2NUTC

Crystal structure of the human sec23a/24a heterodimer, complexed with the snare protein sec22b
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
157
structure length
135
Chain Sequence
MVLLTMIARVADGLPLAASMQEDDLQQYQSQAKQLFRKLNEQSPTRCTLEAGAMTFHYIIEQGVCYLVLCEAAFPKKLAFAYLEDLHSEFDEQHGKKVPTVSRPYSFIEFDTFIQKTKKLYIDSRIMVANIEEVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Protein transport protein Sec23A
publication title The Transport Signal on Sec22 for Packaging into COPII-Coated Vesicles is a Conformational Epitope
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 135
sequence length 157
ec nomenclature
pdb deposition date 2006-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13774 Longin Regulated-SNARE-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.50 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2nutC00
2NUTC 4AFIA 3EGDC 3BW6A 1IOUA 4B93A 1H8MA 1IFQA 2VX8A 3EGXC 3KYQA 2NUPC 2DMWA
chains in the Genus database with same CATH superfamily
5FL3A 2FZ0A 3O5YA 4X56A 2Q0OA 4MCWA 4OOLA 3P7NA 5CX7A 2W3EA 5HDSA 4WZ5A 5EM0A 2VGLS 3IQAA 2WGVA 4E3MA 3KSHA 5EVIA 4BBVA 2IWDA 4BL3A 3O88A 4X6TA 3T1XA 2V20A 2Y2HA 2W3HA 4Y13A 4S2MA 3WS4A 4Y2FA 1IFQA 5FQMA 2PAVP 2PU2A 4EEUA 5AVEA 5HZHA 3DW0A 4KG5A 5HSQA 3M6BA 3EOIA 4RYEA 1U60A 1NZUA 3FKVA 2JHEA 4GS9B 3VP1A 2OAQ1 4CLCB 1LL8A 5A90A 5A91A 1EWZA 2I72A 2VZWA 4GJ4A 1NYMA 2YKFA 1K57A 2Y79A 1T18A 3GMWA 1MBLA 3SS5A 5E2FA 2Y2LA 3RH8B 2ZOHA 5I94A 2ZJ9A 4R3JA 1K0KA 2ZQ7A 1NRFA 4GHIB 5E2HA 2QJ5A 2ZMFA 1D7EA 5HARA 1C3BA 5A93A 4Z9QA 3IHBA 2PU4A 1T1BA 4UA6A 5FASA 5GLCA 1IKIA 2P9VA 5FQJA 1DP9A 3C4PA 1XJ3A 2XROA 3B47A 2QMIA 1PFLA 4GZBA 1F9IA 2EX8A 3LFVA 3SW1A 4BD1A 3N8LA 4LV2A 3CG5A 5G4ZA 1M6KA 5GLDA 1ZHHB 4FH2A 3AGEA 4S2PA 2WK0A 3AGDA 5IT5A 1P9RA 1MKMA 1IYPA 4R4SA 2XEPA 1VETA 4Q0JA 5HWWA 3EQUA 3PBOA 1CJFA 3NOTC 3CJMA 3CLOA 3BY8A 3N8RA 2IA2A 1K4EA 5F83A 3RXWA 4PKYA 5HWVA 1FCMA 1PW8A 4A5RA 1G5UA 3S7NA 1UGUA 5E2GA 1ZG6A 4PPRA 2AVXA 1N9NA 3I7JA 1IYOA 1P97A 3E4QA 2PBDP 2PHYA 1JTDA 3M2KA 1VHMA 1MZUA 2ACGA 2WUQA 5DFXA 3EQVA 4Y0TA 1WA9A 3PTEA 5FI7A 1Y4OA 1ONHA 1PZOA 1JNUA 3LIAA 2EX6A 2G2UA 3WRZA 5L09A 5DF8A 4Y15A 2XK1A 2J9OA 4LCLA 3TJZC 4LCMA 2R9XA 3VV4A 4BENA 1H0MA 5CRFA 5A92A 3Q1FA 4NXBA 5M19A 3PAGA 4ID4A 1S6RA 4JGQA 1KE4A 3O3VA 3V39A 3MKFA 5J3WA 4B4XA 1DP6A 3VOZA 4R1GA 3GTCA 1J9MA 4EQIA 2VKSA 3T4KA 2HDUA 5FDHA 2JKTI 4OQ0A 2Y4AA 4HBTA 5HFOA 2LB9A 5CHUA 1ONGA 2V1ZA 4JGPA 1SZVA 3DBAA 3M6HA 5EVIB 3UDIA 3V3SA 2DCFA 1A0KA 1MWUA 3LR4A 3TW8A 4MBKA 1PI5A 3UE6A 1DY6A 1SKOB 3A3EA 4FOFA 4Y0UA 1TD5A 5HAIA 4BQMA 2ZC4B 1K4FA 1OT6A 2WZZA 5G4YA 3WS1A 4P85A 3IHAA 1LL9A 3A3DA 3VFHA 1ESIA 2JBFA 4LFUA 3T1RA 2VK3A 1YSPA 2ZQ9A 4HQAA 4MDZA 4P0MA 2HJEA 2A24A 4OP8A 4BL2A 1PWDA 1N9OA 3B3XA 4FD8A 5F1FA 4LPZA 1OJGA 4ZJ2A 1H3QA 4DE1A 3S4XA 1Q2PA 3HREA 2V9AA 2XGNA 3NI9A 1S67L 2QJ7A 4JPMA 4U0TA 3GRJA 1G6OA 3NECA 1XKZA 2W0NA 4WBGA 3HLCA 4IVKA 1K54A 3D3OA 3ICYA 1YSQA 4BD0A 4IBRA 2MJ6A 3LY3A 3MXSA 2O9CA 3P09A 3OOVA 4JKTA 4LRZE 4LV3A 5HDDA 3VP3A 3MBZA 2PR6A 4OKPA 2M7VA 3HLWA 2QHKA 3MMHA 3CITA 2K2NA 4LRYC 4DXBA 4HIAA 2CMNA 2G7UA 3RFBA 1YLTA 3GQZA 3NULA 5HD3A 1PWCA 1NWZA 5DJTA 3T50A 3ZG5A 1S66L 2KLIA 3D4FA 1IEMA 2GJ3A 2XF3A 2XD5A 3LUQA 1TDLA 2IWBA 5CGXA 3JYIA 1WE4A 4ESPA 2QPNA 3UO9A 3Q7VA 2XA7M 2ZBBA 1MWRA 5TBMB 2EXBA 1UWPX 4GD8A 5IHVA 5GHXA 5FSRA 3G31A 1SHVA 3LEZA 4CJNA 1SDNA 1L2SA 1TS6A 1ODVA 1HD8A 1EROA 2WKPA 5FQKA 4KG2A 1H8ZA 1FQGA 2C5WB 3E4PA 4UAAA 1FOFA 4Y17A 3VOYA 4WMCA 3PHYA 5JYOA 1E3UA 2Y2JA 3OBFA 3BYDA 1PZPA 2HP5A 1IYQA 5CTMA 3UB9A 1CK3A 1GCEA 2QWSA 2D02A 3MF0A 4K0WA 1UWNX 3VE3A 3S22A 1YLJA 4S2KA 4ZAMA 3UY6A 5J8XA 1AXBA 3LIEA 4BWIA 2XQZA 2VX8A 3WRTA 3DWZA 4IUHA 3VP2A 2Y59A 3BEBA 4R4RA 3NC8A 4I3JA 4DDYA 3IT9A 5E2EA 2WADA 1BTLA 2W3DA 2WYXA 1PW1A 3TRCA 2X71A 3NHQA 2A2LA 1O7EA 4Q8IA 5LBRA 2VGKA 1CI9A 2W1RA 1DJAA 5HDCA 4GNUA 3BM6A 3E0YA 4G3KA 1GHPA 1ZG4A 3H9WA 1YLZA 4BMWA 4R38A 2JKRM 3TG9A 3K3DA 3IBJA 3G4PA 3BLMA 2JC7A 2KX6A 4P6BA 3MR0A 1RP5A 3CAXA 2Z6DA 3C7UA 3FYZA 1ALQA 4HH2A 2L0WA 4EERA 3T1SA 2HDQA 1ERMA 2ZC3B 1YLPA 3NDGA 2O0YA 3LIFA 1MWSA 1DRMA 2A24B 3OPLA 5U47A 3HLDA 1OMEA 1Z09A 2WGWA 4X53A 3SZTA 4JGRA 4B93A 2ZQAA 2FH5A 4CQHA 3LO7A 3F1PA 4H6JA 4IBXA 3O86A 5DTSA 4F3LA 4ME4A 4PAUA 4RX3A 4HH3A 4Q0IA 4E6WA 2GZAA 5GL9A 2HGVA 2GDNA 2OWHA 3LI9A 4WEJA 2EFXA 3A0VA 4QY5A 3BY9A 2WKRA 4EXOA 1XA1A 4IVIA 3EEAA 3E2KA 4N9LA 5GHZA 2A3UA 4EESA 4DE2A 1LL5A 3ZG9B 5F5YA 3VMAA 1L0FA 