3E2KA

Crystal structure of the kpc-2 beta-lactamase/beta-lactamase inhibitor protein (blip)
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
261
structure length
261
Chain Sequence
AEPFAKLEQDFGGSIGVYAMDTGSGATVSYRAEERFPLCSSFKGFLAAAVLARSQQQAGLLDTPIRYGKNALVPWSPISEKYLTTGMTVAELSAAAVQYSDNAAANLLLKELGGPAGLTAFMRSIGDTTFRLDRWELELNSAIPSDARDTSSPRAVTESLQKLTLGSALAAPQRQQFVDWLKGNTTGNHRIRAAVPADWAVGDKTGTCGVYGTANDYAVVWPTGRAPIVLAVYTRAPNKDDKHSEAVIAAAARLALEGLGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Carbapenemase
publication title Structural and biochemical characterization of the interaction between KPC-2 beta-lactamase and beta-lactamase inhibitor protein
pubmed doi rcsb
source organism Klebsiella pneumoniae
total genus 92
structure length 261
sequence length 261
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2008-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3e2kA00
4ZJ2A 1BSGA 3NDEA 3ZVWA 1BZAA 2WGWA 1TDLA 3BECA 3IXGA 4KENB 4WMCD 4BL3A 4CJNA 3V3RA 5AQBA 1ZG6A 1GHIA 3FV7A 1E25A 1W8QA 1PI5A 1YLPA 3IXDA 5FDHA 4QHCA 4HBUA 3V5MA 5M1AA 2IWCA 5CGSA 2EFUA 2Z2MB 4R0QA 1YLJA 1C3BA 5KSCA 1L2SA 5CECA 1YLWA 1KDWA 4GDBA 1RP5A 1XGJA 3A3FA 5CTMA 1BTLA 4C75A 4DE0A 4E3JA 1NY0A 4FD8A 3BM6A 3GV9A 4Y0OA 1J9MA 5F83A 1L0GA 1FCMA 2EX2A 2G2UA 4P87A 3PBSA 2XLNA 5KSHA 2J7VA 1L0DA 1MY8A 1U60A 1M6KA 2V1ZA 3MZDA 2Y2LA 3ZG7B 3ZFZA 5TFQA 5GHZA 2WAFA 4X6TA 3A3EA 3S4XA 4XUZA 4ID4A 4OPZA 1IKIA 3UDXA 1Q2PA 4GD8A 3M6BA 1ERMA 1RGZA 2Y2IA 4GDNA 4B4XA 3WRTA 4O7DA 4X55A 5I94A 4DE3A 1SHVA 4HESA 5L2FA 1VM1A 4RX3A 5CHMA 1BT5A 3CMZA 4FH4A 4E3NA 5DF8A 2Q9MA 3ZDJA 3HLCA 1YM1A 2XFSA 2XD1A 2CC1A 4JBFA 2Y2NA 1BLHA 1JWPA 2HP5A 2ZD8A 2ZLYA 3BLSA 5HAIA 5FI7A 1FSYA 1ES3A 2IWDA 1K38A 1NRFA 3CJMA 4MBHA 4OONA 2A3UA 2X02A 1GHPA 1K57C 4N1HA 4EBPA 4S2KA 1GA9A 5EE8A 1CEGA 2C6WB 4BL2A 2DNSA 4RA7A 3A3IA 1YLZA 2HDRA 1LI9A 3BEBA 4BD0A 1XPBA 5EVIC 1K4FA 2Y2GA 1K55C 3WWXA 1O07A 2EX9A 4IVKA 3O86A 2IWBA 3BYDA 5DTSA 2H0YA 3WS5A 3RXXA 1I2SA 3S22A 2XK1A 4PM5A 3O87A 1I5QA 1ONHA 4Z9QA 5HX9A 3WS0A 1NXYA 2VGJA 4R4RA 3A3JA 4GB7A 1QMEA 4JLFA 4B88A 4IVIA 1KGFA 2H0TA 1S6RA 2EXAA 3WRZA 1YMSA 1YLTA 4YINA 3VP1A 1N9BA 2JC7A 4K91A 1W79A 2R9WA 2OV5A 1K25A 1DJCA 5GLAA 2V2FF 3Q7VA 4HBTA 4EQIA 4MEZA 5KZHA 1MWTA 3UNWA 2ZC4B 1XGIA 4NK3A 2WGVA 4OKPA 3OPLA 1FCOA 4BLMA 4DE1A 3E2LA 4JF4A 4BENA 4DDYA 2WUQA 3ZNTA 1WYBA 2HDSA 3G30A 3N8RA 3NDGA 4KZ9A 3FKVA 3UPPA 3HLDA 1FQGA 1LL5A 4LV2A 3ITAA 4KQRA 4WBGA 3SH7A 1WYCA 2C5WB 2EX8A 3BFDA 2Y2HA 1HTZA 1AXBA 1MWRA 2WK0A 4K0XA 1K6SA 3AGDA 4QU3A 2OLUA 4U3TA 1I2WA 2ZQ9A 1FOFA 2PU2A 2XD5A 4Y0TA 3ZG9B 4WZ5A 3FKWA 1H8YA 5EVIA 2I72A 1K55A 1KGGA 3IXBA 3Q7ZA 2Y2JA 5FAQA 2HDUA 2QZ6A 4MNRA 1KE4A 4OPRA 3MXSA 4NETA 1XP4A 5EUAA 3ZG0A 4D2OA 5J8XA 3G2ZA 4U0TA 4UA9A 3AGFA 4GZBA 4LV3A 2WKEA 1W7FA 5GHXA 3VSLA 2E8IA 3UDIA 3C7UA 1XXMA 3G32A 2ZM8A 4OPYA 2ZM2A 1JVJA 4JKTA 2JE5A 3ZNYA 3NCKA 1H8ZA 3EQUA 4KG6A 4KZ4A 3PTEA 3BRMA 2WYXA 3SS4A 4S2PA 4E3MA 3OZHA 2XF3A 3OPPA 1MPLA 2UWXA 3PBOA 4JXSA 1KDSA 1ESIA 4DE2A 3FWLA 2XGNA 5M19A 5FAPA 5FQJA 1ES4A 5CTNA 3DW0A 1MWSA 3OPRA 1E3UA 4KZ7A 4N92A 4A5RA 1PWGA 5FI6A 4BD1A 2Y91A 3BFFA 4RVAA 2WGWB 1WE4A 3PAGA 1OMEA 5HFOA 1NYMA 4JXVA 3MKFA 3C4OA 4MBFA 3IWIA 4S2MA 1NYYA 1ZG4A 4QY6A 3M2KA 2ZM0A 4S2OA 5U47A 3G4PA 4RX2A 5DVAA 3DTMA 4E6WA 1EWZA 2BG1A 3V3SA 4JPMA 1S0WA 1CI9A 4PM8A 3WS4A 3CG5A 1XX2A 4QB8A 5HAQA 3BFEA 4ZAMA 3IF6B 1PZPA 1K56A 2JBFA 1PWDA 2R9XA 3SOIA 4S2JA 4S2LA 5JYPA 3GR2A 2DRWA 1PYYA 4F94A 3OCNA 4L0LA 3VP4A 4B4ZA 3MXRA 2HP6A 1Q2QA 5KMWA 1K6RA 4UA7A 4OQHA 3G35A 4WZ4A 4BJPA 3O88A 4EV4A 2Y2PA 5FI2A 3IF5A 1FCNA 3MZEA 4OQIA 5FQMA 4N9LA 1JTGA 2P74A 2XFTA 3ZVTA 4E3KA 3VSKA 3HUMA 4WEJA 5F1FA 2WAEA 1FR6A 2VGKA 3SH8A 1LLBA 4WMCA 3GQZA 4WZ5C 3TOIA 5DF9A 1H5XA 1W5DA 4IBXA 4OOMA 4JXWA 4R4SA 3VP2A 4XUXA 5A90A 1KVMA 1XA1A 3W8KA 3N4IA 1O7EA 3N7WA 5F1GA 1RCJA 3UY6A 4CPKA 5EOOA 4Y0UA 5GLBA 4DXBA 2V20A 1JWZA 4S2NC 1L0FA 1HZOA 3UE3A 4EWFA 2Y2QA 4C3QA 3ISGA 3N6IA 1K54C 2A49A 3NY4A 2BLSA 5FA7A 3ZG5A 1LHYA 4GOGA 1KE0A 2ZJ9A 4UHUA 5FSRA 1KE3A 2WADA 4R1GA 5HAPA 3I7JA 5IHVA 5E43A 4E3LA 3MZFA 1IYOA 1G6AA 4OVDA 2WZZA 3IWOA 5GHYA 3MFDA 1MWUA 1MXOA 3HBRA 3IWQA 3ZGAB 5HL1A 1BULA 2Y59A 2H10A 3Q07A 5F82A 5DTTA 1BLSA 2P9VA 1VQQA 4Q8IA 3C4PA 1IKGA 1G68A 2WKHA 4JF5A 3IH8A 4XXRA 1W8YA 4OLGA 3DWKA 3IQAA 5FASA 5TGFA 3Q7VB 3UDFA 3CZDA 5JYOA 4PM6A 4MLLA 5AQ7A 5CERA 4YFMA 4RYEA 2ZQ7A 4P85A 1IEMA 1SDEA 3ZG8B 4KZ6A 5HW3A 3UE1A 3HLEA 3OCLA 3A3DA 3D4FA 5BOHA 2ZQAA 2PU4A 3PBQA 3W4OA 2Y55A 4P0MA 1HVBA 1BLCA 4FCFA 4GN2A 5FATA 1EI5A 4IEDA 4DF6A 5CHUA 3UE0A 3JYIA 2QPNA 3GMWA 4R23A 3W4QA 4S2NA 3TG9A 2JCHA 1Z6FA 2J9PA 3PBNA 4QD4A 4ZDXA 3N8SA 2FFFB 1K54A 5EOEA 5A92A 4E6XA 4PMAA 2ZQCA 4HEFA 3IH9A 5EVIB 2PBYA 1NZOA 2ZC6B 4ZTKA 3LO7A 5FAOA 3SH9A 4C6YA 5HARA 3W4PA 3PAEA 1ALQA 3C5AA 4QY5A 2XDMA 4UAAA 1XKZA 4OLDA 2ZC3B 2XEPA 3O3VA 1NZUA 4N9KA 2Y2MA 1L0EA 3HVFA 3IHBA 4FH2A 4N1XA 4U0XA 2RL3A 1M40A 3GTCA 3HLFA 3QNBA 3HREA 3HLGA 4K0WA 5FQQA 2ZQ8A 2G2WA 2HP9A 1ONGA 1YT4A 4OQ0A 4KZ8A 3LEZA 5D3OA 4EBNA 2ZMAA 1LL9A 3B3XA 5AQ9A 3GVBA 1BUEA 3AGEA 3IF6A 4GNUA 3G2YA 4Y7PA 4WM9A 4FSFA 5CEBA 1DJBA 4KZ3A 3WS2A 4X53A 3ZHHA 1JWVA 1PI4A 1DY6A 5CEDA 5FQIA 2RCXA 1LI0A 5FQKA 3RXWA 4OH0A 3IHAA 2OLVA 4LV1A 3Q81A 4OOLA 1TDGA 2EFXA 3OC2A 2WGIA 2Q9NA 3MBZA 2FFYA 1K4EA 3NC8A 3IT9A 4KG5A 4LENA 2WKIA 3P98A 3Q82A 3VFFA 3VMAA 1MKIA 1YMXA 2Y2KA 3BFGA 4WELA 1FSWA 4LCMA 5CGXA 4BQMA 1FR1A 1MBLA 3V39A 3M2JA 1PIOA 4OOYA 1IYPA 3HUNA 5GLCA 5A91A 3P09A 2X01A 2EX6A 1PW8A 2ZC5B 1IYQA 4GD6A 2OSUA 3VOZA 1CI8A 3IXHA 4EUZA 1GA0A 2ZC7A 1NJ4A 5EVID 1ES2A 1HD8A 4X56A 5G18A 1IELA 5E2GA 3FYZA 4JXGA 3SS3A 5A93A 3WS1A 5GLDA 3ITBA 5DTKA 2H5SA 1ERQA 3HUOA 4PPRA 2ZQDA 4QJGA 1QMFA 2Y2OA 1PW1A 3C7VA 4OP5A 2Y4AA 4DDSA 4MBKA 3OPHA 1YLYA 4P6BA 4LV0A 3EQVA 3NBLA 2EXBA 3RJUA 4ZJ3A 1ZC2A 1N4OA 4ZJ1A 2Z2LB 3MKEA 3G34A 5TR7A 3UO9A 4EBLA 3E2KA 4S2IA 4UA6A 1BLPA 3G31A 1TVFA 4IBRA 4GKUA 5EPHA 4X69A 3VP0A 3VP3A 4M3KA 3GSGA 3LY4A 2B5RA 3VOYA 2DCFA 3PBRA 3TSGA 1XA7A 5CRFA 1JTDA 3BFCA 3V50A 2HDQA 3M6HA 3NIAA 1GHMA 1E3UD 1EROA 4H8RA 4KZBA 4WEKA 5GL9A 1DJAA 3HLBA 4KQQA 4PM7A 3N8LA 1TEMA 4E3IA 5M18A 2XH9A 4LCLA 3QHYA 2XR0A 5EVLA 1GCEA 1SDNA 5E2EA 3S1YA 1ESUA 1RGYA 3IF6C 4KZAA 4X68A 5CXWA 3UPOA 1SKFA 3LCEA 1ES5A 2QMIA 3HL9A 3FZCA 3NI9A 4R3JA 5E2HA 3ZCZA 1IYSA 2P9VB 3LY3A 4E3OA 4OPQA 5DF7A 1KGEA 4DKIA 2J9OA 5FQ9A 3UN7A 1KVLA 1ZKJA 4KZ5A 2XQZA 4DRTA 4KG2A 1K57A 1K56D 2X71A 2GDNA 3GRJA 4ZBEA 1SCWA 3UPNA 4JF6A 1E4DA 3DWZA 4DXCA 5E2FA 3BLMA 5CHJA 1Y54A 3QNCA 4OQGA 5EECA 5AQAA 3VFHA 4PM9A 1PZOA 1YQSA 2HPBA 2J8YA 3HLWA 3PBTA 1CK3A 4R3BA 1PWCA 3SS5A 2WZXA 4KQOA 1CEFA 5CGWA 4WYYA 4OP8A 3Q1FA
chains in the Genus database with same CATH superfamily
