2NUTC

Crystal structure of the human sec23a/24a heterodimer, complexed with the snare protein sec22b
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
157
structure length
135
Chain Sequence
MVLLTMIARVADGLPLAASMQEDDLQQYQSQAKQLFRKLNEQSPTRCTLEAGAMTFHYIIEQGVCYLVLCEAAFPKKLAFAYLEDLHSEFDEQHGKKVPTVSRPYSFIEFDTFIQKTKKLYIDSRIMVANIEEVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein transport protein Sec23A
publication title The Transport Signal on Sec22 for Packaging into COPII-Coated Vesicles is a Conformational Epitope
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 41
structure length 135
sequence length 157
ec nomenclature
pdb deposition date 2006-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13774 Longin Regulated-SNARE-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.50 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2nutC00
2DMWA 1IFQA 2NUPC 4AFIA 4B93A 1H8MA 3BW6A 2VX8A 1IOUA 3EGXC 2NUTC 3KYQA 3EGDC
chains in the Genus database with same CATH superfamily
3F1NB 3EEHA 3KSIA 5FDSA 2OV5A 1QMFA 3RJUA 4EESA 3H82A 1HVBA 4HQAA 3B33A 4KQQA 2JHEA 3VP3A 1MKIA 5BOHA 3L9KA 1YMSA 2VJWA 3ZHHA 2E8JA 1NWZA 3PBQA 4CLCB 2H28A 4JPMA 4UA9A 1K55A 1L0EA 1LL8A 1BUEA 5DJTA 2JKRI 3GDIA 3IHAA 5I94A 3ZG0A 5FQJA 3DWKA 3QP4A 5GLAA 3T1RA 2BTFP 3PTEA 5DFXA 1FCMA 5L10A 1LT0A 1L2SA 4EEUA 3P7NA 3QP5A 2OAP1 1NZOA 2E8IA 2FZ0A 3JPUA 3Q1FA 1PW8A 3SZTA 1DP6A 3MF0A 3V50A 1CK3A 4AFIA 3MR0A 5DTTA 2EX2A 1L0FA 2W3DA 3HUNA 1YLPA 5HPFA 4EERA 2KLIA 3WS1A 2XF3A 3MXSA 4S2NC 4BD1A 1NZUA 4K0WA 3W4PA 3OOVA 1W8YA 1VM1A 4R1GA 2EWWA 3LEQA 5J8XA 4OPZA 1W5DA 4GZBA 4R6LA 3BEBA 4KZ4A 3VFHA 4E3KA 1SKFA 2KDKA 1N9OA 2D01A 4HNBA 5F83A 2VGLM 1H5XA 3IXHA 5EVEA 2W1TA 1W63Q 1CF0A 2JC7A 3UY6A 2WGVA 4UEYA 2XGNA 4DRTA 2ZQCA 2EXBA 3DTEA 4WEJA 4MNRA 2V8CA 2VX8A 1KE0A 1P0ZA 1K4EA 4ARZB 3BFGA 1P9WA 1K56A 3G2ZA 5HW3A 5KZHA 1ZHHB 1T1AA 4LLOB 4X6TA 2HDRA 1YSPA 1S66L 4P87A 2ZLYA 5G18A 1WYCA 4GLQA 4Q0JA 1V9YA 5EVIA 4BENA 4Y0OA 3OPRA 2XK1A 1G68A 2Y8HA 1PI4A 4IJGA 1LL5A 3IXGA 2Z6DA 2BASA 5DFYA 2VKSA 4HEFA 4R23A 4RVAA 1S4SA 3D3OA 1K25A 2UWXA 2XSSA 3F1PA 2HV1A 3W8KA 3UE3A 4GD8A 1N4OA 3DTKA 4FOFA 3ZCZA 4EBPA 3K2NA 4XUXA 3SS4A 1KVLA 1O7EA 4LRZE 4CJNA 3NECA 3NY4A 2JCHA 4X69A 2CMNA 1L3LA 2HDSA 2O9CA 5DVAA 5F68A 2FH5A 5G4YA 1PWCA 2XQZA 5FAQA 2PU4A 5CRFA 3ZQ5A 1CI8A 3E2KA 3MKFA 4ZBEA 3OLOA 2W0NA 4IHQA 3KO6A 3IHBA 3ZNYA 4FTXA 5L09A 3UB6A 1SHVA 1PRQA 2UV0E 3OPPA 5C5KA 3IX3A 4NKPA 4ESPA 1XFQA 3ZVTA 4QHCA 3W2ZA 1IKIA 3PBOA 4WZ5C 2B95A 1H0MA 4ZTKA 1OJ5A 3LGOA 3HLGA 3N7WA 4KQOA 4C6YA 1K6RA 1F2KA 1JVJA 5FQQA 3N8SA 1CQAA 5FQIA 4X1MA 2VV7A 2QYBA 4QJGA 1AXBA 2QKPA 3M2KA 5K5BA 3HLFA 5CX7A 3IWOA 4RQ9A 3KSGA 4HBTA 1I2WA 1L0DA 5GL9A 2V9AA 2Z2MB 2OWJA 3SH7A 3CPTA 3FG8A 5IHVA 4NG2A 4ZJ1A 1GSWA 1YPRA 2BLSA 2WKIA 3S7QA 2HGVA 1JTDA 3PBRA 3ZDJA 3NOUC 3TG9A 1NRJA 4WELA 4FH2A 1DRMA 3DTIA 4HOIA 1XGIA 5FAPA 3WWXA 1WYBA 4DE0A 3IX8A 1BSGA 4QY6A 1Q2QA 1U60A 3WS2A 2IWBA 3NHQA 2ZMAA 3G6OA 4WL9A 3LIEA 4KQDA 2O9AA 2Y2PA 3E4OA 4WM9A 2W3EA 2QMIA 3KX0X 2QPNA 4DDYA 1D1JA 1K0KA 4I38A 4KZ3A 3H82B 3GV9A 3NOPC 5L07A 3UE0A 1K57C 4D2OA 3FZCA 3HLEA 1RCJA 1S4RA 4N9LA 1FIKA 4JXGA 1BZAA 2A49A 1UGUA 1ODVA 3E4PA 2JN7A 1NLYA 1IOUA 1NRFA 3TW8A 2HZ5A 3IXBA 4CPKA 1N9NA 1ZKJA 3CITA 2RL3A 5DF9A 1OPXA 2QJ7A 3MZFA 4WUJA 1BTLA 4P85A 5I5LA 3GRJA 3BM6A 1KGGA 4K91A 4PM7A 4BL2A 3VSKA 1XJ6A 2M1CA 3SOIA 5E2EA 2J3TD 4HH2A 5GHXA 1G5UA 3G34A 4G3WA 1H8ZA 2ZQAA 4EEPA 2Y2JA 3KYEA 2PT7A 1TVFA 1MXOA 3HLBA 4EBNA 3ZNTA 5HX9A 4HJ6A 1OTDA 1XJ3A 2C5WB 2PDRA 3D9YA 4E3JA 5EVLA 2EFXA 2FFYA 3H7WA 4R4RA 1UWNX 2BG1A 3CJMA 2HF6A 3M2JA 4FCFA 3RXWA 1ZG6A 2VV6A 3MQ0A 1XGJA 1KVMA 1N9LA 5HZHA 1IEMA 1ONHA 1K54C 3OBFA 1G6AA 2WGWA 2V0WA 4OVDA 1SZVA 2PR5A 1D7EA 4HI4A 3QP2A 3BYDA 4P0MA 3KYZA 4X1LA 2W1TB 4BBTA 3U2AA 4E3IA 3F1OA 5M1AA 2VGKA 2HJEA 1YMXA 4XT2A 2Y59A 3IBJA 2JKGA 4E3MA 2Y2QA 3A3FA 1TF1A 4Z1WA 3UNWA 5HAQA 3TSGA 1RGYA 3GMWA 4IUHA 1BLHA 1GA9A 3QNBA 1Z6FA 1S67L 3SS3A 2Q0OA 2G7UA 3DW0A 4RYEA 3HLCA 2OLUA 3HVFA 1OMEA 5FAOA 2VZWA 5FL3A 5FATA 3AGEA 2ZQ9A 3MQQA 4BMWA 5EVIB 4UA6A 3S7PA 2XFSA 2QWSA 3G35A 3NULA 4GJ4A 4S2IA 4ZRRA 1YT4A 3F1PB 4MBKA 2JKTM 4JKTA 4H6JA 3EQVA 1NJ4A 3BFFA 3C4PA 1DP8A 4NXFA 4UQIS 3K3CA 5HDCA 3S4XA 4L9FA 5EUAA 1TS6A 4PPRA 1GSVA 1L0GA 3A3JA 3UDFA 3ZG8B 2VGJA 1E3UA 3LI9A 4P6ZM 3V3SA 4S2OA 3LR5A 1IYSA 3N6IA 4R38A 4OPQA 5CXWA 2VV8A 2Y2NA 5DTKA 4S2KA 4RX3A 3FV7A 4F3LA 4ID4A 2XFTA 5A90A 3VP1A 1EW0A 2WKHA 