 3H82B 4S2JA 3M2KA 1PI4A 2ZC6B 3G4PA 4L9GA 4X68A 3VV4A 1S1YA 2KLIA 2XRNA 5CECA 2ZM0A 4CLCB 2V1BA 1CI9A 4JF6A 5GHZA 3ZG9B 4UEYA 4DE0A 2C6WB 2G2WA 4KZAA 4LV3A 4UAAA 5AQBA 5FQQA 3FKWA 4FH2A 1K0KA 4R6LA 5CHUA 3ZVWA 2PU4A 1TVFA 4KENB 2HF6A 5HWVA 4BLMA 4XXRA 4X53A 3GVBA 1XFNA 4GHIA 2DMWA 4DDYA 4CJNA 1W8QA 3HLGA 2R9WA 3V3RA 1J3WA 5EVEA 2OSUA 1YLPA 4NXBA 2EX6A 2JN7A 3ZG8B 2HPBA 2V2FF 4GHIB 4Y15A 3ZDJA 3EGXC 3L9KA 1IKIA 5GLBA 2QKPA 4GLQA 3G35A 4R4SA 4Y0TA 3ZG5A 2ZMAA 3ZGAB 4N1HA 3W8KA 3S7OA 3G30A 3D4FA 1CK3A 1LT0A 2PYPA 3MZDA 4S2PA 1STZA 2J9OA 3NDGA 4X25A 4ARZA 4JF4A 2KDKA 5A93A 3VMAA 1P0ZA 1FCMA 4OOLA 5L2FA 2C5WB 1EWZA 4D2OA 4EBPA 2VGKA 2WAFA 2XLNA 2L1MA 1ZTUA 2EA9A 4EERA 5CGXA 1OTEA 1FSWA 1OTIA 4HI4A 3T1XA 1DP8A 5EE8A 4ARZB 4OP5A 2OLVA 3IBJA 2W0NA 3NOPC 4MBKA 2V20A 1E25A 4C3QA 1XJ2A 2W3HA 3UB7A 3T4LA 5GLCA 1BUEA 3SOIA 5CRFA 2YKHA 1KGFA 2HP6A 3DAVA 1JTDA 3O3VA 1GHMA 2R9XA 5CTMA 4EUZA 2HDRA 5FEFA 2VV6A 1CEGA 4L0LA 1GHIA 1BLPA 4BBTA 1MWSA 1H8ZA 1UWNX 1OT6A 3FPVA 4YINA 3PAGA 3FZCA 4LPZA 1LI0A 1D06A 3ICYA 4GZBA 1LLBA 4KZ7A 2J7VA 1NYYA 2JKGA 1H8YA 5HZHA 1F98A 5DF8A 1N9BA 3MXQA 2XA7S 2OAP1 3VFHA 1H8MA 2Q9MA 4PPRA 2FFFB 4IUKA 3NIAA 1YLTA 4GNUA 4ETZA 2ZQCA 5JYPA 1N9OA 3MQOA 3HUOA 1PFLA 3NBLA 1MKIA 3MZEA 3W4OA 4PM7A 4B4ZA 1W7FA 1I2WA 3TOIA 1IKGA 2OV5A 3MQQA 1MWTA 1TDGA 4PKYA 4PM6A 1XFQA 1CI8A 2EXAA 2ACGA 4G3KA 3LIBA 1PW1A 1KDWA 1HD8A 4PM5A 1K56D 2KX6A 1IYSA 2V0WA 3FV7A 4F94A 2Y2HA 3PYPA 4I3AA 3LI9A 2DNSA 1LL9A 3IF5A 2WAEA 3LIDA 5F1FA 2ZQ8A 3AGEA 5EVIA 1ONGA 3CUEC 2D02A 4I5SA 3KSIA 3A3DA 3ZG0A 1MC0A 4G3WA 4KZ5A 3IXBA 2XA7M 2M7VA 1M6KA 5C5KA 1VB6A 1X0OA 1ES5A 3IF6C 4GCZA 3GTCA 4FD8A 5FAOA 2BG1A 5EVIB 1MPLA 2L4RA 2ZOIA 1J9MA 4ZBEA 4HBUA 4HIAA 3UE0A 5FAPA 3UB9A 1BT5A 1F9IA 1D1JA 3TJZC 4X6TA 3ZNTA 2WK0A 5AQAA 5TBMA 4U0XA 3IQAA 3HLCA 3S7PA 5IS1A 1Y28A 3KSFA 4E3OA 4ZJ2A 5M19A 4JKTA 1XJ6A 5DF7A 2JHEA 3VSKA 1WYBA 1TS7A 2W3EA 1T1BA 4FUWA 5CHMA 5AVEA 1ESUA 5TBMB 1G6OA 2V1ZA 3QHYA 2HJEA 4KQRA 3O86A 1TS0A 1WYCA 3BY8A 4NK3A 2EX8A 2KOIA 4P85A 4FOFA 3B42A 2Y2IA 2Y2MA 3OCNA 2VGLS 4U0TA 3EWKA 3EOIA 1XPBA 4IUHA 4LV0A 3OBFA 1NZUA 1T18A 1PZOA 1IEMA 5HARA 2CMNA 2Y2JA 1PWDA 2Y91A 3T12B 2Y4AA 2PD7A 4N9LA 2W1RA 3Q7ZA 4OVDA 4C6YA 1PI5A 5FL3A 1SZVA 1NLZA 2VK3A 3BM6A 2Y2KA 4I39A 3T1QB 1IYOA 4QD4A 4FSFA 3B47A 3GECA 5FDSA 1C3BA 3IS2A 4LLOB 4E3IA 1K6RA 3HUMA 3V39A 1FR6A 3S7QA 1JWVA 5L09A 4S2NC 5F6AA 2JKRI 3IH8A 1OT9A 3DW0A 3UPPA 2E8IA 4BL3A 5IU1A 3T4QA 4X69A 4Y7PA 5FQ9A 5A90A 2JKTM 1NWZA 2VLGA 3IS2B 2ZQDA 1W8YA 4PMAA 2VGLM 4OPQA 5D3OA 1KGEA 3Q81A 5F82A 5EECA 1YMXA 2H0TA 1VETA 1K57A 1IELA 4KZ4A 4IVIA 3NCKA 3O5YA 4MMNA 4EW7A 4YFMA 5I94A 2XGNA 1L0EA 2JKTI 1GHPA 4B93A 5HL1A 2GJ3A 2HDSA 3A3JA 4WF0A 3CITA 3V5MA 1MWRA 2XFTA 4QB8A 3NJAA 4N1XA 4OOYA 5AJGA 4BD1A 1D7EA 1T19A 1VETB 2B5RA 4O01A 3P98A 2XK1A 4YWZA 4R3JA 5CXWA 3F1NA 4ZJ3A 3BFFA 2Y8HA 3CLOA 4JBFA 4CLCC 4GB7A 1GA9A 1LL8A 3MSHA 2QPNA 3C2WA 3NDEA 3A0RA 4UA7A 4ZRRA 4E3MA 3U2AA 5A91A 3RXWA 3ZQ5A 3KX0X 4Y5FA 2VX8A 4HESA 5DFYA 3IHAA 4KQDA 1U60A 3F1NB 3LO7A 3IHBA 1MZUA 2ZL1A 3T4JA 4LRXC 5FQMA 5MC7A 1NYMA 4MDZA 3VFFA 1KGGA 2HJ9C 3BQAA 3JYIA 4PHTA 5EVLA 4GOGA 4DE1A 1NXYA 1FCNA 4B88A 1Q2PA 1Z09A 4R3AA 1PNEA 2VV7A 1ERQA 3BLMA 1EROA 2VA0A 5EM1A 1SDNA 3ZCZA 2ZL1B 3S1YA 2BTFP 2ZMVA 2L0WA 4NKPA 2EFUA 5DFXA 1ZKJA 1RP5A 1GSWA 2Y2GA 1YKDA 2UWXA 3WS5A 4WM9A 4KZ9A 5HDSA 3T1SA 3MKFA 4S2MA 4ZTKA 4Q0JA 3BFCA 5M1AA 3IWIA 3OPPA 2JKFA 2WKPA 3D72A 3ITAA 1LSWA 5CTNA 4BD0A 1Q2QA 4O7DA 1W79A 5EM0A 2FFYA 3IXHA 4OKPA 3C5AA 3MJQA 1ACFA 4K0XA 4QPRA 5TR7A 1UGUA 4HP9A 4S2LA 1L0GA 1K56A 3GSGA 4LGWA 4M4XA 4CLCE 3LGOA 3BEBA 3C7VA 4F3LA 3A0SA 4CQHA 4WEKA 4X1MA 4Q0IA 4BWIA 3AGDA 3IT9A 4N9KA 1M40A 3LR0A 4BL2A 3LR3A 2ZD8A 1IOUA 3PBRA 3SW1A 2NUTC 5EPHA 4F3LB 2EX9A 3A0VA 3EGDC 3QP2A 4OOMA 4R3BA 4HEFA 2P7JA 3HLWA 4NEED 2Y2OA 3N7WA 3H7WA 4LCMA 4ETXA 5HSQA 2K31A 3S7NA 3DWKA 2WKHA 3VP3A 2XQZA 1L0DA 1HZOA 5TGFA
chains in the Genus database with same CATH topology
2XD5A 3UE1A 3WRZA 2DNSA 1LL9A 2X02A 3IF5A 1PYYA 2Y2NA 2XFSA 2WAEA 1JWZA 4GDBA 5E43A 3WWXA 3HVFA 3CJMA 5F1FA 2ZQ8A 4OPZA 4OLDA 3MBZA 3VP1A 3V50A 3AGEA 3GV9A 1GCEA 5EVIA 1ONGA 2QMIA 3UDXA 3UPNA 1VQQA 1L2SA 3HBRA 1XGJA 1N4OA 1E3UD 3LEZA 3E2KA 2DCFA 5F83A 2ZQ9A 1HVBA 3A3DA 2WKEA 3ZG0A 5FQKA 2WKIA 5GL9A 4KZ5A 4P0MA 1K54A 3IXBA 1M6KA 1EI5A 1WE4A 5CERA 3NY4A 4JPMA 5EOOA 4DRTA 1ES5A 3IF6C 3N4IA 3PBOA 4IEDA 4LENA 3GTCA 1PZPA 3MXRA 2I72A 3I7JA 3ITBA 4BJPA 4EV4A 2H5SA 4FD8A 1SDEA 5FAOA 1TEMA 5FQJA 4Y0OA 2BG1A 5EVIB 1VM1A 1MPLA 4QY5A 4RVAA 3MFDA 4ID4A 5FATA 1FOFA 1BLHA 1J9MA 1DY6A 4HBUA 4ZBEA 2IWBA 3UE0A 3LY3A 5FAPA 4PM9A 4A5RA 2JE5A 4RX3A 3GMWA 4WZ5C 4DE2A 3CZDA 1QMEA 5DF9A 1YLYA 1BT5A 1XP4A 1SCWA 4X6TA 3ZNTA 2JCHA 2WK0A 4WMCD 2HDQA 4U0XA 5AQAA 3IQAA 3QNCA 1KVLA 3HLCA 4ZJ1A 5M18A 4MNRA 2PBYA 1ES2A 5GLDA 1IYPA 4S2NA 3LCEA 1NZOA 2CC1A 1BSGA 2ZQ7A 4E3OA 3HLFA 3SH8A 4ZJ2A 1K38A 1LI9A 3VOZA 5FAQA 5M19A 4JKTA 4R23A 3Q1FA 5DF7A 2ZC5B 1FQGA 1YMSA 5FA7A 3UN7A 2HP5A 4JXWA 1BLSA 1YLJA 3VSKA 1BZAA 1DJBA 1XXMA 2XF3A 2ZJ9A 3G34A 5DTSA 4N92A 1WYBA 5KMWA 1H5XA 4Z9QA 3PTEA 5EVID 1MXOA 3DTMA 3HLEA 5CHMA 1K6SA 1ESUA 2BLSA 2WZZA 4KG5A 5E2EA 2WUQA 2V1ZA 3QHYA 4OONA 4KQRA 3O86A 2Q9NA 4QY6A 1ZG4A 3O87A 2XH9A 1WYCA 3GR2A 2X01A 1PW8A 4LV2A 