1K56D 5IU1A 3MZFA 4II7A 2L4RA 3C38A 3VSLA 2G2WA 5HWTA 1MKIA 2J9PA 4OP5A 4EBPA 4ZBEA 4CLCD 3NY4A 4KZ7A 4LGWA 3VE4A 3PBSA 2EX2A 4X69A 4R3BA 3HBRA 3CPTB 3G34A 1TDGA 4I5SA 4KQDA 3MZEA 4PM6A 2L1MA 3MQQA 3WS2A 3IF6A 1LT0A 2J8YA 5HX9A 2QZ6A 1WYBA 1ES4A 4RA7A 2R78A 1W8QA 3MSHA 1ZC2A 3IH8A 1XP4A 4P6ZS 4GD6A 1D06A 1W7FA 5IS1A 1YMXA 5EM1A 4EBLA 4WMCD 1ES5A 5AQ9A 4EETB 1E3UD 3IWIA 2JKFA 4EV4A 1XGJA 3U2AA 1K54C 3IWQA 1S4RA 3HUNA 5CHMA 5FEGA 1BUEA 3N7WA 3SH7A 5FQIA 3ITBA 3ZCZA 3IX8A 2Z2MB 2VV8A 3GVBA 1LSWA 1RCJA 1ACFA 4HP9A 4X68A 3OC2A 4O8GA 4S2IA 1VQQA 5F68A 2XA7S 3IWOA 1KVMA 3DWKA 3IXHA 1VEUB 3F1NA 1YAXA 2B5RA 3UB8A 1XFQA 2PR5A 3TSGA 3BQAA 1SCWA 4MEZA 2XFTA 4ARZB 1I5QA 4S2OA 3T4TA 5DJUA 1CF0A 3C30A 5TR7A 3ISGA 4P87A 4L9GA 4N9KA 3VFFA 4CLCC 3IS2B 4MN5A 3FWLA 2ZM0A 2PT7A 3CUEC 3LGOA 3SOIA 3MQOA 3UE0A 3S7PA 3Q82A 3W4QA 4CPKA 3C7VA 2KDKA 3H82A 2I9VA 3V3RA 3G6OA 2WAFA 2Y2PA 3ZQ5A 2ZMVA 5HAPA 4QB8A 3UE1A 2V0UA 3CMZA 3G35A 1XGIA 4K0XA 4X1LA 2WKQA 2XRNA 3P98A 2ZL1B 2UWXA 3N6IA 1YKDA 3WS0A 3R7WA 2WZXA 4HESA 4GKUA 5DKKA 5KSHA 2JKRI 2FFYA 4Y5FA 4DMZA 3IXDA 3ZG8B 2HP9A 1Z6FA 3MZDA 2ZMAA 1MWTA 4S2NA 3HLFA 4C75A 5EUAA 2X01A 4E3NA 3Q07A 3BFCA 3VP4A 2W1TA 4NXGA 3HL9A 5L07A 2J3TD 3TOIA 5TFQA 5GLBA 3HLGA 4U0XA 3B33A 3F1OA 4GB7A 2DRWA 1OTBA 4KUKA 3V5MA 4UEYA 4NXFA 3OPPA 1JWZA 3E4OA 4WELA 5HL6A 2VLGA 4Z1WA 1NXYA 3LCEA 3D72A 1W8YA 3HJKA 1FR1A 2D01A 2Z2LB 4HJ3A 1MC0A 1M40A 4OLDA 1XX2A 1PRQA 1YLYA 4KUOA 4XT2A 3UE3A 4HOIA 4EU0A 3ULFA 3KYEA 1OTDA 1I2WA 1GSWA 5EV0A 1J3WA 1BLPA 2WKEA 5FATA 4E3LA 2VJWA 1XPBA 1CEGA 1FCOA 4GDNA 1H8MA 1S1ZA 2OSUA 1G6AA 2O9AA 3L7HA 4UQIM 5DFYA 4ZJ1A 4JXWA 1FIKA 1G68A 3NOUC 2X02A 4KG6A 1D1JA 4BBUA 3V50A 2Y2KA 4M4XA 3LIBA 5I5LA 4GOGA 2BTFP 3HLEA 1TVFA 5L2FA 3BLSA 2V8FA 2OLUA 2P9VB 3UPOA 2J3TC 1K38A 4ETXA 2XSSA 1BLCA 1PIOA 2A49A 2P04A 5F6AA 4DJ3A 1LI9A 4QWOA 1BLSA 5EOEA 4XUXA 5F69A 4WL9A 5CTNA 1QMEA 2XDMA 3UMDA 1SDEA 1VETB 4HBUA 2JKGA 4OPZA 4K08A 3BQ8A 1F5MA 1K56A 2DNSA 2NUPC 1LSXA 4E6XA 3GV9A 3A0SA 4GS9A 5AJGA 4CLCA 5KIZA 1L0GA 1NJ4A 2OOLA 2EX9A 3CUEA 4B9OA 1OTIA 4Y3IA 3IF6C 3SH9A 3ZHHA 1T19A 4D2OA 3JPUA 1GSXA 1L0DA 3WWXA 3MJQA 3QNCA 1WYCA 4EW7A 2WKHA 1YQSA 3ZVWA 2P7JA 5CGWA 4MBHA 1KGFA 2O99A 2P08A 3QP2A 4JF6A 1FCNA 4PKYG 3G32A 4GHIA 4KZAA 4WN5A 5FI2A 2Y8HA 1S1YA 3LIDA 3HVFA 5GHYA 3BFGA 3LR0A 4E3OA 4OPQA 4BBTA 3FPWA 5JYPA 1BULA 1TEMA 3T1QB 5DF9A 4EQ1A 3QP4A 1RGZA 2EA9A 3C2WA 1PI4A 5KMWA 3R7WB 3HCYA 3MQ0A 4F94A 2XFSA 3IX3A 5K5BA 4IUKA 3CZDA 3UN7A 5C5KA 4LENA 5CGSA 2XLNA 3U4LP 1CEFA 2H0TA 4MN6A 1P9WA 3N8SA 3WS5A 2GNXA 1LLBA 1W5DA 1YLWA 5FI6A 3KYQA 4Y0OA 5BOHA 2XH9A 2C6WB 2P74A 4WEKA 3ZDJA 3UMEA 3DTKA 3UDFA 1I2SA 3BWLA 2B02A 4MNRA 4MBFA 4WF0A 2HZ5A 3T4SA 1K55A 3N4IA 1NLYA 1E25A 2HDSA 1OJ5A 3UDXA 3PAEA 3S1YA 5M18A 5FDSA 4WYYA 1L3LA 5GLAA 4N92A 1DP8A 3OZHA 1STZA 3RJUA 1NY0A 3IH9A 2RL3A 5CECA 2BG1A 5EPHA 4JXGA 4XT2B 1FILA 5CXWA 4RQ9A 3OCLA 4L0LA 1FSWA 2CC1A 2BLSA 2UV0E 3PBTA 3B42A 4PM5A 4JLFA 4DJ2A 1FR6A 3UNWA 3V67A 2HV1A 4NXEA 4EBNA 4ZRRA 3EEHA 5HL1A 3W4OA 2BASA 4HHDA 1P0ZA 2B18A 2J7VA 1ES3A 4S2NC 2PD8A 2EWVA 1RGYA 2OV5A 4KZ6A 3LI8A 3T4LA 3KO6A 2K7SA 2H10A 2DMWA 4HY8A 2XD1A 3QNBA 1BZAA 4EEPA 3VP0A 3C8CA 2VEAA 3CI6A 4KZ3A 1IKGA 3ZGAB 1BT5A 3ZG0A 3UB5P 3ZFZA 4JXSA 5HW3A 5J7EA 2PDRA 3SS4A 2PYRA 2JE5A 4OOYA 4FCFA 4O0PA 4MMNA 4B4ZA 2W3GA 4R23A 4UQIS 3MXRA 3ZVTA 2R9WA 2PBYA 1SKOA 4N1XA 1ES2A 4QD4A 3TE8A 3DTEA 3FG8A 4RVAA 4S2LA 1T1CA 3LICA 5DF7A 4IJGA 4R0QA 3DTMA 3NIAA 4JF4A 4O01A 4B88A 2VA0A 4KQRA 3HUOA 3M2JA 1T1AA 2JCHA 1JWVA 4EUVA 5KSCA 3RXXA 1JTGA 1OTEA 1KDSA 3EGDC 4MN7A 5DTTA 4QHCA 2EWWA 2XR0A 5FQ9A 5CHJA 5L10A 5J4EA 3ZG7B 3ZNYA 4ZDXA 4E3IA 3MFDA 4LV1A 3H7WA 3Q7VB 1YPRA 1BSGA 4KQOA 3K3CA 3JVUA 4HI4A 1KGEA 1XJ2A 1VB6A 2M1CA 3A3IA 4I38A 2VV6A 3NOPC 1NZOA 3HJIA 3L9KA 3FZCA 1TS7A 4HP4A 4JBFA 1V9ZA 3DTIA 3OCNA 5KZHA 2W27A 2H28A 1BLHA 4HJ4A 1NLZA 4IEDA 1BYWA 5HD5A 3KSFA 2V1AA 3O87A 1N9BA 1G28A 1KE3A 4OQIA 2H0YA 2V8CA 1FSYA 5D3OA 4YNRA 1H5XA 1N4OA 4KZBA 5M1AA 4PM8A 4G3VA 3PXPA 4C3QA 2Y2OA 2ZD8A 5AQBA 2HJ9C 3QP5A 1W79A 5CEBA 2PRFA 3PBNA 5DVAA 4DKIA 3T4QA 3BFDA 5CERA 4OPYA 3RTYA 3BJNA 2K31A 4YOFA 1IOUA 1JVJA 3A0RA 4L9EA 3ZNTA 3BRMA 4DN0A 5DTKA 4L9FA 4EUZA 3OLOA 5TBMA 3OPHA 4ETZA 3IBRA 3BW6A 3T12B 4GDBA 4JXVA 2VV7A 2ZC5B 3LR3A 2GX5A 3D9YA 4K91A 3ZYTA 2H5SA 4PHTA 2YKHA 5CEDA 2HP6A 1X0OA 1YM1A 2ZM8A 3DAVA 4WZ4A 4X1MA 4NK3A 4GLQA 1KGGA 2OLVA 1EW0A 4NKPA 5EVEA 4OVDA 4R6LA 3BFEA 4BJPA 3UPNA 1V9YA 1XJ6A 1MXOA 