5HX9A

Crystal structure of beta-lactamase from burkholderia vietnamiensis
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
263
structure length
259
Chain Sequence
AHVARSELAALDKASNGRLGVAALDTSNGTRIAHHARERFPLCGTYAVVAAAAILARASLDASLLPRRILYRRYEVVAGSPVTESHVDTGMTIAQLCAAMLQSGDKGAGNLLMNVLGGPQAVTAFAHESGDTVFRLDRWEPELNRAAPGDERDTSTPVAMVDTLQRLLLGDTLQQAQRAQLTDWMTAATGIAAGVPPGSRVAAKRGTGGYGTTTEVAVVWPPSRAPIVLAVSFTQAQADAAARADVVASAARIATGALT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Crystal structure of Beta-lactamase from Burkholderia vietnamiensis
rcsb
source organism Burkholderia vietnamiensis (strain g4 / lmg 22486)
molecule tags Hydrolase
total genus 82
structure length 259
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2016-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5hx9A00
1YT4A 3FKVA 1MKIA 3OZHA 5EE8A 5TFQA 1FSYA 3IXDA 5FAOA 1NRFA 3N8LA 5M19A 4PM8A 1LLBA 3BRMA 4N9LA 5CHUA 5DF9A 4P0MA 3UY6A 2E8IA 1TDLA 3ZVTA 1L2SA 4PM5A 5FASA 1ES3A 3BM6A 2HP6A 3M2KA 3VP3A 3W4OA 1PI4A 2ZQCA 3BEBA 5L2FA 3DWKA 4N1HA 3V3SA 1ES4A 5CTNA 3BFDA 4S2KA 4GKUA 5A90A 4LV3A 1ERMA 2Y2NA 1YLZA 1Z6FA 4C6YA 4Q8IA 2WZXA 1XA7A 5DTSA 5FA7A 1IELA 5M18A 2Y59A 4KQOA 4N1XA 2HDQA 4UAAA 1SKFA 4KZ3A 2ZMAA 4DDSA 4RX3A 5CXWA 4KG5A 4DKIA 1WYCA 1K6RA 2C5WB 2B5RA 3AGFA 5HFOA 3ZGAB 2ZD8A 1PZPA 4S2PA 4EV4A 3BFEA 4OQIA 4WEJA 1BLHA 3HREA 2DRWA 3BECA 4JXWA 3OC2A 2HP5A 3UN7A 2XEPA 3HUOA 4GN2A 4QD4A 2X02A 4C75A 1RGYA 4XXRA 2CC1A 4K0XA 5CGSA 4B4ZA 2A3UA 3P09A 2R9WA 2OLVA 3IWOA 1E25A 4DDYA 5HAIA 3W4QA 4JBFA 3N7WA 3VMAA 2GDNA 3A3FA 3BLSA 1NZUA 1ONHA 2QPNA 3GVBA 3VOZA 3BFCA 3UDFA 1W5DA 2Z2LB 4S2JA 5GL9A 1ES2A 3MXSA 1KE3A 4U3TA 1BULA 4OQHA 2XQZA 1DJBA 2EX6A 3HBRA 1IYQA 4JF6A 4KZ7A 4WELA 3FYZA 2WZZA 4OOLA 5FQMA 3WWXA 5A92A 1VQQA 1XGJA 1JWZA 4ZDXA 1ONGA 4DXCA 3VSKA 2H5SA 1VM1A 1EROA 3DTMA 5GHZA 2ZC5B 3ZVWA 5CECA 4QY6A 2XLNA 4LCLA 4GD6A 2UWXA 4E6XA 1FR6A 1SDNA 3V5MA 1NJ4A 2ZLYA 4KZ5A 1IKGA 3CMZA 2ZM0A 3JYIA 1L0DA 3ISGA 3Q07A 4R0QA 2Y2MA 1IYPA 1W79A 4HBTA 3OPHA 2DCFA 1SCWA 5CHJA 4U0XA 4IVIA 2FFYA 3IH8A 5FDHA 1BSGA 2EXAA 3E2KA 4GDNA 4BD1A 1I2WA 3M6HA 3A3JA 5FQ9A 1L0GA 1H5XA 1H8YA 1TDGA 2WUQA 3IF6C 4BD0A 5GLCA 4YFMA 2HDUA 2DNSA 4HBUA 4XUXA 4R4SA 2ZQDA 3DW0A 4MBKA 4LCMA 4OH0A 4K0WA 4LV0A 4X69A 3MBZA 1I2SA 1MY8A 3Q1FA 4LENA 4OPQA 2JC7A 3ZG8B 1PW1A 3S4XA 2IWCA 4P6BA 5EVLA 1JWVA 2C6WB 3FWLA 2IWBA 5HL1A 1K4EA 3GTCA 1BT5A 1K38A 4KQRA 4YINA 4BJPA 3PAGA 2X01A 4BL2A 2XH9A 3G4PA 3C7UA 4DE0A 4EWFA 1KVMA 4QY5A 2XFTA 1RP5A 2A49A 4OOYA 1LHYA 5E43A 5GLBA 3ZNTA 5JYPA 3WRZA 1HD8A 5FI2A 4FH2A 2J8YA 4DE1A 1GCEA 2BG1A 1EI5A 5TR7A 4OVDA 5HAQA 1MWUA 1PIOA 3CG5A 1CEFA 3LO7A 5KSCA 4NK3A 4KG6A 3IHAA 3Q82A 2HDSA 2V1ZA 3D4FA 4C3QA 1KE0A 1FQGA 1YQSA 3NDEA 3NIAA 4N92A 4B88A 1Y54A 1G6AA 4MBHA 4X6TA 3OPLA 4HESA 3PBQA 4ZJ3A 5A91A 3LEZA 4Y0UA 5E2FA 1K25A 3SH9A 1JWPA 2VGJA 5CEBA 1BLSA 1K57A 4CPKA 3Q81A 1XA1A 2WAEA 3E2LA 4RA7A 5GHXA 4R3BA 2V20A 3IF6A 4H8RA 3WS1A 4B4XA 2WGWA 1FSWA 3IQAA 3GSGA 4S2NA 5CHMA 4EBLA 2ZQ9A 3UO9A 2H0YA 3SH7A 1YLYA 3VOYA 2R9XA 5M1AA 3O86A 4OLGA 1MBLA 3W4PA 4OPYA 4QJGA 1KVLA 4JF5A 3HLGA 4BL3A 4O7DA 1YM1A 5F83A 3HUNA 5DTTA 2Q9NA 3IXBA 4M3KA 1CK3A 1BTLA 1YMXA 4OQ0A 1K55A 1MWSA 3WRTA 3PTEA 4RYEA 3BFGA 3CJMA 5DF7A 2HPBA 1N4OA 4KZ4A 4GD8A 4MEZA 3DWZA 3VSLA 1XPBA 1TEMA 4E3KA 1O07A 4R3JA 5AQAA 4JXGA 3HLFA 1EWZA 4WZ4A 3V39A 3G32A 2Y2GA 3MZFA 3UDXA 2OSUA 3OCNA 4MNRA 4KENB 2WKEA 5FAPA 1ESIA 1ZG6A 2EX8A 3A3EA 4GB7A 4KZ6A 3HLWA 4Y7PA 1ERQA 2Y55A 3ITAA 3OPRA 4PMAA 4WMCA 2J7VA 4JF4A 5KZHA 5KSHA 3SH8A 1ES5A 3EQUA 2Y91A 1HVBA 1Q2QA 4DE2A 4FD8A 5FAQA 1YLJA 3AGDA 2H10A 5JYOA 5IHVA 4PM7A 4E3LA 1IKIA 1BLPA 3BYDA 4JPMA 4IEDA 4S2IA 5AQ9A 1M6KA 3RXWA 3PBOA 1CI8A 2QMIA 4ZJ1A 1JTGA 1GHIA 1PWGA 2I72A 1TVFA 1MPLA 1OMEA 4QB8A 1K54A 3O87A 5TGFA 3MXRA 4UHUA 5GHYA 3IXGA 5HARA 1CEGA 3WS2A 4K91A 3ZG0A 2Y4AA 1RGZA 2Y2IA 3IT9A 3VP0A 3FKWA 3HUMA 3UNWA 1S6RA 3WS4A 1K56D 3ZG5A 5BOHA 2H0TA 3CZDA 3UE3A 3S22A 1FR1A 4KZBA 4X68A 1KE4A 1QMEA 2Z2MB 3NBLA 3OPPA 1K57C 2JE5A 3HL9A 3LY4A 2J9OA 5DF8A 4NETA 1NYMA 1HZOA 2VGKA 1ESUA 3C4OA 4S2NC 1DY6A 5U47A 2ZQ8A 4WZ5C 3NC8A 5E2GA 3G34A 4BLMA 3QHYA 1ALQA 3TG9A 1GHPA 4FSFA 4GDBA 2P9VA 3MZDA 5CTMA 5FSRA 4DF6A 4WYYA 3C4PA 3MFDA 2Y2OA 1YLWA 4EBPA 1LL5A 3GV9A 3LY3A 3IF6B 5HAPA 4Z9QA 2WGWB 5GLAA 4WMCD 2BLSA 3VFHA 3UPPA 4S2MA 1K55C 4UA7A 2XK1A 2JBFA 3OCLA 4KG2A 4KZ9A 5HX9A 3UDIA 5HW3A 3NDGA 1LL9A 3UPOA 4A5RA 3HLBA 4X53A 2RL3A 1SDEA 4OPZA 2JCHA 3BFFA 1KDSA 4HEFA 3HVFA 4WEKA 3RXXA 3TSGA 2QZ6A 3NI9A 2ZQ7A 4GOGA 4RX2A 3AGEA 3IHBA 2WYXA 4JLFA 4P87A 3IF5A 1ZKJA 4DRTA 1ZG4A 2EFXA 1QMFA 1XGIA 4OONA 4E3MA 3IWQA 3WS5A 4DXBA 1PZOA 4ID4A 4QHCA 1J9MA 2Y2PA 1MWRA 2OLUA 4R1GA 1PWDA 5AQ7A 3LCEA 3A3IA 5FATA 4E3IA 1YLPA 1W7FA 5EVIA 1MWTA 4X55A 3ZG7B 2RCXA 2WKHA 3BLMA 4JXVA 4WZ5A 5E2HA 1LI9A 3UE1A 5EOOA 1NZOA 1O7EA 2ZJ9A 3QNCA 3WS0A 4R4RA 1N9BA 1K54C 5EPHA 3S1YA 4LV2A 1JVJA 3G35A 5FQKA 1IYSA 4LV1A 4WBGA 4CJNA 1FCNA 3SS3A 1K56A 3GR2A 5FI7A 5EOEA 3VP1A 2ZC4B 5F1GA 1KDWA 3QNBA 4UA6A 3N8SA 3SS5A 3NCKA 3MKEA 5F82A 4ZBEA 1XKZA 1YLTA 3FZCA 3G2YA 1KGFA 2Y2HA 1FCMA 1H8ZA 3MZEA 4FCFA 5GLDA 1BUEA 1G68A 1YMSA 2Y2KA 2V2FF 5EECA 4E6WA 4MLLA 3TOIA 3W8KA 3B3XA 1E3UD 3IXHA 3ZCZA 4EUZA 2IWDA 3Q7VA 3HLDA 4PPRA 4N9KA 4L0LA 2Y2QA 4F94A 2XR0A 5FQJA 3N6IA 4QU3A 2EX2A 1PW8A 4OQGA 4UA9A 4E3OA 4WM9A 2EXBA 3SOIA 1DJCA 4EQIA 3GQZA 3ITBA 4R23A 2XD5A 3ZHHA 1K4FA 3G2ZA 5G18A 1BLCA 3GMWA 5E2EA 5CEDA 3SS4A 4OKPA 3C7VA 4KZ8A 1PI5A 3ZNYA 4U0TA 3RJUA 1PWCA 2P9VB 1L0EA 4P85A 1JTDA 1S0WA 5CGWA 1WE4A 1XX2A 4E3JA 3GRJA 1XXMA 4DE3A 3VP2A 3MKFA 5CERA 3G31A 5EVID 1W8QA 2ZQAA 2ZC3B 3PBNA 3Q7ZA 4OLDA 2XF3A 1C3BA 5DVAA 1GHMA 4OP5A 5J8XA 3IH9A 5KMWA 1E4DA 2G2WA 4GNUA 3HLCA 4IVKA 2XDMA 4FH4A 3VP4A 3HLEA 2X71A 5EVIC 2OV5A 1DJAA 1ZC2A 4S2OA 5CRFA 2EFUA 5FQQA 1M40A 4ZTKA 1KGEA 5FQIA 4S2LA 3IWIA 4XUZA 2EX9A 3O3VA 3UPNA 1SHVA 4OOMA 1GA9A 4D2OA 4OPRA 4ZAMA 3UE0A 1BZAA 4JXSA 5AQBA 3NY4A 3PBRA 4RVAA 2PU4A 5FI6A 3ZFZA 2Y2LA 2PBYA 2HDRA 3C5AA 3PBSA 5EVIB 1AXBA 3ZDJA 2ZM8A 1NXYA 3ZG9B 3I7JA 1FCOA 4IBRA 1NYYA 1E3UA 1PYYA 3P98A 1MXOA 2WGVA 1CI9A 2Y2JA 4IBXA 1HTZA 1K6SA 5CGXA 5DTKA 2WAFA 5F1FA 3G30A 5D3OA 4EBNA 3PAEA 4OP8A 1L0FA 2WGIA 4PM6A 2WKIA 1KGGA 1LI0A 2HP9A 2Q9MA 3PBTA 3N4IA 4PM9A 4GZBA 4KZAA 1XP4A 3M2JA 2G2UA 2WK0A 3VFFA 4E3NA 4BQMA 4MBFA 4KQQA 1W8YA 2ZC7A 4X56A 2FFFB 3V3RA 4Y0TA 1IEMA 5EUAA 3M6BA 1U60A 1FOFA 1IYOA 2ZC6B 1I5QA 1NY0A 5I94A 1Q2PA 1RCJA 2WADA 2J9PA 4ZJ2A 2XFSA 4Y0OA 4JKTA 2XD1A 5A93A 1WYBA 2ZM2A 2XGNA 1GA0A 3Q7VB 3V50A 3A3DA 3EQVA 3FV7A 3O88A 3N8RA 2PU2A 4BENA 2P74A
chains in the Genus database with same CATH superfamily
