3E2KA

Crystal structure of the kpc-2 beta-lactamase/beta-lactamase inhibitor protein (blip)
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
261
structure length
261
Chain Sequence
AEPFAKLEQDFGGSIGVYAMDTGSGATVSYRAEERFPLCSSFKGFLAAAVLARSQQQAGLLDTPIRYGKNALVPWSPISEKYLTTGMTVAELSAAAVQYSDNAAANLLLKELGGPAGLTAFMRSIGDTTFRLDRWELELNSAIPSDARDTSSPRAVTESLQKLTLGSALAAPQRQQFVDWLKGNTTGNHRIRAAVPADWAVGDKTGTCGVYGTANDYAVVWPTGRAPIVLAVYTRAPNKDDKHSEAVIAAAARLALEGLGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbapenemase
publication title Structural and biochemical characterization of the interaction between KPC-2 beta-lactamase and beta-lactamase inhibitor protein
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Hydrolase/hydrolase inhibitor
total genus 92
structure length 261
sequence length 261
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2008-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3e2kA00
1K6RA 3MFDA 3C5AA 1CEGA 2J9OA 4KZ9A 1I5QA 1RGZA 4RX2A 4FCFA 1PZPA 2EX6A 3C7UA 5EECA 4S2PA 4ZTKA 5EUAA 1BULA 1K57A 1E4DA 5TGFA 4X69A 2WKIA 1HZOA 5FA7A 4OQHA 3SH7A 2WKHA 5EOOA 3BLSA 1K55C 4KZ5A 5CERA 3FV7A 4KENB 1XA1A 1DY6A 3G2ZA 3IF6C 3VP0A 5A93A 3OPRA 4OQIA 5DTTA 1XX2A 1G6AA 3VMAA 5AQ7A 3NDGA 3OCNA 2UWXA 3V3SA 3LY4A 1FR6A 3M2JA 3FYZA 4PPRA 3ISGA 4S2LA 3LCEA 4LV2A 2OLUA 4IEDA 3M6BA 4XXRA 1LL5A 2EX2A 3IXGA 4UHUA 2HP5A 4DDYA 1MWUA 2GDNA 2JE5A 4WYYA 2WUQA 1RP5A 4O7DA 3NI9A 3VP4A 3IHBA 3IHAA 4X56A 1YMXA 3IXHA 2RL3A 4KZ6A 1I2WA 4UA7A 3PBSA 2XR0A 3JYIA 4KQQA 3S22A 4C3QA 4F94A 1GA0A 3GMWA 3BFDA 1XA7A 4HBTA 4BL2A 1O7EA 5M18A 5FSRA 4FH2A 4KZ7A 3G32A 1ERMA 1TDGA 5DF7A 1PI4A 1BSGA 5KZHA 2WAFA 3WS1A 1MWRA 1FCNA 2WKEA 3HUMA 1IYSA 4NK3A 2WGIA 2XLNA 3AGDA 4P85A 3BECA 1FCMA 3IH9A 4JKTA 3UPOA 1ZG6A 1PW8A 1BUEA 3DWZA 3E2LA 5EPHA 4BD0A 4DKIA 5J8XA 2OSUA 1SHVA 4GOGA 2JBFA 2XD1A 4DE3A 1IEMA 3Q82A 1H8YA 4KZ3A 3SH9A 1J9MA 2VGJA 4Y0OA 1DJAA 4OLDA 1IYPA 3VP1A 1HD8A 4E3LA 4PM5A 3A3IA 4CJNA 2G2UA 5HL1A 2ZQDA 3C4PA 5FQMA 2J7VA 2WK0A 2HDQA 3HUOA 1LLBA 5EVID 1OMEA 1SCWA 4QJGA 1NYMA 4K0XA 1IELA 4S2JA 3G30A 3MXSA 3OZHA 3ZNYA 5HFOA 4FD8A 1W8QA 3C7VA 1E3UA 1MY8A 1L2SA 3GQZA 4ZAMA 2Y2KA 4ID4A 5E2HA 3SS3A 1Y54A 5CTMA 4JBFA 1SDNA 1K38A 1XGJA 4KG6A 5GHYA 1PZOA 5GLAA 3ZDJA 4EBLA 1EI5A 1K4FA 1FCOA 2BG1A 3GSGA 3W8KA 2WADA 3UDIA 2Z2LB 4OVDA 3G31A 5FAQA 4OPQA 3MKFA 2I72A 2ZQCA 4QHCA 2Q9NA 2Y2HA 4R3BA 1MXOA 1XPBA 4JLFA 1QMEA 5GHXA 1CK3A 4EBPA 5KMWA 3HVFA 5A90A 5E2FA 2ZQ8A 5KSHA 1BLCA 4RA7A 5TFQA 2EFUA 2IWCA 3HLBA 2B5RA 5IHVA 4FSFA 4EWFA 3MKEA 1KGEA 3PBOA 2H0TA 4OP8A 4S2MA 1DJBA 3N8SA 2ZLYA 5M19A 2V1ZA 4KZAA 4BLMA 4KZBA 4PMAA 2J9PA 3FKWA 3S4XA 1L0DA 4LENA 1YLWA 1NXYA 3N4IA 4YFMA 2WAEA 3HLFA 4P87A 3SH8A 2HPBA 5CGXA 3WRZA 3UPPA 5HAPA 1FOFA 1YT4A 4QY5A 3SS4A 5GL9A 3ZVTA 1BLSA 4OONA 4PM6A 1H5XA 5EVIC 3NDEA 5JYPA 1XKZA 2HP6A 3NCKA 2Y2OA 3HBRA 3PBTA 1ONHA 4K0WA 4IVKA 3A3FA 1L0GA 3Q1FA 4GB7A 1MWSA 4DE1A 1TEMA 4GN2A 3CJMA 4U0XA 4R3JA 3BFGA 2Y2JA 5DTSA 5FI2A 2XD5A 5AQAA 4NETA 3A3EA 5CGSA 2XK1A 2R9WA 3UO9A 1CI8A 3ITAA 4ZJ2A 2ZM0A 4R4SA 1IYQA 1BLPA 4BL3A 5GLCA 3BFFA 4WELA 1ERQA 1PW1A 3P98A 3VSLA 2WGWA 3ZG9B 3WS0A 1YLTA 4OOYA 4QD4A 5GHZA 4OKPA 4QY6A 4Q8IA 1RCJA 2J8YA 3SS5A 4DXBA 4HESA 2ZC7A 5FI6A 4WMCA 3N6IA 2ZC6B 3NIAA 1HTZA 1TVFA 3UPNA 3FZCA 1SDEA 4GD8A 1K56D 2X02A 4WBGA 1MBLA 1ONGA 1K25A 1LHYA 4CPKA 4KZ4A 2BLSA 5FDHA 5EVLA 4EQIA 4KG2A 5EE8A 4E6WA 3G4PA 2ZM2A 3VOZA 3V5MA 1KE4A 4MBHA 1VM1A 1CI9A 2EFXA 3M6HA 1BLHA 4WZ4A 4JXWA 4ZJ1A 2XFSA 2WGWB 3G2YA 4UA6A 3ZG8B 2ZJ9A 1ES2A 3ZNTA 4E3IA 2C5WB 4WZ5A 4JF5A 5DF9A 3HLEA 3OCLA 5HAIA 3WRTA 4S2OA 1N4OA 4U0TA 5FI7A 1M6KA 4QB8A 3Q07A 2OV5A 4D2OA 3PBRA 4OPRA 2PU2A 3I7JA 5CHMA 5A91A 1L0EA 4E3MA 4Y0TA 1YM1A 1JVJA 2ZMAA 5CHJA 2XEPA 2ZC3B 1LI9A 4B4XA 2XH9A 3GVBA 4BQMA 2XGNA 2P74A 1YLZA 1Q2QA 4H8RA 5A92A 1IKIA 1GA9A 2Y2LA 5CECA 2RCXA 3IXDA 3NC8A 4KZ8A 4N1XA 4OQGA 3W4QA 3ZCZA 2Z2MB 1XXMA 3UE3A 1YMSA 1GCEA 2IWBA 4A5RA 3OPLA 1K6SA 1IKGA 1N9BA 4KG5A 1LI0A 1YLJA 2HDSA 3BEBA 4GZBA 4S2IA 5DVAA 4UA9A 1NYYA 5HW3A 4KQOA 3MZEA 4FH4A 3ZVWA 3DWKA 3MBZA 3N7WA 3D4FA 2DRWA 3ITBA 1JTDA 4GNUA 5FQIA 5CEDA 3OC2A 4N1HA 4Z9QA 2HP9A 3C4OA 4OPYA 3VFHA 5M1AA 3NBLA 4XUZA 2P9VA 5JYOA 2WZXA 3O3VA 1ESUA 5F1GA 3VP3A 1GHMA 3O86A 4X68A 3W4PA 2Y91A 5EVIA 5D3OA 3UN7A 1NRFA 1GHPA 1K4EA 1EWZA 5AQBA 2FFYA 3WS5A 1K55A 3QHYA 1JTGA 3W4OA 3VFFA 3S1YA 4DXCA 5F1FA 4Y0UA 3IF6A 5FQQA 1PWGA 2ZQ9A 3A3JA 4JXGA 1RGYA 2ZM8A 4JXVA 3MXRA 4PM7A 4YINA 1W8YA 3CZDA 3UE0A 2A3UA 3VP2A 1TDLA 1BZAA 2P9VB 3UE1A 1KGGA 4BD1A 4E3NA 3PAGA 3UY6A 1I2SA 5EVIB 3TOIA 4R0QA 1PYYA 1FSWA 2XFTA 5DF8A 1XP4A 3BM6A 3ZG5A 1G68A 3IWOA 3IT9A 5FQKA 2WZZA 4K91A 3GV9A 3MZDA 1YLYA 4RYEA 2DCFA 5E43A 3CMZA 2A49A 3IF6B 2EXBA 3IWQA 4S2NC 3SOIA 3IQAA 1JWVA 3PAEA 3O87A 1KDSA 3WWXA 4DRTA 3DTMA 4MNRA 5GLBA 1KVMA 4KQRA 1GHIA 3G34A 2X71A 4C6YA 3Q7VA 4N92A 1FQGA 1PIOA 4DE2A 1U60A 3ZGAB 2EX9A 5FQJA 1KE0A 2R9XA 2C6WB 3V3RA 2E8IA 4R4RA 1ES4A 1E25A 3NY4A 1BT5A 1QMFA 3LEZA 1HVBA 3BFEA 3LY3A 3E2KA 3FKVA 3PBNA 4E3OA 4IBXA 4BJPA 4IVIA 4JF6A 4WMCD 5CTNA 1NZUA 3HLCA 3TG9A 2QZ6A 1JWZA 4DDSA 1K54C 3GTCA 3IXBA 3FWLA 4P0MA 4QU3A 2XQZA 3V39A 4E6XA 4EBNA 5CEBA 1WYCA 4JF4A 3ZHHA 3B3XA 4BENA 1ALQA 3Q81A 4MBKA 3Q7VB 4OP5A 5I94A 1YQSA 1ES5A 2XDMA 3BFCA 3G35A 5FQ9A 2Y2QA 3A3DA 3RJUA 3HL9A 1MPLA 3ZFZA 3M2KA 1VQQA 2Y55A 3PBQA 1O07A 4B88A 1KGFA 5G18A 3GR2A 3RXXA 1MKIA 3IF5A 3AGFA 4JXSA 4WEJA 5E2GA 4LV3A 3HLWA 4RX3A 5F82A 1BTLA 4M3KA 3O88A 2ZC4B 1K57C 2Y2PA 4DF6A 1LL9A 4LCMA 3V50A 2Y4AA 1PI5A 4XUXA 2VGKA 3N8LA 3HREA 4GDBA 2JC7A 4X53A 2G2WA 3TSGA 4OPZA 1DJCA 4N9LA 1WYBA 1SKFA 5CXWA 1ESIA 1H8ZA 4GDNA 5L2FA 1Z6FA 1EROA 3VOYA 3AGEA 5CHUA 3GRJA 1ZG4A 1E3UD 5GLDA 1WE4A 2ZC5B 3HUNA 4R23A 1M40A 2HDUA 1W5DA 2ZD8A 2JCHA 2PU4A 3EQVA 1NJ4A 1AXBA 4ZBEA 5E2EA 3RXWA 1K56A 4MLLA 3WS2A 3CG5A 3BRMA 3OPHA 2Q9MA 4WM9A 3UNWA 1Q2PA 1KVLA 2DNSA 2OLVA 5EOEA 5FATA 3ZG0A 4EUZA 1S6RA 3EQUA 5BOHA 1L0FA 4MEZA 3HLDA 5U47A 2EX8A 5CRFA 2Y2MA 3BLMA 1ZKJA 4C75A 3LO7A 1C3BA 3IH8A 1PWDA 2EXAA 3OPPA 4HEFA 5FAOA 5FASA 5HX9A 1S0WA 5HARA 2Y2GA 4E3JA 2H10A 2IWDA 4HBUA 4LCLA 2H5SA 3ZG7B 2QMIA 2Y59A 1PWCA 3QNBA 2V2FF 4GD6A 1XGIA 2QPNA 3HLGA 4N9KA 2WYXA 4LV0A 4OLGA 2H0YA 3P09A 1CEFA 4WZ5C 5FAPA 3MZFA 3WS4A 4PM8A 4DE0A 3UDFA 4S2KA 4ZJ3A 3DW0A 4OOLA 5TR7A 4S2NA 2Y2NA 4UAAA 4OH0A 4E3KA 1W79A 1MWTA 2XF3A 3PTEA 4ZDXA 4PM9A 1YLPA 5HAQA 4X6TA 4P6BA 4Y7PA 4MBFA 1KE3A 3N8RA 1FSYA 1W7FA 4L0LA 1ES3A 4WEKA 3IWIA 5CGWA 4X55A 4U3TA 3UDXA 3QNCA 3BYDA 1NZOA 2Y2IA 1FR1A 1K54A 2WGVA 1ZC2A 3VSKA 4B4ZA 3Q7ZA 2PBYA 1NY0A 2ZQAA 4JPMA 4OQ0A 4RVAA 5KSCA 1KDWA 2HDRA 5F83A 2X01A 4GKUA 2ZQ7A 1IYOA 2FFFB 2V20A 2CC1A 4LV1A 1JWPA 5DTKA 5AQ9A 4EV4A 4IBRA 4R1GA 4OOMA
chains in the Genus database with same CATH superfamily