4DE0A 3CHWP 2WGWB 4E3KA 4KZ8A 2ZC7A 3G2ZA 5FQQA 1HVBA 3PBRA 3FPVA 2Z6CA 3F1PB 4H6JB 4HEFA 1MY8A 3UB7A 1ESUA 4F3LB 4XUZA 4LLOB 4R70A 4OH0A 1N9LA 5EVID 3W8KA 3HUMA 2Y2MA 1HZOA 1LI0A 4LRXC 4KQQA 1K55C 1L0EA 2Y2QA 5HPFA 4QPRA 5FAQA 3VSKA 3QP6A 3C5AA 1TS8A 4WLAA 3FV7A 1DJBA 5F1GA 3EGXC 3MS6A 4Q0HA 4R3AA 1CI8A 3IF5A 3GDIA 4MLLA 1DJCA 1O07A 4OQHA 4FUWA 2E8JA 5DKLA 1JWPA 2ZLYA 1EI5A 2VGLM 4E04A 3E98A 4GW9A 2J80A 1QMFA 5AQ7A 4OLGA 3JVVA 2O9BA 3G2YA 3IF6B 4M3KA 1IYSA 2QYBA 3GSGA 1XFNA 3GR2A 2VGJA 1W63M 4UA7A 1PYYA 1TS0A 3H7WB 2HF6A 1MPLA 4JGOA 2OAP1 2INWA 4XXRA 3SH8A 3NJAA 2EXAA 4O7DA 2WKIA 4CLCE 2ZQ8A 5EVLA 1HTZA 3ITAA 5E43A 4AFIA 4PMAA 1GA0A 3Q81A 3FKWA 4QU3A 3UB6A 1KDWA 5G18A 2HDRA 4NG2A 4WUJA 4WZ5C 2Y2NA 5F82A 3E2LA 2KOIA 3MXQA 1W63Q 1SKFA 1K6SA 3LEQA 5FA7A 5EVIC 3BECA 4I3AA 3KSGA 2WGIA 1GSVA 4P6ZM 4ZJ3A 2ZQCA 4HNBA 3T4OA 3F1NB 4NEED 1F98A 5HAQA 2QKPA 1YT4A 4I3IA 3UPPA 3PBQA 4KZ9A 1PWGA 3MKEA 3VOLA 1XXMA 1KVLA 4FTXA 3CPTA 2NUTC 3A3JA 2ZOIA 3W2ZA 4S2JA 1NRJA 4IHQA 3LY4A 3KSIA 3FC7A 4JF5A 4KZ4A 4N1HA 4OQGA 1K57C 5EFWA 3GECA 2J3WA 5AQAA 4WM9A 4G3WA 4DE3A 5FAPA 1OTAA 5A8BA 1XA7A 4DDSA 5AVFA 2JN7A 2Y2GA 3NBLA 3A3FA 3H82B 3W4PA 2V0WA 5EECA 2FFFB 2E8IA 3BFFA 4DF6A 1S4SA 3IXGA 2PD7A 1YMSA 1IELA 4OOMA 3S7OA 1KE0A 4OPRA 5L8MA 3NCKA 2ZQDA 1LHYA 2RCXA 3PR6A 3EWKA 2HPBA 1XJ4A 5TJJA 3G30A 4Y7PA 2ZM2A 4GCZA 1OPXA 2Y91A 3OPRA 1Q2QA 1H8YA 2Y2IA 1Y28A 4ZTKA 3C4OA 1CQAA 1VEUA 4LV0A 2W1TB 4I39A 4DXCA 5TGFA 1GHIA 4HJ6A 1F2KA 4YFMA 4H8RA 4E3JA 1OT9A 4DRTA 2Y55A 2V2FF 3F1OB 3QHYA 4ARZA 1PNEA 3KX0X 2IWCA 1ERQA 4PM9A 1ZKJA 4U3TA 4QJGA 3S7QA 4FH4A 4YINA 3QP8A 3AGFA 3IS2A 2ZC6B 4KENB 1ZTUA 1K25A 4KZ5A 1S0WA 4X55A 1LSVA 2OWJA 4RX2A 3P01A 2V1BA 1NYYA 3LR5A 2PYPA 4UHUA 3KYZA 3IX4A 1TF1A 2M7UA 3Q7ZA 1KOUA 2LB5A 4BLMA 2WAEA 1K6RA 3NDEA 4YWZA 1GA9A 4FSFA 3K2NA 4NETA 2Q9NA 4OONA 4D60A 3SS3A 5EE8A 3PYPA 4GN2A 2ZL1A 2EFUA 2Q9MA 1E4DA 4UA9A 1Y54A 4C6YA 1HLUP 4PM7A 3HLBA 3CWFA 5MC7A 3T4JA 2W3FA 3IXBA 4X25A 1VM1A 3LYXA 3QP1A 2B95A 3R4KA 4QY6A 1GHMA 5HPIA 5FEFA 4EWFA 5EOOA 5FAOA 3MFXA 1AWIA 2JKTM
chains in the Genus database with same CATH topology
4EU0A 5FL3A 2FZ0A 3O5YA 1ODVA 3ULFA 4MCWA 2WKPA 1OTDA 4OOLA 3P7NA 5CX7A 2W3EA 5HDSA 3PBNA 1GSWA 3T4QA 2VGLS 3E4PA 3RTYA 3BJNA 2K31A 2VJWA 3KSHA 4YOFA 1IOUA 3PHYA 1H8MA 1S1ZA 3A0RA 3OBFA 4BBVA 2O9AA 4L9EA 4UQIM 5DFYA 4DN0A 4L9FA 3OLOA 3UB9A 2W3HA 5TBMA 3NOUC 4ETZA 3IBRA 4Y2FA 3BW6A 2QWSA 2D02A 1IFQA 3MF0A 2VV7A 1UWNX 3LR3A 2GX5A 4BBUA 4EEUA 5AVEA 3VE3A 5HZHA 4M4XA 3LIBA 3ZYTA 5I5LA 5HSQA 3EOIA 4PHTA 3LIEA 2YKHA 1X0OA 2JHEA 4GS9B 2OAQ1 4CLCB 4BWIA 2VX8A 1LL8A 2J3TC 2VZWA 4GJ4A 2YKFA 4IUHA 4GLQA 2Y79A 4I3JA 1T18A 4ETXA 2XSSA 1EW0A 4NKPA 4R6LA 2P04A 2W3DA 5F6AA 4BJPA 4DJ3A 3RH8B 3TRCA 1V9YA 1XJ6A 2ZOHA 3NHQA 2A2LA 5F69A 4WL9A 5LBRA 3UMDA 4GHIB 2W1RA 2QJ5A 4K08A 3PBRA 3FPVA 5HDCA 2Z6CA 3BQ8A 2ZMFA 3F1PB 4H6JB 3E0YA 3UB7A 4G3KA 1D7EA 1F5MA 2NUPC 4F3LB 3H9WA 4BMWA 1LSXA 4R38A 2JKRM 1T1BA 3A0SA 3K3DA 4LLOB 4GS9A 5AJGA 4R70A 4CLCA 3IBJA 5KIZA 1N9LA 2KX6A 1DP9A 3MR0A 2OOLA 3CUEA 1XJ3A 4B9OA 4LRXC 1OTIA 4Y3IA 3CAXA 2XROA 2Z6DA 3B47A 5HPFA 4QPRA 4HH2A 2L0WA 4EERA 1T19A 1F9IA 1GSXA 3LFVA 3MJQA 3SW1A 2O0YA 4EW7A 1TS8A 3LIFA 4WLAA 1DRMA 2A24B 2P7JA 3EGXC 5G4ZA 2O99A 4Q0HA 1ZHHB 2P08A 4R3AA 4JGRA 4B93A 5IT5A 1P9RA 1MKMA 4PKYG 3GDIA 4GHIA 2FH5A 4WN5A 4CQHA 4Q0JA 5HWWA 3F1PA 2Y8HA 1S1YA 4H6JA 3EQUA 3PBOA 3LIDA 5DKLA 3NOTC 4F3LA 3LR0A 2VGLM 4BBTA 4E04A 3E98A 3FPWA 4GW9A 2J80A 3CLOA 4ME4A 4PAUA 3BY8A 5DF9A 4HH3A 4Q0IA 2GZAA 2IA2A 3JVVA 4EQ1A 2O9BA 2HGVA 2OWHA 4PKYA 5HWVA 3LI9A 4WEJA 2EA9A 3C2WA 3A0VA 2QYBA 3BY9A 2WKRA 3R7WB 3S7NA 4EXOA 1UGUA 1XFNA 3HCYA 3MQ0A 3EEAA 1N9NA 1W63M 1TS0A 3H7WB 5K5BA 4EESA 2HF6A 4IUKA 1P97A 4JGOA 5C5KA 3E4QA 2OAP1 5F5YA 2INWA 5IU1A 4MN6A 1P9WA 2PHYA 4II7A 2L4RA 3C38A 2GNXA 3NJAA 5HWTA 3KYQA 4CLCD 4CLCE 4AFIA 3VE4A 3PBSA 1VHMA 1MZUA 4WEKA 3UB6A 3UMEA 5DFXA 3EQVA 1WA9A 3BWLA 2B02A 4WUJA 4I5SA 3LIAA 4KQDA 1JNUA 2L1MA 2KOIA 3MXQA 1W63Q 4WF0A 3MQQA 1LT0A 3T4SA 1NLYA 1OJ5A 3TJZC 2R78A 4I3AA 3KSGA 3VV4A 1GSVA 4P6ZS 4P6ZM 4NXBA 1D06A 4HNBA 5IS1A 3T4OA 1DP8A 3F1NB 1STZA 4NEED 1F98A 4JGQA 2QKPA 4XT2B 4I3IA 5J3WA 4EETB 4RQ9A 3OCLA 3PBQA 4L0LA 1DP6A 3VOLA 3PBTA 2VKSA 3B42A 3T4KA 3U2AA 1S4RA 2JKTI 2NUTC 2ZOIA 3W2ZA 4DJ2A 3V67A 2HV1A 2LB9A 1NRJA 4IHQA 4NXEA 3KSIA 3FC7A 4ZRRA 3EEHA 4JGPA 2VV8A 3DBAA 5EFWA 1LSWA 3GECA 2BASA 2J3WA 4HP9A 4HHDA 3OC2A 4O8GA 1P0ZA 4G3WA 2B18A 5F68A 2XA7S 