3N8LA 5M19A 4PM8A 3BRMA 4N9LA 5AJGA 3DTKA 5DKKA 3LR5A 2PR6A 3ZVTA 2V8FA 2HP6A 3W4OA 3VP3A 4Y3IA 2ZQCA 2R78A 4LV3A 1ERMA 1Z6FA 1IELA 3KO6A 4KZ3A 1P0ZA 2WKRA 1K6RA 2C5WB 3RTYA 5HFOA 3ZGAB 3F1PA 4EETB 4S2PA 3BFEA 4WEJA 3A0VA 2DRWA 4JXWA 3HUOA 1W63Q 4DN0A 4HH3A 4QD4A 4GS9A 4XXRA 2W3FA 2BASA 2OWHA 4BBVA 2V9AA 3IWOA 1E25A 1NZUA 1TS8A 3VOZA 1DRMA 2UV0E 1ES2A 1MZUA 1KE3A 1BULA 2XQZA 4JF6A 3QP8A 2J3TC 5A92A 1JWZA 1OT6A 2GNXA 3VE3A 2H5SA 5GHZA 3ZVWA 4XT2B 2XLNA 2PYPA 4E6XA 1FR6A 1L0DA 3ISGA 2Y2MA 1W79A 4HBTA 4U0XA 4IVIA 5FDHA 3NOTC 5J3WA 4ESPA 1TDGA 4BD0A 4HJ4A 4YFMA 2DNSA 2ZQDA 5DFXA 3MBZA 4LENA 2JHEA 4OPQA 1D7EA 2JKGA 4P6BA 5EVLA 3LYXA 4YINA 1XJ2A 4IUKA 3C7UA 4QY5A 3F1OA 4I3IA 5E43A 2ZL1B 5GLBA 3KSIA 5JYPA 3C8CA 1HD8A 1EI5A 5KSCA 4M4XA 3T4TA 2V1ZA 4C3QA 5HSQA 1YQSA 3NDEA 2Z6DA 3KSHA 1Y54A 1G6AA 2JKTM 2PHYA 3OPLA 3QP1A 3PBQA 5A91A 4Y0UA 5FEGA 1K25A 2J3WA 5CEBA 4CPKA 1Y28A 2A2LA 3WS1A 2V20A 3IF6A 4H8RA 4S2NA 2ZQ9A 1N9OA 2W3HA 3U2AA 4EEUA 1YLYA 4PHTA 2ZMFA 3VOYA 1N9NA 4OLGA 4QJGA 5G4ZA 3RFBA 4JF5A 3HLGA 5F83A 3H7WA 2W1TA 1S4SA 1N9LA 3HUNA 3IXBA 1BTLA 4OQ0A 3LR0A 3WRTA 5DF7A 2Y79A 2HPBA 4E3KA 3VSLA 4JXGA 3KX0X 3ULFA 5IS1A 3G32A 5FL3A 3LIDA 1MC0A 4CLCB 3R4KA 3OCNA 2WKEA 3ICYA 2Y55A 4PMAA 3ITAA 2J7VA 4JF4A 5KSHA 3BY9A 2Y91A 1HVBA 3L9KA 4HJ6A 1Q2QA 1T1CA 4WUJA 3AGDA 4MN5A 4LRXC 4MMNA 4G3WA 1IKIA 3GECA 4JPMA 2VK3A 2I72A 4QB8A 1OMEA 3MXRA 1IFQA 5GHYA 4L9FA 4QWOA 4K91A 3F1NB 1RGZA 3IT9A 3LIBA 3E0YA 3FKWA 3HUMA 5IU1A 1K56D 1FR1A 2Z2MB 3OPPA 3UMDA 3HL9A 3LY4A 2J9OA 4ME4A 1ESUA 3LEQA 4HQAA 1DY6A 4S2NC 3NC8A 3G34A 1ODVA 1CJFA 3S7OA 5FSRA 3SZTA 1NLYA 5L10A 1LL5A 2M7UA 4Z9QA 2WGWB 5GLAA 4S2MA 2G7UA 5TBMA 2EWWA 3UDIA 1V9YA 3NJAA 1LL9A 2QJ7A 1SDEA 4H6JA 1F98A 3RXXA 4RX2A 3IHBA 4AFIA 5MC7A 3CAXA 1ZG4A 4DXBA 3S7NA 4E3MA 4LGWA 1PZOA 2QYBA 1UWNX 1OTDA 1Y4OA 2PD7A 4E3IA 1W7FA 3EGDC 4JXVA 4WZ5A 3UE1A 3ZQ5A 1O7EA 5HDSA 1L3LA 3WS0A 1JVJA 3G35A 1IYSA 4WBGA 3H9WA 2ZC4B 3SS5A 2V8CA 3G2YA 3D3OA 3ZCZA 4EUZA 1XJ6A 1XJ4A 4EQ1A 2P7JA 5FQJA 1XFQA 1PW8A 4P6ZM 3SOIA 3KYQA 3GQZA 4R23A 2W3EA 3ZHHA 3VE4A 1BLCA 5E2EA 3SS4A 1PI5A 4U0TA 3RJUA 2GZAA 2P9VB 4E3JA 1XXMA 1W8QA 3DAVA 1C3BA 1AWIA 1GHMA 2W0NA 5HPFA 2Z6CA 2VKSA 4FH4A 3IX8A 2X71A 2HF6A 1ZC2A 2KLIA 4S2OA 3T1SA 5FQQA 3A0SA 5FQIA 4S2LA 4GCZA 4D2OA 3NY4A 1Z09A 4Y5FA 2M7VA 2QKPA 1AXBA 3ZDJA 5C5KA 1PYYA 4E3OA 1MXOA 5CGXA 1HTZA 5FEFA 2WAFA 5F1FA 3PAEA 4PM6A 2WKIA 2HP9A 2Q9MA 4NXBA 3M2JA 3CI6A 2WK0A 3LI8A 4E3NA 4KQQA 1W8YA 3LR3A 1FOFA 1RCJA 4ZJ2A 2XGNA 1GA0A 3S7QA 4KUKA 3EQVA 1DP8A 1YT4A 1MKIA 3FKVA 3OZHA 2JN7A 4NXFA 2ZMVA 1LLBA 2V1BA 1L2SA 4PM5A 3M2KA 1PI4A 3BEBA 3DWKA 3V3SA 3BFDA 4GKUA 2Y2NA 1YLZA 4C6YA 2XRNA 1TS0A 1LT0A 4UAAA 2WKPA 5CXWA 4DKIA 2B5RA 4EV4A 3HREA 4X1MA 3OC2A 2HP5A 1KOUA 5J7EA 1YAXA 4GN2A 1V9ZA 1ZHHB 4K0XA 5CGSA 4B4ZA 2P08A 3P09A 2OLVA 5HAIA 3W4QA 1DP6A 3MQ0A 3T4LA 3A3FA 1ONHA 4F3LB 3GVBA 3BFCA 3OLOA 1TS6A 2VGLM 3T1XA 2A24A 4U3TA 1OTEA 1DJBA 3WWXA 4RQ9A 1ONGA 2ZOIA 1FIKA 2AVXA 3V5MA 1NJ4A 1IKGA 4P6ZS 4R3AA 4R0QA 2XA7M 3OPHA 5CHJA 5J4EA 2FFYA 1BSGA 1LSVA 4GDNA 4BD1A 1H5XA 1H8YA 2VV7A 1X0OA 1S4RA 5GLCA 5HPIA 1P97A 4LCMA 1I2SA 3Q1FA 3ZG8B 3DTEA 1G5UA 1BT5A 1K38A 3C30A 3PAGA 2INWA 4EWFA 4O8GA 4EU0A 1OTIA 1RP5A 2A49A 2E8JA 4Y15A 3WRZA 2Y8HA 2J8YA 3FC7A 1XFNA 1GCEA 2BG1A 5HAQA 4OVDA 2QHKA 3HJIA 3Q82A 3F1PB 3D4FA 1KE0A 1FQGA 3NIAA 3B42A 4MBHA 3BQAA 4HESA 4GS9B 4ZJ3A 1OJ5A 2JKRI 1NWZA 1XA1A 4WF0A 2WAEA 4RA7A 4GLQA 4R3BA 4B4XA 4LFUA 1F9IA 2ZBBA 4I38A 3BY8A 3IQAA 4IHQA 4EBLA 3UO9A 2H0YA 4NG2A 2NUTC 1MBLA 1G6OA 4OPYA 1KVLA 2HZ5A 4DJ2A 2D02A 4M3KA 1YMXA 1K55A 4RYEA 4KZ4A 4MEZA 1TEMA 1O07A 4R3JA 5AQAA 2PR5A 1S1ZA 2VEAA 2Y2GA 3UDXA 4KENB 2J3TD 1ESIA 4GB7A 4IUHA 3HLWA 1ERQA 3UB7A 1GSXA 3EQUA 1H8MA 4GW9A 2OAP1 4DE2A 4FD8A 2H10A 2QWSA 4E3LA 1TF1A 3UMEA 3DTIA 4S2IA 5AQ9A 1CI8A 2J80A 1PWGA 1TVFA 4HHDA 5TGFA 3B33A 4PKYG 3WS2A 4DJ3A 5L07A 4R6LA 3F1OB 2HJEA 5I5LA 4JGRA 4HNBA 1TD5A 1S6RA 3ZG5A 3CZDA 1SZVA 3S22A 3UE3A 4WL9A 1KE4A 1QMEA 3NBLA 2JE5A 2B95A 5DF8A 4NETA 2VGKA 3BJNA 3UE6A 2Q0OA 3QHYA 3EEHA 2VLGA 3IF6B 2BLSA 3UPPA 1K55C 4NKPA 2XK1A 3K3CA 3OCLA 4KZ9A 5HW3A 2DMWA 5AVFA 3UPOA 3HLBA 5DJUA 3H7WB 2W1TB 2JCHA 3LICA 3P7NA 4X1LA 3HVFA 4WEKA 2QZ6A 3W2ZA 2ZQ7A 2V0WA 2XA7S 4GOGA 2WYXA 4P87A 1ACFA 3IWQA 2L4RA 5A8BA 4FOFA 3LCEA 1YLPA 4X55A 3ZG7B 3LIEA 2RCXA 5F68A 3BLMA 5E2HA 1LI9A 3QNCA 4R4RA 2PDRA 1T1AA 4LV1A 2PT7A 1FCNA 3SS3A 1K56A 2ZOHA 5EOEA 5F1GA 4R70A 1VETA 3QNBA 2D01A 3N8SA 3NCKA 5F82A 1HLUP 2KOIA 1FCMA 2QJ5A 4FCFA 1BUEA 2V2FF 3CPTA 1PRQA 4MLLA 3B3XA 2M1CA 3HLDA 2GX5A 3PYPA 2L0WA 3N6IA 5EM0A 3T50A 4UA9A 4WM9A 3ITBA 1DP9A 2XD5A 1YKDA 1F5MA 5G18A 3CUEA 5CEDA 3C7VA 4KZ8A 3GDIA 3NULA 1PWCA 1OTBA 4P85A 1L0EA 4HP4A 1XX2A 3T4QA 3GRJA 3VP2A 3MKFA 2ZQAA 2K31A 4YNRA 2K7SA 4OLDA 5TBMB 2XF3A 3ZYTA 4UQIM 5DVAA 3MF0A 3IH9A 1ZTUA 5KMWA 3MQOA 3HLCA 4IVKA 2XDMA 3JVUA 4H6JB 2YKHA 3VP4A 2OV5A 5CRFA 2EFUA 4D60A 1SHVA 3QP5A 4ZAMA 3D72A 3UE0A 3E4OA 4RVAA 2O9AA 3C5AA 2HDRA 1VHMA 3IX4A 3ZG9B 1D1JA 5HWVA 4WELA 3P98A 2WGVA 1G28A 1K6SA 1T1BA 4NXGA 4EBNA 1L0FA 2WGIA 1KGGA 1LI0A 3N4IA 4GZBA 1XP4A 3VFFA 3EEAA 4BQMA 4Y0TA 2FFFB 5EUAA 4CLCE 1VB6A 4JGOA 2WADA 2J9PA 4I39A 4Y0OA 5A93A 1WYBA 3CUEC 3A3DA 1NRJA 2PU2A 3JVVA 5EE8A 3IXDA 5FAOA 1NRFA 5CHUA 1TS7A 1PFLA 3UY6A 2E8IA 2VJWA 1A0KA 1ES3A 1VEUA 3BM6A 4CLCD 1OJGA 4LRYC 5L2FA 4N1HA 5CTNA 2V0UA 2OAQ1 5FA7A 2O0YA 3S7PA 5M18A 4KQOA 2HDQA 1OTAA 1SKFA 4DDSA 4RX3A 4PAUA 5HD5A 4CLCC 4EESA 4OQIA 3BECA 3FPWA 3UN7A 2XEPA 1MKMA 1RGYA 4HIAA 2W3GA 4HP9A 4UEYA 2A3UA 4Y13A 3KYZA 2W1RA 2L1MA 3N7WA 4JBFA 2GDNA 3BLSA 3E98A 4B9OA 4GHIA 4Q0JA 2QPNA 3BQ8A 1W63M 1W5DA 2Z2LB 4S2JA 5GL9A 3MXSA 4OQHA 1P9RA 3HBRA 4HI4A 4KZ7A 3MXQA 2WZZA 5FQMA 1VQQA 1XGJA 4DXCA 2VX8A 1VM1A 3DTMA 5CECA 4QY6A 2UWXA 3MMHA 3CMZA 3JYIA 1IYPA 1S66L 2IA2A 3CHWP 2O9CA 3IH8A 5KIZA 2EXAA 1I2WA 3M6HA 5F5YA 3A3JA 2W3DA 2WUQA 2K2NA 2HDUA 4HBUA 4R4SA 3DW0A 4OH0A 4HJ3A 4EERA 2JC7A 1XJ3A 3C38A 1F2KA 3FWLA 2IWBA 1K4EA 4KQRA 4UQIS 4BL2A 2X01A 4DE0A 2XFTA 5HL6A 4OOYA 3ZNTA 3UB9A 1UGUA 2VA0A 4FH2A 4DE1A 4B93A 5TR7A 1MWUA 3CG5A 3LO7A 1CEFA 3IHAA 5CX7A 5AVEA 3IX3A 3K3DA 4X6TA 3L7HA 1WA9A 5E2FA 3SH9A 1JWPA 1BLSA 1K57A 1LSXA 1LSWA 2CMNA 5GHXA 2KDKA 3GSGA 3SH7A 3O86A 3W4PA 2EA9A 3LFVA 4O7DA 1YM1A 2A24B 5EVEA 1H0MA 2JKTI 4EEPA 3QP6A 1MWSA 3BFGA 1N4OA 3HLFA 3OOVA 4HH2A 1EWZA 4LRZE 3MZFA 4MNRA 3LI9A 5FAPA 1ZG6A 2KX6A 3A3EA 4Y7PA 4R38A 5KZHA 3KYEA 3SH8A 1ES5A 1SKOB 4K08A 2LB9A 5FAQA 1YLJA 5IHVA 2PD8A 4PM7A 4YOFA 1BYWA 3IS2A 1S1YA 1M6KA 3RXWA 2B18A 4ARZA 4ZJ1A 1JTGA 4EW7A 1GHIA 1CQAA 1K54A 3O87A 4ZRRA 3IXGA 4Z1WA 5HARA 1OPXA 1CEGA 2Y4AA 2Y2IA 3LIFA 5DKLA 3VP0A 3H82A 4X68A 1SKOA 5FDSA 1K57C 5EM1A 3U4LP 3C4OA 1HZOA 4JGPA 5F6AA 4BLMA 1ALQA 3TG9A 1GHPA 2PBDP 3MZDA 3TW8A 3NOUC 4DF6A 3MFDA 3QP4A 5HWTA 3GV9A 5HAPA 3R7WA 4UA7A 4KG2A 2YKFA 3CITA 5HZHA 3EGXC 4MN6A 4EUVA 3UB6A 2NUPC 4HEFA 3NI9A 5EV0A 2PYRA 3IF5A 4JGQA 4DRTA 1QMFA 1XGIA 4OONA 4I3JA 4QHCA 1J9MA 1MWRA 2XSSA 3T4JA 1PWDA 5EVIA 1MWTA 3O5YA 5EOOA 1N9BA 1K54C 4O01A 5EPHA 4LV2A 3S1YA 4CJNA 3GR2A 5FI7A 4NXEA 1NLZA 2HJ9C 