2NUTC

Crystal structure of the human sec23a/24a heterodimer, complexed with the snare protein sec22b
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
157
structure length
135
Chain Sequence
MVLLTMIARVADGLPLAASMQEDDLQQYQSQAKQLFRKLNEQSPTRCTLEAGAMTFHYIIEQGVCYLVLCEAAFPKKLAFAYLEDLHSEFDEQHGKKVPTVSRPYSFIEFDTFIQKTKKLYIDSRIMVANIEEVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Transport Signal on Sec22 for Packaging into COPII-Coated Vesicles is a Conformational Epitope
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Protein transport protein Sec23A
total genus 41
structure length 135
sequence length 157
ec nomenclature
pdb deposition date 2006-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13774 Longin Regulated-SNARE-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.50 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2nutC00
4B93A 3KYQA 2NUPC 2VX8A 2NUTC 3BW6A 1IOUA 1H8MA 2DMWA 3EGDC 1IFQA 3EGXC 4AFIA
chains in the Genus database with same CATH superfamily
3MZEA 5HAQA 1EW0A 2Q9MA 2QHKA 5G4ZA 4LCLA 2V8CA 3MKFA 4F3LA 1CEFA 3N8LA 1GA9A 2Y2JA 4JGOA 2GDNA 4JXWA 4JXVA 3JVVA 1PFLA 2GNXA 5BOHA 3NOPC 2JKFA 4P85A 3RXWA 4EERA 3IWOA 4Q0IA 3T1SA 4P6ZS 2ZM2A 2OAQ1 2V0WA 1XFNA 1DJBA 4UA9A 4FCFA 4YINA 2NUPC 2IWBA 1NZOA 2JKGA 1L2SA 5GLAA 1MKIA 4PM6A 4LV1A 3UMEA 1STZA 4MNRA 4BBVA 4DKIA 1YLJA 3CUEA 3E4QA 4WBGA 1JWPA 5FAOA 2Y91A 4KG2A 3T4SA 4N9LA 2ZOHA 3IWQA 3HCYA 4EESA 3QNBA 3DBAA 1BT5A 4R4SA 3M2KA 3NDGA 3TJZC 2H10A 1VB6A 5FEFA 3MBZA 3IX4A 1GHIA 1UGUA 3IH9A 3GECA 2V2FF 1LHYA 2XD1A 4QB8A 1OTBA 1YKDA 4GHIA 3K3DA 1YLYA 2PHYA 2XFTA 1W79A 2EXBA 4OLGA 3CITA 2W0NA 2Y2IA 5F5YA 4JF4A 2Y59A 3ZVTA 2K2NA 3GMWA 5F82A 2VZWA 3MJQA 3QP1A 4HBTA 5CEBA 1H3QA 3G4PA 5F83A 1S66L 5IU1A 3LI8A 1PI5A 3LEQA 2VGJA 1AWIA 1O07A 3EEAA 3JPUA 3UB9A 2KLIA 3PBQA 5FI7A 5MC7A 1NZUA 1H8MA 5FQMA 4R3AA 1KOUA 2VX8A 4DE1A 3MKEA 4UAAA 1JVJA 1FR1A 3TOIA 5EFWA 1H8YA 1N4OA 1EROA 4L0LA 2HP9A 2XK1A 1YQSA 4DDSA 4KQOA 1HLUP 2XDMA 1YSPA 2VJWA 3DTIA 1LLBA 3ZGAB 4E3KA 4GZBA 1UWPX 1SDNA 4OP8A 2M7VA 3UN7A 1FIKA 2DNSA 3CAXA 1D06A 2JKTM 2P74A 4KUOA 3WS0A 1IEMA 3K3CA 3R7WA 3IF6A 1XKZA 5HSQA 5AVEA 3MS6A 1FQGA 3ZFZA 4LV0A 3GVBA 2CC1A 3BEBA 3KYQA 3RJUA 2X01A 3P98A 3T4OA 1IYSA 2W1RA 3ZG7B 3HUNA 3ZG9B 4R4RA 3V3SA 2EA9A 4KZ5A 3P7NA 3EQUA 5L2FA 4IUKA 3VP1A 3HVFA 3IT9A 1TEMA 2Y2MA 5L8MA 1SZVA 2YKHA 4UEYA 4FUWA 4HI4A 4MN5A 3CPTB 4EUZA 3UY6A 5KMWA 4HJ4A 4Y5FA 2BTFP 3PTEA 3NCKA 4MDZA 3HUOA 5A90A 1IKIA 2JKRM 1LSWA 4E3IA 3T50A 2JKTI 5EM1A 1W63Q 1UWNX 3ZQ5A 3KYZA 1SKOA 2VK3A 3WRTA 1NLYA 2ZC7A 3ZG5A 2XEPA 5LBRA 1WA9A 3SH9A 1QMEA 4GDNA 4HIAA 3NHQA 4E6WA 2PYRA 4BL2A 1M6KA 3O87A 4AFIA 3O3VA 3IX3A 3BFGA 3S22A 2VV8A 1W7FA 2W27A 1O7EA 3ZDJA 3LY4A 2EX2A 2L4RA 1H0MA 4MLLA 1VM1A 4G3VA 1CEGA 4F94A 2VKSA 4PKYA 4B93A 5FQKA 4JGQA 5TJJA 4S2NC 1BLPA 4FTXA 2ZBBA 1D1JA 1WYBA 2PYPA 1XPBA 2VLGA 3MQ0A 4FH4A 4KZ8A 3H7WB 1K54C 4R1GA 5AJGA 5E43A 3SOIA 2DMWA 4QHCA 3C4PA 4OQIA 1MBLA 5J3WA 3OOVA 1NYMA 2A2LA 3BFCA 1XX2A 2OWJA 4GNUA 2D02A 1ESIA 2ZQ9A 3DTMA 3MXSA 2PU2A 2GJ3A 1T1CA 3S7OA 5L09A 3IBRA 4K0XA 3PYPA 4II7A 2Y55A 4LENA 3DW0A 2P7JA 2Y2OA 3LR5A 3IHAA 4XT2B 2IWCA 1W8YA 3SZTA 3EWKA 4ARZB 1YT4A 2L0WA 3ICYA 1K4FA 2WGIA 4MN6A 4MBHA 3A3DA 1C3BA 4OPZA 3NDEA 1LL5A 2B18A 3IQAA 5M19A 2XH9A 2ZC4B 2XROA 2W1TA 4EW7A 2Z2MB 1XGJA 3G30A 3QHYA 4L9GA 2Y2KA 5FL3A 4BMWA 3UB5P 4NXFA 1BTLA 1PZOA 1CK3A 1VHMA 3P01A 3UNWA 1FR6A 2VV7A 2GZAA 4ZJ2A 1S1ZA 1MWSA 2ZD8A 3FC7A 2LB5A 3VOZA 1W8QA 4WM9A 3LEZA 4HHDA 1P0ZA 4OPYA 2ZQDA 3KO6A 2R78A 4RX2A 2NUTC 4CLCC 4B88A 2QJ7A 3VP4A 3M6BA 5DJUA 1PNEA 3MXQA 5KZHA 4G3KA 3FKWA 3HJKA 3ITBA 3M2JA 4KZ3A 4KG6A 4OP5A 1ONHA 3IS2B 3RFBA 2H5SA 1E3UA 2BLSA 2Z6CA 3GV9A 5J4EA 1W63M 1WE4A 2WKIA 1CF0A 3L7HA 3VOYA 5FQQA 3AGDA 1RGYA 3N4IA 1S4RA 1FOFA 4GB7A 3VP3A 2WAEA 1OTAA 5HWTA 4H6JA 3W2ZA 5GL9A 5DTTA 3B33A 4X25A 4CLCD 3F1OB 1N9OA 2RCXA 3UDFA 2HZ5A 3S7PA 5EVIB 3JYIA 2X71A 3D72A 1K6RA 1FSWA 5EUAA 2HPBA 4O0PA 2IWDA 3UDIA 2WK0A 3GTCA 3MMHA 3CMZA 4KQQA 1HZOA 4S2OA 2JKRI 2OLUA 4EWFA 3VP0A 3W4PA 1KGEA 5HD3A 1JWZA 1ODVA 1PWCA 4HBUA 3BWLA 4EEPA 4GHIB 5FI6A 1V9YA 5EVLA 1BLHA 4O01A 4HEFA 3Q7VB 3OPHA 1BULA 3PR6A 5EVEA 1LSVA 4Y3IA 1KVLA 5EVIA 2A24A 2W3EA 4I38A 1PYYA 4U0TA 4R3JA 4XT2A 2JHEA 3K2NA 2QZ6A 1S6RA 2WZXA 2HJEA 4HOIA 4OONA 3LR3A 4XUXA 3FPWA 3EGDC 4M4XA 5A93A 4E3NA 3HREA 1AXBA 3OPRA 2M1CA 4R38A 3VV4A 4OOLA 2VV6A 4OKPA 1K55C 4BBUA 3QP2A 5AVFA 5DFXA 1GSWA 3IF6C 2EFUA 1PIOA 