3E2KA

Crystal structure of the kpc-2 beta-lactamase/beta-lactamase inhibitor protein (blip)
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
261
structure length
261
Chain Sequence
AEPFAKLEQDFGGSIGVYAMDTGSGATVSYRAEERFPLCSSFKGFLAAAVLARSQQQAGLLDTPIRYGKNALVPWSPISEKYLTTGMTVAELSAAAVQYSDNAAANLLLKELGGPAGLTAFMRSIGDTTFRLDRWELELNSAIPSDARDTSSPRAVTESLQKLTLGSALAAPQRQQFVDWLKGNTTGNHRIRAAVPADWAVGDKTGTCGVYGTANDYAVVWPTGRAPIVLAVYTRAPNKDDKHSEAVIAAAARLALEGLGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbapenemase
publication title Structural and biochemical characterization of the interaction between KPC-2 beta-lactamase and beta-lactamase inhibitor protein
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Hydrolase/hydrolase inhibitor
total genus 92
structure length 261
sequence length 261
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2008-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3e2kA00
1KGGA 2IWBA 1JWPA 1WE4A 2WAEA 1FR1A 4OOMA 4FH4A 4DXCA 3WRZA 4S2JA 4Z9QA 4BJPA 3BFCA 4KQRA 3BFDA 2ZC5B 1XGIA 1YLTA 1YLZA 4KZ8A 5E2EA 2XK1A 1K54C 4ZTKA 3N7WA 3VOYA 3C7VA 5GLBA 3PBQA 3W4OA 1PYYA 2ZC6B 3PTEA 4R23A 1ZG6A 3UNWA 1CI9A 3Q81A 3D4FA 1PWCA 1XPBA 1U60A 4U0XA 5FQMA 3BRMA 1DJAA 4DXBA 1WYCA 3BLMA 3IWOA 2ZQ8A 2J8YA 4S2OA 3ZG7B 4OQ0A 3HLCA 4U0TA 1ES4A 3AGEA 4Y7PA 4OP8A 1PW8A 4N9KA 4S2LA 1I5QA 3O88A 5EVIB 1W7FA 2Z2MB 1CEGA 4LENA 5EPHA 1EROA 4R4RA 1FOFA 3Q7VA 3ZDJA 3E2KA 1K25A 1LHYA 2R9XA 3I7JA 3HVFA 4WYYA 1QMFA 4JBFA 1IYOA 4LV1A 4GNUA 1IEMA 4PM7A 2WK0A 4GD8A 4JKTA 3VP3A 1ESUA 4KZ5A 1G68A 4M3KA 4XUZA 3W8KA 2ZQ7A 3ZNTA 2ZM0A 3PBOA 2OLUA 1GA9A 4RX2A 4S2NA 5E2HA 4E3OA 4X56A 3E2LA 2RL3A 2C6WB 3WWXA 3BLSA 3HLDA 4OLDA 3BEBA 3N8LA 4LCMA 1NY0A 4BL3A 4HBTA 4E3LA 2Y2HA 3PBRA 2QZ6A 2PU4A 4MEZA 1FSWA 3SH8A 3UDXA 5HW3A 2FFYA 2ZC7A 2HDSA 1JWVA 4RX3A 4S2IA 4Y0UA 5DTTA 5HFOA 1K55A 2IWDA 4YINA 1H8YA 2XF3A 5EOEA 2WGVA 3M6BA 5FQQA 4CJNA 3VMAA 5FSRA 4KG2A 5F83A 1QMEA 5AQ9A 4WZ5A 1MY8A 4K0WA 4YFMA 3OZHA 3OPHA 4JXVA 4UAAA 1DJBA 3PAGA 3MFDA 3QNBA 4OPQA 5EVID 3SOIA 2EX2A 2XD5A 1KGFA 4EBLA 5TR7A 5FA7A 4JF5A 2QMIA 2X02A 4P0MA 4OPYA 2B5RA 1G6AA 2Y4AA 4FSFA 4GOGA 1TDLA 3NBLA 1SHVA 5EOOA 4B4XA 4QB8A 4QY5A 3IF6C 3SS3A 1Q2PA 2G2WA 3FV7A 4B88A 1BTLA 5AQ7A 1LL5A 2Z2LB 4OLGA 5GL9A 3Q82A 4NETA 3V3RA 1YMXA 4IVIA 3UPNA 2Q9MA 1K4FA 2HDRA 1PZOA 1JWZA 3GV9A 1L0EA 3OPRA 4Y0OA 5G18A 4OVDA 2XFSA 3NI9A 5TFQA 3WRTA 1K57A 4Q8IA 5E2FA 4JPMA 5HX9A 3GMWA 3MBZA 3N6IA 3VFHA 3ISGA 4OPZA 1BLHA 4B4ZA 4DDSA 3IWIA 5EVIA 5FATA 1MWSA 1IKGA 4GDNA 4GN2A 2JE5A 4OP5A 4RA7A 3BFEA 3HLGA 3MZEA 2Y2LA 5M19A 4EBNA 3LY3A 4IVKA 1BLPA 5CRFA 4E3JA 4BQMA 5D3OA 1IKIA 5GLDA 3V50A 4HEFA 3NDEA 1MPLA 1PI5A 3CJMA 2E8IA 5FAPA 5KSCA 1ZKJA 3G31A 3VFFA 1YQSA 1JTGA 1N9BA 2I72A 5HL1A 4JLFA 4S2KA 4ZJ3A 4C75A 3C4PA 1MBLA 2XGNA 4FCFA 4KZ9A 1O7EA 5J8XA 1NJ4A 5FQIA 2Y55A 4MNRA 4LV3A 3ZG9B 2FFFB 2EXBA 3HL9A 4Y0TA 1ZG4A 4WM9A 1TDGA 4KG5A 4OONA 2X01A 4S2NC 1LLBA 1KE4A 1DJCA 2Y2MA 3Q1FA 1KVLA 1EWZA 5CGXA 3HLWA 3LCEA 4KENB 5GHXA 5GLCA 5CECA 1FR6A 1NYYA 3G34A 1HD8A 4DE3A 1KGEA 3RXXA 3GTCA 1MXOA 4KQQA 5DTKA 3HUNA 4LV0A 1H8ZA 1ES3A 1ALQA 1K55C 3BM6A 4QU3A 1L0GA 5KMWA 3ZG8B 4GDBA 1K38A 3DW0A 3W4QA 4WZ5C 1BLCA 3RJUA 2P74A 2PBYA 2Q9NA 3UN7A 4CPKA 5FAQA 2XDMA 4A5RA 3PBSA 4E3KA 3TSGA 4OH0A 1DY6A 3OCNA 2J9OA 3PBTA 4OPRA 1ERMA 5FI6A 5CTMA 3FYZA 3UY6A 1EI5A 1FCMA 3WS4A 1N4OA 2EFXA 3AGFA 1E25A 3DTMA 4EQIA 5CTNA 1RP5A 2V2FF 3UO9A 5FI2A 2HDUA 4PM5A 3HREA 3MXRA 1ERQA 3MXSA 3DWKA 3HLBA 3WS2A 4RYEA 5A92A 1IELA 5A90A 3C4OA 4S2MA 4WEKA 2IWCA 1ONGA 3ITBA 5EUAA 5HAIA 4EBPA 3BYDA 1YMSA 3P98A 3NIAA 5CHJA 1K57C 1VM1A 2OSUA 1CK3A 5EE8A 2EX8A 2WGWA 2WZXA 3IXDA 4MBFA 4BD0A 3LY4A 4L0LA 5AQAA 5JYPA 4ID4A 3IH8A 5EVIC 2OV5A 2Y2IA 4GD6A 3CMZA 4R4SA 5M1AA 3ZFZA 5FAOA 2Y2JA 3GQZA 4NK3A 1XP4A 3IXBA 4K0XA 3BFGA 1O07A 3S4XA 1TVFA 1K56D 4R3JA 4EUZA 5F1FA 4KZ3A 4EV4A 1GA0A 3HUMA 3WS1A 4X55A 2UWXA 4E6WA 3ZCZA 2CC1A 3NCKA 4OOLA 5HAPA 4X53A 4JF4A 2EX6A 2H0YA 3C5AA 5FASA 1PZPA 4P87A 5I94A 4HBUA 4R3BA 3HLFA 2QPNA 3ZGAB 2WAFA 4E3NA 1W5DA 4FH2A 1Z6FA 2HP6A 3N4IA 4UA7A 4BD1A 4LV2A 3IQAA 4E3IA 2JCHA 2Y2KA 2Y2NA 1IYSA 3VP0A 2VGKA 1KE3A 5CEBA 4RVAA 5FI7A 3MKEA 5HARA 3GR2A 5FQ9A 1WYBA 1ES5A 3FKVA 3A3EA 3VP4A 5GLAA 2ZJ9A 3EQUA 1YLWA 3SH9A 1XA7A 1K56A 4ZAMA 4KZAA 3NDGA 2DCFA 3GVBA 5CEDA 5CHMA 2XEPA 4C3QA 5FQJA 4OOYA 4PPRA 3G4PA 3OPPA 2R9WA 3LO7A 2ZQCA 2A3UA 1ZC2A 2J7VA 2G2UA 2J9PA 1L2SA 3VSKA 4DRTA 2HDQA 4KZ4A 4F94A 3IXHA 4U3TA 4OQGA 4JXSA 1YM1A 4WELA 4DF6A 1MWRA 1SCWA 2WKIA 1YLJA 3EQVA 4JF6A 4UHUA 1RGYA 3G32A 2A49A 3IWQA 1SKFA 1XKZA 5IHVA 4P6BA 4WZ4A 3FKWA 3FWLA 3ZHHA 2VGJA 5U47A 1XX2A 3G2YA 3IH9A 1CEFA 1VQQA 2ZLYA 3M6HA 3UE3A 2HP5A 2JC7A 3HLEA 3O86A 1NZUA 2ZM2A 4R1GA 2WZZA 3G35A 1H5XA 1I2SA 5E43A 1BUEA 1PW1A 2ZC3B 4LCLA 4JXWA 3A3IA 1L0DA 1NZOA 1KVMA 5A93A 5GHZA 1IYQA 5KZHA 3TOIA 2HP9A 3RXWA 1E3UD 2V20A 3IT9A 2Y2PA 2Y59A 3HUOA 4DDYA 1TEMA 3LEZA 1FCOA 4WMCD 1J9MA 1W79A 4WEJA 4ZBEA 1FCNA 2XR0A 2ZC4B 3Q7ZA 2WUQA 1YLYA 2P9VB 3QHYA 5AQBA 2Y2OA 2WKHA 1AXBA 2H0TA 4XXRA 1ESIA 4KZBA 3B3XA 1GCEA 4X69A 2H5SA 3BECA 4ZJ2A 5CGWA 4KG6A 4OQIA 2DNSA 5KSHA 4C6YA 1S0WA 5CHUA 1GHIA 1BULA 1BT5A 4GZBA 4X6TA 2XQZA 4XUXA 3SH7A 3NC8A 5FQKA 5GHYA 2ZQAA 4X68A 1PIOA 3UE0A 3O3VA 3IHBA 3MKFA 1E3UA 4EWFA 1RCJA 4N92A 5L2FA 1XA1A 1I2WA 3NY4A 4PMAA 5F1GA 3TG9A 4QY6A 3UDFA 2WADA 3V5MA 1NRFA 4WMCA 3IXGA 1K6SA 3OCLA 5EECA 4IBRA 4DE0A 4H8RA 3IHAA 5E2GA 2RCXA 1RGZA 2HPBA 3SS4A 1NYMA 3N8SA 1Y54A 3OPLA 5DTSA 1GHPA 1NXYA 4MBKA 1XXMA 3IF5A 5FDHA 2XFTA 3VSLA 3A3JA 2WKEA 2Y2QA 4UA9A 3UPPA 5F82A 4MLLA 2JBFA 2BLSA 1FQGA 1HTZA 2C5WB 1XGJA 1K54A 3IF6B 1BLSA 1L0FA 5DF9A 1M40A 5TGFA 4R0QA 5BOHA 3S22A 4O7DA 4DKIA 1SDNA 3BFFA 3ZG5A 4HESA 1Q2QA 5CGSA 3VP1A 1ES2A 1SDEA 1OMEA 2Y91A 4N1XA 4DE1A 3SS5A 5HAQA 1CI8A 4PM8A 1HZOA 3JYIA 5DVAA 4BL2A 3M2KA 3FZCA 4PM6A 5DF8A 1M6KA 1KE0A 1YT4A 2EFUA 2P9VA 2PU2A 2WYXA 2ZQDA 3CZDA 3PAEA 3G30A 3W4PA 4BENA 3VP2A 4BLMA 1YLPA 4IEDA 3WS0A 5JYOA 1IYPA 5CERA 4S2PA 3V3SA 2ZM8A 1MKIA 3ZVWA 4N9LA 3A3FA 4OQHA 4KZ7A 3VOZA 2GDNA 2V1ZA 1S6RA 2XD1A 3DWZA 5CXWA 3MZFA 5DF7A 3QNCA 3G2ZA 1K6RA 1MWTA 3AGDA 4QD4A 1MWUA 4ZJ1A 1KDWA 3UE1A 3HBRA 3M2JA 1W8YA 1ONHA 4DE2A 4OKPA 2XH9A 2BG1A 3Q7VB 4GB7A 2EX9A 4P85A 4MBHA 2ZQ9A 4KQOA 3WS5A 4N1HA 1LL9A 4FD8A 4ZDXA 1BZAA 2X71A 2ZD8A 4QJGA 1K4EA 3P09A 1PWGA 3N8RA 1PI4A 1BSGA 1LI9A 3C7UA 4K91A 3Q07A 3V39A 3ITAA 3ZNYA 5M18A 1HVBA 2OLVA 3GRJA 3S1YA 2H10A 3ZVTA 1PWDA 2EXAA 1W8QA 2Y2GA 3ZG0A 2XLNA 4WBGA 4JXGA 1JVJA 4E3MA 2WGWB 4IBXA 1E4DA 1FSYA 1JTDA 2ZMAA 1KDSA 4PM9A 3CG5A 3PBNA 2WGIA 3GSGA 1GHMA 4D2OA 3UPOA 3MZDA 4UA6A 4QHCA 1C3BA 3IF6A 5A91A 4E6XA 3A3DA 1LI0A 3O87A 3OC2A 4KZ6A 3UDIA 4GKUA 2DRWA 5EVLA
chains in the Genus database with same CATH superfamily