2YKFA 1LSXA 3NDEA 2ZMFA 1Y28A 2HJEA 5AVEA 4BL3A 3V3RA 4B93A 1GHIA 3FV7A 1E25A 1DP9A 1W8QA 1YLPA 4QHCA 3T1QB 2IWCA 2Z2MB 1YLJA 1UGUA 1YLWA 5CTMA 4DE0A 2PYPA 1V9YA 4I3JA 2G2UA 2XLNA 5KSHA 2J7VA 5TFQA 5GHZA 1S1ZA 4OPZA 1IKIA 3UDXA 1Q2PA 4GD8A 4KUKA 4GDNA 1KOUA 4HOIA 4DE3A 3C38A 4RX3A 1BT5A 1Y4OA 3CMZA 1F98A 4FH4A 4HIAA 2XA7S 4LRXC 2JKTI 1H0MA 4Y13A 1CF0A 2GZAA 3BLSA 5FI7A 1FSYA 5L10A 1OT6A 1K38A 3CJMA 1TD5A 3LI8A 2A3UA 3UMEA 4EERA 4BBTA 3WWXA 5EVIC 2O0YA 2BASA 4LGWA 2I9VA 3RXXA 5FL3A 3S22A 3T4OA 5G4YA 4M4XA 4GW9A 4R4RA 3HJKA 4JLFA 4AFIA 3RFBA 2CMNA 1YMSA 3H7WB 2R9WA 4UQIM 3Q7VA 4EQIA 4MEZA 3UNWA 2ZC4B 4GLQA 1V9ZA 3CAXA 3NDGA 3FKVA 3HLDA 1LL5A 2Y2HA 5L8MA 2WK0A 3G6OA 2OLUA 3EEAA 4U3TA 4ETXA 4Y0TA 1FIKA 3FKWA 3NJAA 1K55A 1KGGA 3B42A 3IXBA 3T12B 1KE4A 3MXSA 3G2ZA 4JGPA 3AGFA 3LR3A 5GHXA 1W7FA 2E8IA 3C7UA 2INWA 3IBRA 2JE5A 3ZNYA 4KG6A 1H8ZA 3PTEA 2WYXA 5EM1A 4JXSA 1ESIA 4DE2A 5M19A 1ES4A 1E3UA 3LIDA 3SW1A 1XFNA 5HFOA 5C5KA 2M7VA 4S2MA 1NYYA 4O01A 2ZM0A 5U47A 2EWWA 4JGQA 3DTMA 2M7UA 3V3SA 4JPMA 4EUVA 4PKYG 5HAQA 1WA9A 3IF6B 1PZPA 5F6AA 3DTKA 2DRWA 1PYYA 4I5SA 4EW7A 3MXRA 2VEAA 3K3DA 1PRQA 4E3KA 5J7EA 3HUMA 5F1FA 3CITA 1FR6A 4WMCA 5DF9A 1W5DA 4OOMA 4JXWA 3VP2A 4CQHA 1KVMA 1ACFA 3W8KA 3T4LA 4GJ4A 5EOOA 4Y0UA 3EGDC 2WKRA 3T1XA 1L0FA 3MQOA 2Y2QA 3N6IA 1K54C 5DKKA 4GOGA 1KE0A 2ZJ9A 2HF6A 1STZA 1T1BA 5HL6A 3CPTA 5EFWA 1G5UA 2WZZA 5GHYA 2Y59A 1IKGA 4XXRA 3Q7VB 2PR5A 3ICYA 4YFMA 4RYEA 2ZQ7A 1LL8A 3HLEA 3OCLA 4WUJA 2PU4A 4P0MA 1HVBA 3BQ8A 4ZRRA 1D06A 3UE0A 3JYIA 3GMWA 3W4QA 1N9LA 2V1AA 2JCHA 3UB8A 5EOEA 5CX7A 1MZUA 3VV4A 1FILA 2ZC6B 4ZTKA 3LO7A 4DMZA 4C6YA 3W4PA 3UB7A 2XEPA 3O3VA 1NZUA 2Y2MA 4P6ZM 4U0XA 4HJ6A 3MQ0A 1X0OA 3HLFA 3HLGA 3T4SA 2HP9A 4DN0A 3HJIA 5D3OA 2QJ7A 3B3XA 4BWIA 5AQ9A 4QPRA 4HNBA 3GVBA 3T4TA 3IS2B 3QP6A 4GNUA 4Y7PA 3S7PA 5HD3A 1OTBA 5IT5A 1AWIA 1JWVA 1PI4A 2J3WA 5CEDA 1LI0A 4L9FA 2ZMVA 3E4QA 3OC2A 4FUWA 3MBZA 2E8JA 2WKIA 3P98A 3VFFA 3VMAA 3QP2A 1FSWA 3KSGA 4YOFA 3V39A 1PIOA 2PDRA 3KSFA 5GLCA 3P09A 2ZC5B 4GD6A 4QWOA 1CI8A 2ZC7A 1NJ4A 5G18A 4JXGA 5GLDA 2LB5A 2H5SA 2VKSA 1ERQA 3HUOA 4R6LA 5K5BA 3H82A 1QMFA 1PW1A 3C7VA 4DDSA 1LSWA 1YLYA 3EQVA 3UO9A 3E2KA 1BLPA 3G31A 2VV7A 4X69A 3VP0A 4M3KA 3PBRA 3TSGA 1XA7A 3BFCA 3M6HA 1DJAA 3HLBA 4YWZA 3L9KA 2P08A 3CUEC 1T1CA 5M18A 3QHYA 5EVLA 1H3QA 3CPTB 1RGYA 4X68A 3GDIA 3T4JA 3UPOA 1SKFA 3FZCA 3NI9A 1IYSA 4E3OA 3E0YA 3LIBA 1KVLA 4KZ5A 1YSQA 5F69A 3TW8A 3UPNA 2NUTC 2VK3A 4HJ4A 4DJ2A 5AQAA 4PM9A 4R3BA 3PBTA 1CK3A 1T19A 2WZXA 4WYYA 4OP8A 2V0UA 3Q1FA 5LBRA 4ZJ2A 1BSGA 3ZVWA 5HWWA 3IXGA 5AQBA 1ZG6A 3IXDA 3V5MA 1Z09A 5CGSA 4R0QA 5CECA 3KX0X 3GV9A 4D60A 1MY8A 3ZG7B 2Y2LA 2WAFA 4X6TA 4XUZA 4ID4A 4L9EA 2GJ3A 2VZWA 5TBMB 4B4XA 4O7DA 3A0RA 5F5YA 4E3NA 1SKOA 2Q9MA 1EW0A 4DJ3A 5HSQA 5HDCA 2JKFA 2ZD8A 1NRFA 4OONA 4JGRA 5DJUA 5TJJA 3LI9A 4S2KA 1CEGA 2C6WB 4RA7A 2HDRA 1LI9A 3BEBA 4BD0A 1P97A 4EETB 1O07A 2QJ5A 3WS5A 2PYRA 2XRNA 4Z9QA 1NXYA 1T18A 2EXAA 4K91A 5GLAA 3H82B 5KZHA 4BMWA 1XGIA 2V0WA 3L7HA 4I39A 4BLMA 5KIZA 3MXQA 2HDSA 2J3TC 4KZ9A 1FQGA 4I38A 2XSSA 2EX8A 1HTZA 1K6SA 4QU3A 4LRZE 2W27A 1I2WA 1S4RA 2ZQ9A 1GSWA 1MKMA 2PU2A 4MN5A 2QZ6A 4U0TA 4K08A 4LV3A 2WKEA 4WLAA 4I3AA 4OPYA 3NULA 4KZ4A 4S2PA 2XF3A 3OPPA 1MPLA 2OAQ1 4MDZA 1D7EA 4GS9B 1OTIA 2XGNA 3A0SA 5FAPA 1P9RA 3C30A 5CTNA 3OPRA 4KZ7A 3LIFA 4N92A 4A5RA 1LT0A 1PWGA 2Y91A 1OMEA 3LIAA 4JXVA 4LFUA 4CLCD 4R38A 4RX2A 5DVAA 4E6WA 1XJ2A 1OTDA 3QP4A 4EEUA 1K56A 2R9XA 4S2LA 5JYPA 2Z6CA 2HJ9C 3GR2A 3VP4A 4B4ZA 2VJWA 2HP6A 1Q2QA 3FPWA 4UA7A 3G35A 3O88A 2Y2PA 1YKDA 2V9AA 3MZEA 5FQMA 3ZVTA 1JTGA 2XFTA 4I3IA 3S7NA 2PT7A 2WAEA 2VGKA 1SKOB 3TOIA 4R4SA 1YPRA 3N4IA 4HP4A 5F1GA 5HPFA 1RCJA 4DXBA 1F2KA 4HY8A 3MMHA 3LGOA 4S2NC 4BBUA 3KSIA 1HZOA 2VA0A 2L4RA 3ISGA 1LHYA 4CLCB 3TRCA 1K0KA 2WADA 4R1GA 5HAPA 2GNXA 3V67A 3I7JA 2OOLA 5IHVA 4E3LA 3KO6A 3D9YA 1MWUA 1MXOA 1BULA 3Q07A 1S66L 5DTTA 4Y17A 3C4PA 3OBFA 2WKHA 1W8YA 4OLGA 3IQAA 5FASA 2O9BA 3UDFA 4PM6A 3R7WA 5AQ7A 4R3AA 2VX8A 4P85A 4KZ6A 3JPUA 3VE3A 3RTYA 2ZQAA 4P6ZS 3H9WA 3PBQA 4Y2FA 3T50A 3W4OA 2Y55A 1BLCA 5FATA 4IEDA 1LSVA 4R23A 4BBVA 4ZDXA 2K7SA 2FFFB 3BY9A 4E6XA 3VE4A 2ZQCA 2PBYA 3SH9A 2W1TA 3C5AA 1XKZA 1HLUP 4N9KA 1XFQA 4Q0HA 1M40A 3LR4A 2O99A 1ODVA 3TE8A 3QNBA 4K0WA 5FQQA 1ONGA 4OQ0A 3LEZA 2ZMAA 5DFXA 3AGEA 2L0WA 4NXEA 3UB9A 5CEBA 1DJBA 4KZ3A 3ZHHA 2R78A 5FQKA 3RXWA 3IHAA 4LV1A 1TDGA 4ME4A 1D1JA 1K4EA 3NC8A 3IT9A 4LENA 3Q82A 1MKIA 1YMXA 2Y2KA 2A24A 4BQMA 4LRYC 2X01A 1PW8A 2O9AA 5DFYA 1ES2A 1HD8A 4X56A 1IELA 4GHIA 2QWSA 3EGXC 2ZQDA 4ETZA 4OP5A 4MBKA 3OPHA 3NBLA 4PHTA 3RJUA 1GSVA 3LICA 3G34A 4EBLA 4S2IA 4UA6A 4IBRA 3VP3A 2AVXA 3VOYA 2DCFA 2JHEA 1JTDA 3V50A 2QKPA 4H8RA 1E3UD 4KZBA 5DJTA 2JKRI 3N8LA 1TEMA 4HJ3A 2XH9A 4X25A 4ESPA 1SDNA 3S1YA 2ZL1A 2Y8HA 3IF6C 5CXWA 4MN7A 5F68A 5E2HA 3ZCZA 2D02A 5L09A 5DF7A 1KGEA 3IBJA 1NLYA 3EOIA 3DTIA 4DRTA 2X71A 1YSPA 4JF6A 3R7WB 3DWZA 4DXCA 5E2FA 1PFLA 2HPBA 3SS5A 4KQOA 5CGWA 1NLZA 1BZAA 2PBDP 3BECA 4KENB 4WMCD 5FDHA 4HBUA 1C3BA 5KSCA 1L2SA 2OAP1 1RP5A 3A3FA 4C75A 1BTLA 4E3JA 2W1TB 4FD8A 1FCMA 3LEQA 2EX2A 3B33A 1L0DA 3ZFZA 5IS1A 2JKTM 1IOUA 4JGOA 1W63M 1NWZA 2W3HA 3M6BA 1ERMA 1RGZA 2Y2IA 1DP8A 5I94A 4NG2A 1SHVA 4HESA 5L2FA 5CHMA 3UB6A 3HLCA 1YM1A 1DRMA 5HD5A 2XFSA 2XD1A 2Y2NA 1BLHA 3DAVA 3P01A 3LR5A 2ZLYA 2IWDA 4WL9A 2KDKA 1K57C 4N1HA 4EBPA 2DNSA 2OWHA 1YLZA 1XPBA 1K4FA 1K55C 2EX9A 4IVKA 3BYDA 1N9NA 2H0YA 1I2SA 2XK1A 4PM5A 3O87A 3WS0A 2PD7A 4GB7A 1KGFA 2H0TA 3PR6A 3WRZA 1YLTA 4GHIB 1TS7A 4YINA 3VP1A 1N9BA 1K25A 2V2FF 4XT2A 4NK3A 3IX4A 2WGVA 3OPLA 1FCOA 4DE1A 3E2LA 4DDYA 2WUQA 2PD8A 3R4KA 1WYBA 4IHQA 3ZNTA 3G30A 3N8RA 3UPPA 4LV2A 1WYCA 3BFDA 1P0ZA 3AGDA 3MJQA 5HDDA 1FOFA 2XD5A 5G4ZA 5EVIA 3Q7ZA 3ZQ5A 2Y2JA 2ZL1B 4HI4A 5EUAA 2WKQA 4NETA 4D2OA 4UA9A 4G3KA 3D3OA 4GZBA 3VSLA 3UDIA 1XXMA 5AJGA 5HZHA 2ZM8A 2P04A 4L9GA 3T4KA 4E3MA 5FDSA 3F1OA 4WF0A 1KDSA 3F1NA 4RVAA 3PAGA 3QP5A 2O9CA 3MKFA 2ACGA 3C4OA 4MBFA 3IWIA 3D72A 1ZG4A 1S1YA 4QY6A 3M2KA 3PXPA 4S2OA 1EWZA 1CI9A 4PM8A 3WS4A 3CG5A 1XX2A 3BFEA 4ZAMA 2VV8A 1VEUA 3OCNA 4L0LA 5KMWA 1K6RA 4WZ4A 2YKHA 3MF0A 4OQHA 4BJPA 3BWLA 3IF5A 4N9LA 4UQIS 4IUKA 4Q0IA 3BW6A 4ARZA 3SH8A 3GQZA 4WZ5C 5HWVA 5EV0A 1H5XA 4KQDA 4IBXA 1S67L 4XUXA 3LIEA 1XA1A 2DMWA 1O7EA 2V20A 1JWZA 3H7WA 4EWFA 2A49A 3ZG5A 3QP1A 5HDSA 3NHQA 1YAXA 2JKRM 2EA9A 3MS6A 1G6AA 2IA2A 3IWOA 3HBRA 3IWQA 3JVVA 3IX3A 2P9VA 1VQQA 2V8FA 4JF5A 1S4SA 3IH8A 3HCYA 3C2WA 3DWKA 2GX5A 5TGFA 5CERA 2FZ0A 2WKPA 4Y3IA 3D4FA 3NOTC 1J3WA 1OJGA 1TF1A 3OOVA 1JNUA 4B9OA 4GN2A 4EU0A 4DF6A 3MFXA 4X1LA 1Z6FA 3PBNA 3KYEA 3N8SA 1K54A 3OLOA 4UEYA 5EVIB 2ZOHA 3C8CA 1NZOA 1ALQA 2HZ5A 4QY5A 4UAAA 4OLDA 2ZC3B 3S7OA 1L0EA 4N1XA 5DKLA 4EQ1A 2RL3A 4EESA 3ZYTA 2G2WA 3FG8A 4KZ8A 1DP6A 2H28A 3F1OB 4PKYA 1BUEA 3IF6A 3F1NB 4WM9A 3WS2A 4X53A 3PHYA 1DY6A 1ZTUA 4HP9A 2OLVA 3Q81A 4OOLA 2EFXA 2WGIA 2KX6A 2Q9NA 4KG5A 4NKPA 2QYBA 3BFGA 1TS6A 1FR1A 2W3GA 3M2JA 4OOYA 4G3VA 1IYPA 1VEUB 2EX6A 1IYQA 4RQ9A 3VOZA 1GA0A 5A93A 3WS1A 1GSXA 4PPRA 4FOFA 4ARZB 4QJGA 