3OBFA 3BLSA 2JN7A 1XJ3A 3Q1FA 4GW9A 1XA1A 3B3XA 1DP9A 3G2YA 4IVKA 2M7UA 4YFMA 4Y2FA 1XFQA 3W4OA 4M3KA 2A3UA 2HDSA 4WMCD 5FDSA 4A5RA 5FI2A 1DRMA 2B95A 4U0XA 1ZHHB 3A3FA 3F1PA 3RH8B 2ZM0A 3PAEA 3VOLA 3A0SA 1L3LA 3TG9A 3UE6A 1JTGA 3D3OA 4RYEA 4S2LA 2Y79A 2V20A 5EECA 3MZFA 5G18A 3NIAA 3IF6B 4PKYG 4DE0A 3MFDA 1F5MA 4N9KA 3LY3A 5J7EA 4I39A 4HP4A 4WLAA 3P09A 4UQIS 4RQ9A 3ULFA 4P6BA 5GHXA 1DJCA 4O8GA 3T1QB 2V1AA 1ZG6A 2ZM8A 3DWKA 1YLPA 3F1NB 4OQGA 4ETXA 3CPTA 2XSSA 1JNUA 5A91A 3CI6A 3I7JA 1YLWA 1I2WA 3GRJA 2FFFB 3V3RA 3MF0A 3T1RA 1GSVA 1IYOA 4RVAA 3N8SA 2WKHA 1FCMA 2ZMFA 3ZHHA 5AQBA 4GS9B 4OOMA 4Z9QA 5FQJA 3ZNTA 4CJNA 1N9BA 3IHBA 3EQVA 2A24B 1ES4A 4UA7A 4ZRRA 1CQAA 3F1NA 5HDDA 3ZYTA 3NOTC 2PR6A 3OZHA 1N9LA 2Y2NA 2G2UA 4S2MA 5E2EA 4LRZE 5CECA 3QNCA 3MQQA 3VFHA 2ZQ7A 3TSGA 1OPXA 4CQHA 3SS5A 3O5YA 4NXEA 1K56A 2WKPA 4FSFA 3BJNA 2W3GA 1SDEA 2XA7M 4MMNA 2OLVA 3SW1A 3OLOA 1PWGA 3BW6A 5HZHA 3R4KA 3SH7A 4LV2A 2O0YA 3BLMA 1DY6A 4NG2A 3DAVA 3NC8A 4D60A 3ZG8B 1ES2A 3C38A 1ERMA 4U3TA 3ZVWA 5JYPA 2GX5A 3B42A 3A3IA 4I5SA 1MWUA 1NWZA 1VEUB 1VETB 3MSHA 1EI5A 5KSHA 1K56D 1YM1A 1CJFA 5CEDA 1S67L 2A49A 1L0GA 4Y7PA 5CXWA 4KZ7A 5HAPA 2LB9A 1K4EA 2HDUA 5CTNA 3MQOA 4OLDA 5FDHA 3Q07A 2XD5A 1CI9A 1ZG4A 4JBFA 3UB7A 2W3DA 3SS3A 1NRFA 4CLCA 4IBXA 4X6TA 2D01A 1Y4OA 5EPHA 4GLQA 1T18A 3IXHA 3NBLA 3KX0X 1GHMA 2PD7A 5U47A 3ITAA 2MJ6A 1TS0A 2W3HA 4OOYA 3V67A 2ZC6B 4L9FA 4EEUA 2J3WA 4QY6A 4S2PA 5GLBA 1OJ5A 1XJ4A 4I3IA 1OTEA 1PZPA 1FCOA 3QP8A 1JTDA 3GDIA 1KVMA 2WUQA 3UB6A 2KOIA 4CPKA 2ZMAA 1G6OA 2P9VA 2B5RA 4WZ5C 1OMEA 4Y17A 5AQ9A 1K38A 3U4LP 4ME4A 5G4YA 1RP5A 1Z09A 4EQIA 4WZ4A 1E3UD 3C2WA 3E4PA 1BUEA 5L10A 1S0WA 3WS1A 1GSXA 3C8CA 4FD8A 4DN0A 4PAUA 3IS2A 3LICA 3N7WA 4BBTA 5EOOA 4I3JA 1N9NA 4NXBA 4EQ1A 3H9WA 3T12B 3LIAA 5HAIA 2PAVP 2J3TC 4UHUA 2ZL1B 2WKRA 1WYCA 3BFFA 2WKEA 1KDSA 2PT7A 2I72A 2PR5A 4MBKA 3M6HA 4MN7A 4S2KA 1K6SA 3HLGA 1YMXA 5FAQA 1KGFA 3IXGA 3C30A 2HF6A 1Q2PA 4X56A 1NXYA 4Y0OA 1DP6A 4Z1WA 4GKUA 1ALQA 4X53A 4S2JA 1P9WA 5EVIC 1BLCA 3A3JA 1I5QA 2VGLS 2C5WB 2VA0A 3GQZA 4R0QA 5FA7A 4X1MA 3RXXA 3V39A 3Q82A 3KSIA 1P9RA 3BRMA 2OV5A 4KQRA 5F69A 2Y2QA 2P9VB 5TBMA 3LR4A 2X02A 5JYOA 3UPNA 5A8BA 1VQQA 1K55A 1OTIA 2ACGA 1MPLA 3UPPA 2ZC5B 3H82A 1IOUA 3V5MA 4JGPA 4Y13A 4GJ4A 2WGVA 1MZUA 1VETA 3BFEA 3F1OA 4WEJA 3W4QA 4RA7A 3D4FA 3U2AA 1LI9A 3S4XA 4NXGA 3S1YA 4H6JB 5KIZA 3FPVA 1KE0A 1BYWA 2OWHA 1K0KA 4KZ9A 5F68A 4IBRA 4EETB 3CJMA 4KENB 5I5LA 2EFXA 1A0KA 1ES3A 2Y2LA 1OJGA 1S1YA 2I9VA 3G6OA 1K57A 5HFOA 4DMZA 1F9IA 3WWXA 3BY9A 3NOUC 3E0YA 3LIFA 4NETA 4KZ6A 3E2LA 1Y54A 3PHYA 2PBYA 2XA7S 2YKFA 5CHUA 2ZQAA 3FZCA 2HJ9C 2E8IA 5E2HA 1FSYA 2FZ0A 3O88A 4ZAMA 4H8RA 3O86A 5DFYA 3ISGA 5EOEA 1LL8A 4Y0TA 2UWXA 1MKMA 1HVBA 3ZG0A 2PU4A 3VSLA 4JGRA 4X55A 3SH8A 3L9KA 4GCZA 3E4OA 1IKGA 4FOFA 1T1BA 3PBSA 2B02A 2INWA 1PWDA 1KDWA 2Y2GA 1X0OA 4PM5A 1TD5A 3T1XA 3H7WA 4KZAA 1ZKJA 4OPQA 4JXSA 1RGZA 4E6XA 1ES5A 1OT6A 1QMFA 3KSFA 3DTEA 2WKQA 3T4QA 2W1TB 4Y0UA 2WZZA 4PPRA 1U60A 1MY8A 1Z6FA 5HPFA 1FCNA 1V9ZA 3QP4A 1BLSA 1ERQA 5CX7A 4EU0A 4X68A 4HJ6A 4R70A 1MWTA 1FILA 3ZCZA 5D3OA 3S7NA 3CUEC 3VE3A 4E3LA 4GOGA 4LRYC 2C6WB 1Y28A 4LPZA 1LL9A 3LIEA 3C4OA 2H0YA 3C5AA 4IVIA 2UV0E 2XF3A 4P0MA 3A3EA 5TGFA 2P08A 1IYQA 4ZDXA 3OPPA 3IF5A 4UA6A 4NEED 5M18A 1GHPA 2H0TA 3FV7A 4L9EA 1TDGA 3HLFA 3GR2A 3FWLA 1GA0A 4P87A 4XXRA 4OQHA 1YLTA 4LGWA 5TR7A 4QWOA 2XRNA 2QJ5A 4JF5A 4MCWA 4NKPA 2JE5A 4K0WA 4C6YA 3OCLA 4PM7A 3IXDA 4KUKA 4MEZA 3HLDA 3LIBA 1XP4A 2O9BA 2ZC3B 4C75A 4HESA 4YOFA 3QP6A 1L0EA 4BD0A 3Q7ZA 1M40A 4R23A 3AGEA 3UE0A 5HDCA 1F98A 1XJ6A 3T4KA 5I94A 2FH5A 4WN5A 1L0FA 3NULA 3UE1A 2HV1A 5F1FA 3BYDA 5EM0A 4GS9A 2QKPA 3NECA 1LSXA 4RX3A 4B4ZA 3FYZA 2FFYA 3DTKA 5E2GA 2WAFA 2Y2PA 3LR0A 1I2SA 4IEDA 3HLWA 3KYEA 2Z6DA 2L1MA 3TRCA 3LUQA 3D9YA 1CI8A 5CHJA 5CHMA 4E3JA 2CMNA 4ZJ3A 4GDBA 2W3FA 5TBMB 4GD8A 4EBLA 5CTMA 4EBNA 3HUMA 4WUJA 3UE3A 3G2ZA 3B47A 4UQIM 2ZQ8A 3FKVA 3OC2A 3HBRA 2ZOIA 4QY5A 4GN2A 1D7EA 2DRWA 1H8ZA 1KE4A 2HP5A 3Q81A 2OAP1 3PBRA 2ZMVA 3W8KA 1SHVA 3AGFA 2ZQCA 2G7UA 1DP8A 1OTDA 2HP6A 3HLEA 2J80A 2P04A 2V1ZA 2WGWA 2J8YA 3IXBA 4K91A 3TE8A 5FASA 5IHVA 4OH0A 4Q8IA 4E3MA 3EEHA 3WS2A 5DF7A 4N1HA 4R6LA 3Q7VA 3A0VA 1GCEA 2JC7A 1IFQA 2ZL1A 1G6AA 1NYYA 4BJPA 2KDKA 4BQMA 1NRJA 5EV0A 2V0UA 1KGGA 2HDRA 3N6IA 1E4DA 1XGIA 4Y15A 1J9MA 2PDRA 5HPIA 2OSUA 3G31A 3PBTA 1ONGA 2EWVA 4E04A 2R9WA 4G3WA 1MXOA 1RCJA 4F3LB 4HP9A 5GHYA 5HL6A 1BZAA 4PM9A 3S7QA 1F2KA 3MZDA 3JVUA 3TW8A 3VMAA 4DE2A 3SS4A 