5HX9A

Crystal structure of beta-lactamase from burkholderia vietnamiensis
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
263
structure length
259
Chain Sequence
AHVARSELAALDKASNGRLGVAALDTSNGTRIAHHARERFPLCGTYAVVAAAAILARASLDASLLPRRILYRRYEVVAGSPVTESHVDTGMTIAQLCAAMLQSGDKGAGNLLMNVLGGPQAVTAFAHESGDTVFRLDRWEPELNRAAPGDERDTSTPVAMVDTLQRLLLGDTLQQAQRAQLTDWMTAATGIAAGVPPGSRVAAKRGTGGYGTTTEVAVVWPPSRAPIVLAVSFTQAQADAAARADVVASAARIATGALT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase
publication title Crystal structure of Beta-lactamase from Burkholderia vietnamiensis
rcsb
source organism Burkholderia vietnamiensis (strain g4 / lmg 22486)
total genus 82
structure length 259
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2016-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5hx9A00
4JBFA 3Q1FA 5FQJA 3VSLA 3GMWA 2C6WB 5GLBA 3ZG7B 1FQGA 5AQBA 3SH8A 1PWDA 2J9PA 3BEBA 4EUZA 1MWTA 5G18A 3AGDA 5EVIB 4EBNA 4ID4A 1M6KA 3IXHA 3FZCA 3V50A 1IYPA 4BD1A 2Y59A 3IF6A 4DXBA 4H8RA 4GNUA 4E3IA 4QJGA 1VQQA 3MZDA 1SCWA 2G2UA 2Y2HA 1PI4A 3EQUA 3NI9A 4OOMA 5FQMA 5FAOA 2ZQAA 1ERMA 3G31A 4K0XA 3WRTA 5A90A 1QMEA 4OOYA 2OV5A 2P74A 1LLBA 4KQOA 1BUEA 1JVJA 1RGZA 3IWQA 5FA7A 3OC2A 3UDFA 2IWBA 3PAGA 2FFFB 4WZ5A 1HVBA 4N9LA 2EX9A 4MEZA 3LEZA 4GZBA 5A93A 1RCJA 5E43A 1W8QA 2OLVA 1DJCA 1ONHA 3GRJA 1K6SA 4KZ6A 2RCXA 4HESA 3IQAA 3LO7A 2V1ZA 4UA9A 4OQGA 3W4OA 1GCEA 2VGKA 1CI9A 1PW8A 4C6YA 3VMAA 5HX9A 3SOIA 3ZVWA 2XF3A 2XFSA 2ZC5B 4B4XA 1TEMA 1TDGA 4OQHA 1G6AA 1YLJA 2WADA 5IHVA 3EQVA 3V3RA 3ZFZA 5KMWA 2PU2A 1IELA 5FI6A 4Y0UA 4RX2A 4S2LA 5E2EA 5HAIA 3BYDA 3MZEA 2XH9A 3BFCA 1W7FA 1E3UD 3FV7A 4UA6A 2Q9MA 1SHVA 2HP6A 1E3UA 3IWOA 2Y55A 4BL2A 2XLNA 5GLCA 1K54C 4DRTA 3WS4A 4NETA 3GSGA 3WS0A 2E8IA 1KE4A 3IHBA 4O7DA 4OVDA 5EVLA 1O7EA 1K25A 3HLGA 4QD4A 2Y91A 3ZHHA 2V20A 2EX6A 3S22A 2HP5A 3N7WA 4WEJA 5E2GA 5AQ7A 3BFDA 3G32A 4E6XA 3TOIA 4IEDA 4BD0A 5FDHA 3ZVTA 3UNWA 2BLSA 4EWFA 5HW3A 5DTKA 2XDMA 1EWZA 4X6TA 4KZ3A 1LI9A 1IKGA 1DY6A 1K6RA 1XA7A 1XPBA 2R9WA 3A3IA 5EOOA 5EUAA 1PZPA 4C3QA 4S2NC 4DF6A 3C4PA 4KG2A 1FCOA 1KGEA 4X53A 3UE3A 4L0LA 3HLWA 1IEMA 3W8KA 4BLMA 4OP5A 3HLDA 3OPRA 4WM9A 3MKFA 5CHMA 2B5RA 3ZG8B 3Q82A 2WYXA 2QMIA 1KVLA 3SH9A 4PM5A 2X01A 4FCFA 4B88A 4WELA 4DE0A 2XEPA 3G30A 4QHCA 3IXBA 3UDIA 3QNBA 3PBOA 3AGFA 3PBQA 4B4ZA 3BFFA 3BRMA 4RA7A 4FH2A 4OP8A 5GL9A 1NRFA 5DTSA 4E3NA 1MWSA 4KZ8A 4WZ4A 4D2OA 1YT4A 3HREA 3DW0A 4JPMA 3A3JA 4EBPA 3GV9A 3LY4A 1O07A 4CPKA 3GTCA 1FSWA 3NY4A 4DDSA 4FD8A 4ZAMA 4HBUA 3N4IA 5HAPA 5M19A 2Y4AA 1L0FA 2ZLYA 4IBXA 5EPHA 5FASA 3VP4A 2J9OA 3NCKA 4GB7A 5FI7A 1Z6FA 1K56D 5CHJA 2Y2QA 4ZDXA 1K56A 3IF6C 1YMSA 2XR0A 2X02A 3ZNYA 4R4RA 3VP3A 1LL5A 2XQZA 3VP1A 1YMXA 1XGIA 5TFQA 3C4OA 3FYZA 5GHXA 2ZC4B 1TDLA 2WUQA 3G2ZA 4Q8IA 1BLSA 4N9KA 5L2FA 1I2WA 1BZAA 4OQIA 4UAAA 4WZ5C 1N9BA 2DCFA 5FAPA 3HLBA 4P85A 1JWVA 4PMAA 3ITBA 2OSUA 5AQAA 3G34A 2XD5A 3SS4A 1E4DA 4HEFA 1NZUA 3ZG0A 5CGXA 5DF9A 3WWXA 1KVMA 4RYEA 4DXCA 4E6WA 1K4FA 4KQQA 4PM8A 1NXYA 1CEGA 2EFXA 3WS1A 2ZMAA 3OZHA 4LCMA 4R4SA 3V39A 5KSHA 1PWGA 1ES4A 1YM1A 4IBRA 4OPQA 5CGSA 3N8RA 3GR2A 3N8LA 3O86A 4FSFA 4R0QA 1W8YA 5J8XA 1JTGA 1FR6A 3N8SA 5I94A 3DTMA 4S2IA 1NJ4A 5FSRA 3HUNA 4ZJ2A 1YLPA 4ZJ3A 3Q7ZA 4S2OA 4S2JA 5CTMA 2JCHA 4WYYA 3BM6A 2WKEA 2UWXA 2EXBA 2FFYA 3M6HA 1PZOA 2V2FF 4EBLA 1SKFA 1ESUA 1NY0A 3G35A 3HLEA 3O87A 3ZCZA 4X55A 4RVAA 5HARA 3MBZA 2HDRA 5U47A 2H10A 5EECA 2IWCA 4OONA 1DJBA 3PBRA 1XA1A 1W5DA 2ZM2A 1IYQA 1XKZA 4NK3A 5F1FA 4JF6A 1MXOA 3AGEA 1PI5A 1H5XA 1ERQA 2PBYA 4LV1A 4UHUA 1MKIA 3VFHA 1GHIA 1PW1A 2XFTA 5DVAA 1FOFA 5F82A 3HL9A 3IHAA 5HL1A 2WGIA 1MPLA 1J9MA 3JYIA 1JTDA 2OLUA 3GVBA 3C5AA 2XK1A 4RX3A 1LL9A 3ZNTA 1K55A 3VP2A 2HDSA 5KSCA 3CJMA 4E3JA 2ZC3B 3MXRA 3OCLA 1CI8A 1YLYA 3I7JA 4QU3A 4OPZA 5FQIA 3UY6A 5CHUA 3O3VA 4E3KA 1NZOA 1TVFA 3VOYA 1ZG6A 4PPRA 5CRFA 5EVIC 1BLHA 2DRWA 4BJPA 3ISGA 1KDWA 4JXVA 3NBLA 3SS3A 4JXWA 5BOHA 1H8ZA 1SDNA 4JKTA 5CXWA 1KE3A 1ESIA 4C75A 4JF4A 3C7VA 4WMCD 4X56A 2WGWA 1XX2A 2WK0A 2HDQA 4MNRA 4KG5A 4ZTKA 3NDGA 2R9XA 4E3OA 2X71A 2VGJA 4OOLA 5CERA 1YLWA 2EX8A 2ZM8A 3WS5A 5EE8A 4XUZA 1CEFA 4KENB 2Y2NA 1U60A 4OPRA 4Y0OA 3Q07A 5GHYA 3BLMA 2JC7A 3UE1A 4JXGA 3A3DA 3MKEA 5FQQA 3S1YA 1PIOA 2H0TA 1AXBA 2WZXA 4S2KA 4S2NA 1S6RA 5CECA 4LENA 1L0GA 2Y2PA 2Y2GA 4MBFA 5GLDA 4GN2A 3HUOA 2J7VA 3A3EA 4S2PA 1GA9A 4BQMA 3SH7A 3M6BA 4FH4A 4KZ9A 1EROA 3IXDA 5FATA 4KZ5A 1W79A 3NDEA 3UPPA 3IT9A 4M3KA 3UPNA 1IYOA 2JE5A 3OPHA 5FQKA 4OLDA 5TR7A 4XUXA 3VFFA 1JWPA 1BSGA 2WGWB 3BFEA 3DWZA 5KZHA 1KDSA 1JWZA 3WRZA 2G2WA 4Z9QA 3VP0A 2ZJ9A 1XXMA 3LY3A 3NC8A 1E25A 1ZKJA 2PU4A 4R23A 4LV3A 3NIAA 2ZQCA 3HBRA 1OMEA 2Z2MB 4KZ4A 1MBLA 2WKHA 1RP5A 1N4OA 1L2SA 1K57A 1VM1A 2JBFA 3UDXA 3IF5A 3HUMA 1KGGA 4DDYA 4CJNA 4DE2A 4EV4A 3ZGAB 2I72A 2XD1A 3W4PA 4N1XA 5AQ9A 1GHPA 3P09A 4OKPA 1YQSA 4JLFA 1BLCA 1FSYA 1FCMA 3IXGA 3PBNA 5CEDA 5JYOA 4PM9A 1Y54A 2WAEA 3E2LA 2Y2OA 4WBGA 5A92A 4E3LA 5A91A 5GLAA 4YINA 2ZC7A 1C3BA 3C7UA 3PTEA 5HAQA 2H0YA 1ZC2A 4QY6A 4GD8A 4X68A 4XXRA 3TG9A 3HLCA 3BLSA 1M40A 3ZDJA 4OQ0A 3N6IA 2H5SA 3ZG9B 1HZOA 5FQ9A 2Y2IA 3SS5A 3PAEA 3UPOA 2A3UA 1LHYA 1WYCA 4KZBA 4DE3A 2Q9NA 3OPPA 3VOZA 2HP9A 1ONGA 3UO9A 5DTTA 1ES3A 3FKWA 4PM7A 2IWDA 4X69A 2Y2JA 2EFUA 1YLTA 5E2FA 1ES5A 2RL3A 4P87A 4KZ7A 4PM6A 3RXWA 3E2KA 1XP4A 5F83A 4LV0A 4GKUA 4JXSA 4MBHA 4A5RA 2WZZA 3G4PA 4KG6A 3V5MA 1IKIA 5JYPA 1ES2A 3RJUA 2XGNA 4Y0TA 2ZQ7A 3FWLA 1Q2PA 1K55C 4P0MA 4DE1A 3UN7A 3IF6B 1MWRA 1FR1A 3IH9A 5HFOA 5M1AA 3OCNA 3MXSA 2J8YA 4EQIA 4N1HA 3A3FA 4YFMA 2C5WB 1BTLA 3S4XA 2CC1A 2Y2KA 5TGFA 3MFDA 3Q7VA 3DWKA 4ZBEA 2WAFA 2Y2LA 4KQRA 4U0TA 1NYMA 3OPLA 3LCEA 2WKIA 1QMFA 1XGJA 4S2MA 2HPBA 2A49A 1G68A 4KZAA 4OPYA 2Z2LB 2GDNA 3IH8A 4P6BA 4GOGA 1MWUA 1SDEA 4U0XA 4UA7A 1NYYA 1IYSA 2ZD8A 2QPNA 2ZQDA 3FKVA 4QB8A 3WS2A 1BT5A 1CK3A 4N92A 1KE0A 1YLZA 1I2SA 1L0EA 1K54A 2P9VA 4QY5A 3Q81A 4OLGA 5F1GA 3HVFA 5EOEA 3VSKA 5DF7A 1MY8A 3ZG5A 1FCNA 4HBTA 3V3SA 2HDUA 4WMCA 1S0WA 3MZFA 4R3JA 5CTNA 4Y7PA 3IWIA 4BENA 3CMZA 1Q2QA 3UE0A 3B3XA 3O88A 5CGWA 1ALQA 3M2JA 3HLFA 3BFGA 1HD8A 2ZQ8A 1LI0A 3CZDA 3Q7VB 4MLLA 4IVIA 1PYYA 1WE4A 4R3BA 3ITAA 3QHYA 1BLPA 5EVID 1DJAA 5FI2A 4GDBA 2QZ6A 4LV2A 3P98A 4MBKA 5EVIA 5E2HA 1K4EA 1BULA 5DF8A 1L0DA 5M18A 4OH0A 4U3TA 4R1GA 1GA0A 3QNCA 1K38A 2ZM0A 1EI5A 2P9VB 4BL3A 4DKIA 4LCLA 2DNSA 1PWCA 3CG5A 3W4QA 1HTZA 3M2KA 5GHZA 1ZG4A 1K57C 3PBTA 3D4FA 4K0WA 1H8YA 3G2YA 2WGVA 1KGFA 4F94A 4GD6A 3BECA 3GQZA 4JF5A 4ZJ1A 3TSGA 4K91A 4WEKA 4GDNA 5D3OA 2ZQ9A 1GHMA 3PBSA 4IVKA 4E3MA 2ZC6B 1WYBA 1I5QA 5FAQA 2BG1A 2EXAA 3RXXA 2Y2MA 2EX2A 5CEBA 1RGYA