1K6RA 2J9OA 5AVFA 1DP8A 5DFXA 3C7UA 1MZUA 5EUAA 1E4DA 4X69A 2W3GA 2W3EA 4EEPA 1HZOA 3SH7A 3FV7A 2VV8A 3G2ZA 3P01A 5A93A 3OPRA 5HD5A 1TD5A 2UWXA 3ISGA 4S2LA 3LCEA 1SKOA 2OLUA 3CUEC 5CX7A 2VGLM 3MR0A 4UHUA 2HP5A 3UB7A 4B93A 4O7DA 3IHAA 3D9YA 4UA7A 1I2WA 2XR0A 4C3QA 1XA7A 1XJ3A 3JVVA 3LR0A 3G32A 1SKOB 1BSGA 5KZHA 3NJAA 1MWRA 1STZA 2XLNA 3AGDA 3EEHA 1TS7A 4JKTA 1PW8A 5EPHA 3HJIA 3KSIA 5J8XA 2OSUA 4GOGA 2XD1A 3Q82A 5I5LA 3SH9A 5IS1A 4OLDA 3FPVA 4I38A 4CJNA 2G2UA 1TS6A 5G4ZA 2J7VA 4UQIS 4EESA 4K0XA 3UB8A 1W8QA 4K08A 4YNRA 1MY8A 2PHYA 2UV0E 2Y2KA 3SS3A 1Y54A 1SDNA 4KG6A 5GLAA 2BG1A 3GSGA 3A0SA 2JN7A 4Y3IA 4F3LA 2W27A 2Q9NA 2Y2HA 4ETXA 5GHXA 5KMWA 4EBPA 4EU0A 2HF6A 3RH8B 5E2FA 2IWCA 2V1BA 5IHVA 2P08A 1T1BA 5IT5A 2YKHA 3DTEA 4F3LB 2ZLYA 4BLMA 1D1JA 1NXYA 2AVXA 4QWOA 2WAEA 1LSXA 2QHKA 3CUEA 3TRCA 4OONA 5K5BA 1KOUA 5JYPA 3NDEA 2HP6A 3NCKA 2Y2OA 4PKYA 4K0WA 4BWIA 1S4RA 3D72A 3CJMA 4R3JA 5FI2A 5HDSA 3H7WA 4NETA 3A3EA 3VV4A 1CI8A 1IYQA 3DAVA 4FUWA 5GLCA 3P98A 3EWKA 2WGWA 4R70A 4QY6A 4HESA 2ZC7A 1FILA 1HTZA 3UPNA 4GD8A 3H7WB 4LLOB 4GLQA 5EFWA 4HOIA 5FDHA 2YKFA 4KG2A 3L7HA 3G4PA 2ZM2A 3V5MA 4MBHA 2W3DA 2EFXA 3M6HA 1BLHA 2XFSA 2WGWB 3ZNTA 4E3IA 2C5WB 3WRTA 4U0TA 1L3LA 1M6KA 3Q07A 2OV5A 2OWHA 2PU2A 3L9KA 1L0EA 1JVJA 2ZMAA 4DJ2A 2JKTM 3A0VA 2XGNA 1PFLA 1YLZA 1T1CA 4AFIA 1IKIA 4KZ8A 3UE3A 2JHEA 4A5RA 3C8CA 1LI0A 3BY9A 4UA9A 3MBZA 1GSWA 3C2WA 2ZMFA 5CEDA 2HP9A 2P7JA 3DTIA 2FZ0A 5M1AA 4HY8A 4XUZA 4HI4A 4HP4A 1GHMA 3O86A 4LPZA 3VP3A 3W4PA 3GECA 2Y91A 2EWWA 2V9AA 1EWZA 5DJUA 3VE4A 3W4OA 1MC0A 5TJJA 3IF6A 4JXGA 4UQIM 2BTFP 3SW1A 2Z6DA 3UE0A 2LB5A 2A3UA 2GX5A 2ACGA 2QYBA 2OAQ1 1PYYA 1XP4A 4O0PA 1G68A 5FQKA 3IT9A 1W63Q 4MN7A 3GV9A 3MZDA 1F2KA 1YLYA 3CI6A 3CMZA 2A49A 3IF6B 2EXBA 1JWVA 1OTIA 4DRTA 1CF0A 2I9VA 1OT6A 4DE2A 3ZGAB 2EX9A 1TS8A 2V0UA 2C6WB 3IBRA 2E8IA 4R4RA 1E25A 1HVBA 3E4PA 4IBXA 4IVIA 1Y28A 2K2NA 2QZ6A 1K54C 3GTCA 3V39A 4QU3A 4ARZA 4JF4A 4BENA 1ALQA 5J3WA 4I39A 1ES5A 2XDMA 5FQ9A 2Y2QA 3ZFZA 2Y55A 1O07A 1KGFA 1MKIA 4JXSA 4RX3A 4DMZA 4O01A 4HJ6A 1K57C 2Y2PA 5A8BA 4ARZB 3V50A 3KSHA 3T4QA 3G6OA 4WF0A 3HREA 4KUKA 4N9LA 1WYBA 1ESIA 3JPUA 4GDNA 2M7VA 1Z6FA 1EROA 3VOYA 1E3UD 2O9CA 2ZL1B 3OOVA 3QP8A 4R23A 1W5DA 3MMHA 3GDIA 2PU4A 3EQVA 4MMNA 1K56A 4FOFA 3LIBA 2DMWA 3T4JA 3BLMA 1C3BA 5FASA 1P0ZA 1S0WA 3CPTA 4E3JA 4LCLA 2H5SA 2V2FF 2QPNA 3HLGA 4LV0A 2H0YA 4DE0A 4BBTA 5EVEA 2Y2NA 4UAAA 1MWTA 3CPTB 1LT0A 2XA7M 4MBFA 5DJTA 1KE3A 3N8RA 1GSXA 1ES3A 3NOPC 4IHQA 4II7A 4G3WA 2VKSA 1FR1A 1K54A 2PBYA 2ZQAA 5KSCA 1KDWA 1OTBA 2HDRA 2XROA 2V20A 3CAXA 1JWPA 5DTKA 4EV4A 3F1NA 4RX2A 4S2PA 1BULA 1K57A 5TGFA 1ODVA 4OQHA 3MQ0A 1XFNA 4HJ3A 5F69A 5FA7A 5CERA 1K55C 2KX6A 5AVEA 3ZQ5A 3VP0A 4EUVA 4OQIA 1G6AA 3F1NB 3VMAA 5AQ7A 3OCNA 3LY4A 1FR6A 3V67A 3M2JA 3FYZA 3LEQA 4YOFA 3LUQA 3LI9A 3M6BA 4GS9A 4XXRA 1UGUA 2OOLA 2JE5A 2PR6A 3KYZA 3S22A 4F94A 4ZRRA 2OAP1 5FSRA 1DP6A 4KZ7A 4GS9B 4WLAA 1CQAA 1FCNA 3R7WB 3HUMA 1IYSA 4WL9A 3BECA 1FCMA 5J7EA 3UPOA 1ZG6A 3DWZA 4BD0A 2JBFA 3OLOA 1H8YA 4X25A 1J9MA 4Y0OA 1DJAA 3VP1A 4PM5A 3A3IA 2XRNA 4G3VA 2ZQDA 3C4PA 4KUOA 3S7PA 3UE6A 2O9AA 1NYMA 3ZNYA 4QJGA 2J80A 2WKRA 5HFOA 1L2SA 2JKGA 3ZDJA 1EI5A 1FCOA 3DBAA 1XJ6A 4OPQA 3MKFA 4HP9A 2I72A 4ETZA 3B42A 4R3BA 4BBUA 1MXOA 1XPBA 1CK3A 3HVFA 5KSHA 2ZQ8A 4RA7A 4Y17A 4FSFA 1KGEA 3PBOA 4S2MA 1P9WA 2V1ZA 5DKLA 3FKWA 2VV6A 4LENA 3T1SA 3SH8A 1S66L 3K3DA 5GL9A 1BLSA 3P7NA 3LIAA 5EVIC 3NULA 1XKZA 1ONHA 5F68A 3A3FA 1L0GA 3Q1FA 1ZHHB 4GB7A 1MWSA 3T4SA 1OJ5A 4LRYC 5AQAA 2XK1A 2R9WA 5HZHA 3UO9A 3HJKA 3ITAA 4ZJ2A 1UWPX 4CLCA 3VSLA 1PW1A 3TJZC 1YLTA 4QD4A 2PRFA 1OTEA 4Q8IA 1RCJA 2J8YA 3SS5A 3NIAA 3S7QA 1K25A 4CPKA 2BLSA 3MFXA 2B18A 2GJ3A 3VOZA 3JVUA 4GJ4A 1OTAA 3PXPA 4CLCB 4NG2A 4ZJ1A 4D60A 2J3TD 2ZJ9A 1HLUP 4WZ5A 4JF5A 5DF9A 2K31A 3HLEA 4S2OA 5FI7A 1IFQA 4QB8A 1XFQA 2JKRM 2W0NA 2MJ6A 5MC7A 4B4XA 2XH9A 4BQMA 4I3AA 4H8RA 5A92A 3U4LP 3IXDA 3NOUC 3NC8A 1TS0A 4N1XA 4OQGA 3W4QA 1XXMA 2O99A 1GCEA 4QPRA 1IKGA 4KG5A 3BEBA 3KX0X 4S2IA 1NYYA 4KQOA 3ZVWA 4Q0HA 3D4FA 4GNUA 5FQIA 3OC2A 1Y4OA 4N1HA 4KQDA 1J3WA 2P9VA 1PRQA 3VOLA 5EVIA 3UN7A 1GHPA 1K4EA 2VX8A 2FFYA 3WS5A 2Z6CA 3CHWP 3VE3A 2ZM8A 4PM7A 4YINA 3VP2A 3CZDA 1BZAA 3ULFA 2P9VB 3UE1A 3KO6A 2VV7A 3PAGA 2PAVP 4EXOA 5EVIB 3TOIA 1FSWA 3ZG5A 2PD7A 3LIDA 3MS6A 4K91A 1H0MA 2VLGA 4RYEA 3IQAA 1KDSA 3WWXA 3T4LA 2A24A 3G34A 2X71A 4C6YA 5C5KA 1PIOA 1U60A 4JGPA 4CLCD 1GSVA 1BT5A 3LEZA 3E2KA 3FKVA 4BJPA 4JF6A 3UB5P 5CTNA 1NZUA 3HLCA 3TG9A 4EBNA 2A24B 5CEBA 2GZAA 3Q81A 5I94A 2JKTI 5EM1A 3T1QB 1YQSA 5HL6A 1N9NA 3BFCA 3HL9A 1MPLA 1VQQA 4I3IA 5G18A 3GR2A 3RXXA 4WEJA 5E2GA 4LV3A 4M3KA 4LCMA 2PDRA 4XUXA 2VGKA 2JC7A 3TSGA 4OPZA 2ZBBA 3T50A 2LB9A 5FEFA 1ZG4A 2ZC5B 3HUNA 4L9EA 2ZD8A 5J4EA 4HH2A 4B9OA 1NJ4A 1AXBA 3CG5A 3K2NA 4WM9A 3UNWA 2OLVA 5EOEA 5FATA 5HPIA 3KSGA 1ZKJA 2M7UA 2EXAA 3OPPA 3LFVA 5HX9A 1SZVA 5HARA 4FTXA 2H10A 4HBUA 2QMIA 5FEGA 1XGIA 2NUPC 2L4RA 3WS4A 3UDFA 3DW0A 3O5YA 4OH0A 1W79A 3PTEA 4ZDXA 2K7SA 4Y7PA 2V8CA 4L0LA 2PD8A 4X1LA 3E4QA 1S1YA 3QNCA 3PR6A 3BYDA 1ZC2A 2VEAA 4JGRA 4R6LA 3EGXC 2GNXA 5F83A 3NOTC 4GKUA 4I5SA 4HQAA 4OOMA 3C5AA 2VA0A 1CEGA 4KZ9A 2PBDP 1T19A 1I5QA 3BY8A 4NXBA 1RGZA 4FCFA 1PZPA 2EX6A 3BW6A 5EECA 2WKIA 1T18A 2WKHA 5EOOA 4KZ5A 1XA1A 1DY6A 3ICYA 3FPWA 1OT9A 2O0YA 4LRZE 4PPRA 3IX8A 2FH5A 4IEDA 2ZL1A 3F1OA 3IXGA 4DDYA 1MWUA 2GDNA 4WYYA 3VP4A 2WUQA 3NI9A 3IHBA 4X56A 1YMXA 2RL3A 4KZ6A 3JYIA 3T4OA 3GMWA 3BFDA 4BL2A 5M18A 3BQ8A 4FH2A 5G4YA 5DF7A 1PI4A 2EA9A 3F1OB 2WKEA 2M1CA 4P85A 3TE8A 1BUEA 4DE3A 1IYPA 4HJ4A 4E3LA 5HSQA 5FQMA 4NKPA 2WK0A 1LLBA 1SCWA 4S2JA 3G30A 3MXSA 3OZHA 4FD8A 2PT7A 2CMNA 3C7VA 3GQZA 3W2ZA 2QKPA 4H6JB 4ID4A 5E2HA 1K38A 4NXFA 5GHYA 4EBLA 1PZOA 5FDSA 3UDIA 2Z2LB 3G31A 5IU1A 4QHCA 3BQAA 5A90A 4LGWA 2EFUA 3HLBA 2B5RA 4EWFA 3MKEA 2H0TA 2INWA 4Y5FA 1DJBA 3T1XA 1TF1A 2G7UA 3T1RA 1L0DA 1YLWA 4HNBA 4YFMA 4Y15A 4P87A 5CGXA 4P6ZS 5HAPA 4MCWA 4QY5A 1H5XA 3PBTA 3T12B 3CWFA 3LYXA 4R3AA 4M4XA 4GN2A 1DP9A 4U0XA 3S7OA 2Y2JA 4O8GA 3C38A 4X1MA 4BBVA 2ZM0A 3EEAA 1BLPA 3R7WA 3QP6A 3BFFA 4WELA 3SZTA 1ERQA 1WA9A 3MF0A 3WS0A 5GHZA 4OKPA 3TW8A 1MKMA 4E04A 5FI6A 4WMCA 1TVFA 3FZCA 1K56D 2X02A 2PYRA 1MBLA 1LHYA 4KZ4A 2ZOIA 4EQIA 2B02A 4E6WA 1KE4A 1VM1A 1VEUA 4Q0IA 4JXWA 2L0WA 3G2YA 4UA6A 3ZG8B 3OCLA 4I3JA 1N4OA 4D2OA 3PBRA 4OPRA 3I7JA 5CHMA 2PR5A 1YM1A 5CHJA 2XEPA 3GVBA 1VEUB 3RTYA 5CECA 3H82A 3ZCZA 2Z2MB 4G3KA 3QP5A 1VETB 3OPLA 1K6SA 1N9BA 3MZEA 1Z09A 4FH4A 3LI8A 3N7WA 2DRWA 1JTDA 1YPRA 3H82B 2E8JA 4Z9QA 5JYOA 1ESUA 1S4SA 4X68A 3LICA 5AQBA 1K55A 4PHTA 3VFFA 5F5YA 2ZQ9A 1RGYA 5EV0A 1W63M 2Q0OA 1W8YA 3H9WA 1ZTUA 1KGGA 4BD1A 1I2SA 4R0QA 4WUJA 3PHYA 2XFTA 3BM6A 3LR3A 3IWOA 3A0RA 5E43A 3EGDC 4S2NC 4MN6A 3O87A 4KQRA 4Z1WA 5FQJA 2R9XA 3V3RA 1OTDA 1QMFA 3LY3A 3PBNA 5LBRA 4E3OA 1NWZA 4WMCD 4JGQA 4DDSA 2WKPA 2JKRI 1YSQA 1WYCA 2XSSA 3ZHHA 4OP5A 4MBKA 3UB6A 1XJ2A 1XJ4A 3M2KA 4B88A 4P6ZM 2J3WA 3IF5A 3AGFA 1LSVA 3LIEA 1OJGA 5F82A 3O88A 1VB6A 4DF6A 1LL9A 1PNEA 1PI5A 2L1MA 3KYQA 4GDBA 