1KDWA 4I5SA 4ZBEA 1XKZA 3FZCA 2GJ3A 1KGFA 3VV4A 1G68A 1YMSA 2Y2KA 2VV6A 2OOLA 3TOIA 3W8KA 1E3UD 3Q7VA 3PR6A 3QP2A 4L0LA 2Y2QA 2XR0A 2H28A 4QU3A 2FH5A 4OQGA 3VOLA 4MCWA 3OBFA 1OT9A 1K4FA 4L9EA 4BBUA 3MR0A 1JTDA 5CGWA 4E04A 5G4YA 4LPZA 5CERA 3G31A 5EVID 2ZC3B 3PBNA 3Q7ZA 1UWPX 3A0RA 5J8XA 2WKQA 2G2WA 2PAVP 4ETZA 5EVIC 3KSFA 3TJZC 1KGEA 4XUZA 3O3VA 3UPNA 4OOMA 1GA9A 3LGOA 5AQBA 3PBRA 2VGLS 2EWVA 4GJ4A 3JPUA 2PBYA 3EOIA 1FILA 1NXYA 1NYYA 4FUWA 3G30A 3PBTA 1D06A 2G2UA 1IOUA 1VETB 4MDZA 4X56A 5LBRA 3V3RA 1IEMA 4XT2A 1U60A 5I94A 1YSQA 2XFSA 4JKTA 2XD1A 3CPTB 2V1AA 3LUQA 3V50A 1GSWA 3PHYA 5DJTA 4X25A 3N8RA 4N92A 2P74A 5TFQA 1FSYA 5DF9A 4P0MA 2W27A 3C2WA 1TDLA 5FASA 1ES4A 4S2KA 3HCYA 5A90A 4Q8IA 5HDDA 3E4PA 5TJJA 2JKFA 2WZXA 1XA7A 3FG8A 5DTSA 2Y59A 2ZL1A 4N1XA 2ZMAA 4KG5A 3MJQA 1WYCA 3AGFA 2ZD8A 1PZPA 3LIAA 1EW0A 1BLHA 5HWWA 2X02A 4C75A 2CC1A 4WLAA 3G6OA 2R9WA 3PXPA 4DDYA 1GSVA 3VMAA 5F69A 3UDFA 3BW6A 2BTFP 2EX6A 1IYQA 3FYZA 4HY8A 4OOLA 4ZDXA 4Y17A 4L9GA 1STZA 1CF0A 3VSKA 1EROA 2ZC5B 4LCLA 4GD6A 1SDNA 4CLCA 2ZLYA 4KZ5A 2ZM0A 3Q07A 3TRCA 2DCFA 1SCWA 4FTXA 3E2KA 3T4SA 5FQ9A 1L0GA 4CQHA 3IF6C 4XUXA 4MBKA 4K0WA 4LV0A 4X69A 1MY8A 1VEUB 1PW1A 3S4XA 2IWCA 3TE8A 1JWVA 2C6WB 5HL1A 3GTCA 4BJPA 2XH9A 3G4PA 1KVMA 2JKRM 3F1NA 4EXOA 1LHYA 5FI2A 1PIOA 4NK3A 4KG6A 2HDSA 3NECA 4YWZA 4G3VA 4B88A 1JNUA 3LEZA 2VGJA 3Q81A 3E2LA 2WGWA 1FSWA 5CHMA 4KQDA 3B47A 4GHIB 1J3WA 1K0KA 2R9XA 5M1AA 2O99A 4QPRA 4BL3A 3CWFA 5DTTA 4BWIA 2Q9NA 4PKYA 3SW1A 1CK3A 3E4QA 3DBAA 2I9VA 3PTEA 3KSGA 3CJMA 4GD8A 3DWZA 1XPBA 2HGVA 4WZ4A 3V39A 3LR4A 4Q0HA 2OSUA 4ETXA 2EX8A 1YPRA 4KZ6A 3UB5P 3OPRA 4WMCA 1P9WA 1LL8A 2B02A 5L09A 5JYOA 1BLPA 3BYDA 4IEDA 2LB5A 3PBOA 2QMIA 3IBRA 1MPLA 2XROA 4UHUA 3UB8A 3T4OA 4LLOB 3ZG0A 3UNWA 3WS4A 5BOHA 3MFXA 2H0TA 3BWLA 4HOIA 5K5BA 4KZBA 1YSPA 3T1RA 5U47A 1NYMA 3MQQA 4DMZA 2ZQ8A 4WZ5C 4BBTA 5E2GA 4FSFA 4GDBA 4IJGA 2P9VA 5CTMA 3RH8B 4WYYA 3C4PA 2Y2OA 1YLWA 4I3AA 3MS6A 4EBPA 3LY3A 2HV1A 4WMCD 3VFHA 1S67L 2JBFA 5HX9A 3NDGA 3EWKA 3CLOA 4A5RA 3D9YA 4X53A 2RL3A 3K2NA 4OPZA 3BFFA 1KDSA 3TSGA 2P04A 3AGEA 5HD3A 4JLFA 1ZKJA 2EFXA 5IT5A 3WS5A 4ID4A 2Y2PA 2OLUA 4R1GA 4WN5A 3HJKA 5AQ7A 3V67A 3A3IA 2VZWA 5FATA 4BMWA 2WKHA 1NZOA 2ZJ9A 3T12B 3P01A 5FQKA 1T19A 1T18A 5HDCA 3VP1A 5EFWA 3IS2B 4UA6A 3MKEA 4ARZB 1YLTA 4G3KA 2Y2HA 2O9BA 1H8ZA 3T4KA 3MZEA 4Y2FA 2OWJA 1H3QA 5GLDA 5EECA 4E6WA 3NOPC 3IXHA 2IWDA 4PPRA 2ACGA 4N9KA 4F94A 2FZ0A 2EX2A 3H82B 2EXBA 3IBJA 1DJCA 4EQIA 5L8MA 3G2ZA 3GMWA 4OKPA 3ZNYA 5DFYA 1S0WA 1WE4A 4DE3A 2MJ6A 3R7WB 3MSHA 3NHQA 1PNEA 4OP5A 4KUOA 1E4DA 4GNUA 3HLEA 3FPVA 1DJAA 1M40A 4ZTKA 4NEED 3IWIA 2EX9A 4OPRA 1BZAA 4JXSA 2PU4A 5FI6A 3ZFZA 4F3LA 2Y2LA 3PBSA 5EVIB 2PRFA 2ZM8A 3I7JA 1FCOA 4IBRA 4II7A 1E3UA 4IBXA 5DTKA 1CI9A 2Y2JA 5D3OA 4OP8A 4PM9A 4Q0IA 4KZAA 3T1QB 4MN7A 4MBFA 2ZC7A 3M6BA 1IYOA 2ZC6B 1I5QA 1NY0A 1Q2PA 2VV8A 4O0PA 2ZM2A 3Q7VB 3FV7A 3O88A 4BENA
chains in the Genus database with same CATH topology
1YT4A 3FKVA 1MKIA 3OZHA 5EE8A 5TFQA 1FSYA 3IXDA 5FAOA 1NRFA 3N8LA 5M19A 4PM8A 1LLBA 3BRMA 4N9LA 5CHUA 5DF9A 4P0MA 3UY6A 2E8IA 1TDLA 3ZVTA 1L2SA 4PM5A 5FASA 1ES3A 3BM6A 2HP6A 3M2KA 3VP3A 3W4OA 1PI4A 2ZQCA 3BEBA 5L2FA 3DWKA 4N1HA 3V3SA 1ES4A 5CTNA 3BFDA 4S2KA 4GKUA 5A90A 4LV3A 1ERMA 2Y2NA 1YLZA 1Z6FA 4C6YA 4Q8IA 2WZXA 1XA7A 5DTSA 5FA7A 1IELA 5M18A 2Y59A 4KQOA 4N1XA 2HDQA 4UAAA 1SKFA 4KZ3A 2ZMAA 4DDSA 4RX3A 5CXWA 4KG5A 4DKIA 1WYCA 1K6RA 2C5WB 2B5RA 3AGFA 5HFOA 3ZGAB 2ZD8A 1PZPA 4S2PA 4EV4A 3BFEA 4OQIA 4WEJA 1BLHA 3HREA 2DRWA 3BECA 4JXWA 3OC2A 2HP5A 3UN7A 2XEPA 3HUOA 4GN2A 4QD4A 2X02A 4C75A 1RGYA 4XXRA 2CC1A 4K0XA 5CGSA 4B4ZA 2A3UA 3P09A 2R9WA 2OLVA 3IWOA 1E25A 4DDYA 5HAIA 3W4QA 4JBFA 3N7WA 3VMAA 2GDNA 3A3FA 3BLSA 1NZUA 1ONHA 2QPNA 3GVBA 3VOZA 3BFCA 3UDFA 1W5DA 2Z2LB 4S2JA 5GL9A 1ES2A 3MXSA 1KE3A 4U3TA 1BULA 4OQHA 2XQZA 1DJBA 2EX6A 3HBRA 1IYQA 4JF6A 4KZ7A 4WELA 3FYZA 2WZZA 4OOLA 5FQMA 3WWXA 5A92A 1VQQA 1XGJA 1JWZA 4ZDXA 1ONGA 4DXCA 3VSKA 2H5SA 1VM1A 1EROA 3DTMA 5GHZA 2ZC5B 3ZVWA 5CECA 4QY6A 2XLNA 4LCLA 4GD6A 2UWXA 4E6XA 1FR6A 1SDNA 3V5MA 1NJ4A 2ZLYA 4KZ5A 1IKGA 3CMZA 2ZM0A 3JYIA 1L0DA 3ISGA 3Q07A 4R0QA 2Y2MA 1IYPA 1W79A 4HBTA 3OPHA 2DCFA 1SCWA 5CHJA 4U0XA 4IVIA 2FFYA 3IH8A 5FDHA 1BSGA 2EXAA 3E2KA 4GDNA 4BD1A 1I2WA 3M6HA 3A3JA 5FQ9A 1L0GA 1H5XA 1H8YA 1TDGA 2WUQA 3IF6C 4BD0A 5GLCA 4YFMA 2HDUA 2DNSA 4HBUA 4XUXA 4R4SA 2ZQDA 3DW0A 4MBKA 4LCMA 4OH0A 4K0WA 4LV0A 4X69A 3MBZA 1I2SA 1MY8A 3Q1FA 4LENA 4OPQA 2JC7A 3ZG8B 1PW1A 3S4XA 2IWCA 4P6BA 5EVLA 1JWVA 2C6WB 3FWLA 2IWBA 5HL1A 1K4EA 3GTCA 1BT5A 1K38A 4KQRA 4YINA 4BJPA 3PAGA 2X01A 4BL2A 2XH9A 3G4PA 3C7UA 4DE0A 4EWFA 1KVMA 4QY5A 2XFTA 1RP5A 2A49A 4OOYA 1LHYA 5E43A 5GLBA 3ZNTA 5JYPA 3WRZA 1HD8A 5FI2A 4FH2A 2J8YA 4DE1A 1GCEA 2BG1A 1EI5A 5TR7A 4OVDA 5HAQA 1MWUA 1PIOA 3CG5A 1CEFA 3LO7A 5KSCA 4NK3A 4KG6A 3IHAA 3Q82A 2HDSA 2V1ZA 3D4FA 4C3QA 1KE0A 1FQGA 1YQSA 3NDEA 3NIAA 4N92A 4B88A 1Y54A 1G6AA 4MBHA 4X6TA 3OPLA 4HESA 3PBQA 4ZJ3A 5A91A 3LEZA 4Y0UA 5E2FA 1K25A 3SH9A 1JWPA 2VGJA 5CEBA 1BLSA 1K57A 4CPKA 3Q81A 1XA1A 2WAEA 3E2LA 4RA7A 5GHXA 4R3BA 2V20A 3IF6A 4H8RA 3WS1A 4B4XA 2WGWA 1FSWA 3IQAA 3GSGA 4S2NA 5CHMA 4EBLA 2ZQ9A 3UO9A 2H0YA 3SH7A 1YLYA 3VOYA 2R9XA 5M1AA 3O86A 4OLGA 1MBLA 3W4PA 4OPYA 4QJGA 1KVLA 4JF5A 3HLGA 4BL3A 4O7DA 1YM1A 5F83A 3HUNA 5DTTA 2Q9NA 3IXBA 4M3KA 1CK3A 1BTLA 1YMXA 4OQ0A 1K55A 1MWSA 3WRTA 3PTEA 4RYEA 3BFGA 3CJMA 5DF7A 2HPBA 1N4OA 4KZ4A 4GD8A 4MEZA 3DWZA 3VSLA 1XPBA 1TEMA 4E3KA 1O07A 4R3JA 5AQAA 4JXGA 3HLFA 1EWZA 4WZ4A 3V39A 3G32A 2Y2GA 3MZFA 3UDXA 2OSUA 3OCNA 4MNRA 4KENB 2WKEA 5FAPA 1ESIA 1ZG6A 2EX8A 3A3EA 4GB7A 4KZ6A 3HLWA 4Y7PA 1ERQA 2Y55A 3ITAA 3OPRA 4PMAA 4WMCA 2J7VA 4JF4A 5KZHA 5KSHA 3SH8A 1ES5A 3EQUA 2Y91A 1HVBA 1Q2QA 4DE2A 4FD8A 5FAQA 1YLJA 3AGDA 2H10A 5JYOA 5IHVA 4PM7A 4E3LA 1IKIA 1BLPA 3BYDA 4JPMA 4IEDA 4S2IA 5AQ9A 1M6KA 3RXWA 3PBOA 1CI8A 2QMIA 4ZJ1A 1JTGA 1GHIA 1PWGA 2I72A 1TVFA 1MPLA 1OMEA 4QB8A 1K54A 3O87A 5TGFA 3MXRA 4UHUA 5GHYA 3IXGA 5HARA 1CEGA 3WS2A 4K91A 3ZG0A 2Y4AA 1RGZA 2Y2IA 3IT9A 3VP0A 3FKWA 3HUMA 3UNWA 1S6RA 3WS4A 1K56D 3ZG5A 5BOHA 2H0TA 3CZDA 3UE3A 3S22A 1FR1A 4KZBA 4X68A 1KE4A 1QMEA 2Z2MB 3NBLA 3OPPA 1K57C 2JE5A 3HL9A 3LY4A 2J9OA 5DF8A 4NETA 1NYMA 1HZOA 2VGKA 1ESUA 3C4OA 4S2NC 1DY6A 5U47A 2ZQ8A 4WZ5C 3NC8A 5E2GA 3G34A 4BLMA 3QHYA 1ALQA 3TG9A 1GHPA 4FSFA 4GDBA 2P9VA 3MZDA 5CTMA 5FSRA 4DF6A 4WYYA 3C4PA 3MFDA 2Y2OA 1YLWA 4EBPA 1LL5A 3GV9A 3LY3A 3IF6B 5HAPA 4Z9QA 2WGWB 5GLAA 4WMCD 2BLSA 3VFHA 3UPPA 4S2MA 1K55C 4UA7A 2XK1A 2JBFA 3OCLA 4KG2A 4KZ9A 5HX9A 3UDIA 5HW3A 3NDGA 1LL9A 3UPOA 4A5RA 3HLBA 4X53A 2RL3A 1SDEA 4OPZA 2JCHA 3BFFA 1KDSA 4HEFA 3HVFA 4WEKA 3RXXA 3TSGA 2QZ6A 3NI9A 2ZQ7A 4GOGA 4RX2A 3AGEA 3IHBA 2WYXA 4JLFA 4P87A 3IF5A 1ZKJA 4DRTA 1ZG4A 2EFXA 1QMFA 1XGIA 4OONA 4E3MA 3IWQA 3WS5A 4DXBA 1PZOA 4ID4A 4QHCA 1J9MA 2Y2PA 1MWRA 2OLUA 4R1GA 1PWDA 5AQ7A 3LCEA 