2Y2OA 2Y4AA 2EXBA 4ZJ3A 1N4OA 4LPZA 4R70A 3MKEA 4WN5A 5TR7A 2PHYA 2A2LA 1TVFA 4GKUA 3RH8B 2B18A 3GSGA 2B5RA 5CRFA 2HDQA 3NIAA 5GL9A 1EROA 4WEKA 1BYWA 4PM7A 4LCLA 2XR0A 1GCEA 4NXFA 5E2EA 1ESUA 4KZAA 2BTFP 1VETA 2QMIA 3A0VA 2P9VB 4MMNA 5FQ9A 2XQZA 1K57A 5FEGA 3FC7A 4PAUA 1L3LA 1K56D 1F5MA 4ZBEA 3KSHA 4O8GA 1SCWA 3K3CA 1W63Q 5FEFA 3DTEA 5CHJA 1Y54A 2UV0E 3KYZA 4OQGA 4YNRA 2J8YA 3HLWA 1MC0A 2VLGA 1CEFA 3CWFA 3FPVA 2KLIA 1XJ6A 2WGWA 1TDLA 4HQAA 4CJNA 3P7NA 2W3EA 3U4LP 1VHMA 1PI5A 3LFVA 3MQQA 5M1AA 4Z1WA 2EFUA 3S7QA 3CUEA 1KDWA 4GDBA 3T4QA 1XGJA 3IS2A 4CLCC 2VGLM 1NY0A 3BM6A 4Y0OA 1J9MA 5F83A 1L0GA 4P87A 3PBSA 2EWVA 1U60A 1M6KA 2V1ZA 2P7JA 3MZDA 2W0NA 2XROA 3S4XA 3A3EA 3KYQA 3UB5P 3U2AA 1TS8A 3WRTA 4X55A 3T1RA 1TS0A 1VM1A 2L1MA 4KUOA 2W3DA 5DF8A 3ZDJA 4CLCE 2CC1A 4JBFA 1JWPA 5J3WA 2HP5A 5HAIA 3LR0A 1ES3A 4MBHA 4O0PA 1UWNX 4LLOB 2X02A 1GHPA 3IX8A 4BL2A 1GA9A 5EE8A 2NUPC 3A3IA 5IU1A 3E98A 1CQAA 2Y2GA 3O86A 2IWBA 5DTSA 2XA7M 1I5QA 1ONHA 5HX9A 2VGJA 3A3JA 1QMEA 4B88A 4IVIA 1IFQA 1S6RA 4GCZA 5HPIA 2JC7A 1W79A 2OV5A 1DJCA 4HBTA 1MWTA 3T1SA 1NRJA 2PRFA 2FH5A 4OKPA 4JF4A 4BENA 2J80A 3SH7A 4WBGA 2MJ6A 3ITAA 4KQRA 2C5WB 4EXOA 1AXBA 1MWRA 2G7UA 3EWKA 4K0XA 2Y79A 3O5YA 2Q0OA 3ZG9B 4WZ5A 4Y5FA 2PAVP 1H8YA 2I72A 5FAQA 1CJFA 2HDUA 4MNRA 4OPRA 1XP4A 3ZG0A 5J8XA 1VETB 2D01A 3QP8A 3CLOA 3G32A 2B95A 3LYXA 2ZM2A 1JVJA 4JKTA 1OPXA 4IUHA 4H6JA 3NCKA 3EQUA 4F3LA 3BRMA 3SS4A 3OZHA 1A0KA 4MCWA 2UWXA 3PBOA 2JN7A 1OTAA 3FWLA 3K2NA 4G3WA 5FQJA 3DW0A 1MWSA 4II7A 4NEED 3F1PA 5FI6A 4BD1A 5A8BA 3BFFA 2WGWB 1WE4A 1NYMA 3EEHA 3W2ZA 1OT9A 3G4PA 3NOPC 5TBMA 2BG1A 1S0WA 4HHDA 4QB8A 3B47A 3ULFA 1SZVA 2JBFA 1PWDA 3SZTA 3SOIA 4S2JA 1N9OA 4F94A 2VV6A 4EV4A 5FI2A 1FCNA 4OQIA 2P74A 2QHKA 3TJZC 3VSKA 2V1BA 4WEJA 2A24B 1LLBA 2LB9A 4HH2A 4Q0JA 5A90A 2HV1A 3GECA 3N7WA 3UY6A 4CPKA 5GLBA 1P9WA 3UMDA 3UE3A 4C3QA 3NY4A 2BLSA 5FA7A 4UHUA 5FSRA 1KE3A 5E43A 3MZFA 1IYOA 4OVDA 3MFDA 3ZGAB 5HL1A 2H10A 5F82A 1BLSA 2M1CA 4Q8IA 1G68A 1VB6A 3E4OA 3BQAA 3MSHA 2J3TD 3CZDA 4E04A 5JYOA 4IJGA 4MLLA 1IEMA 1SDEA 3ZG8B 5HW3A 3UE1A 3A3DA 5BOHA 3PYPA 4FCFA 1EI5A 5CHUA 1OJ5A 2QPNA 1G28A 4S2NA 3TG9A 2J9PA 4QD4A 5HWTA 2HGVA 5A92A 4PMAA 4HEFA 3IH9A 4GS9A 1UWPX 5FAOA 5HARA 3PAEA 2XDMA 3HVFA 4FH2A 3IHBA 3GTCA 3HREA 2K31A 5I5LA 4H6JB 4F3LB 3NECA 2ZQ8A 1YT4A 2K2NA 4EBNA 1LL9A 1XJ4A 3G2YA 4FSFA 3F1PB 3DBAA 5FQIA 2KOIA 2RCXA 4OH0A 1ZHHB 2W1RA 5AVFA 2Z6DA 1XJ3A 2FFYA 4WELA 4MN6A 4LCMA 5CGXA 1MBLA 3HUNA 1OTEA 4FTXA 5A91A 5EM0A 2OSUA 3IXHA 4EUZA 5J4EA 5EVID 3BJNA 3SS3A 5E2GA 3FYZA 3ITBA 5DTKA 3BY8A 3JVUA 1G6OA 3E4PA 4CLCA 2OWJA 2ZBBA 4P6BA 4LV0A 1F9IA 1ZC2A 3CHWP 4ZJ1A 2Z2LB 2JKGA 3UE6A 4X1MA 2V8CA 1H8MA 5EPHA 3LY4A 5L07A 4HH3A 1T1AA 2B02A 1GHMA 4KQQA 4XT2B 4E3IA 2W3FA 3LUQA 3LCEA 3CI6A 1ES5A 3HL9A 4R3JA 3LY3A 4OPQA 4Y15A 4DKIA 2J9OA 3UN7A 1ZKJA 3MR0A 4KG2A 3GRJA 2GDNA 1PNEA 2ZOIA 3VOLA 1E4DA 4NXGA 3BLMA 3QNCA 5EVEA 2VGLS 5EECA 4EEPA 3VFHA 5MC7A 1PZOA 1YQSA 2PR6A 3NOUC 1PWCA 4NXBA
chains in the Genus database with same CATH topology
4ZJ2A 1BSGA 3NDEA 3ZVWA 1BZAA 2WGWA 1TDLA 3BECA 3IXGA 4KENB 4WMCD 4BL3A 4CJNA 3V3RA 5AQBA 1ZG6A 1GHIA 3FV7A 1E25A 1W8QA 1PI5A 1YLPA 3IXDA 5FDHA 4QHCA 4HBUA 3V5MA 5M1AA 2IWCA 5CGSA 2EFUA 2Z2MB 4R0QA 1YLJA 1C3BA 5KSCA 1L2SA 5CECA 1YLWA 1KDWA 4GDBA 1RP5A 1XGJA 3A3FA 5CTMA 1BTLA 4C75A 4DE0A 4E3JA 1NY0A 4FD8A 3BM6A 3GV9A 4Y0OA 1J9MA 5F83A 1L0GA 1FCMA 2EX2A 2G2UA 4P87A 3PBSA 2XLNA 5KSHA 2J7VA 1L0DA 1MY8A 1U60A 1M6KA 2V1ZA 3MZDA 2Y2LA 3ZG7B 3ZFZA 5TFQA 5GHZA 2WAFA 4X6TA 3A3EA 3S4XA 4XUZA 4ID4A 4OPZA 1IKIA 3UDXA 1Q2PA 4GD8A 3M6BA 1ERMA 1RGZA 2Y2IA 4GDNA 4B4XA 3WRTA 4O7DA 4X55A 5I94A 4DE3A 1SHVA 4HESA 5L2FA 1VM1A 4RX3A 5CHMA 1BT5A 3CMZA 4FH4A 4E3NA 5DF8A 2Q9MA 3ZDJA 3HLCA 1YM1A 2XFSA 2XD1A 2CC1A 4JBFA 2Y2NA 1BLHA 1JWPA 2HP5A 2ZD8A 2ZLYA 3BLSA 5HAIA 5FI7A 1FSYA 1ES3A 2IWDA 1K38A 1NRFA 3CJMA 4MBHA 4OONA 2A3UA 2X02A 1GHPA 1K57C 4N1HA 4EBPA 4S2KA 1GA9A 5EE8A 1CEGA 2C6WB 4BL2A 2DNSA 4RA7A 3A3IA 1YLZA 2HDRA 1LI9A 3BEBA 4BD0A 1XPBA 5EVIC 1K4FA 2Y2GA 1K55C 3WWXA 1O07A 2EX9A 4IVKA 3O86A 2IWBA 3BYDA 5DTSA 2H0YA 3WS5A 3RXXA 1I2SA 3S22A 2XK1A 4PM5A 3O87A 1I5QA 1ONHA 4Z9QA 5HX9A 3WS0A 1NXYA 2VGJA 4R4RA 3A3JA 4GB7A 1QMEA 4JLFA 4B88A 4IVIA 1KGFA 2H0TA 1S6RA 2EXAA 3WRZA 1YMSA 1YLTA 4YINA 3VP1A 1N9BA 2JC7A 4K91A 1W79A 2R9WA 2OV5A 1K25A 1DJCA 5GLAA 2V2FF 3Q7VA 4HBTA 4EQIA 4MEZA 5KZHA 1MWTA 3UNWA 2ZC4B 1XGIA 4NK3A 2WGVA 4OKPA 3OPLA 1FCOA 4BLMA 4DE1A 3E2LA 4JF4A 4BENA 4DDYA 2WUQA 3ZNTA 1WYBA 2HDSA 3G30A 3N8RA 3NDGA 4KZ9A 3FKVA 3UPPA 3HLDA 1FQGA 1LL5A 4LV2A 3ITAA 4KQRA 4WBGA 3SH7A 1WYCA 2C5WB 2EX8A 3BFDA 2Y2HA 1HTZA 1AXBA 1MWRA 2WK0A 4K0XA 1K6SA 3AGDA 4QU3A 2OLUA 4U3TA 1I2WA 2ZQ9A 1FOFA 2PU2A 2XD5A 4Y0TA 3ZG9B 4WZ5A 3FKWA 1H8YA 5EVIA 2I72A 1K55A 1KGGA 3IXBA 3Q7ZA 2Y2JA 5FAQA 2HDUA 2QZ6A 4MNRA 1KE4A 4OPRA 3MXSA 4NETA 1XP4A 5EUAA 3ZG0A 4D2OA 5J8XA 3G2ZA 4U0TA 4UA9A 3AGFA 4GZBA 4LV3A 2WKEA 1W7FA 5GHXA 3VSLA 2E8IA 3UDIA 3C7UA 1XXMA 3G32A 2ZM8A 4OPYA 2ZM2A 1JVJA 4JKTA 2JE5A 3ZNYA 3NCKA 1H8ZA 3EQUA 4KG6A 4KZ4A 3PTEA 3BRMA 2WYXA 3SS4A 4S2PA 4E3MA 3OZHA 2XF3A 3OPPA 1MPLA 2UWXA 3PBOA 4JXSA 1KDSA 1ESIA 4DE2A 3FWLA 2XGNA 5M19A 5FAPA 5FQJA 1ES4A 5CTNA 3DW0A 1MWSA 3OPRA 1E3UA 4KZ7A 4N92A 4A5RA 1PWGA 5FI6A 4BD1A 2Y91A 3BFFA 4RVAA 2WGWB 1WE4A 3PAGA 1OMEA 5HFOA 1NYMA 4JXVA 3MKFA 3C4OA 4MBFA 3IWIA 4S2MA 1NYYA 1ZG4A 4QY6A 3M2KA 2ZM0A 4S2OA 5U47A 3G4PA 4RX2A 5DVAA 3DTMA 4E6WA 1EWZA 2BG1A 3V3SA 4JPMA 1S0WA 1CI9A 4PM8A 3WS4A 3CG5A 1XX2A 4QB8A 5HAQA 3BFEA 4ZAMA 3IF6B 1PZPA 1K56A 2JBFA 1PWDA 2R9XA 3SOIA 4S2JA 4S2LA 5JYPA 3GR2A 2DRWA 1PYYA 4F94A 3OCNA 4L0LA 3VP4A 4B4ZA 3MXRA 2HP6A 1Q2QA 5KMWA 1K6RA 4UA7A 4OQHA 3G35A 4WZ4A 4BJPA 3O88A 4EV4A 2Y2PA 5FI2A 3IF5A 1FCNA 3MZEA 4OQIA 5FQMA 4N9LA 1JTGA 2P74A 2XFTA 3ZVTA 4E3KA 3VSKA 3HUMA 4WEJA 5F1FA 2WAEA 1FR6A 2VGKA 3SH8A 1LLBA 4WMCA 3GQZA 4WZ5C 3TOIA 5DF9A 1H5XA 1W5DA 4IBXA 4OOMA 4JXWA 4R4SA 3VP2A 4XUXA 5A90A 1KVMA 1XA1A 3W8KA 3N4IA 1O7EA 3N7WA 5F1GA 1RCJA 3UY6A 4CPKA 5EOOA 4Y0UA 5GLBA 4DXBA 2V20A 1JWZA 4S2NC 1L0FA 1HZOA 3UE3A 4EWFA 2Y2QA 4C3QA 3ISGA 3N6IA 1K54C 2A49A 3NY4A 2BLSA 5FA7A 3ZG5A 1LHYA 4GOGA 1KE0A 2ZJ9A 4UHUA 5FSRA 1KE3A 2WADA 4R1GA 5HAPA 3I7JA 5IHVA 5E43A 4E3LA 3MZFA 1IYOA 1G6AA 4OVDA 2WZZA 3IWOA 5GHYA 3MFDA 1MWUA 1MXOA 3HBRA 3IWQA 3ZGAB 5HL1A 1BULA 2Y59A 2H10A 3Q07A 5F82A 5DTTA 1BLSA 2P9VA 1VQQA 4Q8IA 3C4PA 1IKGA 1G68A 2WKHA 4JF5A 3IH8A 4XXRA 1W8YA 4OLGA 3DWKA 3IQAA 5FASA 5TGFA 3Q7VB 3UDFA 3CZDA 5JYOA 4PM6A 4MLLA 5AQ7A 5CERA 4YFMA 4RYEA 2ZQ7A 4P85A 1IEMA 1SDEA 3ZG8B 4KZ6A 5HW3A 3UE1A 3HLEA 3OCLA 3A3DA 3D4FA 5BOHA 2ZQAA 2PU4A 3PBQA 3W4OA 2Y55A 4P0MA 1HVBA 1BLCA 4FCFA 4GN2A 5FATA 1EI5A 4IEDA 4DF6A 5CHUA 3UE0A 3JYIA 2QPNA 3GMWA 4R23A 3W4QA 4S2NA 3TG9A 2JCHA 1Z6FA 2J9PA 3PBNA 4QD4A 4ZDXA 3N8SA 2FFFB 1K54A 5EOEA 5A92A 4E6XA 4PMAA 2ZQCA 4HEFA 3IH9A 5EVIB 2PBYA 1NZOA 