1DJCA 1SKFA 1H8ZA 2W3FA 1F9IA 3AGEA 4Y2FA 4ME4A 3LIFA 5GLDA 1WE4A 2HDUA 1T1AA 1N9LA 2V0WA 2JCHA 4L9GA 1V9YA 3RXWA 3QP1A 2O9BA 3OPHA 4JGOA 2Q9MA 1Q2PA 2DNSA 1L0FA 4MEZA 3HLDA 2EX8A 5CRFA 1G5UA 3LR5A 4C75A 2P04A 3LO7A 4Q0JA 3IH8A 1PWDA 4HEFA 3KSFA 2JKFA 2KDKA 2IWDA 1LL8A 1PWCA 3CITA 4BMWA 4N9KA 3P09A 1CEFA 5FAPA 1V9ZA 4OOLA 5TR7A 4S2NA 4NEED 5DFYA 5HWTA 4E3KA 4PM9A 2KLIA 2ZOHA 5HAQA 4GW9A 4X6TA 3LGOA 3QP4A 4P6BA 4GCZA 1FSYA 3HCYA 4WEKA 5HDDA 5CGWA 4U3TA 1N9OA 2W1RA 2Y2IA 4B4ZA 2WGVA 3R4KA 3UMEA 1NY0A 2HJ9C 4JPMA 4RVAA 4DJ3A 1ACFA 2X01A 1IYOA 2CC1A 4IBRA 4R1GA 3MFDA 3IBJA 3IX4A 4ZTKA 2WKQA 3BLSA 2HJEA 4KENB 4MDZA 3IF6C 5DTTA 1XX2A 4PKYG 3NDGA 3V3SA 3CLOA 2HZ5A 1CJFA 4EEUA 4LV2A 3FG8A 3FC7A 1LL5A 2EX2A 1YKDA 1RP5A 3IXHA 3BWLA 3PBSA 4KQQA 1GA0A 4HBTA 1O7EA 1K0KA 4L9FA 1ERMA 1TDGA 3LR4A 2WAFA 3WS1A 4NK3A 2WGIA 4IUHA 3IH9A 4PAUA 2VK3A 1X0OA 3E2LA 2QJ7A 4DKIA 1FIKA 1SHVA 1OPXA 1IEMA 4KZ3A 2V1AA 2QJ5A 4HHDA 2VGJA 1HD8A 2Y79A 2VJWA 5HL1A 2HDQA 3HUOA 5EVID 1OMEA 3B47A 1P9RA 2XA7S 1IELA 1AWIA 1E3UA 5HWVA 2KOIA 4ZAMA 5CTMA 4JBFA 1XGJA 4HIAA 1K4FA 5HDCA 3W8KA 2WADA 5HD3A 3QP2A 4OVDA 5FAQA 3IX3A 2ZQCA 4JLFA 1QMEA 1EW0A 1BLCA 5TFQA 4HH3A 3BJNA 4OP8A 3N8SA 5M19A 4KZAA 4KZBA 4PMAA 2J9PA 3S4XA 4LFUA 3N4IA 2ZMVA 3HLFA 2HPBA 3WRZA 3UPPA 1FOFA 1YT4A 3SS4A 3ZVTA 5DKKA 4PM6A 1A0KA 3MSHA 5FL3A 3HBRA 5L09A 4EW7A 4IVKA 3ZYTA 3E0YA 4DE1A 2V8FA 1TEMA 1NLYA 3RFBA 4EETB 3BFGA 5DTSA 4NXEA 2XD5A 1D06A 5CGSA 4IUKA 4R4SA 4R38A 4BL3A 3ZG9B 4GHIA 4OOYA 3C30A 4DXBA 2W1TA 2EWVA 3N6IA 2NUTC 2ZC6B 2PYPA 1SDEA 4WBGA 3NECA 1ONGA 5EVLA 5EE8A 4YWZA 3D3OA 2IA2A 3DTKA 1CI9A 4WZ4A 4IJGA 4GHIB 1ES2A 5HAIA 3K3CA 2W1TB 4H6JA 4LRXC 5AJGA 5A91A 4Y0TA 4E3MA 2ZC3B 2W3HA 1LI9A 5HPFA 5KIZA 2P74A 1Q2QA 1D7EA 1GA9A 2Y2LA 4CLCE 2RCXA 1YMSA 3F1PA 1JNUA 4WN5A 2IWBA 3PYPA 4RQ9A 1YLJA 2HDSA 4GZBA 5DVAA 5HW3A 3DWKA 5F6AA 3S7NA 3ITBA 1P97A 3C4OA 4OPYA 4EQ1A 3VFHA 3MQOA 3NBLA 3F1PB 2WZXA 3O3VA 5F1GA 3MJQA 1IOUA 3UMDA 5D3OA 1NRFA 4Y13A 3IS2A 3QHYA 1JTGA 5TBMA 3S1YA 4DXCA 5F1FA 2J3TC 4Y0UA 3OBFA 5FQQA 1PWGA 3A3JA 1NRJA 4JXVA 3MXRA 3MXQA 1H8MA 1TDLA 4E3NA 3UY6A 5DF8A 2VGLS 1BYWA 3IS2B 2WZZA 5TBMB 3E4OA 2DCFA 3IWQA 3SOIA 3PAEA 4DN0A 5L07A 2OWJA 4UEYA 2D01A 3DTMA 4MNRA 5GLBA 1KVMA 1GHIA 2R78A 3Q7VA 4N92A 1FQGA 1KE0A 1ES4A 3NY4A 3BFEA 1S1ZA 3B33A 2VZWA 1JWZA 5EM0A 3IXBA 3FWLA 4P0MA 4E6XA 2XQZA 4CQHA 1F5MA 3B3XA 3E98A 4XT2A 3Q7VB 1H3QA 3G35A 3A3DA 3RJUA 3PBQA 3HLWA 2Y8HA 1BTLA 1G28A 2ZC4B 4MN5A 2Y4AA 2QWSA 3N8LA 4X53A 2G2WA 3EOIA 4XT2B 1VETA 5CXWA 2A2LA 5L2FA 5CHUA 3GRJA 1M40A 3UB9A 1DRMA 1YAXA 2D02A 4ZBEA 5E2EA 4MLLA 3WS2A 3BRMA 4CLCC 2HV1A 2BASA 1KVLA 3ZG0A 4EUZA 3U2AA 1S6RA 2B95A 3EQUA 5BOHA 4ESPA 5U47A 2Y2MA 5FAOA 1S67L 2Y2GA 5L8MA 3ZG7B 2Y59A 2H28A 3QNBA 4GD6A 1F98A 2WYXA 1NLZA 4OLGA 4WZ5C 3MZFA 4PM8A 1UWNX 4S2KA 4ZJ3A 4EERA 3KYEA 2HGVA 1VHMA 2XF3A 4NXGA 1YSPA 1YLPA 1LSWA 3MQQA 3T4KA 1W7FA 3IWIA 4X55A 3UDXA 3NHQA 1NZOA 1G6OA 3VSKA 3Q7ZA 4OQ0A 5HWWA 5L10A 2ZQ7A 2FFFB 4LV1A 5AQ9A 3T4TA
chains in the Genus database with same CATH topology
1K6RA 3MFDA 3C5AA 1CEGA 2J9OA 4KZ9A 1I5QA 1RGZA 4RX2A 4FCFA 1PZPA 2EX6A 3C7UA 5EECA 4S2PA 4ZTKA 5EUAA 1BULA 1K57A 1E4DA 5TGFA 4X69A 2WKIA 1HZOA 5FA7A 4OQHA 3SH7A 2WKHA 5EOOA 3BLSA 1K55C 4KZ5A 5CERA 3FV7A 4KENB 1XA1A 1DY6A 3G2ZA 3IF6C 3VP0A 5A93A 3OPRA 4OQIA 5DTTA 1XX2A 1G6AA 3VMAA 5AQ7A 3NDGA 3OCNA 2UWXA 3V3SA 3LY4A 1FR6A 3M2JA 3FYZA 4PPRA 3ISGA 4S2LA 3LCEA 4LV2A 2OLUA 4IEDA 3M6BA 4XXRA 1LL5A 2EX2A 3IXGA 4UHUA 2HP5A 4DDYA 1MWUA 2GDNA 2JE5A 4WYYA 2WUQA 1RP5A 4O7DA 3NI9A 3VP4A 3IHBA 3IHAA 4X56A 1YMXA 3IXHA 2RL3A 4KZ6A 1I2WA 4UA7A 3PBSA 2XR0A 3JYIA 4KQQA 3S22A 4C3QA 4F94A 1GA0A 3GMWA 3BFDA 1XA7A 4HBTA 4BL2A 1O7EA 5M18A 5FSRA 4FH2A 4KZ7A 3G32A 1ERMA 1TDGA 5DF7A 1PI4A 1BSGA 5KZHA 2WAFA 3WS1A 1MWRA 1FCNA 2WKEA 3HUMA 1IYSA 4NK3A 2WGIA 2XLNA 3AGDA 4P85A 3BECA 1FCMA 3IH9A 4JKTA 3UPOA 1ZG6A 1PW8A 1BUEA 3DWZA 3E2LA 5EPHA 4BD0A 4DKIA 5J8XA 2OSUA 1SHVA 4GOGA 2JBFA 2XD1A 4DE3A 1IEMA 3Q82A 1H8YA 4KZ3A 3SH9A 1J9MA 2VGJA 4Y0OA 1DJAA 4OLDA 1IYPA 3VP1A 1HD8A 4E3LA 4PM5A 3A3IA 4CJNA 2G2UA 5HL1A 2ZQDA 3C4PA 5FQMA 2J7VA 2WK0A 2HDQA 3HUOA 1LLBA 5EVID 1OMEA 1SCWA 4QJGA 1NYMA 4K0XA 1IELA 4S2JA 3G30A 3MXSA 3OZHA 3ZNYA 5HFOA 4FD8A 1W8QA 3C7VA 1E3UA 1MY8A 1L2SA 3GQZA 4ZAMA 2Y2KA 4ID4A 5E2HA 3SS3A 1Y54A 5CTMA 4JBFA 1SDNA 1K38A 1XGJA 4KG6A 5GHYA 1PZOA 5GLAA 3ZDJA 4EBLA 1EI5A 1K4FA 1FCOA 2BG1A 3GSGA 3W8KA 2WADA 3UDIA 2Z2LB 4OVDA 3G31A 5FAQA 4OPQA 3MKFA 2I72A 2ZQCA 4QHCA 2Q9NA 2Y2HA 4R3BA 1MXOA 1XPBA 4JLFA 1QMEA 5GHXA 1CK3A 4EBPA 5KMWA 3HVFA 5A90A 5E2FA 2ZQ8A 5KSHA 1BLCA 4RA7A 5TFQA 2EFUA 2IWCA 3HLBA 2B5RA 5IHVA 4FSFA 4EWFA 3MKEA 1KGEA 3PBOA 2H0TA 4OP8A 4S2MA 1DJBA 3N8SA 2ZLYA 5M19A 2V1ZA 4KZAA 4BLMA 4KZBA 4PMAA 2J9PA 3FKWA 3S4XA 1L0DA 4LENA 1YLWA 1NXYA 3N4IA 4YFMA 2WAEA 3HLFA 4P87A 3SH8A 2HPBA 5CGXA 3WRZA 3UPPA 5HAPA 1FOFA 1YT4A 4QY5A 3SS4A 5GL9A 3ZVTA 1BLSA 4OONA 4PM6A 1H5XA 5EVIC 3NDEA 5JYPA 1XKZA 2HP6A 3NCKA 2Y2OA 3HBRA 3PBTA 1ONHA 4K0WA 4IVKA 3A3FA 1L0GA 3Q1FA 4GB7A 1MWSA 4DE1A 1TEMA 4GN2A 3CJMA 4U0XA 4R3JA 3BFGA 2Y2JA 5DTSA 5FI2A 2XD5A 5AQAA 4NETA 3A3EA 5CGSA 2XK1A 2R9WA 3UO9A 1CI8A 3ITAA 4ZJ2A 2ZM0A 4R4SA 1IYQA 1BLPA 4BL3A 5GLCA 3BFFA 4WELA 1ERQA 1PW1A 3P98A 3VSLA 2WGWA 3ZG9B 3WS0A 1YLTA 4OOYA 4QD4A 5GHZA 4OKPA 4QY6A 4Q8IA 1RCJA 2J8YA 3SS5A 4DXBA 4HESA 2ZC7A 5FI6A 4WMCA 3N6IA 2ZC6B 3NIAA 1HTZA 1TVFA 3UPNA 3FZCA 1SDEA 4GD8A 1K56D 2X02A 4WBGA 1MBLA 1ONGA 1K25A 1LHYA 4CPKA 4KZ4A 2BLSA 5FDHA 5EVLA 4EQIA 4KG2A 5EE8A 4E6WA 3G4PA 2ZM2A 3VOZA 3V5MA 1KE4A 4MBHA 1VM1A 1CI9A 2EFXA 3M6HA 1BLHA 4WZ4A 4JXWA 4ZJ1A 2XFSA 2WGWB 3G2YA 4UA6A 3ZG8B 2ZJ9A 1ES2A 3ZNTA 4E3IA 2C5WB 4WZ5A 4JF5A 5DF9A 3HLEA 3OCLA 5HAIA 3WRTA 4S2OA 1N4OA 4U0TA 5FI7A 1M6KA 4QB8A 3Q07A 2OV5A 4D2OA 3PBRA 4OPRA 2PU2A 3I7JA 5CHMA 5A91A 1L0EA 4E3MA 4Y0TA 1YM1A 1JVJA 2ZMAA 5CHJA 2XEPA 2ZC3B 1LI9A 4B4XA 2XH9A 3GVBA 4BQMA 2XGNA 2P74A 1YLZA 1Q2QA 4H8RA 5A92A 1IKIA 1GA9A 2Y2LA 5CECA 2RCXA 3IXDA 3NC8A 4KZ8A 4N1XA 4OQGA 3W4QA 3ZCZA 2Z2MB 1XXMA 3UE3A 1YMSA 1GCEA 2IWBA 4A5RA 3OPLA 1K6SA 1IKGA 1N9BA 4KG5A 1LI0A 1YLJA 2HDSA 3BEBA 4GZBA 4S2IA 5DVAA 4UA9A 1NYYA 5HW3A 4KQOA 3MZEA 4FH4A 3ZVWA 3DWKA 3MBZA 3N7WA 3D4FA 2DRWA 3ITBA 1JTDA 4GNUA 5FQIA 5CEDA 3OC2A 4N1HA 4Z9QA 2HP9A 3C4OA 4OPYA 3VFHA 5M1AA 3NBLA 4XUZA 2P9VA 5JYOA 2WZXA 3O3VA 1ESUA 5F1GA 3VP3A 1GHMA 3O86A 4X68A 3W4PA 2Y91A 5EVIA 5D3OA 3UN7A 1NRFA 1GHPA 1K4EA 1EWZA 5AQBA 2FFYA 3WS5A 1K55A 3QHYA 1JTGA 3W4OA 3VFFA 3S1YA 4DXCA 5F1FA 4Y0UA 3IF6A 5FQQA 1PWGA 2ZQ9A 3A3JA 4JXGA 1RGYA 2ZM8A 4JXVA 3MXRA 4PM7A 4YINA 1W8YA 3CZDA 3UE0A 2A3UA 3VP2A 1TDLA 1BZAA 2P9VB 3UE1A 1KGGA 4BD1A 4E3NA 3PAGA 3UY6A 1I2SA 5EVIB 3TOIA 4R0QA 1PYYA 1FSWA 2XFTA 5DF8A 1XP4A 3BM6A 3ZG5A 1G68A 3IWOA 3IT9A 5FQKA 2WZZA 4K91A 3GV9A 3MZDA 1YLYA 4RYEA 2DCFA 5E43A 3CMZA 2A49A 3IF6B 2EXBA 3IWQA 4S2NC 3SOIA 3IQAA 1JWVA 3PAEA 