5DKLA 1G28A 3VP2A 1XXMA 3H82B 4HJ3A 3PBOA 1PI4A 1NJ4A 4S2NA 4EBPA 5AQAA 3LO7A 3BECA 4WEKA 4LRXC 2XR0A 1YMSA 3CLOA 3MFXA 5DTSA 5DF9A 3BFDA 2QWSA 2XGNA 5DTKA 4OQ0A 2O99A 3WS5A 5FEGA 2EWWA 5E2FA 2K31A 4QU3A 1YLZA 1ZC2A 2PBDP 3T4JA 1TF1A 4K08A 3IBJA 5M1AA 4B4XA 4HNBA 2AVXA 2WGWB 3CWFA 3NY4A 2J7VA 5AQ7A 1HTZA 1Q2QA 3BM6A 2V1BA 2BASA 4N1XA 4CLCE 3QP5A 3GSGA 4HH3A 2QMIA 4E3OA 2PD8A 4IJGA 3IWIA 3VSKA 3C7UA 1MWRA 3FG8A 5TFQA 1E25A 4OVDA 2V8FA 3LGOA 3E2KA 4JXGA 3UPOA 2Q9NA 4WYYA 2PRFA 4YWZA 4ID4A 5HL1A 1SCWA 5DKKA 4LCMA 4KZBA 3UDXA 4DRTA 1OT9A 5F6AA 4ESPA 4ZBEA 5GLDA 2EX6A 5HWWA 1DJAA 4N92A 4JPMA 3CHWP 3G32A 3PBNA 5C5KA 4BLMA 2O9AA 1TDLA 2OOLA 3OCNA 3VE4A 4C3QA 4P6ZM 4S2IA 4EUVA 1XA7A 3UB8A 3VFFA 4ZTKA 4KZ4A 1PW8A 5DVAA 3RTYA 3NI9A 4DJ3A 3HLCA 4WF0A 4O7DA 4D2OA 1G68A 4DE3A 2J9PA 4EXOA 4LV3A 2EXAA 1ESUA 4GD6A 1T19A 3DWZA 3N8RA 4BL3A 1TS8A 4Q0HA 5F1GA 5KSCA 3E98A 3IH8A 4ETZA 3LFVA 4CLCB 5A92A 1YAXA 5FAPA 3KSGA 4WZ5A 4WMCA 5L07A 5CERA 2V9AA 4QD4A 1PRQA 5CRFA 4PMAA 4QJGA 5EVID 5HX9A 2ZLYA 1P97A 4FH2A 3CG5A 4BWIA 3LIDA 2KX6A 1W5DA 4X1LA 2HDQA 3A0RA 2H28A 5CGXA 4I3AA 4ARZA 4X69A 4JLFA 1ZTUA 1YSQA 5IS1A 1VEUA 2Y2HA 3WRZA 3HL9A 3T4TA 1JWVA 5HD5A 4NK3A 2O9CA 5FQ9A 3UMDA 3IX8A 1SKOB 5IT5A 1HD8A 3BQAA 2K7SA 2WADA 5FSRA 4QPRA 4HQAA 4JKTA 2Z2LB 4DF6A 2WYXA 3C7VA 4DDYA 1LT0A 1S4SA 3R7WB 3LI9A 1T1AA 3PAGA 4B9OA 3EGXC 2Y4AA 1BSGA 5DJTA 4PHTA 4WL9A 1KE3A 2E8JA 1ACFA 2EX8A 2Q0OA 3V50A 2QPNA 3MR0A 2G2WA 2R9XA 4ZJ1A 3HLBA 2IA2A 5HW3A 1TVFA 2DCFA 1TS6A 3HJIA 5HDSA 4IHQA 3NJAA 1J3WA 1IELA 2VGLM 4MBFA 1G5UA 5CGWA 4R3BA 2RL3A 5DF8A 3LYXA 4JF6A 4XUZA 4OPRA 2HGVA 4LFUA 3F1PB 3KSHA 1K25A 4YNRA 1EWZA 1YPRA 3G35A 2J9OA 4DXBA 2J3TD 4EV4A 3G34A 4DJ2A 5J8XA 1K54A 4WELA 3UO9A 3CZDA 5CGSA 2VGKA 4HH2A 5GHZA 2XFSA 5GLCA 4KQDA 1TS7A 2XQZA 5FATA 5FQIA 4PM8A 2EX9A 2Y8HA 4KG5A 5HWVA 5HARA 3MXRA 4Q0JA 2BG1A 4BENA 2QYBA 1K57C 3BY8A 3EOIA 3OPLA 3WS4A 1NY0A 4HY8A 2ZJ9A 2VEAA 1L0DA 4BD1A 4LLOB 5K5BA 3LCEA 1H5XA 4IUHA 1NLZA 1PW1A 2XLNA 2JBFA 1LI0A 3ZNYA 1MC0A 1XJ2A 3BQ8A 5EE8A 1IYPA 3PXPA 2JCHA 4DXCA 3T4LA 1SKFA
chains in the Genus database with same CATH topology
3MXQA 1EW0A 2QHKA 5G4ZA 4G3KA 4BJPA 4ME4A 3HJKA 5G4YA 4F3LA 2KDKA 1NRJA 4JGOA 3IS2B 3RFBA 2V0UA 3C2WA 3E4PA 3JVVA 2GNXA 2PDRA 5HPIA 3NOPC 2Z6CA 4EERA 4Q0IA 5J4EA 1W63M 1GSXA 4P6ZS 3C8CA 4DN0A 4PAUA 2OAQ1 3IS2A 3PBTA 2V0WA 2EWVA 4E04A 3LICA 1XFNA 4BBTA 4G3WA 4I3JA 1N9NA 1S4RA 4F3LB 4HP9A 4NXBA 4EQ1A 2NUPC 3H9WA 5HL6A 1OTAA 3LIAA 3S7QA 5HWTA 4H6JA 3W2ZA 2J3TC 3UMEA 2WKRA 1STZA 3B33A 3JVUA 3TW8A 4BBVA 4CLCD 3F1OB 2PT7A 3CUEA 2PR5A 3E4QA 1N9OA 4MN7A 5DKLA 3T4SA 2ZOHA 1G28A 3S7PA 3C30A 3HCYA 4EESA 3H82B 3DBAA 2HF6A 3D72A 4HJ3A 3PBOA 3TJZC 4O0PA 1VB6A 1DP6A 1UGUA 4Z1WA 3GECA 4WEKA 4LRXC 1OTBA 3MMHA 1YKDA 1P9WA 4GHIA 3K3DA 3CLOA 3MFXA 5DF9A 2VGLS 2VA0A 2JKRI 2PHYA 2QWSA 2O99A 5HD3A 2EWWA 1ODVA 3CITA 2K31A 2W0NA 3BWLA 3KSIA 1P9RA 4GHIB 4EEPA 5F69A 5F5YA 5TBMA 3LR4A 1V9YA 3T4JA 4O01A 2K2NA 5A8BA 3PR6A 2VZWA 1TF1A 3MJQA 4K08A 1OTIA 3IBJA 1H3QA 4HNBA 1LSVA 3H82A 1S66L 4Y3IA 1IOUA 5IU1A 2A24A 2W3EA 3LI8A 4JGPA 3CWFA 4I38A 4GJ4A 1MZUA 3EEAA 2V1BA 4XT2A 3UB9A 2BASA 3F1OA 2JHEA 2KLIA 3K2NA 4WEJA 3PBQA 4CLCE 4HH3A 3U2AA 5MC7A 2HJEA 4HOIA 4NXGA 3LR3A 3FPWA 2PD8A 1H8MA 4IJGA 3EGDC 4M4XA 4R3AA 4H6JB 3FG8A 5KIZA 1KOUA 2VX8A 3FPVA 1BYWA 2M1CA 4R38A 2OWHA 3VV4A 4OOLA 2VV6A 5F68A 4EETB 5EFWA 4BBUA 5I5LA 4L0LA 5AVFA 5DFXA 4YWZA 1GSWA 1OJGA 1S1YA 3OBFA 2I9VA 3G6OA 4DMZA 4KQOA 2JN7A 1F9IA 1XJ3A 5DKKA 3BY9A 3NOUC 3E0YA 3LIFA 4GW9A 1OT9A 5F6AA 3PHYA 1YSPA 2VJWA 2XA7S 2YKFA 1UWPX 1DP9A 5HWWA 2M7VA 2HJ9C 3PBNA 5C5KA 2FZ0A 2M7UA 5DFYA 2O9AA 3CAXA 1D06A 1XFQA 2OOLA 4Y2FA 2JKTM 3OCNA 3VE4A 1LL8A 4KUOA 1MKMA 4P6ZM 4EUVA 3K3CA 3R7WA 3UB8A 3RTYA 4DJ3A 5HSQA 1DRMA 4JGRA 5AVEA 1ZHHB 4WF0A 3F1PA 3RH8B 3VOLA 4GCZA 3E4OA 3A0SA 3UE6A 3D3OA 4EXOA 4FOFA 1T1BA 3KYQA 3PBSA 2Y79A 2B02A 3T4OA 2INWA 2W1RA 1T19A 1X0OA 1TS8A 1TD5A 4Q0HA 3H7WA 2EA9A 4PKYG 3P7NA 1F5MA 3EQUA 3E98A 4IUKA 5J7EA 4I39A 4ETZA 4HP4A 4WLAA 3LFVA 1OT6A 3KSFA 4CLCB 4UQIS 1YAXA 4RQ9A 5L8MA 3KSGA 3ULFA 2YKHA 2WKQA 4UEYA 2W1TB 3T4QA 2V9AA 4O8GA 4HI4A 2V1AA 5HPFA 1V9ZA 4MN5A 1P97A 4BWIA 3LIDA 2KX6A 3F1NB 4ETXA 4HJ4A 2XSSA 4Y5FA 1JNUA 5CX7A 4EU0A 3CI6A 4HJ6A 3A0RA 4MDZA 4R70A 2H28A 4I3AA 2JKRM 1LSWA 3MF0A 3T50A 4ARZA 1GSVA 3S7NA 2JKTI 1ZTUA 1W63Q 1YSQA 3CUEC 3VE3A 1UWNX 4LRYC 5IS1A 3ZQ5A 1Y28A 4LPZA 3KYZA 3LIEA 1NLYA 2ZMFA 3T4TA 5LBRA 5HD5A 1WA9A 2O9CA 