chains in the Genus database with same CATH superfamily
3Q1FA 3VSLA 1CF0A 3ZG7B 5AQBA 4I3IA 1PWDA 2HV1A 1Z09A 2J9PA 1MWTA 3L7HA 1M6KA 3IXHA 1EW0A 2Y59A 2JKGA 3QP6A 1VQQA 1PFLA 2G2UA 3MZDA 3NI9A 3EQUA 3T4JA 5FAOA 1ERMA 4K0XA 3VE4A 3WRTA 1QMEA 4OOYA 4LLOB 2WKQA 1OTEA 4KQOA 3IWQA 5FA7A 3UDFA 2YKHA 2FFFB 3MJQA 4NXBA 4GZBA 3KYQA 1RCJA 5E43A 4WUJA 1DJCA 2RCXA 3LUQA 4C6YA 2JN7A 4OQHA 1G6AA 1YLJA 2PU2A 4IUKA 3LR3A 4BBTA 2V8FA 1E3UD 3FV7A 2Q9MA 2Y79A 1E3UA 3MF0A 3NOTC 5K5BA 4RQ9A 2JKTI 1K54C 3WS4A 3WS0A 1O7EA 4L9EA 3HLGA 3B47A 1F5MA 3ZHHA 2V20A 2VJWA 2HP5A 3VOLA 5AQ7A 2GNXA 4IEDA 4BD0A 5FDHA 2BLSA 5HW3A 5DTKA 4JGQA 2XDMA 3LIFA 4KZ3A 4C3QA 5HWWA 1NLZA 1ACFA 5FEGA 4X53A 4L0LA 3QP4A 3OPRA 2NUPC 3MQOA 3MKFA 1GSVA 2QMIA 4JGPA 3SH9A 4PM5A 4DE0A 3G30A 3IXBA 4H6JB 4B4ZA 1N9OA 1NRJA 4FH2A 5HD3A 4D2OA 4LRYC 3A3JA 4G3WA 3GV9A 1S4RA 3KYZA 4HBUA 4ZAMA 3N4IA 2Y4AA 2PD7A 2WKRA 3O5YA 1Z6FA 1K56D 5CHJA 4Y3IA 1AWIA 1K56A 1YMSA 2V9AA 3ZNYA 1LL5A 3VP1A 2QJ7A 2K7SA 3HJKA 3C4OA 2XROA 4Q8IA 5L2FA 3NHQA 1BZAA 4OQIA 4WZ5C 2A24B 5FAPA 2XRNA 1JWVA 3GDIA 2W3GA 3ITBA 3G34A 3SS4A 1E4DA 2PR5A 1K4FA 4KQQA 2ZMAA 1G6OA 4FOFA 4IBRA 5CGSA 3O86A 4FSFA 4R0QA 1HLUP 4HNBA 2J3TC 4S2IA 3H82A 4ZJ2A 5AVFA 3Q7ZA 1PNEA 1OT9A 3BM6A 2VEAA 2EXBA 4CLCB 5L8MA 4IUHA 4BBVA 1SKFA 1ESUA 3HLEA 3C2WA 2XA7S 3OLOA 2HDRA 2W1RA 4OONA 2ZL1A 1XKZA 4DJ2A 2K2NA 3AGEA 1ERQA 2PBYA 4F3LB 1MKIA 1FOFA 3IHAA 3JYIA 1JTDA 2G7UA 2OLUA 3GVBA 1V9ZA 3C5AA 3JVUA 1P0ZA 3DAVA 4R70A 5KSCA 2ZC3B 2K31A 3I7JA 2QHKA 3K3DA 5CRFA 2VKSA 3KSFA 5EVIC 3UB7A 1T1CA 2ZOIA 3CHWP 4ETXA 3L9KA 3SS3A 2HGVA 2OAP1 1DRMA 2PHYA 2WGWA 4ZTKA 2X71A 4OOLA 2QJ5A 3WS5A 4XUZA 1VEUB 1CEFA 4KENB 1SZVA 4Y0OA 1PRQA 3GECA 4X1LA 3KSHA 3NOPC 4QPRA 2DMWA 1NWZA 2H0TA 2WZXA 4S2NA 4LENA 4ARZB 2O9AA 4GN2A 5GLDA 2J7VA 4FH4A 4KZ9A 1EROA 4B93A 5IS1A 3UPPA 4M3KA 1IYOA 5FQKA 2JKRM 3VFFA 1JWPA 3UB9A 5KZHA 3BY9A 2ZJ9A 4G3KA 2OAQ1 3LY3A 3NC8A 2PU4A 1ZKJA 4Y15A 4KZ4A 1N4OA 1VM1A 4PAUA 3UDXA 2JBFA 4ETZA 2I9VA 2XD1A 3DTEA 3LICA 1LSWA 4JLFA 1FSYA 1FCMA 1DP8A 4YINA 1C3BA 2W3FA 5HAQA 2D02A 3ZDJA 3ZG9B 2Y2IA 3SS5A 2A3UA 1N9LA 2HZ5A 3UMDA 4KZBA 4DE3A 3VOZA 1Y28A 5DTTA 4PM7A 2IWDA 4X69A 2RL3A 3RXWA 4LV0A 5EM1A 4GKUA 2WZZA 1IKIA 4BBUA 3RJUA 2W1TB 4Y0TA 1Q2PA 1K55C 4P0MA 3MXQA 1MWRA 5HFOA 5HWTA 2UV0E 2J8YA 3BWLA 4YFMA 4KUKA 2Y2KA 2M7VA 3DWKA 3OPLA 1D7EA 2WKIA 1QMFA 4HI4A 2HPBA 2Z2LB 4UA7A 2ZD8A 2W27A 1XJ3A 1CK3A 1L0EA 1K54A 2ZOHA 1MY8A 2VGLS 3V3SA 1NLYA 3IWIA 2B18A 1Q2QA 3B3XA 3O88A 1ALQA 1STZA 4GCZA 4MLLA 1PYYA 5AJGA 5FI2A 3P98A 2INWA 1L0DA 4MMNA 2OWJA 3T4SA 3QNCA 4NXGA 2GZAA 4BL3A 3T4LA 3T4KA 3CG5A 3W4QA 1HTZA 3M2KA 4YNRA 3D4FA 4K0WA 1H8YA 2WGVA 1KGFA 4GD6A 3JVVA 2PR6A 4GDNA 2ZQ9A 1GHMA 3PBSA 4IVKA 4KUOA 2BG1A 4JBFA 2O99A 2C6WB 5GLBA 3SH8A 4ID4A 4E04A 4L9GA 4QJGA 3T4OA 4L9FA 1SCWA 4GLQA 1PI4A 5FQMA 4OOMA 3LIBA 3MSHA 2OV5A 1RGZA 1OTBA 3PAGA 4WZ5A 4N9LA 1UWPX 2P7JA 1W8QA 2OLVA 4KZ6A 3GRJA 3W2ZA 1K6SA 4HESA 3W4OA 5F69A 1CI9A 1PW8A 3VMAA 5HX9A 3SOIA 2XFSA 4B4XA 1TDGA 4WN5A 5IHVA 1IELA 3HCYA 5HAIA 3BFCA 1W7FA 4O0PA 3IWOA 3F1OB 3IX4A 2XLNA 3EOIA 3HJIA 4DRTA 3R7WB 2W3HA 1P9RA 4NETA 4P6ZS 3F1PA 4O7DA 4CQHA 4OVDA 4QD4A 2EX6A 2VV6A 3N7WA 4E6XA 4JGOA 3EEHA 1DY6A 1OJGA 1H0MA 5EOOA 3UB8A 4S2NC 1T18A 4KG2A 1KGEA 1S66L 3UE3A 4Y2FA 2FZ0A 4OP5A 3HLDA 3ZG8B 2ZL1B 1KVLA 2ZMFA 2NUTC 3DTIA 2HJEA 3UDIA 1SKOB 3BFFA 3E98A 4OP8A 1MWSA 3IBJA 3SW1A 5FASA 2J9OA 5FI7A 1YSPA 1S1ZA 2X02A 4R4RA 2XQZA 2ZBBA 3FYZA 3MQQA 5GHXA 3A0SA 4Y13A 1TDLA 1H8MA 3G2ZA 1DP9A 3TE8A 2DCFA 4P85A 2OSUA 2JKRI 3ZG0A 5DF9A 4E6WA 1YPRA 4PM8A 1NXYA 2EFXA 3WS1A 3T12B 3V39A 5KSHA 4LRZE 3N8RA 3PYPA 5J8XA 3DBAA 1TS0A 3N8SA 5I94A 3DTMA 3JPUA 5FSRA 4EXOA 1YLPA 1LSXA 4WYYA 2WKEA 4GS9A 4EBLA 3CI6A 3O87A 5HARA 3MBZA 5U47A 2H10A 5EECA 2ZM2A 1W5DA 2JKFA 5F1FA 1PI5A 4LV1A 4UHUA 1PW1A 5DVAA 3MR0A 2WGIA 3LR0A 4RX3A 3ZNTA 1K55A 4HQAA 4E3JA 2P04A 1CI8A 1YLYA 3UY6A 1ZG6A 1F2KA 2DRWA 3ISGA 1KDWA 3F1NA 4JXVA 3NBLA 5BOHA 1SDNA 4JKTA 4C75A 4WMCD 4X56A 5TBMB 2PYRA 2HDQA 4KG5A 3NDGA 4E3OA 2VGJA 1YLWA 3BJNA 4EU0A 4MN6A 3KO6A 3T1QB 1U60A 4OPRA 3Q07A 3BLMA 4K08A 2JC7A 2XSSA 5FQQA 1XJ6A 4S2KA 1CJFA 1S6RA 4R6LA 3A3EA 4OLDA 5TR7A 1KDSA 1JWZA 4Q0HA 2IA2A 4LRXC 2G2WA 3VP0A 4O01A 1XXMA 4LV3A 3HBRA 2Z2MB 2OOLA 1J3WA 1L2SA 3IF5A 4CJNA 2QWSA 3ZGAB 5AQ9A 3P09A 1YQSA 3IXGA 3TJZC 1Y54A 2WAEA 4WBGA 4E3LA 1OTAA 4PKYG 5A91A 3C7UA 4QY6A 4XXRA 3N6IA 2H5SA 1XJ4A 5FQ9A 4CLCE 3UPOA 4I38A 1WYCA 3LIDA 3OPPA 2HP9A 1ES3A 5E2FA 3T1XA 2Y2JA 2EFUA 1YLTA 3OBFA 4P87A 3LR5A 2LB9A 4KZ7A 2VX8A 4UEYA 4MBHA 5FDSA 3G4PA 4EEUA 3LR4A 3CPTA 1VHMA 3FWLA 3UN7A 4M4XA 4MN7A 1FR1A 4EQIA 3A3FA 4HH3A 1BTLA 3MFDA 3Q7VA 4ZBEA 2WAFA 5HWVA 1V9YA 4FTXA 3LCEA 4KZAA 1YSQA 3IH8A 1H3QA 3WS2A 3QP1A 3D3OA 2GX5A 2P9VA 4QY5A 4OLGA 3VSKA 2BASA 2HDUA 3U4LP 5CTNA 4Y7PA 3CMZA 3UE0A 3MFXA 3BFGA 1W63M 3ITAA 3QP2A 3CLOA 5E2HA 5DF8A 4MDZA 4OH0A 1GA0A 1K38A 2ZM0A 1EI5A 1T19A 4YWZA 4LPZA 2Q0OA 3KX0X 2QYBA 4DKIA 3D72A 4LCLA 1PWCA 4I3AA 2PDRA 5DJUA 2XA7M 1ZG4A 1K57C 2L0WA 2VLGA 3BECA 3GQZA 4K91A 4EETB 5I5LA 4E3MA 2ZC6B 1WYBA 2Y2MA 3TW8A 4Q0JA 5EFWA 1FQGA 3EWKA 3BEBA 4EUZA 1FILA 5G18A 3AGDA 5EVIB 4EBNA 2Z6DA 4H8RA 4WLAA 4GNUA 4E3IA 3IS2B 4QWOA 4B9OA 1JNUA 4G3VA 2ZQAA 4FUWA 3G31A 5A90A 1LLBA 5HL6A 1BUEA 3OC2A 2IWBA 2VV8A 3EGXC 1HVBA 5CX7A 1OT6A 