1ESIA 4L0LA 2G2UA 3MZEA 2ZJ9A 2J3WA 3UN7A 4LENA 2A2LA 5L8MA 1ES5A 4O8GA 1E4DA 3E4QA 3GQZA 3S1YA 2XR0A 3CG5A 5JYOA 3TJZC 1M6KA 3LIDA 4Y5FA 2Y79A 3O88A 3A0SA 5HDDA 4LCMA 4O0PA 4PMAA 4DXCA 1DJCA 3L7HA 4QWOA 2W1RA 3IF6A 3SW1A 4BWIA 3HL9A 5E43A 2V2FF 4DJ2A 3OPLA 4HP9A 3CPTB 2HP9A 5CGWA 2ZM2A 4O7DA 2ZQ8A 1YLYA 3EGDC 4XXRA 5F1FA 2H10A 3LICA 3VFFA 1HD8A 4E3OA 2Y2MA 4U3TA 5CGXA 2J9OA 2ZOIA 1HTZA 1ALQA 4B88A 4JXWA 5CGSA 3B47A 2Y2KA 4B93A 4BL3A 4I3IA 4DXBA 3UB8A 3ITBA 1T1CA 4S2MA 1K4FA 3MQOA 1NYMA 2CC1A 4IBXA 2X02A 5FQ9A 5CEDA 4EW7A 3G4PA 3PBNA 1SCWA 4N1HA 3T4KA 3D4FA 5U47A 2EX6A 2B02A 4Q0HA 4DJ3A 1D06A 4NK3A 2WGIA 2IWDA 3A0RA 1YQSA 2PHYA 3GECA 3R7WA 2LB5A 2JE5A 3A0VA 1VEUA 2PD7A 3LY4A 1K6SA 3UE1A 1EROA 2EX8A 3ZFZA 3CUEC 4OKPA 2HJ9C 3T12B 5KSHA 3IX4A 1FILA 2J3TC 3QHYA 5E2GA 4DKIA 4KENB 1IFQA 5EECA 5DF7A 4FSFA 4GDNA 4S2NA 1XJ2A 3LIAA 2DMWA 4CLCC 1VHMA 2XD5A 1UWPX 3TOIA 1FQGA 3BW6A 5KIZA 3GSGA 4NEED 1FR1A 1SDNA 4JGPA 4FH4A 5AQ7A 4GDBA 3H7WB 2P9VA 3RFBA 3Q07A 4JF4A 4ZJ3A 4YINA 1H8MA 2XA7S 3MZDA 1Z09A 1GHMA 3PHYA 3S7NA 2PAVP 1H3QA 1ERQA 5A91A 4R70A 4B4ZA 3DAVA 2WGWB 4WEKA 4K08A 1FCOA 2GDNA 4KG5A 3LIBA 4JF6A 1NLZA 3ZG5A 1GA0A 3C7UA 1BLSA 4IBRA 2I9VA 2R9WA 3H9WA 1M40A 3F1OB 3T4TA 4S2LA 3VOYA 3IS2A 4XT2B 3MFXA 1S0WA 1NY0A 2Q9NA 1LLBA 3OPHA 5TR7A 3VE3A 3NIAA 3P01A 3V5MA 1N9BA 3T4SA 1P97A 4Q0IA 2A24A 4E6XA 3MS6A 2R78A 3PR6A 3UE6A 3ZVWA 3SH8A 2OSUA 5EE8A 2O99A 4OQGA 5HWTA 5DKKA 3HLDA 5F69A 3T1QB 1FCNA 4JGQA 4ZDXA 2WK0A 4C3QA 2K7SA 4LRYC 4II7A 2ZBBA 3BQAA 4EXOA 4H6JB 3U4LP 3FC7A 3GVBA 4OPYA 3ZGAB 3I7JA 2L0WA 3HUMA 4KUKA 1STZA 1FR6A 3TRCA 3EWKA 2LB9A 2JKTI 2Y4AA 2J80A 1SDEA 2ZL1A 4ME4A 2XDMA 4ZJ2A 2P7JA 4EUVA 1O07A 4QY5A 2W3FA 4RA7A 4H8RA 2ZOHA 4JF5A 5EM0A 4F3LB 1YLWA 1S6RA 4WZ5A 3C5AA 4XUZA 3Q81A 2WZXA 1XA7A 4WN5A 2ZC7A 1LSVA 2Z6CA 4JLFA 4QU3A 4HHDA 4BJPA 1GSXA 5CHJA 5GHYA 4EWFA 1IYPA 4GOGA 2WUQA 4KG6A 4O01A 1RGZA 4GCZA 4WMCD 3ICYA 1MWRA 4Y0TA 5CEBA 3AGDA 4X68A 2ZD8A 5GLBA 3A3EA 3JVUA 5HARA 5IU1A 1IYQA 2H0YA 3BQ8A 4LRXC 2YKHA 4YWZA 4UHUA 2VGLS 5KMWA 1OJGA 3ULFA 3K3DA 1T18A 2Q9MA 4X53A 4GHIA 1EWZA 3IF6B 1DP9A 3P98A 1EI5A 3DBAA 2J9PA 1KGFA 2Y2HA 3VOZA 4CLCD 5F5YA 2AVXA 1OTIA 1SKOA 1ZTUA 3EQUA 5FI6A 2OLVA 3HREA 3O5YA 2ZQDA 3QP8A 5TFQA 4Y2FA 2EX9A 2GX5A 1W8QA 4QB8A 1MWUA 3B42A 2VA0A 2DCFA 2VEAA 1KGEA 3WRTA 4DE3A 5E2FA 1K57A 4U0XA 4KZBA 1KDSA 3A3DA 3O3VA 1CI9A 4HBUA 5FEFA 2QJ5A 4FUWA 4MEZA 4P6BA 4BD0A 2FFFB 3VSLA 3UDIA 3SH9A 4GKUA 2M7VA 3FKVA 2VK3A 5TJJA 3R4KA 1CEFA 4IVKA 3ZG7B 1I5QA 1LI0A 2K31A 4DF6A 4DE1A 4MMNA 1J3WA 3G2YA 5A92A 4GN2A 3T4OA 2GJ3A 4LV0A 5CTNA 3FPWA 4WZ4A 4KUOA 3R7WB 3EGXC 4I3AA 1VEUB 2EXAA 3S7OA 5MC7A 3C8CA 5L2FA 3VMAA 5TBMA 2H5SA 4OONA 3WRZA 3GTCA 3D72A 2NUPC 3PBSA 2K2NA 2XLNA 1MZUA 1YLZA 4I5SA 3WS5A 1NYYA 2PBDP 4BLMA 1XXMA 2KOIA 4Y13A 3C7VA 3HCYA 1S1YA 4LV3A 4R3JA 3VP4A 3UB7A 1K55C 2V1ZA 5FDHA 1YM1A 4YFMA 5M18A 1OT9A 4IUKA 2P9VB 1OTAA 4MBFA 3NDEA 5DTSA 5HD3A 5AVFA 3SS5A 1ES4A 5F1GA 2ZM0A 4R3AA 1NXYA 1LI9A 5LBRA 1BT5A 1WA9A 4IEDA 5HL1A 1XJ4A 2V1BA 3E0YA 3UMEA 4B9OA 3ZG9B 1XA1A 1K38A 3UPOA 4LPZA 4KG2A 5AQ9A 4LV2A 5J3WA 1KE3A 3HLWA 2WKRA 2O0YA 3IH9A 2EFUA 4PAUA 4N9KA 2WAFA 3QP1A 1A0KA 5DJUA 1ZC2A 2WYXA 5DKLA 4GD6A 4JGRA 1S1ZA 4EQIA 3IS2B 4ETXA 4NETA 3KYQA 2ZC5B 3Q7VA 4B4XA 1JTGA 3S22A 3HJKA 1XPBA 4Y7PA 1KDWA 4MCWA 1C3BA 2QHKA 3C2WA 4EU0A 1LL9A 3FPVA 5HSQA 4BBVA 1W7FA 2EWVA 3IBRA 3PAEA 1Y54A 4OQ0A 2A24B 4HP4A 4GB7A 1TS8A 5CTMA 1F5MA 4E6WA 3IH8A 4M4XA 4OPRA 1G6OA 3MSHA 3UPNA 2HPBA 2MJ6A 1XKZA 2Z2LB 1TD5A 4OLGA 2DNSA 4OLDA 5GHZA 5HWWA 3FWLA 2WKQA 1PWGA 3MXRA 5J4EA 5FEGA 3IQAA 3MMHA 1ESUA 5JYPA 3NOTC 4G3VA 1W63M 1ACFA 1DY6A 3Q82A 4LCLA 4JGOA 1X0OA 3MJQA 4Q8IA 1BYWA 1KE4A 1TEMA 4KQRA 2Y91A 2V8FA 2L1MA 1JNUA 1GCEA 1VETA 1PZOA 2OAQ1 3PBTA 3T1XA 4KZ5A 1TS0A 3MXQA 3BRMA 1TDLA 2EA9A 4JXVA 2XH9A 5EVIC 2V20A 5A8BA 1FSWA 2ZL1B 4Z9QA 1BLPA 1CEGA 3Q7ZA 5M19A 2ZQ7A 3E98A 1PIOA 2PYPA 4S2PA 3G32A 3V39A 5HPIA 1PWDA 3A3IA 1GHPA 2Y2IA 3NCKA 3NI9A 3LYXA 4I3JA 3NJAA 3ITAA 2WKPA 4L9GA 5EV0A 1OT6A 1LHYA 4OH0A 3MFDA 1ERMA 1ES2A 3CWFA 4Y0UA 1E3UD 2PRFA 2P08A 5CERA 2I72A 4KZ9A 4FD8A 3LO7A 3IXDA 3OC2A 2R9XA 4OOLA 3LUQA 1DJBA 3BFCA 4GHIB 2PR6A 4EUZA 1PYYA 2HP6A 3BFDA 3LI8A 3RXXA 3LR0A 1SKOB 3CAXA 3CZDA 4X56A 2XRNA 3PXPA 3C4OA 4OOYA 2XEPA 4S2JA 4X55A 4MN7A 3QP6A 1XX2A 1F9IA 1LSXA 4MBHA 4OQIA 2JBFA 3BLMA 3RTYA 4WYYA 1BULA 4GS9A 5IT5A 3O87A 1H8YA 2OOLA 2ZC6B 3N4IA 3CMZA 2ZC3B 4QPRA 2X01A 3OCNA 4WMCA 4QD4A 1Q2PA 3BY8A 3CLOA 