3A3IA 5FATA 4E3IA 1YLPA 1W7FA 5EVIA 1MWTA 4X55A 3ZG7B 2RCXA 2WKHA 3BLMA 4JXVA 4WZ5A 5E2HA 1LI9A 3UE1A 5EOOA 1NZOA 1O7EA 2ZJ9A 3QNCA 3WS0A 4R4RA 1N9BA 1K54C 5EPHA 3S1YA 4LV2A 1JVJA 3G35A 5FQKA 1IYSA 4LV1A 4WBGA 4CJNA 1FCNA 3SS3A 1K56A 3GR2A 5FI7A 5EOEA 3VP1A 2ZC4B 5F1GA 1KDWA 3QNBA 4UA6A 3N8SA 3SS5A 3NCKA 3MKEA 5F82A 4ZBEA 1XKZA 1YLTA 3FZCA 3G2YA 1KGFA 2Y2HA 1FCMA 1H8ZA 3MZEA 4FCFA 5GLDA 1BUEA 1G68A 1YMSA 2Y2KA 2V2FF 5EECA 4E6WA 4MLLA 3TOIA 3W8KA 3B3XA 1E3UD 3IXHA 3ZCZA 4EUZA 2IWDA 3Q7VA 3HLDA 4PPRA 4N9KA 4L0LA 2Y2QA 4F94A 2XR0A 5FQJA 3N6IA 4QU3A 2EX2A 1PW8A 4OQGA 4UA9A 4E3OA 4WM9A 2EXBA 3SOIA 1DJCA 4EQIA 3GQZA 3ITBA 4R23A 2XD5A 3ZHHA 1K4FA 3G2ZA 5G18A 1BLCA 3GMWA 5E2EA 5CEDA 3SS4A 4OKPA 3C7VA 4KZ8A 1PI5A 3ZNYA 4U0TA 3RJUA 1PWCA 2P9VB 1L0EA 4P85A 1JTDA 1S0WA 5CGWA 1WE4A 1XX2A 4E3JA 3GRJA 1XXMA 4DE3A 3VP2A 3MKFA 5CERA 3G31A 5EVID 1W8QA 2ZQAA 2ZC3B 3PBNA 3Q7ZA 4OLDA 2XF3A 1C3BA 5DVAA 1GHMA 4OP5A 5J8XA 3IH9A 5KMWA 1E4DA 2G2WA 4GNUA 3HLCA 4IVKA 2XDMA 4FH4A 3VP4A 3HLEA 2X71A 5EVIC 2OV5A 1DJAA 1ZC2A 4S2OA 5CRFA 2EFUA 5FQQA 1M40A 4ZTKA 1KGEA 5FQIA 4S2LA 3IWIA 4XUZA 2EX9A 3O3VA 3UPNA 1SHVA 4OOMA 1GA9A 4D2OA 4OPRA 4ZAMA 3UE0A 1BZAA 4JXSA 5AQBA 3NY4A 3PBRA 4RVAA 2PU4A 5FI6A 3ZFZA 2Y2LA 2PBYA 2HDRA 3C5AA 3PBSA 5EVIB 1AXBA 3ZDJA 2ZM8A 1NXYA 3ZG9B 3I7JA 1FCOA 4IBRA 1NYYA 1E3UA 1PYYA 3P98A 1MXOA 2WGVA 1CI9A 2Y2JA 4IBXA 1HTZA 1K6SA 5CGXA 5DTKA 2WAFA 5F1FA 3G30A 5D3OA 4EBNA 3PAEA 4OP8A 1L0FA 2WGIA 4PM6A 2WKIA 1KGGA 1LI0A 2HP9A 2Q9MA 3PBTA 3N4IA 4PM9A 4GZBA 4KZAA 1XP4A 3M2JA 2G2UA 2WK0A 3VFFA 4E3NA 4BQMA 4MBFA 4KQQA 1W8YA 2ZC7A 4X56A 2FFFB 3V3RA 4Y0TA 1IEMA 5EUAA 3M6BA 1U60A 1FOFA 1IYOA 2ZC6B 1I5QA 1NY0A 5I94A 1Q2PA 1RCJA 2WADA 2J9PA 4ZJ2A 2XFSA 4Y0OA 4JKTA 2XD1A 5A93A 1WYBA 2ZM2A 2XGNA 1GA0A 3Q7VB 3V50A 3A3DA 3EQVA 3FV7A 3O88A 3N8RA 2PU2A 4BENA 2P74A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YT4 A;  3FKV A;  1MKI A;  3OZH A;  5EE8 A;  5TFQ A;  1FSY A;  3IXD A;  5FAO A;  1NRF A;  3N8L A;  5M19 A;  4PM8 A;  1LLB A;  3BRM A;  4N9L A;  5CHU A;  5DF9 A;  4P0M A;  3UY6 A;  2E8I A;  1TDL A;  3ZVT A;  1L2S A;  4PM5 A;  5FAS A;  1ES3 A;  3BM6 A;  2HP6 A;  3M2K A;  3VP3 A;  3W4O A;  1PI4 A;  2ZQC A;  3BEB A;  5L2F A;  3DWK A;  4N1H A;  3V3S A;  1ES4 A;  5CTN A;  3BFD A;  4S2K A;  4GKU A;  5A90 A;  4LV3 A;  1ERM A;  2Y2N A;  1YLZ A;  1Z6F A;  4C6Y A;  4Q8I A;  2WZX A;  1XA7 A;  5DTS A;  5FA7 A;  1IEL A;  5M18 A;  2Y59 A;  4KQO A;  4N1X A;  2HDQ A;  4UAA A;  1SKF A;  4KZ3 A;  2ZMA A;  4DDS A;  4RX3 A;  5CXW A;  4KG5 A;  4DKI A;  1WYC A;  1K6R A;  2C5W B;  2B5R A;  3AGF A;  5HFO A;  3ZGA B;  2ZD8 A;  1PZP A;  4S2P A;  4EV4 A;  3BFE A;  4OQI A;  4WEJ A;  1BLH A;  3HRE A;  2DRW A;  3BEC A;  4JXW A;  3OC2 A;  2HP5 A;  3UN7 A;  2XEP A;  3HUO A;  4GN2 A;  4QD4 A;  2X02 A;  4C75 A;  1RGY A;  4XXR A;  2CC1 A;  4K0X A;  5CGS A;  4B4Z A;  2A3U A;  3P09 A;  2R9W A;  2OLV A;  3IWO A;  1E25 A;  4DDY A;  5HAI A;  3W4Q A;  4JBF A;  3N7W A;  3VMA A;  2GDN A;  3A3F A;  3BLS A;  1NZU A;  1ONH A;  2QPN A;  3GVB A;  3VOZ A;  3BFC A;  3UDF A;  1W5D A;  2Z2L B;  4S2J A;  5GL9 A;  1ES2 A;  3MXS A;  1KE3 A;  4U3T A;  1BUL A;  4OQH A;  2XQZ A;  1DJB A;  2EX6 A;  3HBR A;  1IYQ A;  4JF6 A;  4KZ7 A;  4WEL A;  3FYZ A;  2WZZ A;  4OOL A;  5FQM A;  3WWX A;  5A92 A;  1VQQ A;  1XGJ A;  1JWZ A;  4ZDX A;  1ONG A;  4DXC A;  3VSK A;  2H5S A;  1VM1 A;  1ERO A;  3DTM A;  5GHZ A;  2ZC5 B;  3ZVW A;  5CEC A;  4QY6 A;  2XLN A;  4LCL A;  4GD6 A;  2UWX A;  4E6X A;  1FR6 A;  1SDN A;  3V5M A;  1NJ4 A;  2ZLY A;  4KZ5 A;  1IKG A;  3CMZ A;  2ZM0 A;  3JYI A;  1L0D A;  3ISG A;  3Q07 A;  4R0Q A;  2Y2M A;  1IYP A;  1W79 A;  4HBT A;  3OPH A;  2DCF A;  1SCW A;  5CHJ A;  4U0X A;  4IVI A;  2FFY A;  3IH8 A;  5FDH A;  1BSG A;  2EXA A;  3E2K A;  4GDN A;  4BD1 A;  1I2W A;  3M6H A;  3A3J A;  5FQ9 A;  1L0G A;  1H5X A;  1H8Y A;  1TDG A;  2WUQ A;  3IF6 C;  4BD0 A;  5GLC A;  4YFM A;  2HDU A;  2DNS A;  4HBU A;  4XUX A;  4R4S A;  2ZQD A;  3DW0 A;  4MBK A;  4LCM A;  4OH0 A;  4K0W A;  4LV0 A;  4X69 A;  3MBZ A;  1I2S A;  1MY8 A;  3Q1F A;  4LEN A;  4OPQ A;  2JC7 A;  3ZG8 B;  1PW1 A;  3S4X A;  2IWC A;  4P6B A;  5EVL A;  1JWV A;  2C6W B;  3FWL A;  2IWB A;  5HL1 A;  1K4E A;  3GTC A;  1BT5 A;  1K38 A;  4KQR A;  4YIN A;  4BJP A;  3PAG A;  2X01 A;  4BL2 A;  2XH9 A;  3G4P A;  3C7U A;  4DE0 A;  4EWF A;  1KVM A;  4QY5 A;  2XFT A;  1RP5 A;  2A49 A;  4OOY A;  1LHY A;  5E43 A;  5GLB A;  3ZNT A;  5JYP A;  3WRZ A;  1HD8 A;  5FI2 A;  4FH2 A;  2J8Y A;  4DE1 A;  1GCE A;  2BG1 A;  1EI5 A;  5TR7 A;  4OVD A;  5HAQ A;  1MWU A;  1PIO A;  3CG5 A;  1CEF A;  3LO7 A;  5KSC A;  4NK3 A;  4KG6 A;  3IHA A;  3Q82 A;  2HDS A;  2V1Z A;  3D4F A;  4C3Q A;  1KE0 A;  1FQG A;  1YQS A;  3NDE A;  3NIA A;  4N92 A;  4B88 A;  1Y54 A;  1G6A A;  4MBH A;  4X6T A;  3OPL A;  4HES A;  3PBQ A;  4ZJ3 A;  5A91 A;  3LEZ A;  4Y0U A;  5E2F A;  1K25 A;  3SH9 A;  1JWP A;  2VGJ A;  5CEB A;  1BLS A;  1K57 A;  4CPK A;  3Q81 A;  1XA1 A;  2WAE A;  3E2L A;  4RA7 A;  5GHX A;  4R3B A;  2V20 A;  3IF6 A;  4H8R A;  3WS1 A;  4B4X A;  2WGW A;  1FSW A;  3IQA A;  3GSG A;  4S2N A;  5CHM A;  4EBL A;  2ZQ9 A;  3UO9 A;  2H0Y A;  3SH7 A;  1YLY A;  3VOY A;  2R9X A;  5M1A A;  3O86 A;  4OLG A;  1MBL A;  3W4P A;  4OPY A;  4QJG A;  1KVL A;  4JF5 A;  3HLG A;  4BL3 A;  4O7D A;  1YM1 A;  5F83 A;  3HUN A;  5DTT A;  2Q9N A;  3IXB A;  4M3K A;  1CK3 A;  1BTL A;  1YMX A;  4OQ0 A;  1K55 A;  1MWS A;  3WRT A;  3PTE A;  4RYE A;  3BFG A;  3CJM A;  5DF7 A;  2HPB A;  1N4O A;  4KZ4 A;  4GD8 A;  4MEZ A;  3DWZ A;  3VSL A;  1XPB A;  1TEM A;  4E3K A;  1O07 A;  4R3J A;  5AQA A;  4JXG A;  3HLF A;  1EWZ A;  4WZ4 A;  3V39 A;  3G32 A;  2Y2G A;  3MZF A;  3UDX A;  2OSU A;  3OCN A;  4MNR A;  4KEN B;  2WKE A;  5FAP A;  1ESI A;  1ZG6 A;  2EX8 A;  3A3E A;  4GB7 A;  4KZ6 A;  3HLW A;  4Y7P A;  1ERQ A;  2Y55 A;  3ITA A;  3OPR A;  4PMA A;  4WMC A;  2J7V A;  4JF4 A;  5KZH A;  5KSH A;  3SH8 A;  1ES5 A;  3EQU A;  2Y91 A;  1HVB A;  1Q2Q A;  4DE2 A;  4FD8 A;  5FAQ A;  1YLJ A;  3AGD A;  2H10 A;  5JYO A;  5IHV A;  4PM7 A;  4E3L A;  1IKI A;  1BLP A;  3BYD A;  4JPM A;  4IED A;  4S2I A;  5AQ9 A;  1M6K A;  3RXW A;  3PBO A;  1CI8 A;  2QMI A;  4ZJ1 A;  1JTG A;  1GHI A;  1PWG A;  2I72 A;  1TVF A;  1MPL A;  1OME A;  4QB8 A;  1K54 A;  3O87 A;  5TGF A;  3MXR A;  4UHU A;  5GHY A;  3IXG A;  5HAR A;  1CEG A;  3WS2 A;  4K91 A;  3ZG0 A;  2Y4A A;  1RGZ A;  2Y2I A;  3IT9 A;  3VP0 A;  3FKW A;  3HUM A;  3UNW A;  1S6R A;  3WS4 A;  1K56 D;  3ZG5 A;  5BOH A;  2H0T A;  3CZD A;  3UE3 A;  3S22 A;  1FR1 A;  4KZB A;  4X68 A;  1KE4 A;  1QME A;  2Z2M B;  3NBL A;  3OPP A;  1K57 C;  2JE5 A;  3HL9 A;  3LY4 A;  2J9O A;  5DF8 A;  4NET A;  1NYM A;  1HZO A;  2VGK A;  1ESU A;  3C4O A;  4S2N C;  1DY6 A;  5U47 A;  2ZQ8 A;  4WZ5 C;  3NC8 A;  5E2G A;  