4MEZA 3LEZA 5A93A 2B95A 3G6OA 1ONHA 1VETB 3IQAA 3LO7A 2V1ZA 4NEED 4OQGA 1GCEA 2JKTM 1OTDA 2XF3A 1XJ2A 1TEMA 1K0KA 2Y8HA 3V3RA 5KMWA 3ZFZA 5FI6A 4Y0UA 4S2LA 1UWNX 2HP6A 2Y55A 3KSGA 1LL8A 2EWVA 3GSGA 4MCWA 2E8IA 3IHBA 1GSXA 5EVLA 1D1JA 2Y91A 1TS8A 3S22A 5IT5A 1ZHHB 5E2GA 3BFDA 4HP9A 2HF6A 3ZVTA 3UNWA 4EWFA 1LI9A 1IKGA 1XA7A 1PZPA 4DF6A 1FCOA 2OWHA 3HLWA 3FG8A 1MC0A 2L1MA 5CHMA 2B5RA 3Q82A 5HSQA 3C8CA 4WELA 4QHCA 3PBOA 3AGFA 2A24A 3BRMA 4RA7A 1NRFA 4E3NA 4KZ8A 3PXPA 3DW0A 3LY4A 3GTCA 1FSWA 4DDSA 4FD8A 3NOUC 5M19A 1IOUA 1L0FA 4R3AA 3F1NB 2Y2QA 4ZDXA 3IF6C 2XR0A 5F6AA 3VP3A 1MZUA 1XGIA 5TFQA 4GHIA 5HDCA 3OOVA 4X25A 4CLCD 2WUQA 1BLSA 3ZQ5A 4CLCA 1S4SA 1N9BA 1X0OA 1P9WA 2XD5A 1NZUA 5CGXA 3WWXA 4DXCA 1KVMA 4RYEA 2BTFP 4I5SA 3SZTA 4NG2A 4UQIS 4LCMA 4R4SA 4F3LA 1ES4A 3GR2A 3N8LA 3T50A 1W8YA 4PKYA 1NJ4A 3S7OA 3HUNA 4ZJ3A 4JGRA 4S2OA 5TJJA 4I3JA 3A0RA 2JCHA 1TS7A 2UWXA 1G5UA 2V2FF 2V8CA 3G35A 3ZCZA 1TF1A 4Z1WA 2Z6CA 2IWCA 4NK3A 1H5XA 1N9NA 3C30A 1GHIA 2XFTA 4EESA 2V0UA 2B02A 5HL1A 1VEUA 1J9MA 2XK1A 1LL9A 3H82B 3QP5A 4PHTA 3UMEA 3MXRA 3PHYA 4OPZA 3O3VA 4E3KA 1TVFA 3VOYA 4ARZA 1BLHA 1YKDA 2ACGA 5CXWA 4JF4A 5G4ZA 1YAXA 2R9XA 2O9CA 3TRCA 2EX8A 3ULFA 2Y2NA 1OPXA 3FPWA 4JXGA 3MKEA 3S1YA 1PIOA 3CUEA 1L0GA 4MBFA 3HUOA 4BQMA 3M6BA 3IXDA 5FATA 3NDEA 3IT9A 3OPHA 4XUXA 1G28A 1BSGA 2WGWB 3BFEA 3DWZA 3WRZA 3ICYA 4P6ZM 1E25A 4R23A 2ZQCA 1OMEA 1MBLA 2WKHA 1RP5A 1K57A 2EA9A 3HUMA 4DDYA 4DE2A 2R78A 4ESPA 4EV4A 5F68A 1XFNA 1VB6A 1GHPA 4OKPA 2QKPA 2W1TA 2O9BA 3PBNA 5CEDA 1XFQA 4PM9A 3E2LA 2Y2OA 2W3DA 3E0YA 2ZC7A 1ZC2A 3LYXA 4GD8A 4HJ4A 4X68A 2E8JA 3HLCA 3BLSA 1HZOA 2KOIA 3PAEA 4NXEA 2Q9NA 1ONGA 1FIKA 3UO9A 3S7QA 4IHQA 4R38A 3BQ8A 4PM6A 3E2KA 5F83A 4A5RA 4HY8A 4AFIA 4KG6A 3V5MA 5JYPA 1ES2A 2AVXA 2ZQ7A 2VV7A 5M1AA 2H28A 1BYWA 4N1HA 2CC1A 3S7PA 5TGFA 5C5KA 4U0TA 2Y2LA 1IFQA 4EERA 2A49A 1MWUA 1SDEA 2PAVP 2HJ9C 4N92A 1KE0A 1I2SA 3EEAA 5F1GA 3IBRA 3MQ0A 3CAXA 3ZG5A 1FCNA 2L4RA 4WMCA 2D01A 4BENA 3IX3A 5DFXA 5DKLA 2J80A 1A0KA 1LI0A 1P97A 1WE4A 4HJ3A 4R3BA 2W0NA 3QHYA 1BLPA 1DJAA 4GDBA 2QZ6A 4MBKA 5A8BA 1K4EA 4Y5FA 5M18A 5IU1A 4U3TA 3BW6A 5DFYA 4CLCC 2GJ3A 1OJ5A 3PBTA 3NJAA 3G2YA 3LGOA 5EVEA 3IX8A 5LBRA 4F94A 4ZJ1A 4JF5A 4WEKA 2V1BA 3RTYA 1GSWA 5HPIA 2VZWA 3VV4A 3H7WA 5FAQA 3RXXA 5CEBA 2EWWA 4KQDA 5FQJA 3GMWA 2YKFA 3CITA 5MC7A 2WKPA 3V50A 3FZCA 1IYPA 2W3EA 4BD1A 3IF6A 4DXBA 2JHEA 4LGWA 4II7A 2Y2HA 3F1OA 2P74A 1JVJA 3LFVA 2LB5A 3R7WA 3QP8A 2EX9A 4ZRRA 4XT2A 4HOIA 4UA9A 2VGKA 3K2NA 3ZVWA 2ZC5B 2WADA 4GHIB 3EQVA 5HDSA 4RX2A 5E2EA 3BYDA 3MZEA 2XH9A 4EQ1A 4UA6A 1SHVA 4BL2A 5GLCA 4DJ3A 2CMNA 3P7NA 1KE4A 1K25A 3FPVA 4IJGA 1SKOA 1MKMA 3BQAA 4WEJA 3U2AA 4DN0A 3G32A 3TOIA 5HPFA 2M1CA 4WL9A 1EWZA 4X6TA 5EUAA 1K6RA 3A3IA 3T1SA 1XPBA 2R9WA 1S67L 2KLIA 3CUEC 3C4PA 1S1YA 4BLMA 1IEMA 3W8KA 3UB5P 2VA0A 4WM9A 4YOFA 2WYXA 3F1PB 2X01A 4FCFA 4B88A 2XEPA 3QNBA 3PBQA 5GL9A 5DTSA 4WZ4A 1YT4A 3HREA 4JPMA 4EBPA 1O07A 4CPKA 3FC7A 1F98A 3NY4A 5HAPA 5EPHA 4IBXA 2ZLYA 3UE6A 3VP4A 3NCKA 4GB7A 1CQAA 3T4TA 3RFBA 4BMWA 1YMXA 3MS6A 2ZC4B 3LEQA 5J4EA 3E4QA 4N9KA 1I2WA 2M7UA 4UAAA 5FEFA 1D06A 3NECA 3HLBA 4PMAA 5AQAA 1ZTUA 4HEFA 3R4KA 3LI8A 3E4PA 5EV0A 1CEGA 3OZHA 4EEPA 3E4OA 1PWGA 1YM1A 4OPQA 1T1BA 1JTGA 1FR6A 5G4YA 3MMHA 4S2JA 5CTMA 3KSIA 2FFYA 3M6HA 1PZOA 3B42A 3D9YA 3B33A 1NY0A 4NXFA 4X55A 4RVAA 4MN5A 5TBMA 1DJBA 3PBRA 1XA1A 1IYQA 4JF6A 1MXOA 3VFHA 1WA9A 5F82A 3HL9A 4H6JA 5DKKA 1MPLA 5F5YA 4EUVA 2V0WA 3ZYTA 3VP2A 2HDSA 3CJMA 3OCLA 4QU3A 5FQIA 5CHUA 1NZOA 4Y17A 3PR6A 4PPRA 2MJ6A 4GS9B 4BJPA 2V1AA 4JXWA 1H8ZA 1KE3A 1ESIA 3LIEA 2PBDP 3C7VA 2KDKA 1XX2A 2WK0A 3CWFA 4MNRA 5CERA 2PYPA 2ZM8A 5EE8A 3LIAA 4ME4A 4HIAA 5GHYA 4EW7A 4GW9A 3UE1A 3A3DA 1AXBA 5CECA 2Y2PA 2Y2GA 5KIZA 4I39A 2PRFA 1GA9A 4S2PA 1F9IA 3SH7A 4KZ5A 1W79A 2J3WA 3UPNA 2JE5A 1KOUA 4X1MA 4Z9QA 5HDDA 2PD8A 3NIAA 3T4QA 2VK3A 4D60A 1KGGA 3RH8B 4GJ4A 1T1AA 2I72A 3W4PA 2VGLM 4N1XA 2FH5A 1BLCA 1Y4OA 5JYOA 3EGDC 4NKPA 5A92A 3LI9A 5GLAA 3PTEA 3S7NA 2H0YA 3C38A 3TG9A 1M40A 4OQ0A 1OTIA 1LHYA 3FKWA 3K3CA 5J3WA 1ES5A 1XP4A 3H7WB 4JXSA 2A2LA 5L10A 2XGNA 2ZMVA 4Q0IA 4BWIA 2PT7A 4DE1A 1W63Q 4HP4A 3DTKA 5EM0A 3IF6B 3IH9A 1DP6A 3OCNA 3MXSA 2J3TD 2C5WB 3NULA 4LFUA 3S4XA 5FL3A 4KQRA 3VE3A 1NYMA 4S2MA 1XGJA 5HZHA 1G68A 4OPYA 4P6BA 2GDNA 1UGUA 4GOGA 4U0XA 1NYYA 1IYSA 2ZQDA 2QPNA 4QB8A 3FKVA 1LT0A 1BT5A 4XT2B 1YLZA 3Q81A 3HVFA 5EOEA 5DF7A 4HBTA 4WF0A 3CPTB 1S0WA 3MZFA 4R3JA 3A0VA 2O0YA 3H9WA 4HH2A 5CGWA 2P08A 4UQIM 3KYEA 3M2JA 3HLFA 4HJ6A 1HD8A 2ZQ8A 3CZDA 3Q7VB 1L3LA 5L07A 4IVIA 3BY8A 3P01A 5EVID 4HHDA 4LV2A 5EVIA 5J7EA 1BULA 4R1GA 3IS2A 2P9VB 1TS6A 2DNSA 1LSVA 1ODVA 5GHZA 4O8GA 3T1RA 5L09A 5DJTA 3TSGA 5D3OA 5HD5A 3V67A 1TD5A 1I5QA 1VETA 2EXAA 5AVEA 3UB6A 4DMZA 2KX6A 2EX2A 1RGYA
chains in the Genus database with same CATH topology
4JBFA 3Q1FA 5FQJA 3VSLA 3GMWA 2C6WB 5GLBA 3ZG7B 1FQGA 5AQBA 3SH8A 1PWDA 2J9PA 3BEBA 4EUZA 1MWTA 5G18A 3AGDA 5EVIB 4EBNA 4ID4A 1M6KA 3IXHA 3FZCA 3V50A 1IYPA 4BD1A 2Y59A 3IF6A 4DXBA 4H8RA 4GNUA 4E3IA 4QJGA 1VQQA 3MZDA 1SCWA 2G2UA 2Y2HA 1PI4A 3EQUA 3NI9A 4OOMA 5FQMA 5FAOA 2ZQAA 1ERMA 3G31A 4K0XA 3WRTA 5A90A 1QMEA 4OOYA 2OV5A 2P74A 1LLBA 4KQOA 1BUEA 1JVJA 1RGZA 3IWQA 5FA7A 3OC2A 3UDFA 2IWBA 3PAGA 2FFFB 4WZ5A 1HVBA 4N9LA 2EX9A 4MEZA 3LEZA 4GZBA 5A93A 1RCJA 5E43A 1W8QA 2OLVA 1DJCA 1ONHA 3GRJA 1K6SA 4KZ6A 2RCXA 4HESA 3IQAA 3LO7A 2V1ZA 4UA9A 4OQGA 3W4OA 1GCEA 2VGKA 1CI9A 1PW8A 4C6YA 3VMAA 5HX9A 3SOIA 3ZVWA 2XF3A 2XFSA 2ZC5B 4B4XA 1TEMA 1TDGA 4OQHA 1G6AA 1YLJA 2WADA 5IHVA 3EQVA 3V3RA 3ZFZA 5KMWA 2PU2A 1IELA 5FI6A 4Y0UA 4RX2A 4S2LA 5E2EA 5HAIA 3BYDA 3MZEA 2XH9A 3BFCA 1W7FA 1E3UD 3FV7A 4UA6A 2Q9MA 1SHVA 2HP6A 1E3UA 3IWOA 2Y55A 4BL2A 2XLNA 5GLCA 1K54C 4DRTA 3WS4A 4NETA 3GSGA 3WS0A 2E8IA 1KE4A 3IHBA 4O7DA 4OVDA 5EVLA 1O7EA 1K25A 3HLGA 4QD4A 2Y91A 3ZHHA 2V20A 2EX6A 3S22A 2HP5A 3N7WA 4WEJA 5E2GA 5AQ7A 3BFDA 3G32A 4E6XA 3TOIA 4IEDA 4BD0A 5FDHA 3ZVTA 3UNWA 2BLSA 4EWFA 