2ZC6B 4ZTKA 3LO7A 5FAOA 3SH9A 4C6YA 5HARA 3W4PA 3PAEA 1ALQA 3C5AA 4QY5A 2XDMA 4UAAA 1XKZA 4OLDA 2ZC3B 2XEPA 3O3VA 1NZUA 4N9KA 2Y2MA 1L0EA 3HVFA 3IHBA 4FH2A 4N1XA 4U0XA 2RL3A 1M40A 3GTCA 3HLFA 3QNBA 3HREA 3HLGA 4K0WA 5FQQA 2ZQ8A 2G2WA 2HP9A 1ONGA 1YT4A 4OQ0A 4KZ8A 3LEZA 5D3OA 4EBNA 2ZMAA 1LL9A 3B3XA 5AQ9A 3GVBA 1BUEA 3AGEA 3IF6A 4GNUA 3G2YA 4Y7PA 4WM9A 4FSFA 5CEBA 1DJBA 4KZ3A 3WS2A 4X53A 3ZHHA 1JWVA 1PI4A 1DY6A 5CEDA 5FQIA 2RCXA 1LI0A 5FQKA 3RXWA 4OH0A 3IHAA 2OLVA 4LV1A 3Q81A 4OOLA 1TDGA 2EFXA 3OC2A 2WGIA 2Q9NA 3MBZA 2FFYA 1K4EA 3NC8A 3IT9A 4KG5A 4LENA 2WKIA 3P98A 3Q82A 3VFFA 3VMAA 1MKIA 1YMXA 2Y2KA 3BFGA 4WELA 1FSWA 4LCMA 5CGXA 4BQMA 1FR1A 1MBLA 3V39A 3M2JA 1PIOA 4OOYA 1IYPA 3HUNA 5GLCA 5A91A 3P09A 2X01A 2EX6A 1PW8A 2ZC5B 1IYQA 4GD6A 2OSUA 3VOZA 1CI8A 3IXHA 4EUZA 1GA0A 2ZC7A 1NJ4A 5EVID 1ES2A 1HD8A 4X56A 5G18A 1IELA 5E2GA 3FYZA 4JXGA 3SS3A 5A93A 3WS1A 5GLDA 3ITBA 5DTKA 2H5SA 1ERQA 3HUOA 4PPRA 2ZQDA 4QJGA 1QMFA 2Y2OA 1PW1A 3C7VA 4OP5A 2Y4AA 4DDSA 4MBKA 3OPHA 1YLYA 4P6BA 4LV0A 3EQVA 3NBLA 2EXBA 3RJUA 4ZJ3A 1ZC2A 1N4OA 4ZJ1A 2Z2LB 3MKEA 3G34A 5TR7A 3UO9A 4EBLA 3E2KA 4S2IA 4UA6A 1BLPA 3G31A 1TVFA 4IBRA 4GKUA 5EPHA 4X69A 3VP0A 3VP3A 4M3KA 3GSGA 3LY4A 2B5RA 3VOYA 2DCFA 3PBRA 3TSGA 1XA7A 5CRFA 1JTDA 3BFCA 3V50A 2HDQA 3M6HA 3NIAA 1GHMA 1E3UD 1EROA 4H8RA 4KZBA 4WEKA 5GL9A 1DJAA 3HLBA 4KQQA 4PM7A 3N8LA 1TEMA 4E3IA 5M18A 2XH9A 4LCLA 3QHYA 2XR0A 5EVLA 1GCEA 1SDNA 5E2EA 3S1YA 1ESUA 1RGYA 3IF6C 4KZAA 4X68A 5CXWA 3UPOA 1SKFA 3LCEA 1ES5A 2QMIA 3HL9A 3FZCA 3NI9A 4R3JA 5E2HA 3ZCZA 1IYSA 2P9VB 3LY3A 4E3OA 4OPQA 5DF7A 1KGEA 4DKIA 2J9OA 5FQ9A 3UN7A 1KVLA 1ZKJA 4KZ5A 2XQZA 4DRTA 4KG2A 1K57A 1K56D 2X71A 2GDNA 3GRJA 4ZBEA 1SCWA 3UPNA 4JF6A 1E4DA 3DWZA 4DXCA 5E2FA 3BLMA 5CHJA 1Y54A 3QNCA 4OQGA 5EECA 5AQAA 3VFHA 4PM9A 1PZOA 1YQSA 2HPBA 2J8YA 3HLWA 3PBTA 1CK3A 4R3BA 1PWCA 3SS5A 2WZXA 4KQOA 1CEFA 5CGWA 4WYYA 4OP8A 3Q1FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZJ2 A;  1BSG A;  3NDE A;  3ZVW A;  1BZA A;  2WGW A;  1TDL A;  3BEC A;  3IXG A;  4KEN B;  4WMC D;  4BL3 A;  4CJN A;  3V3R A;  5AQB A;  1ZG6 A;  1GHI A;  3FV7 A;  1E25 A;  1W8Q A;  1PI5 A;  1YLP A;  3IXD A;  5FDH A;  4QHC A;  4HBU A;  3V5M A;  5M1A A;  2IWC A;  5CGS A;  2EFU A;  2Z2M B;  4R0Q A;  1YLJ A;  1C3B A;  5KSC A;  1L2S A;  5CEC A;  1YLW A;  1KDW A;  4GDB A;  1RP5 A;  1XGJ A;  3A3F A;  5CTM A;  1BTL A;  4C75 A;  4DE0 A;  4E3J A;  1NY0 A;  4FD8 A;  3BM6 A;  3GV9 A;  4Y0O A;  1J9M A;  5F83 A;  1L0G A;  1FCM A;  2EX2 A;  2G2U A;  4P87 A;  3PBS A;  2XLN A;  5KSH A;  2J7V A;  1L0D A;  1MY8 A;  1U60 A;  1M6K A;  2V1Z A;  3MZD A;  2Y2L A;  3ZG7 B;  3ZFZ A;  5TFQ A;  5GHZ A;  2WAF A;  4X6T A;  3A3E A;  3S4X A;  4XUZ A;  4ID4 A;  4OPZ A;  1IKI A;  3UDX A;  1Q2P A;  4GD8 A;  3M6B A;  1ERM A;  1RGZ A;  2Y2I A;  4GDN A;  4B4X A;  3WRT A;  4O7D A;  4X55 A;  5I94 A;  4DE3 A;  1SHV A;  4HES A;  5L2F A;  1VM1 A;  4RX3 A;  5CHM A;  1BT5 A;  3CMZ A;  4FH4 A;  4E3N A;  5DF8 A;  2Q9M A;  3ZDJ A;  3HLC A;  1YM1 A;  2XFS A;  2XD1 A;  2CC1 A;  4JBF A;  2Y2N A;  1BLH A;  1JWP A;  2HP5 A;  2ZD8 A;  2ZLY A;  3BLS A;  5HAI A;  5FI7 A;  1FSY A;  1ES3 A;  2IWD A;  1K38 A;  1NRF A;  3CJM A;  4MBH A;  4OON A;  2A3U A;  2X02 A;  1GHP A;  1K57 C;  4N1H A;  4EBP A;  4S2K A;  1GA9 A;  5EE8 A;  1CEG A;  2C6W B;  4BL2 A;  2DNS A;  4RA7 A;  3A3I A;  1YLZ A;  2HDR A;  1LI9 A;  3BEB A;  4BD0 A;  1XPB A;  5EVI C;  1K4F A;  2Y2G A;  1K55 C;  3WWX A;  1O07 A;  2EX9 A;  4IVK A;  3O86 A;  2IWB A;  3BYD A;  5DTS A;  2H0Y A;  3WS5 A;  3RXX A;  1I2S A;  3S22 A;  2XK1 A;  4PM5 A;  3O87 A;  1I5Q A;  1ONH A;  4Z9Q A;  5HX9 A;  3WS0 A;  1NXY A;  2VGJ A;  4R4R A;  3A3J A;  4GB7 A;  1QME A;  4JLF A;  4B88 A;  4IVI A;  1KGF A;  2H0T A;  1S6R A;  2EXA A;  3WRZ A;  1YMS A;  1YLT A;  4YIN A;  3VP1 A;  1N9B A;  2JC7 A;  4K91 A;  1W79 A;  2R9W A;  2OV5 A;  1K25 A;  1DJC A;  5GLA A;  2V2F F;  3Q7V A;  4HBT A;  4EQI A;  4MEZ A;  5KZH A;  1MWT A;  3UNW A;  2ZC4 B;  1XGI A;  4NK3 A;  2WGV A;  4OKP A;  3OPL A;  1FCO A;  4BLM A;  4DE1 A;  3E2L A;  4JF4 A;  4BEN A;  4DDY A;  2WUQ A;  3ZNT A;  1WYB A;  2HDS A;  3G30 A;  3N8R A;  3NDG A;  4KZ9 A;  3FKV A;  3UPP A;  3HLD A;  1FQG A;  1LL5 A;  4LV2 A;  3ITA A;  4KQR A;  4WBG A;  3SH7 A;  1WYC A;  2C5W B;  2EX8 A;  3BFD A;  2Y2H A;  1HTZ A;  1AXB A;  1MWR A;  2WK0 A;  4K0X A;  1K6S A;  3AGD A;  4QU3 A;  2OLU A;  4U3T A;  1I2W A;  2ZQ9 A;  1FOF A;  2PU2 A;  2XD5 A;  4Y0T A;  3ZG9 B;  4WZ5 A;  3FKW A;  1H8Y A;  5EVI A;  2I72 A;  1K55 A;  1KGG A;  3IXB A;  3Q7Z A;  2Y2J A;  5FAQ A;  2HDU A;  2QZ6 A;  4MNR A;  1KE4 A;  4OPR A;  3MXS A;  4NET A;  1XP4 A;  5EUA A;  3ZG0 A;  4D2O A;  5J8X A;  3G2Z A;  4U0T A;  4UA9 A;  3AGF A;  4GZB A;  4LV3 A;  2WKE A;  1W7F A;  5GHX A;  3VSL A;  2E8I A;  3UDI A;  3C7U A;  1XXM A;  3G32 A;  2ZM8 A;  4OPY A;  2ZM2 A;  1JVJ A;  4JKT A;  2JE5 A;  3ZNY A;  3NCK A;  1H8Z A;  3EQU A;  4KG6 A;  4KZ4 A;  3PTE A;  3BRM A;  2WYX A;  3SS4 A;  4S2P A;  4E3M A;  3OZH A;  2XF3 A;  3OPP A;  1MPL A;  2UWX A;  3PBO A;  4JXS A;  1KDS A;  1ESI A;  4DE2 A;  3FWL A;  2XGN A;  5M19 A;  5FAP A;  5FQJ A;  1ES4 A;  5CTN A;  3DW0 A;  1MWS A;  3OPR A;  1E3U A;  4KZ7 A;  4N92 A;  4A5R A;  1PWG A;  5FI6 A;  4BD1 A;  2Y91 A;  3BFF A;  4RVA A;  2WGW B;  1WE4 A;  3PAG A;  1OME A;  5HFO A;  1NYM A;  4JXV A;  3MKF A;  3C4O A;  4MBF A;  3IWI A;  4S2M A;  1NYY A;  1ZG4 A;  4QY6 A;  3M2K A;  2ZM0 A;  4S2O A;  5U47 A;  3G4P A;  4RX2 A;  5DVA A;  3DTM A;  4E6W A;  1EWZ A;  2BG1 A;  3V3S A;  4JPM A;  1S0W A;  1CI9 A;  4PM8 A;  3WS4 A;  3CG5 A;  1XX2 A;  4QB8 A;  5HAQ A;  3BFE A;  4ZAM A;  3IF6 B;  1PZP A;  1K56 A;  2JBF A;  1PWD A;  2R9X A;  3SOI A;  4S2J A;  4S2L A;  5JYP A;  3GR2 A;  2DRW A;  1PYY A;  4F94 A;  3OCN A;  4L0L A;  3VP4 A;  4B4Z A;  3MXR A;  2HP6 A;  1Q2Q A;  5KMW A;  1K6R A;  4UA7 A;  4OQH A;  3G35 A;  4WZ4 A;  4BJP A;  3O88 A;  4EV4 A;  2Y2P A;  5FI2 A;  3IF5 A;  1FCN A;  3MZE A;  4OQI A;  5FQM A;  4N9L A;  1JTG A;  2P74 A;  2XFT A;  3ZVT A;  4E3K A;  3VSK A;  3HUM A;  4WEJ A;  5F1F A;  2WAE A;  1FR6 A;  2VGK A;  3SH8 A;  1LLB A;  4WMC A;  3GQZ A;  4WZ5 C;  3TOI A;  5DF9 A;  1H5X A;  1W5D A;  4IBX A;  4OOM A;  4JXW A;  4R4S A;  3VP2 A;  4XUX A;  5A90 A;  1KVM A;  1XA1 A;  3W8K A;  3N4I A;  1O7E A;  3N7W A;  5F1G A;  1RCJ A;  3UY6 A;  4CPK A;  5EOO A;  4Y0U A;  5GLB A;  4DXB A;  2V20 A;  1JWZ A;  4S2N C;  1L0F A;  1HZO A;  3UE3 A;  4EWF A;  2Y2Q A;  4C3Q A;  3ISG A;  3N6I A;  1K54 C;  2A49 A;  3NY4 A;  2BLS A;  5FA7 A;  3ZG5 A;  1LHY A;  4GOG A;  1KE0 A;  2ZJ9 A;  4UHU A;  5FSR A;  1KE3 A;  2WAD A;  4R1G A;  5HAP A;  3I7J A;  5IHV A;  5E43 A;  4E3L A;  3MZF A;  1IYO A;  1G6A A;  4OVD A;  2WZZ A;  3IWO A;  5GHY A;  3MFD A;  1MWU A;  1MXO A;  3HBR A;  3IWQ A;  3ZGA B;  5HL1 A;  1BUL A;  