4LFUA 3KSHA 1MPLA 2V1AA 4R0QA 2WAEA 3W4OA 4UA7A 4IVIA 2JKRM 3V3RA 3F1NA 4WBGA 3CUEA 4N92A 4EETB 3T50A 3LR4A 3O86A 3N8RA 2QZ6A 2IWCA 2D02A 4C75A 3AGFA 3BWLA 4P6ZS 4WLAA 3EOIA 3LIFA 4E04A 4K0XA 4CLCA 5TBMB 4KZAA 3LFVA 5CECA 3UO9A 4LGWA 5FI2A 4CQHA 4R4SA 3LCEA 4UQIM 4YOFA 5HFOA 1HZOA 2NUTC 5GLCA 1FOFA 4LV1A 4PM9A 3P09A 2Y2OA 5EPHA 1JWZA 4EBLA 4HY8A 3IWQA 4PHTA 2ZMVA 3OCLA 1IELA 5AQBA 5AJGA 3ZYTA 3LY3A 1K56D 4DE2A 5CHUA 4OQHA 2HDQA 1Y28A 4HJ4A 1LSWA 3UPPA 3T1SA 4OP8A 4MDZA 5EVID 2OWHA 2PYRA 1F98A 1WE4A 2XD1A 4PKYA 4MN6A 5FASA 2HP5A 3BY9A 1VB6A 5AVEA 4F94A 3HBRA 1PNEA 5AQAA 1KOUA 3GR2A 4R3BA 4UAAA 3VV4A 4MN5A 2WZZA 4GW9A 3MKEA 3UMDA 4U0TA 2B18A 2ACGA 2IA2A 5J7EA 4ETZA 2XROA 3WS4A 3Q7VB 4HJ3A 3T4LA 2W3GA 2Y55A 3BJNA 5F6AA 4RX2A 2PU2A 5GLDA 2INWA 1HLUP 4E3LA 3VOLA 3BLSA 2WADA 2A3UA 5TGFA 1PFLA 3VE4A 3TE8A 3IWIA 4DDSA 1IYOA 1Y4OA 3HUOA 1OTEA 4N1XA 1JWPA 4ARZA 1MY8A 4GNUA 3QNCA 3G30A 2P74A 4EQ1A 1YLTA 3DWZA 5FSRA 1YLJA 4YNRA 3MBZA 3OZHA 4BBUA 5EFWA 3BECA 4DN0A 3FYZA 3NBLA 5E2HA 3W4QA 4OOMA 1E25A 4PM5A 1MC0A 2PBYA 4Y17A 3PAGA 5DF8A 1W79A 1TDGA 1VETB 2B5RA 3IF5A 3V67A 4G3KA 3M6BA 1PW1A 5HD5A 1DJAA 1RP5A 2X71A 1YSQA 1T19A 5HL6A 2W27A 3EEAA 2G2WA 3C30A 2Y2LA 3LEZA 1J9MA 2C6WB 2M7UA 5HAIA 2JKFA 3VP2A 4PM8A 2RCXA 4WF0A 4JXSA 1OTBA 3CI6A 4PM6A 3C38A 1ONGA 4X25A 3PYPA 2H0TA 2ZM8A 3ISGA 5F82A 4E3NA 5EOOA 2ZC4B 3WS0A 4KZ6A 3KSFA 1FSYA 2HDUA 4A5RA 1CJFA 3NDGA 4KZ8A 1MBLA 5HAPA 3FKWA 3HJIA 2VLGA 5HWVA 4NXEA 4NXBA 5KSCA 2GNXA 4EV4A 3DTMA 4JBFA 4M3KA 2YKFA 1PZPA 1GHIA 3NC8A 1V9ZA 4Y3IA 3BFEA 2W3HA 1G28A 3IT9A 1YKDA 2DRWA 4D60A 1BLCA 1JWVA 1ZG4A 4BQMA 3UDXA 1ES3A 4ZAMA 4OP5A 3RH8B 4L9EA 3LR3A 4HH3A 5EOEA 2O9BA 1T1BA 3M6HA 3UB9A 5FQMA 2XA7M 1IKGA 4MLLA 1XP4A 2PD8A 2GZAA 2J7VA 4Y15A 4DMZA 1K54A 1XFNA 2ZMFA 5FQKA 3JYIA 1QMEA 5FA7A 5IS1A 5EM1A 1MWSA 2P04A 3E2LA 1MWTA 5A93A 4HIAA 2V0UA 2L4RA 1YAXA 4GS9B 1TS7A 4KZ7A 4I39A 3CHWP 5CHMA 3IF6C 5FI7A 3UB5P 2Y2GA 4CLCE 1PI5A 5D3OA 1P9RA 2J8YA 4PKYG 1VQQA 5HDSA 1AWIA 3G31A 4NXGA 3T4QA 1I2SA 2KX6A 1MKMA 3T4JA 2WKEA 3VP0A 3N8LA 3B3XA 3JVVA 5G4ZA 4HESA
chains in the Genus database with same CATH topology
4II7A 2ZBBA 3F1NB 3EEHA 3KSIA 3BQAA 2HF6A 4EXOA 3OC2A 4H6JB 4EESA 3FC7A 4OOLA 3H82A 3LUQA 2VV6A 4HQAA 3MQ0A 3B33A 2JHEA 1N9LA 4GHIB 2PR6A 5HZHA 2VJWA 3OBFA 1NWZA 3PBQA 4CLCB 2H28A 2V0WA 3LI8A 2L0WA 1LL8A 2PR5A 3LR0A 4KUKA 5DJTA 1D7EA 1STZA 2JKRI 4HI4A 3CAXA 3GDIA 3TRCA 3KYZA 3EWKA 2XRNA 4BBTA 2LB9A 2W1TB 3PXPA 2JKTI 2J80A 3U2AA 3F1OA 4ME4A 2HJEA 2P7JA 4EUVA 4XT2A 2W3FA 3IBJA 1TF1A 4Z1WA 5DFXA 4MN7A 1LT0A 2ZOHA 1F9IA 1LSXA 4IUHA 4F3LB 4EEUA 1S67L 3RTYA 3P7NA 2G7UA 4GS9A 4WN5A 5IT5A 2OAP1 1LSVA 2FZ0A 2VZWA 2Z6CA 5FL3A 2OOLA 4HHDA 4BJPA 1GSXA 1DP6A 3MF0A 4AFIA 3MQQA 3MR0A 4BMWA 3S7PA 2W3DA 4QPRA 3OCNA 4O01A 5HPFA 2QWSA 4GCZA 3BY8A 3CLOA 4EERA 3ICYA 2KLIA 3KSHA 2V1AA 2JKRM 4GJ4A 3JVUA 4ZRRA 3F1NA 5IU1A 3CUEA 4EETB 3F1PB 2JKTM 3BQ8A 4H6JA 4LRXC 2YKHA 3EQVA 4YWZA 3T50A 2VGLS 3LR4A 1OJGA 3OOVA 1DP8A 4NXFA 3ULFA 3K3DA 1T18A 2D02A 3BWLA 4P6ZS 2EWWA 4UQIS 4GHIA 3K3CA 4WLAA 3EOIA 3LIFA 5HDCA 4E04A 1DP9A 4L9FA 3DBAA 4CLCA 1TS6A 4R6LA 2KDKA 4CLCD 1N9OA 5TBMB 5F5YA 1GSVA 1OTIA 2D01A 4HNBA 1ZTUA 3LFVA 2VGLM 3EQUA 2W1TA 3LI9A 3O5YA 1W63Q 4CQHA 4P6ZM 4UQIM 4YOFA 4UEYA 4Y2FA 2GX5A 3LR5A 2NUTC 4R38A 2VV8A 3B42A 2VA0A 2VEAA 4WEJA 2VX8A 1P0ZA 4F3LA 4ARZB 4HY8A 4PHTA 2ZMVA 3OCLA 2QJ5A 1P9WA 1EW0A 5AJGA 3ZYTA 4L0LA 1ZHHB 1T1AA 4LLOB 1YSPA 1S66L 1Y28A 4HJ4A 1LSWA 2M7VA 4GLQA 4Q0JA 2J3WA 1V9YA 4MDZA 2A2LA 5L8MA 4O8GA 2OWHA 2PYRA 1F98A 2Y8HA 4IJGA 3E4QA 2Z6DA 2BASA 5TJJA 3R4KA 4MN6A 4PKYA 5DFYA 2VKSA 2K31A 1S4SA 3D3OA 3BY9A 4MMNA 1VB6A 3TJZC 5AVEA 3LIDA 4Y5FA 2XSSA 3F1PA 2GJ3A 2HV1A 3T4OA 2Y79A 1KOUA 3UE3A 3FPWA 3VV4A 4MN5A 4FOFA 4KUOA 3R7WB 4GW9A 3EGXC 3A0SA 4I3AA 5HDDA 3S7OA 3K2NA 5MC7A 4O0PA 3C8CA 3UMDA 2B18A 4LRZE 2W1RA 5J7EA 2IA2A 2XROA 4ETZA 3SW1A 4BWIA 2CMNA 5TBMA 2O9CA 4HJ3A 3T4LA 2W3GA 4DJ2A 3BJNA 4HP9A 3D72A 5F6AA 2NUPC 5F68A 2FH5A 3PBSA 5G4YA 2K2NA 1MZUA 4I5SA 2INWA 3EGDC 2KOIA 3ZQ5A 3OLOA 2W0NA 3LICA 3HCYA 3VOLA 1S1YA 3UB7A 4IHQA 3VE4A 3KO6A 3TE8A 2ZOIA 3UB6A 1OT9A 1OTEA 4ARZA 4IUKA 3B47A 1OTAA 4B93A 5C5KA 4I3IA 4EQ1A 4NKPA 5HD3A 1XFQA 4YNRA 5AVFA 3UB8A 1T1CA 4BBUA 5EFWA 4R3AA 4DN0A 3MQOA 3W2ZA 5LBRA 1WA9A 3PBOA 4OOMA 1XJ4A 1OJ5A 2V1BA 3E0YA 1MC0A 4EW7A 3UMEA 4B9OA 3PBNA 3T4KA 4KQOA 4LPZA 5J3WA 2B02A 4Q0HA 4DJ3A 1D06A 2WKRA 2O0YA 4G3KA 3V67A 4PAUA 5HD5A 2VV7A 2QYBA 3A0RA 2PHYA 5DJUA 