2Z2MB 4NK3A 2Y2PA 4LV1A 2PU2A 3O88A 2G2UA 3LY4A 3SS5A 1I5QA 1KE3A 4JF5A 3WS0A 2EX8A 1ES4A 4P85A 4DF6A 1HTZA 2Y2IA 2Y2MA 2ZLYA 3G2YA 3OCNA 4U0TA 2JC7A 4NETA 1K55A 3FKVA 5HFOA 4OQIA 1XKZA 1XPBA 3ZVTA 4MEZA 1LL5A 4LV0A 4EQIA 5DTTA 3UO9A 1NZUA 1JWPA 4UHUA 5EVIC 3C7UA 1ONHA 4B4XA 1PZOA 1IEMA 5HARA 4LCLA 2Y2JA 4K91A 1PWDA 2Y91A 4MBFA 2Y4AA 1E4DA 3G2ZA 4N9LA 1K54C 5KSHA 5CGSA 3Q7ZA 4OVDA 4GN2A 4BQMA 4C6YA 2RL3A 1PI5A 4FH4A 3CMZA 4XUXA 3OPLA 1JVJA 3IWOA 3BM6A 4KZ6A 2Y2KA 1S0WA 3UNWA 1IYOA 4KQQA 1K4FA 4QD4A 3BYDA 3RXXA 2P74A 4KZBA 4H8RA 4FSFA 4MLLA 2Y2LA 1MWUA 4S2JA 1ZG6A 3M2KA 5U47A 1PI4A 1C3BA 4WBGA 2ZC6B 3G4PA 4OQGA 3IXDA 2WGIA 1SKFA 4X68A 4E3IA 1TDLA 1K6RA 4X55A 3HUMA 3V39A 5CECA 1FR6A 3UE3A 2RCXA 2ZM0A 3BRMA 1CI9A 4JF6A 3EQVA 5GHZA 3ZG9B 4KZ3A 1JWVA 5EUAA 4DE0A 4E3JA 4S2NC 1DJCA 2EXBA 2C6WB 2ZC4B 2G2WA 3IH8A 3DW0A 5HW3A 3SS3A 3PBQA 3UPPA 4DKIA 2E8IA 1G6AA 4KZAA 5E2HA 4BL3A 3IH9A 5EOEA 3G31A 2VGJA 3IXGA 4LV3A 2XEPA 2ZQAA 4X69A 4Y7PA 4UAAA 5FQ9A 4QHCA 5AQBA 4OH0A 3S22A 5A90A 5FQQA 3WRTA 2A3UA 2HP9A 5AQ7A 2ZQDA 1W8YA 3FKWA 4FH2A 4PMAA 4OPQA 2QZ6A 5CHJA 4E3KA 3UY6A 5CHUA 3ZVWA 2XD1A 2PU4A 1KGEA 1TVFA 3FYZA 3Q81A 5D3OA 3VSLA 4KENB 5F82A 5EECA 1KDSA 5BOHA 1I2SA 1MY8A 1YMXA 2H0TA 4BLMA 3EQUA 4XXRA 4X53A 1K57A 5IHVA 2GDNA 5FI7A 3GVBA 4UA9A 2JBFA 4KZ8A 1BULA 1IELA 5FDHA 4KZ4A 1JTGA 2P9VA 4IVIA 3HLDA 4RYEA 3NCKA 4YFMA 5I94A 2Y55A 2XGNA 3OPHA 3N6IA 1L0EA 2IWCA 1GHPA 4DDYA 4CJNA 4OLGA 5HL1A 3A3EA 1W8QA 3HLGA 4EBLA 2HDSA 3A3JA 2R9WA 2X71A 3ZNYA 3V3RA 3V5MA 1MWRA 2XFTA 3FWLA 4QB8A 4P87A 4HBTA 4N1XA 4OOYA 4BD1A 2OSUA 4E6XA 5HX9A 1YLPA 2B5RA 2DRWA 4JXSA 3P98A 2XK1A 4R3JA 1RGZA 4OPYA 2EX6A 1PIOA 2P9VB 5CXWA 4ZJ3A 1QMFA 3ZG8B 3BFFA 2HPBA 2ZM8A 4C75A 4EBNA 2V2FF 4JXVA 1XA1A 4IBRA 4PM8A 3SH7A 3ZDJA 4QJGA 3OC2A 4JBFA 2WADA 1IKIA 3TSGA 3PAEA 4GB7A 5GLBA 1GA9A 2WGVA 2QPNA 2HDUA 3NDEA 4GKUA 4DXBA 3G35A 3N8RA 1AXBA 3OPRA 4R4SA 4UA7A 4E3MA 4MBHA 2WYXA 5A91A 4Y0TA 3ZG5A 1YLWA 5E2GA 2ZMAA 1BLCA 3ZGAB 3RXWA 3C4PA 2H0YA 3IWQA 4N1HA 5E2FA 4UA6A 4EWFA 4ZDXA 5AQ9A 3ZFZA 3W8KA 4HESA 3G30A 1KVMA 3IHAA 1O07A 3D4FA 1CK3A 1U60A 3MZDA 4GD8A 4E3LA 3LO7A 3IHBA 5A92A 5FQMA 3A3FA 4S2PA 3Q7VA 4OQHA 1NYMA 4R0QA 4U3TA 3VFFA 2J9OA 1KGGA 3OZHA 3NDGA 4DE3A 4DXCA 5FASA 3JYIA 1RGYA 4JF4A 3S4XA 5A93A 5EVLA 3VMAA 1YLZA 3C4OA 1K25A 1FCMA 4GOGA 4DE1A 4CPKA 1IYQA 1NXYA 1FCNA 4OOLA 4B88A 5L2FA 2Y59A 4GD6A 1ERMA 1EWZA 2C5WB 3N8LA 3ZHHA 1Q2PA 2VGKA 4D2OA 4EBPA 3QNBA 3ZG7B 1XA7A 2WAFA 2XLNA 1ERQA 1Y54A 1PWCA 3Q82A 3VP4A 3BLMA 1EROA 2OLUA 2EFXA 1SDNA 3ZCZA 3UDFA 4KG6A 5CGXA 3S1YA 1FSWA 3Q7VB 3A3IA 3Q07A 2ZC7A 3HREA 4KQOA 2EFUA 4JXGA 1ZKJA 5HAPA 1W5DA 1K4EA 1RP5A 2ZC3B 5EE8A 2WZXA 4OP5A 1K57C 5CGWA 2OLVA 3BFEA 3NI9A 2Y2GA 3VOYA 1BTLA 2Z2LB 4KG2A 5KZHA 2IWDA 2UWXA 2Y2QA 3HLBA 3TG9A 3NC8A 3WS5A 4FCFA 4WM9A 4KZ9A 3PBNA 2H10A 4MBKA 3WS2A 1ALQA 2V20A 3HL9A 1E25A 5J8XA 4C3QA 3GRJA 3MKFA 4S2MA 1FCOA 1XGIA 4ZTKA 5GLCA 4IVKA 3BFCA 5M1AA 1DJAA 3IWIA 4IBXA 4Y0UA 3PBSA 3W4PA 1BUEA 4OQ0A 3OPPA 5FI2A 3SOIA 3BFDA 4ZAMA 5CRFA 2EX2A 4BENA 3RJUA 1OMEA 1ZC2A 1KGFA 3E2LA 2HP6A 3ITAA 5CTNA 4BD0A 4WEJA 1Q2QA 1JTDA 4O7DA 3O3VA 4RA7A 1W79A 1GHMA 1NJ4A 2R9XA 3SS4A 2A49A 3BLSA 3ISGA 5CTMA 4EUZA 2FFYA 3IXHA 5JYOA 4OKPA 4Q8IA 4K0WA 3M2JA 2HDRA 5DVAA 4WYYA 4E6WA 3B3XA 5HAQA 3C5AA 1GA0A 3SH9A 1NY0A 1CEGA 4K0XA 5TR7A 4L0LA 2J8YA 1GHIA 4QU3A 1ESIA 3IF6A 1RCJA 4S2LA 1BLPA 4WELA 1KE0A 1L0GA 1MWSA 1H8ZA 1K55C 1CEFA 1Z6FA 3WS1A 1K56A 5GLAA 3GSGA 3M6BA 5FSRA 4YINA 3PAGA 3FZCA 1LI0A 3BEBA 3C7VA 3MZFA 4GZBA 3G32A 4R1GA 1LLBA 5DTKA 3V3SA 3P09A 4KZ7A 3UPOA 5GHXA 4WEKA 1FSYA 2J7VA 1NYYA 4OPRA 1H8YA 4WZ5A 4E3NA 1YQSA 5DF8A 1N9BA 3DWZA 3AGDA 3IT9A 1E3UA 3OCLA 4N9KA 1LHYA 1M40A 4RX2A 3VFHA 2Q9MA 4BL2A 4DDSA 3IF6B 2ZD8A 1SHVA 4PPRA 2FFFB 3PBRA 3NIAA 1S6RA 1YLTA 4GNUA 4S2OA 2ZQCA 5JYPA 4S2IA 3AGFA 2WGWA 5EPHA 3WS4A 2EX9A 5CEDA 4M3KA 1KE4A 4GDNA 1NRFA 1YT4A 1FR1A 3HUOA 3NBLA 1MKIA 3W4QA 3VP0A 4OOMA 1XX2A 3MZEA 2ZM2A 3MXSA 4R3BA 3UDIA 5KSCA 1G68A 2J9PA 3W4OA 1ES3A 3BFGA 3PBTA 4PM7A 1PWGA 4HEFA 3HLWA 5F1GA 4P6BA 5CEBA 4B4ZA 1W7FA 2Y2OA 1I2WA 3N7WA 4X56A 3TOIA 1IKGA 5FQIA 4LCMA 2OV5A 1O7EA 3M6HA 3HUNA 4OP8A 1MWTA 5FI6A 1TDGA 4PM6A 3GQZA 1YM1A 4WZ4A 5HAIA 1CI8A 3MKEA 4WMCA 2EXAA 4R4RA 1MBLA 3BECA 3DWKA 2WKHA 1PW1A 3VP3A 2XQZA 4XUZA 3VP2A 1L0FA 2WGWB 4S2KA 1KDWA 2XR0A 4JLFA 1HD8A 1L0DA 3CG5A 1K56D 2XDMA 4PM5A 3N8SA 1IYSA 3FV7A 4F94A 1HZOA 5G18A 5TFQA 2Y2HA 5GHYA 5TGFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XD5 A;  3UE1 A;  3WRZ A;  2DNS A;  1LL9 A;  2X02 A;  3IF5 A;  1PYY A;  2Y2N A;  2XFS A;  2WAE A;  1JWZ A;  4GDB A;  5E43 A;  3WWX A;  3HVF A;  3CJM A;  5F1F A;  2ZQ8 A;  4OPZ A;  4OLD A;  3MBZ A;  3VP1 A;  3V50 A;  3AGE A;  3GV9 A;  1GCE A;  5EVI A;  1ONG A;  2QMI A;  3UDX A;  3UPN A;  1VQQ A;  1L2S A;  3HBR A;  1XGJ A;  1N4O A;  1E3U D;  3LEZ A;  3E2K A;  2DCF A;  5F83 A;  2ZQ9 A;  1HVB A;  3A3D A;  2WKE A;  3ZG0 A;  5FQK A;  2WKI A;  5GL9 A;  4KZ5 A;  4P0M A;  1K54 A;  3IXB A;  1M6K A;  1EI5 A;  1WE4 A;  5CER A;  3NY4 A;  4JPM A;  5EOO A;  4DRT A;  1ES5 A;  3IF6 C;  3N4I A;  3PBO A;  4IED A;  4LEN A;  3GTC A;  1PZP A;  3MXR A;  2I72 A;  3I7J A;  3ITB A;  4BJP A;  4EV4 A;  2H5S A;  4FD8 A;  1SDE A;  5FAO A;  1TEM A;  