1KGGA 1OTAA 2W1TB 1FR1A 2O9BA 1F98A 5IS1A 3WRZA 4S2JA 4BJPA 1K54C 4KUOA 3F1OA 3N7WA 3PBQA 3T1SA 4DJ2A 3Q81A 3D4FA 3U4LP 5HPFA 1WYCA 3BLMA 5EM0A 3LR0A 2J8YA 3ZG7B 3HLCA 4ZRRA 2B18A 4OP8A 4S2LA 3FPWA 1CEGA 4LENA 1F5MA 1FOFA 3Q7VA 1K25A 3IS2A 3I7JA 4LGWA 4ME4A 3TRCA 4WYYA 3S4XA 1IYOA 4PM7A 1G68A 1T1BA 2ZQ7A 2PDRA 3MFXA 4S2NA 4E3OA 2A24A 4HH2A 3E2LA 1FILA 3WWXA 3HLDA 4OLDA 3BEBA 1NY0A 4HBTA 1W63M 4E3LA 3H7WA 3UDXA 5HW3A 4S2IA 2ZC7A 1JWVA 3E4OA 1K55A 4YINA 1H8YA 5FQQA 4CJNA 1CQAA 4NXEA 3VMAA 5FEGA 2W3HA 5AQ9A 3TW8A 3OPHA 1DJBA 4EBLA 1T1AA 2X02A 4OPYA 2B5RA 2Y4AA 3C38A 1Q2PA 3FV7A 5AQ7A 2HZ5A 4NETA 4CLCE 4GHIA 2HDRA 1PZOA 2J80A 2J3WA 3HJIA 4DN0A 5E2FA 3U2AA 3N6IA 3ISGA 4OPZA 4DDSA 3IWIA 2IWBA 5F68A 2LB5A 4BQMA 4Y5FA 4HEFA 3NDEA 2E8IA 1ZKJA 5TJJA 3LR3A 1YQSA 2J3TD 2ZMFA 5C5KA 4S2KA 4C75A 1O7EA 4HJ4A 5J8XA 3T1RA 3ICYA 1ZG4A 4WM9A 3T4KA 4KG5A 4OONA 1LLBA 3W2ZA 4LFUA 1OT9A 3G34A 1HD8A 4LLOB 2PT7A 1KGEA 4KQQA 1SZVA 3VOLA 4LV0A 2VEAA 4LRXC 2H28A 1K38A 3R4KA 4WZ5C 5J7EA 3RJUA 2P74A 3EOIA 4HY8A 3EWKA 2XDMA 4E3KA 5EV0A 4OH0A 2YKFA 5FI6A 5CTMA 1N4OA 3CUEC 1RP5A 2V2FF 3VE4A 3MXRA 3MXSA 4MCWA 2QJ5A 2EA9A 1VETA 2IWCA 3ITBA 4CQHA 1K57C 1VM1A 2PR5A 3A0RA 1ZTUA 2EX8A 3IBJA 1OPXA 4L0LA 5EVIC 4FTXA 4R4SA 2PR6A 4BBVA 4L9FA 2KLIA 2PD8A 1O07A 4I5SA 5DJTA 4O01A 4EV4A 3HUMA 2UWXA 3NOUC 4E6WA 1F2KA 3NCKA 4OOLA 3MS6A 2VZWA 4P87A 3RFBA 3HLFA 1H3QA 2WAFA 4H6JB 3SZTA 4WF0A 1Z6FA 4UA7A 3ULFA 4FUWA 3CAXA 3IQAA 3FG8A 2Y2KA 4R38A 2GNXA 3JVUA 2VGKA 1MZUA 3VP4A 5GLAA 3MQ0A 4LPZA 4ZAMA 4KZAA 3NDGA 3GVBA 3KX0X 5CHMA 2XEPA 2A3UA 5K5BA 4DF6A 1YLJA 4JF6A 3KSHA 2P7JA 1RGYA 3IS2B 3IWQA 1SKFA 4P6BA 2QKPA 3FKWA 3S7QA 1S1ZA 5U47A 5AVFA 3IH9A 1CEFA 4Q0JA 2PYPA 3CPTB 4R1GA 4WUJA 1KVMA 5A93A 2HP9A 5DJUA 2Y2PA 2Y59A 3CLOA 4DDYA 3P7NA 1W79A 5HPIA 4ZBEA 3QHYA 4XXRA 3F1PB 1T1CA 4HOIA 4GS9A 4ZJ2A 3F1NB 3LR4A 4C6YA 4GHIB 2VX8A 1S4SA 5GHYA 3MKFA 1E3UA 3BY9A 1XA1A 3NY4A 3GECA 2WADA 4WMCA 4DE0A 5HWVA 3IHAA 2RCXA 1RGZA 2HPBA 2W3DA 1Y54A 1NXYA 3IF5A 5FDHA 2QJ7A 2Z6CA 5F82A 5F69A 2JBFA 4I39A 2BLSA 1FQGA 1K54A 1L0FA 4R0QA 1W63Q 5BOHA 3S22A 4O7DA 1SDNA 3BFFA 4Y2FA 3ZG5A 5CGSA 5L10A 5LBRA 1VEUA 1OMEA 2Y91A 4DE1A 4BL2A 1N9LA 1M6KA 2EFUA 3VP2A 3WS0A 4IHQA 1T19A 4S2PA 3VOZA 2JKRM 5CXWA 3MZFA 2ZL1B 1MWUA 3P01A 3UE1A 1W8YA 3T50A 5HD3A 2XH9A 4Y13A 3NECA 4P85A 2QWSA 3IX4A 2ZD8A 1BSGA 3V39A 5M18A 3GRJA 3C8CA 1PWDA 2BTFP 1W8QA 3ZG0A 4JXGA 2ZBBA 4E3MA 2V1BA 4PM9A 1UWNX 5DKLA 2JKTI 3PBNA 1GHMA 5HDCA 5HDSA 4QHCA 4EQ1A 1S66L 3UB8A 4E6XA 3OC2A 3UDIA 2DRWA 1JWPA 1WE4A 2WAEA 1TS8A 4OOMA 4DXCA 3RH8B 1A0KA 4Z9QA 3VV4A 1YAXA 3BFCA 4KQRA 2V0WA 4ARZB 1YLTA 1YLZA 4WL9A 2XK1A 3VOYA 3PR6A 3C7VA 1MC0A 1PYYA 2ZC6B 1SKOA 3R7WB 2NUPC 3S7PA 3UNWA 5HWTA 4U0XA 2JN7A 2ZOHA 3BRMA 3IWOA 3AGEA 2V9AA 1YSPA 1W7FA 2Z2MB 5EPHA 3NJAA 3PYPA 1UGUA 3ZDJA 1LHYA 2R9XA 3DAVA 3HJKA 1IEMA 2WK0A 4GD8A 2Q0OA 1ESUA 4KZ5A 4M3KA 3T4TA 2ZM0A 2OLUA 1P97A 2RL3A 2C6WB 4LCMA 3E4PA 4BL3A 2WKQA 2HDSA 2IWDA 1HLUP 5EFWA 3M6BA 4BBUA 3T1XA 1QMEA 4WZ5A 1MY8A 4JXVA 3MFDA 3QNBA 4OPQA 5FA7A 2HGVA 4FSFA 3NBLA 5EOOA 4QB8A 2B95A 4QY5A 3CUEA 3IF6C 4CLCC 2G2WA 4B88A 3LGOA 4UQIM 3UB9A 5G18A 5FDSA 4OVDA 1K57A 3B33A 4Q8IA 1N9OA 4JPMA 2VGLM 1S1YA 2L1MA 4B4ZA 5EVIA 2JE5A 4RA7A 5M19A 4E3JA 3T12B 5D3OA 3L9KA 1JTGA 2I72A 2WKPA 4JLFA 4ZJ3A 2XGNA 1LL8A 4KZ9A 5TBMB 2JHEA 5FQIA 2Y55A 4MNRA 4LV3A 1OTBA 2FFFB 2EXBA 3HL9A 1TDGA 3L7HA 3Q1FA 5GHXA 5CECA 1PRQA 4WN5A 1VEUB 3QP8A 3DTKA 1ALQA 3CI6A 5KMWA 4XT2A 3ZG8B 4GDBA 5IU1A 2QHKA 3T4LA 1BLCA 3H82A 2Q9NA 4PAUA 4LRYC 2E8JA 3QP4A 2J9OA 2EFXA 3HREA 3HLBA 4RYEA 5A92A 1FIKA 4EBPA 5CHJA 2OSUA 1CK3A 2WGWA 5HD5A 3IXDA 4BD0A 4MBFA 4ID4A 3UB7A 2Y2IA 4GD6A 3CMZA 5FAOA 3PXPA 4MN7A 3IXBA 2W3EA 4EUZA 4KZ3A 1GA0A 3WS1A 4X55A 2CC1A 3C5AA 5I94A 1PNEA 4R3BA 3IX3A 4UQIS 2QPNA 1W5DA 3JPUA 3S7OA 4GLQA 2VGLS 4YWZA 1KE3A 5FI7A 3MKEA 5HARA 4RQ9A 1DRMA 1WYBA 3FKVA 1D06A 3A3EA 3EQUA 3SH9A 1XJ3A 2DCFA 4OOYA 3G4PA 3LO7A 2ZQCA 2G2UA 2J9PA 4G3KA 2KX6A 4KZ4A 4U3TA 3K2NA 1YM1A 3QP6A 2A49A 1XKZA 4NXBA 3ZHHA 3G2YA 1VHMA 2DMWA 2ZLYA 2P04A 1ZHHB 2JC7A 2WZZA 3G35A 1H5XA 1PW1A 5FEFA 2M7VA 4JXWA 3A3IA 1L0DA 4EEPA 3RXWA 1E3UD 2OWJA 3HUOA 4WMCD 1J9MA 4WEJA 1XJ6A 4GCZA 4JGQA 2WKHA 2D02A 4NXGA 1AXBA 3OBFA 4KZBA 5AJGA 1GCEA 4KG6A 2DNSA 5KSHA 5CHUA 4XUXA 2XQZA 5HL6A 5FQKA 2Y79A 1PIOA 3KO6A 3IHBA 1XJ2A 1I2WA 4PMAA 5F1GA 3UDFA 4QY6A 1NRFA 4HJ6A 4HQAA 5AVEA 1K6SA 5EECA 5E2GA 3E4QA 3SS4A 3N8SA 3OLOA 3LICA 3LIFA 5DTSA 2V1AA 3VSLA 1TS7A 2Y2QA 3NOTC 4NG2A 2C5WB 1HTZA 1BLSA 5HWWA 5DF9A 2O0YA 2W3FA 3QP1A 5L09A 2MJ6A 1OT6A 4L9EA 5HAQA 3JYIA 3M2KA 1NLYA 1ODVA 1IOUA 1D7EA 3F1OB 2P9VA 1YKDA 3PAEA 3CZDA 4IJGA 1YLPA 1IYPA 3ZVWA 1LSWA 3KSIA 2GDNA 2V1ZA 2XD1A 3QNCA 3G2ZA 4QD4A 4F3LA 3DBAA 3KYZA 2BG1A 3Q7VB 4GB7A 2ZQ9A 4KQOA 3WS5A 1GSXA 1OTIA 4ZDXA 4QJGA 3QP2A 3P09A 1PWGA 2OOLA 1LI9A 2A24B 4K91A 3Q07A 3ZNYA 1HVBA 2OLVA 2PBDP 5HDDA 2OAP1 1GSVA 4WBGA 1DP8A 1JVJA 2I9VA 2WGWB 1FSYA 3H7WB 4NEED 4UA6A 1C3BA 3IF6A 4CLCA 1ACFA 3B47A 3A3DA 1LI0A 3O87A 1G28A 2R78A 3BFDA 2ZC5B 2HV1A 1XGIA 4R23A 1CI9A 3UB6A 1PWCA 1XPBA 1U60A 4BBTA 2Z6DA 4S2OA 4EXOA 1PW8A 5FL3A 1I5QA 3O88A 3H9WA 2EWWA 4JBFA 4GNUA 4R70A 4XUZA 2A2LA 2CMNA 3PBOA 4RX2A 5E2HA 3V67A 2HJEA 3N8LA 3LIDA 3PBRA 4MEZA 2GJ3A 1FSWA 2M1CA 1F9IA 2FFYA 4Y0UA 5DTTA 5HFOA 2HF6A 3LIBA 4KG2A 5F83A 4YFMA 4UAAA 3PAGA 1LSXA 3MR0A 5EVID 3SOIA 2EX2A 2W1TA 3RTYA 1G6AA 4HP9A 1TDLA 4G3VA 2K31A 4B4XA 1BTLA 2Z2LB 4WLAA 4OLGA 1STZA 1K4FA 3GV9A 1JWZA 3OPRA 1K0KA 4Y0OA 2OAQ1 3NI9A 5TFQA 3WRTA 2NUTC 1G5UA 2VJWA 5HX9A 3GMWA 3MBZA 2V8FA 3KYEA 5FATA 1IKGA 3HLGA 3MZEA 2Y2LA 4EBNA 1VETB 1BLPA 2FH5A 3CJMA 5FAPA 5KSCA 2G7UA 3G31A 3VFFA 1N9BA 5CX7A 3K3DA 5HL1A 3C4PA 3E0YA 1BYWA 3ZG9B 4Y0TA 2JKRI 4JGPA 2L4RA 1KE4A 1KVLA 4EETB 1EWZA 4ETZA 4EERA 4KENB 4DJ3A 2ZOIA 4DE3A 2W0NA 1MXOA 3BQAA 3HUNA 1PFLA 1L0GA 2VV6A 3DW0A 2PBYA 1CJFA 3UN7A 4CPKA 2O9AA 3TSGA 5HSQA 1DY6A 1YSQA 3PBTA 4OPRA 1S67L 1ERMA 1EI5A 1FCMA 3WS4A 3AGFA 4HNBA 2XRNA 2HDUA 5A90A 1IELA 3C4OA 2INWA 1ONGA 1J3WA 4X1MA 1YMSA 3P98A 3NIAA 3BY8A 2WKRA 2IA2A 3LY4A 4MMNA 5AQAA 5JYPA 2OV5A 3ZFZA 1V9YA 3GQZA 4NK3A 1XP4A 1MKMA 3BFGA 1TVFA 4R3JA 5F1FA 3LIAA 1V9ZA 2O9CA 3NOPC 2V0UA 3DTIA 5HAPA 5J3WA 4JGRA 4JF4A 4X53A 2H0YA 5FASA 1PZPA 2UV0E 4HBUA 3ZGAB 4E3NA 4R6LA 4FH2A 3ZQ5A 2HP6A 4LV2A 4E3IA 4PKYA 2Y2NA 3IBRA 4GS9B 4RVAA 1ES5A 1YLWA 1P9RA 1XA7A 1K56A 1LT0A 2VK3A 5FQJA 2J3TC 3CITA 3S7NA 2R9WA 2D01A 3LFVA 1ZC2A 4DRTA 2HDQA 4OQGA 1MWRA 3EQVA 1TF1A 5IHVA 2VLGA 2YKHA 3FWLA 2W27A 2VGJA 1XX2A 4HJ3A 1L3LA 3M6HA 3UE3A 4D60A 3D9YA 3HLEA 3MXQA 5DKKA 3LI8A 1BUEA 2ZC3B 4LCLA 2XROA 1IYQA 1XFNA 5KZHA 4KUKA 2XSSA 5G4ZA 3LEZA 1FCOA 1FCNA 3HCYA 2ZC4B 2WUQA 4H6JA 2Y2OA 1OJ5A 4QPRA 3B3XA 4X69A 2H5SA 1DP9A 4I3JA 3SW1A 1TD5A 1TS0A 3T4JA 1BULA 1BT5A 4X6TA 3SH7A 1P0ZA 4EWFA 1RCJA 4N92A 3TG9A 3IXGA 1D1JA 4IBRA 4BMWA 2JKGA 4P6ZM 2PD7A 1GHPA 4MBKA 3LEQA 4FOFA 2XFTA 3A3JA 5MC7A 5A8BA 3CPTA 3MMHA 1XGJA 1M40A 5TGFA 3BQ8A 4DKIA 3VP1A 1SDEA 4N1XA 3SS5A 4NXFA 