3UMDA 5IT5A 4GS9B 4OOMA 4HIAA 3BQAA 2K7SA 3NHQA 4QPRA 2PYRA 4AFIA 4HQAA 3EQVA 2A24B 2P08A 2VV8A 2W27A 4ZRRA 4NEED 2L4RA 3F1NA 1LT0A 4L9EA 1S4SA 5HDDA 3ZYTA 3NOTC 4G3VA 3R7WB 2PR6A 2VKSA 4PKYA 4B93A 3LI9A 1N9LA 1T1AA 4JGQA 4B9OA 5TJJA 3EGXC 4LRZE 3MQQA 2XRNA 2QJ5A 5DJTA 4PHTA 4WL9A 1OPXA 2ZBBA 4MCWA 4NKPA 4CQHA 2PYPA 3OCLA 3O5YA 4KUKA 2VLGA 4NXEA 3MQ0A 2WKPA 3MR0A 3LIBA 4FSFA 2O9BA 3H7WB 3BJNA 5AJGA 4YOFA 2W3GA 2IA2A 2XA7M 2DMWA 4MMNA 3SW1A 3OLOA 1TS6A 3HJIA 5J3WA 5HDSA 3OOVA 5HDCA 3BW6A 2A2LA 1F98A 4IHQA 1XJ6A 3NJAA 3T4KA 2FH5A 5HZHA 4WN5A 2VGLM 3R4KA 2OWJA 2D02A 2O0YA 2HV1A 3LYXA 2HGVA 2GJ3A 1T1CA 3F1PB 3C38A 3S7OA 3KSHA 3IBRA 4YNRA 4GS9A 2QKPA 3PYPA 2GX5A 3B42A 4II7A 4I5SA 1LSXA 2J3TD 2P7JA 3LR5A 4DJ2A 1NWZA 4WELA 4XT2B 3LR0A 4HH2A 3EWKA 5KSHA 4ARZB 2L0WA 4KQDA 3ICYA 1S67L 1TS7A 4MN6A 2Z6DA 2L1MA 3TRCA 3LUQA 2CMNA 2LB9A 2W3FA 2Y8HA 2B18A 5TBMB 3MQOA 5HWVA 4Q0JA 2XROA 2W1TA 2QYBA 4EW7A 3BY8A 4WUJA 3UE3A 3UB7A 3B47A 4UQIM 3EOIA 3OC2A 2W3DA 4CLCA 2D01A 2ZOIA 4L9GA 1D7EA 4HY8A 5FL3A 4GLQA 1T18A 4BMWA 3KX0X 2VEAA 2PD7A 4NXFA 2OAP1 1VHMA 2MJ6A 3PBRA 3P01A 2ZMVA 2VV7A 2GZAA 1S1ZA 4LLOB 5K5BA 1TS0A 2G7UA 2W3HA 4IUHA 1NLZA 3FC7A 1DP8A 1OTDA 2LB5A 4HHDA 2J80A 2P04A 3V67A 1P0ZA 4L9FA 4EEUA 2J3WA 3TE8A 3KO6A 2R78A 1OJ5A 1MC0A 1XJ2A 1XJ4A 3BQ8A 4I3IA 1OTEA 2NUTC 4CLCC 3EEHA 3GDIA 3PXPA 4R6LA 2KOIA 3UB6A 2QJ7A 1G6OA 5DJUA 3A0VA 3T4LA 1IFQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B93 A;  3KYQ A;  2NUP C;  2VX8 A;  2NUT C;  3BW6 A;  1IOU A;  1H8M A;  2DMW A;  3EGD C;  1IFQ A;  3EGX C;  4AFI A; 
#chains in the Genus database with same CATH topology
 3MZE A;  5HAQ A;  1EW0 A;  2Q9M A;  2QHK A;  5G4Z A;  4LCL A;  2V8C A;  3MKF A;  4F3L A;  1CEF A;  3N8L A;  1GA9 A;  2Y2J A;  4JGO A;  2GDN A;  4JXW A;  4JXV A;  3JVV A;  1PFL A;  2GNX A;  5BOH A;  3NOP C;  2JKF A;  4P85 A;  3RXW A;  4EER A;  3IWO A;  4Q0I A;  3T1S A;  4P6Z S;  2ZM2 A;  2OAQ 1;  2V0W A;  1XFN A;  1DJB A;  4UA9 A;  4FCF A;  4YIN A;  2NUP C;  2IWB A;  1NZO A;  2JKG A;  1L2S A;  5GLA A;  1MKI A;  4PM6 A;  4LV1 A;  3UME A;  1STZ A;  4MNR A;  4BBV A;  4DKI A;  1YLJ A;  3CUE A;  3E4Q A;  4WBG A;  1JWP A;  5FAO A;  2Y91 A;  4KG2 A;  3T4S A;  4N9L A;  2ZOH A;  3IWQ A;  3HCY A;  4EES A;  3QNB A;  3DBA A;  1BT5 A;  4R4S A;  3M2K A;  3NDG A;  3TJZ C;  2H10 A;  1VB6 A;  5FEF A;  3MBZ A;  3IX4 A;  1GHI A;  1UGU A;  3IH9 A;  3GEC A;  2V2F F;  1LHY A;  2XD1 A;  4QB8 A;  1OTB A;  1YKD A;  4GHI A;  3K3D A;  1YLY A;  2PHY A;  2XFT A;  1W79 A;  2EXB A;  4OLG A;  3CIT A;  2W0N A;  2Y2I A;  5F5Y A;  4JF4 A;  2Y59 A;  3ZVT A;  2K2N A;  3GMW A;  5F82 A;  2VZW A;  3MJQ A;  3QP1 A;  4HBT A;  5CEB A;  1H3Q A;  3G4P A;  5F83 A;  1S66 L;  5IU1 A;  3LI8 A;  1PI5 A;  3LEQ A;  2VGJ A;  1AWI A;  1O07 A;  3EEA A;  3JPU A;  3UB9 A;  2KLI A;  3PBQ A;  5FI7 A;  5MC7 A;  1NZU A;  1H8M A;  5FQM A;  4R3A A;  1KOU A;  2VX8 A;  4DE1 A;  3MKE A;  4UAA A;  1JVJ A;  1FR1 A;  3TOI A;  5EFW A;  1H8Y A;  1N4O A;  1ERO A;  4L0L A;  2HP9 A;  2XK1 A;  1YQS A;  4DDS A;  4KQO A;  1HLU P;  2XDM A;  1YSP A;  2VJW A;  3DTI A;  1LLB A;  3ZGA B;  4E3K A;  4GZB A;  1UWP X;  1SDN A;  4OP8 A;  2M7V A;  3UN7 A;  1FIK A;  2DNS A;  3CAX A;  1D06 A;  2JKT M;  2P74 A;  4KUO A;  3WS0 A;  1IEM A;  3K3C A;  3R7W A;  3IF6 A;  1XKZ A;  5HSQ A;  5AVE A;  3MS6 A;  1FQG A;  3ZFZ A;  4LV0 A;  3GVB A;  2CC1 A;  3BEB A;  3KYQ A;  3RJU A;  2X01 A;  3P98 A;  3T4O A;  1IYS A;  2W1R A;  3ZG7 B;  3HUN A;  3ZG9 B;  4R4R A;  3V3S A;  2EA9 A;  4KZ5 A;  3P7N A;  3EQU A;  5L2F A;  4IUK A;  3VP1 A;  3HVF A;  3IT9 A;  1TEM A;  2Y2M A;  5L8M A;  1SZV A;  2YKH A;  4UEY A;  4FUW A;  4HI4 A;  4MN5 A;  3CPT B;  4EUZ A;  3UY6 A;  5KMW A;  4HJ4 A;  4Y5F A;  2BTF P;  3PTE A;  3NCK A;  4MDZ A;  3HUO A;  5A90 A;  1IKI A;  2JKR M;  1LSW A;  4E3I A;  3T50 A;  2JKT I;  5EM1 A;  1W63 Q;  1UWN X;  3ZQ5 A;  3KYZ A;  1SKO A;  2VK3 A;  3WRT A;  1NLY A;  2ZC7 A;  3ZG5 A;  2XEP A;  5LBR A;  1WA9 A;  3SH9 A;  1QME A;  4GDN A;  4HIA A;  3NHQ A;  4E6W A;  2PYR A;  4BL2 A;  1M6K A;  3O87 A;  4AFI A;  3O3V A;  3IX3 A;  3BFG A;  3S22 A;  2VV8 A;  1W7F A;  2W27 A;  1O7E A;  3ZDJ A;  3LY4 A;  2EX2 A;  2L4R A;  1H0M A;  4MLL A;  1VM1 A;  4G3V A;  1CEG A;  4F94 A;  2VKS A;  4PKY A;  4B93 A;  5FQK A;  4JGQ A;  5TJJ A;  4S2N C;  1BLP A;  4FTX A;  2ZBB A;  1D1J A;  1WYB A;  2PYP A;  1XPB A;  2VLG A;  3MQ0 A;  4FH4 A;  4KZ8 A;  3H7W B;  1K54 