5HW3A 5DTKA 2XDMA 1EWZA 4X6TA 4KZ3A 1LI9A 1IKGA 1DY6A 1K6RA 1XA7A 1XPBA 2R9WA 3A3IA 5EOOA 5EUAA 1PZPA 4C3QA 4S2NC 4DF6A 3C4PA 4KG2A 1FCOA 1KGEA 4X53A 3UE3A 4L0LA 3HLWA 1IEMA 3W8KA 4BLMA 4OP5A 3HLDA 3OPRA 4WM9A 3MKFA 5CHMA 2B5RA 3ZG8B 3Q82A 2WYXA 2QMIA 1KVLA 3SH9A 4PM5A 2X01A 4FCFA 4B88A 4WELA 4DE0A 2XEPA 3G30A 4QHCA 3IXBA 3UDIA 3QNBA 3PBOA 3AGFA 3PBQA 4B4ZA 3BFFA 3BRMA 4RA7A 4FH2A 4OP8A 5GL9A 1NRFA 5DTSA 4E3NA 1MWSA 4KZ8A 4WZ4A 4D2OA 1YT4A 3HREA 3DW0A 4JPMA 3A3JA 4EBPA 3GV9A 3LY4A 1O07A 4CPKA 3GTCA 1FSWA 3NY4A 4DDSA 4FD8A 4ZAMA 4HBUA 3N4IA 5HAPA 5M19A 2Y4AA 1L0FA 2ZLYA 4IBXA 5EPHA 5FASA 3VP4A 2J9OA 3NCKA 4GB7A 5FI7A 1Z6FA 1K56D 5CHJA 2Y2QA 4ZDXA 1K56A 3IF6C 1YMSA 2XR0A 2X02A 3ZNYA 4R4RA 3VP3A 1LL5A 2XQZA 3VP1A 1YMXA 1XGIA 5TFQA 3C4OA 3FYZA 5GHXA 2ZC4B 1TDLA 2WUQA 3G2ZA 4Q8IA 1BLSA 4N9KA 5L2FA 1I2WA 1BZAA 4OQIA 4UAAA 4WZ5C 1N9BA 2DCFA 5FAPA 3HLBA 4P85A 1JWVA 4PMAA 3ITBA 2OSUA 5AQAA 3G34A 2XD5A 3SS4A 1E4DA 4HEFA 1NZUA 3ZG0A 5CGXA 5DF9A 3WWXA 1KVMA 4RYEA 4DXCA 4E6WA 1K4FA 4KQQA 4PM8A 1NXYA 1CEGA 2EFXA 3WS1A 2ZMAA 3OZHA 4LCMA 4R4SA 3V39A 5KSHA 1PWGA 1ES4A 1YM1A 4IBRA 4OPQA 5CGSA 3N8RA 3GR2A 3N8LA 3O86A 4FSFA 4R0QA 1W8YA 5J8XA 1JTGA 1FR6A 3N8SA 5I94A 3DTMA 4S2IA 1NJ4A 5FSRA 3HUNA 4ZJ2A 1YLPA 4ZJ3A 3Q7ZA 4S2OA 4S2JA 5CTMA 2JCHA 4WYYA 3BM6A 2WKEA 2UWXA 2EXBA 2FFYA 3M6HA 1PZOA 2V2FF 4EBLA 1SKFA 1ESUA 1NY0A 3G35A 3HLEA 3O87A 3ZCZA 4X55A 4RVAA 5HARA 3MBZA 2HDRA 5U47A 2H10A 5EECA 2IWCA 4OONA 1DJBA 3PBRA 1XA1A 1W5DA 2ZM2A 1IYQA 1XKZA 4NK3A 5F1FA 4JF6A 1MXOA 3AGEA 1PI5A 1H5XA 1ERQA 2PBYA 4LV1A 4UHUA 1MKIA 3VFHA 1GHIA 1PW1A 2XFTA 5DVAA 1FOFA 5F82A 3HL9A 3IHAA 5HL1A 2WGIA 1MPLA 1J9MA 3JYIA 1JTDA 2OLUA 3GVBA 3C5AA 2XK1A 4RX3A 1LL9A 3ZNTA 1K55A 3VP2A 2HDSA 5KSCA 3CJMA 4E3JA 2ZC3B 3MXRA 3OCLA 1CI8A 1YLYA 3I7JA 4QU3A 4OPZA 5FQIA 3UY6A 5CHUA 3O3VA 4E3KA 1NZOA 1TVFA 3VOYA 1ZG6A 4PPRA 5CRFA 5EVIC 1BLHA 2DRWA 4BJPA 3ISGA 1KDWA 4JXVA 3NBLA 3SS3A 4JXWA 5BOHA 1H8ZA 1SDNA 4JKTA 5CXWA 1KE3A 1ESIA 4C75A 4JF4A 3C7VA 4WMCD 4X56A 2WGWA 1XX2A 2WK0A 2HDQA 4MNRA 4KG5A 4ZTKA 3NDGA 2R9XA 4E3OA 2X71A 2VGJA 4OOLA 5CERA 1YLWA 2EX8A 2ZM8A 3WS5A 5EE8A 4XUZA 1CEFA 4KENB 2Y2NA 1U60A 4OPRA 4Y0OA 3Q07A 5GHYA 3BLMA 2JC7A 3UE1A 4JXGA 3A3DA 3MKEA 5FQQA 3S1YA 1PIOA 2H0TA 1AXBA 2WZXA 4S2KA 4S2NA 1S6RA 5CECA 4LENA 1L0GA 2Y2PA 2Y2GA 4MBFA 5GLDA 4GN2A 3HUOA 2J7VA 3A3EA 4S2PA 1GA9A 4BQMA 3SH7A 3M6BA 4FH4A 4KZ9A 1EROA 3IXDA 5FATA 4KZ5A 1W79A 3NDEA 3UPPA 3IT9A 4M3KA 3UPNA 1IYOA 2JE5A 3OPHA 5FQKA 4OLDA 5TR7A 4XUXA 3VFFA 1JWPA 1BSGA 2WGWB 3BFEA 3DWZA 5KZHA 1KDSA 1JWZA 3WRZA 2G2WA 4Z9QA 3VP0A 2ZJ9A 1XXMA 3LY3A 3NC8A 1E25A 1ZKJA 2PU4A 4R23A 4LV3A 3NIAA 2ZQCA 3HBRA 1OMEA 2Z2MB 4KZ4A 1MBLA 2WKHA 1RP5A 1N4OA 1L2SA 1K57A 1VM1A 2JBFA 3UDXA 3IF5A 3HUMA 1KGGA 4DDYA 4CJNA 4DE2A 4EV4A 3ZGAB 2I72A 2XD1A 3W4PA 4N1XA 5AQ9A 1GHPA 3P09A 4OKPA 1YQSA 4JLFA 1BLCA 1FSYA 1FCMA 3IXGA 3PBNA 5CEDA 5JYOA 4PM9A 1Y54A 2WAEA 3E2LA 2Y2OA 4WBGA 5A92A 4E3LA 5A91A 5GLAA 4YINA 2ZC7A 1C3BA 3C7UA 3PTEA 5HAQA 2H0YA 1ZC2A 4QY6A 4GD8A 4X68A 4XXRA 3TG9A 3HLCA 3BLSA 1M40A 3ZDJA 4OQ0A 3N6IA 2H5SA 3ZG9B 1HZOA 5FQ9A 2Y2IA 3SS5A 3PAEA 3UPOA 2A3UA 1LHYA 1WYCA 4KZBA 4DE3A 2Q9NA 3OPPA 3VOZA 2HP9A 1ONGA 3UO9A 5DTTA 1ES3A 3FKWA 4PM7A 2IWDA 4X69A 2Y2JA 2EFUA 1YLTA 5E2FA 1ES5A 2RL3A 4P87A 4KZ7A 4PM6A 3RXWA 3E2KA 1XP4A 5F83A 4LV0A 4GKUA 4JXSA 4MBHA 4A5RA 2WZZA 3G4PA 4KG6A 3V5MA 1IKIA 5JYPA 1ES2A 3RJUA 2XGNA 4Y0TA 2ZQ7A 3FWLA 1Q2PA 1K55C 4P0MA 4DE1A 3UN7A 3IF6B 1MWRA 1FR1A 3IH9A 5HFOA 5M1AA 3OCNA 3MXSA 2J8YA 4EQIA 4N1HA 3A3FA 4YFMA 2C5WB 1BTLA 3S4XA 2CC1A 2Y2KA 5TGFA 3MFDA 3Q7VA 3DWKA 4ZBEA 2WAFA 2Y2LA 4KQRA 4U0TA 1NYMA 3OPLA 3LCEA 2WKIA 1QMFA 1XGJA 4S2MA 2HPBA 2A49A 1G68A 4KZAA 4OPYA 2Z2LB 2GDNA 3IH8A 4P6BA 4GOGA 1MWUA 1SDEA 4U0XA 4UA7A 1NYYA 1IYSA 2ZD8A 2QPNA 2ZQDA 3FKVA 4QB8A 3WS2A 1BT5A 1CK3A 4N92A 1KE0A 1YLZA 1I2SA 1L0EA 1K54A 2P9VA 4QY5A 3Q81A 4OLGA 5F1GA 3HVFA 5EOEA 3VSKA 5DF7A 1MY8A 3ZG5A 1FCNA 4HBTA 3V3SA 2HDUA 4WMCA 1S0WA 3MZFA 4R3JA 5CTNA 4Y7PA 3IWIA 4BENA 3CMZA 1Q2QA 3UE0A 3B3XA 3O88A 5CGWA 1ALQA 3M2JA 3HLFA 3BFGA 1HD8A 2ZQ8A 1LI0A 3CZDA 3Q7VB 4MLLA 4IVIA 1PYYA 1WE4A 4R3BA 3ITAA 3QHYA 1BLPA 5EVID 1DJAA 5FI2A 4GDBA 2QZ6A 4LV2A 3P98A 4MBKA 5EVIA 5E2HA 1K4EA 1BULA 5DF8A 1L0DA 5M18A 4OH0A 4U3TA 4R1GA 1GA0A 3QNCA 1K38A 2ZM0A 1EI5A 2P9VB 4BL3A 4DKIA 4LCLA 2DNSA 1PWCA 3CG5A 3W4QA 1HTZA 3M2KA 5GHZA 1ZG4A 1K57C 3PBTA 3D4FA 4K0WA 1H8YA 3G2YA 2WGVA 1KGFA 4F94A 4GD6A 3BECA 3GQZA 4JF5A 4ZJ1A 3TSGA 4K91A 4WEKA 4GDNA 5D3OA 2ZQ9A 1GHMA 3PBSA 4IVKA 4E3MA 2ZC6B 1WYBA 1I5QA 5FAQA 2BG1A 2EXAA 3RXXA 2Y2MA 2EX2A 5CEBA 1RGYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JBF A;  3Q1F A;  5FQJ A;  3VSL A;  3GMW A;  2C6W B;  5GLB A;  3ZG7 B;  1FQG A;  5AQB A;  3SH8 A;  1PWD A;  2J9P A;  3BEB A;  4EUZ A;  1MWT A;  5G18 A;  3AGD A;  5EVI B;  4EBN A;  4ID4 A;  1M6K A;  3IXH A;  3FZC A;  3V50 A;  1IYP A;  4BD1 A;  2Y59 A;  3IF6 A;  4DXB A;  4H8R A;  4GNU A;  4E3I A;  4QJG A;  1VQQ A;  3MZD A;  1SCW A;  2G2U A;  2Y2H A;  1PI4 A;  3EQU A;  3NI9 A;  4OOM A;  5FQM A;  5FAO A;  2ZQA A;  1ERM A;  3G31 A;  4K0X A;  3WRT A;  5A90 A;  1QME A;  4OOY A;  2OV5 A;  2P74 A;  1LLB A;  4KQO A;  1BUE A;  1JVJ A;  1RGZ A;  3IWQ A;  5FA7 A;  3OC2 A;  3UDF A;  2IWB A;  3PAG A;  2FFF B;  4WZ5 A;  1HVB A;  4N9L A;  2EX9 A;  4MEZ A;  3LEZ A;  4GZB A;  5A93 A;  1RCJ A;  5E43 A;  1W8Q A;  2OLV A;  1DJC A;  1ONH A;  3GRJ A;  1K6S A;  4KZ6 A;  2RCX A;  4HES A;  3IQA A;  3LO7 A;  2V1Z A;  4UA9 A;  4OQG A;  3W4O A;  1GCE A;  2VGK A;  1CI9 A;  1PW8 A;  4C6Y A;  3VMA A;  5HX9 A;  3SOI A;  3ZVW A;  2XF3 A;  2XFS A;  2ZC5 B;  4B4X A;  1TEM A;  1TDG A;  4OQH A;  1G6A A;  1YLJ A;  2WAD A;  5IHV A;  3EQV A;  3V3R A;  3ZFZ A;  5KMW A;  2PU2 A;  1IEL A;  5FI6 A;  4Y0U A;  4RX2 A;  4S2L A;  5E2E A;  5HAI A;  3BYD A;  3MZE A;  2XH9 A;  3BFC A;  1W7F A;  1E3U D;  3FV7 A;  4UA6 A;  2Q9M A;  1SHV A;  2HP6 A;  