3O87A 1KDSA 3WWXA 4DRTA 3DTMA 4MNRA 5GLBA 1KVMA 4KQRA 1GHIA 3G34A 2X71A 4C6YA 3Q7VA 4N92A 1FQGA 1PIOA 4DE2A 1U60A 3ZGAB 2EX9A 5FQJA 1KE0A 2R9XA 2C6WB 3V3RA 2E8IA 4R4RA 1ES4A 1E25A 3NY4A 1BT5A 1QMFA 3LEZA 1HVBA 3BFEA 3LY3A 3E2KA 3FKVA 3PBNA 4E3OA 4IBXA 4BJPA 4IVIA 4JF6A 4WMCD 5CTNA 1NZUA 3HLCA 3TG9A 2QZ6A 1JWZA 4DDSA 1K54C 3GTCA 3IXBA 3FWLA 4P0MA 4QU3A 2XQZA 3V39A 4E6XA 4EBNA 5CEBA 1WYCA 4JF4A 3ZHHA 3B3XA 4BENA 1ALQA 3Q81A 4MBKA 3Q7VB 4OP5A 5I94A 1YQSA 1ES5A 2XDMA 3BFCA 3G35A 5FQ9A 2Y2QA 3A3DA 3RJUA 3HL9A 1MPLA 3ZFZA 3M2KA 1VQQA 2Y55A 3PBQA 1O07A 4B88A 1KGFA 5G18A 3GR2A 3RXXA 1MKIA 3IF5A 3AGFA 4JXSA 4WEJA 5E2GA 4LV3A 3HLWA 4RX3A 5F82A 1BTLA 4M3KA 3O88A 2ZC4B 1K57C 2Y2PA 4DF6A 1LL9A 4LCMA 3V50A 2Y4AA 1PI5A 4XUXA 2VGKA 3N8LA 3HREA 4GDBA 2JC7A 4X53A 2G2WA 3TSGA 4OPZA 1DJCA 4N9LA 1WYBA 1SKFA 5CXWA 1ESIA 1H8ZA 4GDNA 5L2FA 1Z6FA 1EROA 3VOYA 3AGEA 5CHUA 3GRJA 1ZG4A 1E3UD 5GLDA 1WE4A 2ZC5B 3HUNA 4R23A 1M40A 2HDUA 1W5DA 2ZD8A 2JCHA 2PU4A 3EQVA 1NJ4A 1AXBA 4ZBEA 5E2EA 3RXWA 1K56A 4MLLA 3WS2A 3CG5A 3BRMA 3OPHA 2Q9MA 4WM9A 3UNWA 1Q2PA 1KVLA 2DNSA 2OLVA 5EOEA 5FATA 3ZG0A 4EUZA 1S6RA 3EQUA 5BOHA 1L0FA 4MEZA 3HLDA 5U47A 2EX8A 5CRFA 2Y2MA 3BLMA 1ZKJA 4C75A 3LO7A 1C3BA 3IH8A 1PWDA 2EXAA 3OPPA 4HEFA 5FAOA 5FASA 5HX9A 1S0WA 5HARA 2Y2GA 4E3JA 2H10A 2IWDA 4HBUA 4LCLA 2H5SA 3ZG7B 2QMIA 2Y59A 1PWCA 3QNBA 2V2FF 4GD6A 1XGIA 2QPNA 3HLGA 4N9KA 2WYXA 4LV0A 4OLGA 2H0YA 3P09A 1CEFA 4WZ5C 5FAPA 3MZFA 3WS4A 4PM8A 4DE0A 3UDFA 4S2KA 4ZJ3A 3DW0A 4OOLA 5TR7A 4S2NA 2Y2NA 4UAAA 4OH0A 4E3KA 1W79A 1MWTA 2XF3A 3PTEA 4ZDXA 4PM9A 1YLPA 5HAQA 4X6TA 4P6BA 4Y7PA 4MBFA 1KE3A 3N8RA 1FSYA 1W7FA 4L0LA 1ES3A 4WEKA 3IWIA 5CGWA 4X55A 4U3TA 3UDXA 3QNCA 3BYDA 1NZOA 2Y2IA 1FR1A 1K54A 2WGVA 1ZC2A 3VSKA 4B4ZA 3Q7ZA 2PBYA 1NY0A 2ZQAA 4JPMA 4OQ0A 4RVAA 5KSCA 1KDWA 2HDRA 5F83A 2X01A 4GKUA 2ZQ7A 1IYOA 2FFFB 2V20A 2CC1A 4LV1A 1JWPA 5DTKA 5AQ9A 4EV4A 4IBRA 4R1GA 4OOMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K6R A;  3MFD A;  3C5A A;  1CEG A;  2J9O A;  4KZ9 A;  1I5Q A;  1RGZ A;  4RX2 A;  4FCF A;  1PZP A;  2EX6 A;  3C7U A;  5EEC A;  4S2P A;  4ZTK A;  5EUA A;  1BUL A;  1K57 A;  1E4D A;  5TGF A;  4X69 A;  2WKI A;  1HZO A;  5FA7 A;  4OQH A;  3SH7 A;  2WKH A;  5EOO A;  3BLS A;  1K55 C;  4KZ5 A;  5CER A;  3FV7 A;  4KEN B;  1XA1 A;  1DY6 A;  3G2Z A;  3IF6 C;  3VP0 A;  5A93 A;  3OPR A;  4OQI A;  5DTT A;  1XX2 A;  1G6A A;  3VMA A;  5AQ7 A;  3NDG A;  3OCN A;  2UWX A;  3V3S A;  3LY4 A;  1FR6 A;  3M2J A;  3FYZ A;  4PPR A;  3ISG A;  4S2L A;  3LCE A;  4LV2 A;  2OLU A;  4IED A;  3M6B A;  4XXR A;  1LL5 A;  2EX2 A;  3IXG A;  4UHU A;  2HP5 A;  4DDY A;  1MWU A;  2GDN A;  2JE5 A;  4WYY A;  2WUQ A;  1RP5 A;  4O7D A;  3NI9 A;  3VP4 A;  3IHB A;  3IHA A;  4X56 A;  1YMX A;  3IXH A;  2RL3 A;  4KZ6 A;  1I2W A;  4UA7 A;  3PBS A;  2XR0 A;  3JYI A;  4KQQ A;  3S22 A;  4C3Q A;  4F94 A;  1GA0 A;  3GMW A;  3BFD A;  1XA7 A;  4HBT A;  4BL2 A;  1O7E A;  5M18 A;  5FSR A;  4FH2 A;  4KZ7 A;  3G32 A;  1ERM A;  1TDG A;  5DF7 A;  1PI4 A;  1BSG A;  5KZH A;  2WAF A;  3WS1 A;  1MWR A;  1FCN A;  2WKE A;  3HUM A;  1IYS A;  4NK3 A;  2WGI A;  2XLN A;  3AGD A;  4P85 A;  3BEC A;  1FCM A;  3IH9 A;  4JKT A;  3UPO A;  1ZG6 A;  1PW8 A;  1BUE A;  3DWZ A;  3E2L A;  5EPH A;  4BD0 A;  4DKI A;  5J8X A;  2OSU A;  1SHV A;  4GOG A;  2JBF A;  2XD1 A;  4DE3 A;  1IEM A;  3Q82 A;  1H8Y A;  4KZ3 A;  3SH9 A;  1J9M A;  2VGJ A;  4Y0O A;  1DJA A;  4OLD A;  1IYP A;  3VP1 A;  1HD8 A;  4E3L A;  4PM5 A;  3A3I A;  4CJN A;  2G2U A;  5HL1 A;  2ZQD A;  3C4P A;  5FQM A;  2J7V A;  2WK0 A;  2HDQ A;  3HUO A;  1LLB A;  5EVI D;  1OME A;  1SCW A;  4QJG A;  1NYM A;  4K0X A;  1IEL A;  4S2J A;  3G30 A;  3MXS A;  3OZH A;  3ZNY A;  5HFO A;  4FD8 A;  1W8Q A;  3C7V A;  1E3U A;  1MY8 A;  1L2S A;  3GQZ A;  4ZAM A;  2Y2K A;  4ID4 A;  5E2H A;  3SS3 A;  1Y54 A;  5CTM A;  4JBF A;  1SDN A;  1K38 A;  1XGJ A;  4KG6 A;  5GHY A;  1PZO A;  5GLA A;  3ZDJ A;  4EBL A;  1EI5 A;  1K4F A;  1FCO A;  2BG1 A;  3GSG A;  3W8K A;  2WAD A;  3UDI A;  2Z2L B;  4OVD A;  3G31 A;  5FAQ A;  4OPQ A;  3MKF A;  2I72 A;  2ZQC A;  4QHC A;  2Q9N A;  2Y2H A;  4R3B A;  1MXO A;  1XPB A;  4JLF A;  1QME A;  5GHX A;  1CK3 A;  4EBP A;  5KMW A;  3HVF A;  5A90 A;  5E2F A;  2ZQ8 A;  5KSH A;  1BLC A;  4RA7 A;  5TFQ A;  2EFU A;  2IWC A;  3HLB A;  2B5R A;  5IHV A;  4FSF A;  4EWF A;  3MKE A;  1KGE A;  3PBO A;  2H0T A;  4OP8 A;  4S2M A;  1DJB A;  3N8S A;  2ZLY A;  5M19 A;  2V1Z A;  4KZA A;  4BLM A;  4KZB A;  4PMA A;  2J9P A;  3FKW A;  3S4X A;  1L0D A;  4LEN A;  1YLW A;  1NXY A;  3N4I A;  4YFM A;  2WAE A;  3HLF A;  4P87 A;  3SH8 A;  2HPB A;  5CGX A;  3WRZ A;  3UPP A;  5HAP A;  1FOF A;  1YT4 A;  4QY5 A;  3SS4 A;  5GL9 A;  3ZVT A;  1BLS A;  4OON A;  4PM6 A;  1H5X A;  5EVI C;  3NDE A;  5JYP A;  1XKZ A;  2HP6 A;  3NCK A;  2Y2O A;  3HBR A;  3PBT A;  1ONH A;  4K0W A;  4IVK A;  3A3F A;  1L0G A;  3Q1F A;  4GB7 A;  1MWS A;  4DE1 A;  1TEM A;  4GN2 A;  3CJM A;  4U0X A;  4R3J A;  3BFG A;  2Y2J A;  5DTS A;  5FI2 A;  2XD5 A;  5AQA A;  4NET A;  3A3E A;  5CGS A;  2XK1 A;  2R9W A;  3UO9 A;  1CI8 A;  3ITA A;  4ZJ2 A;  2ZM0 A;  4R4S A;  1IYQ A;  1BLP A;  4BL3 A;  5GLC A;  3BFF A;  4WEL A;  1ERQ A;  1PW1 A;  3P98 A;  3VSL A;  2WGW A;  3ZG9 B;  3WS0 A;  1YLT A;  4OOY A;  4QD4 A;  5GHZ A;  4OKP A;  4QY6 A;  4Q8I A;  1RCJ A;  2J8Y A;  3SS5 A;  4DXB A;  4HES A;  2ZC7 A;  5FI6 A;  4WMC A;  3N6I A;  2ZC6 B;  3NIA A;  1HTZ A;  1TVF A;  3UPN A;  3FZC A;  1SDE A;  4GD8 A;  1K56 D;  2X02 A;  4WBG A;  1MBL A;  1ONG A;  1K25 A;  1LHY A;  4CPK A;  4KZ4 A;  2BLS A;  5FDH A;  5EVL A;  4EQI A;  4KG2 A;  5EE8 A;  4E6W A;  3G4P A;  2ZM2 A;  3VOZ A;  3V5M A;  1KE4 A;  4MBH A;  1VM1 A;  1CI9 A;  2EFX A;  3M6H A;  1BLH A;  4WZ4 A;  4JXW A;  4ZJ1 A;  2XFS A;  2WGW B;  3G2Y A;  4UA6 A;  3ZG8 B;  2ZJ9 A;  1ES2 A;  3ZNT A;  4E3I A;  2C5W B;  4WZ5 A;  4JF5 A;  5DF9 A;  3HLE A;  3OCL A;  5HAI A;  3WRT A;  4S2O A;  1N4O A;  4U0T A;  5FI7 A;  1M6K A;  4QB8 A;  3Q07 A;  2OV5 A;  4D2O A;  3PBR A;  4OPR A;  2PU2 A;  3I7J A;  5CHM A;  5A91 A;  1L0E A;  4E3M A;  4Y0T A;  1YM1 A;  1JVJ A;  2ZMA A;  5CHJ A;  2XEP A;  2ZC3 B;  1LI9 A;  4B4X A;  2XH9 A;  3GVB A;  4BQM A;  2XGN A;  2P74 A;  1YLZ A;  1Q2Q A;  4H8R A;  5A92 A;  1IKI A;  1GA9 A;  2Y2L A;  5CEC A;  2RCX A;  3IXD A;  3NC8 A;  4KZ8 A;  4N1X A;  4OQG A;  3W4Q A;  3ZCZ A;  2Z2M B;  1XXM A;  3UE3 A;  1YMS A;  1GCE A;  2IWB A;  4A5R A;  3OPL A;  1K6S A;  1IKG A;  1N9B A;  4KG5 A;  1LI0 A;  1YLJ A;  2HDS A;  3BEB A;  4GZB A;  4S2I A;  5DVA A;  4UA9 A;  1NYY A;  5HW3 A;  4KQO A;  3MZE A;  4FH4 A;  3ZVW A;  3DWK A;  3MBZ A;  3N7W A;  3D4F A;  2DRW A;  3ITB A;  1JTD A;  4GNU A;  5FQI A;  5CED A;  3OC2 A;  4N1H A;  4Z9Q A;  2HP9 A;  3C4O A;  4OPY A;  3VFH A;  5M1A A;  3NBL A;  4XUZ A;  2P9V A;  5JYO A;  2WZX A;  3O3V