3G34 A;  4BLM A;  3QHY A;  1ALQ A;  3TG9 A;  1GHP A;  4FSF A;  4GDB A;  2P9V A;  3MZD A;  5CTM A;  5FSR A;  4DF6 A;  4WYY A;  3C4P A;  3MFD A;  2Y2O A;  1YLW A;  4EBP A;  1LL5 A;  3GV9 A;  3LY3 A;  3IF6 B;  5HAP A;  4Z9Q A;  2WGW B;  5GLA A;  4WMC D;  2BLS A;  3VFH A;  3UPP A;  4S2M A;  1K55 C;  4UA7 A;  2XK1 A;  2JBF A;  3OCL A;  4KG2 A;  4KZ9 A;  5HX9 A;  3UDI A;  5HW3 A;  3NDG A;  1LL9 A;  3UPO A;  4A5R A;  3HLB A;  4X53 A;  2RL3 A;  1SDE A;  4OPZ A;  2JCH A;  3BFF A;  1KDS A;  4HEF A;  3HVF A;  4WEK A;  3RXX A;  3TSG A;  2QZ6 A;  3NI9 A;  2ZQ7 A;  4GOG A;  4RX2 A;  3AGE A;  3IHB A;  2WYX A;  4JLF A;  4P87 A;  3IF5 A;  1ZKJ A;  4DRT A;  1ZG4 A;  2EFX A;  1QMF A;  1XGI A;  4OON A;  4E3M A;  3IWQ A;  3WS5 A;  4DXB A;  1PZO A;  4ID4 A;  4QHC A;  1J9M A;  2Y2P A;  1MWR A;  2OLU A;  4R1G A;  1PWD A;  5AQ7 A;  3LCE A;  3A3I A;  5FAT A;  4E3I A;  1YLP A;  1W7F A;  5EVI A;  1MWT A;  4X55 A;  3ZG7 B;  2RCX A;  2WKH A;  3BLM A;  4JXV A;  4WZ5 A;  5E2H A;  1LI9 A;  3UE1 A;  5EOO A;  1NZO A;  1O7E A;  2ZJ9 A;  3QNC A;  3WS0 A;  4R4R A;  1N9B A;  1K54 C;  5EPH A;  3S1Y A;  4LV2 A;  1JVJ A;  3G35 A;  5FQK A;  1IYS A;  4LV1 A;  4WBG A;  4CJN A;  1FCN A;  3SS3 A;  1K56 A;  3GR2 A;  5FI7 A;  5EOE A;  3VP1 A;  2ZC4 B;  5F1G A;  1KDW A;  3QNB A;  4UA6 A;  3N8S A;  3SS5 A;  3NCK A;  3MKE A;  5F82 A;  4ZBE A;  1XKZ A;  1YLT A;  3FZC A;  3G2Y A;  1KGF A;  2Y2H A;  1FCM A;  1H8Z A;  3MZE A;  4FCF A;  5GLD A;  1BUE A;  1G68 A;  1YMS A;  2Y2K A;  2V2F F;  5EEC A;  4E6W A;  4MLL A;  3TOI A;  3W8K A;  3B3X A;  1E3U D;  3IXH A;  3ZCZ A;  4EUZ A;  2IWD A;  3Q7V A;  3HLD A;  4PPR A;  4N9K A;  4L0L A;  2Y2Q A;  4F94 A;  2XR0 A;  5FQJ A;  3N6I A;  4QU3 A;  2EX2 A;  1PW8 A;  4OQG A;  4UA9 A;  4E3O A;  4WM9 A;  2EXB A;  3SOI A;  1DJC A;  4EQI A;  3GQZ A;  3ITB A;  4R23 A;  2XD5 A;  3ZHH A;  1K4F A;  3G2Z A;  5G18 A;  1BLC A;  3GMW A;  5E2E A;  5CED A;  3SS4 A;  4OKP A;  3C7V A;  4KZ8 A;  1PI5 A;  3ZNY A;  4U0T A;  3RJU A;  1PWC A;  2P9V B;  1L0E A;  4P85 A;  1JTD A;  1S0W A;  5CGW A;  1WE4 A;  1XX2 A;  4E3J A;  3GRJ A;  1XXM A;  4DE3 A;  3VP2 A;  3MKF A;  5CER A;  3G31 A;  5EVI D;  1W8Q A;  2ZQA A;  2ZC3 B;  3PBN A;  3Q7Z A;  4OLD A;  2XF3 A;  1C3B A;  5DVA A;  1GHM A;  4OP5 A;  5J8X A;  3IH9 A;  5KMW A;  1E4D A;  2G2W A;  4GNU A;  3HLC A;  4IVK A;  2XDM A;  4FH4 A;  3VP4 A;  3HLE A;  2X71 A;  5EVI C;  2OV5 A;  1DJA A;  1ZC2 A;  4S2O A;  5CRF A;  2EFU A;  5FQQ A;  1M40 A;  4ZTK A;  1KGE A;  5FQI A;  4S2L A;  3IWI A;  4XUZ A;  2EX9 A;  3O3V A;  3UPN A;  1SHV A;  4OOM A;  1GA9 A;  4D2O A;  4OPR A;  4ZAM A;  3UE0 A;  1BZA A;  4JXS A;  5AQB A;  3NY4 A;  3PBR A;  4RVA A;  2PU4 A;  5FI6 A;  3ZFZ A;  2Y2L A;  2PBY A;  2HDR A;  3C5A A;  3PBS A;  5EVI B;  1AXB A;  3ZDJ A;  2ZM8 A;  1NXY A;  3ZG9 B;  3I7J A;  1FCO A;  4IBR A;  1NYY A;  1E3U A;  1PYY A;  3P98 A;  1MXO A;  2WGV A;  1CI9 A;  2Y2J A;  4IBX A;  1HTZ A;  1K6S A;  5CGX A;  5DTK A;  2WAF A;  5F1F A;  3G30 A;  5D3O A;  4EBN A;  3PAE A;  4OP8 A;  1L0F A;  2WGI A;  4PM6 A;  2WKI A;  1KGG A;  1LI0 A;  2HP9 A;  2Q9M A;  3PBT A;  3N4I A;  4PM9 A;  4GZB A;  4KZA A;  1XP4 A;  3M2J A;  2G2U A;  2WK0 A;  3VFF A;  4E3N A;  4BQM A;  4MBF A;  4KQQ A;  1W8Y A;  2ZC7 A;  4X56 A;  2FFF B;  3V3R A;  4Y0T A;  1IEM A;  5EUA A;  3M6B A;  1U60 A;  1FOF A;  1IYO A;  2ZC6 B;  1I5Q A;  1NY0 A;  5I94 A;  1Q2P A;  1RCJ A;  2WAD A;  2J9P A;  4ZJ2 A;  2XFS A;  4Y0O A;  4JKT A;  2XD1 A;  5A93 A;  1WYB A;  2ZM2 A;  2XGN A;  1GA0 A;  3Q7V B;  3V50 A;  3A3D A;  3EQV A;  3FV7 A;  3O88 A;  3N8R A;  2PU2 A;  4BEN A;  2P74 A; 
#chains in the Genus database with same CATH topology
 3N8L A;  5M19 A;  4PM8 A;  3BRM A;  4N9L A;  5AJG A;  3DTK A;  5DKK A;  3LR5 A;  2PR6 A;  3ZVT A;  2V8F A;  2HP6 A;  3W4O A;  3VP3 A;  4Y3I A;  2ZQC A;  2R78 A;  4LV3 A;  1ERM A;  1Z6F A;  1IEL A;  3KO6 A;  4KZ3 A;  1P0Z A;  2WKR A;  1K6R A;  2C5W B;  3RTY A;  5HFO A;  3ZGA B;  3F1P A;  4EET B;  4S2P A;  3BFE A;  4WEJ A;  3A0V A;  2DRW A;  4JXW A;  3HUO A;  1W63 Q;  4DN0 A;  4HH3 A;  4QD4 A;  4GS9 A;  4XXR A;  2W3F A;  2BAS A;  2OWH A;  4BBV A;  2V9A A;  3IWO A;  1E25 A;  1NZU A;  1TS8 A;  3VOZ A;  1DRM A;  2UV0 E;  1ES2 A;  1MZU A;  1KE3 A;  1BUL A;  2XQZ A;  4JF6 A;  3QP8 A;  2J3T C;  5A92 A;  1JWZ A;  1OT6 A;  2GNX A;  3VE3 A;  2H5S A;  5GHZ A;  3ZVW A;  4XT2 B;  2XLN A;  2PYP A;  4E6X A;  1FR6 A;  1L0D A;  3ISG A;  2Y2M A;  1W79 A;  4HBT A;  4U0X A;  4IVI A;  5FDH A;  3NOT C;  5J3W A;  4ESP A;  1TDG A;  4BD0 A;  4HJ4 A;  4YFM A;  2DNS A;  2ZQD A;  5DFX A;  3MBZ A;  4LEN A;  2JHE A;  4OPQ A;  1D7E A;  2JKG A;  4P6B A;  5EVL A;  3LYX A;  4YIN A;  1XJ2 A;  4IUK A;  3C7U A;  4QY5 A;  3F1O A;  4I3I A;  5E43 A;  2ZL1 B;  5GLB A;  3KSI A;  5JYP A;  3C8C A;  1HD8 A;  1EI5 A;  5KSC A;  4M4X A;  3T4T A;  2V1Z A;  4C3Q A;  5HSQ A;  1YQS A;  3NDE A;  2Z6D A;  3KSH A;  1Y54 A;  1G6A A;  2JKT M;  2PHY A;  3OPL A;  3QP1 A;  3PBQ A;  5A91 A;  4Y0U A;  5FEG A;  1K25 A;  2J3W A;  5CEB A;  4CPK A;  1Y28 A;  2A2L A;  3WS1 A;  2V20 A;  3IF6 A;  4H8R A;  4S2N A;  2ZQ9 A;  1N9O A;  2W3H A;  3U2A A;  4EEU A;  1YLY A;  4PHT A;  2ZMF A;  3VOY A;  1N9N A;  4OLG A;  4QJG A;  5G4Z A;  3RFB A;  4JF5 A;  3HLG A;  5F83 A;  3H7W A;  2W1T A;  1S4S A;  1N9L A;  3HUN A;  3IXB A;  1BTL A;  4OQ0 A;  3LR0 A;  3WRT A;  5DF7 A;  2Y79 A;  2HPB A;  4E3K A;  3VSL A;  4JXG A;  3KX0 X;  3ULF A;  5IS1 A;  3G32 A;  5FL3 A;  3LID A;  1MC0 A;  4CLC B;  3R4K A;  3OCN A;  2WKE A;  3ICY A;  2Y55 A;  4PMA A;  3ITA A;  2J7V A;  4JF4 A;  5KSH A;  3BY9 A;  2Y91 A;  1HVB A;  3L9K A;  4HJ6 A;  1Q2Q A;  1T1C A;  4WUJ A;  3AGD A;  4MN5 A;  4LRX C;  4MMN A;  4G3W A;  1IKI A;  3GEC A;  4JPM A;  2VK3 A;  2I72 A;  4QB8 A;  1OME A;  3MXR A;  1IFQ A;  5GHY A;  4L9F A;  4QWO A;  4K91 A;  3F1N B;  1RGZ A;  3IT9 A;  3LIB A;  3E0Y A;  3FKW A;  3HUM A;  5IU1 A;  1K56 D;  1FR1 A;  2Z2M B;  3OPP A;  3UMD A;  3HL9 A;  3LY4 A;  2J9O A;  4ME4 A;  1ESU A;  3LEQ A;  4HQA A;  1DY6 A;  4S2N C;  3NC8 A;  3G34 A;  1ODV A;  1CJF A;  3S7O A;  5FSR A;  3SZT A;  1NLY A;  5L10 A;  1LL5 A;  2M7U A;  4Z9Q A;  2WGW B;  5GLA A;  4S2M A;  2G7U A;  5TBM A;  2EWW A;  3UDI A;  1V9Y A;  3NJA A;  1LL9 A;  2QJ7 A;  1SDE A;  4H6J A;  1F98 A;  3RXX A;  4RX2 A;  3IHB A;  4AFI A;  5MC7 A;  3CAX A;  1ZG4 A;  4DXB A;  3S7N A;  4E3M A;  4LGW A;  1PZO A;  2QYB A;  1UWN X;  1OTD A;  1Y4O A;  2PD7 A;  4E3I A;  1W7F A;  3EGD C;  4JXV A;  4WZ5 A;  3UE1 A;  3ZQ5 A;  1O7E A;  5HDS A;  1L3L A;  3WS0 A;  1JVJ A;  3G35 A;  1IYS A;  4WBG A;  3H9W A;  2ZC4 B;  3SS5 A;  2V8C A;  3G2Y A;  3D3O A;  3ZCZ A;  4EUZ A;  1XJ6 A;  1XJ4 A;  4EQ1 A;  2P7J A;  5FQJ A;  1XFQ A;  1PW8 A;  4P6Z M;  3SOI A;  3KYQ A;  3GQZ A;  4R23 A;  2W3E A;  3ZHH A;  3VE4 A;  