3GECA 5DKLA 2QKPA 3R7WA 2LB5A 5K5BA 1YSQA 3A0VA 5CX7A 2PD7A 1T19A 4JGRA 1S1ZA 5HL6A 2W27A 4RQ9A 3IS2B 3EEAA 3KSGA 3C30A 4ETXA 3KYQA 2M7UA 3CUEC 3HJKA 2V9AA 2HJ9C 4MCWA 2OWJA 5KSHA 2QHKA 4WF0A 2J3TC 3C2WA 1OTBA 4EU0A 3CI6A 3FG8A 3C38A 3FPVA 5HSQA 3PYPA 4BBVA 2EWVA 3IBRA 1IFQA 1GSWA 4FSFA 1XJ2A 2A24B 4HP4A 3S7QA 3LIAA 2HGVA 3PBRA 2DMWA 4CLCC 3NOUC 3KSFA 1NRJA 1TS8A 1VHMA 4WELA 1DRMA 1F5MA 4HOIA 1UWPX 4M4XA 1G6OA 2MJ6A 3BW6A 5KIZA 4NEED 1TD5A 4JGPA 3HJIA 2VLGA 5HWVA 4NXEA 3H7WB 4NXBA 5HWWA 2WKQA 3NHQA 3G6OA 2GNXA 3RFBA 3LIEA 4WL9A 4KQDA 2O9AA 5J4EA 2YKFA 3E4OA 3MMHA 2W3EA 3KX0X 1V9ZA 4Y3IA 1H8MA 2W3HA 1G28A 3NOTC 2XA7S 4I38A 3H82B 4G3VA 1W63M 1YKDA 3NOPC 3PHYA 3S7NA 4JGOA 1X0OA 3MJQA 1H3QA 3RH8B 1BYWA 1S4RA 4R70A 4L9EA 3LR3A 4HH3A 2L1MA 4WEKA 4K08A 2O9BA 1JNUA 2OAQ1 3PBTA 1T1BA 3UB9A 1UGUA 1ODVA 3E4PA 1TS0A 3LIBA 2JN7A 1NLYA 1IOUA 1NLZA 3MXQA 2XA7M 3TW8A 2EA9A 5A8BA 2I9VA 3H9WA 2PD8A 3F1OB 2GZAA 3T4TA 1N9NA 3CITA 3IS2A 4DMZA 5DF9A 1OPXA 4XT2B 1XFNA 2QJ7A 2ZMFA 4WUJA 3E98A 3MFXA 5I5LA 5IS1A 1XJ6A 2P04A 2M1CA 2PYPA 2J3TD 5HPIA 4HH2A 3VE3A 3P01A 4HIAA 3T4SA 2V0UA 2L4RA 1P97A 1YAXA 1TS7A 4G3WA 4GS9B 4Q0IA 4I39A 2A24A 4EEPA 3LYXA 2R78A 2PT7A 3PR6A 4I3JA 4CLCE 3UE6A 3NJAA 2WKPA 4L9GA 1P9RA 1OT6A 2O99A 4PKYG 5HWTA 5DKKA 5HDSA 4HJ6A 4NXGA 3T4QA 2KX6A 1OTDA 5F69A 1XJ3A 2PDRA 3CWFA 1MKMA 3T4JA 4JGQA 3H7WA 2P08A 3JVVA 1UWNX 5G4ZA 2K7SA 4LRYC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DMW A;  1IFQ A;  2NUP C;  4AFI A;  4B93 A;  1H8M A;  3BW6 A;  2VX8 A;  1IOU A;  3EGX C;  2NUT C;  3KYQ A;  3EGD C; 
#chains in the Genus database with same CATH topology
 3F1N B;  3EEH A;  3KSI A;  5FDS A;  2OV5 A;  1QMF A;  3RJU A;  4EES A;  3H82 A;  1HVB A;  4HQA A;  3B33 A;  4KQQ A;  2JHE A;  3VP3 A;  1MKI A;  5BOH A;  3L9K A;  1YMS A;  2VJW A;  3ZHH A;  2E8J A;  1NWZ A;  3PBQ A;  4CLC B;  2H28 A;  4JPM A;  4UA9 A;  1K55 A;  1L0E A;  1LL8 A;  1BUE A;  5DJT A;  2JKR I;  3GDI A;  3IHA A;  5I94 A;  3ZG0 A;  5FQJ A;  3DWK A;  3QP4 A;  5GLA A;  3T1R A;  2BTF P;  3PTE A;  5DFX A;  1FCM A;  5L10 A;  1LT0 A;  1L2S A;  4EEU A;  3P7N A;  3QP5 A;  2OAP 1;  1NZO A;  2E8I A;  2FZ0 A;  3JPU A;  3Q1F A;  1PW8 A;  3SZT A;  1DP6 A;  3MF0 A;  3V50 A;  1CK3 A;  4AFI A;  3MR0 A;  5DTT A;  2EX2 A;  1L0F A;  2W3D A;  3HUN A;  1YLP A;  5HPF A;  4EER A;  2KLI A;  3WS1 A;  2XF3 A;  3MXS A;  4S2N C;  4BD1 A;  1NZU A;  4K0W A;  3W4P A;  3OOV A;  1W8Y A;  1VM1 A;  4R1G A;  2EWW A;  3LEQ A;  5J8X A;  4OPZ A;  1W5D A;  4GZB A;  4R6L A;  3BEB A;  4KZ4 A;  3VFH A;  4E3K A;  1SKF A;  2KDK A;  1N9O A;  2D01 A;  4HNB A;  5F83 A;  2VGL M;  1H5X A;  3IXH A;  5EVE A;  2W1T A;  1W63 Q;  1CF0 A;  2JC7 A;  3UY6 A;  2WGV A;  4UEY A;  2XGN A;  4DRT A;  2ZQC A;  2EXB A;  3DTE A;  4WEJ A;  4MNR A;  2V8C A;  2VX8 A;  1KE0 A;  1P0Z A;  1K4E A;  4ARZ B;  3BFG A;  1P9W A;  1K56 A;  3G2Z A;  5HW3 A;  5KZH A;  1ZHH B;  1T1A A;  4LLO B;  4X6T A;  2HDR A;  1YSP A;  1S66 L;  4P87 A;  2ZLY A;  5G18 A;  1WYC A;  4GLQ A;  4Q0J A;  1V9Y A;  5EVI A;  4BEN A;  4Y0O A;  3OPR A;  2XK1 A;  1G68 A;  2Y8H A;  1PI4 A;  4IJG A;  1LL5 A;  3IXG A;  2Z6D A;  2BAS A;  5DFY A;  2VKS A;  4HEF A;  4R23 A;  4RVA A;  1S4S A;  3D3O A;  1K25 A;  2UWX A;  2XSS A;  3F1P A;  2HV1 A;  3W8K A;  3UE3 A;  4GD8 A;  1N4O A;  3DTK A;  4FOF A;  3ZCZ A;  4EBP A;  3K2N A;  4XUX A;  3SS4 A;  1KVL A;  1O7E A;  4LRZ E;  4CJN A;  3NEC A;  3NY4 A;  2JCH A;  4X69 A;  2CMN A;  1L3L A;  2HDS A;  2O9C A;  5DVA A;  5F68 A;  2FH5 A;  5G4Y A;  1PWC A;  2XQZ A;  5FAQ A;  2PU4 A;  5CRF A;  3ZQ5 A;  1CI8 A;  3E2K A;  3MKF A;  4ZBE A;  3OLO A;  2W0N A;  4IHQ A;  3KO6 A;  3IHB A;  3ZNY A;  4FTX A;  5L09 A;  3UB6 A;  1SHV A;  1PRQ A;  2UV0 E;  3OPP A;  5C5K A;  3IX3 A;  4NKP A;  4ESP A;  1XFQ A;  3ZVT A;  4QHC A;  3W2Z A;  1IKI A;  3PBO A;  4WZ5 C;  2B95 A;  1H0M A;  4ZTK A;  1OJ5 A;  3LGO A;  3HLG A;  3N7W A;  4KQO A;  4C6Y A;  1K6R A;  1F2K A;  1JVJ A;  5FQQ A;  3N8S A;  1CQA A;  5FQI A;  4X1M A;  2VV7 A;  2QYB A;  4QJG A;  1AXB A;  2QKP A;  3M2K A;  5K5B A;  3HLF A;  5CX7 A;  3IWO A;  4RQ9 A;  3KSG A;  4HBT A;  1I2W A;  1L0D A;  5GL9 A;  2V9A A;  2Z2M B;  2OWJ A;  3SH7 A;  3CPT A;  3FG8 A;  5IHV A;  4NG2 A;  4ZJ1 A;  1GSW A;  1YPR A;  2BLS A;  2WKI A;  3S7Q A;  2HGV A;  1JTD A;  3PBR A;  3ZDJ A;  3NOU C;  3TG9 A;  1NRJ A;  4WEL A;  4FH2 A;  1DRM A;  3DTI A;  4HOI A;  1XGI A;  5FAP A;  3WWX A;  1WYB A;  