1OTAA 5A8BA 2PD8A 2EWVA 3LR4A 5AVFA 3TW8A 2JN7A 3UE6A 3F1NA 1YAXA 3H82B 3LI8A 4FOFA 3UB8A 3T4LA 3KO6A 2K7SA 2V0WA 2DMWA 4HY8A 1TD5A 1XFQA 2PR5A 3BQAA 1OT6A 5G4YA 4ARZB 4EEPA 1S4SA 3C8CA 2VEAA 2PD7A 3CI6A 3T4TA 5DJUA 3C30A 4OOMA 4L9GA 3S7OA 1YSPA 4CLCC 3IS2B 4HQAA 4MN5A 5J7EA 4MDZA 5L8MA 2PDRA 2HJEA 2A24A 2PT7A 2PYRA 3PR6A 3CUEC 3EWKA 3MQOA 4O0PA 1XJ4A 4MMNA 1N9OA 5TJJA 3S7PA 2W3GA 4UQIS 4LPZA 4GCZA 1OJGA 1OPXA 1H3QA 2V9AA 1Y28A 2KDKA 2W1TB 3H82A 2I9VA 1S67L 4I39A 2QJ7A 3G6OA 4HJ6A 3TE8A 3FG8A 3ZQ5A 2ZMVA 1T1CA 3LICA 1G6OA 4IJGA 1OT9A 2V0UA 4O01A 2VA0A 2W0NA 3F1OB 4ARZA 3KX0X 1T1AA 4EUVA 2WKQA 2XRNA 1OTEA 3EGDC 3D3OA 4MN7A 3S7QA 3ICYA 1YKDA 1YSQA 3R7WA 2EWWA 3IS2A 2MJ6A 5J4EA 5DKKA 5KSHA 2JKRI 1ZTUA 4DMZA 4Y5FA 3H7WA 2O9CA 1LSVA 2OWJA 3OOVA 4LRZE 5HDDA 3P01A 4KQOA 3K3CA 3JVUA 4HI4A 2V1BA 2M7VA 2PR6A 1XJ2A 2QHKA 3LR5A 2PYPA 3MMHA 1VB6A 3CITA 3KYZA 2K2NA 2M1CA 4LRYC 4HIAA 4I38A 1TF1A 2VV6A 2W1TA 2M7UA 3NOPC 2CMNA 1KOUA 2G7UA 4NXGA 2LB5A 2J3TD 3RFBA 4YWZA 4FSFA 3HJIA 5HD3A 3K2NA 1TS7A 3B33A 4HP4A 1NWZA 3F1OA 1V9ZA 5DJTA 1OTBA 3PYPA 3OCNA 3T50A 2W27A 2H28A 4KUKA 1S66L 2KLIA 4UEYA 4NXFA 4HJ4A 1NLZA 2GJ3A 1BYWA 5HD5A 3KSFA 2V1AA 3E4OA 3LUQA 3CWFA 4WELA 1G28A 5MC7A 3T4JA 5HL6A 2W3FA 2VLGA 4Z1WA 4YNRA 2XA7M 3LYXA 2ZBBA 3D72A 5TBMB 3HJKA 4G3VA 3PXPA 3R4KA 1UWPX 2D01A 4HJ3A 5HPIA 2HJ9C 1MC0A 4KUOA 4XT2A 3UE3A 3MFXA 4HOIA 1TS6A 2JKTM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NUT C;  4AFI A;  3EGD C;  3BW6 A;  1IOU A;  4B93 A;  1H8M A;  1IFQ A;  2VX8 A;  3EGX C;  3KYQ A;  2NUP C;  2DMW A; 
#chains in the Genus database with same CATH topology
 5FL3 A;  2FZ0 A;  3O5Y A;  4X56 A;  2Q0O A;  4MCW A;  4OOL A;  3P7N A;  5CX7 A;  2W3E A;  5HDS A;  4WZ5 A;  5EM0 A;  2VGL S;  3IQA A;  2WGV A;  4E3M A;  3KSH A;  5EVI A;  4BBV A;  2IWD A;  4BL3 A;  3O88 A;  4X6T A;  3T1X A;  2V20 A;  2Y2H A;  2W3H A;  4Y13 A;  4S2M A;  3WS4 A;  4Y2F A;  1IFQ A;  5FQM A;  2PAV P;  2PU2 A;  4EEU A;  5AVE A;  5HZH A;  3DW0 A;  4KG5 A;  5HSQ A;  3M6B A;  3EOI A;  4RYE A;  1U60 A;  1NZU A;  3FKV A;  2JHE A;  4GS9 B;  3VP1 A;  2OAQ 1;  4CLC B;  1LL8 A;  5A90 A;  5A91 A;  1EWZ A;  2I72 A;  2VZW A;  4GJ4 A;  1NYM A;  2YKF A;  1K57 A;  2Y79 A;  1T18 A;  3GMW A;  1MBL A;  3SS5 A;  5E2F A;  2Y2L A;  3RH8 B;  2ZOH A;  5I94 A;  2ZJ9 A;  4R3J A;  1K0K A;  2ZQ7 A;  1NRF A;  4GHI B;  5E2H A;  2QJ5 A;  2ZMF A;  1D7E A;  5HAR A;  1C3B A;  5A93 A;  4Z9Q A;  3IHB A;  2PU4 A;  1T1B A;  4UA6 A;  5FAS A;  5GLC A;  1IKI A;  2P9V A;  5FQJ A;  1DP9 A;  3C4P A;  1XJ3 A;  2XRO A;  3B47 A;  2QMI A;  1PFL A;  4GZB A;  1F9I A;  2EX8 A;  3LFV A;  3SW1 A;  4BD1 A;  3N8L A;  4LV2 A;  3CG5 A;  5G4Z A;  1M6K A;  5GLD A;  1ZHH B;  4FH2 A;  3AGE A;  4S2P A;  2WK0 A;  3AGD A;  5IT5 A;  1P9R A;  1MKM A;  1IYP A;  4R4S A;  2XEP A;  1VET A;  4Q0J A;  5HWW A;  3EQU A;  3PBO A;  1CJF A;  3NOT C;  3CJM A;  3CLO A;  3BY8 A;  3N8R A;  2IA2 A;  1K4E A;  5F83 A;  3RXW A;  4PKY A;  5HWV A;  1FCM A;  1PW8 A;  4A5R A;  1G5U A;  3S7N A;  1UGU A;  5E2G A;  1ZG6 A;  4PPR A;  2AVX A;  1N9N A;  3I7J A;  1IYO A;  1P97 A;  3E4Q A;  2PBD P;  2PHY A;  1JTD A;  3M2K A;  1VHM A;  1MZU A;  2ACG A;  2WUQ A;  5DFX A;  3EQV A;  4Y0T A;  1WA9 A;  3PTE A;  5FI7 A;  1Y4O A;  1ONH A;  1PZO A;  1JNU A;  3LIA A;  2EX6 A;  2G2U A;  3WRZ A;  5L09 A;  5DF8 A;  4Y15 A;  2XK1 A;  2J9O A;  4LCL A;  3TJZ C;  4LCM A;  2R9X A;  3VV4 A;  4BEN A;  1H0M A;  5CRF A;  5A92 A;  3Q1F A;  4NXB A;  5M19 A;  3PAG A;  4ID4 A;  1S6R A;  4JGQ A;  1KE4 A;  3O3V A;  3V39 A;  3MKF A;  5J3W A;  4B4X A;  1DP6 A;  3VOZ A;  4R1G A;  3GTC A;  1J9M A;  4EQI A;  2VKS A;  3T4K A;  2HDU A;  5FDH A;  2JKT I;  4OQ0 A;  2Y4A A;  4HBT A;  5HFO A;  2LB9 A;  5CHU A;  1ONG A;  2V1Z A;  4JGP A;  1SZV A;  3DBA A;  3M6H A;  5EVI B;  3UDI A;  3V3S A;  2DCF A;  1A0K A;  1MWU A;  3LR4 A;  3TW8 A;  4MBK A;  1PI5 A;  3UE6 A;  1DY6 A;  1SKO B;  3A3E A;  4FOF A;  4Y0U A;  1TD5 A;  5HAI A;  4BQM A;  2ZC4 B;  1K4F A;  1OT6 A;  2WZZ A;  5G4Y A;  3WS1 A;  4P85 A;  3IHA A;  1LL9 A;  3A3D A;  3VFH A;  1ESI A;  2JBF A;  4LFU A;  3T1R A;  2VK3 A;  1YSP A;  2ZQ9 A;  4HQA A;  4MDZ A;  4P0M A;  2HJE A;  2A24 A;  4OP8 A;  4BL2 A;  1PWD A;  1N9O A;  3B3X A;  4FD8 A;  5F1F A;  4LPZ A;  1OJG A;  4ZJ2 A;  1H3Q A;  4DE1 A;  3S4X A;  1Q2P A;  3HRE A;  2V9A A;  2XGN A;  3NI9 A;  1S67 L;  2QJ7 A;  4JPM A;  4U0T A;  3GRJ A;  1G6O A;  3NEC A;  1XKZ A;  