1CI8A 4K08A 4PM8A 5DFXA 5DVAA 3FZCA 5DF8A 4KQDA 2VKSA 1KE0A 3NHQA 1YT4A 2WYXA 3LUQA 3T4OA 4BLMA 1SKOB 4UEYA 4IEDA 3EEAA 5CERA 1MKIA 3F1PA 4N9LA 1S6RA 5I5LA 3F1NA 5DF7A 3T4SA 1MWTA 4MN5A 4ZJ1A 4DE2A 2Y8HA 4CLCD 2EX9A 4N1HA 1LSVA 4FD8A 1K4EA 3N8RA 1PI4A 3ITAA 2H10A 3IX8A 3ZVTA 2XLNA 4BWIA 1S4RA 1E4DA 1JTDA 2ZMAA 1KDSA 2HJ9C 2PAVP 2WGIA 1OJGA 3UPOA 2AVXA 4KZ6A 2K2NA 3TE8A 3CHWP 4FH4A 4KZ8A 5E2EA 2PRFA 4ZTKA 5GLBA 3W4OA 3PTEA 1ZG6A 1Y4OA 5FQMA 1DJAA 4DXBA 1T18A 4IUHA 2ZQ8A 4P6ZS 4OQ0A 2ZL1A 4U0TA 1ES4A 4Y7PA 4N9KA 5EVIB 4X1LA 1EROA 1NWZA 4R4RA 3E2KA 3KSFA 2V8CA 2W3GA 3HVFA 4NKPA 1QMFA 4LV1A 3VP3A 4JKTA 3W8KA 3ZNTA 2PHYA 1GA9A 4X56A 3BJNA 3BLSA 1OTDA 5KIZA 2ACGA 2Y2HA 2QZ6A 2PU4A 3SH8A 3ZYTA 3PHYA 4RX3A 2XA7M 1NRJA 2XF3A 5EOEA 2WGVA 2KOIA 5FSRA 1Z09A 4K0WA 3O5YA 3OZHA 4I3IA 2XD5A 1KGFA 5TR7A 5HZHA 4JF5A 2QMIA 4P0MA 3LR5A 1OTEA 4GOGA 1TS6A 1SHVA 1UWPX 2JKFA 4ARZA 3FC7A 4XT2B 3SS3A 3QP5A 1LL5A 1P9WA 4LRZE 5GL9A 3Q82A 3R7WA 3V3RA 1YMXA 2FZ0A 3H82B 4IVIA 2Q9MA 3UPNA 1L0EA 3KYQA 2XFSA 3VFHA 1KOUA 4O8GA 3KSGA 1BLHA 4I38A 1IFQA 1VB6A 1NLZA 1MWSA 4GDNA 4OP5A 4GN2A 3BFEA 3LI9A 3LY3A 4IVKA 5CRFA 1IKIA 5GLDA 3V50A 1MPLA 1PI5A 5F6AA 3CWFA 4HP4A 1MBLA 1DP6A 3EEHA 4FCFA 4Q0IA 1NJ4A 2X01A 4S2NC 4ESPA 1DJCA 2Y2MA 5CGXA 5L8MA 3D3OA 3HLWA 3LCEA 5GLCA 1FR6A 1NYYA 4AFIA 3RXXA 3GTCA 5DTKA 1H8ZA 1ES3A 1K55C 3BM6A 3G6OA 4QU3A 3FPVA 3W4QA 4IUKA 3K3CA 4I3AA 5FAQA 1Y28A 5EVEA 3LIEA 4A5RA 3PBSA 3OCNA 1WA9A 4II7A 3A0SA 3FYZA 1EW0A 3UY6A 3MQOA 4EQIA 1E25A 3DTMA 3T4QA 5CTNA 3UO9A 5FI2A 2PYRA 4PM5A 1ERQA 3DWKA 3WS2A 4HH3A 2GX5A 4S2MA 4WEKA 5EUAA 5HAIA 3BYDA 2XA7S 5EE8A 2WZXA 5EM1A 3IH8A 2ZMVA 3JVVA 5M1AA 2Y2JA 5TBMA 4K0XA 1X0OA 4Y17A 1K56D 5F5YA 2O99A 3ZCZA 2EX6A 3UMDA 1H8MA 4EESA 4YOFA 3N4IA 4BD1A 4PHTA 4EEUA 2M7UA 2JCHA 2JKTM 1IYSA 3VP0A 5CEBA 3EGXC 1CF0A 3GR2A 5FQ9A 2ZJ9A 4GW9A 2LB9A 1XJ4A 5CEDA 4C3QA 3GDIA 4PPRA 3UB5P 4DMZA 3OPPA 2L0WA 2J7VA 3VSKA 1L2SA 4F94A 3IXHA 3DTEA 3C30A 2KDKA 4JXSA 4B9OA 4WELA 1SCWA 2WKIA 4UHUA 4MN6A 3G32A 3BWLA 4WZ4A 1VQQA 2BASA 2HP5A 4HIAA 3O86A 1NZUA 2ZM2A 1H0MA 1I2SA 5E43A 4R3AA 1NZOA 3MF0A 4Y3IA 1G6OA 5GHZA 3TOIA 2V20A 2EWVA 3IT9A 3MSHA 1TEMA 4Q0HA 4EUVA 3BW6A 2XR0A 3Q7ZA 1YLYA 2P9VB 4Z1WA 5AQBA 2H0TA 1ESIA 2W1RA 3BECA 5IT5A 5CGWA 4OQIA 4EW7A 5J4EA 3MJQA 1S0WA 1GHIA 4GZBA 4F3LB 2QYBA 3NC8A 2ZQAA 4X68A 3UE0A 3O3VA 3OOVA 5L2FA 4QWOA 3V5MA 4JGOA 2VV7A 2B02A 3OCLA 4H8RA 1XFQA 4L9GA 5L07A 1NYMA 4Y15A 4G3WA 3OPLA 1XXMA 3UMEA 3EGDC 2WKEA 4UA9A 3UPPA 1GSWA 4MLLA 3B42A 3IF6B 5G4YA 4CLCB 4EU0A 3T1QB 4E04A 3A0VA 4HESA 1Q2QA 2GZAA 5DFYA 1ES2A 2VA0A 3D72A 3UE6A 1HZOA 4PM6A 4ETXA 2PU2A 3W4PA 2ZQDA 3G30A 4BENA 1AWIA 5JYOA 3C2WA 3VE3A 2OWHA 3V3SA 2ZM8A 1N9NA 3NULA 3A3FA 4OQHA 4KZ7A 4B93A 1YPRA 4M4XA 3DWZA 1K6RA 3AGDA 4O0PA 1KDWA 3HBRA 3M2JA 1ONHA 3TJZC 4OKPA 4PKYG 3E98A 4HHDA 3LYXA 4MBHA 3MQQA 1LL9A 1BZAA 2X71A 4HI4A 3C7UA 1JNUA 4YNRA 3S1YA 2K7SA 2EXAA 2Y2GA 4IBXA 4MDZA 3CG5A 3GSGA 2VV8A 4D2OA 3MZDA 5A91A 4X25A 2P08A 4GKUA 4GJ4A 5EVLA
chains in the Genus database with same CATH topology
1KGGA 2IWBA 1JWPA 1WE4A 2WAEA 1FR1A 4OOMA 4FH4A 4DXCA 3WRZA 4S2JA 4Z9QA 4BJPA 3BFCA 4KQRA 3BFDA 2ZC5B 1XGIA 1YLTA 1YLZA 4KZ8A 5E2EA 2XK1A 1K54C 4ZTKA 3N7WA 3VOYA 3C7VA 5GLBA 3PBQA 3W4OA 1PYYA 2ZC6B 3PTEA 4R23A 1ZG6A 3UNWA 1CI9A 3Q81A 3D4FA 1PWCA 1XPBA 1U60A 4U0XA 5FQMA 3BRMA 1DJAA 4DXBA 1WYCA 3BLMA 3IWOA 2ZQ8A 2J8YA 4S2OA 3ZG7B 4OQ0A 3HLCA 4U0TA 1ES4A 3AGEA 4Y7PA 4OP8A 1PW8A 4N9KA 4S2LA 1I5QA 3O88A 5EVIB 1W7FA 2Z2MB 1CEGA 4LENA 5EPHA 1EROA 4R4RA 1FOFA 3Q7VA 3ZDJA 3E2KA 1K25A 1LHYA 2R9XA 3I7JA 3HVFA 4WYYA 1QMFA 4JBFA 1IYOA 4LV1A 4GNUA 1IEMA 4PM7A 2WK0A 4GD8A 4JKTA 3VP3A 1ESUA 4KZ5A 1G68A 4M3KA 4XUZA 3W8KA 2ZQ7A 3ZNTA 2ZM0A 3PBOA 2OLUA 1GA9A 4RX2A 4S2NA 5E2HA 4E3OA 4X56A 3E2LA 2RL3A 2C6WB 3WWXA 3BLSA 3HLDA 4OLDA 3BEBA 3N8LA 4LCMA 1NY0A 4BL3A 4HBTA 4E3LA 2Y2HA 3PBRA 2QZ6A 2PU4A 4MEZA 1FSWA 3SH8A 3UDXA 5HW3A 2FFYA 2ZC7A 2HDSA 1JWVA 4RX3A 4S2IA 4Y0UA 5DTTA 5HFOA 1K55A 2IWDA 4YINA 1H8YA 2XF3A 5EOEA 2WGVA 3M6BA 5FQQA 4CJNA 3VMAA 5FSRA 4KG2A 5F83A 1QMEA 5AQ9A 4WZ5A 1MY8A 4K0WA 4YFMA 3OZHA 3OPHA 4JXVA 4UAAA 1DJBA 3PAGA 3MFDA 3QNBA 4OPQA 5EVID 3SOIA 2EX2A 2XD5A 1KGFA 4EBLA 5TR7A 5FA7A 4JF5A 2QMIA 2X02A 4P0MA 4OPYA 2B5RA 1G6AA 2Y4AA 4FSFA 4GOGA 1TDLA 3NBLA 1SHVA 5EOOA 4B4XA 4QB8A 4QY5A 3IF6C 3SS3A 1Q2PA 2G2WA 3FV7A 4B88A 1BTLA 5AQ7A 1LL5A 2Z2LB 4OLGA 5GL9A 3Q82A 4NETA 3V3RA 1YMXA 4IVIA 3UPNA 2Q9MA 1K4FA 2HDRA 1PZOA 1JWZA 3GV9A 1L0EA 3OPRA 4Y0OA 5G18A 4OVDA 2XFSA 3NI9A 5TFQA 3WRTA 1K57A 4Q8IA 5E2FA 4JPMA 5HX9A 3GMWA 3MBZA 3N6IA 3VFHA 3ISGA 4OPZA 1BLHA 4B4ZA 4DDSA 3IWIA 5EVIA 5FATA 1MWSA 1IKGA 4GDNA 4GN2A 2JE5A 4OP5A 4RA7A 3BFEA 3HLGA 3MZEA 2Y2LA 5M19A 4EBNA 3LY3A 4IVKA 1BLPA 5CRFA 4E3JA 4BQMA 5D3OA 1IKIA 5GLDA 3V50A 4HEFA 3NDEA 1MPLA 1PI5A 3CJMA 2E8IA 5FAPA 5KSCA 1ZKJA 3G31A 3VFFA 1YQSA 1JTGA 1N9BA 2I72A 5HL1A 4JLFA 4S2KA 4ZJ3A 4C75A 3C4PA 1MBLA 2XGNA 4FCFA 4KZ9A 1O7EA 5J8XA 1NJ4A 5FQIA 2Y55A 4MNRA 4LV3A 3ZG9B 2FFFB 2EXBA 3HL9A 4Y0TA 1ZG4A 4WM9A 1TDGA 4KG5A 4OONA 2X01A 4S2NC 1LLBA 1KE4A 1DJCA 2Y2MA 3Q1FA 1KVLA 1EWZA 5CGXA 3HLWA 3LCEA 4KENB 5GHXA 5GLCA 5CECA 1FR6A 1NYYA 3G34A 1HD8A 4DE3A 1KGEA 3RXXA 3GTCA 1MXOA 4KQQA 5DTKA 3HUNA 4LV0A 1H8ZA 1ES3A 1ALQA 1K55C 3BM6A 4QU3A 1L0GA 5KMWA 3ZG8B 4GDBA 1K38A 3DW0A 3W4QA 4WZ5C 1BLCA 3RJUA 2P74A 2PBYA 2Q9NA 3UN7A 4CPKA 5FAQA 2XDMA 4A5RA 3PBSA 4E3KA 3TSGA 4OH0A 1DY6A 3OCNA 2J9OA 3PBTA 4OPRA 1ERMA 5FI6A 5CTMA 3FYZA 3UY6A 1EI5A 1FCMA 3WS4A 1N4OA 2EFXA 3AGFA 1E25A 3DTMA 4EQIA 5CTNA 1RP5A 2V2FF 3UO9A 5FI2A 2HDUA 4PM5A 3HREA 3MXRA 1ERQA 3MXSA 3DWKA 3HLBA 3WS2A 4RYEA 5A92A 1IELA 5A90A 3C4OA 4S2MA 4WEKA 2IWCA 1ONGA 3ITBA 5EUAA 5HAIA 4EBPA 3BYDA 1YMSA 3P98A 3NIAA 5CHJA 1K57C 1VM1A 2OSUA 1CK3A 5EE8A 2EX8A 2WGWA 2WZXA 3IXDA 4MBFA 4BD0A 3LY4A 4L0LA 5AQAA 5JYPA 4ID4A 3IH8A 5EVIC 2OV5A 2Y2IA 4GD6A 3CMZA 4R4SA 5M1AA 3ZFZA 5FAOA 2Y2JA 3GQZA 4NK3A 1XP4A 3IXBA 4K0XA 3BFGA 1O07A 3S4XA 1TVFA 1K56D 4R3JA 4EUZA 5F1FA 4KZ3A 4EV4A 1GA0A 3HUMA 3WS1A 4X55A 2UWXA 4E6WA 3ZCZA 2CC1A 3NCKA 4OOLA 5HAPA 4X53A 4JF4A 2EX6A 2H0YA 3C5AA 5FASA 1PZPA 4P87A 5I94A 4HBUA 4R3BA 3HLFA 2QPNA 3ZGAB 2WAFA 4E3NA 1W5DA 4FH2A 1Z6FA 2HP6A 3N4IA 4UA7A 4BD1A 4LV2A 3IQAA 4E3IA 2JCHA 2Y2KA 2Y2NA 1IYSA 3VP0A 2VGKA 1KE3A 5CEBA 4RVAA 5FI7A 3MKEA 5HARA 3GR2A 5FQ9A 1WYBA 1ES5A 3FKVA 3A3EA 3VP4A 5GLAA 2ZJ9A 3EQUA 1YLWA 3SH9A 1XA7A 1K56A 4ZAMA 4KZAA 3NDGA 2DCFA 3GVBA 5CEDA 5CHMA 2XEPA 4C3QA 5FQJA 4OOYA 4PPRA 3G4PA 3OPPA 2R9WA 3LO7A 2ZQCA 2A3UA 1ZC2A 2J7VA 2G2UA 2J9PA 1L2SA 3VSKA 4DRTA 2HDQA 4KZ4A 4F94A 3IXHA 4U3TA 4OQGA 4JXSA 1YM1A 4WELA 4DF6A 1MWRA 1SCWA 2WKIA 1YLJA 3EQVA 4JF6A 4UHUA 1RGYA 3G32A 2A49A 3IWQA 1SKFA 1XKZA 5IHVA 4P6BA 4WZ4A 3FKWA 3FWLA 3ZHHA 2VGJA 5U47A 1XX2A 3G2YA 3IH9A 1CEFA 1VQQA 2ZLYA 3M6HA 3UE3A 2HP5A 2JC7A 3HLEA 3O86A 1NZUA 2ZM2A 4R1GA 2WZZA 3G35A 1H5XA 1I2SA 5E43A 