4DE0 A;  3IX8 A;  1BSG A;  4QY6 A;  1Q2Q A;  1U60 A;  3WS2 A;  2IWB A;  3NHQ A;  2ZMA A;  3G6O A;  4WL9 A;  3LIE A;  4KQD A;  2O9A A;  2Y2P A;  3E4O A;  4WM9 A;  2W3E A;  2QMI A;  3KX0 X;  2QPN A;  4DDY A;  1D1J A;  1K0K A;  4I38 A;  4KZ3 A;  3H82 B;  3GV9 A;  3NOP C;  5L07 A;  3UE0 A;  1K57 C;  4D2O A;  3FZC A;  3HLE A;  1RCJ A;  1S4R A;  4N9L A;  1FIK A;  4JXG A;  1BZA A;  2A49 A;  1UGU A;  1ODV A;  3E4P A;  2JN7 A;  1NLY A;  1IOU A;  1NRF A;  3TW8 A;  2HZ5 A;  3IXB A;  4CPK A;  1N9N A;  1ZKJ A;  3CIT A;  2RL3 A;  5DF9 A;  1OPX A;  2QJ7 A;  3MZF A;  4WUJ A;  1BTL A;  4P85 A;  5I5L A;  3GRJ A;  3BM6 A;  1KGG A;  4K91 A;  4PM7 A;  4BL2 A;  3VSK A;  1XJ6 A;  2M1C A;  3SOI A;  5E2E A;  2J3T D;  4HH2 A;  5GHX A;  1G5U A;  3G34 A;  4G3W A;  1H8Z A;  2ZQA A;  4EEP A;  2Y2J A;  3KYE A;  2PT7 A;  1TVF A;  1MXO A;  3HLB A;  4EBN A;  3ZNT A;  5HX9 A;  4HJ6 A;  1OTD A;  1XJ3 A;  2C5W B;  2PDR A;  3D9Y A;  4E3J A;  5EVL A;  2EFX A;  2FFY A;  3H7W A;  4R4R A;  1UWN X;  2BG1 A;  3CJM A;  2HF6 A;  3M2J A;  4FCF A;  3RXW A;  1ZG6 A;  2VV6 A;  3MQ0 A;  1XGJ A;  1KVM A;  1N9L A;  5HZH A;  1IEM A;  1ONH A;  1K54 C;  3OBF A;  1G6A A;  2WGW A;  2V0W A;  4OVD A;  1SZV A;  2PR5 A;  1D7E A;  4HI4 A;  3QP2 A;  3BYD A;  4P0M A;  3KYZ A;  4X1L A;  2W1T B;  4BBT A;  3U2A A;  4E3I A;  3F1O A;  5M1A A;  2VGK A;  2HJE A;  1YMX A;  4XT2 A;  2Y59 A;  3IBJ A;  2JKG A;  4E3M A;  2Y2Q A;  3A3F A;  1TF1 A;  4Z1W A;  3UNW A;  5HAQ A;  3TSG A;  1RGY A;  3GMW A;  4IUH A;  1BLH A;  1GA9 A;  3QNB A;  1Z6F A;  1S67 L;  3SS3 A;  2Q0O A;  2G7U A;  3DW0 A;  4RYE A;  3HLC A;  2OLU A;  3HVF A;  1OME A;  5FAO A;  2VZW A;  5FL3 A;  5FAT A;  3AGE A;  2ZQ9 A;  3MQQ A;  4BMW A;  5EVI B;  4UA6 A;  3S7P A;  2XFS A;  2QWS A;  3G35 A;  3NUL A;  4GJ4 A;  4S2I A;  4ZRR A;  1YT4 A;  3F1P B;  4MBK A;  2JKT M;  4JKT A;  4H6J A;  3EQV A;  1NJ4 A;  3BFF A;  3C4P A;  1DP8 A;  4NXF A;  4UQI S;  3K3C A;  5HDC A;  3S4X A;  4L9F A;  5EUA A;  1TS6 A;  4PPR A;  1GSV A;  1L0G A;  3A3J A;  3UDF A;  3ZG8 B;  2VGJ A;  1E3U A;  3LI9 A;  4P6Z M;  3V3S A;  4S2O A;  3LR5 A;  1IYS A;  3N6I A;  4R38 A;  4OPQ A;  5CXW A;  2VV8 A;  2Y2N A;  5DTK A;  4S2K A;  4RX3 A;  3FV7 A;  4F3L A;  4ID4 A;  2XFT A;  5A90 A;  3VP1 A;  1EW0 A;  2WKH A;  1ESI A;  4L0L A;  2G2U A;  3MZE A;  2ZJ9 A;  2J3W A;  3UN7 A;  4LEN A;  2A2L A;  5L8M A;  1ES5 A;  4O8G A;  1E4D A;  3E4Q A;  3GQZ A;  3S1Y A;  2XR0 A;  3CG5 A;  5JYO A;  3TJZ C;  1M6K A;  3LID A;  4Y5F A;  2Y79 A;  3O88 A;  3A0S A;  5HDD A;  4LCM A;  4O0P A;  4PMA A;  4DXC A;  1DJC A;  3L7H A;  4QWO A;  2W1R A;  3IF6 A;  3SW1 A;  4BWI A;  3HL9 A;  5E43 A;  2V2F F;  4DJ2 A;  3OPL A;  4HP9 A;  3CPT B;  2HP9 A;  5CGW A;  2ZM2 A;  4O7D A;  2ZQ8 A;  1YLY A;  3EGD C;  4XXR A;  5F1F A;  2H10 A;  3LIC A;  3VFF A;  1HD8 A;  4E3O A;  2Y2M A;  4U3T A;  5CGX A;  2J9O A;  2ZOI A;  1HTZ A;  1ALQ A;  4B88 A;  4JXW A;  5CGS A;  3B47 A;  2Y2K A;  4B93 A;  4BL3 A;  4I3I A;  4DXB A;  3UB8 A;  3ITB A;  1T1C A;  4S2M A;  1K4F A;  3MQO A;  1NYM A;  2CC1 A;  4IBX A;  2X02 A;  5FQ9 A;  5CED A;  4EW7 A;  3G4P A;  3PBN A;  1SCW A;  4N1H A;  3T4K A;  3D4F A;  5U47 A;  2EX6 A;  2B02 A;  4Q0H A;  4DJ3 A;  1D06 A;  4NK3 A;  2WGI A;  2IWD A;  3A0R A;  1YQS A;  2PHY A;  3GEC A;  3R7W A;  2LB5 A;  2JE5 A;  3A0V A;  1VEU A;  2PD7 A;  3LY4 A;  1K6S A;  3UE1 A;  1ERO A;  2EX8 A;  3ZFZ A;  3CUE C;  4OKP A;  2HJ9 C;  3T12 B;  5KSH A;  3IX4 A;  1FIL A;  2J3T C;  3QHY A;  5E2G A;  4DKI A;  4KEN B;  1IFQ A;  5EEC A;  5DF7 A;  4FSF A;  4GDN A;  4S2N A;  1XJ2 A;  3LIA A;  2DMW A;  4CLC C;  1VHM A;  2XD5 A;  1UWP X;  3TOI A;  1FQG A;  3BW6 A;  5KIZ A;  3GSG A;  4NEE D;  1FR1 A;  1SDN A;  4JGP A;  4FH4 A;  5AQ7 A;  4GDB A;  3H7W B;  2P9V A;  3RFB A;  3Q07 A;  4JF4 A;  4ZJ3 A;  4YIN A;  1H8M A;  2XA7 S;  3MZD A;  1Z09 A;  1GHM A;  3PHY A;  3S7N A;  2PAV P;  1H3Q A;  1ERQ A;  5A91 A;  4R70 A;  4B4Z A;  3DAV A;  2WGW B;  4WEK A;  4K08 A;  1FCO A;  2GDN A;  4KG5 A;  3LIB A;  4JF6 A;  1NLZ A;  3ZG5 A;  1GA0 A;  3C7U A;  1BLS A;  4IBR A;  2I9V A;  2R9W A;  3H9W A;  1M40 A;  3F1O B;  3T4T A;  4S2L A;  3VOY A;  3IS2 A;  4XT2 B;  3MFX A;  1S0W A;  1NY0 A;  2Q9N A;  1LLB A;  3OPH A;  5TR7 A;  3VE3 A;  3NIA A;  3P01 A;  3V5M A;  1N9B A;  3T4S A;  1P97 A;  4Q0I A;  2A24 A;  4E6X A;  3MS6 A;  2R78 A;  3PR6 A;  3UE6 A;  3ZVW A;  3SH8 A;  2OSU A;  5EE8 A;  2O99 A;  4OQG A;  5HWT A;  