2Y59 A;  2H10 A;  3Q07 A;  5F82 A;  5DTT A;  1BLS A;  2P9V A;  1VQQ A;  4Q8I A;  3C4P A;  1IKG A;  1G68 A;  2WKH A;  4JF5 A;  3IH8 A;  4XXR A;  1W8Y A;  4OLG A;  3DWK A;  3IQA A;  5FAS A;  5TGF A;  3Q7V B;  3UDF A;  3CZD A;  5JYO A;  4PM6 A;  4MLL A;  5AQ7 A;  5CER A;  4YFM A;  4RYE A;  2ZQ7 A;  4P85 A;  1IEM A;  1SDE A;  3ZG8 B;  4KZ6 A;  5HW3 A;  3UE1 A;  3HLE A;  3OCL A;  3A3D A;  3D4F A;  5BOH A;  2ZQA A;  2PU4 A;  3PBQ A;  3W4O A;  2Y55 A;  4P0M A;  1HVB A;  1BLC A;  4FCF A;  4GN2 A;  5FAT A;  1EI5 A;  4IED A;  4DF6 A;  5CHU A;  3UE0 A;  3JYI A;  2QPN A;  3GMW A;  4R23 A;  3W4Q A;  4S2N A;  3TG9 A;  2JCH A;  1Z6F A;  2J9P A;  3PBN A;  4QD4 A;  4ZDX A;  3N8S A;  2FFF B;  1K54 A;  5EOE A;  5A92 A;  4E6X A;  4PMA A;  2ZQC A;  4HEF A;  3IH9 A;  5EVI B;  2PBY A;  1NZO A;  2ZC6 B;  4ZTK A;  3LO7 A;  5FAO A;  3SH9 A;  4C6Y A;  5HAR A;  3W4P A;  3PAE A;  1ALQ A;  3C5A A;  4QY5 A;  2XDM A;  4UAA A;  1XKZ A;  4OLD A;  2ZC3 B;  2XEP A;  3O3V A;  1NZU A;  4N9K A;  2Y2M A;  1L0E A;  3HVF A;  3IHB A;  4FH2 A;  4N1X A;  4U0X A;  2RL3 A;  1M40 A;  3GTC A;  3HLF A;  3QNB A;  3HRE A;  3HLG A;  4K0W A;  5FQQ A;  2ZQ8 A;  2G2W A;  2HP9 A;  1ONG A;  1YT4 A;  4OQ0 A;  4KZ8 A;  3LEZ A;  5D3O A;  4EBN A;  2ZMA A;  1LL9 A;  3B3X A;  5AQ9 A;  3GVB A;  1BUE A;  3AGE A;  3IF6 A;  4GNU A;  3G2Y A;  4Y7P A;  4WM9 A;  4FSF A;  5CEB A;  1DJB A;  4KZ3 A;  3WS2 A;  4X53 A;  3ZHH A;  1JWV A;  1PI4 A;  1DY6 A;  5CED A;  5FQI A;  2RCX A;  1LI0 A;  5FQK A;  3RXW A;  4OH0 A;  3IHA A;  2OLV A;  4LV1 A;  3Q81 A;  4OOL A;  1TDG A;  2EFX A;  3OC2 A;  2WGI A;  2Q9N A;  3MBZ A;  2FFY A;  1K4E A;  3NC8 A;  3IT9 A;  4KG5 A;  4LEN A;  2WKI A;  3P98 A;  3Q82 A;  3VFF A;  3VMA A;  1MKI A;  1YMX A;  2Y2K A;  3BFG A;  4WEL A;  1FSW A;  4LCM A;  5CGX A;  4BQM A;  1FR1 A;  1MBL A;  3V39 A;  3M2J A;  1PIO A;  4OOY A;  1IYP A;  3HUN A;  5GLC A;  5A91 A;  3P09 A;  2X01 A;  2EX6 A;  1PW8 A;  2ZC5 B;  1IYQ A;  4GD6 A;  2OSU A;  3VOZ A;  1CI8 A;  3IXH A;  4EUZ A;  1GA0 A;  2ZC7 A;  1NJ4 A;  5EVI D;  1ES2 A;  1HD8 A;  4X56 A;  5G18 A;  1IEL A;  5E2G A;  3FYZ A;  4JXG A;  3SS3 A;  5A93 A;  3WS1 A;  5GLD A;  3ITB A;  5DTK A;  2H5S A;  1ERQ A;  3HUO A;  4PPR A;  2ZQD A;  4QJG A;  1QMF A;  2Y2O A;  1PW1 A;  3C7V A;  4OP5 A;  2Y4A A;  4DDS A;  4MBK A;  3OPH A;  1YLY A;  4P6B A;  4LV0 A;  3EQV A;  3NBL A;  2EXB A;  3RJU A;  4ZJ3 A;  1ZC2 A;  1N4O A;  4ZJ1 A;  2Z2L B;  3MKE A;  3G34 A;  5TR7 A;  3UO9 A;  4EBL A;  3E2K A;  4S2I A;  4UA6 A;  1BLP A;  3G31 A;  1TVF A;  4IBR A;  4GKU A;  5EPH A;  4X69 A;  3VP0 A;  3VP3 A;  4M3K A;  3GSG A;  3LY4 A;  2B5R A;  3VOY A;  2DCF A;  3PBR A;  3TSG A;  1XA7 A;  5CRF A;  1JTD A;  3BFC A;  3V50 A;  2HDQ A;  3M6H A;  3NIA A;  1GHM A;  1E3U D;  1ERO A;  4H8R A;  4KZB A;  4WEK A;  5GL9 A;  1DJA A;  3HLB A;  4KQQ A;  4PM7 A;  3N8L A;  1TEM A;  4E3I A;  5M18 A;  2XH9 A;  4LCL A;  3QHY A;  2XR0 A;  5EVL A;  1GCE A;  1SDN A;  5E2E A;  3S1Y A;  1ESU A;  1RGY A;  3IF6 C;  4KZA A;  4X68 A;  5CXW A;  3UPO A;  1SKF A;  3LCE A;  1ES5 A;  2QMI A;  3HL9 A;  3FZC A;  3NI9 A;  4R3J A;  5E2H A;  3ZCZ A;  1IYS A;  2P9V B;  3LY3 A;  4E3O A;  4OPQ A;  5DF7 A;  1KGE A;  4DKI A;  2J9O A;  5FQ9 A;  3UN7 A;  1KVL A;  1ZKJ A;  4KZ5 A;  2XQZ A;  4DRT A;  4KG2 A;  1K57 A;  1K56 D;  2X71 A;  2GDN A;  3GRJ A;  4ZBE A;  1SCW A;  3UPN A;  4JF6 A;  1E4D A;  3DWZ A;  4DXC A;  5E2F A;  3BLM A;  5CHJ A;  1Y54 A;  3QNC A;  4OQG A;  5EEC A;  5AQA A;  3VFH A;  4PM9 A;  1PZO A;  1YQS A;  2HPB A;  2J8Y A;  3HLW A;  3PBT A;  1CK3 A;  4R3B A;  1PWC A;  3SS5 A;  2WZX A;  4KQO A;  1CEF A;  5CGW A;  4WYY A;  4OP8 A;  3Q1F A; 
#chains in the Genus database with same CATH topology
 2YKF A;  1LSX A;  3NDE A;  2ZMF A;  1Y28 A;  2HJE A;  5AVE A;  4BL3 A;  3V3R A;  4B93 A;  1GHI A;  3FV7 A;  1E25 A;  1DP9 A;  1W8Q A;  1YLP A;  4QHC A;  3T1Q B;  2IWC A;  2Z2M B;  1YLJ A;  1UGU A;  1YLW A;  5CTM A;  4DE0 A;  2PYP A;  1V9Y A;  4I3J A;  2G2U A;  2XLN A;  5KSH A;  2J7V A;  5TFQ A;  5GHZ A;  1S1Z A;  4OPZ A;  1IKI A;  3UDX A;  1Q2P A;  4GD8 A;  4KUK A;  4GDN A;  1KOU A;  4HOI A;  4DE3 A;  3C38 A;  4RX3 A;  1BT5 A;  1Y4O A;  3CMZ A;  1F98 A;  4FH4 A;  4HIA A;  2XA7 S;  4LRX C;  2JKT I;  1H0M A;  4Y13 A;  1CF0 A;  2GZA A;  3BLS A;  5FI7 A;  1FSY A;  5L10 A;  1OT6 A;  1K38 A;  3CJM A;  1TD5 A;  3LI8 A;  2A3U A;  3UME A;  4EER A;  4BBT A;  3WWX A;  5EVI C;  2O0Y A;  2BAS A;  4LGW A;  2I9V A;  3RXX A;  5FL3 A;  3S22 A;  3T4O A;  5G4Y A;  4M4X A;  4GW9 A;  4R4R A;  3HJK A;  4JLF A;  4AFI A;  3RFB A;  2CMN A;  1YMS A;  3H7W B;  2R9W A;  4UQI M;  3Q7V A;  4EQI A;  4MEZ A;  3UNW A;  2ZC4 B;  4GLQ A;  1V9Z A;  3CAX A;  3NDG A;  3FKV A;  3HLD A;  1LL5 A;  2Y2H A;  5L8M A;  2WK0 A;  3G6O A;  2OLU A;  3EEA A;  4U3T A;  4ETX A;  4Y0T A;  1FIK A;  3FKW A;  3NJA A;  1K55 A;  1KGG A;  3B42 A;  3IXB A;  3T12 B;  1KE4 A;  3MXS A;  3G2Z A;  4JGP A;  3AGF A;  3LR3 A;  5GHX A;  1W7F A;  2E8I A;  3C7U A;  2INW A;  3IBR A;  2JE5 A;  3ZNY A;  4KG6 A;  1H8Z A;  3PTE A;  2WYX A;  5EM1 A;  4JXS A;  1ESI A;  4DE2 A;  5M19 A;  1ES4 A;  1E3U A;  3LID A;  3SW1 A;  1XFN A;  5HFO A;  5C5K A;  2M7V A;  4S2M A;  1NYY A;  4O01 A;  2ZM0 A;  5U47 A;  2EWW A;  4JGQ A;  3DTM A;  2M7U A;  3V3S A;  4JPM A;  4EUV A;  4PKY G;  5HAQ A;  1WA9 A;  3IF6 B;  1PZP A;  5F6A A;  3DTK A;  2DRW A;  1PYY A;  4I5S A;  4EW7 A;  3MXR A;  2VEA A;  3K3D A;  1PRQ A;  4E3K A;  5J7E A;  3HUM A;  5F1F A;  3CIT A;  1FR6 A;  4WMC A;  5DF9 A;  1W5D A;  4OOM A;  4JXW A;  3VP2 A;  4CQH A;  1KVM A;  1ACF A;  3W8K A;  3T4L A;  4GJ4 A;  5EOO A;  4Y0U A;  3EGD C;  2WKR A;  3T1X A;  1L0F A;  3MQO A;  2Y2Q A;  3N6I A;  1K54 C;  5DKK A;  4GOG A;  1KE0 A;  2ZJ9 A;  2HF6 A;  1STZ A;  1T1B A;  5HL6 A;  3CPT A;  5EFW A;  1G5U A;  2WZZ A;  5GHY A;  2Y59 A;  1IKG A;  4XXR A;  3Q7V B;  2PR5 A;  3ICY A;  4YFM A;  4RYE A;  2ZQ7 A;  1LL8 A;  3HLE A;  3OCL A;  4WUJ A;  2PU4 A;  4P0M A;  1HVB A;  3BQ8 A;  4ZRR A;  1D06 A;  3UE0 A;  3JYI A;  3GMW A;  3W4Q A;  1N9L A;  2V1A A;  2JCH A;  3UB8 A;  5EOE A;  5CX7 A;  1MZU A;  3VV4 A;  1FIL A;  2ZC6 B;  4ZTK A;  3LO7 A;  4DMZ A;  4C6Y A;  3W4P A;  3UB7 A;  2XEP A;  3O3V A;  1NZU A;  2Y2M A;  4P6Z M;  4U0X A;  4HJ6 A;  3MQ0 A;  1X0O A;  3HLF A;  3HLG A;  3T4S A;  2HP9 A;  4DN0 A;  3HJI A;  5D3O A;  2QJ7 A;  3B3X A;  4BWI A;  5AQ9 A;  4QPR A;  4HNB A;  3GVB A;  3T4T A;  3IS2 B;  3QP6 A;  4GNU A;  4Y7P A;  3S7P A;  5HD3 A;  1OTB A;  5IT5 A;  1AWI A;  1JWV A;  1PI4 A;  2J3W A;  5CED A;  1LI0 A;  4L9F A;  2ZMV A;  3E4Q A;  3OC2 A;  4FUW A;  3MBZ A;  2E8J A;  2WKI A;  3P98 A;  3VFF A;  3VMA A;  3QP2 A;  1FSW A;  3KSG A;  4YOF A;  3V39 A;  1PIO A;  2PDR A;  3KSF A;  5GLC A;  3P09 A;  2ZC5 B;  4GD6 A;  4QWO A;  1CI8 A;  2ZC7 A;  1NJ4 A;  5G18 