A;  1ESU A;  5F1G A;  3VP3 A;  1GHM A;  3O86 A;  4X68 A;  3W4P A;  2Y91 A;  5EVI A;  5D3O A;  3UN7 A;  1NRF A;  1GHP A;  1K4E A;  1EWZ A;  5AQB A;  2FFY A;  3WS5 A;  1K55 A;  3QHY A;  1JTG A;  3W4O A;  3VFF A;  3S1Y A;  4DXC A;  5F1F A;  4Y0U A;  3IF6 A;  5FQQ A;  1PWG A;  2ZQ9 A;  3A3J A;  4JXG A;  1RGY A;  2ZM8 A;  4JXV A;  3MXR A;  4PM7 A;  4YIN A;  1W8Y A;  3CZD A;  3UE0 A;  2A3U A;  3VP2 A;  1TDL A;  1BZA A;  2P9V B;  3UE1 A;  1KGG A;  4BD1 A;  4E3N A;  3PAG A;  3UY6 A;  1I2S A;  5EVI B;  3TOI A;  4R0Q A;  1PYY A;  1FSW A;  2XFT A;  5DF8 A;  1XP4 A;  3BM6 A;  3ZG5 A;  1G68 A;  3IWO A;  3IT9 A;  5FQK A;  2WZZ A;  4K91 A;  3GV9 A;  3MZD A;  1YLY A;  4RYE A;  2DCF A;  5E43 A;  3CMZ A;  2A49 A;  3IF6 B;  2EXB A;  3IWQ A;  4S2N C;  3SOI A;  3IQA A;  1JWV A;  3PAE A;  3O87 A;  1KDS A;  3WWX A;  4DRT A;  3DTM A;  4MNR A;  5GLB A;  1KVM A;  4KQR A;  1GHI A;  3G34 A;  2X71 A;  4C6Y A;  3Q7V A;  4N92 A;  1FQG A;  1PIO A;  4DE2 A;  1U60 A;  3ZGA B;  2EX9 A;  5FQJ A;  1KE0 A;  2R9X A;  2C6W B;  3V3R A;  2E8I A;  4R4R A;  1ES4 A;  1E25 A;  3NY4 A;  1BT5 A;  1QMF A;  3LEZ A;  1HVB A;  3BFE A;  3LY3 A;  3E2K A;  3FKV A;  3PBN A;  4E3O A;  4IBX A;  4BJP A;  4IVI A;  4JF6 A;  4WMC D;  5CTN A;  1NZU A;  3HLC A;  3TG9 A;  2QZ6 A;  1JWZ A;  4DDS A;  1K54 C;  3GTC A;  3IXB A;  3FWL A;  4P0M A;  4QU3 A;  2XQZ A;  3V39 A;  4E6X A;  4EBN A;  5CEB A;  1WYC A;  4JF4 A;  3ZHH A;  3B3X A;  4BEN A;  1ALQ A;  3Q81 A;  4MBK A;  3Q7V B;  4OP5 A;  5I94 A;  1YQS A;  1ES5 A;  2XDM A;  3BFC A;  3G35 A;  5FQ9 A;  2Y2Q A;  3A3D A;  3RJU A;  3HL9 A;  1MPL A;  3ZFZ A;  3M2K A;  1VQQ A;  2Y55 A;  3PBQ A;  1O07 A;  4B88 A;  1KGF A;  5G18 A;  3GR2 A;  3RXX A;  1MKI A;  3IF5 A;  3AGF A;  4JXS A;  4WEJ A;  5E2G A;  4LV3 A;  3HLW A;  4RX3 A;  5F82 A;  1BTL A;  4M3K A;  3O88 A;  2ZC4 B;  1K57 C;  2Y2P A;  4DF6 A;  1LL9 A;  4LCM A;  3V50 A;  2Y4A A;  1PI5 A;  4XUX A;  2VGK A;  3N8L A;  3HRE A;  4GDB A;  2JC7 A;  4X53 A;  2G2W A;  3TSG A;  4OPZ A;  1DJC A;  4N9L A;  1WYB A;  1SKF A;  5CXW A;  1ESI A;  1H8Z A;  4GDN A;  5L2F A;  1Z6F A;  1ERO A;  3VOY A;  3AGE A;  5CHU A;  3GRJ A;  1ZG4 A;  1E3U D;  5GLD A;  1WE4 A;  2ZC5 B;  3HUN A;  4R23 A;  1M40 A;  2HDU A;  1W5D A;  2ZD8 A;  2JCH A;  2PU4 A;  3EQV A;  1NJ4 A;  1AXB A;  4ZBE A;  5E2E A;  3RXW A;  1K56 A;  4MLL A;  3WS2 A;  3CG5 A;  3BRM A;  3OPH A;  2Q9M A;  4WM9 A;  3UNW A;  1Q2P A;  1KVL A;  2DNS A;  2OLV A;  5EOE A;  5FAT A;  3ZG0 A;  4EUZ A;  1S6R A;  3EQU A;  5BOH A;  1L0F A;  4MEZ A;  3HLD A;  5U47 A;  2EX8 A;  5CRF A;  2Y2M A;  3BLM A;  1ZKJ A;  4C75 A;  3LO7 A;  1C3B A;  3IH8 A;  1PWD A;  2EXA A;  3OPP A;  4HEF A;  5FAO A;  5FAS A;  5HX9 A;  1S0W A;  5HAR A;  2Y2G A;  4E3J A;  2H10 A;  2IWD A;  4HBU A;  4LCL A;  2H5S A;  3ZG7 B;  2QMI A;  2Y59 A;  1PWC A;  3QNB A;  2V2F F;  4GD6 A;  1XGI A;  2QPN A;  3HLG A;  4N9K A;  2WYX A;  4LV0 A;  4OLG A;  2H0Y A;  3P09 A;  1CEF A;  4WZ5 C;  5FAP A;  3MZF A;  3WS4 A;  4PM8 A;  4DE0 A;  3UDF A;  4S2K A;  4ZJ3 A;  3DW0 A;  4OOL A;  5TR7 A;  4S2N A;  2Y2N A;  4UAA A;  4OH0 A;  4E3K A;  1W79 A;  1MWT A;  2XF3 A;  3PTE A;  4ZDX A;  4PM9 A;  1YLP A;  5HAQ A;  4X6T A;  4P6B A;  4Y7P A;  4MBF A;  1KE3 A;  3N8R A;  1FSY A;  1W7F A;  4L0L A;  1ES3 A;  4WEK A;  3IWI A;  5CGW A;  4X55 A;  4U3T A;  3UDX A;  3QNC A;  3BYD A;  1NZO A;  2Y2I A;  1FR1 A;  1K54 A;  2WGV A;  1ZC2 A;  3VSK A;  4B4Z A;  3Q7Z A;  2PBY A;  1NY0 A;  2ZQA A;  4JPM A;  4OQ0 A;  4RVA A;  5KSC A;  1KDW A;  2HDR A;  5F83 A;  2X01 A;  4GKU A;  2ZQ7 A;  1IYO A;  2FFF B;  2V20 A;  2CC1 A;  4LV1 A;  1JWP A;  5DTK A;  5AQ9 A;  4EV4 A;  4IBR A;  4R1G A;  4OOM A; 
#chains in the Genus database with same CATH topology
 1K6R A;  2J9O A;  5AVF A;  1DP8 A;  5DFX A;  3C7U A;  1MZU A;  5EUA A;  1E4D A;  4X69 A;  2W3G A;  2W3E A;  4EEP A;  1HZO A;  3SH7 A;  3FV7 A;  2VV8 A;  3G2Z A;  3P01 A;  5A93 A;  3OPR A;  5HD5 A;  1TD5 A;  2UWX A;  3ISG A;  4S2L A;  3LCE A;  1SKO A;  2OLU A;  3CUE C;  5CX7 A;  2VGL M;  3MR0 A;  4UHU A;  2HP5 A;  3UB7 A;  4B93 A;  4O7D A;  3IHA A;  3D9Y A;  4UA7 A;  1I2W A;  2XR0 A;  4C3Q A;  1XA7 A;  1XJ3 A;  3JVV A;  3LR0 A;  3G32 A;  1SKO B;  1BSG A;  5KZH A;  3NJA A;  1MWR A;  1STZ A;  2XLN A;  3AGD A;  3EEH A;  1TS7 A;  4JKT A;  1PW8 A;  5EPH A;  3HJI A;  3KSI A;  5J8X A;  2OSU A;  4GOG A;  2XD1 A;  3Q82 A;  5I5L A;  3SH9 A;  5IS1 A;  4OLD A;  3FPV A;  4I38 A;  4CJN A;  2G2U A;  1TS6 A;  5G4Z A;  2J7V A;  4UQI S;  4EES A;  4K0X A;  3UB8 A;  1W8Q A;  4K08 A;  4YNR A;  1MY8 A;  2PHY A;  2UV0 E;  2Y2K A;  3SS3 A;  1Y54 A;  1SDN A;  4KG6 A;  5GLA A;  2BG1 A;  3GSG A;  3A0S A;  2JN7 A;  4Y3I A;  4F3L A;  2W27 A;  2Q9N A;  2Y2H A;  4ETX A;  5GHX A;  5KMW A;  4EBP A;  4EU0 A;  2HF6 A;  3RH8 B;  5E2F A;  2IWC A;  2V1B A;  5IHV A;  2P08 A;  1T1B A;  5IT5 A;  2YKH A;  3DTE A;  4F3L B;  2ZLY A;  4BLM A;  1D1J A;  1NXY A;  2AVX A;  4QWO A;  2WAE A;  1LSX A;  2QHK A;  3CUE A;  3TRC A;  4OON A;  5K5B A;  1KOU A;  5JYP A;  3NDE A;  2HP6 A;  3NCK A;  2Y2O A;  4PKY A;  4K0W A;  4BWI A;  1S4R A;  3D72 A;  3CJM A;  4R3J A;  5FI2 A;  5HDS A;  3H7W A;  4NET A;  3A3E A;  3VV4 A;  1CI8 A;  1IYQ A;  3DAV A;  4FUW A;  5GLC A;  3P98 A;  3EWK A;  2WGW A;  4R70 A;  4QY6 A;  4HES A;  2ZC7 A;  1FIL A;  1HTZ A;  3UPN A;  4GD8 A;  3H7W B;  4LLO B;  4GLQ A;  5EFW A;  4HOI A;  5FDH A;  2YKF A;  4KG2 A;  3L7H A;  3G4P A;  2ZM2 A;  3V5M A;  4MBH A;  2W3D A;  2EFX A;  3M6H A;  1BLH A;  2XFS A;  2WGW B;  3ZNT A;  4E3I A;  2C5W B;  3WRT A;  4U0T A;  1L3L A;  1M6K A;  3Q07 A;  2OV5 A;  2OWH A;  2PU2 A;  3L9K A;  1L0E A;  1JVJ A;  2ZMA A;  4DJ2 A;  2JKT M;  3A0V A;  2XGN A;  1PFL A;  1YLZ A;  1T1C A;  4AFI A;  1IKI A;  4KZ8 A;  3UE3 A;  2JHE A;  4A5R A;  3C8C A;  1LI0 A;  3BY9 A;  4UA9 A;  3MBZ A;  1GSW A;  3C2W A;  2ZMF A;  5CED A;  2HP9 A;  2P7J A;  3DTI A;  2FZ0 A;  5M1A A;  4HY8 A;  4XUZ A;  4HI4 A;  4HP4 A;  1GHM A;  3O86 A;  4LPZ A;  3VP3 A;  3W4P A;  3GEC A;  2Y91 A;  2EWW A;  2V9A A;  1EWZ A;  5DJU A;  3VE4 A;  3W4O A;  1MC0 A;  5TJJ A;  3IF6 A;  4JXG A;  4UQI M;  2BTF P;  3SW1 A;  2Z6D A;  3UE0 A;  2LB5 A;  2A3U A;  2GX5 A;  2ACG A;  2QYB A;  2OAQ 1;  1PYY A;  1XP4 A;  4O0P A;  1G68 A;  5FQK A;  3IT9 A;  1W63 Q;  4MN7 A;  3GV9 A;  3MZD A;  1F2K A;  1YLY A;  3CI6 A;  3CMZ A;  2A49 A;  3IF6 B;  2EXB A;  1JWV A;  1OTI A;  4DRT A;  1CF0 A;  2I9V A;  1OT6 A;  4DE2 A;  3ZGA B;  2EX9 A;  1TS8 A;  2V0U A;  2C6W B;  3IBR A;  2E8I A;  4R4R A;  1E25 A;  1HVB A;  3E4P A;  4IBX A;  4IVI A;  1Y28 A;  2K2N A;  2QZ6 A;  1K54 C;  3GTC A;  3V39 A;  4QU3 A;  4ARZ A;  4JF4 A;  4BEN A;  1ALQ A;  5J3W A;  4I39 A;  1ES5 A;  2XDM A;  5FQ9 A;  2Y2Q A;  3ZFZ A;  2Y55 A;  1O07 A;  1KGF A;  1MKI A;  4JXS A;  4RX3 A;  4DMZ A;  4O01 A;  4HJ6 A;  1K57 