5DKK A;  3HLD A;  5F69 A;  3T1Q B;  1FCN A;  4JGQ A;  4ZDX A;  2WK0 A;  4C3Q A;  2K7S A;  4LRY C;  4II7 A;  2ZBB A;  3BQA A;  4EXO A;  4H6J B;  3U4L P;  3FC7 A;  3GVB A;  4OPY A;  3ZGA B;  3I7J A;  2L0W A;  3HUM A;  4KUK A;  1STZ A;  1FR6 A;  3TRC A;  3EWK A;  2LB9 A;  2JKT I;  2Y4A A;  2J80 A;  1SDE A;  2ZL1 A;  4ME4 A;  2XDM A;  4ZJ2 A;  2P7J A;  4EUV A;  1O07 A;  4QY5 A;  2W3F A;  4RA7 A;  4H8R A;  2ZOH A;  4JF5 A;  5EM0 A;  4F3L B;  1YLW A;  1S6R A;  4WZ5 A;  3C5A A;  4XUZ A;  3Q81 A;  2WZX A;  1XA7 A;  4WN5 A;  2ZC7 A;  1LSV A;  2Z6C A;  4JLF A;  4QU3 A;  4HHD A;  4BJP A;  1GSX A;  5CHJ A;  5GHY A;  4EWF A;  1IYP A;  4GOG A;  2WUQ A;  4KG6 A;  4O01 A;  1RGZ A;  4GCZ A;  4WMC D;  3ICY A;  1MWR A;  4Y0T A;  5CEB A;  3AGD A;  4X68 A;  2ZD8 A;  5GLB A;  3A3E A;  3JVU A;  5HAR A;  5IU1 A;  1IYQ A;  2H0Y A;  3BQ8 A;  4LRX C;  2YKH A;  4YWZ A;  4UHU A;  2VGL S;  5KMW A;  1OJG A;  3ULF A;  3K3D A;  1T18 A;  2Q9M A;  4X53 A;  4GHI A;  1EWZ A;  3IF6 B;  1DP9 A;  3P98 A;  1EI5 A;  3DBA A;  2J9P A;  1KGF A;  2Y2H A;  3VOZ A;  4CLC D;  5F5Y A;  2AVX A;  1OTI A;  1SKO A;  1ZTU A;  3EQU A;  5FI6 A;  2OLV A;  3HRE A;  3O5Y A;  2ZQD A;  3QP8 A;  5TFQ A;  4Y2F A;  2EX9 A;  2GX5 A;  1W8Q A;  4QB8 A;  1MWU A;  3B42 A;  2VA0 A;  2DCF A;  2VEA A;  1KGE A;  3WRT A;  4DE3 A;  5E2F A;  1K57 A;  4U0X A;  4KZB A;  1KDS A;  3A3D A;  3O3V A;  1CI9 A;  4HBU A;  5FEF A;  2QJ5 A;  4FUW A;  4MEZ A;  4P6B A;  4BD0 A;  2FFF B;  3VSL A;  3UDI A;  3SH9 A;  4GKU A;  2M7V A;  3FKV A;  2VK3 A;  5TJJ A;  3R4K A;  1CEF A;  4IVK A;  3ZG7 B;  1I5Q A;  1LI0 A;  2K31 A;  4DF6 A;  4DE1 A;  4MMN A;  1J3W A;  3G2Y A;  5A92 A;  4GN2 A;  3T4O A;  2GJ3 A;  4LV0 A;  5CTN A;  3FPW A;  4WZ4 A;  4KUO A;  3R7W B;  3EGX C;  4I3A A;  1VEU B;  2EXA A;  3S7O A;  5MC7 A;  3C8C A;  5L2F A;  3VMA A;  5TBM A;  2H5S A;  4OON A;  3WRZ A;  3GTC A;  3D72 A;  2NUP C;  3PBS A;  2K2N A;  2XLN A;  1MZU A;  1YLZ A;  4I5S A;  3WS5 A;  1NYY A;  2PBD P;  4BLM A;  1XXM A;  2KOI A;  4Y13 A;  3C7V A;  3HCY A;  1S1Y A;  4LV3 A;  4R3J A;  3VP4 A;  3UB7 A;  1K55 C;  2V1Z A;  5FDH A;  1YM1 A;  4YFM A;  5M18 A;  1OT9 A;  4IUK A;  2P9V B;  1OTA A;  4MBF A;  3NDE A;  5DTS A;  5HD3 A;  5AVF A;  3SS5 A;  1ES4 A;  5F1G A;  2ZM0 A;  4R3A A;  1NXY A;  1LI9 A;  5LBR A;  1BT5 A;  1WA9 A;  4IED A;  5HL1 A;  1XJ4 A;  2V1B A;  3E0Y A;  3UME A;  4B9O A;  3ZG9 B;  1XA1 A;  1K38 A;  3UPO A;  4LPZ A;  4KG2 A;  5AQ9 A;  4LV2 A;  5J3W A;  1KE3 A;  3HLW A;  2WKR A;  2O0Y A;  3IH9 A;  2EFU A;  4PAU A;  4N9K A;  2WAF A;  3QP1 A;  1A0K A;  5DJU A;  1ZC2 A;  2WYX A;  5DKL A;  4GD6 A;  4JGR A;  1S1Z A;  4EQI A;  3IS2 B;  4ETX A;  4NET A;  3KYQ A;  2ZC5 B;  3Q7V A;  4B4X A;  1JTG A;  3S22 A;  3HJK A;  1XPB A;  4Y7P A;  1KDW A;  4MCW A;  1C3B A;  2QHK A;  3C2W A;  4EU0 A;  1LL9 A;  3FPV A;  5HSQ A;  4BBV A;  1W7F A;  2EWV A;  3IBR A;  3PAE A;  1Y54 A;  4OQ0 A;  2A24 B;  4HP4 A;  4GB7 A;  1TS8 A;  5CTM A;  1F5M A;  4E6W A;  3IH8 A;  4M4X A;  4OPR A;  1G6O A;  3MSH A;  3UPN A;  2HPB A;  2MJ6 A;  1XKZ A;  2Z2L B;  1TD5 A;  4OLG A;  2DNS A;  4OLD A;  5GHZ A;  5HWW A;  3FWL A;  2WKQ A;  1PWG A;  3MXR A;  5J4E A;  5FEG A;  3IQA A;  3MMH A;  1ESU A;  5JYP A;  3NOT C;  4G3V A;  1W63 M;  1ACF A;  1DY6 A;  3Q82 A;  4LCL A;  4JGO A;  1X0O A;  3MJQ A;  4Q8I A;  1BYW A;  1KE4 A;  1TEM A;  4KQR A;  2Y91 A;  2V8F A;  2L1M A;  1JNU A;  1GCE A;  1VET A;  1PZO A;  2OAQ 1;  3PBT A;  3T1X A;  4KZ5 A;  1TS0 A;  3MXQ A;  3BRM A;  1TDL A;  2EA9 A;  4JXV A;  2XH9 A;  5EVI C;  2V20 A;  5A8B A;  1FSW A;  2ZL1 B;  4Z9Q A;  1BLP A;  1CEG A;  3Q7Z A;  5M19 A;  2ZQ7 A;  3E98 A;  1PIO A;  2PYP A;  4S2P A;  3G32 A;  3V39 A;  5HPI A;  1PWD A;  3A3I A;  1GHP A;  2Y2I A;  3NCK A;  3NI9 A;  3LYX A;  4I3J A;  3NJA A;  3ITA A;  2WKP A;  4L9G A;  5EV0 A;  1OT6 A;  1LHY A;  4OH0 A;  3MFD A;  1ERM A;  1ES2 A;  3CWF A;  4Y0U A;  1E3U D;  2PRF A;  2P08 A;  5CER A;  2I72 A;  4KZ9 A;  4FD8 A;  3LO7 A;  3IXD A;  3OC2 A;  2R9X A;  4OOL A;  3LUQ A;  1DJB A;  3BFC A;  4GHI B;  2PR6 A;  4EUZ A;  1PYY A;  2HP6 A;  3BFD A;  3LI8 A;  3RXX A;  3LR0 A;  1SKO B;  3CAX A;  3CZD A;  4X56 A;  2XRN A;  3PXP A;  3C4O A;  4OOY A;  2XEP A;  4S2J A;  4X55 A;  4MN7 A;  3QP6 A;  1XX2 A;  1F9I A;  1LSX A;  4MBH A;  4OQI A;  2JBF A;  3BLM A;  3RTY A;  4WYY A;  1BUL A;  4GS9 A;  5IT5 A;  3O87 A;  1H8Y A;  2OOL A;  2ZC6 B;  3N4I A;  3CMZ A;  2ZC3 B;  