A;  4JXG A;  5GLD A;  2LB5 A;  2H5S A;  2VKS A;  1ERQ A;  3HUO A;  4R6L A;  5K5B A;  3H82 A;  1QMF A;  1PW1 A;  3C7V A;  4DDS A;  1LSW A;  1YLY A;  3EQV A;  3UO9 A;  3E2K A;  1BLP A;  3G31 A;  2VV7 A;  4X69 A;  3VP0 A;  4M3K A;  3PBR A;  3TSG A;  1XA7 A;  3BFC A;  3M6H A;  1DJA A;  3HLB A;  4YWZ A;  3L9K A;  2P08 A;  3CUE C;  1T1C A;  5M18 A;  3QHY A;  5EVL A;  1H3Q A;  3CPT B;  1RGY A;  4X68 A;  3GDI A;  3T4J A;  3UPO A;  1SKF A;  3FZC A;  3NI9 A;  1IYS A;  4E3O A;  3E0Y A;  3LIB A;  1KVL A;  4KZ5 A;  1YSQ A;  5F69 A;  3TW8 A;  3UPN A;  2NUT C;  2VK3 A;  4HJ4 A;  4DJ2 A;  5AQA A;  4PM9 A;  4R3B A;  3PBT A;  1CK3 A;  1T19 A;  2WZX A;  4WYY A;  4OP8 A;  2V0U A;  3Q1F A;  5LBR A;  4ZJ2 A;  1BSG A;  3ZVW A;  5HWW A;  3IXG A;  5AQB A;  1ZG6 A;  3IXD A;  3V5M A;  1Z09 A;  5CGS A;  4R0Q A;  5CEC A;  3KX0 X;  3GV9 A;  4D60 A;  1MY8 A;  3ZG7 B;  2Y2L A;  2WAF A;  4X6T A;  4XUZ A;  4ID4 A;  4L9E A;  2GJ3 A;  2VZW A;  5TBM B;  4B4X A;  4O7D A;  3A0R A;  5F5Y A;  4E3N A;  1SKO A;  2Q9M A;  1EW0 A;  4DJ3 A;  5HSQ A;  5HDC A;  2JKF A;  2ZD8 A;  1NRF A;  4OON A;  4JGR A;  5DJU A;  5TJJ A;  3LI9 A;  4S2K A;  1CEG A;  2C6W B;  4RA7 A;  2HDR A;  1LI9 A;  3BEB A;  4BD0 A;  1P97 A;  4EET B;  1O07 A;  2QJ5 A;  3WS5 A;  2PYR A;  2XRN A;  4Z9Q A;  1NXY A;  1T18 A;  2EXA A;  4K91 A;  5GLA A;  3H82 B;  5KZH A;  4BMW A;  1XGI A;  2V0W A;  3L7H A;  4I39 A;  4BLM A;  5KIZ A;  3MXQ A;  2HDS A;  2J3T C;  4KZ9 A;  1FQG A;  4I38 A;  2XSS A;  2EX8 A;  1HTZ A;  1K6S A;  4QU3 A;  4LRZ E;  2W27 A;  1I2W A;  1S4R A;  2ZQ9 A;  1GSW A;  1MKM A;  2PU2 A;  4MN5 A;  2QZ6 A;  4U0T A;  4K08 A;  4LV3 A;  2WKE A;  4WLA A;  4I3A A;  4OPY A;  3NUL A;  4KZ4 A;  4S2P A;  2XF3 A;  3OPP A;  1MPL A;  2OAQ 1;  4MDZ A;  1D7E A;  4GS9 B;  1OTI A;  2XGN A;  3A0S A;  5FAP A;  1P9R A;  3C30 A;  5CTN A;  3OPR A;  4KZ7 A;  3LIF A;  4N92 A;  4A5R A;  1LT0 A;  1PWG A;  2Y91 A;  1OME A;  3LIA A;  4JXV A;  4LFU A;  4CLC D;  4R38 A;  4RX2 A;  5DVA A;  4E6W A;  1XJ2 A;  1OTD A;  3QP4 A;  4EEU A;  1K56 A;  2R9X A;  4S2L A;  5JYP A;  2Z6C A;  2HJ9 C;  3GR2 A;  3VP4 A;  4B4Z A;  2VJW A;  2HP6 A;  1Q2Q A;  3FPW A;  4UA7 A;  3G35 A;  3O88 A;  2Y2P A;  1YKD A;  2V9A A;  3MZE A;  5FQM A;  3ZVT A;  1JTG A;  2XFT A;  4I3I A;  3S7N A;  2PT7 A;  2WAE A;  2VGK A;  1SKO B;  3TOI A;  4R4S A;  1YPR A;  3N4I A;  4HP4 A;  5F1G A;  5HPF A;  1RCJ A;  4DXB A;  1F2K A;  4HY8 A;  3MMH A;  3LGO A;  4S2N C;  4BBU A;  3KSI A;  1HZO A;  2VA0 A;  2L4R A;  3ISG A;  1LHY A;  4CLC B;  3TRC A;  1K0K A;  2WAD A;  4R1G A;  5HAP A;  2GNX A;  3V67 A;  3I7J A;  2OOL A;  5IHV A;  4E3L A;  3KO6 A;  3D9Y A;  1MWU A;  1MXO A;  1BUL A;  3Q07 A;  1S66 L;  5DTT A;  4Y17 A;  3C4P A;  3OBF A;  2WKH A;  1W8Y A;  4OLG A;  3IQA A;  5FAS A;  2O9B A;  3UDF A;  4PM6 A;  3R7W A;  5AQ7 A;  4R3A A;  2VX8 A;  4P85 A;  4KZ6 A;  3JPU A;  3VE3 A;  3RTY A;  2ZQA A;  4P6Z S;  3H9W A;  3PBQ A;  4Y2F A;  3T50 A;  3W4O A;  2Y55 A;  1BLC A;  5FAT A;  4IED A;  1LSV A;  4R23 A;  4BBV A;  4ZDX A;  2K7S A;  2FFF B;  3BY9 A;  4E6X A;  3VE4 A;  2ZQC A;  2PBY A;  3SH9 A;  2W1T A;  3C5A A;  1XKZ A;  1HLU P;  4N9K A;  1XFQ A;  4Q0H A;  1M40 A;  3LR4 A;  2O99 A;  1ODV A;  3TE8 A;  3QNB A;  4K0W A;  5FQQ A;  1ONG A;  4OQ0 A;  3LEZ A;  2ZMA A;  5DFX A;  3AGE A;  2L0W A;  4NXE A;  3UB9 A;  5CEB A;  1DJB A;  4KZ3 A;  3ZHH A;  2R78 A;  5FQK A;  3RXW A;  3IHA A;  4LV1 A;  1TDG A;  4ME4 A;  1D1J A;  1K4E A;  3NC8 A;  3IT9 A;  4LEN A;  3Q82 A;  1MKI A;  1YMX A;  2Y2K A;  2A24 A;  4BQM A;  4LRY C;  2X01 A;  1PW8 A;  2O9A A;  5DFY A;  1ES2 A;  1HD8 A;  4X56 A;  1IEL A;  4GHI A;  2QWS A;  3EGX C;  2ZQD A;  4ETZ A;  4OP5 A;  4MBK A;  3OPH A;  3NBL A;  4PHT A;  3RJU A;  1GSV A;  3LIC A;  3G34 A;  4EBL A;  4S2I A;  4UA6 A;  4IBR A;  3VP3 A;  2AVX A;  3VOY A;  2DCF A;  2JHE A;  1JTD A;  3V50 A;  2QKP A;  4H8R A;  1E3U D;  4KZB A;  5DJT A;  2JKR I;  3N8L A;  1TEM A;  4HJ3 A;  2XH9 A;  4X25 A;  4ESP A;  1SDN A;  3S1Y A;  2ZL1 A;  2Y8H A;  3IF6 C;  5CXW A;  4MN7 A;  5F68 A;  5E2H A;  3ZCZ A;  2D02 A;  5L09 A;  5DF7 A;  1KGE A;  3IBJ A;  1NLY A;  3EOI A;  3DTI A;  4DRT A;  2X71 A;  1YSP A;  4JF6 A;  3R7W B;  3DWZ A;  4DXC A;  5E2F A;  1PFL A;  2HPB A;  3SS5 A;  4KQO A;  5CGW A;  1NLZ A;  1BZA A;  2PBD P;  3BEC A;  4KEN B;  4WMC D;  5FDH A;  4HBU A;  1C3B A;  5KSC A;  1L2S A;  2OAP 1;  1RP5 A;  3A3F A;  4C75 A;  1BTL A;  4E3J A;  2W1T B;  4FD8 A;  1FCM A;  3LEQ A;  2EX2 A;  3B33 A;  1L0D A;  3ZFZ A;  5IS1 A;  2JKT M;  1IOU A;  4JGO A;  1W63 M;  1NWZ A;  2W3H A;  3M6B A;  1ERM A;  1RGZ A;  2Y2I A;  1DP8 A;  5I94 A;  4NG2 A;  1SHV A;  4HES A;  5L2F A;  5CHM A;  3UB6 A;  3HLC A;  1YM1 A;  1DRM A;  5HD5 A;  2XFS A;  2XD1 A;  2Y2N A;  1BLH A;  3DAV A;  3P01 A;  3LR5 A;  2ZLY A;  2IWD A;  4WL9 A;  2KDK A;  1K57 C;  4N1H A;  4EBP A;  2DNS A;  2OWH A;  1YLZ A;  1XPB A;  1K4F A;  1K55 C;  2EX9 A;  4IVK A;  3BYD A;  1N9N A;  2H0Y A;  1I2S A;  2XK1 A;  4PM5 A;  3O87 A;  3WS0 A;  2PD7 A;  4GB7 A;  1KGF A;  2H0T A;  3PR6 A;  3WRZ A;  1YLT A;  4GHI B;  1TS7 A;  4YIN A;  3VP1 A;  1N9B A;  1K25 A;  2V2F F;  4XT2 A;  4NK3 A;  3IX4 A;  2WGV A;  3OPL A;  1FCO A;  4DE1 A;  3E2L A;  4DDY A;  2WUQ A;  2PD8 A;  3R4K A;  1WYB A;  4IHQ A;  3ZNT A;  3G30 A;  3N8R A;  3UPP A;  4LV2 A;  1WYC A;  3BFD A;  1P0Z A;  3AGD A;  3MJQ A;  5HDD A;  1FOF A;  2XD5 A;  5G4Z A;  5EVI A;  3Q7Z A;  3ZQ5 A;  2Y2J A;  2ZL1 B;  4HI4 A;  5EUA A;  2WKQ A;  4NET A;  4D2O A;  4UA9 A;  4G3K A;  3D3O A;  4GZB A;  3VSL A;  3UDI A;  1XXM A;  5AJG A;  5HZH A;  2ZM8 A;  2P04 A;  4L9G A;  3T4K A;  4E3M A;  5FDS A;  3F1O A;  4WF0 A;  1KDS A;  3F1N A;  4RVA A;  3PAG A;  3QP5 A;  2O9C A;  3MKF A;  2ACG A;  3C4O A;  4MBF A;  3IWI A;  3D72 A;  1ZG4 A;  1S1Y A;  4QY6 A;  3M2K A;  3PXP A;  4S2O A;  1EWZ A;  1CI9 A;  4PM8 A;  3WS4 A;  3CG5 A;  1XX2 A;  3BFE A;  4ZAM A;  2VV8 A;  1VEU A;  3OCN A;  4L0L A;  5KMW A;  1K6R A;  4WZ4 A;  2YKH A;  3MF0 A;  4OQH A;  4BJP A;  3BWL A;  3IF5 A;  4N9L A;  4UQI S;  4IUK A;  4Q0I A;  3BW6 A;  4ARZ A;  3SH8 A;  3GQZ A;  4WZ5 C;  5HWV A;  5EV0 A;  1H5X A;  4KQD A;  4IBX A;  1S67 L;  4XUX A;  3LIE A;  1XA1 A;  2DMW A;  1O7E A;  2V20 A;  1JWZ A;  3H7W A;  4EWF A;  2A49 A;  3ZG5 A;  3QP1 A;  5HDS A;  3NHQ A;  1YAX A;  2JKR M;  2EA9 A;  3MS6 A;  1G6A A;  2IA2 A;  3IWO A;  3HBR A;  3IWQ A;  3JVV A;  3IX3 A;  2P9V A;  1VQQ A;  2V8F A;  4JF5 A;  1S4S A;  3IH8 A;  3HCY A;  3C2W A;  3DWK A;  2GX5 A;  5TGF A;  5CER A;  2FZ0 A;  2WKP A;  4Y3I A;  3D4F A;  3NOT C;  1J3W A;  1OJG A;  1TF1 A;  3OOV A;  1JNU A;  4B9O A;  4GN2 A;  4EU0 A;  4DF6 A;  3MFX A;  4X1L A;  1Z6F A;  3PBN A;  3KYE A;  3N8S A;  1K54 A;  3OLO A;  4UEY A;  5EVI B;  2ZOH A;  3C8C A;  1NZO A;  1ALQ A;  2HZ5 A;  4QY5 A;  4UAA A;  4OLD A;  