C;  2Y2P A;  5A8B A;  4ARZ B;  3V50 A;  3KSH A;  3T4Q A;  3G6O A;  4WF0 A;  3HRE A;  4KUK A;  4N9L A;  1WYB A;  1ESI A;  3JPU A;  4GDN A;  2M7V A;  1Z6F A;  1ERO A;  3VOY A;  1E3U D;  2O9C A;  2ZL1 B;  3OOV A;  3QP8 A;  4R23 A;  1W5D A;  3MMH A;  3GDI A;  2PU4 A;  3EQV A;  4MMN A;  1K56 A;  4FOF A;  3LIB A;  2DMW A;  3T4J A;  3BLM A;  1C3B A;  5FAS A;  1P0Z A;  1S0W A;  3CPT A;  4E3J A;  4LCL A;  2H5S A;  2V2F F;  2QPN A;  3HLG A;  4LV0 A;  2H0Y A;  4DE0 A;  4BBT A;  5EVE A;  2Y2N A;  4UAA A;  1MWT A;  3CPT B;  1LT0 A;  2XA7 M;  4MBF A;  5DJT A;  1KE3 A;  3N8R A;  1GSX A;  1ES3 A;  3NOP C;  4IHQ A;  4II7 A;  4G3W A;  2VKS A;  1FR1 A;  1K54 A;  2PBY A;  2ZQA A;  5KSC A;  1KDW A;  1OTB A;  2HDR A;  2XRO A;  2V20 A;  3CAX A;  1JWP A;  5DTK A;  4EV4 A;  3F1N A;  4RX2 A;  4S2P A;  1BUL A;  1K57 A;  5TGF A;  1ODV A;  4OQH A;  3MQ0 A;  1XFN A;  4HJ3 A;  5F69 A;  5FA7 A;  5CER A;  1K55 C;  2KX6 A;  5AVE A;  3ZQ5 A;  3VP0 A;  4EUV A;  4OQI A;  1G6A A;  3F1N B;  3VMA A;  5AQ7 A;  3OCN A;  3LY4 A;  1FR6 A;  3V67 A;  3M2J A;  3FYZ A;  3LEQ A;  4YOF A;  3LUQ A;  3LI9 A;  3M6B A;  4GS9 A;  4XXR A;  1UGU A;  2OOL A;  2JE5 A;  2PR6 A;  3KYZ A;  3S22 A;  4F94 A;  4ZRR A;  2OAP 1;  5FSR A;  1DP6 A;  4KZ7 A;  4GS9 B;  4WLA A;  1CQA A;  1FCN A;  3R7W B;  3HUM A;  1IYS A;  4WL9 A;  3BEC A;  1FCM A;  5J7E A;  3UPO A;  1ZG6 A;  3DWZ A;  4BD0 A;  2JBF A;  3OLO A;  1H8Y A;  4X25 A;  1J9M A;  4Y0O A;  1DJA A;  3VP1 A;  4PM5 A;  3A3I A;  2XRN A;  4G3V A;  2ZQD A;  3C4P A;  4KUO A;  3S7P A;  3UE6 A;  2O9A A;  1NYM A;  3ZNY A;  4QJG A;  2J80 A;  2WKR A;  5HFO A;  1L2S A;  2JKG A;  3ZDJ A;  1EI5 A;  1FCO A;  3DBA A;  1XJ6 A;  4OPQ A;  3MKF A;  4HP9 A;  2I72 A;  4ETZ A;  3B42 A;  4R3B A;  4BBU A;  1MXO A;  1XPB A;  1CK3 A;  3HVF A;  5KSH A;  2ZQ8 A;  4RA7 A;  4Y17 A;  4FSF A;  1KGE A;  3PBO A;  4S2M A;  1P9W A;  2V1Z A;  5DKL A;  3FKW A;  2VV6 A;  4LEN A;  3T1S A;  3SH8 A;  1S66 L;  3K3D A;  5GL9 A;  1BLS A;  3P7N A;  3LIA A;  5EVI C;  3NUL A;  1XKZ A;  1ONH A;  5F68 A;  3A3F A;  1L0G A;  3Q1F A;  1ZHH B;  4GB7 A;  1MWS A;  3T4S A;  1OJ5 A;  4LRY C;  5AQA A;  2XK1 A;  2R9W A;  5HZH A;  3UO9 A;  3HJK A;  3ITA A;  4ZJ2 A;  1UWP X;  4CLC A;  3VSL A;  1PW1 A;  3TJZ C;  1YLT A;  4QD4 A;  2PRF A;  1OTE A;  4Q8I A;  1RCJ A;  2J8Y A;  3SS5 A;  3NIA A;  3S7Q A;  1K25 A;  4CPK A;  2BLS A;  3MFX A;  2B18 A;  2GJ3 A;  3VOZ A;  3JVU A;  4GJ4 A;  1OTA A;  3PXP A;  4CLC B;  4NG2 A;  4ZJ1 A;  4D60 A;  2J3T D;  2ZJ9 A;  1HLU P;  4WZ5 A;  4JF5 A;  5DF9 A;  2K31 A;  3HLE A;  4S2O A;  5FI7 A;  1IFQ A;  4QB8 A;  1XFQ A;  2JKR M;  2W0N A;  2MJ6 A;  5MC7 A;  4B4X A;  2XH9 A;  4BQM A;  4I3A A;  4H8R A;  5A92 A;  3U4L P;  3IXD A;  3NOU C;  3NC8 A;  1TS0 A;  4N1X A;  4OQG A;  3W4Q A;  1XXM A;  2O99 A;  1GCE A;  4QPR A;  1IKG A;  4KG5 A;  3BEB A;  3KX0 X;  4S2I A;  1NYY A;  4KQO A;  3ZVW A;  4Q0H A;  3D4F A;  4GNU A;  5FQI A;  3OC2 A;  1Y4O A;  4N1H A;  4KQD A;  1J3W A;  2P9V A;  1PRQ A;  3VOL A;  5EVI A;  3UN7 A;  1GHP A;  1K4E A;  2VX8 A;  2FFY A;  3WS5 A;  2Z6C A;  3CHW P;  3VE3 A;  2ZM8 A;  4PM7 A;  4YIN A;  3VP2 A;  3CZD A;  1BZA A;  3ULF A;  2P9V B;  3UE1 A;  3KO6 A;  2VV7 A;  3PAG A;  2PAV P;  4EXO A;  5EVI B;  3TOI A;  1FSW A;  3ZG5 A;  2PD7 A;  3LID A;  3MS6 A;  4K91 A;  1H0M A;  2VLG A;  4RYE A;  3IQA A;  1KDS A;  3WWX A;  3T4L A;  2A24 A;  3G34 A;  2X71 A;  4C6Y A;  5C5K A;  1PIO A;  1U60 A;  4JGP A;  4CLC D;  1GSV A;  1BT5 A;  3LEZ A;  3E2K A;  3FKV A;  4BJP A;  4JF6 A;  3UB5 P;  5CTN A;  1NZU A;  3HLC A;  3TG9 A;  4EBN A;  2A24 B;  5CEB A;  2GZA A;  3Q81 A;  5I94 A;  2JKT I;  5EM1 A;  3T1Q B;  1YQS A;  5HL6 A;  1N9N A;  3BFC A;  3HL9 A;  1MPL A;  1VQQ A;  4I3I A;  5G18 A;  3GR2 A;  3RXX A;  4WEJ A;  5E2G A;  4LV3 A;  4M3K A;  4LCM A;  2PDR A;  4XUX A;  2VGK A;  2JC7 A;  3TSG A;  4OPZ A;  2ZBB A;  3T50 A;  2LB9 A;  5FEF A;  1ZG4 A;  2ZC5 B;  3HUN A;  4L9E A;  2ZD8 A;  5J4E A;  4HH2 A;  4B9O A;  1NJ4 A;  1AXB A;  3CG5 A;  3K2N A;  4WM9 A;  3UNW A;  2OLV A;  5EOE A;  5FAT A;  5HPI A;  3KSG A;  1ZKJ A;  2M7U A;  2EXA A;  3OPP A;  3LFV A;  5HX9 A;  1SZV A;  5HAR A;  4FTX A;  2H10 A;  4HBU A;  2QMI A;  5FEG A;  1XGI A;  2NUP C;  2L4R A;  3WS4 A;  3UDF A;  3DW0 A;  3O5Y A;  4OH0 A;  1W79 A;  3PTE A;  4ZDX A;  2K7S A;  4Y7P A;  2V8C A;  4L0L A;  2PD8 A;  4X1L A;  3E4Q A;  1S1Y A;  3QNC A;  3PR6 A;  3BYD A;  1ZC2 A;  2VEA A;  4JGR A;  4R6L A;  3EGX C;  2GNX A;  5F83 A;  3NOT C;  4GKU A;  4I5S A;  4HQA A;  4OOM A;  3C5A A;  2VA0 A;  1CEG A;  4KZ9 A;  2PBD P;  1T19 A;  1I5Q A;  3BY8 A;  4NXB A;  1RGZ A;  4FCF A;  1PZP A;  2EX6 A;  3BW6 A;  5EEC A;  2WKI A;  1T18 A;  2WKH A;  5EOO A;  4KZ5 A;  1XA1 A;  1DY6 A;  3ICY A;  3FPW A;  1OT9 A;  2O0Y A;  4LRZ E;  4PPR A;  3IX8 A;  2FH5 A;  4IED A;  2ZL1 A;  3F1O A;  3IXG A;  4DDY A;  1MWU A;  2GDN A;  4WYY A;  3VP4 A;  2WUQ A;  3NI9 A;  3IHB A;  4X56 A;  1YMX A;  2RL3 A;  4KZ6 A;  3JYI A;  3T4O A;  3GMW A;  3BFD A;  4BL2 A;  5M18 A;  3BQ8 A;  4FH2 A;  5G4Y A;  5DF7 A;  1PI4 A;  2EA9 A;  3F1O B;  2WKE A;  2M1C A;  4P85 A;  3TE8 A;  1BUE A;  4DE3 A;  1IYP A;  4HJ4 A;  4E3L A;  5HSQ A;  5FQM A;  4NKP A;  2WK0 A;  1LLB A;  1SCW A;  4S2J A;  3G30 A;  3MXS A;  3OZH A;  4FD8 A;  2PT7 A;  2CMN A;  3C7V A;  3GQZ A;  3W2Z A;  2QKP A;  4H6J B;  4ID4 A;  5E2H A;  1K38 A;  4NXF A;  5GHY A;  4EBL A;  1PZO A;  5FDS A;  3UDI A;  2Z2L B;  3G31 A;  5IU1 A;  4QHC A;  3BQA A;  5A90 A;  4LGW A;  2EFU A;  3HLB A;  2B5R A;  4EWF A;  3MKE A;  2H0T A;  2INW A;  4Y5F A;  1DJB A;  3T1X A;  1TF1 A;  2G7U A;  3T1R A;  1L0D A;  1YLW A;  4HNB A;  4YFM A;  4Y15 A;  4P87 A;  5CGX A;  4P6Z S;  5HAP A;  4MCW A;  4QY5 A;  1H5X A;  3PBT A;  3T12 B;  3CWF A;  3LYX A;  4R3A A;  4M4X A;  4GN2 A;  1DP9 A;  4U0X A;  3S7O A;  2Y2J A;  4O8G A;  3C38 A;  4X1M A;  4BBV A;  2ZM0 A;  3EEA A;  1BLP A;  3R7W A;  3QP6 A;  3BFF A;  4WEL A;  3SZT A;  1ERQ A;  1WA9 A;  3MF0 A;  3WS0 A;  5GHZ A;  4OKP A;  3TW8 A;  1MKM A;  4E04 A;  5FI6 A;  4WMC A;  1TVF A;  3FZC A;  1K56 D;  2X02 A;  2PYR A;  1MBL A;  1LHY A;  4KZ4 A;  2ZOI A;  4EQI A;  2B02 A;  4E6W A;  1KE4 A;  1VM1 A;  1VEU A;  4Q0I A;  4JXW A;  2L0W A;  3G2Y A;  4UA6 A;  3ZG8 B;  3OCL A;  4I3J A;  1N4O A;  4D2O A;  3PBR A;  4OPR A;  3I7J A;  5CHM A;  2PR5 A;  1YM1 A;  5CHJ A;  2XEP A;  3GVB A;  1VEU B;  3RTY A;  5CEC A;  3H82 A;  3ZCZ A;  2Z2M B;  4G3K A;  3QP5 A;  1VET B;  3OPL A;  1K6S A;  1N9B A;  3MZE A;  1Z09 A;  4FH4 A;  3LI8 A;  3N7W A;  2DRW A;  1JTD A;  1YPR A;  3H82 B;  2E8J A;  4Z9Q A;  5JYO A;  1ESU A;  1S4S A;  4X68 A;  3LIC A;  5AQB A;  1K55 A;  4PHT A;  3VFF A;  5F5Y A;  2ZQ9 A;  1RGY A;  5EV0 A;  1W63 M;  2Q0O A;  1W8Y A;  3H9W A;  1ZTU A;  1KGG A;  4BD1 A;  1I2S A;  4R0Q A;  4WUJ A;  3PHY A;  2XFT A;  3BM6 