1BUEA 1PW1A 2ZC3B 4LCLA 4JXWA 3A3IA 1L0DA 1NZOA 1KVMA 5A93A 5GHZA 1IYQA 5KZHA 3TOIA 2HP9A 3RXWA 1E3UD 2V20A 3IT9A 2Y2PA 2Y59A 3HUOA 4DDYA 1TEMA 3LEZA 1FCOA 4WMCD 1J9MA 1W79A 4WEJA 4ZBEA 1FCNA 2XR0A 2ZC4B 3Q7ZA 2WUQA 1YLYA 2P9VB 3QHYA 5AQBA 2Y2OA 2WKHA 1AXBA 2H0TA 4XXRA 1ESIA 4KZBA 3B3XA 1GCEA 4X69A 2H5SA 3BECA 4ZJ2A 5CGWA 4KG6A 4OQIA 2DNSA 5KSHA 4C6YA 1S0WA 5CHUA 1GHIA 1BULA 1BT5A 4GZBA 4X6TA 2XQZA 4XUXA 3SH7A 3NC8A 5FQKA 5GHYA 2ZQAA 4X68A 1PIOA 3UE0A 3O3VA 3IHBA 3MKFA 1E3UA 4EWFA 1RCJA 4N92A 5L2FA 1XA1A 1I2WA 3NY4A 4PMAA 5F1GA 3TG9A 4QY6A 3UDFA 2WADA 3V5MA 1NRFA 4WMCA 3IXGA 1K6SA 3OCLA 5EECA 4IBRA 4DE0A 4H8RA 3IHAA 5E2GA 2RCXA 1RGZA 2HPBA 3SS4A 1NYMA 3N8SA 1Y54A 3OPLA 5DTSA 1GHPA 1NXYA 4MBKA 1XXMA 3IF5A 5FDHA 2XFTA 3VSLA 3A3JA 2WKEA 2Y2QA 4UA9A 3UPPA 5F82A 4MLLA 2JBFA 2BLSA 1FQGA 1HTZA 2C5WB 1XGJA 1K54A 3IF6B 1BLSA 1L0FA 5DF9A 1M40A 5TGFA 4R0QA 5BOHA 3S22A 4O7DA 4DKIA 1SDNA 3BFFA 3ZG5A 4HESA 1Q2QA 5CGSA 3VP1A 1ES2A 1SDEA 1OMEA 2Y91A 4N1XA 4DE1A 3SS5A 5HAQA 1CI8A 4PM8A 1HZOA 3JYIA 5DVAA 4BL2A 3M2KA 3FZCA 4PM6A 5DF8A 1M6KA 1KE0A 1YT4A 2EFUA 2P9VA 2PU2A 2WYXA 2ZQDA 3CZDA 3PAEA 3G30A 3W4PA 4BENA 3VP2A 4BLMA 1YLPA 4IEDA 3WS0A 5JYOA 1IYPA 5CERA 4S2PA 3V3SA 2ZM8A 1MKIA 3ZVWA 4N9LA 3A3FA 4OQHA 4KZ7A 3VOZA 2GDNA 2V1ZA 1S6RA 2XD1A 3DWZA 5CXWA 3MZFA 5DF7A 3QNCA 3G2ZA 1K6RA 1MWTA 3AGDA 4QD4A 1MWUA 4ZJ1A 1KDWA 3UE1A 3HBRA 3M2JA 1W8YA 1ONHA 4DE2A 4OKPA 2XH9A 2BG1A 3Q7VB 4GB7A 2EX9A 4P85A 4MBHA 2ZQ9A 4KQOA 3WS5A 4N1HA 1LL9A 4FD8A 4ZDXA 1BZAA 2X71A 2ZD8A 4QJGA 1K4EA 3P09A 1PWGA 3N8RA 1PI4A 1BSGA 1LI9A 3C7UA 4K91A 3Q07A 3V39A 3ITAA 3ZNYA 5M18A 1HVBA 2OLVA 3GRJA 3S1YA 2H10A 3ZVTA 1PWDA 2EXAA 1W8QA 2Y2GA 3ZG0A 2XLNA 4WBGA 4JXGA 1JVJA 4E3MA 2WGWB 4IBXA 1E4DA 1FSYA 1JTDA 2ZMAA 1KDSA 4PM9A 3CG5A 3PBNA 2WGIA 3GSGA 1GHMA 4D2OA 3UPOA 3MZDA 4UA6A 4QHCA 1C3BA 3IF6A 5A91A 4E6XA 3A3DA 1LI0A 3O87A 3OC2A 4KZ6A 3UDIA 4GKUA 2DRWA 5EVLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KGG A;  2IWB A;  1JWP A;  1WE4 A;  2WAE A;  1FR1 A;  4OOM A;  4FH4 A;  4DXC A;  3WRZ A;  4S2J A;  4Z9Q A;  4BJP A;  3BFC A;  4KQR A;  3BFD A;  2ZC5 B;  1XGI A;  1YLT A;  1YLZ A;  4KZ8 A;  5E2E A;  2XK1 A;  1K54 C;  4ZTK A;  3N7W A;  3VOY A;  3C7V A;  5GLB A;  3PBQ A;  3W4O A;  1PYY A;  2ZC6 B;  3PTE A;  4R23 A;  1ZG6 A;  3UNW A;  1CI9 A;  3Q81 A;  3D4F A;  1PWC A;  1XPB A;  1U60 A;  4U0X A;  5FQM A;  3BRM A;  1DJA A;  4DXB A;  1WYC A;  3BLM A;  3IWO A;  2ZQ8 A;  2J8Y A;  4S2O A;  3ZG7 B;  4OQ0 A;  3HLC A;  4U0T A;  1ES4 A;  3AGE A;  4Y7P A;  4OP8 A;  1PW8 A;  4N9K A;  4S2L A;  1I5Q A;  3O88 A;  5EVI B;  1W7F A;  2Z2M B;  1CEG A;  4LEN A;  5EPH A;  1ERO A;  4R4R A;  1FOF A;  3Q7V A;  3ZDJ A;  3E2K A;  1K25 A;  1LHY A;  2R9X A;  3I7J A;  3HVF A;  4WYY A;  1QMF A;  4JBF A;  1IYO A;  4LV1 A;  4GNU A;  1IEM A;  4PM7 A;  2WK0 A;  4GD8 A;  4JKT A;  3VP3 A;  1ESU A;  4KZ5 A;  1G68 A;  4M3K A;  4XUZ A;  3W8K A;  2ZQ7 A;  3ZNT A;  2ZM0 A;  3PBO A;  2OLU A;  1GA9 A;  4RX2 A;  4S2N A;  5E2H A;  4E3O A;  4X56 A;  3E2L A;  2RL3 A;  2C6W B;  3WWX A;  3BLS A;  3HLD A;  4OLD A;  3BEB A;  3N8L A;  4LCM A;  1NY0 A;  4BL3 A;  4HBT A;  4E3L A;  2Y2H A;  3PBR A;  2QZ6 A;  2PU4 A;  4MEZ A;  1FSW A;  3SH8 A;  3UDX A;  5HW3 A;  2FFY A;  2ZC7 A;  2HDS A;  1JWV A;  4RX3 A;  4S2I A;  4Y0U A;  5DTT A;  5HFO A;  1K55 A;  2IWD A;  4YIN A;  1H8Y A;  2XF3 A;  5EOE A;  2WGV A;  3M6B A;  5FQQ A;  4CJN A;  3VMA A;  5FSR A;  4KG2 A;  5F83 A;  1QME A;  5AQ9 A;  4WZ5 A;  1MY8 A;  4K0W A;  4YFM A;  3OZH A;  3OPH A;  4JXV A;  4UAA A;  1DJB A;  3PAG A;  3MFD A;  3QNB A;  4OPQ A;  5EVI D;  3SOI A;  2EX2 A;  2XD5 A;  1KGF A;  4EBL A;  5TR7 A;  5FA7 A;  4JF5 A;  2QMI A;  2X02 A;  4P0M A;  4OPY A;  2B5R A;  1G6A A;  2Y4A A;  4FSF A;  4GOG A;  1TDL A;  3NBL A;  1SHV A;  5EOO A;  4B4X A;  4QB8 A;  4QY5 A;  3IF6 C;  3SS3 A;  1Q2P A;  2G2W A;  3FV7 A;  4B88 A;  1BTL A;  5AQ7 A;  1LL5 A;  2Z2L B;  4OLG A;  5GL9 A;  3Q82 A;  4NET A;  3V3R A;  1YMX A;  4IVI A;  3UPN A;  2Q9M A;  1K4F A;  2HDR A;  1PZO A;  1JWZ A;  3GV9 A;  1L0E A;  3OPR A;  4Y0O A;  5G18 A;  4OVD A;  2XFS A;  3NI9 A;  5TFQ A;  3WRT A;  1K57 A;  4Q8I A;  5E2F A;  4JPM A;  5HX9 A;  3GMW A;  3MBZ A;  3N6I A;  3VFH A;  3ISG A;  4OPZ A;  1BLH A;  4B4Z A;  4DDS A;  3IWI A;  5EVI A;  5FAT A;  1MWS A;  1IKG A;  4GDN A;  4GN2 A;  2JE5 A;  4OP5 A;  4RA7 A;  3BFE A;  3HLG A;  3MZE A;  2Y2L A;  5M19 A;  4EBN A;  3LY3 A;  4IVK A;  1BLP A;  5CRF A;  4E3J A;  4BQM A;  5D3O A;  1IKI A;  5GLD A;  3V50 A;  4HEF A;  3NDE A;  1MPL A;  1PI5 A;  3CJM A;  2E8I A;  5FAP A;  5KSC A;  1ZKJ A;  3G31 A;  3VFF A;  1YQS A;  1JTG A;  1N9B A;  2I72 A;  5HL1 A;  4JLF A;  4S2K A;  4ZJ3 A;  4C75 A;  3C4P A;  1MBL A;  2XGN A;  4FCF A;  4KZ9 A;  1O7E A;  5J8X A;  1NJ4 A;  5FQI A;  2Y55 A;  4MNR A;  4LV3 A;  3ZG9 B;  2FFF B;  2EXB A;  3HL9 A;  4Y0T A;  1ZG4 A;  4WM9 A;  1TDG A;  4KG5 A;  4OON A;  2X01 A;  4S2N C;  1LLB A;  1KE4 A;  1DJC A;  2Y2M A;  3Q1F A;  1KVL A;  1EWZ A;  5CGX A;  3HLW A;  3LCE A;  4KEN B;  5GHX A;  5GLC A;  5CEC A;  1FR6 A;  1NYY A;  3G34 A;  1HD8 A;  4DE3 A;  1KGE A;  3RXX A;  3GTC A;  1MXO A;  4KQQ A;  5DTK A;  3HUN A;  4LV0 A;  1H8Z A;  1ES3 A;  1ALQ A;  1K55 C;  3BM6 A;  4QU3 A;  1L0G A;  5KMW A;  3ZG8 B;  4GDB A;  1K38 A;  3DW0 A;  3W4Q A;  4WZ5 C;  1BLC A;  3RJU A;  2P74 A;  2PBY A;  2Q9N A;  3UN7 A;  4CPK A;  5FAQ A;  2XDM A;  4A5R A;  3PBS A;  4E3K A;  3TSG A;  4OH0 A;  1DY6 A;  3OCN A;  2J9O A;  3PBT A;  4OPR A;  1ERM A;  5FI6 A;  5CTM A;  3FYZ A;  3UY6 A;  1EI5 A;  1FCM A;  3WS4 A;  1N4O A;  2EFX A;  3AGF A;  1E25 A;  3DTM A;  4EQI A;  5CTN A;  1RP5 A;  2V2F F;  3UO9 A;  5FI2 A;  2HDU A;  4PM5 A;  3HRE A;  3MXR A;  1ERQ A;  3MXS A;  3DWK A;  3HLB A;  3WS2 A;  4RYE A;  5A92 A;  1IEL A;  5A90 A;  3C4O A;  4S2M A;  4WEK A;  2IWC A;  1ONG A;  3ITB A;  5EUA A;  5HAI A;  4EBP A;  3BYD A;  1YMS A;  3P98 A;  3NIA A;  5CHJ A;  1K57 C;  1VM1 A;  2OSU A;  1CK3 A;  5EE8 A;  2EX8 A;  2WGW A;  2WZX A;  3IXD A;  4MBF A;  4BD0 A;  3LY4 A;  4L0L A;  5AQA A;  5JYP A;  4ID4 A;  3IH8 A;  5EVI C;  2OV5 A;  2Y2I A;  4GD6 A;  3CMZ A;  4R4S A;  5M1A A;  3ZFZ A;  5FAO A;  2Y2J A;  3GQZ A;  4NK3 A;  1XP4 A;  3IXB A;  4K0X A;  3BFG A;  1O07 A;  3S4X A;  1TVF A;  1K56 D;  4R3J A;  4EUZ A;  5F1F A;  4KZ3 A;  4EV4 A;  1GA0 A;  3HUM A;  3WS1 A;  4X55 A;  2UWX A;  4E6W A;  3ZCZ A;  2CC1 A;  3NCK A;  4OOL A;  5HAP A;  4X53 A;  4JF4 A;  2EX6 A;  2H0Y A;  3C5A A;  5FAS A;  1PZP A;  4P87 A;  5I94 A;  4HBU A;  4R3B A;  3HLF A;  2QPN A;  3ZGA B;  2WAF A;  4E3N A;  1W5D A;  4FH2 A;  1Z6F A;  2HP6 A;  3N4I A;  4UA7 A;  4BD1 A;  4LV2 A;  3IQA A;  4E3I A;  2JCH A;  2Y2K A;  2Y2N A;  1IYS A;  3VP0 A;  2VGK A;  1KE3 A;  5CEB A;  4RVA A;  5FI7 A;  3MKE A;  5HAR A;  3GR2 A;  5FQ9 A;  1WYB A;  1ES5 