2ZC3 B;  3S7O A;  1L0E A;  4N1X A;  5DKL A;  4EQ1 A;  2RL3 A;  4EES A;  3ZYT A;  2G2W A;  3FG8 A;  4KZ8 A;  1DP6 A;  2H28 A;  3F1O B;  4PKY A;  1BUE A;  3IF6 A;  3F1N B;  4WM9 A;  3WS2 A;  4X53 A;  3PHY A;  1DY6 A;  1ZTU A;  4HP9 A;  2OLV A;  3Q81 A;  4OOL A;  2EFX A;  2WGI A;  2KX6 A;  2Q9N A;  4KG5 A;  4NKP A;  2QYB A;  3BFG A;  1TS6 A;  1FR1 A;  2W3G A;  3M2J A;  4OOY A;  4G3V A;  1IYP A;  1VEU B;  2EX6 A;  1IYQ A;  4RQ9 A;  3VOZ A;  1GA0 A;  5A93 A;  3WS1 A;  1GSX A;  4PPR A;  4FOF A;  4ARZ B;  4QJG A;  2Y2O A;  2Y4A A;  2EXB A;  4ZJ3 A;  1N4O A;  4LPZ A;  4R70 A;  3MKE A;  4WN5 A;  5TR7 A;  2PHY A;  2A2L A;  1TVF A;  4GKU A;  3RH8 B;  2B18 A;  3GSG A;  2B5R A;  5CRF A;  2HDQ A;  3NIA A;  5GL9 A;  1ERO A;  4WEK A;  1BYW A;  4PM7 A;  4LCL A;  2XR0 A;  1GCE A;  4NXF A;  5E2E A;  1ESU A;  4KZA A;  2BTF P;  1VET A;  2QMI A;  3A0V A;  2P9V B;  4MMN A;  5FQ9 A;  2XQZ A;  1K57 A;  5FEG A;  3FC7 A;  4PAU A;  1L3L A;  1K56 D;  1F5M A;  4ZBE A;  3KSH A;  4O8G A;  1SCW A;  3K3C A;  1W63 Q;  5FEF A;  3DTE A;  5CHJ A;  1Y54 A;  2UV0 E;  3KYZ A;  4OQG A;  4YNR A;  2J8Y A;  3HLW A;  1MC0 A;  2VLG A;  1CEF A;  3CWF A;  3FPV A;  2KLI A;  1XJ6 A;  2WGW A;  1TDL A;  4HQA A;  4CJN A;  3P7N A;  2W3E A;  3U4L P;  1VHM A;  1PI5 A;  3LFV A;  3MQQ A;  5M1A A;  4Z1W A;  2EFU A;  3S7Q A;  3CUE A;  1KDW A;  4GDB A;  3T4Q A;  1XGJ A;  3IS2 A;  4CLC C;  2VGL M;  1NY0 A;  3BM6 A;  4Y0O A;  1J9M A;  5F83 A;  1L0G A;  4P87 A;  3PBS A;  2EWV A;  1U60 A;  1M6K A;  2V1Z A;  2P7J A;  3MZD A;  2W0N A;  2XRO A;  3S4X A;  3A3E A;  3KYQ A;  3UB5 P;  3U2A A;  1TS8 A;  3WRT A;  4X55 A;  3T1R A;  1TS0 A;  1VM1 A;  2L1M A;  4KUO A;  2W3D A;  5DF8 A;  3ZDJ A;  4CLC E;  2CC1 A;  4JBF A;  1JWP A;  5J3W A;  2HP5 A;  5HAI A;  3LR0 A;  1ES3 A;  4MBH A;  4O0P A;  1UWN X;  4LLO B;  2X02 A;  1GHP A;  3IX8 A;  4BL2 A;  1GA9 A;  5EE8 A;  2NUP C;  3A3I A;  5IU1 A;  3E98 A;  1CQA A;  2Y2G A;  3O86 A;  2IWB A;  5DTS A;  2XA7 M;  1I5Q A;  1ONH A;  5HX9 A;  2VGJ A;  3A3J A;  1QME A;  4B88 A;  4IVI A;  1IFQ A;  1S6R A;  4GCZ A;  5HPI A;  2JC7 A;  1W79 A;  2OV5 A;  1DJC A;  4HBT A;  1MWT A;  3T1S A;  1NRJ A;  2PRF A;  2FH5 A;  4OKP A;  4JF4 A;  4BEN A;  2J80 A;  3SH7 A;  4WBG A;  2MJ6 A;  3ITA A;  4KQR A;  2C5W B;  4EXO A;  1AXB A;  1MWR A;  2G7U A;  3EWK A;  4K0X A;  2Y79 A;  3O5Y A;  2Q0O A;  3ZG9 B;  4WZ5 A;  4Y5F A;  2PAV P;  1H8Y A;  2I72 A;  5FAQ A;  1CJF A;  2HDU A;  4MNR A;  4OPR A;  1XP4 A;  3ZG0 A;  5J8X A;  1VET B;  2D01 A;  3QP8 A;  3CLO A;  3G32 A;  2B95 A;  3LYX A;  2ZM2 A;  1JVJ A;  4JKT A;  1OPX A;  4IUH A;  4H6J A;  3NCK A;  3EQU A;  4F3L A;  3BRM A;  3SS4 A;  3OZH A;  1A0K A;  4MCW A;  2UWX A;  3PBO A;  2JN7 A;  1OTA A;  3FWL A;  3K2N A;  4G3W A;  5FQJ A;  3DW0 A;  1MWS A;  4II7 A;  4NEE D;  3F1P A;  5FI6 A;  4BD1 A;  5A8B A;  3BFF A;  2WGW B;  1WE4 A;  1NYM A;  3EEH A;  3W2Z A;  1OT9 A;  3G4P A;  3NOP C;  5TBM A;  2BG1 A;  1S0W A;  4HHD A;  4QB8 A;  3B47 A;  3ULF A;  1SZV A;  2JBF A;  1PWD A;  3SZT A;  3SOI A;  4S2J A;  1N9O A;  4F94 A;  2VV6 A;  4EV4 A;  5FI2 A;  1FCN A;  4OQI A;  2P74 A;  2QHK A;  3TJZ C;  3VSK A;  2V1B A;  4WEJ A;  2A24 B;  1LLB A;  2LB9 A;  4HH2 A;  4Q0J A;  5A90 A;  2HV1 A;  3GEC A;  3N7W A;  3UY6 A;  4CPK A;  5GLB A;  1P9W A;  3UMD A;  3UE3 A;  4C3Q A;  3NY4 A;  2BLS A;  5FA7 A;  4UHU A;  5FSR A;  1KE3 A;  5E43 A;  3MZF A;  1IYO A;  4OVD A;  3MFD A;  3ZGA B;  5HL1 A;  2H10 A;  5F82 A;  1BLS A;  2M1C A;  4Q8I A;  1G68 A;  1VB6 A;  3E4O A;  3BQA A;  3MSH A;  2J3T D;  3CZD A;  4E04 A;  5JYO A;  4IJG A;  4MLL A;  1IEM A;  1SDE A;  3ZG8 B;  5HW3 A;  3UE1 A;  3A3D A;  5BOH A;  3PYP A;  4FCF A;  1EI5 A;  5CHU A;  1OJ5 A;  2QPN A;  1G28 A;  4S2N A;  3TG9 A;  2J9P A;  4QD4 A;  5HWT A;  2HGV A;  5A92 A;  4PMA A;  4HEF A;  3IH9 A;  4GS9 A;  1UWP X;  5FAO A;  5HAR A;  3PAE A;  2XDM A;  3HVF A;  4FH2 A;  3IHB A;  3GTC A;  3HRE A;  2K31 A;  5I5L A;  4H6J B;  4F3L B;  3NEC A;  2ZQ8 A;  1YT4 A;  2K2N A;  4EBN A;  1LL9 A;  1XJ4 A;  3G2Y A;  4FSF A;  3F1P B;  3DBA A;  5FQI A;  2KOI A;  2RCX A;  4OH0 A;  1ZHH B;  2W1R A;  5AVF A;  2Z6D A;  1XJ3 A;  2FFY A;  4WEL A;  4MN6 A;  4LCM A;  5CGX A;  1MBL A;  3HUN A;  1OTE A;  4FTX A;  5A91 A;  5EM0 A;  2OSU A;  3IXH A;  4EUZ A;  5J4E A;  5EVI D;  3BJN A;  3SS3 A;  5E2G A;  3FYZ A;  3ITB A;  5DTK A;  3BY8 A;  3JVU A;  1G6O A;  3E4P A;  4CLC A;  2OWJ A;  2ZBB A;  4P6B A;  4LV0 A;  1F9I A;  1ZC2 A;  3CHW P;  4ZJ1 A;  2Z2L B;  2JKG A;  3UE6 A;  4X1M A;  2V8C A;  1H8M A;  5EPH A;  3LY4 A;  5L07 A;  4HH3 A;  1T1A A;  2B02 A;  1GHM A;  4KQQ A;  4XT2 B;  4E3I A;  2W3F A;  3LUQ A;  3LCE A;  3CI6 A;  1ES5 A;  3HL9 A;  4R3J A;  3LY3 A;  4OPQ A;  4Y15 A;  4DKI A;  2J9O A;  3UN7 A;  1ZKJ A;  3MR0 A;  4KG2 A;  3GRJ A;  2GDN A;  1PNE A;  2ZOI A;  3VOL A;  1E4D A;  4NXG A;  3BLM A;  3QNC A;  5EVE A;  2VGL S;  5EEC A;  4EEP A;  3VFH A;  5MC7 A;  1PZO A;  1YQS A;  2PR6 A;  3NOU C;  1PWC A;  4NXB A; 
#chains in the Genus database with same CATH homology
 4ZJ2 A;  1BSG A;  3NDE A;  3ZVW A;  1BZA A;  2WGW A;  1TDL A;  3BEC A;  3IXG A;  4KEN B;  4WMC D;  4BL3 A;  4CJN A;  3V3R A;  5AQB A;  1ZG6 A;  1GHI A;  3FV7 A;  1E25 A;  1W8Q A;  1PI5 A;  1YLP A;  3IXD A;  5FDH A;  4QHC A;  4HBU A;  3V5M A;  5M1A A;  2IWC A;  5CGS A;  2EFU A;  2Z2M B;  4R0Q A;  1YLJ A;  1C3B A;  5KSC A;  1L2S A;  5CEC A;  1YLW A;  1KDW A;  4GDB A;  1RP5 A;  1XGJ A;  3A3F A;  5CTM A;  1BTL A;  4C75 A;  4DE0 A;  4E3J A;  1NY0 A;  4FD8 A;  3BM6 A;  3GV9 A;  4Y0O A;  1J9M A;  5F83 A;  1L0G A;  1FCM A;  2EX2 A;  2G2U A;  4P87 A;  3PBS A;  2XLN A;  5KSH A;  2J7V A;  1L0D A;  1MY8 A;  1U60 A;  1M6K A;  2V1Z A;  3MZD A;  2Y2L A;  3ZG7 B;  3ZFZ A;  5TFQ A;  5GHZ A;  2WAF A;  4X6T A;  3A3E A;  3S4X A;  4XUZ A;  4ID4 A;  4OPZ A;  1IKI A;  3UDX A;  1Q2P A;  4GD8 A;  3M6B A;  1ERM A;  1RGZ A;  2Y2I A;  4GDN A;  4B4X A;  3WRT A;  4O7D A;  4X55 A;  5I94 A;  4DE3 A;  1SHV A;  4HES A;  5L2F A;  1VM1 A;  4RX3 A;  5CHM A;  1BT5 A;  3CMZ A;  4FH4 A;  4E3N A;  5DF8 A;  2Q9M A;  3ZDJ A;  3HLC A;  1YM1 A;  2XFS A;  2XD1 A;  2CC1 A;  4JBF A;  2Y2N A;  1BLH A;  1JWP A;  2HP5 A;  2ZD8 A;  2ZLY A;  3BLS A;  5HAI A;  5FI7 A;  1FSY A;  1ES3 A;  2IWD A;  1K38 A;  1NRF A;  3CJM A;  4MBH A;  4OON A;  2A3U A;  2X02 A;  1GHP A;  1K57 C;  4N1H A;  4EBP A;  4S2K A;  1GA9 A;  5EE8 A;  1CEG A;  2C6W B;  4BL2 A;  2DNS A;  4RA7 A;  3A3I A;  1YLZ A;  2HDR A;  1LI9 A;  3BEB A;  4BD0 A;  1XPB A;  5EVI C;  1K4F A;  2Y2G A;  1K55 C;  3WWX A;  1O07 A;  2EX9 A;  4IVK A;  3O86 A;  2IWB A;  3BYD A;  5DTS A;  2H0Y A;  3WS5 A;  3RXX A;  1I2S A;  3S22 A;  2XK1 A;  4PM5 A;  3O87 A;  1I5Q A;  1ONH A;  4Z9Q A;  5HX9 A;  3WS0 A;  1NXY A;  2VGJ A;  4R4R A;  3A3J A;  4GB7 A;  1QME A;  4JLF A;  4B88 A;  4IVI A;  