A;  3LR3 A;  3IWO A;  3A0R A;  5E43 A;  3EGD C;  4S2N C;  4MN6 A;  3O87 A;  4KQR A;  4Z1W A;  5FQJ A;  2R9X A;  3V3R A;  1OTD A;  1QMF A;  3LY3 A;  3PBN A;  5LBR A;  4E3O A;  1NWZ A;  4WMC D;  4JGQ A;  4DDS A;  2WKP A;  2JKR I;  1YSQ A;  1WYC A;  2XSS A;  3ZHH A;  4OP5 A;  4MBK A;  3UB6 A;  1XJ2 A;  1XJ4 A;  3M2K A;  4B88 A;  4P6Z M;  2J3W A;  3IF5 A;  3AGF A;  1LSV A;  3LIE A;  1OJG A;  5F82 A;  3O88 A;  1VB6 A;  4DF6 A;  1LL9 A;  1PNE A;  1PI5 A;  2L1M A;  3KYQ A;  4GDB A;  1DJC A;  1SKF A;  1H8Z A;  2W3F A;  1F9I A;  3AGE A;  4Y2F A;  4ME4 A;  3LIF A;  5GLD A;  1WE4 A;  2HDU A;  1T1A A;  1N9L A;  2V0W A;  2JCH A;  4L9G A;  1V9Y A;  3RXW A;  3QP1 A;  2O9B A;  3OPH A;  4JGO A;  2Q9M A;  1Q2P A;  2DNS A;  1L0F A;  4MEZ A;  3HLD A;  2EX8 A;  5CRF A;  1G5U A;  3LR5 A;  4C75 A;  2P04 A;  3LO7 A;  4Q0J A;  3IH8 A;  1PWD A;  4HEF A;  3KSF A;  2JKF A;  2KDK A;  2IWD A;  1LL8 A;  1PWC A;  3CIT A;  4BMW A;  4N9K A;  3P09 A;  1CEF A;  5FAP A;  1V9Z A;  4OOL A;  5TR7 A;  4S2N A;  4NEE D;  5DFY A;  5HWT A;  4E3K A;  4PM9 A;  2KLI A;  2ZOH A;  5HAQ A;  4GW9 A;  4X6T A;  3LGO A;  3QP4 A;  4P6B A;  4GCZ A;  1FSY A;  3HCY A;  4WEK A;  5HDD A;  5CGW A;  4U3T A;  1N9O A;  2W1R A;  2Y2I A;  4B4Z A;  2WGV A;  3R4K A;  3UME A;  1NY0 A;  2HJ9 C;  4JPM A;  4RVA A;  4DJ3 A;  1ACF A;  2X01 A;  1IYO A;  2CC1 A;  4IBR A;  4R1G A;  3MFD A;  3IBJ A;  3IX4 A;  4ZTK A;  2WKQ A;  3BLS A;  2HJE A;  4KEN B;  4MDZ A;  3IF6 C;  5DTT A;  1XX2 A;  4PKY G;  3NDG A;  3V3S A;  3CLO A;  2HZ5 A;  1CJF A;  4EEU A;  4LV2 A;  3FG8 A;  3FC7 A;  1LL5 A;  2EX2 A;  1YKD A;  1RP5 A;  3IXH A;  3BWL A;  3PBS A;  4KQQ A;  1GA0 A;  4HBT A;  1O7E A;  1K0K A;  4L9F A;  1ERM A;  1TDG A;  3LR4 A;  2WAF A;  3WS1 A;  4NK3 A;  2WGI A;  4IUH A;  3IH9 A;  4PAU A;  2VK3 A;  1X0O A;  3E2L A;  2QJ7 A;  4DKI A;  1FIK A;  1SHV A;  1OPX A;  1IEM A;  4KZ3 A;  2V1A A;  2QJ5 A;  4HHD A;  2VGJ A;  1HD8 A;  2Y79 A;  2VJW A;  5HL1 A;  2HDQ A;  3HUO A;  5EVI D;  1OME A;  3B47 A;  1P9R A;  2XA7 S;  1IEL A;  1AWI A;  1E3U A;  5HWV A;  2KOI A;  4ZAM A;  5CTM A;  4JBF A;  1XGJ A;  4HIA A;  1K4F A;  5HDC A;  3W8K A;  2WAD A;  5HD3 A;  3QP2 A;  4OVD A;  5FAQ A;  3IX3 A;  2ZQC A;  4JLF A;  1QME A;  1EW0 A;  1BLC A;  5TFQ A;  4HH3 A;  3BJN A;  4OP8 A;  3N8S A;  5M19 A;  4KZA A;  4KZB A;  4PMA A;  2J9P A;  3S4X A;  4LFU A;  3N4I A;  2ZMV A;  3HLF A;  2HPB A;  3WRZ A;  3UPP A;  1FOF A;  1YT4 A;  3SS4 A;  3ZVT A;  5DKK A;  4PM6 A;  1A0K A;  3MSH A;  5FL3 A;  3HBR A;  5L09 A;  4EW7 A;  4IVK A;  3ZYT A;  3E0Y A;  4DE1 A;  2V8F A;  1TEM A;  1NLY A;  3RFB A;  4EET B;  3BFG A;  5DTS A;  4NXE A;  2XD5 A;  1D06 A;  5CGS A;  4IUK A;  4R4S A;  4R38 A;  4BL3 A;  3ZG9 B;  4GHI A;  4OOY A;  3C30 A;  4DXB A;  2W1T A;  2EWV A;  3N6I A;  2NUT C;  2ZC6 B;  2PYP A;  1SDE A;  4WBG A;  3NEC A;  1ONG A;  5EVL A;  5EE8 A;  4YWZ A;  3D3O A;  2IA2 A;  3DTK A;  1CI9 A;  4WZ4 A;  4IJG A;  4GHI B;  1ES2 A;  5HAI A;  3K3C A;  2W1T B;  4H6J A;  4LRX C;  5AJG A;  5A91 A;  4Y0T A;  4E3M A;  2ZC3 B;  2W3H A;  1LI9 A;  5HPF A;  5KIZ A;  2P74 A;  1Q2Q A;  1D7E A;  1GA9 A;  2Y2L A;  4CLC E;  2RCX A;  1YMS A;  3F1P A;  1JNU A;  4WN5 A;  2IWB A;  3PYP A;  4RQ9 A;  1YLJ A;  2HDS A;  4GZB A;  5DVA A;  5HW3 A;  3DWK A;  5F6A A;  3S7N A;  3ITB A;  1P97 A;  3C4O A;  4OPY A;  4EQ1 A;  3VFH A;  3MQO A;  3NBL A;  3F1P B;  2WZX A;  3O3V A;  5F1G A;  3MJQ A;  1IOU A;  3UMD A;  5D3O A;  1NRF A;  4Y13 A;  3IS2 A;  3QHY A;  1JTG A;  5TBM A;  3S1Y A;  4DXC A;  5F1F A;  2J3T C;  4Y0U A;  3OBF A;  5FQQ A;  1PWG A;  3A3J A;  1NRJ A;  4JXV A;  3MXR A;  3MXQ A;  1H8M A;  1TDL A;  4E3N A;  3UY6 A;  5DF8 A;  2VGL S;  1BYW A;  3IS2 B;  2WZZ A;  5TBM B;  3E4O A;  2DCF A;  3IWQ A;  3SOI A;  3PAE A;  4DN0 A;  5L07 A;  2OWJ A;  4UEY A;  2D01 A;  3DTM A;  4MNR A;  5GLB A;  1KVM A;  1GHI A;  2R78 A;  3Q7V A;  4N92 A;  1FQG A;  1KE0 A;  1ES4 A;  3NY4 A;  3BFE A;  1S1Z A;  3B33 A;  2VZW A;  1JWZ A;  5EM0 A;  3IXB A;  3FWL A;  4P0M A;  4E6X A;  2XQZ A;  4CQH A;  1F5M A;  3B3X A;  3E98 A;  4XT2 A;  3Q7V B;  1H3Q A;  3G35 A;  3A3D A;  3RJU A;  3PBQ A;  3HLW A;  2Y8H A;  1BTL A;  1G28 A;  2ZC4 B;  4MN5 A;  2Y4A A;  2QWS A;  3N8L A;  4X53 A;  2G2W A;  3EOI A;  4XT2 B;  1VET A;  5CXW A;  2A2L A;  5L2F A;  5CHU A;  3GRJ A;  1M40 A;  3UB9 A;  1DRM A;  1YAX A;  2D02 A;  4ZBE A;  5E2E A;  4MLL A;  3WS2 A;  3BRM A;  4CLC C;  2HV1 A;  2BAS A;  1KVL A;  3ZG0 A;  4EUZ A;  3U2A A;  1S6R A;  2B95 A;  3EQU A;  5BOH A;  4ESP A;  5U47 A;  2Y2M A;  5FAO A;  1S67 L;  2Y2G A;  5L8M A;  3ZG7 B;  2Y59 A;  2H28 A;  3QNB A;  4GD6 A;  1F98 A;  2WYX A;  1NLZ A;  4OLG A;  4WZ5 C;  3MZF A;  4PM8 A;  1UWN X;  4S2K A;  4ZJ3 A;  4EER A;  3KYE A;  2HGV A;  1VHM A;  2XF3 A;  4NXG A;  1YSP A;  1YLP A;  1LSW A;  3MQQ A;  3T4K A;  1W7F A;  3IWI A;  4X55 A;  3UDX A;  3NHQ A;  1NZO A;  1G6O A;  3VSK A;  3Q7Z A;  4OQ0 A;  5HWW A;  5L10 A;  2ZQ7 A;  2FFF B;  4LV1 A;  5AQ9 A;  3T4T A; 
#chains in the Genus database with same CATH homology
 1K6R A;  3MFD A;  3C5A A;  1CEG A;  2J9O A;  4KZ9 A;  1I5Q A;  1RGZ A;  4RX2 A;  4FCF A;  1PZP A;  2EX6 A;  3C7U A;  5EEC A;  4S2P A;  4ZTK A;  5EUA A;  1BUL A;  1K57 A;  1E4D A;  5TGF A;  4X69 A;  2WKI A;  1HZO A;  5FA7 A;  4OQH A;  3SH7 A;  2WKH A;  5EOO A;  3BLS A;  1K55 C;  4KZ5 A;  5CER A;  3FV7 A;  4KEN B;  1XA1 A;  1DY6 A;  3G2Z A;  3IF6 C;  3VP0 A;  5A93 A;  3OPR A;  4OQI A;  5DTT A;  1XX2 A;  1G6A A;  3VMA A;  5AQ7 A;  3NDG A;  3OCN A;  2UWX A;  3V3S A;  3LY4 A;  1FR6 A;  3M2J A;  3FYZ A;  4PPR A;  3ISG A;  4S2L A;  3LCE A;  4LV2 A;  2OLU A;  4IED A;  3M6B A;  4XXR A;  1LL5 A;  2EX2 A;  3IXG A;  4UHU A;  2HP5 A;  4DDY A;  1MWU A;  2GDN A;  2JE5 A;  4WYY A;  2WUQ A;  1RP5 A;  4O7D A;  3NI9 A;  3VP4 A;  3IHB A;  3IHA A;  4X56 A;  1YMX A;  3IXH A;  2RL3 A;  4KZ6 A;  1I2W A;  4UA7 A;  3PBS A;  2XR0 A;  3JYI A;  4KQQ A;  3S22 A;  4C3Q A;  4F94 A;  1GA0 A;  3GMW A;  3BFD A;  1XA7 A;  4HBT A;  4BL2 A;  1O7E A;  5M18 A;  5FSR A;  4FH2 A;  4KZ7 A;  3G32 A;  1ERM A;  1TDG A;  5DF7 A;  1PI4 A;  1BSG A;  5KZH A;  2WAF A;  3WS1 A;  1MWR A;  1FCN A;  2WKE A;  3HUM A;  1IYS A;  4NK3 A;  2WGI A;  2XLN A;  3AGD A;  4P85 A;  3BEC A;  1FCM A;  3IH9 A;  4JKT A;  3UPO A;  1ZG6 A;  1PW8 A;  1BUE A;  3DWZ A;  3E2L A;  5EPH A;  4BD0 A;  4DKI A;  5J8X A;  2OSU A;  1SHV A;  4GOG A;  2JBF A;  2XD1 A;  4DE3 A;  1IEM A;  3Q82 A;  1H8Y A;  4KZ3 A;  3SH9 A;  1J9M A;  2VGJ A;  4Y0O A;  1DJA A;  4OLD A;  1IYP A;  3VP1 A;  1HD8 A;  4E3L A;  4PM5 A;  3A3I A;  4CJN A;  2G2U A;  5HL1 A;  2ZQD A;  3C4P A;  5FQM A;  2J7V A;  2WK0 A;  2HDQ A;  3HUO A;  1LLB A;  5EVI D;  1OME A;  1SCW A;  4QJG A;  1NYM A;  4K0X A;  1IEL A;  4S2J A;  3G30 A;  3MXS A;  3OZH A;  3ZNY A;  5HFO A;  4FD8 A;  1W8Q A;  3C7V