5FQJ A;  4Y0O A;  2BG1 A;  5EVI B;  1VM1 A;  1MPL A;  4QY5 A;  4RVA A;  3MFD A;  4ID4 A;  5FAT A;  1FOF A;  1BLH A;  1J9M A;  1DY6 A;  4HBU A;  4ZBE A;  2IWB A;  3UE0 A;  3LY3 A;  5FAP A;  4PM9 A;  4A5R A;  2JE5 A;  4RX3 A;  3GMW A;  4WZ5 C;  4DE2 A;  3CZD A;  1QME A;  5DF9 A;  1YLY A;  1BT5 A;  1XP4 A;  1SCW A;  4X6T A;  3ZNT A;  2JCH A;  2WK0 A;  4WMC D;  2HDQ A;  4U0X A;  5AQA A;  3IQA A;  3QNC A;  1KVL A;  3HLC A;  4ZJ1 A;  5M18 A;  4MNR A;  2PBY A;  1ES2 A;  5GLD A;  1IYP A;  4S2N A;  3LCE A;  1NZO A;  2CC1 A;  1BSG A;  2ZQ7 A;  4E3O A;  3HLF A;  3SH8 A;  4ZJ2 A;  1K38 A;  1LI9 A;  3VOZ A;  5FAQ A;  5M19 A;  4JKT A;  4R23 A;  3Q1F A;  5DF7 A;  2ZC5 B;  1FQG A;  1YMS A;  5FA7 A;  3UN7 A;  2HP5 A;  4JXW A;  1BLS A;  1YLJ A;  3VSK A;  1BZA A;  1DJB A;  1XXM A;  2XF3 A;  2ZJ9 A;  3G34 A;  5DTS A;  4N92 A;  1WYB A;  5KMW A;  1H5X A;  4Z9Q A;  3PTE A;  5EVI D;  1MXO A;  3DTM A;  3HLE A;  5CHM A;  1K6S A;  1ESU A;  2BLS A;  2WZZ A;  4KG5 A;  5E2E A;  2WUQ A;  2V1Z A;  3QHY A;  4OON A;  4KQR A;  3O86 A;  2Q9N A;  4QY6 A;  1ZG4 A;  3O87 A;  2XH9 A;  1WYC A;  3GR2 A;  2X01 A;  1PW8 A;  4LV2 A;  2Z2M B;  4NK3 A;  2Y2P A;  4LV1 A;  2PU2 A;  3O88 A;  2G2U A;  3LY4 A;  3SS5 A;  1I5Q A;  1KE3 A;  4JF5 A;  3WS0 A;  2EX8 A;  1ES4 A;  4P85 A;  4DF6 A;  1HTZ A;  2Y2I A;  2Y2M A;  2ZLY A;  3G2Y A;  3OCN A;  4U0T A;  2JC7 A;  4NET A;  1K55 A;  3FKV A;  5HFO A;  4OQI A;  1XKZ A;  1XPB A;  3ZVT A;  4MEZ A;  1LL5 A;  4LV0 A;  4EQI A;  5DTT A;  3UO9 A;  1NZU A;  1JWP A;  4UHU A;  5EVI C;  3C7U A;  1ONH A;  4B4X A;  1PZO A;  1IEM A;  5HAR A;  4LCL A;  2Y2J A;  4K91 A;  1PWD A;  2Y91 A;  4MBF A;  2Y4A A;  1E4D A;  3G2Z A;  4N9L A;  1K54 C;  5KSH A;  5CGS A;  3Q7Z A;  4OVD A;  4GN2 A;  4BQM A;  4C6Y A;  2RL3 A;  1PI5 A;  4FH4 A;  3CMZ A;  4XUX A;  3OPL A;  1JVJ A;  3IWO A;  3BM6 A;  4KZ6 A;  2Y2K A;  1S0W A;  3UNW A;  1IYO A;  4KQQ A;  1K4F A;  4QD4 A;  3BYD A;  3RXX A;  2P74 A;  4KZB A;  4H8R A;  4FSF A;  4MLL A;  2Y2L A;  1MWU A;  4S2J A;  1ZG6 A;  3M2K A;  5U47 A;  1PI4 A;  1C3B A;  4WBG A;  2ZC6 B;  3G4P A;  4OQG A;  3IXD A;  2WGI A;  1SKF A;  4X68 A;  4E3I A;  1TDL A;  1K6R A;  4X55 A;  3HUM A;  3V39 A;  5CEC A;  1FR6 A;  3UE3 A;  2RCX A;  2ZM0 A;  3BRM A;  1CI9 A;  4JF6 A;  3EQV A;  5GHZ A;  3ZG9 B;  4KZ3 A;  1JWV A;  5EUA A;  4DE0 A;  4E3J A;  4S2N C;  1DJC A;  2EXB A;  2C6W B;  2ZC4 B;  2G2W A;  3IH8 A;  3DW0 A;  5HW3 A;  3SS3 A;  3PBQ A;  3UPP A;  4DKI A;  2E8I A;  1G6A A;  4KZA A;  5E2H A;  4BL3 A;  3IH9 A;  5EOE A;  3G31 A;  2VGJ A;  3IXG A;  4LV3 A;  2XEP A;  2ZQA A;  4X69 A;  4Y7P A;  4UAA A;  5FQ9 A;  4QHC A;  5AQB A;  4OH0 A;  3S22 A;  5A90 A;  5FQQ A;  3WRT A;  2A3U A;  2HP9 A;  5AQ7 A;  2ZQD A;  1W8Y A;  3FKW A;  4FH2 A;  4PMA A;  4OPQ A;  2QZ6 A;  5CHJ A;  4E3K A;  3UY6 A;  5CHU A;  3ZVW A;  2XD1 A;  2PU4 A;  1KGE A;  1TVF A;  3FYZ A;  3Q81 A;  5D3O A;  3VSL A;  4KEN B;  5F82 A;  5EEC A;  1KDS A;  5BOH A;  1I2S A;  1MY8 A;  1YMX A;  2H0T A;  4BLM A;  3EQU A;  4XXR A;  4X53 A;  1K57 A;  5IHV A;  2GDN A;  5FI7 A;  3GVB A;  4UA9 A;  2JBF A;  4KZ8 A;  1BUL A;  1IEL A;  5FDH A;  4KZ4 A;  1JTG A;  2P9V A;  4IVI A;  3HLD A;  4RYE A;  3NCK A;  4YFM A;  5I94 A;  2Y55 A;  2XGN A;  3OPH A;  3N6I A;  1L0E A;  2IWC A;  1GHP A;  4DDY A;  4CJN A;  4OLG A;  5HL1 A;  3A3E A;  1W8Q A;  3HLG A;  4EBL A;  2HDS A;  3A3J A;  2R9W A;  2X71 A;  3ZNY A;  3V3R A;  3V5M A;  1MWR A;  2XFT A;  3FWL A;  4QB8 A;  4P87 A;  4HBT A;  4N1X A;  4OOY A;  4BD1 A;  2OSU A;  4E6X A;  5HX9 A;  1YLP A;  2B5R A;  2DRW A;  4JXS A;  3P98 A;  2XK1 A;  4R3J A;  1RGZ A;  4OPY A;  2EX6 A;  1PIO A;  2P9V B;  5CXW A;  4ZJ3 A;  1QMF A;  3ZG8 B;  3BFF A;  2HPB A;  2ZM8 A;  4C75 A;  4EBN A;  2V2F F;  4JXV A;  1XA1 A;  4IBR A;  4PM8 A;  3SH7 A;  3ZDJ A;  4QJG A;  3OC2 A;  4JBF A;  2WAD A;  1IKI A;  3TSG A;  3PAE A;  4GB7 A;  5GLB A;  1GA9 A;  2WGV A;  2QPN A;  2HDU A;  3NDE A;  4GKU A;  4DXB A;  3G35 A;  3N8R A;  1AXB A;  3OPR A;  4R4S A;  4UA7 A;  4E3M A;  4MBH A;  2WYX A;  5A91 A;  4Y0T A;  3ZG5 A;  1YLW A;  5E2G A;  2ZMA A;  1BLC A;  3ZGA B;  3RXW A;  3C4P A;  2H0Y A;  3IWQ A;  4N1H A;  5E2F A;  4UA6 A;  4EWF A;  4ZDX A;  5AQ9 A;  3ZFZ A;  3W8K A;  4HES A;  3G30 A;  1KVM A;  3IHA A;  1O07 A;  3D4F A;  1CK3 A;  1U60 A;  3MZD A;  4GD8 A;  4E3L A;  3LO7 A;  3IHB A;  5A92 A;  5FQM A;  3A3F A;  4S2P A;  3Q7V A;  4OQH A;  1NYM A;  4R0Q A;  4U3T A;  3VFF A;  2J9O A;  1KGG A;  3OZH A;  3NDG A;  4DE3 A;  4DXC A;  5FAS A;  3JYI A;  1RGY A;  4JF4 A;  3S4X A;  5A93 A;  5EVL A;  3VMA A;  1YLZ A;  3C4O A;  1K25 A;  1FCM A;  4GOG A;  4DE1 A;  4CPK A;  1IYQ A;  1NXY A;  1FCN A;  4OOL A;  4B88 A;  5L2F A;  2Y59 A;  4GD6 A;  1ERM A;  1EWZ A;  2C5W B;  3N8L A;  3ZHH A;  1Q2P A;  2VGK A;  4D2O A;  4EBP A;  3QNB A;  3ZG7 B;  1XA7 A;  2WAF A;  2XLN A;  1ERQ A;  1Y54 A;  1PWC A;  3Q82 A;  3VP4 A;  3BLM A;  1ERO A;  2OLU A;  2EFX A;  1SDN A;  3ZCZ A;  3UDF A;  4KG6 A;  5CGX A;  3S1Y A;  1FSW A;  3Q7V B;  3A3I A;  3Q07 A;  2ZC7 A;  3HRE A;  4KQO A;  2EFU A;  4JXG A;  1ZKJ A;  5HAP A;  1W5D A;  1K4E A;  1RP5 A;  2ZC3 B;  5EE8 A;  2WZX A;  4OP5 A;  1K57 C;  5CGW A;  2OLV A;  3BFE A;  3NI9 A;  2Y2G