1BLC A;  5E2E A;  3SS4 A;  1PI5 A;  4U0T A;  3RJU A;  2GZA A;  2P9V B;  4E3J A;  1XXM A;  1W8Q A;  3DAV A;  1C3B A;  1AWI A;  1GHM A;  2W0N A;  5HPF A;  2Z6C A;  2VKS A;  4FH4 A;  3IX8 A;  2X71 A;  2HF6 A;  1ZC2 A;  2KLI A;  4S2O A;  3T1S A;  5FQQ A;  3A0S A;  5FQI A;  4S2L A;  4GCZ A;  4D2O A;  3NY4 A;  1Z09 A;  4Y5F A;  2M7V A;  2QKP A;  1AXB A;  3ZDJ A;  5C5K A;  1PYY A;  4E3O A;  1MXO A;  5CGX A;  1HTZ A;  5FEF A;  2WAF A;  5F1F A;  3PAE A;  4PM6 A;  2WKI A;  2HP9 A;  2Q9M A;  4NXB A;  3M2J A;  3CI6 A;  2WK0 A;  3LI8 A;  4E3N A;  4KQQ A;  1W8Y A;  3LR3 A;  1FOF A;  1RCJ A;  4ZJ2 A;  2XGN A;  1GA0 A;  3S7Q A;  4KUK A;  3EQV A;  1DP8 A;  1YT4 A;  1MKI A;  3FKV A;  3OZH A;  2JN7 A;  4NXF A;  2ZMV A;  1LLB A;  2V1B A;  1L2S A;  4PM5 A;  3M2K A;  1PI4 A;  3BEB A;  3DWK A;  3V3S A;  3BFD A;  4GKU A;  2Y2N A;  1YLZ A;  4C6Y A;  2XRN A;  1TS0 A;  1LT0 A;  4UAA A;  2WKP A;  5CXW A;  4DKI A;  2B5R A;  4EV4 A;  3HRE A;  4X1M A;  3OC2 A;  2HP5 A;  1KOU A;  5J7E A;  1YAX A;  4GN2 A;  1V9Z A;  1ZHH B;  4K0X A;  5CGS A;  4B4Z A;  2P08 A;  3P09 A;  2OLV A;  5HAI A;  3W4Q A;  1DP6 A;  3MQ0 A;  3T4L A;  3A3F A;  1ONH A;  4F3L B;  3GVB A;  3BFC A;  3OLO A;  1TS6 A;  2VGL M;  3T1X A;  2A24 A;  4U3T A;  1OTE A;  1DJB A;  3WWX A;  4RQ9 A;  1ONG A;  2ZOI A;  1FIK A;  2AVX A;  3V5M A;  1NJ4 A;  1IKG A;  4P6Z S;  4R3A A;  4R0Q A;  2XA7 M;  3OPH A;  5CHJ A;  5J4E A;  2FFY A;  1BSG A;  1LSV A;  4GDN A;  4BD1 A;  1H5X A;  1H8Y A;  2VV7 A;  1X0O A;  1S4R A;  5GLC A;  5HPI A;  1P97 A;  4LCM A;  1I2S A;  3Q1F A;  3ZG8 B;  3DTE A;  1G5U A;  1BT5 A;  1K38 A;  3C30 A;  3PAG A;  2INW A;  4EWF A;  4O8G A;  4EU0 A;  1OTI A;  1RP5 A;  2A49 A;  2E8J A;  4Y15 A;  3WRZ A;  2Y8H A;  2J8Y A;  3FC7 A;  1XFN A;  1GCE A;  2BG1 A;  5HAQ A;  4OVD A;  2QHK A;  3HJI A;  3Q82 A;  3F1P B;  3D4F A;  1KE0 A;  1FQG A;  3NIA A;  3B42 A;  4MBH A;  3BQA A;  4HES A;  4GS9 B;  4ZJ3 A;  1OJ5 A;  2JKR I;  1NWZ A;  1XA1 A;  4WF0 A;  2WAE A;  4RA7 A;  4GLQ A;  4R3B A;  4B4X A;  4LFU A;  1F9I A;  2ZBB A;  4I38 A;  3BY8 A;  3IQA A;  4IHQ A;  4EBL A;  3UO9 A;  2H0Y A;  4NG2 A;  2NUT C;  1MBL A;  1G6O A;  4OPY A;  1KVL A;  2HZ5 A;  4DJ2 A;  2D02 A;  4M3K A;  1YMX A;  1K55 A;  4RYE A;  4KZ4 A;  4MEZ A;  1TEM A;  1O07 A;  4R3J A;  5AQA A;  2PR5 A;  1S1Z A;  2VEA A;  2Y2G A;  3UDX A;  4KEN B;  2J3T D;  1ESI A;  4GB7 A;  4IUH A;  3HLW A;  1ERQ A;  3UB7 A;  1GSX A;  3EQU A;  1H8M A;  4GW9 A;  2OAP 1;  4DE2 A;  4FD8 A;  2H10 A;  2QWS A;  4E3L A;  1TF1 A;  3UME A;  3DTI A;  4S2I A;  5AQ9 A;  1CI8 A;  2J80 A;  1PWG A;  1TVF A;  4HHD A;  5TGF A;  3B33 A;  4PKY G;  3WS2 A;  4DJ3 A;  5L07 A;  4R6L A;  3F1O B;  2HJE A;  5I5L A;  4JGR A;  4HNB A;  1TD5 A;  1S6R A;  3ZG5 A;  3CZD A;  1SZV A;  3S22 A;  3UE3 A;  4WL9 A;  1KE4 A;  1QME A;  3NBL A;  2JE5 A;  2B95 A;  5DF8 A;  4NET A;  2VGK A;  3BJN A;  3UE6 A;  2Q0O A;  3QHY A;  3EEH A;  2VLG A;  3IF6 B;  2BLS A;  3UPP A;  1K55 C;  4NKP A;  2XK1 A;  3K3C A;  3OCL A;  4KZ9 A;  5HW3 A;  2DMW A;  5AVF A;  3UPO A;  3HLB A;  5DJU A;  3H7W B;  2W1T B;  2JCH A;  3LIC A;  3P7N A;  4X1L A;  3HVF A;  4WEK A;  2QZ6 A;  3W2Z A;  2ZQ7 A;  2V0W A;  2XA7 S;  4GOG A;  2WYX A;  4P87 A;  1ACF A;  3IWQ A;  2L4R A;  5A8B A;  4FOF A;  3LCE A;  1YLP A;  4X55 A;  3ZG7 B;  3LIE A;  2RCX A;  5F68 A;  3BLM A;  5E2H A;  1LI9 A;  3QNC A;  4R4R A;  2PDR A;  1T1A A;  4LV1 A;  2PT7 A;  1FCN A;  3SS3 A;  1K56 A;  2ZOH A;  5EOE A;  5F1G A;  4R70 A;  1VET A;  3QNB A;  2D01 A;  3N8S A;  3NCK A;  5F82 A;  1HLU P;  2KOI A;  1FCM A;  2QJ5 A;  4FCF A;  1BUE A;  2V2F F;  3CPT A;  1PRQ A;  4MLL A;  3B3X A;  2M1C A;  3HLD A;  2GX5 A;  3PYP A;  2L0W A;  3N6I A;  5EM0 A;  3T50 A;  4UA9 A;  4WM9 A;  3ITB A;  1DP9 A;  2XD5 A;  1YKD A;  1F5M A;  5G18 A;  3CUE A;  5CED A;  3C7V A;  4KZ8 A;  3GDI A;  3NUL A;  1PWC A;  1OTB A;  4P85 A;  1L0E A;  4HP4 A;  1XX2 A;  3T4Q A;  3GRJ A;  3VP2 A;  3MKF A;  2ZQA A;  2K31 A;  4YNR A;  2K7S A;  4OLD A;  5TBM B;  2XF3 A;  3ZYT A;  4UQI M;  5DVA A;  3MF0 A;  3IH9 A;  1ZTU A;  5KMW A;  3MQO A;  3HLC A;  4IVK A;  2XDM A;  3JVU A;  4H6J B;  2YKH A;  3VP4 A;  2OV5 A;  5CRF A;  2EFU A;  4D60 A;  1SHV A;  3QP5 A;  4ZAM A;  3D72 A;  3UE0 A;  3E4O A;  4RVA A;  2O9A A;  3C5A A;  2HDR A;  1VHM A;  3IX4 A;  3ZG9 B;  1D1J A;  5HWV A;  4WEL A;  3P98 A;  2WGV A;  1G28 A;  1K6S A;  1T1B A;  4NXG A;  4EBN A;  1L0F A;  2WGI A;  1KGG A;  1LI0 A;  3N4I A;  4GZB A;  1XP4 A;  3VFF A;  3EEA A;  4BQM A;  4Y0T A;  2FFF B;  5EUA A;  4CLC E;  1VB6 A;  4JGO A;  2WAD A;  2J9P A;  4I39 A;  4Y0O A;  5A93 A;  1WYB A;  3CUE C;  3A3D A;  1NRJ A;  2PU2 A;  3JVV A;  5EE8 A;  3IXD A;  5FAO A;  1NRF A;  5CHU A;  1TS7 A;  1PFL A;  3UY6 A;  2E8I A;  2VJW A;  1A0K A;  1ES3 A;  1VEU A;  3BM6 A;  4CLC D;  1OJG A;  4LRY C;  5L2F A;  4N1H A;  5CTN A;  2V0U A;  2OAQ 1;  5FA7 A;  2O0Y A;  3S7P A;  5M18 A;  4KQO A;  2HDQ A;  1OTA A;  1SKF A;  4DDS A;  4RX3 A;  4PAU A;  5HD5 A;  4CLC C;  4EES A;  4OQI A;  3BEC A;  3FPW A;  3UN7 A;  2XEP A;  1MKM A;  1RGY A;  4HIA A;  2W3G A;  4HP9 A;  4UEY A;  2A3U A;  4Y13 A;  3KYZ A;  2W1R A;  2L1M A;  3N7W A;  4JBF A;  2GDN A;  3BLS A;  3E98 A;  4B9O A;  4GHI A;  4Q0J A;  2QPN A;  3BQ8 A;  1W63 M;  1W5D A;  2Z2L B;  4S2J A;  5GL9 A;  3MXS A;  4OQH A;  1P9R A;  3HBR A;  4HI4 A;  4KZ7 A;  3MXQ A;  2WZZ A;  5FQM A;  1VQQ A;  1XGJ A;  4DXC A;  2VX8 A;  1VM1 A;  3DTM A;  5CEC A;  4QY6 A;  2UWX A;  3MMH A;  3CMZ A;  3JYI A;  1IYP A;  1S66 L;  2IA2 A;  3CHW P;  2O9C A;  3IH8 A;  5KIZ A;  2EXA A;  1I2W A;  3M6H A;  5F5Y A;  3A3J A;  2W3D A;  2WUQ A;  2K2N A;  2HDU A;  4HBU A;  4R4S A;  3DW0 A;  4OH0 A;  4HJ3 A;  4EER A;  2JC7 A;  1XJ3 A;  3C38 A;  1F2K A;  3FWL A;  2IWB A;  1K4E A;  4KQR A;  4UQI S;  4BL2 A;  2X01 A;  4DE0 A;  2XFT A;  5HL6 A;  4OOY A;  3ZNT A;  3UB9 A;  1UGU A;  2VA0 A;  4FH2 A;  4DE1 A;  4B93 A;  5TR7 A;  1MWU A;  3CG5 A;  3LO7 A;  1CEF A;  3IHA A;  5CX7 A;  5AVE A;  3IX3 A;  3K3D A;  4X6T A;  3L7H A;  1WA9 A;  5E2F A;  3SH9 A;  1JWP A;  1BLS A;  1K57 A;  1LSX A;  1LSW A;  2CMN A;  5GHX A;  2KDK A;  3GSG A;  3SH7 A;  3O86 A;  3W4P A;  2EA9 A;  3LFV A;  4O7D A;  1YM1 A;  2A24 B;  5EVE A;  1H0M A;  2JKT I;  4EEP A;  3QP6 A;  1MWS A;  3BFG A;  1N4O A;  3HLF A;  3OOV A;  4HH2 A;  1EWZ A;  4LRZ E;  3MZF A;  4MNR A;  3LI9 A;  5FAP A;  1ZG6 A;  2KX6 A;  3A3E A;  4Y7P A;  4R38 A;  5KZH A;  3KYE A;  3SH8 A;  1ES5 A;  1SKO B;  4K08 A;  2LB9 A;  5FAQ A;  1YLJ A;  5IHV A;  2PD8 A;  4PM7 A;  4YOF A;  1BYW A;  3IS2 A;  1S1Y A;  1M6K A;  3RXW A;  2B18 A;  4ARZ A;  4ZJ1 A;  1JTG A;  4EW7 A;  1GHI A;  1CQA A;  1K54 A;  3O87 A;  4ZRR A;  3IXG A;  4Z1W A;  5HAR A;  1OPX A;  1CEG A;  2Y4A A;  2Y2I A;  3LIF A;  5DKL A;  3VP0 A;  3H82 A;  4X68 A;  1SKO A;  5FDS A;  