1KGF A;  2H0T A;  1S6R A;  2EXA A;  3WRZ A;  1YMS A;  1YLT A;  4YIN A;  3VP1 A;  1N9B A;  2JC7 A;  4K91 A;  1W79 A;  2R9W A;  2OV5 A;  1K25 A;  1DJC A;  5GLA A;  2V2F F;  3Q7V A;  4HBT A;  4EQI A;  4MEZ A;  5KZH A;  1MWT A;  3UNW A;  2ZC4 B;  1XGI A;  4NK3 A;  2WGV A;  4OKP A;  3OPL A;  1FCO A;  4BLM A;  4DE1 A;  3E2L A;  4JF4 A;  4BEN A;  4DDY A;  2WUQ A;  3ZNT A;  1WYB A;  2HDS A;  3G30 A;  3N8R A;  3NDG A;  4KZ9 A;  3FKV A;  3UPP A;  3HLD A;  1FQG A;  1LL5 A;  4LV2 A;  3ITA A;  4KQR A;  4WBG A;  3SH7 A;  1WYC A;  2C5W B;  2EX8 A;  3BFD A;  2Y2H A;  1HTZ A;  1AXB A;  1MWR A;  2WK0 A;  4K0X A;  1K6S A;  3AGD A;  4QU3 A;  2OLU A;  4U3T A;  1I2W A;  2ZQ9 A;  1FOF A;  2PU2 A;  2XD5 A;  4Y0T A;  3ZG9 B;  4WZ5 A;  3FKW A;  1H8Y A;  5EVI A;  2I72 A;  1K55 A;  1KGG A;  3IXB A;  3Q7Z A;  2Y2J A;  5FAQ A;  2HDU A;  2QZ6 A;  4MNR A;  1KE4 A;  4OPR A;  3MXS A;  4NET A;  1XP4 A;  5EUA A;  3ZG0 A;  4D2O A;  5J8X A;  3G2Z A;  4U0T A;  4UA9 A;  3AGF A;  4GZB A;  4LV3 A;  2WKE A;  1W7F A;  5GHX A;  3VSL A;  2E8I A;  3UDI A;  3C7U A;  1XXM A;  3G32 A;  2ZM8 A;  4OPY A;  2ZM2 A;  1JVJ A;  4JKT A;  2JE5 A;  3ZNY A;  3NCK A;  1H8Z A;  3EQU A;  4KG6 A;  4KZ4 A;  3PTE A;  3BRM A;  2WYX A;  3SS4 A;  4S2P A;  4E3M A;  3OZH A;  2XF3 A;  3OPP A;  1MPL A;  2UWX A;  3PBO A;  4JXS A;  1KDS A;  1ESI A;  4DE2 A;  3FWL A;  2XGN A;  5M19 A;  5FAP A;  5FQJ A;  1ES4 A;  5CTN A;  3DW0 A;  1MWS A;  3OPR A;  1E3U A;  4KZ7 A;  4N92 A;  4A5R A;  1PWG A;  5FI6 A;  4BD1 A;  2Y91 A;  3BFF A;  4RVA A;  2WGW B;  1WE4 A;  3PAG A;  1OME A;  5HFO A;  1NYM A;  4JXV A;  3MKF A;  3C4O A;  4MBF A;  3IWI A;  4S2M A;  1NYY A;  1ZG4 A;  4QY6 A;  3M2K A;  2ZM0 A;  4S2O A;  5U47 A;  3G4P A;  4RX2 A;  5DVA A;  3DTM A;  4E6W A;  1EWZ A;  2BG1 A;  3V3S A;  4JPM A;  1S0W A;  1CI9 A;  4PM8 A;  3WS4 A;  3CG5 A;  1XX2 A;  4QB8 A;  5HAQ A;  3BFE A;  4ZAM A;  3IF6 B;  1PZP A;  1K56 A;  2JBF A;  1PWD A;  2R9X A;  3SOI A;  4S2J A;  4S2L A;  5JYP A;  3GR2 A;  2DRW A;  1PYY A;  4F94 A;  3OCN A;  4L0L A;  3VP4 A;  4B4Z A;  3MXR A;  2HP6 A;  1Q2Q A;  5KMW A;  1K6R A;  4UA7 A;  4OQH A;  3G35 A;  4WZ4 A;  4BJP A;  3O88 A;  4EV4 A;  2Y2P A;  5FI2 A;  3IF5 A;  1FCN A;  3MZE A;  4OQI A;  5FQM A;  4N9L A;  1JTG A;  2P74 A;  2XFT A;  3ZVT A;  4E3K A;  3VSK A;  3HUM A;  4WEJ A;  5F1F A;  2WAE A;  1FR6 A;  2VGK A;  3SH8 A;  1LLB A;  4WMC A;  3GQZ A;  4WZ5 C;  3TOI A;  5DF9 A;  1H5X A;  1W5D A;  4IBX A;  4OOM A;  4JXW A;  4R4S A;  3VP2 A;  4XUX A;  5A90 A;  1KVM A;  1XA1 A;  3W8K A;  3N4I A;  1O7E A;  3N7W A;  5F1G A;  1RCJ A;  3UY6 A;  4CPK A;  5EOO A;  4Y0U A;  5GLB A;  4DXB A;  2V20 A;  1JWZ A;  4S2N C;  1L0F A;  1HZO A;  3UE3 A;  4EWF A;  2Y2Q A;  4C3Q A;  3ISG A;  3N6I A;  1K54 C;  2A49 A;  3NY4 A;  2BLS A;  5FA7 A;  3ZG5 A;  1LHY A;  4GOG A;  1KE0 A;  2ZJ9 A;  4UHU A;  5FSR A;  1KE3 A;  2WAD A;  4R1G A;  5HAP A;  3I7J A;  5IHV A;  5E43 A;  4E3L A;  3MZF A;  1IYO A;  1G6A A;  4OVD A;  2WZZ A;  3IWO A;  5GHY A;  3MFD A;  1MWU A;  1MXO A;  3HBR A;  3IWQ A;  3ZGA B;  5HL1 A;  1BUL A;  2Y59 A;  2H10 A;  3Q07 A;  5F82 A;  5DTT A;  1BLS A;  2P9V A;  1VQQ A;  4Q8I A;  3C4P A;  1IKG A;  1G68 A;  2WKH A;  4JF5 A;  3IH8 A;  4XXR A;  1W8Y A;  4OLG A;  3DWK A;  3IQA A;  5FAS A;  5TGF A;  3Q7V B;  3UDF A;  3CZD A;  5JYO A;  4PM6 A;  4MLL A;  5AQ7 A;  5CER A;  4YFM A;  4RYE A;  2ZQ7 A;  4P85 A;  1IEM A;  1SDE A;  3ZG8 B;  4KZ6 A;  5HW3 A;  3UE1 A;  3HLE A;  3OCL A;  3A3D A;  3D4F A;  5BOH A;  2ZQA A;  2PU4 A;  3PBQ A;  3W4O A;  2Y55 A;  4P0M A;  1HVB A;  1BLC A;  4FCF A;  4GN2 A;  5FAT A;  1EI5 A;  4IED A;  4DF6 A;  5CHU A;  3UE0 A;  3JYI A;  2QPN A;  3GMW A;  4R23 A;  3W4Q A;  4S2N A;  3TG9 A;  2JCH A;  1Z6F A;  2J9P A;  3PBN A;  4QD4 A;  4ZDX A;  3N8S A;  2FFF B;  1K54 A;  5EOE A;  5A92 A;  4E6X A;  4PMA A;  2ZQC A;  4HEF A;  3IH9 A;  5EVI B;  2PBY A;  1NZO A;  2ZC6 B;  4ZTK A;  3LO7 A;  5FAO A;  3SH9 A;  4C6Y A;  5HAR A;  3W4P A;  3PAE A;  1ALQ A;  3C5A A;  4QY5 A;  2XDM A;  4UAA A;  1XKZ A;  4OLD A;  2ZC3 B;  2XEP A;  3O3V A;  1NZU A;  4N9K A;  2Y2M A;  1L0E A;  3HVF A;  3IHB A;  4FH2 A;  4N1X A;  4U0X A;  2RL3 A;  1M40 A;  3GTC A;  3HLF A;  3QNB A;  3HRE A;  3HLG A;  4K0W A;  5FQQ A;  2ZQ8 A;  2G2W A;  2HP9 A;  1ONG A;  1YT4 A;  4OQ0 A;  4KZ8 A;  3LEZ A;  5D3O A;  4EBN A;  2ZMA A;  1LL9 A;  3B3X A;  5AQ9 A;  3GVB A;  1BUE A;  3AGE A;  3IF6 A;  4GNU A;  3G2Y A;  4Y7P A;  4WM9 A;  4FSF A;  5CEB A;  1DJB A;  4KZ3 A;  3WS2 A;  4X53 A;  3ZHH A;  1JWV A;  1PI4 A;  1DY6 A;  5CED A;  5FQI A;  2RCX A;  1LI0 A;  5FQK A;  3RXW A;  4OH0 A;  3IHA A;  2OLV A;  4LV1 A;  3Q81 A;  4OOL A;  1TDG A;  2EFX A;  3OC2 A;  2WGI A;  2Q9N A;  3MBZ A;  2FFY A;  1K4E A;  3NC8 A;  3IT9 A;  4KG5 A;  4LEN A;  2WKI A;  3P98 A;  3Q82 A;  3VFF A;  3VMA A;  1MKI A;  1YMX A;  2Y2K A;  3BFG A;  4WEL A;  1FSW A;  4LCM A;  5CGX A;  4BQM A;  1FR1 A;  1MBL A;  3V39 A;  3M2J A;  1PIO A;  4OOY A;  1IYP A;  3HUN A;  5GLC A;  5A91 A;  3P09 A;  2X01 A;  2EX6 A;  1PW8 A;  2ZC5 B;  1IYQ A;  4GD6 A;  2OSU A;  3VOZ A;  1CI8 A;  3IXH A;  4EUZ A;  1GA0 A;  2ZC7 A;  1NJ4 A;  5EVI D;  1ES2 A;  1HD8 A;  4X56 A;  5G18 A;  1IEL A;  5E2G A;  3FYZ A;  4JXG A;  3SS3 A;  5A93 A;  3WS1 A;  5GLD A;  3ITB A;  5DTK A;  2H5S A;  1ERQ A;  3HUO A;  4PPR A;  2ZQD A;  4QJG A;  1QMF A;  2Y2O A;  1PW1 A;  3C7V A;  4OP5 A;  2Y4A A;  4DDS A;  4MBK A;  3OPH A;  1YLY A;  4P6B A;  4LV0 A;  3EQV A;  3NBL A;  2EXB A;  3RJU A;  4ZJ3 A;  1ZC2 A;  1N4O A;  4ZJ1 A;  2Z2L B;  3MKE A;  3G34 A;  5TR7 A;  3UO9 A;  4EBL A;  3E2K A;  4S2I A;  4UA6 A;  1BLP A;  3G31 A;  1TVF A;  4IBR A;  4GKU A;  5EPH A;  4X69 A;  3VP0 A;  3VP3 A;  4M3K A;  3GSG A;  3LY4 A;  2B5R A;  3VOY A;  2DCF A;  3PBR A;  3TSG A;  1XA7 A;  5CRF A;  1JTD A;  3BFC A;  3V50 A;  2HDQ A;  3M6H A;  3NIA A;  1GHM A;  1E3U D;  1ERO A;  4H8R A;  4KZB A;  4WEK A;  5GL9 A;  1DJA A;  3HLB A;  4KQQ A;  4PM7 A;  3N8L A;  1TEM A;  4E3I A;  5M18 A;  2XH9 A;  4LCL A;  3QHY A;  2XR0 A;  5EVL A;  1GCE A;  1SDN A;  5E2E A;  3S1Y A;  1ESU A;  1RGY A;  3IF6 C;  4KZA A;  4X68 A;  5CXW A;  3UPO A;  1SKF A;  3LCE A;  1ES5 A;  2QMI A;  3HL9 A;  3FZC A;  3NI9 A;  4R3J A;  5E2H A;  3ZCZ A;  1IYS A;  2P9V B;  3LY3 A;  4E3O A;  4OPQ A;  5DF7 A;  1KGE A;  4DKI A;  2J9O A;  5FQ9 A;  3UN7 A;  1KVL A;  1ZKJ A;  4KZ5 A;  2XQZ A;  4DRT A;  4KG2 A;  1K57 A;  1K56 D;  2X71 A;  2GDN A;  3GRJ A;  4ZBE A;  1SCW A;  3UPN A;  4JF6 A;  1E4D A;  3DWZ A;  4DXC A;  5E2F A;  3BLM A;  5CHJ A;  1Y54 A;  3QNC A;  4OQG A;  5EEC A;  5AQA A;  3VFH A;  4PM9 A;  1PZO A;  1YQS A;  2HPB A;  2J8Y A;  3HLW A;  3PBT A;  1CK3 A;  4R3B A;  1PWC A;  3SS5 A;  2WZX A;  4KQO A;  1CEF A;  5CGW A;  4WYY A;  4OP8 A;  3Q1F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...