2W0N A;  4WBG A;  3HLC A;  4IVK A;  1K54 A;  3D3O A;  3ICY A;  1YSQ A;  4BD0 A;  4IBR A;  2MJ6 A;  3LY3 A;  3MXS A;  2O9C A;  3P09 A;  3OOV A;  4JKT A;  4LRZ E;  4LV3 A;  5HDD A;  3VP3 A;  3MBZ A;  2PR6 A;  4OKP A;  2M7V A;  3HLW A;  2QHK A;  3MMH A;  3CIT A;  2K2N A;  4LRY C;  4DXB A;  4HIA A;  2CMN A;  2G7U A;  3RFB A;  1YLT A;  3GQZ A;  3NUL A;  5HD3 A;  1PWC A;  1NWZ A;  5DJT A;  3T50 A;  3ZG5 A;  1S66 L;  2KLI A;  3D4F A;  1IEM A;  2GJ3 A;  2XF3 A;  2XD5 A;  3LUQ A;  1TDL A;  2IWB A;  5CGX A;  3JYI A;  1WE4 A;  4ESP A;  2QPN A;  3UO9 A;  3Q7V A;  2XA7 M;  2ZBB A;  1MWR A;  5TBM B;  2EXB A;  1UWP X;  4GD8 A;  5IHV A;  5GHX A;  5FSR A;  3G31 A;  1SHV A;  3LEZ A;  4CJN A;  1SDN A;  1L2S A;  1TS6 A;  1ODV A;  1HD8 A;  1ERO A;  2WKP A;  5FQK A;  4KG2 A;  1H8Z A;  1FQG A;  2C5W B;  3E4P A;  4UAA A;  1FOF A;  4Y17 A;  3VOY A;  4WMC A;  3PHY A;  5JYO A;  1E3U A;  2Y2J A;  3OBF A;  3BYD A;  1PZP A;  2HP5 A;  1IYQ A;  5CTM A;  3UB9 A;  1CK3 A;  1GCE A;  2QWS A;  2D02 A;  3MF0 A;  4K0W A;  1UWN X;  3VE3 A;  3S22 A;  1YLJ A;  4S2K A;  4ZAM A;  3UY6 A;  5J8X A;  1AXB A;  3LIE A;  4BWI A;  2XQZ A;  2VX8 A;  3WRT A;  3DWZ A;  4IUH A;  3VP2 A;  2Y59 A;  3BEB A;  4R4R A;  3NC8 A;  4I3J A;  4DDY A;  3IT9 A;  5E2E A;  2WAD A;  1BTL A;  2W3D A;  2WYX A;  1PW1 A;  3TRC A;  2X71 A;  3NHQ A;  2A2L A;  1O7E A;  4Q8I A;  5LBR A;  2VGK A;  1CI9 A;  2W1R A;  1DJA A;  5HDC A;  4GNU A;  3BM6 A;  3E0Y A;  4G3K A;  1GHP A;  1ZG4 A;  3H9W A;  1YLZ A;  4BMW A;  4R38 A;  2JKR M;  3TG9 A;  3K3D A;  3IBJ A;  3G4P A;  3BLM A;  2JC7 A;  2KX6 A;  4P6B A;  3MR0 A;  1RP5 A;  3CAX A;  2Z6D A;  3C7U A;  3FYZ A;  1ALQ A;  4HH2 A;  2L0W A;  4EER A;  3T1S A;  2HDQ A;  1ERM A;  2ZC3 B;  1YLP A;  3NDG A;  2O0Y A;  3LIF A;  1MWS A;  1DRM A;  2A24 B;  3OPL A;  5U47 A;  3HLD A;  1OME A;  1Z09 A;  2WGW A;  4X53 A;  3SZT A;  4JGR A;  4B93 A;  2ZQA A;  2FH5 A;  4CQH A;  3LO7 A;  3F1P A;  4H6J A;  4IBX A;  3O86 A;  5DTS A;  4F3L A;  4ME4 A;  4PAU A;  4RX3 A;  4HH3 A;  4Q0I A;  4E6W A;  2GZA A;  5GL9 A;  2HGV A;  2GDN A;  2OWH A;  3LI9 A;  4WEJ A;  2EFX A;  3A0V A;  4QY5 A;  3BY9 A;  2WKR A;  4EXO A;  1XA1 A;  4IVI A;  3EEA A;  3E2K A;  4N9L A;  5GHZ A;  2A3U A;  4EES A;  4DE2 A;  1LL5 A;  3ZG9 B;  5F5Y A;  3VMA A;  1L0F A;  1K56 D;  5IU1 A;  3MZF A;  4II7 A;  2L4R A;  3C38 A;  3VSL A;  2G2W A;  5HWT A;  1MKI A;  2J9P A;  4OP5 A;  4EBP A;  4ZBE A;  4CLC D;  3NY4 A;  4KZ7 A;  4LGW A;  3VE4 A;  3PBS A;  2EX2 A;  4X69 A;  4R3B A;  3HBR A;  3CPT B;  3G34 A;  1TDG A;  4I5S A;  4KQD A;  3MZE A;  4PM6 A;  2L1M A;  3MQQ A;  3WS2 A;  3IF6 A;  1LT0 A;  2J8Y A;  5HX9 A;  2QZ6 A;  1WYB A;  1ES4 A;  4RA7 A;  2R78 A;  1W8Q A;  3MSH A;  1ZC2 A;  3IH8 A;  1XP4 A;  4P6Z S;  4GD6 A;  1D06 A;  1W7F A;  5IS1 A;  1YMX A;  5EM1 A;  4EBL A;  4WMC D;  1ES5 A;  5AQ9 A;  4EET B;  1E3U D;  3IWI A;  2JKF A;  4EV4 A;  1XGJ A;  3U2A A;  1K54 C;  3IWQ A;  1S4R A;  3HUN A;  5CHM A;  5FEG A;  1BUE A;  3N7W A;  3SH7 A;  5FQI A;  3ITB A;  3ZCZ A;  3IX8 A;  2Z2M B;  2VV8 A;  3GVB A;  1LSW A;  1RCJ A;  1ACF A;  4HP9 A;  4X68 A;  3OC2 A;  4O8G A;  4S2I A;  1VQQ A;  5F68 A;  2XA7 S;  3IWO A;  1KVM A;  3DWK A;  3IXH A;  1VEU B;  3F1N A;  1YAX A;  2B5R A;  3UB8 A;  1XFQ A;  2PR5 A;  3TSG A;  3BQA A;  1SCW A;  4MEZ A;  2XFT A;  4ARZ B;  1I5Q A;  4S2O A;  3T4T A;  5DJU A;  1CF0 A;  3C30 A;  5TR7 A;  3ISG A;  4P87 A;  4L9G A;  4N9K A;  3VFF A;  4CLC C;  3IS2 B;  4MN5 A;  3FWL A;  2ZM0 A;  2PT7 A;  3CUE C;  3LGO A;  3SOI A;  3MQO A;  3UE0 A;  3S7P A;  3Q82 A;  3W4Q A;  4CPK A;  3C7V A;  2KDK A;  3H82 A;  2I9V A;  3V3R A;  3G6O A;  2WAF A;  2Y2P A;  3ZQ5 A;  2ZMV A;  5HAP A;  4QB8 A;  3UE1 A;  2V0U A;  3CMZ A;  3G35 A;  1XGI A;  4K0X A;  4X1L A;  2WKQ A;  2XRN A;  3P98 A;  2ZL1 B;  2UWX A;  3N6I A;  1YKD A;  3WS0 A;  3R7W A;  2WZX A;  4HES A;  4GKU A;  5DKK A;  5KSH A;  2JKR I;  2FFY A;  4Y5F A;  4DMZ A;  3IXD A;  3ZG8 B;  2HP9 A;  1Z6F A;  3MZD A;  2ZMA A;  1MWT A;  4S2N A;  3HLF A;  4C75 A;  5EUA A;  2X01 A;  4E3N A;  3Q07 A;  3BFC A;  3VP4 A;  2W1T A;  4NXG A;  3HL9 A;  5L07 A;  2J3T D;  3TOI A;  5TFQ A;  5GLB A;  3HLG A;  4U0X A;  3B33 A;  3F1O A;  4GB7 A;  2DRW A;  1OTB A;  4KUK A;  3V5M A;  4UEY A;  4NXF A;  3OPP A;  1JWZ A;  3E4O A;  4WEL A;  5HL6 A;  2VLG A;  4Z1W A;  1NXY A;  3LCE A;  3D72 A;  1W8Y A;  3HJK A;  1FR1 A;  2D01 A;  2Z2L B;  4HJ3 A;  1MC0 A;  1M40 