A;  3VOY A;  1BTL A;  2Z2L B;  4KG2 A;  5KZH A;  2IWD A;  2UWX A;  2Y2Q A;  3HLB A;  3TG9 A;  3NC8 A;  3WS5 A;  4FCF A;  4WM9 A;  4KZ9 A;  3PBN A;  2H10 A;  4MBK A;  3WS2 A;  1ALQ A;  2V20 A;  3HL9 A;  1E25 A;  5J8X A;  4C3Q A;  3GRJ A;  3MKF A;  4S2M A;  1FCO A;  1XGI A;  4ZTK A;  5GLC A;  4IVK A;  3BFC A;  5M1A A;  1DJA A;  3IWI A;  4IBX A;  4Y0U A;  3PBS A;  3W4P A;  1BUE A;  4OQ0 A;  3OPP A;  5FI2 A;  3SOI A;  3BFD A;  4ZAM A;  5CRF A;  2EX2 A;  4BEN A;  3RJU A;  1OME A;  1ZC2 A;  1KGF A;  3E2L A;  2HP6 A;  3ITA A;  5CTN A;  4BD0 A;  4WEJ A;  1Q2Q A;  1JTD A;  4O7D A;  3O3V A;  4RA7 A;  1W79 A;  1GHM A;  1NJ4 A;  2R9X A;  3SS4 A;  2A49 A;  3BLS A;  3ISG A;  5CTM A;  4EUZ A;  2FFY A;  3IXH A;  5JYO A;  4OKP A;  4Q8I A;  4K0W A;  3M2J A;  2HDR A;  5DVA A;  4WYY A;  4E6W A;  3B3X A;  5HAQ A;  3C5A A;  1GA0 A;  3SH9 A;  1NY0 A;  1CEG A;  4K0X A;  5TR7 A;  4L0L A;  2J8Y A;  1GHI A;  4QU3 A;  1ESI A;  3IF6 A;  1RCJ A;  4S2L A;  1BLP A;  4WEL A;  1KE0 A;  1L0G A;  1MWS A;  1H8Z A;  1K55 C;  1CEF A;  1Z6F A;  3WS1 A;  1K56 A;  5GLA A;  3GSG A;  3M6B A;  5FSR A;  4YIN A;  3PAG A;  3FZC A;  1LI0 A;  3BEB A;  3C7V A;  3MZF A;  4GZB A;  3G32 A;  4R1G A;  1LLB A;  5DTK A;  3V3S A;  3P09 A;  4KZ7 A;  3UPO A;  5GHX A;  4WEK A;  1FSY A;  2J7V A;  1NYY A;  4OPR A;  1H8Y A;  4WZ5 A;  4E3N A;  1YQS A;  5DF8 A;  1N9B A;  3DWZ A;  3AGD A;  3IT9 A;  1E3U A;  3OCL A;  4N9K A;  1LHY A;  1M40 A;  4RX2 A;  3VFH A;  2Q9M A;  4BL2 A;  4DDS A;  3IF6 B;  2ZD8 A;  1SHV A;  4PPR A;  2FFF B;  3PBR A;  3NIA A;  1S6R A;  1YLT A;  4GNU A;  4S2O A;  2ZQC A;  5JYP A;  4S2I A;  3AGF A;  2WGW A;  5EPH A;  3WS4 A;  2EX9 A;  5CED A;  4M3K A;  1KE4 A;  4GDN A;  1NRF A;  1YT4 A;  1FR1 A;  3HUO A;  3NBL A;  1MKI A;  3W4Q A;  3VP0 A;  4OOM A;  1XX2 A;  3MZE A;  2ZM2 A;  3MXS A;  4R3B A;  3UDI A;  5KSC A;  1G68 A;  2J9P A;  3W4O A;  1ES3 A;  3BFG A;  3PBT A;  4PM7 A;  1PWG A;  4HEF A;  3HLW A;  5F1G A;  4P6B A;  5CEB A;  4B4Z A;  1W7F A;  2Y2O A;  1I2W A;  3N7W A;  4X56 A;  3TOI A;  1IKG A;  5FQI A;  4LCM A;  2OV5 A;  1O7E A;  3M6H A;  3HUN A;  4OP8 A;  1MWT A;  5FI6 A;  1TDG A;  4PM6 A;  3GQZ A;  1YM1 A;  4WZ4 A;  5HAI A;  1CI8 A;  3MKE A;  4WMC A;  2EXA A;  4R4R A;  1MBL A;  3BEC A;  3DWK A;  2WKH A;  1PW1 A;  3VP3 A;  2XQZ A;  4XUZ A;  3VP2 A;  1L0F A;  2WGW B;  4S2K A;  1KDW A;  2XR0 A;  4JLF A;  1HD8 A;  1L0D A;  3CG5 A;  1K56 D;  2XDM A;  4PM5 A;  3N8S A;  1IYS A;  3FV7 A;  4F94 A;  1HZO A;  5G18 A;  5TFQ A;  2Y2H A;  5GHY A;  5TGF A; 
#chains in the Genus database with same CATH topology
 2XD5 A;  3KYE A;  3UE1 A;  3WRZ A;  3JPU A;  1PYY A;  2Y2N A;  3MR0 A;  2QYB A;  1N9N A;  3W2Z A;  2J3T C;  1GCE A;  3H7W B;  4EUV A;  3E0Y A;  2B18 A;  5F83 A;  5DKK A;  1HVB A;  5FQK A;  2WKI A;  1K54 A;  1FIL A;  2G7U A;  1CF0 A;  2PD8 A;  3CI6 A;  3NY4 A;  4JPM A;  5EOO A;  3ZYT A;  4WLA A;  4Y2F A;  4LEN A;  1PZP A;  2I72 A;  4BJP A;  2PT7 A;  1TEM A;  3K3C A;  4ID4 A;  3LEQ A;  1NRJ A;  1FOF A;  2O9A A;  3LY3 A;  4PM9 A;  2JE5 A;  4DE2 A;  2BAS A;  3CZD A;  1QME A;  2ZMF A;  1XP4 A;  2JCH A;  1LSX A;  5M18 A;  3BW6 A;  4Z1W A;  1ZHH B;  3HLF A;  3VOZ A;  4R23 A;  3Q1F A;  2ZC5 B;  1F2K A;  1YMS A;  5FA7 A;  3UN7 A;  1BLS A;  4I3J A;  3G34 A;  4BBV A;  1H5X A;  4Z9Q A;  2MJ6 A;  3HLE A;  2Z6C A;  2WZZ A;  4LRZ E;  5E2E A;  2WUQ A;  3KO6 A;  2Q9N A;  4QY6 A;  2V0U A;  4LV2 A;  4I3I A;  2FZ0 A;  4LV1 A;  2PU2 A;  3O88 A;  2G2U A;  1KE3 A;  1ES4 A;  4DF6 A;  4MN7 A;  2R78 A;  3T4O A;  5DTT A;  1JWP A;  5EVI C;  3C7U A;  5K5B A;  1UWP X;  1CQA A;  5CGS A;  3LIF A;  5KIZ A;  2LB9 A;  3MFX A;  1JVJ A;  3IWO A;  4IHQ A;  3UNW A;  2VJW A;  4L9E A;  2P74 A;  4HHD A;  3E4P A;  3IXD A;  3QP4 A;  2WGI A;  4HY8 A;  5HD5 A;  1TDL A;  1BYW A;  4X55 A;  3UE3 A;  1VHM A;  2RCX A;  3SZT A;  4E3J A;  3IX4 A;  2EXB A;  2ZC4 B;  5HW3 A;  3PBQ A;  3VE3 A;  4DKI A;  3MQ0 A;  4YNR A;  5EOE A;  3G31 A;  2VGJ A;  3IXG A;  2XEP A;  2ZQA A;  5L10 A;  3S22 A;  4R38 A;  3TE8 A;  2A3U A;  4NXF A;  3WRT A;  5AQ7 A;  2O99 A;  2VKS A;  2VV8 A;  4E3K A;  2XD1 A;  3FYZ A;  3K2N A;  2PYR A;  3D3O A;  4JGR A;  5HD3 A;  1I2S A;  3EQU A;  3LIA A;  5IHV A;  2GDN A;  4UA9 A;  4UQI S;  4JGQ A;  1BUL A;  5HWT A;  2OAQ 1;  3UE6 A;  2P9V A;  4RYE A;  3CUE A;  4NXE A;  3N6I A;  3FG8 A;  2J3W A;  2IWC A;  4KUO A;  2OWJ A;  4OLG A;  4PKY G;  3ZNY A;  3FWL A;  3QP1 A;  4HH2 A;  1RGZ A;  4OPY A;  2P9V B;  1QMF A;  3MF0 A;  3C38 A;  3KYQ A;  3LUQ A;  1XA1 A;  4IBR A;  4PM8 A;  3OC2 A;  2WAD A;  5L07 A;  3R7W A;  3DTE A;  2WGV A;  3KYZ A;  2HDU A;  4B9O A;  3N8R A;  1AXB A;  2K7S A;  4II7 A;  1CJF A;  2O0Y A;  5E2G A;  4EET B;  1BLC A;  2I9V A;  3NUL A;  3C4P A;  2H0Y A;  3IWQ A;  4DMZ A;  4ZDX A;  4EWF A;  5AVF A;  5AQ9 A;  3ZFZ A;  1JNU A;  4E3L A;  1ODV A;  1IFQ A;  5A92 A;  3A3F A;  3RFB A;  3OZH A;  4DXC A;  4DE3 A;  3R7W B;  5FAS A;  3S4X A;  2JKR M;  5FEG A;  4UQI M;  2EWV A;  3C4O A;  4ESP A;  1EW0 A;  3BQ8 A;  4WUJ A;  3LI8 A;  1G5U A;  5I5L A;  3N8L A;  3UB6 A;  2W27 A;  3QNB A;  4EEP A;  1XA7 A;  2O9B A;  1PWC A;  2EFX A;  4XT2 A;  3CPT A;  4Y17 A;  3A3I A;  3Q07 A;  2ZC7 A;  4JXG A;  3FPW A;  5HAP A;  