C;  4R1G A;  5AJG A;  5E43 A;  3SOI A;  2DMW A;  4QHC A;  3C4P A;  4OQI A;  1MBL A;  5J3W A;  3OOV A;  1NYM A;  2A2L A;  3BFC A;  1XX2 A;  2OWJ A;  4GNU A;  2D02 A;  1ESI A;  2ZQ9 A;  3DTM A;  3MXS A;  2PU2 A;  2GJ3 A;  1T1C A;  3S7O A;  5L09 A;  3IBR A;  4K0X A;  3PYP A;  4II7 A;  2Y55 A;  4LEN A;  3DW0 A;  2P7J A;  2Y2O A;  3LR5 A;  3IHA A;  4XT2 B;  2IWC A;  1W8Y A;  3SZT A;  3EWK A;  4ARZ B;  1YT4 A;  2L0W A;  3ICY A;  1K4F A;  2WGI A;  4MN6 A;  4MBH A;  3A3D A;  1C3B A;  4OPZ A;  3NDE A;  1LL5 A;  2B18 A;  3IQA A;  5M19 A;  2XH9 A;  2ZC4 B;  2XRO A;  2W1T A;  4EW7 A;  2Z2M B;  1XGJ A;  3G30 A;  3QHY A;  4L9G A;  2Y2K A;  5FL3 A;  4BMW A;  3UB5 P;  4NXF A;  1BTL A;  1PZO A;  1CK3 A;  1VHM A;  3P01 A;  3UNW A;  1FR6 A;  2VV7 A;  2GZA A;  4ZJ2 A;  1S1Z A;  1MWS A;  2ZD8 A;  3FC7 A;  2LB5 A;  3VOZ A;  1W8Q A;  4WM9 A;  3LEZ A;  4HHD A;  1P0Z A;  4OPY A;  2ZQD A;  3KO6 A;  2R78 A;  4RX2 A;  2NUT C;  4CLC C;  4B88 A;  2QJ7 A;  3VP4 A;  3M6B A;  5DJU A;  1PNE A;  3MXQ A;  5KZH A;  4G3K A;  3FKW A;  3HJK A;  3ITB A;  3M2J A;  4KZ3 A;  4KG6 A;  4OP5 A;  1ONH A;  3IS2 B;  3RFB A;  2H5S A;  1E3U A;  2BLS A;  2Z6C A;  3GV9 A;  5J4E A;  1W63 M;  1WE4 A;  2WKI A;  1CF0 A;  3L7H A;  3VOY A;  5FQQ A;  3AGD A;  1RGY A;  3N4I A;  1S4R A;  1FOF A;  4GB7 A;  3VP3 A;  2WAE A;  1OTA A;  5HWT A;  4H6J A;  3W2Z A;  5GL9 A;  5DTT A;  3B33 A;  4X25 A;  4CLC D;  3F1O B;  1N9O A;  2RCX A;  3UDF A;  2HZ5 A;  3S7P A;  5EVI B;  3JYI A;  2X71 A;  3D72 A;  1K6R A;  1FSW A;  5EUA A;  2HPB A;  4O0P A;  2IWD A;  3UDI A;  2WK0 A;  3GTC A;  3MMH A;  3CMZ A;  4KQQ A;  1HZO A;  4S2O A;  2JKR I;  2OLU A;  4EWF A;  3VP0 A;  3W4P A;  1KGE A;  5HD3 A;  1JWZ A;  1ODV A;  1PWC A;  4HBU A;  3BWL A;  4EEP A;  4GHI B;  5FI6 A;  1V9Y A;  5EVL A;  1BLH A;  4O01 A;  4HEF A;  3Q7V B;  3OPH A;  1BUL A;  3PR6 A;  5EVE A;  1LSV A;  4Y3I A;  1KVL A;  5EVI A;  2A24 A;  2W3E A;  4I38 A;  1PYY A;  4U0T A;  4R3J A;  4XT2 A;  2JHE A;  3K2N A;  2QZ6 A;  1S6R A;  2WZX A;  2HJE A;  4HOI A;  4OON A;  3LR3 A;  4XUX A;  3FPW A;  3EGD C;  4M4X A;  5A93 A;  4E3N A;  3HRE A;  1AXB A;  3OPR A;  2M1C A;  4R38 A;  3VV4 A;  4OOL A;  2VV6 A;  4OKP A;  1K55 C;  4BBU A;  3QP2 A;  5AVF A;  5DFX A;  1GSW A;  3IF6 C;  2EFU A;  1PIO A;  3OBF A;  3BLS A;  2JN7 A;  1XJ3 A;  3Q1F A;  4GW9 A;  1XA1 A;  3B3X A;  1DP9 A;  3G2Y A;  4IVK A;  2M7U A;  4YFM A;  4Y2F A;  1XFQ A;  3W4O A;  4M3K A;  2A3U A;  2HDS A;  4WMC D;  5FDS A;  4A5R A;  5FI2 A;  1DRM A;  2B95 A;  4U0X A;  1ZHH B;  3A3F A;  3F1P A;  3RH8 B;  2ZM0 A;  3PAE A;  3VOL A;  3A0S A;  1L3L A;  3TG9 A;  3UE6 A;  1JTG A;  3D3O A;  4RYE A;  4S2L A;  2Y79 A;  2V20 A;  5EEC A;  3MZF A;  5G18 A;  3NIA A;  3IF6 B;  4PKY G;  4DE0 A;  3MFD A;  1F5M A;  4N9K A;  3LY3 A;  5J7E A;  4I39 A;  4HP4 A;  4WLA A;  3P09 A;  4UQI S;  4RQ9 A;  3ULF A;  4P6B A;  5GHX A;  1DJC A;  4O8G A;  3T1Q B;  2V1A A;  1ZG6 A;  2ZM8 A;  3DWK A;  1YLP A;  3F1N B;  4OQG A;  4ETX A;  3CPT A;  2XSS A;  1JNU A;  5A91 A;  3CI6 A;  3I7J A;  1YLW A;  1I2W A;  3GRJ A;  2FFF B;  3V3R A;  3MF0 A;  3T1R A;  1GSV A;  1IYO A;  4RVA A;  3N8S A;  2WKH A;  1FCM A;  2ZMF A;  3ZHH A;  5AQB A;  4GS9 B;  4OOM A;  4Z9Q A;  5FQJ A;  3ZNT A;  4CJN A;  1N9B A;  3IHB A;  3EQV A;  2A24 B;  1ES4 A;  4UA7 A;  4ZRR A;  1CQA A;  3F1N A;  5HDD A;  3ZYT A;  3NOT C;  2PR6 A;  3OZH A;  1N9L A;  2Y2N A;  2G2U A;  4S2M A;  5E2E A;  4LRZ E;  5CEC A;  3QNC A;  3MQQ A;  3VFH A;  2ZQ7 A;  3TSG A;  1OPX A;  4CQH A;  3SS5 A;  3O5Y A;  4NXE A;  1K56 A;  2WKP A;  4FSF A;  3BJN A;  2W3G A;  1SDE A;  2XA7 M;  4MMN A;  2OLV A;  3SW1 A;  3OLO A;  1PWG A;  3BW6 A;  5HZH A;  3R4K A;  3SH7 A;  4LV2 A;  2O0Y A;  3BLM A;  1DY6 A;  4NG2 A;  3DAV A;  3NC8 A;  4D60 A;  3ZG8 B;  1ES2 A;  3C38 A;  1ERM A;  4U3T A;  3ZVW A;  5JYP A;  2GX5 A;  3B42 A;  3A3I A;  4I5S A;  1MWU A;  1NWZ A;  1VEU B;  1VET B;  3MSH A;  1EI5 A;  5KSH A;  1K56 D;  1YM1 A;  1CJF A;  5CED A;  1S67 L;  2A49 A;  1L0G A;  4Y7P A;  5CXW A;  4KZ7 A;  5HAP A;  2LB9 A;  1K4E A;  2HDU A;  5CTN A;  3MQO A;  4OLD A;  5FDH A;  3Q07 A;  2XD5 A;  1CI9 A;  1ZG4 A;  4JBF A;  3UB7 A;  2W3D A;  3SS3 A;  1NRF A;  4CLC A;  4IBX A;  4X6T A;  2D01 A;  1Y4O A;  5EPH A;  4GLQ A;  1T18 A;  3IXH A;  3NBL A;  3KX0 X;  1GHM A;  2PD7 A;  5U47 A;  3ITA A;  2MJ6 A;  1TS0 A;  2W3H A;  4OOY A;  3V67 A;  2ZC6 B;  4L9F A;  4EEU A;  2J3W A;  4QY6 A;  