A;  4OLD A;  1XX2 A;  1PRQ A;  1YLY A;  4KUO A;  4XT2 A;  3UE3 A;  4HOI A;  4EU0 A;  3ULF A;  3KYE A;  1OTD A;  1I2W A;  1GSW A;  5EV0 A;  1J3W A;  1BLP A;  2WKE A;  5FAT A;  4E3L A;  2VJW A;  1XPB A;  1CEG A;  1FCO A;  4GDN A;  1H8M A;  1S1Z A;  2OSU A;  1G6A A;  2O9A A;  3L7H A;  4UQI M;  5DFY A;  4ZJ1 A;  4JXW A;  1FIK A;  1G68 A;  3NOU C;  2X02 A;  4KG6 A;  1D1J A;  4BBU A;  3V50 A;  2Y2K A;  4M4X A;  3LIB A;  5I5L A;  4GOG A;  2BTF P;  3HLE A;  1TVF A;  5L2F A;  3BLS A;  2V8F A;  2OLU A;  2P9V B;  3UPO A;  2J3T C;  1K38 A;  4ETX A;  2XSS A;  1BLC A;  1PIO A;  2A49 A;  2P04 A;  5F6A A;  4DJ3 A;  1LI9 A;  4QWO A;  1BLS A;  5EOE A;  4XUX A;  5F69 A;  4WL9 A;  5CTN A;  1QME A;  2XDM A;  3UMD A;  1SDE A;  1VET B;  4HBU A;  2JKG A;  4OPZ A;  4K08 A;  3BQ8 A;  1F5M A;  1K56 A;  2DNS A;  2NUP C;  1LSX A;  4E6X A;  3GV9 A;  3A0S A;  4GS9 A;  5AJG A;  4CLC A;  5KIZ A;  1L0G A;  1NJ4 A;  2OOL A;  2EX9 A;  3CUE A;  4B9O A;  1OTI A;  4Y3I A;  3IF6 C;  3SH9 A;  3ZHH A;  1T19 A;  4D2O A;  3JPU A;  1GSX A;  1L0D A;  3WWX A;  3MJQ A;  3QNC A;  1WYC A;  4EW7 A;  2WKH A;  1YQS A;  3ZVW A;  2P7J A;  5CGW A;  4MBH A;  1KGF A;  2O99 A;  2P08 A;  3QP2 A;  4JF6 A;  1FCN A;  4PKY G;  3G32 A;  4GHI A;  4KZA A;  4WN5 A;  5FI2 A;  2Y8H A;  1S1Y A;  3LID A;  3HVF A;  5GHY A;  3BFG A;  3LR0 A;  4E3O A;  4OPQ A;  4BBT A;  3FPW A;  5JYP A;  1BUL A;  1TEM A;  3T1Q B;  5DF9 A;  4EQ1 A;  3QP4 A;  1RGZ A;  2EA9 A;  3C2W A;  1PI4 A;  5KMW A;  3R7W B;  3HCY A;  3MQ0 A;  4F94 A;  2XFS A;  3IX3 A;  5K5B A;  4IUK A;  3CZD A;  3UN7 A;  5C5K A;  4LEN A;  5CGS A;  2XLN A;  3U4L P;  1CEF A;  2H0T A;  4MN6 A;  1P9W A;  3N8S A;  3WS5 A;  2GNX A;  1LLB A;  1W5D A;  1YLW A;  5FI6 A;  3KYQ A;  4Y0O A;  5BOH A;  2XH9 A;  2C6W B;  2P74 A;  4WEK A;  3ZDJ A;  3UME A;  3DTK A;  3UDF A;  1I2S A;  3BWL A;  2B02 A;  4MNR A;  4MBF A;  4WF0 A;  2HZ5 A;  3T4S A;  1K55 A;  3N4I A;  1NLY A;  1E25 A;  2HDS A;  1OJ5 A;  3UDX A;  3PAE A;  3S1Y A;  5M18 A;  5FDS A;  4WYY A;  1L3L A;  5GLA A;  4N92 A;  1DP8 A;  3OZH A;  1STZ A;  3RJU A;  1NY0 A;  3IH9 A;  2RL3 A;  5CEC A;  2BG1 A;  5EPH A;  4JXG A;  4XT2 B;  1FIL A;  5CXW A;  4RQ9 A;  3OCL A;  4L0L A;  1FSW A;  2CC1 A;  2BLS A;  2UV0 E;  3PBT A;  3B42 A;  4PM5 A;  4JLF A;  4DJ2 A;  1FR6 A;  3UNW A;  3V67 A;  2HV1 A;  4NXE A;  4EBN A;  4ZRR A;  3EEH A;  5HL1 A;  3W4O A;  2BAS A;  4HHD A;  1P0Z A;  2B18 A;  2J7V A;  1ES3 A;  4S2N C;  2PD8 A;  2EWV A;  1RGY A;  2OV5 A;  4KZ6 A;  3LI8 A;  3T4L A;  3KO6 A;  2K7S A;  2H10 A;  2DMW A;  4HY8 A;  2XD1 A;  3QNB A;  1BZA A;  4EEP A;  3VP0 A;  3C8C A;  2VEA A;  3CI6 A;  4KZ3 A;  1IKG A;  3ZGA B;  1BT5 A;  3ZG0 A;  3UB5 P;  3ZFZ A;  4JXS A;  5HW3 A;  5J7E A;  2PDR A;  3SS4 A;  2PYR A;  2JE5 A;  4OOY A;  4FCF A;  4O0P A;  4MMN A;  4B4Z A;  2W3G A;  4R23 A;  4UQI S;  3MXR A;  3ZVT A;  2R9W A;  2PBY A;  1SKO A;  4N1X A;  1ES2 A;  4QD4 A;  3TE8 A;  3DTE A;  3FG8 A;  4RVA A;  4S2L A;  1T1C A;  3LIC A;  5DF7 A;  4IJG A;  4R0Q A;  3DTM A;  3NIA A;  4JF4 A;  4O01 A;  4B88 A;  2VA0 A;  4KQR A;  3HUO A;  3M2J A;  1T1A A;  2JCH A;  1JWV A;  4EUV A;  5KSC A;  3RXX A;  1JTG A;  1OTE A;  1KDS A;  3EGD C;  4MN7 A;  5DTT A;  4QHC A;  2EWW A;  2XR0 A;  5FQ9 A;  5CHJ A;  5L10 A;  5J4E A;  3ZG7 B;  3ZNY A;  4ZDX A;  4E3I A;  3MFD A;  4LV1 A;  3H7W A;  3Q7V B;  1YPR A;  1BSG A;  4KQO A;  3K3C A;  3JVU A;  4HI4 A;  1KGE A;  1XJ2 A;  1VB6 A;  2M1C A;  3A3I A;  4I38 A;  2VV6 A;  3NOP C;  1NZO A;  3HJI A;  3L9K A;  3FZC A;  1TS7 A;  4HP4 A;  4JBF A;  1V9Z A;  3DTI A;  3OCN A;  5KZH A;  2W27 A;  2H28 A;  1BLH A;  4HJ4 A;  1NLZ A;  4IED A;  1BYW A;  5HD5 A;  3KSF A;  2V1A A;  3O87 A;  1N9B A;  1G28 A;  1KE3 A;  4OQI A;  2H0Y A;  2V8C A;  1FSY A;  5D3O A;  4YNR A;  1H5X A;  1N4O A;  4KZB A;  5M1A A;  4PM8 A;  4G3V A;  3PXP A;  4C3Q A;  2Y2O A;  2ZD8 A;  5AQB A;  2HJ9 C;  3QP5 A;  1W79 A;  5CEB A;  2PRF A;  3PBN A;  5DVA A;  4DKI A;  3T4Q A;  3BFD A;  5CER A;  4OPY A;  3RTY A;  3BJN A;  2K31 A;  4YOF A;  1IOU A;  1JVJ A;  3A0R A;  4L9E A;  3ZNT A;  3BRM A;  4DN0 A;  5DTK A;  4L9F A;  4EUZ A;  3OLO A;  5TBM A;  3OPH A;  4ETZ A;  3IBR A;  3BW6 A;  3T12 B;  4GDB A;  4JXV A;  2VV7 A;  2ZC5 B;  3LR3 A;  2GX5 A;  3D9Y A;  4K91 A;  3ZYT A;  2H5S A;  4PHT A;  2YKH A;  5CED A;  2HP6 A;  1X0O A;  1YM1 A;  2ZM8 A;  3DAV A;  4WZ4 A;  4X1M A;  4NK3 A;  4GLQ A;  1KGG A;  2OLV A;  1EW0 A;  4NKP