1K4E A;  1K57 C;  2D01 A;  5KZH A;  4KG2 A;  2IWD A;  3NC8 A;  4FCF A;  3PBN A;  4LRY C;  2H10 A;  4BBU A;  1ALQ A;  3HL9 A;  2M7U A;  3E4O A;  2PDR A;  2QHK A;  1FCO A;  1XGI A;  3LR4 A;  5J7E A;  4XT2 B;  1DJA A;  3CPT B;  4IBX A;  3W4P A;  4OQ0 A;  1H3Q A;  5FI2 A;  3BFD A;  1SKO A;  4ZAM A;  3RJU A;  3BJN A;  1ZC2 A;  4WEJ A;  4RA7 A;  1LSV A;  3D9Y A;  5CX7 A;  5DJT A;  2A49 A;  3ISG A;  4K0W A;  3M2J A;  2VEA A;  4WYY A;  3B3X A;  5HAQ A;  3IX3 A;  1NY0 A;  4QU3 A;  2PAV P;  3EEH A;  2XSS A;  1ESI A;  1RCJ A;  1K55 C;  1Z6F A;  2HGV A;  3WS1 A;  5GLA A;  4IJG A;  5FSR A;  1SKO B;  4R1G A;  3P09 A;  3LIE A;  1FSY A;  4WZ5 A;  5HDC A;  3DWZ A;  3OCL A;  1LHY A;  3IBR A;  1SHV A;  3T4T A;  3DTK A;  4S2O A;  1GSV A;  3AGF A;  4S2I A;  3WS4 A;  2AVX A;  5CED A;  1KE4 A;  3E98 A;  1NRF A;  1YT4 A;  1FR1 A;  1NLY A;  3P01 A;  3VP0 A;  1XX2 A;  3UDI A;  1G68 A;  2J9P A;  1ES3 A;  3PBT A;  1PWG A;  5F1G A;  2E8J A;  5CEB A;  4YOF A;  3M6H A;  3HUN A;  4WZ4 A;  3MKE A;  1MBL A;  3VE4 A;  3BEC A;  4XUZ A;  3VP2 A;  1L0F A;  4S2K A;  4JGO A;  1S1Z A;  3HJI A;  2XDM A;  4KUK A;  4P6Z S;  5G18 A;  2X02 A;  3UMD A;  5E43 A;  2W3G A;  1JWZ A;  3WWX A;  3HVF A;  3CJM A;  5F5Y A;  2V9A A;  4OLD A;  3JVV A;  2GNX A;  2QMI A;  3UDX A;  1N4O A;  1E3U D;  3LEZ A;  3E2K A;  4K08 A;  1S4S A;  4MN6 A;  2ZQ9 A;  3VOL A;  4P0M A;  2PBD P;  4IED A;  1S67 L;  2V8C A;  4PAU A;  4EV4 A;  3ITB A;  2H5S A;  1SDE A;  4E04 A;  2NUP C;  3QP5 A;  5FQJ A;  4Y0O A;  1VM1 A;  4RVA A;  3MFD A;  5FAT A;  1BLH A;  3GMW A;  3OLO A;  1H0M A;  1YLY A;  2V1A A;  1SCW A;  2ZBB A;  4WMC D;  2HDQ A;  2FH5 A;  1KVL A;  2W3D A;  4D60 A;  2PBY A;  1ES2 A;  2P08 A;  3LCE A;  1BSG A;  3SH8 A;  4O0P A;  2WKR A;  2HP5 A;  1YLJ A;  1XJ3 A;  1DJB A;  1XXM A;  2XF3 A;  4P6Z M;  4G3V A;  1MXO A;  1K6S A;  3DBA A;  4KG5 A;  2H28 A;  1ZG4 A;  3O87 A;  3KSH A;  2O9C A;  5DKL A;  3SS5 A;  4JF5 A;  3WS0 A;  4GW9 A;  1P9W A;  3G2Y A;  2JC7 A;  3QP6 A;  4OQI A;  5HFO A;  4L9F A;  3ZVT A;  4EQI A;  3UO9 A;  1DP6 A;  4UHU A;  1ONH A;  3B33 A;  3PXP A;  4K91 A;  1PRQ A;  5EV0 A;  3G2Z A;  1K54 C;  4LFU A;  3RH8 B;  2INW A;  3K3D A;  2LB5 A;  2RL3 A;  2Y79 A;  3CWF A;  4XUX A;  3OPL A;  4KZ6 A;  1S0W A;  1YPR A;  3HJK A;  4KQQ A;  3BYD A;  4MN5 A;  4KZB A;  1MWU A;  1OPX A;  1ZG6 A;  5U47 A;  4WBG A;  4OQG A;  1SKF A;  1TD5 A;  2GX5 A;  2W1T A;  4EQ1 A;  3IX8 A;  3BRM A;  3EQV A;  4H6J A;  4KZ3 A;  5EUA A;  2OOL A;  1DJC A;  3SS3 A;  1G6A A;  5E2H A;  3IH9 A;  4QHC A;  4OH0 A;  2M1C A;  1KOU A;  3PR6 A;  2HP9 A;  1Y4O A;  3QP8 A;  2QZ6 A;  5CHJ A;  3UY6 A;  1TS6 A;  2W1T B;  3DTI A;  3VSL A;  2GZA A;  2IA2 A;  3NEC A;  1KDS A;  1S66 L;  5BOH A;  4HP4 A;  4HH3 A;  1MY8 A;  4H6J B;  4Y3I A;  5FI7 A;  2JBF A;  4KZ8 A;  3V67 A;  5FDH A;  1JTG A;  3HLD A;  4CLC D;  3RTY A;  1F5M A;  2WKQ A;  2Y55 A;  3OPH A;  5HWW A;  1OTD A;  2J80 A;  4BMW A;  3A3E A;  4EBL A;  1W63 M;  2X71 A;  4P87 A;  4HBT A;  4HJ3 A;  4E6X A;  5HX9 A;  3CAX A;  1MKM A;  3T4S A;  2DRW A;  4JXS A;  1PIO A;  2ZM8 A;  4C75 A;  4EBN A;  4JXV A;  3SH7 A;  4QJG A;  1OTB A;  3TSG A;  3PAE A;  4EU0 A;  4EES A;  4GKU A;  4DXB A;  4HNB A;  1DRM A;  3OOV A;  3OPR A;  1HLU P;  1DP9 A;  4MBH A;  2WYX A;  1YSQ A;  1YLW A;  3JVU A;  5G4Z A;  3ULF A;  4EXO A;  5E2F A;  4UA6 A;  2PHY A;  1VEU A;  3MS6 A;  1KVM A;  1O07 A;  4GD8 A;  4R70 A;  3Q7V A;  4OQH A;  4R0Q A;  4U3T A;  2OWH A;  1RGY A;  5EFW A;  1YLZ A;  2UV0 E;  1K25 A;  4CPK A;  1IYQ A;  2P04 A;  2Y59 A;  4GD6 A;  1ERM A;  3ZHH A;  3ZG7 B;  2HZ5 A;  1Y54 A;  1VEU B;  3Q82 A;  3VP4 A;  2ZOH A;  2OLU A;  3UDF A;  4KG6 A;  3E4Q A;  3MMH A;  3Q7V B;  1YAX A;  3HRE A;  4KQO A;  1W5D A;  2ZC3 B;  2WZX A;  5CGW A;  3BFE A;  3NI9 A;  3VOY A;  1BTL A;  2Z2L B;  2Y2Q A;  3HLB A;  3TG9 A;  3LYX A;  1G28 A;  4WL9 A;  3WS2 A;  5J8X A;  4Y13 A;  3GRJ A;  4IVK A;  2K2N A;  5F68 A;  4Y0U A;  3PBS A;  4EEU A;  4BEN A;  2EX2 A;  3F1O A;  1OME A;  3E2L A;  1TS8 A;  3UB8 A;  2V8F A;  1NJ4 A;  3SS4 A;  3BLS A;  5JYO A;  4Q8I A;  2PR6 A;  5DVA A;  2Z6D A;  4E6W A;  1GA0 A;  3SH9 A;  2J8Y A;  2A24 A;  3IF6 A;  4WEL A;  1KE0 A;  3P7N A;  1CEF A;  4GJ4 A;  3M6B A;  2B02 A;  3LR5 A;  3F1O B;  3MZF A;  4HOI A;  3G32 A;  5DTK A;  3V3S A;  3UPO A;  1TF1 A;  5GHX A;  4HQA A;  4OPR A;  5LBR A;  4E3N A;  4Q0H A;  1YQS A;  2QJ5 A;  1E3U A;  5TJJ A;  4RX2 A;  2A24 B;  4AFI A;  4DDS A;  3IF6 B;  1S4R A;  1OJG A;  3GDI A;  3PHY A;  1S6R A;  3G6O A;  3UME A;  1OTA A;  2WGW A;  5L8M A;  4M3K A;  4GDN A;  3LIC A;  3W4Q A;  2J3T D;  5KSC A;  2ZM2 A;  3MXS A;  4DJ2 A;  1P97 A;  3BFG A;  1A0K A;  4P6B A;  3R4K A;  4X56 A;  5FQI A;  1O7E A;  4OP8 A;  5FI6 A;  3TW8 A;  3GQZ A;  1YM1 A;  5HAI A;  4WMC A;  4R4R A;  3F1P A;  2WGW B;  2XR0 A;  4JLF A;  3CG5 A;  1FIK A;  3NOU C;  3H9W A;  3N8S A;  1AWI A;  4HJ4 A;  3EEA A;  5TFQ A;  5GHY A;  2EWW A;  3TRC A;  4GDB A;  2XFS A;  5HPI A;  5HL6 A;  1YSP A;  1P9R A;  4OPZ A;  3MBZ A;  3VP1 A;  3V50 A;  3GV9 A;  3UPN A;  5DJU A;  1VQQ A;  1L2S A;  3HBR A;  1XGJ A;  4NXG A;  4QWO A;  2DCF A;  2WKE A;  3F1P B;  1OJ5 A;  5GL9 A;  3KSG A;  5HDD A;  1EI5 A;  3HCY A;  1WE4 A;  5CER A;  