1E3U A;  3IWO A;  2Y55 A;  4BL2 A;  2XLN A;  5GLC A;  1K54 C;  4DRT A;  3WS4 A;  4NET A;  3GSG A;  3WS0 A;  2E8I A;  1KE4 A;  3IHB A;  4O7D A;  4OVD A;  5EVL A;  1O7E A;  1K25 A;  3HLG A;  4QD4 A;  2Y91 A;  3ZHH A;  2V20 A;  2EX6 A;  3S22 A;  2HP5 A;  3N7W A;  4WEJ A;  5E2G A;  5AQ7 A;  3BFD A;  3G32 A;  4E6X A;  3TOI A;  4IED A;  4BD0 A;  5FDH A;  3ZVT A;  3UNW A;  2BLS A;  4EWF A;  5HW3 A;  5DTK A;  2XDM A;  1EWZ A;  4X6T A;  4KZ3 A;  1LI9 A;  1IKG A;  1DY6 A;  1K6R A;  1XA7 A;  1XPB A;  2R9W A;  3A3I A;  5EOO A;  5EUA A;  1PZP A;  4C3Q A;  4S2N C;  4DF6 A;  3C4P A;  4KG2 A;  1FCO A;  1KGE A;  4X53 A;  3UE3 A;  4L0L A;  3HLW A;  1IEM A;  3W8K A;  4BLM A;  4OP5 A;  3HLD A;  3OPR A;  4WM9 A;  3MKF A;  5CHM A;  2B5R A;  3ZG8 B;  3Q82 A;  2WYX A;  2QMI A;  1KVL A;  3SH9 A;  4PM5 A;  2X01 A;  4FCF A;  4B88 A;  4WEL A;  4DE0 A;  2XEP A;  3G30 A;  4QHC A;  3IXB A;  3UDI A;  3QNB A;  3PBO A;  3AGF A;  3PBQ A;  4B4Z A;  3BFF A;  3BRM A;  4RA7 A;  4FH2 A;  4OP8 A;  5GL9 A;  1NRF A;  5DTS A;  4E3N A;  1MWS A;  4KZ8 A;  4WZ4 A;  4D2O A;  1YT4 A;  3HRE A;  3DW0 A;  4JPM A;  3A3J A;  4EBP A;  3GV9 A;  3LY4 A;  1O07 A;  4CPK A;  3GTC A;  1FSW A;  3NY4 A;  4DDS A;  4FD8 A;  4ZAM A;  4HBU A;  3N4I A;  5HAP A;  5M19 A;  2Y4A A;  1L0F A;  2ZLY A;  4IBX A;  5EPH A;  5FAS A;  3VP4 A;  2J9O A;  3NCK A;  4GB7 A;  5FI7 A;  1Z6F A;  1K56 D;  5CHJ A;  2Y2Q A;  4ZDX A;  1K56 A;  3IF6 C;  1YMS A;  2XR0 A;  2X02 A;  3ZNY A;  4R4R A;  3VP3 A;  1LL5 A;  2XQZ A;  3VP1 A;  1YMX A;  1XGI A;  5TFQ A;  3C4O A;  3FYZ A;  5GHX A;  2ZC4 B;  1TDL A;  2WUQ A;  3G2Z A;  4Q8I A;  1BLS A;  4N9K A;  5L2F A;  1I2W A;  1BZA A;  4OQI A;  4UAA A;  4WZ5 C;  1N9B A;  2DCF A;  5FAP A;  3HLB A;  4P85 A;  1JWV A;  4PMA A;  3ITB A;  2OSU A;  5AQA A;  3G34 A;  2XD5 A;  3SS4 A;  1E4D A;  4HEF A;  1NZU A;  3ZG0 A;  5CGX A;  5DF9 A;  3WWX A;  1KVM A;  4RYE A;  4DXC A;  4E6W A;  1K4F A;  4KQQ A;  4PM8 A;  1NXY A;  1CEG A;  2EFX A;  3WS1 A;  2ZMA A;  3OZH A;  4LCM A;  4R4S A;  3V39 A;  5KSH A;  1PWG A;  1ES4 A;  1YM1 A;  4IBR A;  4OPQ A;  5CGS A;  3N8R A;  3GR2 A;  3N8L A;  3O86 A;  4FSF A;  4R0Q A;  1W8Y A;  5J8X A;  1JTG A;  1FR6 A;  3N8S A;  5I94 A;  3DTM A;  4S2I A;  1NJ4 A;  5FSR A;  3HUN A;  4ZJ2 A;  1YLP A;  4ZJ3 A;  3Q7Z A;  4S2O A;  4S2J A;  5CTM A;  2JCH A;  4WYY A;  3BM6 A;  2WKE A;  2UWX A;  2EXB A;  2FFY A;  3M6H A;  1PZO A;  2V2F F;  4EBL A;  1SKF A;  1ESU A;  1NY0 A;  3G35 A;  3HLE A;  3O87 A;  3ZCZ A;  4X55 A;  4RVA A;  5HAR A;  3MBZ A;  2HDR A;  5U47 A;  2H10 A;  5EEC A;  2IWC A;  4OON A;  1DJB A;  3PBR A;  1XA1 A;  1W5D A;  2ZM2 A;  1IYQ A;  1XKZ A;  4NK3 A;  5F1F A;  4JF6 A;  1MXO A;  3AGE A;  1PI5 A;  1H5X A;  1ERQ A;  2PBY A;  4LV1 A;  4UHU A;  1MKI A;  3VFH A;  1GHI A;  1PW1 A;  2XFT A;  5DVA A;  1FOF A;  5F82 A;  3HL9 A;  3IHA A;  5HL1 A;  2WGI A;  1MPL A;  1J9M A;  3JYI A;  1JTD A;  2OLU A;  3GVB A;  3C5A A;  2XK1 A;  4RX3 A;  1LL9 A;  3ZNT A;  1K55 A;  3VP2 A;  2HDS A;  5KSC A;  3CJM A;  4E3J A;  2ZC3 B;  3MXR A;  3OCL A;  1CI8 A;  1YLY A;  3I7J A;  4QU3 A;  4OPZ A;  5FQI A;  3UY6 A;  5CHU A;  3O3V A;  4E3K A;  1NZO A;  1TVF A;  3VOY A;  1ZG6 A;  4PPR A;  5CRF A;  5EVI C;  1BLH A;  2DRW A;  4BJP A;  3ISG A;  1KDW A;  4JXV A;  3NBL A;  3SS3 A;  4JXW A;  5BOH A;  1H8Z A;  1SDN A;  4JKT A;  5CXW A;  1KE3 A;  1ESI A;  4C75 A;  4JF4 A;  3C7V A;  4WMC D;  4X56 A;  2WGW A;  1XX2 A;  2WK0 A;  2HDQ A;  4MNR A;  4KG5 A;  4ZTK A;  3NDG A;  2R9X A;  4E3O A;  2X71 A;  2VGJ A;  4OOL A;  5CER A;  1YLW A;  2EX8 A;  2ZM8 A;  3WS5 A;  5EE8 A;  4XUZ A;  1CEF A;  4KEN B;  2Y2N A;  1U60 A;  4OPR A;  4Y0O A;  3Q07 A;  5GHY A;  3BLM A;  2JC7 A;  3UE1 A;  4JXG A;  3A3D A;  3MKE A;  5FQQ A;  3S1Y A;  1PIO A;  2H0T A;  1AXB A;  2WZX A;  4S2K A;  4S2N A;  1S6R A;  5CEC A;  4LEN A;  1L0G A;  2Y2P A;  2Y2G A;  4MBF A;  5GLD A;  4GN2 A;  3HUO A;  2J7V A;  3A3E A;  4S2P A;  1GA9 A;  4BQM A;  3SH7 A;  3M6B A;  4FH4 A;  4KZ9 A;  1ERO A;  3IXD A;  5FAT A;  4KZ5 A;  1W79 A;  3NDE A;  3UPP A;  3IT9 A;  4M3K A;  3UPN A;  1IYO A;  2JE5 A;  3OPH A;  5FQK A;  4OLD A;  5TR7 A;  4XUX A;  3VFF A;  1JWP A;  1BSG A;  2WGW B;  3BFE A;  3DWZ A;  5KZH A;  1KDS A;  1JWZ A;  3WRZ A;  2G2W A;  4Z9Q A;  3VP0 A;  2ZJ9 A;  1XXM A;  3LY3 A;  3NC8 A;  1E25 A;  1ZKJ A;  2PU4 A;  4R23 A;  4LV3 A;  3NIA A;  2ZQC A;  3HBR A;  1OME A;  2Z2M B;  4KZ4 A;  1MBL A;  2WKH A;  1RP5 A;  1N4O A;  1L2S A;  1K57 A;  1VM1 A;  2JBF A;  3UDX A;  3IF5 A;  3HUM A;  1KGG A;  4DDY A;  4CJN A;  4DE2 A;  4EV4 A;  3ZGA B;  2I72 A;  2XD1 A;  3W4P A;  4N1X A;  5AQ9 A;  1GHP A;  3P09 A;  4OKP A;  1YQS A;  4JLF A;  1BLC A;  1FSY A;  1FCM A;  3IXG A;  3PBN A;  5CED A;  5JYO A;  4PM9 A;  1Y54 A;  2WAE A;  3E2L A;  2Y2O A;  4WBG A;  5A92 A;  4E3L A;  5A91 A;  5GLA A;  4YIN A;  2ZC7 A;  1C3B A;  3C7U A;  3PTE A;  5HAQ A;  2H0Y A;  1ZC2 A;  4QY6 A;  4GD8 A;  4X68 A;  4XXR A;  3TG9 A;  3HLC A;  3BLS A;  1M40 A;  3ZDJ A;  4OQ0 A;  3N6I A;  2H5S A;  3ZG9 B;  1HZO A;  5FQ9 A;  2Y2I A;  3SS5 A;  3PAE A;  3UPO A;  2A3U A;  1LHY A;  1WYC A;  4KZB A;  4DE3 A;  2Q9N A;  3OPP A;  3VOZ A;  2HP9 A;  1ONG A;  3UO9 A;  5DTT A;  1ES3 A;  3FKW A;  4PM7 A;  2IWD A;  4X69 A;  2Y2J A;  2EFU A;  1YLT A;  5E2F A;  1ES5 A;  2RL3 A;  4P87 A;  4KZ7 A;  4PM6 A;  3RXW A;  3E2K A;  1XP4 A;  5F83 A;  4LV0 A;  4GKU A;  4JXS A;  4MBH A;  4A5R A;  2WZZ A;  3G4P A;  4KG6 A;  3V5M A;  1IKI A;  5JYP A;  1ES2 A;  3RJU A;  2XGN A;  4Y0T A;  2ZQ7 A;  3FWL A;  1Q2P A;  1K55 C;  4P0M A;  4DE1 A;  3UN7 A;  3IF6 B;  1MWR A;  1FR1 A;  3IH9 A;  5HFO A;  5M1A A;  3OCN A;  3MXS A;  2J8Y A;  4EQI A;  4N1H A;  3A3F A;  4YFM A;  2C5W B;  1BTL A;  3S4X A;  2CC1 A;  2Y2K A;  5TGF A;  3MFD A;  3Q7V A;  3DWK A;  4ZBE A;  2WAF A;  2Y2L A;  4KQR A;  4U0T A;  1NYM A;  3OPL A;  3LCE A;  2WKI A;  1QMF A;  1XGJ A;  4S2M