1K57 C;  5EM1 A;  3U4L P;  3C4O A;  1HZO A;  4JGP A;  5F6A A;  4BLM A;  1ALQ A;  3TG9 A;  1GHP A;  2PBD P;  3MZD A;  3TW8 A;  3NOU C;  4DF6 A;  3MFD A;  3QP4 A;  5HWT A;  3GV9 A;  5HAP A;  3R7W A;  4UA7 A;  4KG2 A;  2YKF A;  3CIT A;  5HZH A;  3EGX C;  4MN6 A;  4EUV A;  3UB6 A;  2NUP C;  4HEF A;  3NI9 A;  5EV0 A;  2PYR A;  3IF5 A;  4JGQ A;  4DRT A;  1QMF A;  1XGI A;  4OON A;  4I3J A;  4QHC A;  1J9M A;  1MWR A;  2XSS A;  3T4J A;  1PWD A;  5EVI A;  1MWT A;  3O5Y A;  5EOO A;  1N9B A;  1K54 C;  4O01 A;  5EPH A;  4LV2 A;  3S1Y A;  4CJN A;  3GR2 A;  5FI7 A;  4NXE A;  1NLZ A;  2HJ9 C;  1KDW A;  4I5S A;  4ZBE A;  1XKZ A;  3FZC A;  2GJ3 A;  1KGF A;  3VV4 A;  1G68 A;  1YMS A;  2Y2K A;  2VV6 A;  2OOL A;  3TOI A;  3W8K A;  1E3U D;  3Q7V A;  3PR6 A;  3QP2 A;  4L0L A;  2Y2Q A;  2XR0 A;  2H28 A;  4QU3 A;  2FH5 A;  4OQG A;  3VOL A;  4MCW A;  3OBF A;  1OT9 A;  1K4F A;  4L9E A;  4BBU A;  3MR0 A;  1JTD A;  5CGW A;  4E04 A;  5G4Y A;  4LPZ A;  5CER A;  3G31 A;  5EVI D;  2ZC3 B;  3PBN A;  3Q7Z A;  1UWP X;  3A0R A;  5J8X A;  2WKQ A;  2G2W A;  2PAV P;  4ETZ A;  5EVI C;  3KSF A;  3TJZ C;  1KGE A;  4XUZ A;  3O3V A;  3UPN A;  4OOM A;  1GA9 A;  3LGO A;  5AQB A;  3PBR A;  2VGL S;  2EWV A;  4GJ4 A;  3JPU A;  2PBY A;  3EOI A;  1FIL A;  1NXY A;  1NYY A;  4FUW A;  3G30 A;  3PBT A;  1D06 A;  2G2U A;  1IOU A;  1VET B;  4MDZ A;  4X56 A;  5LBR A;  3V3R A;  1IEM A;  4XT2 A;  1U60 A;  5I94 A;  1YSQ A;  2XFS A;  4JKT A;  2XD1 A;  3CPT B;  2V1A A;  3LUQ A;  3V50 A;  1GSW A;  3PHY A;  5DJT A;  4X25 A;  3N8R A;  4N92 A;  2P74 A;  5TFQ A;  1FSY A;  5DF9 A;  4P0M A;  2W27 A;  3C2W A;  1TDL A;  5FAS A;  1ES4 A;  4S2K A;  3HCY A;  5A90 A;  4Q8I A;  5HDD A;  3E4P A;  5TJJ A;  2JKF A;  2WZX A;  1XA7 A;  3FG8 A;  5DTS A;  2Y59 A;  2ZL1 A;  4N1X A;  2ZMA A;  4KG5 A;  3MJQ A;  1WYC A;  3AGF A;  2ZD8 A;  1PZP A;  3LIA A;  1EW0 A;  1BLH A;  5HWW A;  2X02 A;  4C75 A;  2CC1 A;  4WLA A;  3G6O A;  2R9W A;  3PXP A;  4DDY A;  1GSV A;  3VMA A;  5F69 A;  3UDF A;  3BW6 A;  2BTF P;  2EX6 A;  1IYQ A;  3FYZ A;  4HY8 A;  4OOL A;  4ZDX A;  4Y17 A;  4L9G A;  1STZ A;  1CF0 A;  3VSK A;  1ERO A;  2ZC5 B;  4LCL A;  4GD6 A;  1SDN A;  4CLC A;  2ZLY A;  4KZ5 A;  2ZM0 A;  3Q07 A;  3TRC A;  2DCF A;  1SCW A;  4FTX A;  3E2K A;  3T4S A;  5FQ9 A;  1L0G A;  4CQH A;  3IF6 C;  4XUX A;  4MBK A;  4K0W A;  4LV0 A;  4X69 A;  1MY8 A;  1VEU B;  1PW1 A;  3S4X A;  2IWC A;  3TE8 A;  1JWV A;  2C6W B;  5HL1 A;  3GTC A;  4BJP A;  2XH9 A;  3G4P A;  1KVM A;  2JKR M;  3F1N A;  4EXO A;  1LHY A;  5FI2 A;  1PIO A;  4NK3 A;  4KG6 A;  2HDS A;  3NEC A;  4YWZ A;  4G3V A;  4B88 A;  1JNU A;  3LEZ A;  2VGJ A;  3Q81 A;  3E2L A;  2WGW A;  1FSW A;  5CHM A;  4KQD A;  3B47 A;  4GHI B;  1J3W A;  1K0K A;  2R9X A;  5M1A A;  2O99 A;  4QPR A;  4BL3 A;  3CWF A;  5DTT A;  4BWI A;  2Q9N A;  4PKY A;  3SW1 A;  1CK3 A;  3E4Q A;  3DBA A;  2I9V A;  3PTE A;  3KSG A;  3CJM A;  4GD8 A;  3DWZ A;  1XPB A;  2HGV A;  4WZ4 A;  3V39 A;  3LR4 A;  4Q0H A;  2OSU A;  4ETX A;  2EX8 A;  1YPR A;  4KZ6 A;  3UB5 P;  3OPR A;  4WMC A;  1P9W A;  1LL8 A;  2B02 A;  5L09 A;  5JYO A;  1BLP A;  3BYD A;  4IED A;  2LB5 A;  3PBO A;  2QMI A;  3IBR A;  1MPL A;  2XRO A;  4UHU A;  3UB8 A;  3T4O A;  4LLO B;  3ZG0 A;  3UNW A;  3WS4 A;  5BOH A;  3MFX A;  2H0T A;  3BWL A;  4HOI A;  5K5B A;  4KZB A;  1YSP A;  3T1R A;  5U47 A;  1NYM A;  3MQQ A;  4DMZ A;  2ZQ8 A;  4WZ5 C;  4BBT A;  5E2G A;  4FSF A;  4GDB A;  4IJG A;  2P9V A;  5CTM A;  3RH8 B;  4WYY A;  3C4P A;  2Y2O A;  1YLW A;  4I3A A;  3MS6 A;  4EBP A;  3LY3 A;  2HV1 A;  4WMC D;  3VFH A;  1S67 L;  2JBF A;  5HX9 A;  3NDG A;  3EWK A;  3CLO A;  4A5R A;  3D9Y A;  4X53 A;  2RL3 A;  3K2N A;  4OPZ A;  3BFF A;  1KDS A;  3TSG A;  2P04 A;  3AGE A;  5HD3 A;  4JLF A;  1ZKJ A;  2EFX A;  5IT5 A;  3WS5 A;  4ID4 A;  2Y2P A;  2OLU A;  4R1G A;  4WN5 A;  3HJK A;  5AQ7 A;  3V67 A;  3A3I A;  2VZW A;  5FAT A;  4BMW A;  2WKH A;  1NZO A;  2ZJ9 A;  3T12 B;  3P01 A;  5FQK A;  1T19 A;  1T18 A;  5HDC A;  3VP1 A;  5EFW A;  3IS2 B;  4UA6 A;  3MKE A;  4ARZ B;  1YLT A;  4G3K A;  2Y2H A;  2O9B A;  1H8Z A;  3T4K A;  3MZE A;  4Y2F A;  2OWJ A;  1H3Q A;  5GLD A;  5EEC A;  4E6W A;  3NOP C;  3IXH A;  2IWD A;  4PPR A;  2ACG A;  4N9K A;  4F94 A;  2FZ0 A;  2EX2 A;  3H82 B;  2EXB A;  3IBJ A;  1DJC A;  4EQI A;  5L8M A;  3G2Z A;  3GMW A;  4OKP A;  3ZNY A;  5DFY A;  1S0W A;  1WE4 A;  4DE3 A;  2MJ6 A;  3R7W B;  3MSH A;  3NHQ A;  1PNE A;  4OP5 A;  4KUO A;  1E4D A;  4GNU A;  3HLE A;  3FPV A;  1DJA A;  1M40 A;  4ZTK A;  4NEE D;  3IWI A;  2EX9 A;  4OPR A;  1BZA A;  4JXS A;  2PU4 A;  5FI6 A;  3ZFZ A;  4F3L A;  2Y2L A;  3PBS A;  5EVI B;  2PRF A;  2ZM8 A;  3I7J A;  1FCO A;  4IBR A;  4II7 A;  1E3U A;  4IBX A;  5DTK A;  1CI9 A;  2Y2J A;  5D3O A;  4OP8 A;  4PM9 A;  4Q0I A;  4KZA A;  3T1Q B;  4MN7 A;  4MBF A;  2ZC7 A;  3M6B A;  1IYO A;  2ZC6 B;  1I5Q A;  1NY0 A;  1Q2P A;  2VV8 A;  4O0P A;  2ZM2 A;  3Q7V B;  3FV7 A;  3O88 A;  4BEN A; 
#chains in the Genus database with same CATH homology
 1YT4 A;  3FKV A;  1MKI A;  3OZH A;  5EE8 A;  5TFQ A;  1FSY A;  3IXD A;  5FAO A;  1NRF A;  3N8L A;  5M19 A;  4PM8 A;  1LLB A;  3BRM A;  4N9L A;  5CHU A;  5DF9 A;  4P0M A;  3UY6 A;  2E8I A;  1TDL A;  3ZVT A;  1L2S A;  4PM5 A;  5FAS A;  1ES3 A;  3BM6 A;  2HP6 A;  3M2K A;  3VP3 A;  3W4O A;  1PI4 A;  2ZQC A;  3BEB A;  5L2F A;  3DWK A;  4N1H A;  3V3S A;  1ES4 A;  5CTN A;  3BFD A;  4S2K A;  4GKU A;  5A90 A;  4LV3 A;  1ERM A;  2Y2N A;  1YLZ A;  1Z6F A;  4C6Y A;  4Q8I A;  2WZX A;  1XA7 A;  5DTS A;  5FA7 A;  1IEL A;  5M18 A;  2Y59 A;  4KQO A;  4N1X A;  2HDQ A;  4UAA A;  1SKF A;  4KZ3 A;  2ZMA A;  4DDS A;  4RX3 A;  5CXW A;  4KG5 A;  4DKI A;  1WYC A;  1K6R A;  2C5W B;  2B5R A;  3AGF A;  5HFO A;  3ZGA B;  2ZD8 A;  1PZP A;  4S2P A;  4EV4 A;  3BFE A;  4OQI A;  4WEJ A;  1BLH A;  3HRE A;  2DRW A;  3BEC A;  4JXW A;  3OC2 A;  2HP5 A;  3UN7 A;  2XEP A;  3HUO A;  4GN2 A;  4QD4 A;  2X02 A;  4C75 A;  1RGY A;  4XXR A;  2CC1 A;  4K0X A;  5CGS A;  4B4Z A;  2A3U A;  3P09 A;  2R9W A;  2OLV A;  3IWO A;  1E25 A;  4DDY A;  5HAI A;  3W4Q A;  4JBF A;  3N7W A;  3VMA A;  2GDN A;  3A3F A;  3BLS A;  1NZU A;  1ONH A;  2QPN A;  3GVB A;  3VOZ A;  3BFC A;  3UDF A;  1W5D A;  2Z2L B;  4S2J A;  5GL9 A;  1ES2 A;  3MXS A;  1KE3 A;  4U3T A;  1BUL A;  4OQH A;  2XQZ A;  1DJB A;  2EX6 A;  3HBR A;  1IYQ A;  4JF6 A;  4KZ7 A;  4WEL A;  3FYZ A;  2WZZ A;  4OOL A;  5FQM A;  3WWX A;  5A92 A;  1VQQ A;  1XGJ A;  1JWZ A;  4ZDX A;  1ONG A;  4DXC A;  3VSK A;  2H5S A;  1VM1 A;  1ERO A;  3DTM A;  5GHZ A;  2ZC5 B;  3ZVW A;  5CEC A;  4QY6 A;  2XLN A;  4LCL A;  4GD6 A;  2UWX A;  4E6X A;  1FR6 A;  1SDN A;  3V5M A;  1NJ4 A;  2ZLY A;  4KZ5 A;  1IKG A;  3CMZ A;  2ZM0 A;  3JYI A;  1L0D A;  3ISG A;  3Q07 A;  4R0Q A;  2Y2M A;  1IYP A;  1W79 A;  4HBT A;  