4S2P A;  5GLB A;  1OJ5 A;  1XJ4 A;  4I3I A;  1OTE A;  1PZP A;  1FCO A;  3QP8 A;  1JTD A;  3GDI A;  1KVM A;  2WUQ A;  3UB6 A;  2KOI A;  4CPK A;  2ZMA A;  1G6O A;  2P9V A;  2B5R A;  4WZ5 C;  1OME A;  4Y17 A;  5AQ9 A;  1K38 A;  3U4L P;  4ME4 A;  5G4Y A;  1RP5 A;  1Z09 A;  4EQI A;  4WZ4 A;  1E3U D;  3C2W A;  3E4P A;  1BUE A;  5L10 A;  1S0W A;  3WS1 A;  1GSX A;  3C8C A;  4FD8 A;  4DN0 A;  4PAU A;  3IS2 A;  3LIC A;  3N7W A;  4BBT A;  5EOO A;  4I3J A;  1N9N A;  4NXB A;  4EQ1 A;  3H9W A;  3T12 B;  3LIA A;  5HAI A;  2PAV P;  2J3T C;  4UHU A;  2ZL1 B;  2WKR A;  1WYC A;  3BFF A;  2WKE A;  1KDS A;  2PT7 A;  2I72 A;  2PR5 A;  4MBK A;  3M6H A;  4MN7 A;  4S2K A;  1K6S A;  3HLG A;  1YMX A;  5FAQ A;  1KGF A;  3IXG A;  3C30 A;  2HF6 A;  1Q2P A;  4X56 A;  1NXY A;  4Y0O A;  1DP6 A;  4Z1W A;  4GKU A;  1ALQ A;  4X53 A;  4S2J A;  1P9W A;  5EVI C;  1BLC A;  3A3J A;  1I5Q A;  2VGL S;  2C5W B;  2VA0 A;  3GQZ A;  4R0Q A;  5FA7 A;  4X1M A;  3RXX A;  3V39 A;  3Q82 A;  3KSI A;  1P9R A;  3BRM A;  2OV5 A;  4KQR A;  5F69 A;  2Y2Q A;  2P9V B;  5TBM A;  3LR4 A;  2X02 A;  5JYO A;  3UPN A;  5A8B A;  1VQQ A;  1K55 A;  1OTI A;  2ACG A;  1MPL A;  3UPP A;  2ZC5 B;  3H82 A;  1IOU A;  3V5M A;  4JGP A;  4Y13 A;  4GJ4 A;  2WGV A;  1MZU A;  1VET A;  3BFE A;  3F1O A;  4WEJ A;  3W4Q A;  4RA7 A;  3D4F A;  3U2A A;  1LI9 A;  3S4X A;  4NXG A;  3S1Y A;  4H6J B;  5KIZ A;  3FPV A;  1KE0 A;  1BYW A;  2OWH A;  1K0K A;  4KZ9 A;  5F68 A;  4IBR A;  4EET B;  3CJM A;  4KEN B;  5I5L A;  2EFX A;  1A0K A;  1ES3 A;  2Y2L A;  1OJG A;  1S1Y A;  2I9V A;  3G6O A;  1K57 A;  5HFO A;  4DMZ A;  1F9I A;  3WWX A;  3BY9 A;  3NOU C;  3E0Y A;  3LIF A;  4NET A;  4KZ6 A;  3E2L A;  1Y54 A;  3PHY A;  2PBY A;  2XA7 S;  2YKF A;  5CHU A;  2ZQA A;  3FZC A;  2HJ9 C;  2E8I A;  5E2H A;  1FSY A;  2FZ0 A;  3O88 A;  4ZAM A;  4H8R A;  3O86 A;  5DFY A;  3ISG A;  5EOE A;  1LL8 A;  4Y0T A;  2UWX A;  1MKM A;  1HVB A;  3ZG0 A;  2PU4 A;  3VSL A;  4JGR A;  4X55 A;  3SH8 A;  3L9K A;  4GCZ A;  3E4O A;  1IKG A;  4FOF A;  1T1B A;  3PBS A;  2B02 A;  2INW A;  1PWD A;  1KDW A;  2Y2G A;  1X0O A;  4PM5 A;  1TD5 A;  3T1X A;  3H7W A;  4KZA A;  1ZKJ A;  4OPQ A;  4JXS A;  1RGZ A;  4E6X A;  1ES5 A;  1OT6 A;  1QMF A;  3KSF A;  3DTE A;  2WKQ A;  3T4Q A;  2W1T B;  4Y0U A;  2WZZ A;  4PPR A;  1U60 A;  1MY8 A;  1Z6F A;  5HPF A;  1FCN A;  1V9Z A;  3QP4 A;  1BLS A;  1ERQ A;  5CX7 A;  4EU0 A;  4X68 A;  4HJ6 A;  4R70 A;  1MWT A;  1FIL A;  3ZCZ A;  5D3O A;  3S7N A;  3CUE C;  3VE3 A;  4E3L A;  4GOG A;  4LRY C;  2C6W B;  1Y28 A;  4LPZ A;  1LL9 A;  3LIE A;  3C4O A;  2H0Y A;  3C5A A;  4IVI A;  2UV0 E;  2XF3 A;  4P0M A;  3A3E A;  5TGF A;  2P08 A;  1IYQ A;  4ZDX A;  3OPP A;  3IF5 A;  4UA6 A;  4NEE D;  5M18 A;  1GHP A;  2H0T A;  3FV7 A;  4L9E A;  1TDG A;  3HLF A;  3GR2 A;  3FWL A;  1GA0 A;  4P87 A;  4XXR A;  4OQH A;  1YLT A;  4LGW A;  5TR7 A;  4QWO A;  2XRN A;  2QJ5 A;  4JF5 A;  4MCW A;  4NKP A;  2JE5 A;  4K0W A;  4C6Y A;  3OCL A;  4PM7 A;  3IXD A;  4KUK A;  4MEZ A;  3HLD A;  3LIB A;  1XP4 A;  2O9B A;  2ZC3 B;  4C75 A;  4HES A;  4YOF A;  3QP6 A;  1L0E A;  4BD0 A;  3Q7Z A;  1M40 A;  4R23 A;  3AGE A;  3UE0 A;  5HDC A;  1F98 A;  1XJ6 A;  3T4K A;  5I94 A;  2FH5 A;  4WN5 A;  1L0F A;  3NUL A;  3UE1 A;  2HV1 A;  5F1F A;  3BYD A;  5EM0 A;  4GS9 A;  2QKP A;  3NEC A;  1LSX A;  4RX3 A;  4B4Z A;  3FYZ A;  2FFY A;  3DTK A;  5E2G A;  2WAF A;  2Y2P A;  3LR0 A;  1I2S A;  4IED A;  3HLW A;  3KYE A;  2Z6D A;  2L1M A;  3TRC A;  3LUQ A;  3D9Y A;  1CI8 A;  5CHJ A;  5CHM A;  4E3J A;  2CMN A;  4ZJ3 A;  4GDB A;  2W3F A;  5TBM B;  4GD8 A;  4EBL A;  5CTM A;  4EBN A;  3HUM A;  4WUJ A;  3UE3 A;  3G2Z A;  3B47 A;  4UQI M;  2ZQ8 A;  3FKV A;  3OC2 A;  3HBR A;  2ZOI A;  4QY5 A;  4GN2 A;  1D7E A;  2DRW A;  1H8Z A;  1KE4 A;  2HP5 A;  3Q81 A;  2OAP 1;  3PBR A;  2ZMV A;  3W8K A;  1SHV A;  3AGF A;  2ZQC A;  2G7U A;  1DP8 A;  1OTD A;  2HP6 A;  3HLE A;  2J80 A;  2P04 A;  2V1Z A;  2WGW A;  2J8Y A;  3IXB A;  4K91 A;  3TE8 A;  5FAS A;  5IHV A;  4OH0 A;  4Q8I A;  4E3M A;  3EEH A;  3WS2 A;  5DF7 A;  4N1H A;  4R6L A;  3Q7V A;  3A0V A;  1GCE A;  2JC7 A;  1IFQ A;  2ZL1 A;  1G6A A;  1NYY A;  4BJP A;  2KDK A;  4BQM A;  1NRJ A;  5EV0 A;  2V0U A;  1KGG A;  2HDR A;  3N6I A;  1E4D A;  1XGI A;  4Y15 A;  1J9M A;  2PDR A;  5HPI A;  2OSU A;  3G31 A;  3PBT A;  1ONG A;  2EWV A;  4E04 A;  2R9W A;  4G3W A;  1MXO A;  1RCJ A;  4F3L B;  4HP9 A;  5GHY A;  5HL6 A;  1BZA A;  