A;  3FKV A;  3A3E A;  3VP4 A;  5GLA A;  2ZJ9 A;  3EQU A;  1YLW A;  3SH9 A;  1XA7 A;  1K56 A;  4ZAM A;  4KZA A;  3NDG A;  2DCF A;  3GVB A;  5CED A;  5CHM A;  2XEP A;  4C3Q A;  5FQJ A;  4OOY A;  4PPR A;  3G4P A;  3OPP A;  2R9W A;  3LO7 A;  2ZQC A;  2A3U A;  1ZC2 A;  2J7V A;  2G2U A;  2J9P A;  1L2S A;  3VSK A;  4DRT A;  2HDQ A;  4KZ4 A;  4F94 A;  3IXH A;  4U3T A;  4OQG A;  4JXS A;  1YM1 A;  4WEL A;  4DF6 A;  1MWR A;  1SCW A;  2WKI A;  1YLJ A;  3EQV A;  4JF6 A;  4UHU A;  1RGY A;  3G32 A;  2A49 A;  3IWQ A;  1SKF A;  1XKZ A;  5IHV A;  4P6B A;  4WZ4 A;  3FKW A;  3FWL A;  3ZHH A;  2VGJ A;  5U47 A;  1XX2 A;  3G2Y A;  3IH9 A;  1CEF A;  1VQQ A;  2ZLY A;  3M6H A;  3UE3 A;  2HP5 A;  2JC7 A;  3HLE A;  3O86 A;  1NZU A;  2ZM2 A;  4R1G A;  2WZZ A;  3G35 A;  1H5X A;  1I2S A;  5E43 A;  1BUE A;  1PW1 A;  2ZC3 B;  4LCL A;  4JXW A;  3A3I A;  1L0D A;  1NZO A;  1KVM A;  5A93 A;  5GHZ A;  1IYQ A;  5KZH A;  3TOI A;  2HP9 A;  3RXW A;  1E3U D;  2V20 A;  3IT9 A;  2Y2P A;  2Y59 A;  3HUO A;  4DDY A;  1TEM A;  3LEZ A;  1FCO A;  4WMC D;  1J9M A;  1W79 A;  4WEJ A;  4ZBE A;  1FCN A;  2XR0 A;  2ZC4 B;  3Q7Z A;  2WUQ A;  1YLY A;  2P9V B;  3QHY A;  5AQB A;  2Y2O A;  2WKH A;  1AXB A;  2H0T A;  4XXR A;  1ESI A;  4KZB A;  3B3X A;  1GCE A;  4X69 A;  2H5S A;  3BEC A;  4ZJ2 A;  5CGW A;  4KG6 A;  4OQI A;  2DNS A;  5KSH A;  4C6Y A;  1S0W A;  5CHU A;  1GHI A;  1BUL A;  1BT5 A;  4GZB A;  4X6T A;  2XQZ A;  4XUX A;  3SH7 A;  3NC8 A;  5FQK A;  5GHY A;  2ZQA A;  4X68 A;  1PIO A;  3UE0 A;  3O3V A;  3IHB A;  3MKF A;  1E3U A;  4EWF A;  1RCJ A;  4N92 A;  5L2F A;  1XA1 A;  1I2W A;  3NY4 A;  4PMA A;  5F1G A;  3TG9 A;  4QY6 A;  3UDF A;  2WAD A;  3V5M A;  1NRF A;  4WMC A;  3IXG A;  1K6S A;  3OCL A;  5EEC A;  4IBR A;  4DE0 A;  4H8R A;  3IHA A;  5E2G A;  2RCX A;  1RGZ A;  2HPB A;  3SS4 A;  1NYM A;  3N8S A;  1Y54 A;  3OPL A;  5DTS A;  1GHP A;  1NXY A;  4MBK A;  1XXM A;  3IF5 A;  5FDH A;  2XFT A;  3VSL A;  3A3J A;  2WKE A;  2Y2Q A;  4UA9 A;  3UPP A;  5F82 A;  4MLL A;  2JBF A;  2BLS A;  1FQG A;  1HTZ A;  2C5W B;  1XGJ A;  1K54 A;  3IF6 B;  1BLS A;  1L0F A;  5DF9 A;  1M40 A;  5TGF A;  4R0Q A;  5BOH A;  3S22 A;  4O7D A;  4DKI A;  1SDN A;  3BFF A;  3ZG5 A;  4HES A;  1Q2Q A;  5CGS A;  3VP1 A;  1ES2 A;  1SDE A;  1OME A;  2Y91 A;  4N1X A;  4DE1 A;  3SS5 A;  5HAQ A;  1CI8 A;  4PM8 A;  1HZO A;  3JYI A;  5DVA A;  4BL2 A;  3M2K A;  3FZC A;  4PM6 A;  5DF8 A;  1M6K A;  1KE0 A;  1YT4 A;  2EFU A;  2P9V A;  2PU2 A;  2WYX A;  2ZQD A;  3CZD A;  3PAE A;  3G30 A;  3W4P A;  4BEN A;  3VP2 A;  4BLM A;  1YLP A;  4IED A;  3WS0 A;  5JYO A;  1IYP A;  5CER A;  4S2P A;  3V3S A;  2ZM8 A;  1MKI A;  3ZVW A;  4N9L A;  3A3F A;  4OQH A;  4KZ7 A;  3VOZ A;  2GDN A;  2V1Z A;  1S6R A;  2XD1 A;  3DWZ A;  5CXW A;  3MZF A;  5DF7 A;  3QNC A;  3G2Z A;  1K6R A;  1MWT A;  3AGD A;  4QD4 A;  1MWU A;  4ZJ1 A;  1KDW A;  3UE1 A;  3HBR A;  3M2J A;  1W8Y A;  1ONH A;  4DE2 A;  4OKP A;  2XH9 A;  2BG1 A;  3Q7V B;  4GB7 A;  2EX9 A;  4P85 A;  4MBH A;  2ZQ9 A;  4KQO A;  3WS5 A;  4N1H A;  1LL9 A;  4FD8 A;  4ZDX A;  1BZA A;  2X71 A;  2ZD8 A;  4QJG A;  1K4E A;  3P09 A;  1PWG A;  3N8R A;  1PI4 A;  1BSG A;  1LI9 A;  3C7U A;  4K91 A;  3Q07 A;  3V39 A;  3ITA A;  3ZNY A;  5M18 A;  1HVB A;  2OLV A;  3GRJ A;  3S1Y A;  2H10 A;  3ZVT A;  1PWD A;  2EXA A;  1W8Q A;  2Y2G A;  3ZG0 A;  2XLN A;  4WBG A;  4JXG A;  1JVJ A;  4E3M A;  2WGW B;  4IBX A;  1E4D A;  1FSY A;  1JTD A;  2ZMA A;  1KDS A;  4PM9 A;  3CG5 A;  3PBN A;  2WGI A;  3GSG A;  1GHM A;  4D2O A;  3UPO A;  3MZD A;  4UA6 A;  4QHC A;  1C3B A;  3IF6 A;  5A91 A;  4E6X A;  3A3D A;  1LI0 A;  3O87 A;  3OC2 A;  4KZ6 A;  3UDI A;  4GKU A;  2DRW A;  5EVL A; 
#chains in the Genus database with same CATH topology
 1KGG A;  1OTA A;  2W1T B;  1FR1 A;  2O9B A;  1F98 A;  5IS1 A;  3WRZ A;  4S2J A;  4BJP A;  1K54 C;  4KUO A;  3F1O A;  3N7W A;  3PBQ A;  3T1S A;  4DJ2 A;  3Q81 A;  3D4F A;  3U4L P;  5HPF A;  1WYC A;  3BLM A;  5EM0 A;  3LR0 A;  2J8Y A;  3ZG7 B;  3HLC A;  4ZRR A;  2B18 A;  4OP8 A;  4S2L A;  3FPW A;  1CEG A;  4LEN A;  1F5M A;  1FOF A;  3Q7V A;  1K25 A;  3IS2 A;  3I7J A;  4LGW A;  4ME4 A;  3TRC A;  4WYY A;  3S4X A;  1IYO A;  4PM7 A;  1G68 A;  1T1B A;  2ZQ7 A;  2PDR A;  3MFX A;  4S2N A;  4E3O A;  2A24 A;  4HH2 A;  3E2L A;  1FIL A;  3WWX A;  3HLD A;  4OLD A;  3BEB A;  1NY0 A;  4HBT A;  1W63 M;  4E3L A;  3H7W A;  3UDX A;  5HW3 A;  4S2I A;  2ZC7 A;  1JWV A;  3E4O A;  1K55 A;  4YIN A;  1H8Y A;  5FQQ A;  4CJN A;  1CQA A;  4NXE A;  3VMA A;  5FEG A;  2W3H A;  5AQ9 A;  3TW8 A;  3OPH A;  1DJB A;  4EBL A;  1T1A A;  2X02 A;  4OPY A;  2B5R A;  2Y4A A;  3C38 A;  1Q2P A;  3FV7 A;  5AQ7 A;  2HZ5 A;  4NET A;  4CLC E;  4GHI A;  2HDR A;  1PZO A;  2J80 A;  2J3W A;  3HJI A;  4DN0 A;  5E2F A;  3U2A A;  3N6I A;  3ISG A;  4OPZ A;  4DDS A;  3IWI A;  2IWB A;  5F68 A;  2LB5 A;  4BQM A;  4Y5F A;  4HEF A;  3NDE A;  2E8I A;  1ZKJ A;  5TJJ A;  3LR3 A;  1YQS A;  2J3T D;  2ZMF A;  5C5K A;  4S2K A;  4C75 A;  1O7E A;  4HJ4 A;  5J8X A;  3T1R A;  3ICY A;  1ZG4 A;  4WM9 A;  3T4K A;  4KG5 A;  4OON A;  1LLB A;  3W2Z A;  4LFU A;  1OT9 A;  3G34 A;  1HD8 A;  4LLO B;  2PT7 A;  1KGE A;  4KQQ A;  1SZV A;  3VOL A;  4LV0 A;  2VEA A;  4LRX C;  2H28 A;  1K38 A;  3R4K A;  4WZ5 C;  5J7E A;  3RJU A;  2P74 A;  3EOI A;  4HY8 A;  3EWK A;  2XDM A;  4E3K A;  5EV0 A;  4OH0 A;  2YKF A;  5FI6 A;  5CTM A;  1N4O A;  3CUE C;  1RP5 A;  2V2F F;  3VE4 A;  3MXR A;  3MXS A;  4MCW A;  2QJ5 A;  2EA9 A;  1VET A;  2IWC A;  3ITB A;  4CQH A;  1K57 C;  1VM1 A;  2PR5 A;  3A0R A;  1ZTU A;  2EX8 A;  3IBJ A;  1OPX A;  4L0L A;  5EVI C;  4FTX A;  4R4S A;  2PR6 A;  4BBV A;  4L9F A;  2KLI A;  2PD8 A;  1O07 A;  4I5S A;  5DJT A;  4O01 A;  4EV4 A;  3HUM A;  2UWX A;  3NOU C;  4E6W A;  1F2K A;  3NCK A;  4OOL A;  3MS6 A;  2VZW A;  4P87 A;  3RFB A;  3HLF A;  1H3Q A;  2WAF A;  4H6J B;  3SZT A;  4WF0 A;  1Z6F A;  4UA7 A;  3ULF A;  4FUW A;  3CAX A;  3IQA A;  3FG8 A;  2Y2K A;  4R38 A;  2GNX A;  3JVU A;  2VGK A;  1MZU A;  3VP4 A;  5GLA A;  3MQ0 A;  4LPZ A;  4ZAM A;  4KZA A;  3NDG A;  3GVB A;  3KX0 X;  5CHM A;  2XEP A;  2A3U A;  5K5B A;  4DF6 A;  1YLJ A;  4JF6 A;  3KSH A;  2P7J A;  1RGY A;  3IS2 B;  3IWQ A;  1SKF A;  4P6B A;  2QKP A;  3FKW A;  3S7Q A;  1S1Z A;  5U47 A;  5AVF A;  3IH9 A;  1CEF A;  4Q0J A;  2PYP A;  3CPT B;  4R1G A;  4WUJ A;  1KVM A;  5A93 A;  2HP9 A;  5DJU A;  2Y2P A;  2Y59 A;  3CLO A;  4DDY A;  3P7N A;  1W79 A;  5HPI A;  4ZBE A;  3QHY A;  4XXR A;  3F1P B;  1T1C A;  4HOI A;  4GS9 A;  4ZJ2 A;  3F1N B;  3LR4 A;  4C6Y A;  4GHI B;  2VX8 A;  1S4S A;  5GHY A;  3MKF A;  1E3U A;  3BY9 A;  1XA1 A;  3NY4 A;  3GEC A;  2WAD A;  4WMC A;  4DE0 A;  5HWV A;  3IHA A;  2RCX A;  1RGZ A;  2HPB A;  2W3D A;  1Y54 A;  1NXY A;  3IF5 A;  5FDH A;  2QJ7 A;  2Z6C A;  5F82 A;  5F69 A;  2JBF A;  4I39 A;  2BLS