A;  2HPB A;  2A49 A;  1G68 A;  4KZA A;  4OPY A;  2Z2L B;  2GDN A;  3IH8 A;  4P6B A;  4GOG A;  1MWU A;  1SDE A;  4U0X A;  4UA7 A;  1NYY A;  1IYS A;  2ZD8 A;  2QPN A;  2ZQD A;  3FKV A;  4QB8 A;  3WS2 A;  1BT5 A;  1CK3 A;  4N92 A;  1KE0 A;  1YLZ A;  1I2S A;  1L0E A;  1K54 A;  2P9V A;  4QY5 A;  3Q81 A;  4OLG A;  5F1G A;  3HVF A;  5EOE A;  3VSK A;  5DF7 A;  1MY8 A;  3ZG5 A;  1FCN A;  4HBT A;  3V3S A;  2HDU A;  4WMC A;  1S0W A;  3MZF A;  4R3J A;  5CTN A;  4Y7P A;  3IWI A;  4BEN A;  3CMZ A;  1Q2Q A;  3UE0 A;  3B3X A;  3O88 A;  5CGW A;  1ALQ A;  3M2J A;  3HLF A;  3BFG A;  1HD8 A;  2ZQ8 A;  1LI0 A;  3CZD A;  3Q7V B;  4MLL A;  4IVI A;  1PYY A;  1WE4 A;  4R3B A;  3ITA A;  3QHY A;  1BLP A;  5EVI D;  1DJA A;  5FI2 A;  4GDB A;  2QZ6 A;  4LV2 A;  3P98 A;  4MBK A;  5EVI A;  5E2H A;  1K4E A;  1BUL A;  5DF8 A;  1L0D A;  5M18 A;  4OH0 A;  4U3T A;  4R1G A;  1GA0 A;  3QNC A;  1K38 A;  2ZM0 A;  1EI5 A;  2P9V B;  4BL3 A;  4DKI A;  4LCL A;  2DNS A;  1PWC A;  3CG5 A;  3W4Q A;  1HTZ A;  3M2K A;  5GHZ A;  1ZG4 A;  1K57 C;  3PBT A;  3D4F A;  4K0W A;  1H8Y A;  3G2Y A;  2WGV A;  1KGF A;  4F94 A;  4GD6 A;  3BEC A;  3GQZ A;  4JF5 A;  4ZJ1 A;  3TSG A;  4K91 A;  4WEK A;  4GDN A;  5D3O A;  2ZQ9 A;  1GHM A;  3PBS A;  4IVK A;  4E3M A;  2ZC6 B;  1WYB A;  1I5Q A;  5FAQ A;  2BG1 A;  2EXA A;  3RXX A;  2Y2M A;  2EX2 A;  5CEB A;  1RGY A; 
#chains in the Genus database with same CATH topology
 3Q1F A;  3VSL A;  1CF0 A;  3ZG7 B;  5AQB A;  4I3I A;  1PWD A;  2HV1 A;  1Z09 A;  2J9P A;  1MWT A;  3L7H A;  1M6K A;  3IXH A;  1EW0 A;  2Y59 A;  2JKG A;  3QP6 A;  1VQQ A;  1PFL A;  2G2U A;  3MZD A;  3NI9 A;  3EQU A;  3T4J A;  5FAO A;  1ERM A;  4K0X A;  3VE4 A;  3WRT A;  1QME A;  4OOY A;  4LLO B;  2WKQ A;  1OTE A;  4KQO A;  3IWQ A;  5FA7 A;  3UDF A;  2YKH A;  2FFF B;  3MJQ A;  4NXB A;  4GZB A;  3KYQ A;  1RCJ A;  5E43 A;  4WUJ A;  1DJC A;  2RCX A;  3LUQ A;  4C6Y A;  2JN7 A;  4OQH A;  1G6A A;  1YLJ A;  2PU2 A;  4IUK A;  3LR3 A;  4BBT A;  2V8F A;  1E3U D;  3FV7 A;  2Q9M A;  2Y79 A;  1E3U A;  3MF0 A;  3NOT C;  5K5B A;  4RQ9 A;  2JKT I;  1K54 C;  3WS4 A;  3WS0 A;  1O7E A;  4L9E A;  3HLG A;  3B47 A;  1F5M A;  3ZHH A;  2V20 A;  2VJW A;  2HP5 A;  3VOL A;  5AQ7 A;  2GNX A;  4IED A;  4BD0 A;  5FDH A;  2BLS A;  5HW3 A;  5DTK A;  4JGQ A;  2XDM A;  3LIF A;  4KZ3 A;  4C3Q A;  5HWW A;  1NLZ A;  1ACF A;  5FEG A;  4X53 A;  4L0L A;  3QP4 A;  3OPR A;  2NUP C;  3MQO A;  3MKF A;  1GSV A;  2QMI A;  4JGP A;  3SH9 A;  4PM5 A;  4DE0 A;  3G30 A;  3IXB A;  4H6J B;  4B4Z A;  1N9O A;  1NRJ A;  4FH2 A;  5HD3 A;  4D2O A;  4LRY C;  3A3J A;  4G3W A;  3GV9 A;  1S4R A;  3KYZ A;  4HBU A;  4ZAM A;  3N4I A;  2Y4A A;  2PD7 A;  2WKR A;  3O5Y A;  1Z6F A;  1K56 D;  5CHJ A;  4Y3I A;  1AWI A;  1K56 A;  1YMS A;  2V9A A;  3ZNY A;  1LL5 A;  3VP1 A;  2QJ7 A;  2K7S A;  3HJK A;  3C4O A;  2XRO A;  4Q8I A;  5L2F A;  3NHQ A;  1BZA A;  4OQI A;  4WZ5 C;  2A24 B;  5FAP A;  2XRN A;  1JWV A;  3GDI A;  2W3G A;  3ITB A;  3G34 A;  3SS4 A;  1E4D A;  2PR5 A;  1K4F A;  4KQQ A;  2ZMA A;  1G6O A;  4FOF A;  4IBR A;  5CGS A;  3O86 A;  4FSF A;  4R0Q A;  1HLU P;  4HNB A;  2J3T C;  4S2I A;  3H82 A;  4ZJ2 A;  5AVF A;  3Q7Z A;  1PNE A;  1OT9 A;  3BM6 A;  2VEA A;  2EXB A;  4CLC B;  5L8M A;  4IUH A;  4BBV A;  1SKF A;  1ESU A;  3HLE A;  3C2W A;  2XA7 S;  3OLO A;  2HDR A;  2W1R A;  4OON A;  2ZL1 A;  1XKZ A;  4DJ2 A;  2K2N A;  3AGE A;  1ERQ A;  2PBY A;  4F3L B;  1MKI A;  1FOF A;  3IHA A;  3JYI A;  1JTD A;  2G7U A;  2OLU A;  3GVB A;  1V9Z A;  3C5A A;  3JVU A;  1P0Z A;  3DAV A;  4R70 A;  5KSC A;  2ZC3 B;  2K31 A;  3I7J A;  2QHK A;  3K3D A;  5CRF A;  2VKS A;  3KSF A;  5EVI C;  3UB7 A;  1T1C A;  2ZOI A;  3CHW P;  4ETX A;  3L9K A;  3SS3 A;  2HGV A;  2OAP 1;  1DRM A;  2PHY A;  2WGW A;  4ZTK A;  2X71 A;  4OOL A;  2QJ5 A;  3WS5 A;  4XUZ A;  1VEU B;  1CEF A;  4KEN B;  1SZV A;  4Y0O A;  1PRQ A;  3GEC A;  4X1L A;  3KSH A;  3NOP C;  4QPR A;  2DMW A;  1NWZ A;  2H0T A;  2WZX A;  4S2N A;  4LEN A;  4ARZ B;  2O9A A;  4GN2 A;  5GLD A;  2J7V A;  4FH4 A;  4KZ9 A;  1ERO A;  4B93 A;  5IS1 A;  3UPP A;  4M3K A;  1IYO A;  5FQK A;  2JKR M;  3VFF A;  1JWP A;  3UB9 A;  5KZH A;  3BY9 A;  2ZJ9 A;  4G3K A;  2OAQ 1;  3LY3 A;  3NC8 A;  2PU4 A;  1ZKJ A;  4Y15 A;  4KZ4 A;  1N4O A;  1VM1 A;  4PAU A;  3UDX A;  2JBF A;  4ETZ A;  2I9V A;  2XD1 A;  3DTE A;  3LIC A;  1LSW A;  4JLF A;  1FSY A;  1FCM A;  1DP8 A;  4YIN A;  1C3B A;  2W3F A;  5HAQ A;  2D02 A;  3ZDJ A;  3ZG9 B;  2Y2I A;  3SS5 A;  2A3U A;  1N9L A;  2HZ5 A;  3UMD A;  4KZB A;  4DE3 A;  3VOZ A;  1Y28 A;  5DTT A;  4PM7 A;  2IWD A;  4X69 A;  2RL3 A;  3RXW A;  4LV0 A;  5EM1 A;  4GKU A;  2WZZ A;  1IKI A;  4BBU A;  3RJU A;  2W1T B;  4Y0T A;  1Q2P A;  1K55 C;  4P0M A;  3MXQ A;  1MWR A;  5HFO A;  5HWT A;  2UV0 E;  2J8Y A;  3BWL A;  4YFM A;  4KUK A;  2Y2K A;  2M7V A;  3DWK A;  3OPL A;  1D7E A;  2WKI A;  1QMF A;  4HI4 A;  2HPB A;  2Z2L B;  4UA7 A;  2ZD8 A;  2W27 A;  1XJ3 A;  1CK3 A;  1L0E A;  1K54 A;  2ZOH A;  1MY8 A;  2VGL S;  3V3S A;  1NLY A;  3IWI A;  2B18 A;  1Q2Q A;  3B3X A;  3O88 A;  1ALQ A;  1STZ A;  4GCZ A;  4MLL A;  1PYY A;  5AJG A;  5FI2 A;  3P98 A;  2INW A;  1L0D A;  4MMN A;  2OWJ A;  3T4S A;  3QNC A;  4NXG A;  2GZA A;  4BL3 A;  3T4L A;  3T4K A;  3CG5 A;  3W4Q A;  1HTZ A;  3M2K A;  4YNR A;  3D4F A;  4K0W A;  1H8Y A;  2WGV A;  1KGF A;  4GD6 A;  3JVV A;  2PR6 A;  4GDN A;  2ZQ9 A;  1GHM A;  3PBS A;  4IVK A;  4KUO A;  2BG1 A;  4JBF A;  2O99 A;  2C6W B;  5GLB A;  3SH8 A;  4ID4 A;  4E04 A;  4L9G A;  4QJG A;  3T4O A;  4L9F A;  1SCW A;  4GLQ A;  1PI4 A;  5FQM A;  4OOM A;  3LIB A;  3MSH A;  2OV5 A;  1RGZ A;  1OTB A;  3PAG A;  4WZ5 A;  4N9L A;  1UWP X;  2P7J A;  1W8Q A;  2OLV A;  4KZ6 A;  3GRJ A;  3W2Z A;  1K6S A;  4HES A;  3W4O A;  5F69 A;  1CI9 A;  1PW8 A;  3VMA A;  5HX9 A;  3SOI A;  2XFS A;  4B4X A;  1TDG A;  4WN5 A;  5IHV A;  1IEL A;  3HCY A;  5HAI A;  3BFC