4PM9 A;  3S7Q A;  1F2K A;  3MZD A;  3JVU A;  3TW8 A;  3VMA A;  4DE2 A;  3SS4 A;  5DKL A;  1G28 A;  3VP2 A;  1XXM A;  3H82 B;  4HJ3 A;  3PBO A;  1PI4 A;  1NJ4 A;  4S2N A;  4EBP A;  5AQA A;  3LO7 A;  3BEC A;  4WEK A;  4LRX C;  2XR0 A;  1YMS A;  3CLO A;  3MFX A;  5DTS A;  5DF9 A;  3BFD A;  2QWS A;  2XGN A;  5DTK A;  4OQ0 A;  2O99 A;  3WS5 A;  5FEG A;  2EWW A;  5E2F A;  2K31 A;  4QU3 A;  1YLZ A;  1ZC2 A;  2PBD P;  3T4J A;  1TF1 A;  4K08 A;  3IBJ A;  5M1A A;  4B4X A;  4HNB A;  2AVX A;  2WGW B;  3CWF A;  3NY4 A;  2J7V A;  5AQ7 A;  1HTZ A;  1Q2Q A;  3BM6 A;  2V1B A;  2BAS A;  4N1X A;  4CLC E;  3QP5 A;  3GSG A;  4HH3 A;  2QMI A;  4E3O A;  2PD8 A;  4IJG A;  3IWI A;  3VSK A;  3C7U A;  1MWR A;  3FG8 A;  5TFQ A;  1E25 A;  4OVD A;  2V8F A;  3LGO A;  3E2K A;  4JXG A;  3UPO A;  2Q9N A;  4WYY A;  2PRF A;  4YWZ A;  4ID4 A;  5HL1 A;  1SCW A;  5DKK A;  4LCM A;  4KZB A;  3UDX A;  4DRT A;  1OT9 A;  5F6A A;  4ESP A;  4ZBE A;  5GLD A;  2EX6 A;  5HWW A;  1DJA A;  4N92 A;  4JPM A;  3CHW P;  3G32 A;  3PBN A;  5C5K A;  4BLM A;  2O9A A;  1TDL A;  2OOL A;  3OCN A;  3VE4 A;  4C3Q A;  4P6Z M;  4S2I A;  4EUV A;  1XA7 A;  3UB8 A;  3VFF A;  4ZTK A;  4KZ4 A;  1PW8 A;  5DVA A;  3RTY A;  3NI9 A;  4DJ3 A;  3HLC A;  4WF0 A;  4O7D A;  4D2O A;  1G68 A;  4DE3 A;  2J9P A;  4EXO A;  4LV3 A;  2EXA A;  1ESU A;  4GD6 A;  1T19 A;  3DWZ A;  3N8R A;  4BL3 A;  1TS8 A;  4Q0H A;  5F1G A;  5KSC A;  3E98 A;  3IH8 A;  4ETZ A;  3LFV A;  4CLC B;  5A92 A;  1YAX A;  5FAP A;  3KSG A;  4WZ5 A;  4WMC A;  5L07 A;  5CER A;  2V9A A;  4QD4 A;  1PRQ A;  5CRF A;  4PMA A;  4QJG A;  5EVI D;  5HX9 A;  2ZLY A;  1P97 A;  4FH2 A;  3CG5 A;  4BWI A;  3LID A;  2KX6 A;  1W5D A;  4X1L A;  2HDQ A;  3A0R A;  2H28 A;  5CGX A;  4I3A A;  4ARZ A;  4X69 A;  4JLF A;  1ZTU A;  1YSQ A;  5IS1 A;  1VEU A;  2Y2H A;  3WRZ A;  3HL9 A;  3T4T A;  1JWV A;  5HD5 A;  4NK3 A;  2O9C A;  5FQ9 A;  3UMD A;  3IX8 A;  1SKO B;  5IT5 A;  1HD8 A;  3BQA A;  2K7S A;  2WAD A;  5FSR A;  4QPR A;  4HQA A;  4JKT A;  2Z2L B;  4DF6 A;  2WYX A;  3C7V A;  4DDY A;  1LT0 A;  1S4S A;  3R7W B;  3LI9 A;  1T1A A;  3PAG A;  4B9O A;  3EGX C;  2Y4A A;  1BSG A;  5DJT A;  4PHT A;  4WL9 A;  1KE3 A;  2E8J A;  1ACF A;  2EX8 A;  2Q0O A;  3V50 A;  2QPN A;  3MR0 A;  2G2W A;  2R9X A;  4ZJ1 A;  3HLB A;  2IA2 A;  5HW3 A;  1TVF A;  2DCF A;  1TS6 A;  3HJI A;  5HDS A;  4IHQ A;  3NJA A;  1J3W A;  1IEL A;  2VGL M;  4MBF A;  1G5U A;  5CGW A;  4R3B A;  2RL3 A;  5DF8 A;  3LYX A;  4JF6 A;  4XUZ A;  4OPR A;  2HGV A;  4LFU A;  3F1P B;  3KSH A;  1K25 A;  4YNR A;  1EWZ A;  1YPR A;  3G35 A;  2J9O A;  4DXB A;  2J3T D;  4EV4 A;  3G34 A;  4DJ2 A;  5J8X A;  1K54 A;  4WEL A;  3UO9 A;  3CZD A;  5CGS A;  2VGK A;  4HH2 A;  5GHZ A;  2XFS A;  5GLC A;  4KQD A;  1TS7 A;  2XQZ A;  5FAT A;  5FQI A;  4PM8 A;  2EX9 A;  2Y8H A;  4KG5 A;  5HWV A;  5HAR A;  3MXR A;  4Q0J A;  2BG1 A;  4BEN A;  2QYB A;  1K57 C;  3BY8 A;  3EOI A;  3OPL A;  3WS4 A;  1NY0 A;  4HY8 A;  2ZJ9 A;  2VEA A;  1L0D A;  4BD1 A;  4LLO B;  5K5B A;  3LCE A;  1H5X A;  4IUH A;  1NLZ A;  1PW1 A;  2XLN A;  2JBF A;  1LI0 A;  3ZNY A;  1MC0 A;  1XJ2 A;  3BQ8 A;  5EE8 A;  1IYP A;  3PXP A;  2JCH A;  4DXC A;  3T4L A;  1SKF A; 
#chains in the Genus database with same CATH homology
 3MXQ A;  1EW0 A;  2QHK A;  5G4Z A;  4G3K A;  4BJP A;  4ME4 A;  3HJK A;  5G4Y A;  4F3L A;  2KDK A;  1NRJ A;  4JGO A;  3IS2 B;  3RFB A;  2V0U A;  3C2W A;  3E4P A;  3JVV A;  2GNX A;  2PDR A;  5HPI A;  3NOP C;  2Z6C A;  4EER A;  4Q0I A;  5J4E A;  1W63 M;  1GSX A;  4P6Z S;  3C8C A;  4DN0 A;  4PAU A;  2OAQ 1;  3IS2 A;  3PBT A;  2V0W A;  2EWV A;  4E04 A;  3LIC A;  1XFN A;  4BBT A;  4G3W A;  4I3J A;  1N9N A;  1S4R A;  4F3L B;  4HP9 A;  4NXB A;  4EQ1 A;  2NUP C;  3H9W A;  5HL6 A;  1OTA A;  3LIA A;  3S7Q A;  5HWT A;  4H6J A;  3W2Z A;  2J3T C;  3UME A;  2WKR A;  1STZ A;  3B33 A;  3JVU A;  3TW8 A;  4BBV A;  4CLC D;  3F1O B;  2PT7 A;  3CUE A;  2PR5 A;  3E4Q A;  1N9O A;  4MN7 A;  5DKL A;  3T4S A;  2ZOH A;  1G28 A;  3S7P A;  3C30 A;  3HCY A;  4EES A;  3H82 B;  3DBA A;  2HF6 A;  3D72 A;  4HJ3 A;  3PBO A;  3TJZ C;  4O0P A;  1VB6 A;  1DP6 A;  1UGU A;  4Z1W A;  3GEC A;  4WEK A;  4LRX C;  1OTB A;  3MMH A;  1YKD A;  1P9W A;  4GHI A;  3K3D A;  3CLO A;  3MFX A;  5DF9 A;  2VGL S;  2VA0 A;  2JKR I;  2PHY A;  2QWS A;  2O99 A;  5HD3 A;  2EWW A;  1ODV A;  3CIT A;  2K31 A;  2W0N A;  3BWL A;  3KSI A;  1P9R A;  4GHI B;  4EEP A;  5F69 A;  5F5Y A;  