A;  1E3U A;  1MY8 A;  1L2S A;  3GQZ A;  4ZAM A;  2Y2K A;  4ID4 A;  5E2H A;  3SS3 A;  1Y54 A;  5CTM A;  4JBF A;  1SDN A;  1K38 A;  1XGJ A;  4KG6 A;  5GHY A;  1PZO A;  5GLA A;  3ZDJ A;  4EBL A;  1EI5 A;  1K4F A;  1FCO A;  2BG1 A;  3GSG A;  3W8K A;  2WAD A;  3UDI A;  2Z2L B;  4OVD A;  3G31 A;  5FAQ A;  4OPQ A;  3MKF A;  2I72 A;  2ZQC A;  4QHC A;  2Q9N A;  2Y2H A;  4R3B A;  1MXO A;  1XPB A;  4JLF A;  1QME A;  5GHX A;  1CK3 A;  4EBP A;  5KMW A;  3HVF A;  5A90 A;  5E2F A;  2ZQ8 A;  5KSH A;  1BLC A;  4RA7 A;  5TFQ A;  2EFU A;  2IWC A;  3HLB A;  2B5R A;  5IHV A;  4FSF A;  4EWF A;  3MKE A;  1KGE A;  3PBO A;  2H0T A;  4OP8 A;  4S2M A;  1DJB A;  3N8S A;  2ZLY A;  5M19 A;  2V1Z A;  4KZA A;  4BLM A;  4KZB A;  4PMA A;  2J9P A;  3FKW A;  3S4X A;  1L0D A;  4LEN A;  1YLW A;  1NXY A;  3N4I A;  4YFM A;  2WAE A;  3HLF A;  4P87 A;  3SH8 A;  2HPB A;  5CGX A;  3WRZ A;  3UPP A;  5HAP A;  1FOF A;  1YT4 A;  4QY5 A;  3SS4 A;  5GL9 A;  3ZVT A;  1BLS A;  4OON A;  4PM6 A;  1H5X A;  5EVI C;  3NDE A;  5JYP A;  1XKZ A;  2HP6 A;  3NCK A;  2Y2O A;  3HBR A;  3PBT A;  1ONH A;  4K0W A;  4IVK A;  3A3F A;  1L0G A;  3Q1F A;  4GB7 A;  1MWS A;  4DE1 A;  1TEM A;  4GN2 A;  3CJM A;  4U0X A;  4R3J A;  3BFG A;  2Y2J A;  5DTS A;  5FI2 A;  2XD5 A;  5AQA A;  4NET A;  3A3E A;  5CGS A;  2XK1 A;  2R9W A;  3UO9 A;  1CI8 A;  3ITA A;  4ZJ2 A;  2ZM0 A;  4R4S A;  1IYQ A;  1BLP A;  4BL3 A;  5GLC A;  3BFF A;  4WEL A;  1ERQ A;  1PW1 A;  3P98 A;  3VSL A;  2WGW A;  3ZG9 B;  3WS0 A;  1YLT A;  4OOY A;  4QD4 A;  5GHZ A;  4OKP A;  4QY6 A;  4Q8I A;  1RCJ A;  2J8Y A;  3SS5 A;  4DXB A;  4HES A;  2ZC7 A;  5FI6 A;  4WMC A;  3N6I A;  2ZC6 B;  3NIA A;  1HTZ A;  1TVF A;  3UPN A;  3FZC A;  1SDE A;  4GD8 A;  1K56 D;  2X02 A;  4WBG A;  1MBL A;  1ONG A;  1K25 A;  1LHY A;  4CPK A;  4KZ4 A;  2BLS A;  5FDH A;  5EVL A;  4EQI A;  4KG2 A;  5EE8 A;  4E6W A;  3G4P A;  2ZM2 A;  3VOZ A;  3V5M A;  1KE4 A;  4MBH A;  1VM1 A;  1CI9 A;  2EFX A;  3M6H A;  1BLH A;  4WZ4 A;  4JXW A;  4ZJ1 A;  2XFS A;  2WGW B;  3G2Y A;  4UA6 A;  3ZG8 B;  2ZJ9 A;  1ES2 A;  3ZNT A;  4E3I A;  2C5W B;  4WZ5 A;  4JF5 A;  5DF9 A;  3HLE A;  3OCL A;  5HAI A;  3WRT A;  4S2O A;  1N4O A;  4U0T A;  5FI7 A;  1M6K A;  4QB8 A;  3Q07 A;  2OV5 A;  4D2O A;  3PBR A;  4OPR A;  2PU2 A;  3I7J A;  5CHM A;  5A91 A;  1L0E A;  4E3M A;  4Y0T A;  1YM1 A;  1JVJ A;  2ZMA A;  5CHJ A;  2XEP A;  2ZC3 B;  1LI9 A;  4B4X A;  2XH9 A;  3GVB A;  4BQM A;  2XGN A;  2P74 A;  1YLZ A;  1Q2Q A;  4H8R A;  5A92 A;  1IKI A;  1GA9 A;  2Y2L A;  5CEC A;  2RCX A;  3IXD A;  3NC8 A;  4KZ8 A;  4N1X A;  4OQG A;  3W4Q A;  3ZCZ A;  2Z2M B;  1XXM A;  3UE3 A;  1YMS A;  1GCE A;  2IWB A;  4A5R A;  3OPL A;  1K6S A;  1IKG A;  1N9B A;  4KG5 A;  1LI0 A;  1YLJ A;  2HDS A;  3BEB A;  4GZB A;  4S2I A;  5DVA A;  4UA9 A;  1NYY A;  5HW3 A;  4KQO A;  3MZE A;  4FH4 A;  3ZVW A;  3DWK A;  3MBZ A;  3N7W A;  3D4F A;  2DRW A;  3ITB A;  1JTD A;  4GNU A;  5FQI A;  5CED A;  3OC2 A;  4N1H A;  4Z9Q A;  2HP9 A;  3C4O A;  4OPY A;  3VFH A;  5M1A A;  3NBL A;  4XUZ A;  2P9V A;  5JYO A;  2WZX A;  3O3V A;  1ESU A;  5F1G A;  3VP3 A;  1GHM A;  3O86 A;  4X68 A;  3W4P A;  2Y91 A;  5EVI A;  5D3O A;  3UN7 A;  1NRF A;  1GHP A;  1K4E A;  1EWZ A;  5AQB A;  2FFY A;  3WS5 A;  1K55 A;  3QHY A;  1JTG A;  3W4O A;  3VFF A;  3S1Y A;  4DXC A;  5F1F A;  4Y0U A;  3IF6 A;  5FQQ A;  1PWG A;  2ZQ9 A;  3A3J A;  4JXG A;  1RGY A;  2ZM8 A;  4JXV A;  3MXR A;  4PM7 A;  4YIN A;  1W8Y A;  3CZD A;  3UE0 A;  2A3U A;  3VP2 A;  1TDL A;  1BZA A;  2P9V B;  3UE1 A;  1KGG A;  4BD1 A;  4E3N A;  3PAG A;  3UY6 A;  1I2S A;  5EVI B;  3TOI A;  4R0Q A;  1PYY A;  1FSW A;  2XFT A;  5DF8 A;  1XP4 A;  3BM6 A;  3ZG5 A;  1G68 A;  3IWO A;  3IT9 A;  5FQK A;  2WZZ A;  4K91 A;  3GV9 A;  3MZD A;  1YLY A;  4RYE A;  2DCF A;  5E43 A;  3CMZ A;  2A49 A;  3IF6 B;  2EXB A;  3IWQ A;  4S2N C;  3SOI A;  3IQA A;  1JWV A;  3PAE A;  3O87 A;  1KDS A;  3WWX A;  4DRT A;  3DTM A;  4MNR A;  5GLB A;  1KVM A;  4KQR A;  1GHI A;  3G34 A;  2X71 A;  4C6Y A;  3Q7V A;  4N92 A;  1FQG A;  1PIO A;  4DE2 A;  1U60 A;  3ZGA B;  2EX9 A;  5FQJ A;  1KE0 A;  2R9X A;  2C6W B;  3V3R A;  2E8I A;  4R4R A;  1ES4 A;  1E25 A;  3NY4 A;  1BT5 A;  1QMF A;  3LEZ A;  1HVB A;  3BFE A;  3LY3 A;  3E2K A;  3FKV A;  3PBN A;  4E3O A;  4IBX A;  4BJP A;  4IVI A;  4JF6 A;  4WMC D;  5CTN A;  1NZU A;  3HLC A;  3TG9 A;  2QZ6 A;  1JWZ A;  4DDS A;  1K54 C;  3GTC A;  3IXB A;  3FWL A;  4P0M A;  4QU3 A;  2XQZ A;  3V39 A;  4E6X A;  4EBN A;  5CEB A;  1WYC A;  4JF4 A;  3ZHH A;  3B3X A;  4BEN A;  1ALQ A;  3Q81 A;  4MBK A;  3Q7V B;  4OP5 A;  5I94 A;  1YQS A;  1ES5 A;  2XDM A;  3BFC A;  3G35 A;  5FQ9 A;  2Y2Q A;  3A3D A;  3RJU A;  3HL9 A;  1MPL A;  3ZFZ A;  3M2K A;  1VQQ A;  2Y55 A;  3PBQ A;  1O07 A;  4B88 A;  1KGF A;  5G18 A;  3GR2 A;  3RXX A;  1MKI A;  3IF5 A;  3AGF A;  4JXS A;  4WEJ A;  5E2G A;  4LV3 A;  3HLW A;  4RX3 A;  5F82 A;  1BTL A;  4M3K A;  3O88 A;  2ZC4 B;  1K57 C;  2Y2P A;  4DF6 A;  1LL9 A;  4LCM A;  3V50 A;  2Y4A A;  1PI5 A;  4XUX A;  2VGK A;  3N8L A;  3HRE A;  4GDB A;  2JC7 A;  4X53 A;  2G2W A;  3TSG A;  4OPZ A;  1DJC A;  4N9L A;  1WYB A;  1SKF A;  5CXW A;  1ESI A;  1H8Z A;  4GDN A;  5L2F A;  1Z6F A;  1ERO A;  3VOY A;  3AGE A;  5CHU A;  3GRJ A;  1ZG4 A;  1E3U D;  5GLD A;  1WE4 A;  2ZC5 B;  3HUN A;  4R23 A;  1M40 A;  2HDU A;  1W5D A;  2ZD8 A;  2JCH A;  2PU4 A;  3EQV A;  1NJ4 A;  1AXB A;  4ZBE A;  5E2E A;  3RXW A;  1K56 A;  4MLL A;  3WS2 A;  3CG5 A;  3BRM A;  3OPH A;  2Q9M A;  4WM9 A;  3UNW A;  1Q2P A;  1KVL A;  2DNS A;  2OLV A;  5EOE A;  5FAT A;  3ZG0 A;  4EUZ A;  1S6R A;  3EQU A;  5BOH A;  1L0F A;  4MEZ A;  3HLD A;  5U47 A;  2EX8 A;  5CRF A;  2Y2M A;  3BLM A;  1ZKJ A;  4C75 A;  3LO7 A;  1C3B A;  3IH8 A;  1PWD A;  2EXA A;  3OPP A;  4HEF A;  5FAO A;  5FAS A;  5HX9 A;  1S0W A;  5HAR A;  2Y2G A;  4E3J A;  2H10 A;  2IWD A;  4HBU A;  4LCL A;  2H5S A;  3ZG7 B;  2QMI A;  2Y59 A;  1PWC A;  3QNB A;  2V2F F;  4GD6 A;  1XGI A;  2QPN A;  3HLG A;  4N9K A;  2WYX A;  4LV0 A;  4OLG A;  2H0Y A;  3P09 A;  1CEF A;  4WZ5 C;  5FAP A;  3MZF A;  3WS4 A;  4PM8 A;  4DE0 A;  3UDF A;  4S2K A;  4ZJ3 A;  3DW0 A;  4OOL A;  5TR7 A;  4S2N A;  2Y2N A;  4UAA A;  4OH0 A;  4E3K A;  1W79 A;  1MWT A;  2XF3 A;  3PTE A;  4ZDX A;  4PM9 A;  1YLP A;  5HAQ A;  4X6T A;  4P6B A;  4Y7P A;  4MBF A;  1KE3 A;  3N8R A;  1FSY A;  1W7F A;  4L0L A;  1ES3 A;  4WEK A;  3IWI A;  5CGW A;  4X55 A;  4U3T A;  3UDX A;  3QNC A;  3BYD A;  1NZO A;  2Y2I A;  1FR1 A;  1K54 A;  2WGV A;  1ZC2 A;  3VSK A;  4B4Z A;  3Q7Z A;  2PBY A;  1NY0 A;  2ZQA A;  4JPM A;  4OQ0 A;  4RVA A;  5KSC A;  1KDW A;  2HDR A;  5F83 A;  2X01 A;  4GKU A;  2ZQ7 A;  1IYO A;  2FFF B;  2V20 A;  2CC1 A;  4LV1 A;  1JWP A;  5DTK A;  5AQ9 A;  4EV4 A;  4IBR A;  4R1G A;  4OOM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...