A;  5EVE A;  4OVD A;  4R6L A;  3BFE A;  4BJP A;  3UPN A;  1V9Y A;  1XJ6 A;  1MXO A;  4DE0 A;  3CHW P;  2WGW B;  4E3K A;  4KZ8 A;  2ZC7 A;  3G2Z A;  5FQQ A;  1HVB A;  3PBR A;  3FPV A;  2Z6C A;  3F1P B;  4H6J B;  4HEF A;  1MY8 A;  3UB7 A;  1ESU A;  4F3L B;  4XUZ A;  4LLO B;  4R70 A;  4OH0 A;  1N9L A;  5EVI D;  3W8K A;  3HUM A;  2Y2M A;  1HZO A;  1LI0 A;  4LRX C;  4KQQ A;  1K55 C;  1L0E A;  2Y2Q A;  5HPF A;  4QPR A;  5FAQ A;  3VSK A;  3QP6 A;  3C5A A;  1TS8 A;  4WLA A;  3FV7 A;  1DJB A;  5F1G A;  3EGX C;  3MS6 A;  4Q0H A;  4R3A A;  1CI8 A;  3IF5 A;  3GDI A;  4MLL A;  1DJC A;  1O07 A;  4OQH A;  4FUW A;  2E8J A;  5DKL A;  1JWP A;  2ZLY A;  1EI5 A;  2VGL M;  4E04 A;  3E98 A;  4GW9 A;  2J80 A;  1QMF A;  5AQ7 A;  4OLG A;  3JVV A;  2O9B A;  3G2Y A;  3IF6 B;  4M3K A;  1IYS A;  2QYB A;  3GSG A;  1XFN A;  3GR2 A;  2VGJ A;  1W63 M;  4UA7 A;  1PYY A;  1TS0 A;  3H7W B;  2HF6 A;  1MPL A;  4JGO A;  2OAP 1;  2INW A;  4XXR A;  3SH8 A;  3NJA A;  2EXA A;  4O7D A;  2WKI A;  4CLC E;  2ZQ8 A;  5EVL A;  1HTZ A;  3ITA A;  5E43 A;  4AFI A;  4PMA A;  1GA0 A;  3Q81 A;  3FKW A;  4QU3 A;  3UB6 A;  1KDW A;  5G18 A;  2HDR A;  4NG2 A;  4WUJ A;  4WZ5 C;  2Y2N A;  5F82 A;  3E2L A;  2KOI A;  3MXQ A;  1W63 Q;  1SKF A;  1K6S A;  3LEQ A;  5FA7 A;  5EVI C;  3BEC A;  4I3A A;  3KSG A;  2WGI A;  1GSV A;  4P6Z M;  4ZJ3 A;  2ZQC A;  4HNB A;  3T4O A;  3F1N B;  4NEE D;  1F98 A;  5HAQ A;  2QKP A;  1YT4 A;  4I3I A;  3UPP A;  3PBQ A;  4KZ9 A;  1PWG A;  3MKE A;  3VOL A;  1XXM A;  1KVL A;  4FTX A;  3CPT A;  2NUT C;  3A3J A;  2ZOI A;  3W2Z A;  4S2J A;  1NRJ A;  4IHQ A;  3LY4 A;  3KSI A;  3FC7 A;  4JF5 A;  4KZ4 A;  4N1H A;  4OQG A;  1K57 C;  5EFW A;  3GEC A;  2J3W A;  5AQA A;  4WM9 A;  4G3W A;  4DE3 A;  5FAP A;  1OTA A;  5A8B A;  1XA7 A;  4DDS A;  5AVF A;  2JN7 A;  2Y2G A;  3NBL A;  3A3F A;  3H82 B;  3W4P A;  2V0W A;  5EEC A;  2FFF B;  2E8I A;  3BFF A;  4DF6 A;  1S4S A;  3IXG A;  2PD7 A;  1YMS A;  1IEL A;  4OOM A;  3S7O A;  1KE0 A;  4OPR A;  5L8M A;  3NCK A;  2ZQD A;  1LHY A;  2RCX A;  3PR6 A;  3EWK A;  2HPB A;  1XJ4 A;  5TJJ A;  3G30 A;  4Y7P A;  2ZM2 A;  4GCZ A;  1OPX A;  2Y91 A;  3OPR A;  1Q2Q A;  1H8Y A;  2Y2I A;  1Y28 A;  4ZTK A;  3C4O A;  1CQA A;  1VEU A;  4LV0 A;  2W1T B;  4I39 A;  4DXC A;  5TGF A;  1GHI A;  4HJ6 A;  1F2K A;  4YFM A;  4H8R A;  4E3J A;  1OT9 A;  4DRT A;  2Y55 A;  2V2F F;  3F1O B;  3QHY A;  4ARZ A;  1PNE A;  3KX0 X;  2IWC A;  1ERQ A;  4PM9 A;  1ZKJ A;  4U3T A;  4QJG A;  3S7Q A;  4FH4 A;  4YIN A;  3QP8 A;  3AGF A;  3IS2 A;  2ZC6 B;  4KEN B;  1ZTU A;  1K25 A;  4KZ5 A;  1S0W A;  4X55 A;  1LSV A;  2OWJ A;  4RX2 A;  3P01 A;  2V1B A;  1NYY A;  3LR5 A;  2PYP A;  4UHU A;  3KYZ A;  3IX4 A;  1TF1 A;  2M7U A;  3Q7Z A;  1KOU A;  2LB5 A;  4BLM A;  2WAE A;  1K6R A;  3NDE A;  4YWZ A;  1GA9 A;  4FSF A;  3K2N A;  4NET A;  2Q9N A;  4OON A;  4D60 A;  3SS3 A;  5EE8 A;  3PYP A;  4GN2 A;  2ZL1 A;  2EFU A;  2Q9M A;  1E4D A;  4UA9 A;  1Y54 A;  4C6Y A;  1HLU P;  4PM7 A;  3HLB A;  3CWF A;  5MC7 A;  3T4J A;  2W3F A;  3IXB A;  4X25 A;  1VM1 A;  3LYX A;  3QP1 A;  2B95 A;  3R4K A;  4QY6 A;  1GHM A;  5HPI A;  5FEF A;  4EWF A;  5EOO A;  5FAO A;  3MFX A;  1AWI A;  2JKT M; 
#chains in the Genus database with same CATH homology
 4EU0 A;  5FL3 A;  2FZ0 A;  3O5Y A;  1ODV A;  3ULF A;  4MCW A;  2WKP A;  1OTD A;  4OOL A;  3P7N A;  5CX7 A;  2W3E A;  5HDS A;  3PBN A;  1GSW A;  3T4Q A;  2VGL S;  3E4P A;  3RTY A;  3BJN A;  2K31 A;  2VJW A;  3KSH A;  4YOF A;  1IOU A;  3PHY A;  1H8M A;  1S1Z A;  3A0R A;  3OBF A;  4BBV A;  2O9A A;  4L9E A;  4UQI M;  5DFY A;  4DN0 A;  4L9F A;  3OLO A;  3UB9 A;  2W3H A;  5TBM A;  3NOU C;  4ETZ A;  3IBR A;  4Y2F A;  3BW6 A;  2QWS A;  2D02 A;  1IFQ A;  3MF0 A;  2VV7 A;  1UWN X;  3LR3 A;  2GX5 A;  4BBU A;  4EEU A;  5AVE A;  3VE3 A;  5HZH A;  4M4X A;  3LIB A;  3ZYT A;  5I5L A;  5HSQ A;  3EOI A;  4PHT A;  3LIE A;  2YKH A;  1X0O A;  2JHE A;  4GS9 B;  2OAQ 1;  4CLC B;  4BWI A;  2VX8 A;  1LL8 A;  2J3T C;  2VZW A;  4GJ4 A;  2YKF A;  4IUH A;  4GLQ A;  2Y79 A;  4I3J A;  1T18 A;  4ETX A;  2XSS A;  1EW0 A;  4NKP A;  4R6L A;  2P04 A;  2W3D A;  5F6A A;  4BJP A;  4DJ3 A;  3RH8 B;  3TRC A;  1V9Y A;  1XJ6 A;  2ZOH A;  3NHQ A;  2A2L A;  5F69 A;  4WL9 A;  5LBR A;  3UMD A;  4GHI B;  2W1R A;  2QJ5 A;  4K08 A;  3PBR A;  3FPV A;  5HDC A;  2Z6C A;  3BQ8 A;  2ZMF A;  3F1P B;  4H6J B;  3E0Y A;  3UB7 A;  4G3K A;  1D7E A;  1F5M A;  2NUP C;  4F3L B;  