4QPR A;  2X01 A;  3OCN A;  4WMC A;  4QD4 A;  1Q2P A;  3BY8 A;  3CLO A;  4LFU A;  3KSH A;  1MPL A;  2V1A A;  4R0Q A;  2WAE A;  3W4O A;  4UA7 A;  4IVI A;  2JKR M;  3V3R A;  3F1N A;  4WBG A;  3CUE A;  4N92 A;  4EET B;  3T50 A;  3LR4 A;  3O86 A;  3N8R A;  2QZ6 A;  2IWC A;  2D02 A;  4C75 A;  3AGF A;  3BWL A;  4P6Z S;  4WLA A;  3EOI A;  3LIF A;  4E04 A;  4K0X A;  4CLC A;  5TBM B;  4KZA A;  3LFV A;  5CEC A;  3UO9 A;  4LGW A;  5FI2 A;  4CQH A;  4R4S A;  3LCE A;  4UQI M;  4YOF A;  5HFO A;  1HZO A;  2NUT C;  5GLC A;  1FOF A;  4LV1 A;  4PM9 A;  3P09 A;  2Y2O A;  5EPH A;  1JWZ A;  4EBL A;  4HY8 A;  3IWQ A;  4PHT A;  2ZMV A;  3OCL A;  1IEL A;  5AQB A;  5AJG A;  3ZYT A;  3LY3 A;  1K56 D;  4DE2 A;  5CHU A;  4OQH A;  2HDQ A;  1Y28 A;  4HJ4 A;  1LSW A;  3UPP A;  3T1S A;  4OP8 A;  4MDZ A;  5EVI D;  2OWH A;  2PYR A;  1F98 A;  1WE4 A;  2XD1 A;  4PKY A;  4MN6 A;  5FAS A;  2HP5 A;  3BY9 A;  1VB6 A;  5AVE A;  4F94 A;  3HBR A;  1PNE A;  5AQA A;  1KOU A;  3GR2 A;  4R3B A;  4UAA A;  3VV4 A;  4MN5 A;  2WZZ A;  4GW9 A;  3MKE A;  3UMD A;  4U0T A;  2B18 A;  2ACG A;  2IA2 A;  5J7E A;  4ETZ A;  2XRO A;  3WS4 A;  3Q7V B;  4HJ3 A;  3T4L A;  2W3G A;  2Y55 A;  3BJN A;  5F6A A;  4RX2 A;  2PU2 A;  5GLD A;  2INW A;  1HLU P;  4E3L A;  3VOL A;  3BLS A;  2WAD A;  2A3U A;  5TGF A;  1PFL A;  3VE4 A;  3TE8 A;  3IWI A;  4DDS A;  1IYO A;  1Y4O A;  3HUO A;  1OTE A;  4N1X A;  1JWP A;  4ARZ A;  1MY8 A;  4GNU A;  3QNC A;  3G30 A;  2P74 A;  4EQ1 A;  1YLT A;  3DWZ A;  5FSR A;  1YLJ A;  4YNR A;  3MBZ A;  3OZH A;  4BBU A;  5EFW A;  3BEC A;  4DN0 A;  3FYZ A;  3NBL A;  5E2H A;  3W4Q A;  4OOM A;  1E25 A;  4PM5 A;  1MC0 A;  2PBY A;  4Y17 A;  3PAG A;  5DF8 A;  1W79 A;  1TDG A;  1VET B;  2B5R A;  3IF5 A;  3V67 A;  4G3K A;  3M6B A;  1PW1 A;  5HD5 A;  1DJA A;  1RP5 A;  2X71 A;  1YSQ A;  1T19 A;  5HL6 A;  2W27 A;  3EEA A;  2G2W A;  3C30 A;  2Y2L A;  3LEZ A;  1J9M A;  2C6W B;  2M7U A;  5HAI A;  2JKF A;  3VP2 A;  4PM8 A;  2RCX A;  4WF0 A;  4JXS A;  1OTB A;  3CI6 A;  4PM6 A;  3C38 A;  1ONG A;  4X25 A;  3PYP A;  2H0T A;  2ZM8 A;  3ISG A;  5F82 A;  4E3N A;  5EOO A;  2ZC4 B;  3WS0 A;  4KZ6 A;  3KSF A;  1FSY A;  2HDU A;  4A5R A;  1CJF A;  3NDG A;  4KZ8 A;  1MBL A;  5HAP A;  3FKW A;  3HJI A;  2VLG A;  5HWV A;  4NXE A;  4NXB A;  5KSC A;  2GNX A;  4EV4 A;  3DTM A;  4JBF A;  4M3K A;  2YKF A;  1PZP A;  1GHI A;  3NC8 A;  1V9Z A;  4Y3I A;  3BFE A;  2W3H A;  1G28 A;  3IT9 A;  1YKD A;  2DRW A;  4D60 A;  1BLC A;  1JWV A;  1ZG4 A;  4BQM A;  3UDX A;  1ES3 A;  4ZAM A;  4OP5 A;  3RH8 B;  4L9E A;  3LR3 A;  4HH3 A;  5EOE A;  2O9B A;  1T1B A;  3M6H A;  3UB9 A;  5FQM A;  2XA7 M;  1IKG A;  4MLL A;  1XP4 A;  2PD8 A;  2GZA A;  2J7V A;  4Y15 A;  4DMZ A;  1K54 A;  1XFN A;  2ZMF A;  5FQK A;  3JYI A;  1QME A;  5FA7 A;  5IS1 A;  5EM1 A;  1MWS A;  2P04 A;  3E2L A;  1MWT A;  5A93 A;  4HIA A;  2V0U A;  2L4R A;  1YAX A;  4GS9 B;  1TS7 A;  4KZ7 A;  4I39 A;  3CHW P;  5CHM A;  3IF6 C;  5FI7 A;  3UB5 P;  2Y2G A;  4CLC E;  1PI5 A;  5D3O A;  1P9R A;  2J8Y A;  4PKY G;  1VQQ A;  5HDS A;  1AWI A;  3G31 A;  4NXG A;  3T4Q A;  1I2S A;  2KX6 A;  1MKM A;  3T4J A;  2WKE A;  3VP0 A;  3N8L A;  3B3X A;  3JVV A;  5G4Z A;  4HES A; 
#chains in the Genus database with same CATH homology
 4II7 A;  2ZBB A;  3F1N B;  3EEH A;  3KSI A;  3BQA A;  2HF6 A;  4EXO A;  3OC2 A;  4H6J B;  4EES A;  3FC7 A;  4OOL A;  3H82 A;  3LUQ A;  2VV6 A;  4HQA A;  3MQ0 A;  3B33 A;  2JHE A;  1N9L A;  4GHI B;  2PR6 A;  5HZH A;  2VJW A;  3OBF A;  1NWZ A;  3PBQ A;  4CLC B;  2H28 A;  2V0W A;  3LI8 A;  2L0W A;  1LL8 A;  2PR5 A;  3LR0 A;  4KUK A;  5DJT A;  1D7E A;  1STZ A;  2JKR I;  4HI4 A;  3CAX A;  3GDI A;  3TRC A;  3KYZ A;  3EWK A;  2XRN A;  4BBT A;  2LB9 A;  2W1T B;  3PXP A;  2JKT I;  2J80 A;  3U2A A;  3F1O A;  4ME4 A;  2HJE A;  2P7J A;  4EUV A;  4XT2 A;  2W3F A;  3IBJ A;  1TF1 A;  4Z1W A;  5DFX A;  4MN7 A;  1LT0 A;  2ZOH A;  1F9I A;  1LSX A;  4IUH A;  4F3L B;  4EEU A;  1S67 L;  3RTY A;  3P7N A;  2G7U A;  4GS9 A;  4WN5 A;  5IT5 A;  2OAP 1;  1LSV A;  2FZ0 A;  2VZW A;  2Z6C A;  5FL3 A;  2OOL A;  4HHD A;  4BJP A;  1GSX A;  1DP6 A;  3MF0 A;  4AFI A;  3MQQ A;  3MR0 A;  4BMW A;  3S7P A;  2W3D A;  4QPR A;  3OCN A;  4O01 A;  5HPF A;  2QWS A;  4GCZ A;  3BY8 A;  3CLO A;  4EER A;  3ICY A;  2KLI A;  3KSH A;  2V1A A;  2JKR M;  4GJ4 A;  3JVU A;  4ZRR A;  3F1N A;  5IU1 A;  3CUE A;  4EET B;  3F1P B;  2JKT M;  3BQ8 A;  4H6J A;  4LRX C;  2YKH A;  