A;  1FQG A;  1K54 A;  1L0F A;  4R0Q A;  1W63 Q;  5BOH A;  3S22 A;  4O7D A;  1SDN A;  3BFF A;  4Y2F A;  3ZG5 A;  5CGS A;  5L10 A;  5LBR A;  1VEU A;  1OME A;  2Y91 A;  4DE1 A;  4BL2 A;  1N9L A;  1M6K A;  2EFU A;  3VP2 A;  3WS0 A;  4IHQ A;  1T19 A;  4S2P A;  3VOZ A;  2JKR M;  5CXW A;  3MZF A;  2ZL1 B;  1MWU A;  3P01 A;  3UE1 A;  1W8Y A;  3T50 A;  5HD3 A;  2XH9 A;  4Y13 A;  3NEC A;  4P85 A;  2QWS A;  3IX4 A;  2ZD8 A;  1BSG A;  3V39 A;  5M18 A;  3GRJ A;  3C8C A;  1PWD A;  2BTF P;  1W8Q A;  3ZG0 A;  4JXG A;  2ZBB A;  4E3M A;  2V1B A;  4PM9 A;  1UWN X;  5DKL A;  2JKT I;  3PBN A;  1GHM A;  5HDC A;  5HDS A;  4QHC A;  4EQ1 A;  1S66 L;  3UB8 A;  4E6X A;  3OC2 A;  3UDI A;  2DRW A;  1JWP A;  1WE4 A;  2WAE A;  1TS8 A;  4OOM A;  4DXC A;  3RH8 B;  1A0K A;  4Z9Q A;  3VV4 A;  1YAX A;  3BFC A;  4KQR A;  2V0W A;  4ARZ B;  1YLT A;  1YLZ A;  4WL9 A;  2XK1 A;  3VOY A;  3PR6 A;  3C7V A;  1MC0 A;  1PYY A;  2ZC6 B;  1SKO A;  3R7W B;  2NUP C;  3S7P A;  3UNW A;  5HWT A;  4U0X A;  2JN7 A;  2ZOH A;  3BRM A;  3IWO A;  3AGE A;  2V9A A;  1YSP A;  1W7F A;  2Z2M B;  5EPH A;  3NJA A;  3PYP A;  1UGU A;  3ZDJ A;  1LHY A;  2R9X A;  3DAV A;  3HJK A;  1IEM A;  2WK0 A;  4GD8 A;  2Q0O A;  1ESU A;  4KZ5 A;  4M3K A;  3T4T A;  2ZM0 A;  2OLU A;  1P97 A;  2RL3 A;  2C6W B;  4LCM A;  3E4P A;  4BL3 A;  2WKQ A;  2HDS A;  2IWD A;  1HLU P;  5EFW A;  3M6B A;  4BBU A;  3T1X A;  1QME A;  4WZ5 A;  1MY8 A;  4JXV A;  3MFD A;  3QNB A;  4OPQ A;  5FA7 A;  2HGV A;  4FSF A;  3NBL A;  5EOO A;  4QB8 A;  2B95 A;  4QY5 A;  3CUE A;  3IF6 C;  4CLC C;  2G2W A;  4B88 A;  3LGO A;  4UQI M;  3UB9 A;  5G18 A;  5FDS A;  4OVD A;  1K57 A;  3B33 A;  4Q8I A;  1N9O A;  4JPM A;  2VGL M;  1S1Y A;  2L1M A;  4B4Z A;  5EVI A;  2JE5 A;  4RA7 A;  5M19 A;  4E3J A;  3T12 B;  5D3O A;  3L9K A;  1JTG A;  2I72 A;  2WKP A;  4JLF A;  4ZJ3 A;  2XGN A;  1LL8 A;  4KZ9 A;  5TBM B;  2JHE A;  5FQI A;  2Y55 A;  4MNR A;  4LV3 A;  1OTB A;  2FFF B;  2EXB A;  3HL9 A;  1TDG A;  3L7H A;  3Q1F A;  5GHX A;  5CEC A;  1PRQ A;  4WN5 A;  1VEU B;  3QP8 A;  3DTK A;  1ALQ A;  3CI6 A;  5KMW A;  4XT2 A;  3ZG8 B;  4GDB A;  5IU1 A;  2QHK A;  3T4L A;  1BLC A;  3H82 A;  2Q9N A;  4PAU A;  4LRY C;  2E8J A;  3QP4 A;  2J9O A;  2EFX A;  3HRE A;  3HLB A;  4RYE A;  5A92 A;  1FIK A;  4EBP A;  5CHJ A;  2OSU A;  1CK3 A;  2WGW A;  5HD5 A;  3IXD A;  4BD0 A;  4MBF A;  4ID4 A;  3UB7 A;  2Y2I A;  4GD6 A;  3CMZ A;  5FAO A;  3PXP A;  4MN7 A;  3IXB A;  2W3E A;  4EUZ A;  4KZ3 A;  1GA0 A;  3WS1 A;  4X55 A;  2CC1 A;  3C5A A;  5I94 A;  1PNE A;  4R3B A;  3IX3 A;  4UQI S;  2QPN A;  1W5D A;  3JPU A;  3S7O A;  4GLQ A;  2VGL S;  4YWZ A;  1KE3 A;  5FI7 A;  3MKE A;  5HAR A;  4RQ9 A;  1DRM A;  1WYB A;  3FKV A;  1D06 A;  3A3E A;  3EQU A;  3SH9 A;  1XJ3 A;  2DCF A;  4OOY A;  3G4P A;  3LO7 A;  2ZQC A;  2G2U A;  2J9P A;  4G3K A;  2KX6 A;  4KZ4 A;  4U3T A;  3K2N A;  1YM1 A;  3QP6 A;  2A49 A;  1XKZ A;  4NXB A;  3ZHH A;  3G2Y A;  1VHM A;  2DMW A;  2ZLY A;  2P04 A;  1ZHH B;  2JC7 A;  2WZZ A;  3G35 A;  1H5X A;  1PW1 A;  5FEF A;  2M7V A;  4JXW A;  3A3I A;  1L0D A;  4EEP A;  3RXW A;  1E3U D;  2OWJ A;  3HUO A;  4WMC D;  1J9M A;  4WEJ A;  1XJ6 A;  4GCZ A;  4JGQ A;  2WKH A;  2D02 A;  4NXG A;  1AXB A;  3OBF A;  4KZB A;  5AJG A;  1GCE A;  4KG6 A;  2DNS A;  5KSH A;  5CHU A;  4XUX A;  2XQZ A;  5HL6 A;  5FQK A;  2Y79 A;  1PIO A;  3KO6 A;  3IHB A;  1XJ2 A;  1I2W A;  4PMA A;  5F1G A;  3UDF A;  4QY6 A;  1NRF A;  4HJ6 A;  4HQA A;  5AVE A;  1K6S A;  5EEC A;  5E2G A;  3E4Q A;  3SS4 A;  3N8S A;  3OLO A;  3LIC A;  3LIF A;  5DTS A;  2V1A A;  3VSL A;  1TS7 A;  2Y2Q A;  3NOT C;  4NG2 A;  2C5W B;  1HTZ A;  1BLS A;  5HWW A;  5DF9 A;  2O0Y A;  2W3F A;  3QP1 A;  5L09 A;  2MJ6 A;  1OT6 A;  4L9E A;  5HAQ A;  3JYI A;  3M2K A;  1NLY A;  1ODV A;  1IOU A;  1D7E A;  3F1O B;  2P9V A;  1YKD A;  3PAE A;  3CZD A;  4IJG A;  1YLP A;  1IYP A;  3ZVW A;  1LSW A;  3KSI A;  2GDN A;  2V1Z A;  2XD1 A;  3QNC A;  3G2Z A;  4QD4 A;  4F3L A;  3DBA A;  3KYZ A;  2BG1 A;  3Q7V B;  4GB7 A;  2ZQ9 A;  4KQO A;  3WS5 A;  1GSX A;  1OTI A;  4ZDX A;  4QJG A;  3QP2 A;  3P09 A;  1PWG A;  2OOL A;  1LI9 A;  2A24 B;  4K91 A;  3Q07 A;  3ZNY A;  1HVB A;  2OLV A;  2PBD P;  5HDD A;  2OAP 1;  1GSV A;  4WBG A;  1DP8 A;  1JVJ A;  2I9V A;  2WGW B;  1FSY A;  3H7W B;  4NEE D;  4UA6 A;  1C3B A;  3IF6 A;  4CLC A;  1ACF A;  3B47 A;  3A3D A;  1LI0 A;  3O87 A;  1G28 A;  2R78 A;  3BFD A;  2ZC5 B;  2HV1 A;  1XGI A;  4R23 A;  1CI9 A;  3UB6 A;  1PWC A;  1XPB A;  1U60 A;  4BBT A;  2Z6D A;  4S2O A;  4EXO A;  1PW8 A;  5FL3 A;  1I5Q A;  3O88 A;  3H9W A;  2EWW A;  4JBF A;  4GNU A;  4R70 A;  4XUZ A;  2A2L A;  2CMN A;  3PBO A;  4RX2 A;  5E2H A;  3V67 A;  2HJE A;  3N8L A;  3LID A;  3PBR A;  4MEZ A;  2GJ3 A;  1FSW A;  2M1C A;  1F9I A;  2FFY A;  4Y0U A;  5DTT A;  5HFO A;  2HF6 A;  3LIB A;  4KG2 A;  5F83 A;  4YFM A;  4UAA A;  3PAG A;  1LSX A;  3MR0 A;  5EVI D;  3SOI A;  2EX2 A;  2W1T A;  3RTY A;  1G6A A;  4HP9 A;  1TDL A;  4G3V A;  2K31 A;  4B4X A;  1BTL A;  2Z2L B;  4WLA A;  4OLG A;  1STZ A;  1K4F A;  3GV9 A;  1JWZ A;  3OPR A;  1K0K A;  4Y0O A;  2OAQ 1;  3NI9 A;  5TFQ A;  3WRT A;  2NUT C;  1G5U A;  2VJW A;  5HX9 A;  3GMW A;  3MBZ A;  2V8F A;  3KYE A;  5FAT A;  1IKG A;  3HLG A;  3MZE A;  2Y2L A;  4EBN A;  1VET B;  1BLP A;  2FH5 A;  3CJM A;  5FAP A;  5KSC A;  2G7U A;  3G31 A;  3VFF A;  1N9B A;  5CX7 A;  3K3D A;  5HL1 A;  3C4P A;  3E0Y A;  1BYW A;  3ZG9 B;  4Y0T A;  2JKR I;  4JGP A;  2L4R A;  1KE4 A;  1KVL A;  4EET B;  1EWZ A;  4ETZ A;  4EER A;  4KEN B;  4DJ3 A;  2ZOI A;  4DE3 A;  2W0N A;  1MXO A;  3BQA A;  3HUN A;  1PFL A;  1L0G A;  2VV6 A;  3DW0 A;  2PBY A;  1CJF A;  3UN7 A;  4CPK A;  2O9A A;  3TSG A;  5HSQ A;  1DY6 A;  1YSQ A;  3PBT A;  4OPR A;  1S67 L;  1ERM A;  1EI5 A;  1FCM A;  3WS4 A;  3AGF A;  4HNB A;  2XRN A;  2HDU A;  5A90 A;  1IEL A;  3C4O A;  2INW A;  1ONG A;  1J3W A;  4X1M A;  1YMS A;  3P98 A;  3NIA A;  3BY8 A;  2WKR A;  2IA2 A;  3LY4 A;  4MMN A;  5AQA A;  5JYP A;  2OV5 A;  3ZFZ A;  1V9Y A;  3GQZ A;  4NK3 A;  1XP4 A;  1MKM A;  3BFG A;  1TVF A;  4R3J A;  5F1F A;  3LIA A;  1V9Z A;  2O9C A;  3NOP C;  2V0U A;  3DTI A;  5HAP A;  5J3W A;  4JGR A;  4JF4 A;  4X53 A;  2H0Y A;  5FAS A;  1PZP A;  2UV0 E;  4HBU A;  3ZGA B;  4E3N A;  4R6L A;  4FH2 A;  3ZQ5 A;  2HP6 A;  4LV2 A;  4E3I A;  4PKY A;  2Y2N A;  3IBR A;  4GS9 B;  4RVA A;  1ES5 A;  1YLW A;  1P9R A;  1XA7 A;  1K56 A;  1LT0 A;  2VK3 A;  5FQJ A;  2J3T C;  3CIT A;  3S7N A;  2R9W A;  2D01 A;  3LFV A;  1ZC2 A;  4DRT A;  2HDQ A;  4OQG A;  1MWR A;  3EQV A;  1TF1 A;  5IHV A;  2VLG A;  2YKH A;  3FWL A;  2W27 A;  2VGJ A;  1XX2 A;  4HJ3 A;  1L3L A;  3M6H A;  3UE3 A;  4D60 A;  3D9Y A;  3HLE A;  3MXQ A;  5DKK A;  3LI8 A;  1BUE A;  2ZC3 B;  4LCL A;  2XRO A;  1IYQ A;  1XFN A;  5KZH A;  4KUK A;  2XSS A;  5G4Z A;  3LEZ A;  1FCO