5TBM A;  3LR4 A;  1V9Y A;  3T4J A;  4O01 A;  2K2N A;  5A8B A;  3PR6 A;  2VZW A;  1TF1 A;  3MJQ A;  4K08 A;  1OTI A;  3IBJ A;  1H3Q A;  4HNB A;  1LSV A;  3H82 A;  1S66 L;  4Y3I A;  1IOU A;  5IU1 A;  2A24 A;  2W3E A;  3LI8 A;  4JGP A;  3CWF A;  4I38 A;  4GJ4 A;  1MZU A;  3EEA A;  2V1B A;  4XT2 A;  3UB9 A;  2BAS A;  3F1O A;  2JHE A;  2KLI A;  3K2N A;  4WEJ A;  3PBQ A;  4CLC E;  4HH3 A;  3U2A A;  5MC7 A;  2HJE A;  4HOI A;  4NXG A;  3LR3 A;  3FPW A;  2PD8 A;  1H8M A;  4IJG A;  3EGD C;  4M4X A;  4R3A A;  4H6J B;  3FG8 A;  5KIZ A;  1KOU A;  2VX8 A;  3FPV A;  1BYW A;  2M1C A;  4R38 A;  2OWH A;  3VV4 A;  4OOL A;  2VV6 A;  5F68 A;  4EET B;  5EFW A;  4BBU A;  5I5L A;  4L0L A;  5AVF A;  5DFX A;  4YWZ A;  1GSW A;  1OJG A;  1S1Y A;  3OBF A;  2I9V A;  3G6O A;  4DMZ A;  4KQO A;  2JN7 A;  1F9I A;  1XJ3 A;  5DKK A;  3BY9 A;  3NOU C;  3E0Y A;  3LIF A;  4GW9 A;  1OT9 A;  5F6A A;  3PHY A;  1YSP A;  2VJW A;  2XA7 S;  2YKF A;  1UWP X;  1DP9 A;  5HWW A;  2M7V A;  2HJ9 C;  3PBN A;  5C5K A;  2FZ0 A;  2M7U A;  5DFY A;  2O9A A;  3CAX A;  1D06 A;  1XFQ A;  2OOL A;  4Y2F A;  2JKT M;  3OCN A;  3VE4 A;  1LL8 A;  4KUO A;  1MKM A;  4P6Z M;  4EUV A;  3K3C A;  3R7W A;  3UB8 A;  3RTY A;  4DJ3 A;  5HSQ A;  1DRM A;  4JGR A;  5AVE A;  1ZHH B;  4WF0 A;  3F1P A;  3RH8 B;  3VOL A;  4GCZ A;  3E4O A;  3A0S A;  3UE6 A;  3D3O A;  4EXO A;  4FOF A;  1T1B A;  3KYQ A;  3PBS A;  2Y79 A;  2B02 A;  3T4O A;  2INW A;  2W1R A;  1T19 A;  1X0O A;  1TS8 A;  1TD5 A;  4Q0H A;  3H7W A;  2EA9 A;  4PKY G;  3P7N A;  1F5M A;  3EQU A;  3E98 A;  4IUK A;  5J7E A;  4I39 A;  4ETZ A;  4HP4 A;  4WLA A;  3LFV A;  1OT6 A;  3KSF A;  4CLC B;  4UQI S;  1YAX A;  4RQ9 A;  5L8M A;  3KSG A;  3ULF A;  2YKH A;  2WKQ A;  4UEY A;  2W1T B;  3T4Q A;  2V9A A;  4O8G A;  4HI4 A;  2V1A A;  5HPF A;  1V9Z A;  4MN5 A;  1P97 A;  4BWI A;  3LID A;  2KX6 A;  3F1N B;  4ETX A;  4HJ4 A;  2XSS A;  4Y5F A;  1JNU A;  5CX7 A;  4EU0 A;  3CI6 A;  4HJ6 A;  3A0R A;  4MDZ A;  4R70 A;  2H28 A;  4I3A A;  2JKR M;  1LSW A;  3MF0 A;  3T50 A;  4ARZ A;  1GSV A;  3S7N A;  2JKT I;  1ZTU A;  1W63 Q;  1YSQ A;  3CUE C;  3VE3 A;  1UWN X;  4LRY C;  5IS1 A;  3ZQ5 A;  1Y28 A;  4LPZ A;  3KYZ A;  3LIE A;  1NLY A;  2ZMF A;  3T4T A;  5LBR A;  5HD5 A;  1WA9 A;  2O9C A;  3UMD A;  5IT5 A;  4GS9 B;  4OOM A;  4HIA A;  3BQA A;  2K7S A;  3NHQ A;  4QPR A;  2PYR A;  4AFI A;  4HQA A;  3EQV A;  2A24 B;  2P08 A;  2VV8 A;  2W27 A;  4ZRR A;  4NEE D;  2L4R A;  3F1N A;  1LT0 A;  4L9E A;  1S4S A;  5HDD A;  3ZYT A;  3NOT C;  4G3V A;  3R7W B;  2PR6 A;  2VKS A;  4PKY A;  4B93 A;  3LI9 A;  1N9L A;  1T1A A;  4JGQ A;  4B9O A;  5TJJ A;  3EGX C;  4LRZ E;  3MQQ A;  2XRN A;  2QJ5 A;  5DJT A;  4PHT A;  4WL9 A;  1OPX A;  2ZBB A;  4MCW A;  4NKP A;  4CQH A;  2PYP A;  3OCL A;  3O5Y A;  4KUK A;  2VLG A;  4NXE A;  3MQ0 A;  2WKP A;  3MR0 A;  3LIB A;  4FSF A;  2O9B A;  3H7W B;  3BJN A;  5AJG A;  4YOF A;  2W3G A;  2IA2 A;  2XA7 M;  2DMW A;  4MMN A;  3SW1 A;  3OLO A;  1TS6 A;  3HJI A;  5J3W A;  5HDS A;  3OOV A;  5HDC A;  3BW6 A;  2A2L A;  1F98 A;  4IHQ A;  1XJ6 A;  3NJA A;  3T4K A;  2FH5 A;  5HZH A;  4WN5 A;  2VGL M;  3R4K A;  2OWJ A;  2D02 A;  2O0Y A;  2HV1 A;  3LYX A;  2HGV A;  2GJ3 A;  1T1C A;  3F1P B;  3C38 A;  3S7O A;  3KSH A;  3IBR A;  4YNR A;  4GS9 A;  2QKP A;  3PYP A;  2GX5 A;  3B42 A;  4II7 A;  4I5S A;  1LSX A;  2J3T D;  2P7J A;  3LR5 A;  4DJ2 A;  1NWZ A;  4WEL A;  4XT2 B;  3LR0 A;  4HH2 A;  3EWK A;  5KSH A;  4ARZ B;  2L0W A;  4KQD A;  3ICY A;  1S67 L;  1TS7 A;  4MN6 A;  2Z6D A;  2L1M A;  3TRC A;  3LUQ A;  2CMN A;  2LB9 A;  2W3F A;  2Y8H A;  2B18 A;  5TBM B;  3MQO A;  5HWV A;  4Q0J A;  2XRO A;  2W1T A;  2QYB A;  4EW7 A;  3BY8 A;  4WUJ A;  3UE3 A;  3UB7 A;  3B47 A;  4UQI M;  3EOI A;  3OC2 A;  2W3D A;  4CLC A;  2D01 A;  2ZOI A;  4L9G A;  1D7E A;  4HY8 A;  5FL3 A;  4GLQ A;  1T18 A;  4BMW A;  3KX0 X;  2VEA A;  2PD7 A;  4NXF A;  2OAP 1;  1VHM A;  2MJ6 A;  3PBR A;  3P01 A;  2ZMV A;  2VV7 A;  2GZA A;  1S1Z A;  4LLO B;  5K5B A;  1TS0 A;  2G7U A;  2W3H A;  4IUH A;  1NLZ A;  3FC7 A;  1DP8 A;  1OTD A;  2LB5 A;  4HHD A;  2J80 A;  2P04 A;  3V67 A;  1P0Z A;  4L9F A;  4EEU A;  2J3W A;  3TE8 A;  3KO6 A;  2R78 A;  1OJ5 A;  1MC0 A;  1XJ2 A;  1XJ4 A;  3BQ8 A;  4I3I A;  1OTE A;  2NUT C;  4CLC C;  3EEH A;  3GDI A;  3PXP A;  4R6L A;  2KOI A;  3UB6 A;  2QJ7 A;  1G6O A;  5DJU A;  3A0V A;  3T4L A;  1IFQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...