4DRT A;  3N4I A;  3PBO A;  3MXR A;  3C30 A;  3I7J A;  2QWS A;  4QY5 A;  3BWL A;  5G4Y A;  1DY6 A;  2IWB A;  5J4E A;  3T50 A;  4A5R A;  1XJ4 A;  2VZW A;  4RX3 A;  4WZ5 C;  4HJ6 A;  5DF9 A;  5J3W A;  1N9L A;  2PR5 A;  3LFV A;  4MCW A;  2PRF A;  3QNC A;  4ZJ1 A;  4MNR A;  5GLD A;  5IT5 A;  3T4K A;  1IYP A;  4S2N A;  5HPF A;  4RQ9 A;  1NZO A;  2CC1 A;  2ZQ7 A;  1K38 A;  1LI9 A;  5FAQ A;  3L7H A;  2W3F A;  1FQG A;  4JXW A;  4GS9 A;  3BY9 A;  1BZA A;  5DTS A;  2ZJ9 A;  3FC7 A;  4N92 A;  5KMW A;  2B95 A;  3PTE A;  5EVI D;  5A8B A;  3DTM A;  2BLS A;  3U4L P;  4FTX A;  4OON A;  2XH9 A;  2YKF A;  2HV1 A;  3GR2 A;  2X01 A;  1PW8 A;  3NOT C;  2Z2M B;  1T1A A;  2Y2P A;  1GSX A;  1T1C A;  3LY4 A;  4GS9 B;  2Q0O A;  1I5Q A;  4ME4 A;  1HTZ A;  2ZLY A;  4NET A;  1K55 A;  3FKV A;  4DN0 A;  1XKZ A;  4MEZ A;  1LL5 A;  4WN5 A;  3CHW P;  3C8C A;  2QJ7 A;  5F69 A;  4NG2 A;  2XRO A;  3H82 A;  4B4X A;  3UB5 P;  4LCL A;  4MBF A;  3NHQ A;  1E4D A;  1WA9 A;  4JGP A;  2A2L A;  5KSH A;  1V9Y A;  4CLC A;  4GN2 A;  4BQM A;  4I38 A;  1W63 Q;  4FH4 A;  3CMZ A;  4DJ3 A;  4X1L A;  1K4F A;  4O8G A;  3RXX A;  3T1R A;  4H8R A;  1L3L A;  4MLL A;  2Y2L A;  1V9Z A;  3H82 B;  4S2J A;  3M2K A;  1PI4 A;  2ZC6 B;  3G4P A;  4L9G A;  4X68 A;  3VV4 A;  1S1Y A;  2KLI A;  2XRN A;  5CEC A;  2ZM0 A;  4CLC B;  2V1B A;  1CI9 A;  4JF6 A;  5GHZ A;  3ZG9 B;  4UEY A;  4DE0 A;  2C6W B;  2G2W A;  4KZA A;  4LV3 A;  4UAA A;  5AQB A;  5FQQ A;  3FKW A;  4FH2 A;  1K0K A;  4R6L A;  5CHU A;  3ZVW A;  2PU4 A;  1TVF A;  4KEN B;  2HF6 A;  5HWV A;  4BLM A;  4XXR A;  4X53 A;  3GVB A;  1XFN A;  4GHI A;  2DMW A;  4DDY A;  4CJN A;  1W8Q A;  3HLG A;  2R9W A;  3V3R A;  1J3W A;  5EVE A;  2OSU A;  1YLP A;  4NXB A;  2EX6 A;  2JN7 A;  3ZG8 B;  2HPB A;  2V2F F;  4GHI B;  4Y15 A;  3ZDJ A;  3EGX C;  3L9K A;  1IKI A;  5GLB A;  2QKP A;  4GLQ A;  3G35 A;  4R4S A;  4Y0T A;  3ZG5 A;  2ZMA A;  3ZGA B;  4N1H A;  3W8K A;  3S7O A;  3G30 A;  3D4F A;  1CK3 A;  1LT0 A;  2PYP A;  3MZD A;  4S2P A;  1STZ A;  2J9O A;  3NDG A;  4X25 A;  4ARZ A;  4JF4 A;  2KDK A;  5A93 A;  3VMA A;  1P0Z A;  1FCM A;  4OOL A;  5L2F A;  2C5W B;  1EWZ A;  4D2O A;  4EBP A;  2VGK A;  2WAF A;  2XLN A;  2L1M A;  1ZTU A;  2EA9 A;  4EER A;  5CGX A;  1OTE A;  1FSW A;  1OTI A;  4HI4 A;  3T1X A;  1DP8 A;  5EE8 A;  4ARZ B;  4OP5 A;  2OLV A;  3IBJ A;  2W0N A;  3NOP C;  4MBK A;  2V20 A;  1E25 A;  4C3Q A;  1XJ2 A;  2W3H A;  3UB7 A;  3T4L A;  5GLC A;  1BUE A;  3SOI A;  5CRF A;  2YKH A;  1KGF A;  2HP6 A;  3DAV A;  1JTD A;  3O3V A;  1GHM A;  2R9X A;  5CTM A;  4EUZ A;  2HDR A;  5FEF A;  2VV6 A;  1CEG A;  4L0L A;  1GHI A;  1BLP A;  4BBT A;  1MWS A;  1H8Z A;  1UWN X;  1OT6 A;  3FPV A;  4YIN A;  3PAG A;  3FZC A;  4LPZ A;  1LI0 A;  1D06 A;  3ICY A;  4GZB A;  1LLB A;  4KZ7 A;  2J7V A;  1NYY A;  2JKG A;  1H8Y A;  5HZH A;  1F98 A;  5DF8 A;  1N9B A;  3MXQ A;  2XA7 S;  2OAP 1;  3VFH A;  1H8M A;  2Q9M A;  4PPR A;  2FFF B;  4IUK A;  3NIA A;  1YLT A;  4GNU A;  4ETZ A;  2ZQC A;  5JYP A;  1N9O A;  3MQO A;  3HUO A;  1PFL A;  3NBL A;  1MKI A;  3MZE A;  3W4O A;  4PM7 A;  4B4Z A;  1W7F A;  1I2W A;  3TOI A;  1IKG A;  2OV5 A;  3MQQ A;  1MWT A;  1TDG A;  4PKY A;  4PM6 A;  1XFQ A;  1CI8 A;  2EXA A;  2ACG A;  4G3K A;  3LIB A;  1PW1 A;  1KDW A;  1HD8 A;  4PM5 A;  1K56 D;  2KX6 A;  1IYS A;  2V0W A;  3FV7 A;  4F94 A;  2Y2H A;  3PYP A;  4I3A A;  3LI9 A;  2DNS A;  1LL9 A;  3IF5 A;  2WAE A;  3LID A;  5F1F A;  2ZQ8 A;  3AGE A;  5EVI A;  1ONG A;  3CUE C;  2D02 A;  4I5S A;  3KSI A;  3A3D A;  3ZG0 A;  1MC0 A;  4G3W A;  4KZ5 A;  3IXB A;  2XA7 M;  2M7V A;  1M6K A;  5C5K A;  1VB6 A;  1X0O A;  1ES5 A;  3IF6 C;  4GCZ A;  3GTC A;  4FD8 A;  5FAO A;  2BG1 A;  5EVI B;  1MPL A;  2L4R A;  2ZOI A;  1J9M A;  4ZBE A;  4HBU A;  4HIA A;  3UE0 A;  5FAP A;  3UB9 A;  1BT5 A;  1F9I A;  1D1J A;  3TJZ C;  4X6T A;  3ZNT A;  2WK0 A;  5AQA A;  5TBM A;  4U0X A;  3IQA A;  3HLC A;  3S7P A;  5IS1 A;  1Y28 A;  3KSF A;  4E3O A;  4ZJ2 A;  5M19 A;  4JKT A;  1XJ6 A;  5DF7 A;  2JHE A;  3VSK A;  1WYB A;  1TS7 A;  2W3E A;  1T1B A;  4FUW A;  5CHM A;  5AVE A;  1ESU A;  5TBM B;  1G6O A;  2V1Z A;  3QHY A;  2HJE A;  4KQR A;  3O86 A;  1TS0 A;  1WYC A;  3BY8 A;  4NK3 A;  2EX8 A;  2KOI A;  4P85 A;  4FOF A;  3B42 A;  2Y2I A;  2Y2M A;  3OCN A;  2VGL S;  4U0T A;  3EWK A;  3EOI A;  1XPB A;  4IUH A;  4LV0 A;  3OBF A;  1NZU A;  1T18 A;  1PZO A;  1IEM A;  5HAR A;  2CMN A;  2Y2J A;  1PWD A;  2Y91 A;  3T12 B;  2Y4A A;  2PD7 A;  4N9L A;  2W1R A;  3Q7Z A;  4OVD A;  4C6Y A;  1PI5 A;  5FL3 A;  1SZV A;  1NLZ A;  2VK3 A;  3BM6 A;  2Y2K A;  4I39 A;  3T1Q B;  1IYO A;  4QD4 A;  4FSF A;  3B47 A;  3GEC A;  5FDS A;  1C3B A;  3IS2 A;  4LLO B;  4E3I A;  1K6R A;  3HUM A;  3V39 A;  1FR6 A;  3S7Q A;  1JWV A;  5L09 A;  4S2N C;  5F6A A;  2JKR I;  3IH8 A;  1OT9 A;  3DW0 A;  3UPP A;  2E8I A;  4BL3 A;  5IU1 A;  3T4Q A;  4X69 A;  4Y7P A;  5FQ9 A;  5A90 A;  2JKT M;  1NWZ A;  2VLG A;  3IS2 B;  2ZQD A;  1W8Y A;  4PMA A;  2VGL M;  4OPQ A;  5D3O A;  1KGE A;  3Q81 A;  5F82 A;  5EEC A;  1YMX A;  2H0T A;  1VET A;  1K57 A;  1IEL A;  4KZ4 A;  4IVI A;  3NCK A;  3O5Y A;  4MMN A;  4EW7 A;  4YFM A;  5I94 A;  2XGN A;  1L0E A;  2JKT I;  1GHP A;  4B93 A;  5HL1 A;  2GJ3 A;  2HDS