3H9W A;  4BMW A;  1LSX A;  4R38 A;  2JKR M;  1T1B A;  3A0S A;  3K3D A;  4LLO B;  4GS9 A;  5AJG A;  4R70 A;  4CLC A;  3IBJ A;  5KIZ A;  1N9L A;  2KX6 A;  1DP9 A;  3MR0 A;  2OOL A;  3CUE A;  1XJ3 A;  4B9O A;  4LRX C;  1OTI A;  4Y3I A;  3CAX A;  2XRO A;  2Z6D A;  3B47 A;  5HPF A;  4QPR A;  4HH2 A;  2L0W A;  4EER A;  1T19 A;  1F9I A;  1GSX A;  3LFV A;  3MJQ A;  3SW1 A;  2O0Y A;  4EW7 A;  1TS8 A;  3LIF A;  4WLA A;  1DRM A;  2A24 B;  2P7J A;  3EGX C;  5G4Z A;  2O99 A;  4Q0H A;  1ZHH B;  2P08 A;  4R3A A;  4JGR A;  4B93 A;  5IT5 A;  1P9R A;  1MKM A;  4PKY G;  3GDI A;  4GHI A;  2FH5 A;  4WN5 A;  4CQH A;  4Q0J A;  5HWW A;  3F1P A;  2Y8H A;  1S1Y A;  4H6J A;  3EQU A;  3PBO A;  3LID A;  5DKL A;  3NOT C;  4F3L A;  3LR0 A;  2VGL M;  4BBT A;  4E04 A;  3E98 A;  3FPW A;  4GW9 A;  2J80 A;  3CLO A;  4ME4 A;  4PAU A;  3BY8 A;  5DF9 A;  4HH3 A;  4Q0I A;  2GZA A;  2IA2 A;  3JVV A;  4EQ1 A;  2O9B A;  2HGV A;  2OWH A;  4PKY A;  5HWV A;  3LI9 A;  4WEJ A;  2EA9 A;  3C2W A;  3A0V A;  2QYB A;  3BY9 A;  2WKR A;  3R7W B;  3S7N A;  4EXO A;  1UGU A;  1XFN A;  3HCY A;  3MQ0 A;  3EEA A;  1N9N A;  1W63 M;  1TS0 A;  3H7W B;  5K5B A;  4EES A;  2HF6 A;  4IUK A;  1P97 A;  4JGO A;  5C5K A;  3E4Q A;  2OAP 1;  5F5Y A;  2INW A;  5IU1 A;  4MN6 A;  1P9W A;  2PHY A;  4II7 A;  2L4R A;  3C38 A;  2GNX A;  3NJA A;  5HWT A;  3KYQ A;  4CLC D;  4CLC E;  4AFI A;  3VE4 A;  3PBS A;  1VHM A;  1MZU A;  4WEK A;  3UB6 A;  3UME A;  5DFX A;  3EQV A;  1WA9 A;  3BWL A;  2B02 A;  4WUJ A;  4I5S A;  3LIA A;  4KQD A;  1JNU A;  2L1M A;  2KOI A;  3MXQ A;  1W63 Q;  4WF0 A;  3MQQ A;  1LT0 A;  3T4S A;  1NLY A;  1OJ5 A;  3TJZ C;  2R78 A;  4I3A A;  3KSG A;  3VV4 A;  1GSV A;  4P6Z S;  4P6Z M;  4NXB A;  1D06 A;  4HNB A;  5IS1 A;  3T4O A;  1DP8 A;  3F1N B;  1STZ A;  4NEE D;  1F98 A;  4JGQ A;  2QKP A;  4XT2 B;  4I3I A;  5J3W A;  4EET B;  4RQ9 A;  3OCL A;  3PBQ A;  4L0L A;  1DP6 A;  3VOL A;  3PBT A;  2VKS A;  3B42 A;  3T4K A;  3U2A A;  1S4R A;  2JKT I;  2NUT C;  2ZOI A;  3W2Z A;  4DJ2 A;  3V67 A;  2HV1 A;  2LB9 A;  1NRJ A;  4IHQ A;  4NXE A;  3KSI A;  3FC7 A;  4ZRR A;  3EEH A;  4JGP A;  2VV8 A;  3DBA A;  5EFW A;  1LSW A;  3GEC A;  2BAS A;  2J3W A;  4HP9 A;  4HHD A;  3OC2 A;  4O8G A;  1P0Z A;  4G3W A;  2B18 A;  5F68 A;  2XA7 S;  1OTA A;  5A8B A;  2PD8 A;  2EWV A;  3LR4 A;  5AVF A;  3TW8 A;  2JN7 A;  3UE6 A;  3F1N A;  1YAX A;  3H82 B;  3LI8 A;  4FOF A;  3UB8 A;  3T4L A;  3KO6 A;  2K7S A;  2V0W A;  2DMW A;  4HY8 A;  1TD5 A;  1XFQ A;  2PR5 A;  3BQA A;  1OT6 A;  5G4Y A;  4ARZ B;  4EEP A;  1S4S A;  3C8C A;  2VEA A;  2PD7 A;  3CI6 A;  3T4T A;  5DJU A;  3C30 A;  4OOM A;  4L9G A;  3S7O A;  1YSP A;  4CLC C;  3IS2 B;  4HQA A;  4MN5 A;  5J7E A;  4MDZ A;  5L8M A;  2PDR A;  2HJE A;  2A24 A;  2PT7 A;  2PYR A;  3PR6 A;  3CUE C;  3EWK A;  3MQO A;  4O0P A;  1XJ4 A;  4MMN A;  1N9O A;  5TJJ A;  3S7P A;  2W3G A;  4UQI S;  4LPZ A;  4GCZ A;  1OJG A;  1OPX A;  1H3Q A;  2V9A A;  1Y28 A;  2KDK A;  2W1T B;  3H82 A;  2I9V A;  1S67 L;  4I39 A;  2QJ7 A;  3G6O A;  4HJ6 A;  3TE8 A;  3FG8 A;  3ZQ5 A;  2ZMV A;  1T1C A;  3LIC A;  1G6O A;  4IJG A;  1OT9 A;  2V0U A;  4O01 A;  2VA0 A;  2W0N A;  3F1O B;  4ARZ A;  3KX0 X;  1T1A A;  4EUV A;  2WKQ A;  2XRN A;  1OTE A;  3EGD C;  3D3O A;  4MN7 A;  3S7Q A;  3ICY A;  1YKD A;  1YSQ A;  3R7W A;  2EWW A;  3IS2 A;  2MJ6 A;  5J4E A;  5DKK A;  5KSH A;  2JKR I;  1ZTU A;  4DMZ A;  4Y5F A;  3H7W A;  2O9C A;  1LSV A;  2OWJ A;  3OOV A;  4LRZ E;  5HDD A;  3P01 A;  4KQO A;  3K3C A;  3JVU A;  4HI4 A;  2V1B A;  2M7V A;  2PR6 A;  1XJ2 A;  2QHK A;  3LR5 A;  2PYP A;  3MMH A;  1VB6 A;  3CIT A;  3KYZ A;  2K2N A;  2M1C A;  4LRY C;  4HIA A;  4I38 A;  1TF1 A;  2VV6 A;  2W1T A;  2M7U A;  3NOP C;  2CMN A;  1KOU A;  2G7U A;  4NXG A;  2LB5 A;  2J3T D;  3RFB A;  4YWZ A;  4FSF A;  3HJI A;  5HD3 A;  3K2N A;  1TS7 A;  3B33 A;  4HP4 A;  1NWZ A;  3F1O A;  1V9Z A;  5DJT A;  1OTB A;  3PYP A;  3OCN A;  3T50 A;  2W27 A;  2H28 A;  4KUK A;  1S66 L;  2KLI A;  4UEY A;  4NXF A;  4HJ4 A;  1NLZ A;  2GJ3 A;  1BYW A;  5HD5 A;  3KSF A;  2V1A A;  3E4O A;  3LUQ A;  3CWF A;  4WEL A;  1G28 A;  5MC7 A;  3T4J A;  5HL6 A;  2W3F A;  2VLG A;  4Z1W A;  4YNR A;  2XA7 M;  3LYX A;  2ZBB A;  3D72 A;  5TBM B;  3HJK A;  4G3V A;  3PXP A;  3R4K A;  1UWP X;  2D01 A;  4HJ3 A;  5HPI A;  2HJ9 C;  1MC0 A;  4KUO A;  4XT2 A;  3UE3 A;  3MFX A;  4HOI A;  1TS6 A;  2JKT M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...