A;  1W7F A;  4O0P A;  3IWO A;  3F1O B;  3IX4 A;  2XLN A;  3EOI A;  3HJI A;  4DRT A;  3R7W B;  2W3H A;  1P9R A;  4NET A;  4P6Z S;  3F1P A;  4O7D A;  4CQH A;  4OVD A;  4QD4 A;  2EX6 A;  2VV6 A;  3N7W A;  4E6X A;  4JGO A;  3EEH A;  1DY6 A;  1OJG A;  1H0M A;  5EOO A;  3UB8 A;  4S2N C;  1T18 A;  4KG2 A;  1KGE A;  1S66 L;  3UE3 A;  4Y2F A;  2FZ0 A;  4OP5 A;  3HLD A;  3ZG8 B;  2ZL1 B;  1KVL A;  2ZMF A;  2NUT C;  3DTI A;  2HJE A;  3UDI A;  1SKO B;  3BFF A;  3E98 A;  4OP8 A;  1MWS A;  3IBJ A;  3SW1 A;  5FAS A;  2J9O A;  5FI7 A;  1YSP A;  1S1Z A;  2X02 A;  4R4R A;  2XQZ A;  2ZBB A;  3FYZ A;  3MQQ A;  5GHX A;  3A0S A;  4Y13 A;  1TDL A;  1H8M A;  3G2Z A;  1DP9 A;  3TE8 A;  2DCF A;  4P85 A;  2OSU A;  2JKR I;  3ZG0 A;  5DF9 A;  4E6W A;  1YPR A;  4PM8 A;  1NXY A;  2EFX A;  3WS1 A;  3T12 B;  3V39 A;  5KSH A;  4LRZ E;  3N8R A;  3PYP A;  5J8X A;  3DBA A;  1TS0 A;  3N8S A;  5I94 A;  3DTM A;  3JPU A;  5FSR A;  4EXO A;  1YLP A;  1LSX A;  4WYY A;  2WKE A;  4GS9 A;  4EBL A;  3CI6 A;  3O87 A;  5HAR A;  3MBZ A;  5U47 A;  2H10 A;  5EEC A;  2ZM2 A;  1W5D A;  2JKF A;  5F1F A;  1PI5 A;  4LV1 A;  4UHU A;  1PW1 A;  5DVA A;  3MR0 A;  2WGI A;  3LR0 A;  4RX3 A;  3ZNT A;  1K55 A;  4HQA A;  4E3J A;  2P04 A;  1CI8 A;  1YLY A;  3UY6 A;  1ZG6 A;  1F2K A;  2DRW A;  3ISG A;  1KDW A;  3F1N A;  4JXV A;  3NBL A;  5BOH A;  1SDN A;  4JKT A;  4C75 A;  4WMC D;  4X56 A;  5TBM B;  2PYR A;  2HDQ A;  4KG5 A;  3NDG A;  4E3O A;  2VGJ A;  1YLW A;  3BJN A;  4EU0 A;  4MN6 A;  3KO6 A;  3T1Q B;  1U60 A;  4OPR A;  3Q07 A;  3BLM A;  4K08 A;  2JC7 A;  2XSS A;  5FQQ A;  1XJ6 A;  4S2K A;  1CJF A;  1S6R A;  4R6L A;  3A3E A;  4OLD A;  5TR7 A;  1KDS A;  1JWZ A;  4Q0H A;  2IA2 A;  4LRX C;  2G2W A;  3VP0 A;  4O01 A;  1XXM A;  4LV3 A;  3HBR A;  2Z2M B;  2OOL A;  1J3W A;  1L2S A;  3IF5 A;  4CJN A;  2QWS A;  3ZGA B;  5AQ9 A;  3P09 A;  1YQS A;  3IXG A;  3TJZ C;  1Y54 A;  2WAE A;  4WBG A;  4E3L A;  1OTA A;  4PKY G;  5A91 A;  3C7U A;  4QY6 A;  4XXR A;  3N6I A;  2H5S A;  1XJ4 A;  5FQ9 A;  4CLC E;  3UPO A;  4I38 A;  1WYC A;  3LID A;  3OPP A;  2HP9 A;  1ES3 A;  5E2F A;  3T1X A;  2Y2J A;  2EFU A;  1YLT A;  3OBF A;  4P87 A;  3LR5 A;  2LB9 A;  4KZ7 A;  2VX8 A;  4UEY A;  4MBH A;  5FDS A;  3G4P A;  4EEU A;  3LR4 A;  3CPT A;  1VHM A;  3FWL A;  3UN7 A;  4M4X A;  4MN7 A;  1FR1 A;  4EQI A;  3A3F A;  4HH3 A;  1BTL A;  3MFD A;  3Q7V A;  4ZBE A;  2WAF A;  5HWV A;  1V9Y A;  4FTX A;  3LCE A;  4KZA A;  1YSQ A;  3IH8 A;  1H3Q A;  3WS2 A;  3QP1 A;  3D3O A;  2GX5 A;  2P9V A;  4QY5 A;  4OLG A;  3VSK A;  2BAS A;  2HDU A;  3U4L P;  5CTN A;  4Y7P A;  3CMZ A;  3UE0 A;  3MFX A;  3BFG A;  1W63 M;  3ITA A;  3QP2 A;  3CLO A;  5E2H A;  5DF8 A;  4MDZ A;  4OH0 A;  1GA0 A;  1K38 A;  2ZM0 A;  1EI5 A;  1T19 A;  4YWZ A;  4LPZ A;  2Q0O A;  3KX0 X;  2QYB A;  4DKI A;  3D72 A;  4LCL A;  1PWC A;  4I3A A;  2PDR A;  5DJU A;  2XA7 M;  1ZG4 A;  1K57 C;  2L0W A;  2VLG A;  3BEC A;  3GQZ A;  4K91 A;  4EET B;  5I5L A;  4E3M A;  2ZC6 B;  1WYB A;  2Y2M A;  3TW8 A;  4Q0J A;  5EFW A;  1FQG A;  3EWK A;  3BEB A;  4EUZ A;  1FIL A;  5G18 A;  3AGD A;  5EVI B;  4EBN A;  2Z6D A;  4H8R A;  4WLA A;  4GNU A;  4E3I A;  3IS2 B;  4QWO A;  4B9O A;  1JNU A;  4G3V A;  2ZQA A;  4FUW A;  3G31 A;  5A90 A;  1LLB A;  5HL6 A;  1BUE A;  3OC2 A;  2IWB A;  2VV8 A;  3EGX C;  1HVB A;  5CX7 A;  1OT6 A;  4MEZ A;  3LEZ A;  5A93 A;  2B95 A;  3G6O A;  1ONH A;  1VET B;  3IQA A;  3LO7 A;  2V1Z A;  4NEE D;  4OQG A;  1GCE A;  2JKT M;  1OTD A;  2XF3 A;  1XJ2 A;  1TEM A;  1K0K A;  2Y8H A;  3V3R A;  5KMW A;  3ZFZ A;  5FI6 A;  4Y0U A;  4S2L A;  1UWN X;  2HP6 A;  2Y55 A;  3KSG A;  1LL8 A;  2EWV A;  3GSG A;  4MCW A;  2E8I A;  3IHB A;  1GSX A;  5EVL A;  1D1J A;  2Y91 A;  1TS8 A;  3S22 A;  5IT5 A;  1ZHH B;  5E2G A;  3BFD A;  4HP9 A;  2HF6 A;  3ZVT A;  3UNW A;  4EWF A;  1LI9 A;  1IKG A;  1XA7 A;  1PZP A;  4DF6 A;  1FCO A;  2OWH A;  3HLW A;  3FG8 A;  1MC0 A;  2L1M A;  5CHM A;  2B5R A;  3Q82 A;  5HSQ A;  3C8C A;  4WEL A;  4QHC A;  3PBO A;  3AGF A;  2A24 A;  3BRM A;  4RA7 A;  1NRF A;  4E3N A;  4KZ8 A;  3PXP A;  3DW0 A;  3LY4 A;  3GTC A;  1FSW A;  4DDS A;  4FD8 A;  3NOU C;  5M19 A;  1IOU A;  1L0F A;  4R3A A;  3F1N B;  2Y2Q A;  4ZDX A;  3IF6 C;  2XR0 A;  5F6A A;  3VP3 A;  1MZU A;  1XGI A;  5TFQ A;  4GHI A;  5HDC A;  3OOV A;  4X25 A;  4CLC D;  2WUQ A;  1BLS A;  3ZQ5 A;  4CLC A;  1S4S A;  1N9B A;  1X0O A;  1P9W A;  2XD5 A;  1NZU A;  5CGX A;  3WWX A;  4DXC A;  1KVM A;  4RYE A;  2BTF P;  4I5S A;  3SZT A;  4NG2 A;  4UQI S;  4LCM A;  4R4S A;  4F3L A;  1ES4 A;  3GR2 A;  3N8L A;  3T50 A;  1W8Y A;  4PKY A;  1NJ4 A;  3S7O A;  3HUN A;  4ZJ3 A;  4JGR A;  4S2O A;  5TJJ A;  4I3J A;  3A0R A;  2JCH A;  1TS7 A;  2UWX A;  1G5U A;  2V2F F;  2V8C A;  3G35 A;  3ZCZ A;  1TF1 A;  4Z1W A;  2Z6C A;  2IWC A;  4NK3 A;  1H5X A;  1N9N A;  3C30 A;  1GHI A;  2XFT A;  4EES A;  2V0U A;  2B02 A;  5HL1 A;  1VEU A;  1J9M A;  2XK1 A;  1LL9 A;  3H82 B;  3QP5 A;  4PHT A;  3UME A;  3MXR A;  3PHY A;  4OPZ A;  3O3V A;  4E3K A;  1TVF A;  3VOY A;  4ARZ A;  1BLH A;  1YKD A;  2ACG A;  5CXW A;  4JF4 A;  5G4Z A;  1YAX A;  2R9X A;  2O9C A;  3TRC A;  2EX8 A;  3ULF A;  2Y2N A;  1OPX A;  3FPW A;  4JXG A;  3MKE A;  3S1Y A;  1PIO A;  3CUE A;  1L0G A;  4MBF A;  3HUO A;  4BQM A;  3M6B A;  3IXD A;  5FAT A;  3NDE A;  3IT9 A;  3OPH A;  4XUX A;  1G28 A;  1BSG A;  2WGW B;  3BFE A;  3DWZ A;  3WRZ A;  3ICY A;  4P6Z M;  1E25 A;  4R23 A;  2ZQC A;  1OME A;  1MBL A;  2WKH A;  1RP5 A;  1K57 A;  2EA9 A;  3HUM A;  4DDY A;  4DE2 A;  2R78 A;  4ESP A;  4EV4 A;  5F68 A;  1XFN A;  1VB6 A;  1GHP A;  4OKP A;  2QKP A;  2W1T A;  2O9B A;  3PBN A;  5CED A;  1XFQ A;  4PM9 A;  3E2L A;  2Y2O A;  2W3D A;  3E0Y A;  2ZC7 A;  1ZC2 A;  3LYX A;  4GD8 A;  4HJ4 A;  4X68 A;  2E8J A;  3HLC A;  3BLS A;  1HZO A;  2KOI A;  3PAE A;  4NXE A;  2Q9N A;  1ONG A;  1FIK A;  3UO9 A;  3S7Q A;  4IHQ A;  4R38 A;  3BQ8 A;  