A;  3A3J A;  4WF0 A;  3CIT A;  3V5M A;  1MWR A;  2XFT A;  4QB8 A;  3NJA A;  4N1X A;  4OOY A;  5AJG A;  4BD1 A;  1D7E A;  1T19 A;  1VET B;  2B5R A;  4O01 A;  3P98 A;  2XK1 A;  4YWZ A;  4R3J A;  5CXW A;  3F1N A;  4ZJ3 A;  3BFF A;  2Y8H A;  3CLO A;  4JBF A;  4CLC C;  4GB7 A;  1GA9 A;  1LL8 A;  3MSH A;  2QPN A;  3C2W A;  3NDE A;  3A0R A;  4UA7 A;  4ZRR A;  4E3M A;  3U2A A;  5A91 A;  3RXW A;  3ZQ5 A;  3KX0 X;  4Y5F A;  2VX8 A;  4HES A;  5DFY A;  3IHA A;  4KQD A;  1U60 A;  3F1N B;  3LO7 A;  3IHB A;  1MZU A;  2ZL1 A;  3T4J A;  4LRX C;  5FQM A;  5MC7 A;  1NYM A;  4MDZ A;  3VFF A;  1KGG A;  2HJ9 C;  3BQA A;  3JYI A;  4PHT A;  5EVL A;  4GOG A;  4DE1 A;  1NXY A;  1FCN A;  4B88 A;  1Q2P A;  1Z09 A;  4R3A A;  1PNE A;  2VV7 A;  1ERQ A;  3BLM A;  1ERO A;  2VA0 A;  5EM1 A;  1SDN A;  3ZCZ A;  2ZL1 B;  3S1Y A;  2BTF P;  2ZMV A;  2L0W A;  4NKP A;  2EFU A;  5DFX A;  1ZKJ A;  1RP5 A;  1GSW A;  2Y2G A;  1YKD A;  2UWX A;  3WS5 A;  4WM9 A;  4KZ9 A;  5HDS A;  3T1S A;  3MKF A;  4S2M A;  4ZTK A;  4Q0J A;  3BFC A;  5M1A A;  3IWI A;  3OPP A;  2JKF A;  2WKP A;  3D72 A;  3ITA A;  1LSW A;  5CTN A;  4BD0 A;  1Q2Q A;  4O7D A;  1W79 A;  5EM0 A;  2FFY A;  3IXH A;  4OKP A;  3C5A A;  3MJQ A;  1ACF A;  4K0X A;  4QPR A;  5TR7 A;  1UGU A;  4HP9 A;  4S2L A;  1L0G A;  1K56 A;  3GSG A;  4LGW A;  4M4X A;  4CLC E;  3LGO A;  3BEB A;  3C7V A;  4F3L A;  3A0S A;  4CQH A;  4WEK A;  4X1M A;  4Q0I A;  4BWI A;  3AGD A;  3IT9 A;  4N9K A;  1M40 A;  3LR0 A;  4BL2 A;  3LR3 A;  2ZD8 A;  1IOU A;  3PBR A;  3SW1 A;  2NUT C;  5EPH A;  4F3L B;  2EX9 A;  3A0V A;  3EGD C;  3QP2 A;  4OOM A;  4R3B A;  4HEF A;  2P7J A;  3HLW A;  4NEE D;  2Y2O A;  3N7W A;  3H7W A;  4LCM A;  4ETX A;  5HSQ A;  2K31 A;  3S7N A;  3DWK A;  2WKH A;  3VP3 A;  2XQZ A;  1L0D A;  1HZO A;  5TGF A; 
#chains in the Genus database with same CATH homology
 2XD5 A;  3UE1 A;  3WRZ A;  2DNS A;  1LL9 A;  2X02 A;  3IF5 A;  1PYY A;  2Y2N A;  2XFS A;  2WAE A;  1JWZ A;  4GDB A;  5E43 A;  3WWX A;  3HVF A;  3CJM A;  5F1F A;  2ZQ8 A;  4OPZ A;  4OLD A;  3MBZ A;  3VP1 A;  3V50 A;  3AGE A;  3GV9 A;  1GCE A;  5EVI A;  1ONG A;  2QMI A;  3UDX A;  3UPN A;  1VQQ A;  1L2S A;  3HBR A;  1XGJ A;  1N4O A;  1E3U D;  3LEZ A;  3E2K A;  2DCF A;  5F83 A;  2ZQ9 A;  1HVB A;  3A3D A;  2WKE A;  3ZG0 A;  5FQK A;  2WKI A;  5GL9 A;  4KZ5 A;  4P0M A;  1K54 A;  3IXB A;  1M6K A;  1EI5 A;  1WE4 A;  5CER A;  3NY4 A;  4JPM A;  5EOO A;  4DRT A;  1ES5 A;  3IF6 C;  3N4I A;  3PBO A;  4IED A;  4LEN A;  3GTC A;  1PZP A;  3MXR A;  2I72 A;  3I7J A;  3ITB A;  4BJP A;  4EV4 A;  2H5S A;  4FD8 A;  1SDE A;  5FAO A;  1TEM A;  5FQJ A;  4Y0O A;  2BG1 A;  5EVI B;  1VM1 A;  1MPL A;  4QY5 A;  4RVA A;  3MFD A;  4ID4 A;  5FAT A;  1FOF A;  1BLH A;  1J9M A;  1DY6 A;  4HBU A;  4ZBE A;  2IWB A;  3UE0 A;  3LY3 A;  5FAP A;  4PM9 A;  4A5R A;  2JE5 A;  4RX3 A;  3GMW A;  4WZ5 C;  4DE2 A;  3CZD A;  1QME A;  5DF9 A;  1YLY A;  1BT5 A;  1XP4 A;  1SCW A;  4X6T A;  3ZNT A;  2JCH A;  2WK0 A;  4WMC D;  2HDQ A;  4U0X A;  5AQA A;  3IQA A;  3QNC A;  1KVL A;  3HLC A;  4ZJ1 A;  5M18 A;  4MNR A;  2PBY A;  1ES2 A;  5GLD A;  1IYP A;  4S2N A;  3LCE A;  1NZO A;  2CC1 A;  1BSG A;  2ZQ7 A;  4E3O A;  3HLF A;  3SH8 A;  4ZJ2 A;  1K38 A;  1LI9 A;  3VOZ A;  5FAQ A;  5M19 A;  4JKT A;  4R23 A;  3Q1F A;  5DF7 A;  2ZC5 B;  1FQG A;  1YMS A;  5FA7 A;  3UN7 A;  2HP5 A;  4JXW A;  1BLS A;  1YLJ A;  3VSK A;  1BZA A;  1DJB A;  1XXM A;  2XF3 A;  2ZJ9 A;  3G34 A;  5DTS A;  4N92 A;  1WYB A;  5KMW A;  1H5X A;  4Z9Q A;  3PTE A;  5EVI D;  1MXO A;  3DTM A;  3HLE A;  5CHM A;  1K6S A;  1ESU A;  2BLS A;  2WZZ A;  4KG5 A;  5E2E A;  2WUQ A;  2V1Z A;  3QHY A;  4OON A;  4KQR A;  3O86 A;  2Q9N A;  4QY6 A;  1ZG4 A;  3O87 A;  2XH9 A;  1WYC A;  3GR2 A;  2X01 A;  1PW8 A;  4LV2 A;  2Z2M B;  4NK3 A;  2Y2P A;  4LV1 A;  2PU2 A;  3O88 A;  2G2U A;  3LY4 A;  3SS5 A;  1I5Q A;  1KE3 A;  4JF5 A;  3WS0 A;  2EX8 A;  1ES4 A;  4P85 A;  4DF6 A;  1HTZ A;  2Y2I A;  2Y2M A;  2ZLY A;  3G2Y A;  3OCN A;  4U0T A;  2JC7 A;  4NET A;  1K55 A;  3FKV A;  5HFO A;  4OQI A;  1XKZ A;  1XPB A;  3ZVT A;  4MEZ A;  1LL5 A;  4LV0 A;  4EQI A;  5DTT A;  3UO9 A;  1NZU A;  1JWP A;  4UHU A;  5EVI C;  3C7U A;  1ONH A;  4B4X A;  1PZO A;  1IEM A;  5HAR A;  4LCL A;  2Y2J A;  4K91 A;  1PWD A;  2Y91 A;  4MBF A;  2Y4A A;  1E4D A;  3G2Z A;  4N9L A;  1K54 C;  5KSH A;  5CGS A;  3Q7Z A;  4OVD A;  4GN2 A;  4BQM A;  4C6Y A;  2RL3 A;  1PI5 A;  4FH4 A;  3CMZ A;  4XUX A;  3OPL A;  1JVJ A;  3IWO A;  3BM6 A;  4KZ6 A;  2Y2K A;  1S0W A;  3UNW A;  1IYO A;  4KQQ A;  1K4F A;  4QD4 A;  3BYD A;  3RXX A;  2P74 A;  4KZB A;  4H8R A;  4FSF A;  4MLL A;  2Y2L A;  1MWU A;  4S2J A;  1ZG6 A;  3M2K A;  5U47 A;  1PI4 A;  1C3B A;  4WBG A;  2ZC6 B;  3G4P A;  4OQG A;  3IXD A;  2WGI A;  1SKF A;  4X68 A;  4E3I A;  1TDL A;  1K6R A;  4X55 A;  3HUM A;  3V39 A;  5CEC A;  1FR6 A;  3UE3 A;  2RCX A;  2ZM0 A;  3BRM A;  1CI9 A;  4JF6 A;  3EQV A;  5GHZ A;  3ZG9 B;  4KZ3 A;  1JWV A;  5EUA A;  4DE0 A;  4E3J A;  4S2N C;  1DJC A;  2EXB A;  2C6W B;  2ZC4 B;  2G2W A;  3IH8 A;  3DW0 A;  5HW3 A;  3SS3 A;  3PBQ A;  3UPP A;  4DKI A;  2E8I A;  1G6A A;  4KZA A;  5E2H A;  4BL3 A;  3IH9 A;  5EOE A;  3G31 A;  2VGJ A;  3IXG A;  4LV3 A;  2XEP A;  