3OPH A;  2DCF A;  1SCW A;  5CHJ A;  4U0X A;  4IVI A;  2FFY A;  3IH8 A;  5FDH A;  1BSG A;  2EXA A;  3E2K A;  4GDN A;  4BD1 A;  1I2W A;  3M6H A;  3A3J A;  5FQ9 A;  1L0G A;  1H5X A;  1H8Y A;  1TDG A;  2WUQ A;  3IF6 C;  4BD0 A;  5GLC A;  4YFM A;  2HDU A;  2DNS A;  4HBU A;  4XUX A;  4R4S A;  2ZQD A;  3DW0 A;  4MBK A;  4LCM A;  4OH0 A;  4K0W A;  4LV0 A;  4X69 A;  3MBZ A;  1I2S A;  1MY8 A;  3Q1F A;  4LEN A;  4OPQ A;  2JC7 A;  3ZG8 B;  1PW1 A;  3S4X A;  2IWC A;  4P6B A;  5EVL A;  1JWV A;  2C6W B;  3FWL A;  2IWB A;  5HL1 A;  1K4E A;  3GTC A;  1BT5 A;  1K38 A;  4KQR A;  4YIN A;  4BJP A;  3PAG A;  2X01 A;  4BL2 A;  2XH9 A;  3G4P A;  3C7U A;  4DE0 A;  4EWF A;  1KVM A;  4QY5 A;  2XFT A;  1RP5 A;  2A49 A;  4OOY A;  1LHY A;  5E43 A;  5GLB A;  3ZNT A;  5JYP A;  3WRZ A;  1HD8 A;  5FI2 A;  4FH2 A;  2J8Y A;  4DE1 A;  1GCE A;  2BG1 A;  1EI5 A;  5TR7 A;  4OVD A;  5HAQ A;  1MWU A;  1PIO A;  3CG5 A;  1CEF A;  3LO7 A;  5KSC A;  4NK3 A;  4KG6 A;  3IHA A;  3Q82 A;  2HDS A;  2V1Z A;  3D4F A;  4C3Q A;  1KE0 A;  1FQG A;  1YQS A;  3NDE A;  3NIA A;  4N92 A;  4B88 A;  1Y54 A;  1G6A A;  4MBH A;  4X6T A;  3OPL A;  4HES A;  3PBQ A;  4ZJ3 A;  5A91 A;  3LEZ A;  4Y0U A;  5E2F A;  1K25 A;  3SH9 A;  1JWP A;  2VGJ A;  5CEB A;  1BLS A;  1K57 A;  4CPK A;  3Q81 A;  1XA1 A;  2WAE A;  3E2L A;  4RA7 A;  5GHX A;  4R3B A;  2V20 A;  3IF6 A;  4H8R A;  3WS1 A;  4B4X A;  2WGW A;  1FSW A;  3IQA A;  3GSG A;  4S2N A;  5CHM A;  4EBL A;  2ZQ9 A;  3UO9 A;  2H0Y A;  3SH7 A;  1YLY A;  3VOY A;  2R9X A;  5M1A A;  3O86 A;  4OLG A;  1MBL A;  3W4P A;  4OPY A;  4QJG A;  1KVL A;  4JF5 A;  3HLG A;  4BL3 A;  4O7D A;  1YM1 A;  5F83 A;  3HUN A;  5DTT A;  2Q9N A;  3IXB A;  4M3K A;  1CK3 A;  1BTL A;  1YMX A;  4OQ0 A;  1K55 A;  1MWS A;  3WRT A;  3PTE A;  4RYE A;  3BFG A;  3CJM A;  5DF7 A;  2HPB A;  1N4O A;  4KZ4 A;  4GD8 A;  4MEZ A;  3DWZ A;  3VSL A;  1XPB A;  1TEM A;  4E3K A;  1O07 A;  4R3J A;  5AQA A;  4JXG A;  3HLF A;  1EWZ A;  4WZ4 A;  3V39 A;  3G32 A;  2Y2G A;  3MZF A;  3UDX A;  2OSU A;  3OCN A;  4MNR A;  4KEN B;  2WKE A;  5FAP A;  1ESI A;  1ZG6 A;  2EX8 A;  3A3E A;  4GB7 A;  4KZ6 A;  3HLW A;  4Y7P A;  1ERQ A;  2Y55 A;  3ITA A;  3OPR A;  4PMA A;  4WMC A;  2J7V A;  4JF4 A;  5KZH A;  5KSH A;  3SH8 A;  1ES5 A;  3EQU A;  2Y91 A;  1HVB A;  1Q2Q A;  4DE2 A;  4FD8 A;  5FAQ A;  1YLJ A;  3AGD A;  2H10 A;  5JYO A;  5IHV A;  4PM7 A;  4E3L A;  1IKI A;  1BLP A;  3BYD A;  4JPM A;  4IED A;  4S2I A;  5AQ9 A;  1M6K A;  3RXW A;  3PBO A;  1CI8 A;  2QMI A;  4ZJ1 A;  1JTG A;  1GHI A;  1PWG A;  2I72 A;  1TVF A;  1MPL A;  1OME A;  4QB8 A;  1K54 A;  3O87 A;  5TGF A;  3MXR A;  4UHU A;  5GHY A;  3IXG A;  5HAR A;  1CEG A;  3WS2 A;  4K91 A;  3ZG0 A;  2Y4A A;  1RGZ A;  2Y2I A;  3IT9 A;  3VP0 A;  3FKW A;  3HUM A;  3UNW A;  1S6R A;  3WS4 A;  1K56 D;  3ZG5 A;  5BOH A;  2H0T A;  3CZD A;  3UE3 A;  3S22 A;  1FR1 A;  4KZB A;  4X68 A;  1KE4 A;  1QME A;  2Z2M B;  3NBL A;  3OPP A;  1K57 C;  2JE5 A;  3HL9 A;  3LY4 A;  2J9O A;  5DF8 A;  4NET A;  1NYM A;  1HZO A;  2VGK A;  1ESU A;  3C4O A;  4S2N C;  1DY6 A;  5U47 A;  2ZQ8 A;  4WZ5 C;  3NC8 A;  5E2G A;  3G34 A;  4BLM A;  3QHY A;  1ALQ A;  3TG9 A;  1GHP A;  4FSF A;  4GDB A;  2P9V A;  3MZD A;  5CTM A;  5FSR A;  4DF6 A;  4WYY A;  3C4P A;  3MFD A;  2Y2O A;  1YLW A;  4EBP A;  1LL5 A;  3GV9 A;  3LY3 A;  3IF6 B;  5HAP A;  4Z9Q A;  2WGW B;  5GLA A;  4WMC D;  2BLS A;  3VFH A;  3UPP A;  4S2M A;  1K55 C;  4UA7 A;  2XK1 A;  2JBF A;  3OCL A;  4KG2 A;  4KZ9 A;  5HX9 A;  3UDI A;  5HW3 A;  3NDG A;  1LL9 A;  3UPO A;  4A5R A;  3HLB A;  4X53 A;  2RL3 A;  1SDE A;  4OPZ A;  2JCH A;  3BFF A;  1KDS A;  4HEF A;  3HVF A;  4WEK A;  3RXX A;  3TSG A;  2QZ6 A;  3NI9 A;  2ZQ7 A;  4GOG A;  4RX2 A;  3AGE A;  3IHB A;  2WYX A;  4JLF A;  4P87 A;  3IF5 A;  1ZKJ A;  4DRT A;  1ZG4 A;  2EFX A;  1QMF A;  1XGI A;  4OON A;  4E3M A;  3IWQ A;  3WS5 A;  4DXB A;  1PZO A;  4ID4 A;  4QHC A;  1J9M A;  2Y2P A;  1MWR A;  2OLU A;  4R1G A;  1PWD A;  5AQ7 A;  3LCE A;  3A3I A;  5FAT A;  4E3I A;  1YLP A;  1W7F A;  5EVI A;  1MWT A;  4X55 A;  3ZG7 B;  2RCX A;  2WKH A;  3BLM A;  4JXV A;  4WZ5 A;  5E2H A;  1LI9 A;  3UE1 A;  5EOO A;  1NZO A;  1O7E A;  2ZJ9 A;  3QNC A;  3WS0 A;  4R4R A;  1N9B A;  1K54 C;  5EPH A;  3S1Y A;  4LV2 A;  1JVJ A;  3G35 A;  5FQK A;  1IYS A;  4LV1 A;  4WBG A;  4CJN A;  1FCN A;  3SS3 A;  1K56 A;  3GR2 A;  5FI7 A;  5EOE A;  3VP1 A;  2ZC4 B;  5F1G A;  1KDW A;  3QNB A;  4UA6 A;  3N8S A;  3SS5 A;  3NCK A;  3MKE A;  5F82 A;  4ZBE A;  1XKZ A;  1YLT A;  3FZC A;  3G2Y A;  1KGF A;  2Y2H A;  1FCM A;  1H8Z A;  3MZE A;  4FCF A;  5GLD A;  1BUE A;  1G68 A;  1YMS A;  2Y2K A;  2V2F F;  5EEC A;  4E6W A;  4MLL A;  3TOI A;  3W8K A;  3B3X A;  1E3U D;  3IXH A;  3ZCZ A;  4EUZ A;  2IWD A;  3Q7V A;  3HLD A;  4PPR A;  4N9K A;  4L0L A;  2Y2Q A;  4F94 A;  2XR0 A;  5FQJ A;  3N6I A;  4QU3 A;  2EX2 A;  1PW8 A;  4OQG A;  4UA9 A;  4E3O A;  4WM9 A;  2EXB A;  3SOI A;  1DJC A;  4EQI A;  3GQZ A;  3ITB A;  4R23 A;  2XD5 A;  3ZHH A;  1K4F A;  3G2Z A;  5G18 A;  1BLC A;  3GMW A;  5E2E A;  5CED A;  3SS4 A;  4OKP A;  3C7V A;  4KZ8 A;  1PI5 A;  3ZNY A;  4U0T A;  3RJU A;  1PWC A;  2P9V B;  1L0E A;  4P85 A;  1JTD A;  1S0W A;  5CGW A;  1WE4 A;  1XX2 A;  4E3J A;  3GRJ A;  1XXM A;  4DE3 A;  3VP2 A;  3MKF A;  5CER A;  3G31 A;  5EVI D;  1W8Q A;  2ZQA A;  2ZC3 B;  3PBN A;  3Q7Z A;  4OLD A;  2XF3 A;  1C3B A;  5DVA A;  1GHM A;  4OP5 A;  5J8X A;  3IH9 A;  5KMW A;  1E4D A;  2G2W A;  4GNU A;  3HLC A;  4IVK A;  2XDM A;  4FH4 A;  3VP4 A;  3HLE A;  2X71 A;  5EVI C;  2OV5 A;  1DJA A;  1ZC2 A;  4S2O A;  5CRF A;  2EFU A;  5FQQ A;  1M40 A;  4ZTK A;  1KGE A;  5FQI A;  4S2L A;  3IWI A;  4XUZ A;  2EX9 A;  3O3V A;  3UPN A;  1SHV A;  4OOM A;  1GA9 A;  4D2O A;  4OPR A;  4ZAM A;  3UE0 A;  1BZA A;  4JXS A;  5AQB A;  3NY4 A;  3PBR A;  4RVA A;  2PU4 A;  5FI6 A;  3ZFZ A;  2Y2L A;  2PBY A;  2HDR A;  3C5A A;  3PBS A;  5EVI B;  1AXB A;  3ZDJ A;  2ZM8 A;  1NXY A;  3ZG9 B;  3I7J A;  1FCO A;  4IBR A;  1NYY A;  1E3U A;  1PYY A;  3P98 A;  1MXO A;  2WGV A;  1CI9 A;  2Y2J A;  4IBX A;  1HTZ A;  1K6S A;  5CGX A;  5DTK A;  2WAF A;  5F1F A;  3G30 A;  5D3O A;  4EBN A;  3PAE A;  4OP8 A;  1L0F A;  2WGI A;  4PM6 A;  2WKI A;  1KGG A;  1LI0 A;  2HP9 A;  2Q9M A;  3PBT A;  3N4I A;  4PM9 A;  4GZB A;  4KZA A;  1XP4 A;  3M2J A;  2G2U A;  2WK0 A;  3VFF A;  4E3N A;  4BQM A;  4MBF A;  4KQQ A;  1W8Y A;  2ZC7 A;  4X56 A;  2FFF B;  3V3R A;  4Y0T A;  1IEM A;  5EUA A;  3M6B A;  1U60 A;  1FOF A;  1IYO A;  2ZC6 B;  1I5Q A;  1NY0 A;  5I94 A;  1Q2P A;  1RCJ A;  2WAD A;  2J9P A;  4ZJ2 A;  2XFS A;  4Y0O A;  4JKT A;  2XD1 A;  5A93 A;  1WYB A;  2ZM2 A;  2XGN A;  1GA0 A;  3Q7V B;  3V50 A;  3A3D A;  3EQV A;  3FV7 A;  3O88 A;  3N8R A;  2PU2 A;  4BEN A;  2P74 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...