A;  1FCN A;  3HCY A;  2ZC4 B;  2WUQ A;  4H6J A;  2Y2O A;  1OJ5 A;  4QPR A;  3B3X A;  4X69 A;  2H5S A;  1DP9 A;  4I3J A;  3SW1 A;  1TD5 A;  1TS0 A;  3T4J A;  1BUL A;  1BT5 A;  4X6T A;  3SH7 A;  1P0Z A;  4EWF A;  1RCJ A;  4N92 A;  3TG9 A;  3IXG A;  1D1J A;  4IBR A;  4BMW A;  2JKG A;  4P6Z M;  2PD7 A;  1GHP A;  4MBK A;  3LEQ A;  4FOF A;  2XFT A;  3A3J A;  5MC7 A;  5A8B A;  3CPT A;  3MMH A;  1XGJ A;  1M40 A;  5TGF A;  3BQ8 A;  4DKI A;  3VP1 A;  1SDE A;  4N1X A;  3SS5 A;  4NXF A;  1CI8 A;  4K08 A;  4PM8 A;  5DFX A;  5DVA A;  3FZC A;  5DF8 A;  4KQD A;  2VKS A;  1KE0 A;  3NHQ A;  1YT4 A;  2WYX A;  3LUQ A;  3T4O A;  4BLM A;  1SKO B;  4UEY A;  4IED A;  3EEA A;  5CER A;  1MKI A;  3F1P A;  4N9L A;  1S6R A;  5I5L A;  3F1N A;  5DF7 A;  3T4S A;  1MWT A;  4MN5 A;  4ZJ1 A;  4DE2 A;  2Y8H A;  4CLC D;  2EX9 A;  4N1H A;  1LSV A;  4FD8 A;  1K4E A;  3N8R A;  1PI4 A;  3ITA A;  2H10 A;  3IX8 A;  3ZVT A;  2XLN A;  4BWI A;  1S4R A;  1E4D A;  1JTD A;  2ZMA A;  1KDS A;  2HJ9 C;  2PAV P;  2WGI A;  1OJG A;  3UPO A;  2AVX A;  4KZ6 A;  2K2N A;  3TE8 A;  3CHW P;  4FH4 A;  4KZ8 A;  5E2E A;  2PRF A;  4ZTK A;  5GLB A;  3W4O A;  3PTE A;  1ZG6 A;  1Y4O A;  5FQM A;  1DJA A;  4DXB A;  1T18 A;  4IUH A;  2ZQ8 A;  4P6Z S;  4OQ0 A;  2ZL1 A;  4U0T A;  1ES4 A;  4Y7P A;  4N9K A;  5EVI B;  4X1L A;  1ERO A;  1NWZ A;  4R4R A;  3E2K A;  3KSF A;  2V8C A;  2W3G A;  3HVF A;  4NKP A;  1QMF A;  4LV1 A;  3VP3 A;  4JKT A;  3W8K A;  3ZNT A;  2PHY A;  1GA9 A;  4X56 A;  3BJN A;  3BLS A;  1OTD A;  5KIZ A;  2ACG A;  2Y2H A;  2QZ6 A;  2PU4 A;  3SH8 A;  3ZYT A;  3PHY A;  4RX3 A;  2XA7 M;  1NRJ A;  2XF3 A;  5EOE A;  2WGV A;  2KOI A;  5FSR A;  1Z09 A;  4K0W A;  3O5Y A;  3OZH A;  4I3I A;  2XD5 A;  1KGF A;  5TR7 A;  5HZH A;  4JF5 A;  2QMI A;  4P0M A;  3LR5 A;  1OTE A;  4GOG A;  1TS6 A;  1SHV A;  1UWP X;  2JKF A;  4ARZ A;  3FC7 A;  4XT2 B;  3SS3 A;  3QP5 A;  1LL5 A;  1P9W A;  4LRZ E;  5GL9 A;  3Q82 A;  3R7W A;  3V3R A;  1YMX A;  2FZ0 A;  3H82 B;  4IVI A;  2Q9M A;  3UPN A;  1L0E A;  3KYQ A;  2XFS A;  3VFH A;  1KOU A;  4O8G A;  3KSG A;  1BLH A;  4I38 A;  1IFQ A;  1VB6 A;  1NLZ A;  1MWS A;  4GDN A;  4OP5 A;  4GN2 A;  3BFE A;  3LI9 A;  3LY3 A;  4IVK A;  5CRF A;  1IKI A;  5GLD A;  3V50 A;  1MPL A;  1PI5 A;  5F6A A;  3CWF A;  4HP4 A;  1MBL A;  1DP6 A;  3EEH A;  4FCF A;  4Q0I A;  1NJ4 A;  2X01 A;  4S2N C;  4ESP A;  1DJC A;  2Y2M A;  5CGX A;  5L8M A;  3D3O A;  3HLW A;  3LCE A;  5GLC A;  1FR6 A;  1NYY A;  4AFI A;  3RXX A;  3GTC A;  5DTK A;  1H8Z A;  1ES3 A;  1K55 C;  3BM6 A;  3G6O A;  4QU3 A;  3FPV A;  3W4Q A;  4IUK A;  3K3C A;  4I3A A;  5FAQ A;  1Y28 A;  5EVE A;  3LIE A;  4A5R A;  3PBS A;  3OCN A;  1WA9 A;  4II7 A;  3A0S A;  3FYZ A;  1EW0 A;  3UY6 A;  3MQO A;  4EQI A;  1E25 A;  3DTM A;  3T4Q A;  5CTN A;  3UO9 A;  5FI2 A;  2PYR A;  4PM5 A;  1ERQ A;  3DWK A;  3WS2 A;  4HH3 A;  2GX5 A;  4S2M A;  4WEK A;  5EUA A;  5HAI A;  3BYD A;  2XA7 S;  5EE8 A;  2WZX A;  5EM1 A;  3IH8 A;  2ZMV A;  3JVV A;  5M1A A;  2Y2J A;  5TBM A;  4K0X A;  1X0O A;  4Y17 A;  1K56 D;  5F5Y A;  2O99 A;  3ZCZ A;  2EX6 A;  3UMD A;  1H8M A;  4EES A;  4YOF A;  3N4I A;  4BD1 A;  4PHT A;  4EEU A;  2M7U A;  2JCH A;  2JKT M;  1IYS A;  3VP0 A;  5CEB A;  3EGX C;  1CF0 A;  3GR2 A;  5FQ9 A;  2ZJ9 A;  4GW9 A;  2LB9 A;  1XJ4 A;  5CED A;  4C3Q A;  3GDI A;  4PPR A;  3UB5 P;  4DMZ A;  3OPP A;  2L0W A;  2J7V A;  3VSK A;  1L2S A;  4F94 A;  3IXH A;  3DTE A;  3C30 A;  2KDK A;  4JXS A;  4B9O A;  4WEL A;  1SCW A;  2WKI A;  4UHU A;  4MN6 A;  3G32 A;  3BWL A;  4WZ4 A;  1VQQ A;  2BAS A;  2HP5 A;  4HIA A;  3O86 A;  1NZU A;  2ZM2 A;  1H0M A;  1I2S A;  5E43 A;  4R3A A;  1NZO A;  3MF0 A;  4Y3I A;  1G6O A;  5GHZ A;  3TOI A;  2V20 A;  2EWV A;  3IT9 A;  3MSH A;  1TEM A;  4Q0H A;  4EUV A;  3BW6 A;  2XR0 A;  3Q7Z A;  1YLY A;  2P9V B;  4Z1W A;  5AQB A;  2H0T A;  1ESI A;  2W1R A;  3BEC A;  5IT5 A;  5CGW A;  4OQI A;  4EW7 A;  5J4E A;  3MJQ A;  1S0W A;  1GHI A;  4GZB A;  4F3L B;  2QYB A;  3NC8 A;  2ZQA A;  4X68 A;  3UE0 A;  3O3V A;  3OOV A;  5L2F A;  4QWO A;  3V5M A;  4JGO A;  2VV7 A;  2B02 A;  3OCL A;  4H8R A;  1XFQ A;  4L9G A;  5L07 A;  1NYM A;  4Y15 A;  4G3W A;  3OPL A;  1XXM A;  3UME A;  3EGD C;  2WKE A;  4UA9 A;  3UPP A;  1GSW A;  4MLL A;  3B42 A;  3IF6 B;  5G4Y A;  4CLC B;  4EU0 A;  3T1Q B;  4E04 A;  3A0V A;  4HES A;  1Q2Q A;  2GZA A;  5DFY A;  1ES2 A;  2VA0 A;  3D72 A;  3UE6 A;  1HZO A;  4PM6 A;  4ETX A;  2PU2 A;  3W4P A;  2ZQD A;  3G30 A;  4BEN A;  1AWI A;  5JYO A;  3C2W A;  3VE3 A;  2OWH A;  3V3S A;  2ZM8 A;  1N9N A;  3NUL A;  3A3F A;  4OQH A;  4KZ7 A;  4B93 A;  1YPR A;  4M4X A;  3DWZ A;  1K6R A;  3AGD A;  4O0P A;  1KDW A;  3HBR A;  3M2J A;  1ONH A;  3TJZ C;  4OKP A;  4PKY G;  3E98 A;  4HHD A;  3LYX A;  4MBH A;  3MQQ A;  1LL9 A;  1BZA A;  2X71 A;  4HI4 A;  3C7U A;  1JNU A;  4YNR A;  3S1Y A;  2K7S A;  2EXA A;  2Y2G A;  4IBX A;  4MDZ A;  3CG5 A;  3GSG A;  2VV8 A;  4D2O A;  3MZD A;  5A91 A;  4X25 A;  2P08 A;  4GKU A;  4GJ4 A;  5EVL A; 
#chains in the Genus database with same CATH homology
 1KGG A;  2IWB A;  1JWP A;  1WE4 A;  2WAE A;  1FR1 A;  4OOM A;  4FH4 A;  4DXC A;  3WRZ A;  4S2J A;  4Z9Q A;  4BJP A;  3BFC A;  4KQR A;  3BFD A;  2ZC5 B;  1XGI A;  1YLT A;  1YLZ A;  4KZ8 A;  5E2E A;  2XK1 A;  1K54 C;  4ZTK A;  3N7W A;  3VOY A;  3C7V A;  5GLB A;  3PBQ A;  3W4O A;  1PYY A;  2ZC6 B;  3PTE A;  4R23 A;  1ZG6 A;  3UNW A;  1CI9 A;  3Q81 A;  3D4F A;  1PWC A;  1XPB A;  1U60 A;  4U0X A;  5FQM A;  3BRM A;  1DJA A;  4DXB A;  1WYC A;  3BLM A;  3IWO A;  2ZQ8 A;  2J8Y A;  4S2O A;  3ZG7 B;  4OQ0 A;  3HLC A;  4U0T A;  1ES4 A;  3AGE A;  4Y7P A;  4OP8 A;  1PW8 A;  4N9K A;  4S2L A;  1I5Q A;  3O88 A;  5EVI B;  1W7F A;  2Z2M B;  1CEG A;  4LEN A;  5EPH A;  1ERO A;  4R4R A;  1FOF A;  3Q7V A;  3ZDJ A;  3E2K A;  1K25 A;  1LHY A;  2R9X A;  3I7J A;  3HVF A;  4WYY A;  1QMF A;  4JBF A;  1IYO A;  4LV1 A;  4GNU A;  1IEM A;  4PM7 A;  2WK0 A;  4GD8 A;  4JKT A;  3VP3 A;  1ESU A;  4KZ5 A;  1G68 A;  4M3K A;  4XUZ A;  3W8K A;  2ZQ7 A;  3ZNT A;  2ZM0 A;  3PBO A;  2OLU A;  1GA9 A;  4RX2 A;  4S2N A;  5E2H A;  4E3O A;  4X56 A;  3E2L A;  2RL3 A;  2C6W B;  3WWX A;  3BLS A;  3HLD A;  4OLD A;  3BEB A;  3N8L A;  4LCM A;  1NY0 A;  4BL3 A;  4HBT A;  4E3L A;  2Y2H A;  3PBR A;  2QZ6 A;  2PU4 A;  4MEZ A;  1FSW A;  3SH8 A;  3UDX A;  5HW3 A;  2FFY A;  2ZC7 A;  2HDS A;  1JWV A;  4RX3 A;  4S2I A;  4Y0U A;  5DTT A;  5HFO A;  1K55 A;  2IWD A;  4YIN A;  1H8Y A;  2XF3 A;  5EOE A;  2WGV A;  3M6B A;  5FQQ A;  4CJN A;  3VMA A;  5FSR A;  4KG2 A;  5F83 A;  1QME A;  5AQ9 A;  4WZ5 A;  1MY8 A;  4K0W A;  4YFM A;  3OZH A;  3OPH A;  4JXV A;  4UAA A;  1DJB A;  3PAG A;  3MFD A;  3QNB A;  4OPQ A;  5EVI D;  3SOI A;  2EX2 A;  2XD5 A;  1KGF A;  4EBL A;  5TR7 A;  5FA7 A;  4JF5 A;  2QMI A;  2X02 A;  4P0M A;  4OPY A;  2B5R A;  1G6A