2ZQA A;  4X69 A;  4Y7P A;  4UAA A;  5FQ9 A;  4QHC A;  5AQB A;  4OH0 A;  3S22 A;  5A90 A;  5FQQ A;  3WRT A;  2A3U A;  2HP9 A;  5AQ7 A;  2ZQD A;  1W8Y A;  3FKW A;  4FH2 A;  4PMA A;  4OPQ A;  2QZ6 A;  5CHJ A;  4E3K A;  3UY6 A;  5CHU A;  3ZVW A;  2XD1 A;  2PU4 A;  1KGE A;  1TVF A;  3FYZ A;  3Q81 A;  5D3O A;  3VSL A;  4KEN B;  5F82 A;  5EEC A;  1KDS A;  5BOH A;  1I2S A;  1MY8 A;  1YMX A;  2H0T A;  4BLM A;  3EQU A;  4XXR A;  4X53 A;  1K57 A;  5IHV A;  2GDN A;  5FI7 A;  3GVB A;  4UA9 A;  2JBF A;  4KZ8 A;  1BUL A;  1IEL A;  5FDH A;  4KZ4 A;  1JTG A;  2P9V A;  4IVI A;  3HLD A;  4RYE A;  3NCK A;  4YFM A;  5I94 A;  2Y55 A;  2XGN A;  3OPH A;  3N6I A;  1L0E A;  2IWC A;  1GHP A;  4DDY A;  4CJN A;  4OLG A;  5HL1 A;  3A3E A;  1W8Q A;  3HLG A;  4EBL A;  2HDS A;  3A3J A;  2R9W A;  2X71 A;  3ZNY A;  3V3R A;  3V5M A;  1MWR A;  2XFT A;  3FWL A;  4QB8 A;  4P87 A;  4HBT A;  4N1X A;  4OOY A;  4BD1 A;  2OSU A;  4E6X A;  5HX9 A;  1YLP A;  2B5R A;  2DRW A;  4JXS A;  3P98 A;  2XK1 A;  4R3J A;  1RGZ A;  4OPY A;  2EX6 A;  1PIO A;  2P9V B;  5CXW A;  4ZJ3 A;  1QMF A;  3ZG8 B;  3BFF A;  2HPB A;  2ZM8 A;  4C75 A;  4EBN A;  2V2F F;  4JXV A;  1XA1 A;  4IBR A;  4PM8 A;  3SH7 A;  3ZDJ A;  4QJG A;  3OC2 A;  4JBF A;  2WAD A;  1IKI A;  3TSG A;  3PAE A;  4GB7 A;  5GLB A;  1GA9 A;  2WGV A;  2QPN A;  2HDU A;  3NDE A;  4GKU A;  4DXB A;  3G35 A;  3N8R A;  1AXB A;  3OPR A;  4R4S A;  4UA7 A;  4E3M A;  4MBH A;  2WYX A;  5A91 A;  4Y0T A;  3ZG5 A;  1YLW A;  5E2G A;  2ZMA A;  1BLC A;  3ZGA B;  3RXW A;  3C4P A;  2H0Y A;  3IWQ A;  4N1H A;  5E2F A;  4UA6 A;  4EWF A;  4ZDX A;  5AQ9 A;  3ZFZ A;  3W8K A;  4HES A;  3G30 A;  1KVM A;  3IHA A;  1O07 A;  3D4F A;  1CK3 A;  1U60 A;  3MZD A;  4GD8 A;  4E3L A;  3LO7 A;  3IHB A;  5A92 A;  5FQM A;  3A3F A;  4S2P A;  3Q7V A;  4OQH A;  1NYM A;  4R0Q A;  4U3T A;  3VFF A;  2J9O A;  1KGG A;  3OZH A;  3NDG A;  4DE3 A;  4DXC A;  5FAS A;  3JYI A;  1RGY A;  4JF4 A;  3S4X A;  5A93 A;  5EVL A;  3VMA A;  1YLZ A;  3C4O A;  1K25 A;  1FCM A;  4GOG A;  4DE1 A;  4CPK A;  1IYQ A;  1NXY A;  1FCN A;  4OOL A;  4B88 A;  5L2F A;  2Y59 A;  4GD6 A;  1ERM A;  1EWZ A;  2C5W B;  3N8L A;  3ZHH A;  1Q2P A;  2VGK A;  4D2O A;  4EBP A;  3QNB A;  3ZG7 B;  1XA7 A;  2WAF A;  2XLN A;  1ERQ A;  1Y54 A;  1PWC A;  3Q82 A;  3VP4 A;  3BLM A;  1ERO A;  2OLU A;  2EFX A;  1SDN A;  3ZCZ A;  3UDF A;  4KG6 A;  5CGX A;  3S1Y A;  1FSW A;  3Q7V B;  3A3I A;  3Q07 A;  2ZC7 A;  3HRE A;  4KQO A;  2EFU A;  4JXG A;  1ZKJ A;  5HAP A;  1W5D A;  1K4E A;  1RP5 A;  2ZC3 B;  5EE8 A;  2WZX A;  4OP5 A;  1K57 C;  5CGW A;  2OLV A;  3BFE A;  3NI9 A;  2Y2G A;  3VOY A;  1BTL A;  2Z2L B;  4KG2 A;  5KZH A;  2IWD A;  2UWX A;  2Y2Q A;  3HLB A;  3TG9 A;  3NC8 A;  3WS5 A;  4FCF A;  4WM9 A;  4KZ9 A;  3PBN A;  2H10 A;  4MBK A;  3WS2 A;  1ALQ A;  2V20 A;  3HL9 A;  1E25 A;  5J8X A;  4C3Q A;  3GRJ A;  3MKF A;  4S2M A;  1FCO A;  1XGI A;  4ZTK A;  5GLC A;  4IVK A;  3BFC A;  5M1A A;  1DJA A;  3IWI A;  4IBX A;  4Y0U A;  3PBS A;  3W4P A;  1BUE A;  4OQ0 A;  3OPP A;  5FI2 A;  3SOI A;  3BFD A;  4ZAM A;  5CRF A;  2EX2 A;  4BEN A;  3RJU A;  1OME A;  1ZC2 A;  1KGF A;  3E2L A;  2HP6 A;  3ITA A;  5CTN A;  4BD0 A;  4WEJ A;  1Q2Q A;  1JTD A;  4O7D A;  3O3V A;  4RA7 A;  1W79 A;  1GHM A;  1NJ4 A;  2R9X A;  3SS4 A;  2A49 A;  3BLS A;  3ISG A;  5CTM A;  4EUZ A;  2FFY A;  3IXH A;  5JYO A;  4OKP A;  4Q8I A;  4K0W A;  3M2J A;  2HDR A;  5DVA A;  4WYY A;  4E6W A;  3B3X A;  5HAQ A;  3C5A A;  1GA0 A;  3SH9 A;  1NY0 A;  1CEG A;  4K0X A;  5TR7 A;  4L0L A;  2J8Y A;  1GHI A;  4QU3 A;  1ESI A;  3IF6 A;  1RCJ A;  4S2L A;  1BLP A;  4WEL A;  1KE0 A;  1L0G A;  1MWS A;  1H8Z A;  1K55 C;  1CEF A;  1Z6F A;  3WS1 A;  1K56 A;  5GLA A;  3GSG A;  3M6B A;  5FSR A;  4YIN A;  3PAG A;  3FZC A;  1LI0 A;  3BEB A;  3C7V A;  3MZF A;  4GZB A;  3G32 A;  4R1G A;  1LLB A;  5DTK A;  3V3S A;  3P09 A;  4KZ7 A;  3UPO A;  5GHX A;  4WEK A;  1FSY A;  2J7V A;  1NYY A;  4OPR A;  1H8Y A;  4WZ5 A;  4E3N A;  1YQS A;  5DF8 A;  1N9B A;  3DWZ A;  3AGD A;  3IT9 A;  1E3U A;  3OCL A;  4N9K A;  1LHY A;  1M40 A;  4RX2 A;  3VFH A;  2Q9M A;  4BL2 A;  4DDS A;  3IF6 B;  2ZD8 A;  1SHV A;  4PPR A;  2FFF B;  3PBR A;  3NIA A;  1S6R A;  1YLT A;  4GNU A;  4S2O A;  2ZQC A;  5JYP A;  4S2I A;  3AGF A;  2WGW A;  5EPH A;  3WS4 A;  2EX9 A;  5CED A;  4M3K A;  1KE4 A;  4GDN A;  1NRF A;  1YT4 A;  1FR1 A;  3HUO A;  3NBL A;  1MKI A;  3W4Q A;  3VP0 A;  4OOM A;  1XX2 A;  3MZE A;  2ZM2 A;  3MXS A;  4R3B A;  3UDI A;  5KSC A;  1G68 A;  2J9P A;  3W4O A;  1ES3 A;  3BFG A;  3PBT A;  4PM7 A;  1PWG A;  4HEF A;  3HLW A;  5F1G A;  4P6B A;  5CEB A;  4B4Z A;  1W7F A;  2Y2O A;  1I2W A;  3N7W A;  4X56 A;  3TOI A;  1IKG A;  5FQI A;  4LCM A;  2OV5 A;  1O7E A;  3M6H A;  3HUN A;  4OP8 A;  1MWT A;  5FI6 A;  1TDG A;  4PM6 A;  3GQZ A;  1YM1 A;  4WZ4 A;  5HAI A;  1CI8 A;  3MKE A;  4WMC A;  2EXA A;  4R4R A;  1MBL A;  3BEC A;  3DWK A;  2WKH A;  1PW1 A;  3VP3 A;  2XQZ A;  4XUZ A;  3VP2 A;  1L0F A;  2WGW B;  4S2K A;  1KDW A;  2XR0 A;  4JLF A;  1HD8 A;  1L0D A;  3CG5 A;  1K56 D;  2XDM A;  4PM5 A;  3N8S A;  1IYS A;  3FV7 A;  4F94 A;  1HZO A;  5G18 A;  5TFQ A;  2Y2H A;  5GHY A;  5TGF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...