3EQV A;  4YWZ A;  3T50 A;  2VGL S;  3LR4 A;  1OJG A;  3OOV A;  1DP8 A;  4NXF A;  3ULF A;  3K3D A;  1T18 A;  2D02 A;  3BWL A;  4P6Z S;  2EWW A;  4UQI S;  4GHI A;  3K3C A;  4WLA A;  3EOI A;  3LIF A;  5HDC A;  4E04 A;  1DP9 A;  4L9F A;  3DBA A;  4CLC A;  1TS6 A;  4R6L A;  2KDK A;  4CLC D;  1N9O A;  5TBM B;  5F5Y A;  1GSV A;  1OTI A;  2D01 A;  4HNB A;  1ZTU A;  3LFV A;  2VGL M;  3EQU A;  2W1T A;  3LI9 A;  3O5Y A;  1W63 Q;  4CQH A;  4P6Z M;  4UQI M;  4YOF A;  4UEY A;  4Y2F A;  2GX5 A;  3LR5 A;  2NUT C;  4R38 A;  2VV8 A;  3B42 A;  2VA0 A;  2VEA A;  4WEJ A;  2VX8 A;  1P0Z A;  4F3L A;  4ARZ B;  4HY8 A;  4PHT A;  2ZMV A;  3OCL A;  2QJ5 A;  1P9W A;  1EW0 A;  5AJG A;  3ZYT A;  4L0L A;  1ZHH B;  1T1A A;  4LLO B;  1YSP A;  1S66 L;  1Y28 A;  4HJ4 A;  1LSW A;  2M7V A;  4GLQ A;  4Q0J A;  2J3W A;  1V9Y A;  4MDZ A;  2A2L A;  5L8M A;  4O8G A;  2OWH A;  2PYR A;  1F98 A;  2Y8H A;  4IJG A;  3E4Q A;  2Z6D A;  2BAS A;  5TJJ A;  3R4K A;  4MN6 A;  4PKY A;  5DFY A;  2VKS A;  2K31 A;  1S4S A;  3D3O A;  3BY9 A;  4MMN A;  1VB6 A;  3TJZ C;  5AVE A;  3LID A;  4Y5F A;  2XSS A;  3F1P A;  2GJ3 A;  2HV1 A;  3T4O A;  2Y79 A;  1KOU A;  3UE3 A;  3FPW A;  3VV4 A;  4MN5 A;  4FOF A;  4KUO A;  3R7W B;  4GW9 A;  3EGX C;  3A0S A;  4I3A A;  5HDD A;  3S7O A;  3K2N A;  5MC7 A;  4O0P A;  3C8C A;  3UMD A;  2B18 A;  4LRZ E;  2W1R A;  5J7E A;  2IA2 A;  2XRO A;  4ETZ A;  3SW1 A;  4BWI A;  2CMN A;  5TBM A;  2O9C A;  4HJ3 A;  3T4L A;  2W3G A;  4DJ2 A;  3BJN A;  4HP9 A;  3D72 A;  5F6A A;  2NUP C;  5F68 A;  2FH5 A;  3PBS A;  5G4Y A;  2K2N A;  1MZU A;  4I5S A;  2INW A;  3EGD C;  2KOI A;  3ZQ5 A;  3OLO A;  2W0N A;  3LIC A;  3HCY A;  3VOL A;  1S1Y A;  3UB7 A;  4IHQ A;  3VE4 A;  3KO6 A;  3TE8 A;  2ZOI A;  3UB6 A;  1OT9 A;  1OTE A;  4ARZ A;  4IUK A;  3B47 A;  1OTA A;  4B93 A;  5C5K A;  4I3I A;  4EQ1 A;  4NKP A;  5HD3 A;  1XFQ A;  4YNR A;  5AVF A;  3UB8 A;  1T1C A;  4BBU A;  5EFW A;  4R3A A;  4DN0 A;  3MQO A;  3W2Z A;  5LBR A;  1WA9 A;  3PBO A;  4OOM A;  1XJ4 A;  1OJ5 A;  2V1B A;  3E0Y A;  1MC0 A;  4EW7 A;  3UME A;  4B9O A;  3PBN A;  3T4K A;  4KQO A;  4LPZ A;  5J3W A;  2B02 A;  4Q0H A;  4DJ3 A;  1D06 A;  2WKR A;  2O0Y A;  4G3K A;  3V67 A;  4PAU A;  5HD5 A;  2VV7 A;  2QYB A;  3A0R A;  2PHY A;  5DJU A;  3GEC A;  5DKL A;  2QKP A;  3R7W A;  2LB5 A;  5K5B A;  1YSQ A;  3A0V A;  5CX7 A;  2PD7 A;  1T19 A;  4JGR A;  1S1Z A;  5HL6 A;  2W27 A;  4RQ9 A;  3IS2 B;  3EEA A;  3KSG A;  3C30 A;  4ETX A;  3KYQ A;  2M7U A;  3CUE C;  3HJK A;  2V9A A;  2HJ9 C;  4MCW A;  2OWJ A;  5KSH A;  2QHK A;  4WF0 A;  2J3T C;  3C2W A;  1OTB A;  4EU0 A;  3CI6 A;  3FG8 A;  3C38 A;  3FPV A;  5HSQ A;  3PYP A;  4BBV A;  2EWV A;  3IBR A;  1IFQ A;  1GSW A;  4FSF A;  1XJ2 A;  2A24 B;  4HP4 A;  3S7Q A;  3LIA A;  2HGV A;  3PBR A;  2DMW A;  4CLC C;  3NOU C;  3KSF A;  1NRJ A;  1TS8 A;  1VHM A;  4WEL A;  1DRM A;  1F5M A;  4HOI A;  1UWP X;  4M4X A;  1G6O A;  2MJ6 A;  3BW6 A;  5KIZ A;  4NEE D;  1TD5 A;  4JGP A;  3HJI A;  2VLG A;  5HWV A;  4NXE A;  3H7W B;  4NXB A;  5HWW A;  2WKQ A;  3NHQ A;  3G6O A;  2GNX A;  3RFB A;  3LIE A;  4WL9 A;  4KQD A;  2O9A A;  5J4E A;  2YKF A;  3E4O A;  3MMH A;  2W3E A;  3KX0 X;  1V9Z A;  4Y3I A;  1H8M A;  2W3H A;  1G28 A;  3NOT C;  2XA7 S;  4I38 A;  3H82 B;  4G3V A;  1W63 M;  1YKD A;  3NOP C;  3PHY A;  3S7N A;  4JGO A;  1X0O A;  3MJQ A;  1H3Q A;  3RH8 B;  1BYW A;  1S4R A;  4R70 A;  4L9E A;  3LR3 A;  4HH3 A;  2L1M A;  4WEK A;  4K08 A;  2O9B A;  1JNU A;  2OAQ 1;  3PBT A;  1T1B A;  3UB9 A;  1UGU A;  1ODV A;  3E4P A;  1TS0 A;  3LIB A;  2JN7 A;  1NLY A;  1IOU A;  1NLZ A;  3MXQ A;  2XA7 M;  3TW8 A;  2EA9 A;  5A8B A;  2I9V A;  3H9W A;  2PD8 A;  3F1O B;  2GZA A;  3T4T A;  1N9N A;  3CIT A;  3IS2 A;  4DMZ A;  5DF9 A;  1OPX A;  4XT2 B;  1XFN A;  2QJ7 A;  2ZMF A;  4WUJ A;  3E98 A;  3MFX A;  5I5L A;  5IS1 A;  1XJ6 A;  2P04 A;  2M1C A;  2PYP A;  2J3T D;  5HPI A;  4HH2 A;  3VE3 A;  3P01 A;  4HIA A;  3T4S A;  2V0U A;  2L4R A;  1P97 A;  1YAX A;  1TS7 A;  4G3W A;  4GS9 B;  4Q0I A;  4I39 A;  2A24 A;  4EEP A;  3LYX A;  2R78 A;  2PT7 A;  3PR6 A;  4I3J A;  4CLC E;  3UE6 A;  3NJA A;  2WKP A;  4L9G A;  1P9R A;  1OT6 A;  2O99 A;  4PKY G;  5HWT A;  5DKK A;  5HDS A;  4HJ6 A;  4NXG A;  3T4Q A;  2KX6 A;  1OTD A;  5F69 A;  1XJ3 A;  2PDR A;  3CWF A;  1MKM A;  3T4J A;  4JGQ A;  3H7W A;  2P08 A;  3JVV A;  1UWN X;  5G4Z A;  2K7S A;  4LRY C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...