A;  2Y4A A;  4FSF A;  4GOG A;  1TDL A;  3NBL A;  1SHV A;  5EOO A;  4B4X A;  4QB8 A;  4QY5 A;  3IF6 C;  3SS3 A;  1Q2P A;  2G2W A;  3FV7 A;  4B88 A;  1BTL A;  5AQ7 A;  1LL5 A;  2Z2L B;  4OLG A;  5GL9 A;  3Q82 A;  4NET A;  3V3R A;  1YMX A;  4IVI A;  3UPN A;  2Q9M A;  1K4F A;  2HDR A;  1PZO A;  1JWZ A;  3GV9 A;  1L0E A;  3OPR A;  4Y0O A;  5G18 A;  4OVD A;  2XFS A;  3NI9 A;  5TFQ A;  3WRT A;  1K57 A;  4Q8I A;  5E2F A;  4JPM A;  5HX9 A;  3GMW A;  3MBZ A;  3N6I A;  3VFH A;  3ISG A;  4OPZ A;  1BLH A;  4B4Z A;  4DDS A;  3IWI A;  5EVI A;  5FAT A;  1MWS A;  1IKG A;  4GDN A;  4GN2 A;  2JE5 A;  4OP5 A;  4RA7 A;  3BFE A;  3HLG A;  3MZE A;  2Y2L A;  5M19 A;  4EBN A;  3LY3 A;  4IVK A;  1BLP A;  5CRF A;  4E3J A;  4BQM A;  5D3O A;  1IKI A;  5GLD A;  3V50 A;  4HEF A;  3NDE A;  1MPL A;  1PI5 A;  3CJM A;  2E8I A;  5FAP A;  5KSC A;  1ZKJ A;  3G31 A;  3VFF A;  1YQS A;  1JTG A;  1N9B A;  2I72 A;  5HL1 A;  4JLF A;  4S2K A;  4ZJ3 A;  4C75 A;  3C4P A;  1MBL A;  2XGN A;  4FCF A;  4KZ9 A;  1O7E A;  5J8X A;  1NJ4 A;  5FQI A;  2Y55 A;  4MNR A;  4LV3 A;  3ZG9 B;  2FFF B;  2EXB A;  3HL9 A;  4Y0T A;  1ZG4 A;  4WM9 A;  1TDG A;  4KG5 A;  4OON A;  2X01 A;  4S2N C;  1LLB A;  1KE4 A;  1DJC A;  2Y2M A;  3Q1F A;  1KVL A;  1EWZ A;  5CGX A;  3HLW A;  3LCE A;  4KEN B;  5GHX A;  5GLC A;  5CEC A;  1FR6 A;  1NYY A;  3G34 A;  1HD8 A;  4DE3 A;  1KGE A;  3RXX A;  3GTC A;  1MXO A;  4KQQ A;  5DTK A;  3HUN A;  4LV0 A;  1H8Z A;  1ES3 A;  1ALQ A;  1K55 C;  3BM6 A;  4QU3 A;  1L0G A;  5KMW A;  3ZG8 B;  4GDB A;  1K38 A;  3DW0 A;  3W4Q A;  4WZ5 C;  1BLC A;  3RJU A;  2P74 A;  2PBY A;  2Q9N A;  3UN7 A;  4CPK A;  5FAQ A;  2XDM A;  4A5R A;  3PBS A;  4E3K A;  3TSG A;  4OH0 A;  1DY6 A;  3OCN A;  2J9O A;  3PBT A;  4OPR A;  1ERM A;  5FI6 A;  5CTM A;  3FYZ A;  3UY6 A;  1EI5 A;  1FCM A;  3WS4 A;  1N4O A;  2EFX A;  3AGF A;  1E25 A;  3DTM A;  4EQI A;  5CTN A;  1RP5 A;  2V2F F;  3UO9 A;  5FI2 A;  2HDU A;  4PM5 A;  3HRE A;  3MXR A;  1ERQ A;  3MXS A;  3DWK A;  3HLB A;  3WS2 A;  4RYE A;  5A92 A;  1IEL A;  5A90 A;  3C4O A;  4S2M A;  4WEK A;  2IWC A;  1ONG A;  3ITB A;  5EUA A;  5HAI A;  4EBP A;  3BYD A;  1YMS A;  3P98 A;  3NIA A;  5CHJ A;  1K57 C;  1VM1 A;  2OSU A;  1CK3 A;  5EE8 A;  2EX8 A;  2WGW A;  2WZX A;  3IXD A;  4MBF A;  4BD0 A;  3LY4 A;  4L0L A;  5AQA A;  5JYP A;  4ID4 A;  3IH8 A;  5EVI C;  2OV5 A;  2Y2I A;  4GD6 A;  3CMZ A;  4R4S A;  5M1A A;  3ZFZ A;  5FAO A;  2Y2J A;  3GQZ A;  4NK3 A;  1XP4 A;  3IXB A;  4K0X A;  3BFG A;  1O07 A;  3S4X A;  1TVF A;  1K56 D;  4R3J A;  4EUZ A;  5F1F A;  4KZ3 A;  4EV4 A;  1GA0 A;  3HUM A;  3WS1 A;  4X55 A;  2UWX A;  4E6W A;  3ZCZ A;  2CC1 A;  3NCK A;  4OOL A;  5HAP A;  4X53 A;  4JF4 A;  2EX6 A;  2H0Y A;  3C5A A;  5FAS A;  1PZP A;  4P87 A;  5I94 A;  4HBU A;  4R3B A;  3HLF A;  2QPN A;  3ZGA B;  2WAF A;  4E3N A;  1W5D A;  4FH2 A;  1Z6F A;  2HP6 A;  3N4I A;  4UA7 A;  4BD1 A;  4LV2 A;  3IQA A;  4E3I A;  2JCH A;  2Y2K A;  2Y2N A;  1IYS A;  3VP0 A;  2VGK A;  1KE3 A;  5CEB A;  4RVA A;  5FI7 A;  3MKE A;  5HAR A;  3GR2 A;  5FQ9 A;  1WYB A;  1ES5 A;  3FKV A;  3A3E A;  3VP4 A;  5GLA A;  2ZJ9 A;  3EQU A;  1YLW A;  3SH9 A;  1XA7 A;  1K56 A;  4ZAM A;  4KZA A;  3NDG A;  2DCF A;  3GVB A;  5CED A;  5CHM A;  2XEP A;  4C3Q A;  5FQJ A;  4OOY A;  4PPR A;  3G4P A;  3OPP A;  2R9W A;  3LO7 A;  2ZQC A;  2A3U A;  1ZC2 A;  2J7V A;  2G2U A;  2J9P A;  1L2S A;  3VSK A;  4DRT A;  2HDQ A;  4KZ4 A;  4F94 A;  3IXH A;  4U3T A;  4OQG A;  4JXS A;  1YM1 A;  4WEL A;  4DF6 A;  1MWR A;  1SCW A;  2WKI A;  1YLJ A;  3EQV A;  4JF6 A;  4UHU A;  1RGY A;  3G32 A;  2A49 A;  3IWQ A;  1SKF A;  1XKZ A;  5IHV A;  4P6B A;  4WZ4 A;  3FKW A;  3FWL A;  3ZHH A;  2VGJ A;  5U47 A;  1XX2 A;  3G2Y A;  3IH9 A;  1CEF A;  1VQQ A;  2ZLY A;  3M6H A;  3UE3 A;  2HP5 A;  2JC7 A;  3HLE A;  3O86 A;  1NZU A;  2ZM2 A;  4R1G A;  2WZZ A;  3G35 A;  1H5X A;  1I2S A;  5E43 A;  1BUE A;  1PW1 A;  2ZC3 B;  4LCL A;  4JXW A;  3A3I A;  1L0D A;  1NZO A;  1KVM A;  5A93 A;  5GHZ A;  1IYQ A;  5KZH A;  3TOI A;  2HP9 A;  3RXW A;  1E3U D;  2V20 A;  3IT9 A;  2Y2P A;  2Y59 A;  3HUO A;  4DDY A;  1TEM A;  3LEZ A;  1FCO A;  4WMC D;  1J9M A;  1W79 A;  4WEJ A;  4ZBE A;  1FCN A;  2XR0 A;  2ZC4 B;  3Q7Z A;  2WUQ A;  1YLY A;  2P9V B;  3QHY A;  5AQB A;  2Y2O A;  2WKH A;  1AXB A;  2H0T A;  4XXR A;  1ESI A;  4KZB A;  3B3X A;  1GCE A;  4X69 A;  2H5S A;  3BEC A;  4ZJ2 A;  5CGW A;  4KG6 A;  4OQI A;  2DNS A;  5KSH A;  4C6Y A;  1S0W A;  5CHU A;  1GHI A;  1BUL A;  1BT5 A;  4GZB A;  4X6T A;  2XQZ A;  4XUX A;  3SH7 A;  3NC8 A;  5FQK A;  5GHY A;  2ZQA A;  4X68 A;  1PIO A;  3UE0 A;  3O3V A;  3IHB A;  3MKF A;  1E3U A;  4EWF A;  1RCJ A;  4N92 A;  5L2F A;  1XA1 A;  1I2W A;  3NY4 A;  4PMA A;  5F1G A;  3TG9 A;  4QY6 A;  3UDF A;  2WAD A;  3V5M A;  1NRF A;  4WMC A;  3IXG A;  1K6S A;  3OCL A;  5EEC A;  4IBR A;  4DE0 A;  4H8R A;  3IHA A;  5E2G A;  2RCX A;  1RGZ A;  2HPB A;  3SS4 A;  1NYM A;  3N8S A;  1Y54 A;  3OPL A;  5DTS A;  1GHP A;  1NXY A;  4MBK A;  1XXM A;  3IF5 A;  5FDH A;  2XFT A;  3VSL A;  3A3J A;  2WKE A;  2Y2Q A;  4UA9 A;  3UPP A;  5F82 A;  4MLL A;  2JBF A;  2BLS A;  1FQG A;  1HTZ A;  2C5W B;  1XGJ A;  1K54 A;  3IF6 B;  1BLS A;  1L0F A;  5DF9 A;  1M40 A;  5TGF A;  4R0Q A;  5BOH A;  3S22 A;  4O7D A;  4DKI A;  1SDN A;  3BFF A;  3ZG5 A;  4HES A;  1Q2Q A;  5CGS A;  3VP1 A;  1ES2 A;  1SDE A;  1OME A;  2Y91 A;  4N1X A;  4DE1 A;  3SS5 A;  5HAQ A;  1CI8 A;  4PM8 A;  1HZO A;  3JYI A;  5DVA A;  4BL2 A;  3M2K A;  3FZC A;  4PM6 A;  5DF8 A;  1M6K A;  1KE0 A;  1YT4 A;  2EFU A;  2P9V A;  2PU2 A;  2WYX A;  2ZQD A;  3CZD A;  3PAE A;  3G30 A;  3W4P A;  4BEN A;  3VP2 A;  4BLM A;  1YLP A;  4IED A;  3WS0 A;  5JYO A;  1IYP A;  5CER A;  4S2P A;  3V3S A;  2ZM8 A;  1MKI A;  3ZVW A;  4N9L A;  3A3F A;  4OQH A;  4KZ7 A;  3VOZ A;  2GDN A;  2V1Z A;  1S6R A;  2XD1 A;  3DWZ A;  5CXW A;  3MZF A;  5DF7 A;  3QNC A;  3G2Z A;  1K6R A;  1MWT A;  3AGD A;  4QD4 A;  1MWU A;  4ZJ1 A;  1KDW A;  3UE1 A;  3HBR A;  3M2J A;  1W8Y A;  1ONH A;  4DE2 A;  4OKP A;  2XH9 A;  2BG1 A;  3Q7V B;  4GB7 A;  2EX9 A;  4P85 A;  4MBH A;  2ZQ9 A;  4KQO A;  3WS5 A;  4N1H A;  1LL9 A;  4FD8 A;  4ZDX A;  1BZA A;  2X71 A;  2ZD8 A;  4QJG A;  1K4E A;  3P09 A;  1PWG A;  3N8R A;  1PI4 A;  1BSG A;  1LI9 A;  3C7U A;  4K91 A;  3Q07 A;  3V39 A;  3ITA A;  3ZNY A;  5M18 A;  1HVB A;  2OLV A;  3GRJ A;  3S1Y A;  2H10 A;  3ZVT A;  1PWD A;  2EXA A;  1W8Q A;  2Y2G A;  3ZG0 A;  2XLN A;  4WBG A;  4JXG A;  1JVJ A;  4E3M A;  2WGW B;  4IBX A;  1E4D A;  1FSY A;  1JTD A;  2ZMA A;  1KDS A;  4PM9 A;  3CG5 A;  3PBN A;  2WGI A;  3GSG A;  1GHM A;  4D2O A;  3UPO A;  3MZD A;  4UA6 A;  4QHC A;  1C3B A;  3IF6 A;  5A91 A;  4E6X A;  3A3D A;  1LI0 A;  3O87 A;  3OC2 A;  4KZ6 A;  3UDI A;  4GKU A;  2DRW A;  5EVL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...