4PM6 A;  3E2K A;  5F83 A;  4A5R A;  4HY8 A;  4AFI A;  4KG6 A;  3V5M A;  5JYP A;  1ES2 A;  2AVX A;  2ZQ7 A;  2VV7 A;  5M1A A;  2H28 A;  1BYW A;  4N1H A;  2CC1 A;  3S7P A;  5TGF A;  5C5K A;  4U0T A;  2Y2L A;  1IFQ A;  4EER A;  2A49 A;  1MWU A;  1SDE A;  2PAV P;  2HJ9 C;  4N92 A;  1KE0 A;  1I2S A;  3EEA A;  5F1G A;  3IBR A;  3MQ0 A;  3CAX A;  3ZG5 A;  1FCN A;  2L4R A;  4WMC A;  2D01 A;  4BEN A;  3IX3 A;  5DFX A;  5DKL A;  2J80 A;  1A0K A;  1LI0 A;  1P97 A;  1WE4 A;  4HJ3 A;  4R3B A;  2W0N A;  3QHY A;  1BLP A;  1DJA A;  4GDB A;  2QZ6 A;  4MBK A;  5A8B A;  1K4E A;  4Y5F A;  5M18 A;  5IU1 A;  4U3T A;  3BW6 A;  5DFY A;  4CLC C;  2GJ3 A;  1OJ5 A;  3PBT A;  3NJA A;  3G2Y A;  3LGO A;  5EVE A;  3IX8 A;  5LBR A;  4F94 A;  4ZJ1 A;  4JF5 A;  4WEK A;  2V1B A;  3RTY A;  1GSW A;  5HPI A;  2VZW A;  3VV4 A;  3H7W A;  5FAQ A;  3RXX A;  5CEB A;  2EWW A;  4KQD A;  5FQJ A;  3GMW A;  2YKF A;  3CIT A;  5MC7 A;  2WKP A;  3V50 A;  3FZC A;  1IYP A;  2W3E A;  4BD1 A;  3IF6 A;  4DXB A;  2JHE A;  4LGW A;  4II7 A;  2Y2H A;  3F1O A;  2P74 A;  1JVJ A;  3LFV A;  2LB5 A;  3R7W A;  3QP8 A;  2EX9 A;  4ZRR A;  4XT2 A;  4HOI A;  4UA9 A;  2VGK A;  3K2N A;  3ZVW A;  2ZC5 B;  2WAD A;  4GHI B;  3EQV A;  5HDS A;  4RX2 A;  5E2E A;  3BYD A;  3MZE A;  2XH9 A;  4EQ1 A;  4UA6 A;  1SHV A;  4BL2 A;  5GLC A;  4DJ3 A;  2CMN A;  3P7N A;  1KE4 A;  1K25 A;  3FPV A;  4IJG A;  1SKO A;  1MKM A;  3BQA A;  4WEJ A;  3U2A A;  4DN0 A;  3G32 A;  3TOI A;  5HPF A;  2M1C A;  4WL9 A;  1EWZ A;  4X6T A;  5EUA A;  1K6R A;  3A3I A;  3T1S A;  1XPB A;  2R9W A;  1S67 L;  2KLI A;  3CUE C;  3C4P A;  1S1Y A;  4BLM A;  1IEM A;  3W8K A;  3UB5 P;  2VA0 A;  4WM9 A;  4YOF A;  2WYX A;  3F1P B;  2X01 A;  4FCF A;  4B88 A;  2XEP A;  3QNB A;  3PBQ A;  5GL9 A;  5DTS A;  4WZ4 A;  1YT4 A;  3HRE A;  4JPM A;  4EBP A;  1O07 A;  4CPK A;  3FC7 A;  1F98 A;  3NY4 A;  5HAP A;  5EPH A;  4IBX A;  2ZLY A;  3UE6 A;  3VP4 A;  3NCK A;  4GB7 A;  1CQA A;  3T4T A;  3RFB A;  4BMW A;  1YMX A;  3MS6 A;  2ZC4 B;  3LEQ A;  5J4E A;  3E4Q A;  4N9K A;  1I2W A;  2M7U A;  4UAA A;  5FEF A;  1D06 A;  3NEC A;  3HLB A;  4PMA A;  5AQA A;  1ZTU A;  4HEF A;  3R4K A;  3LI8 A;  3E4P A;  5EV0 A;  1CEG A;  3OZH A;  4EEP A;  3E4O A;  1PWG A;  1YM1 A;  4OPQ A;  1T1B A;  1JTG A;  1FR6 A;  5G4Y A;  3MMH A;  4S2J A;  5CTM A;  3KSI A;  2FFY A;  3M6H A;  1PZO A;  3B42 A;  3D9Y A;  3B33 A;  1NY0 A;  4NXF A;  4X55 A;  4RVA A;  4MN5 A;  5TBM A;  1DJB A;  3PBR A;  1XA1 A;  1IYQ A;  4JF6 A;  1MXO A;  3VFH A;  1WA9 A;  5F82 A;  3HL9 A;  4H6J A;  5DKK A;  1MPL A;  5F5Y A;  4EUV A;  2V0W A;  3ZYT A;  3VP2 A;  2HDS A;  3CJM A;  3OCL A;  4QU3 A;  5FQI A;  5CHU A;  1NZO A;  4Y17 A;  3PR6 A;  4PPR A;  2MJ6 A;  4GS9 B;  4BJP A;  2V1A A;  4JXW A;  1H8Z A;  1KE3 A;  1ESI A;  3LIE A;  2PBD P;  3C7V A;  2KDK A;  1XX2 A;  2WK0 A;  3CWF A;  4MNR A;  5CER A;  2PYP A;  2ZM8 A;  5EE8 A;  3LIA A;  4ME4 A;  4HIA A;  5GHY A;  4EW7 A;  4GW9 A;  3UE1 A;  3A3D A;  1AXB A;  5CEC A;  2Y2P A;  2Y2G A;  5KIZ A;  4I39 A;  2PRF A;  1GA9 A;  4S2P A;  1F9I A;  3SH7 A;  4KZ5 A;  1W79 A;  2J3W A;  3UPN A;  2JE5 A;  1KOU A;  4X1M A;  4Z9Q A;  5HDD A;  2PD8 A;  3NIA A;  3T4Q A;  2VK3 A;  4D60 A;  1KGG A;  3RH8 B;  4GJ4 A;  1T1A A;  2I72 A;  3W4P A;  2VGL M;  4N1X A;  2FH5 A;  1BLC A;  1Y4O A;  5JYO A;  3EGD C;  4NKP A;  5A92 A;  3LI9 A;  5GLA A;  3PTE A;  3S7N A;  2H0Y A;  3C38 A;  3TG9 A;  1M40 A;  4OQ0 A;  1OTI A;  1LHY A;  3FKW A;  3K3C A;  5J3W A;  1ES5 A;  1XP4 A;  3H7W B;  4JXS A;  2A2L A;  5L10 A;  2XGN A;  2ZMV A;  4Q0I A;  4BWI A;  2PT7 A;  4DE1 A;  1W63 Q;  4HP4 A;  3DTK A;  5EM0 A;  3IF6 B;  3IH9 A;  1DP6 A;  3OCN A;  3MXS A;  2J3T D;  2C5W B;  3NUL A;  4LFU A;  3S4X A;  5FL3 A;  4KQR A;  3VE3 A;  1NYM A;  4S2M A;  1XGJ A;  5HZH A;  1G68 A;  4OPY A;  4P6B A;  2GDN A;  1UGU A;  4GOG A;  4U0X A;  1NYY A;  1IYS A;  2ZQD A;  2QPN A;  4QB8 A;  3FKV A;  1LT0 A;  1BT5 A;  4XT2 B;  1YLZ A;  3Q81 A;  3HVF A;  5EOE A;  5DF7 A;  4HBT A;  4WF0 A;  3CPT B;  1S0W A;  3MZF A;  4R3J A;  3A0V A;  2O0Y A;  3H9W A;  4HH2 A;  5CGW A;  2P08 A;  4UQI M;  3KYE A;  3M2J A;  3HLF A;  4HJ6 A;  1HD8 A;  2ZQ8 A;  3CZD A;  3Q7V B;  1L3L A;  5L07 A;  4IVI A;  3BY8 A;  3P01 A;  5EVI D;  4HHD A;  4LV2 A;  5EVI A;  5J7E A;  1BUL A;  4R1G A;  3IS2 A;  2P9V B;  1TS6 A;  2DNS A;  1LSV A;  1ODV A;  5GHZ A;  4O8G A;  3T1R A;  5L09 A;  5DJT A;  3TSG A;  5D3O A;  5HD5 A;  3V67 A;  1TD5 A;  1I5Q A;  1VET A;  2EXA A;  5AVE A;  3UB6 A;  4DMZ A;  2KX6 A;  2EX2 A;  1RGY A; 
#chains in the Genus database with same CATH homology
 4JBF A;  3Q1F A;  5FQJ A;  3VSL A;  3GMW A;  2C6W B;  5GLB A;  3ZG7 B;  1FQG A;  5AQB A;  3SH8 A;  1PWD A;  2J9P A;  3BEB A;  4EUZ A;  1MWT A;  5G18 A;  3AGD A;  5EVI B;  4EBN A;  4ID4 A;  1M6K A;  3IXH A;  3FZC A;  3V50 A;  1IYP A;  4BD1 A;  2Y59 A;  3IF6 A;  4DXB A;  4H8R A;  4GNU A;  4E3I A;  4QJG A;  1VQQ A;  3MZD A;  1SCW A;  2G2U A;  2Y2H A;  1PI4 A;  3EQU A;  3NI9 A;  4OOM A;  5FQM A;  5FAO A;  2ZQA A;  1ERM A;  3G31 A;  4K0X A;  3WRT A;  5A90 A;  1QME A;  4OOY A;  2OV5 A;  2P74 A;  1LLB A;  4KQO A;  1BUE A;  1JVJ A;  1RGZ A;  3IWQ A;  5FA7 A;  3OC2 A;  3UDF A;  2IWB A;  3PAG A;  2FFF B;  4WZ5 A;  1HVB A;  4N9L A;  2EX9 A;  4MEZ A;  3LEZ A;  4GZB A;  5A93 A;  1RCJ A;  5E43 A;  1W8Q A;  2OLV A;  1DJC A;  1ONH A;  3GRJ A;  1K6S A;  4KZ6 A;  2RCX A;  4HES A;  3IQA A;  3LO7 A;  2V1Z A;  4UA9 A;  4OQG A;  3W4O A;  1GCE A;  2VGK A;  1CI9 A;  1PW8 A;  4C6Y A;  3VMA A;  5HX9 A;  3SOI A;  3ZVW A;  2XF3 A;  2XFS A;  2ZC5 B;  4B4X A;  1TEM A;  1TDG A;  4OQH A;  1G6A A;  1YLJ A;  2WAD A;  5IHV A;  3EQV A;  3V3R A;  3ZFZ A;  5KMW A;  2PU2 A;  1IEL A;  5FI6 A;  4Y0U A;  4RX2 A;  4S2L A;  5E2E A;  5HAI A;  3BYD A;  3MZE A;  2XH9 A;  3BFC A;  1W7F A;  1E3U D;  3FV7 A;  4UA6 A;  2Q9M A;  1SHV A;  2HP6 A;  1E3U A;  3IWO A;  2Y55 A;  4BL2 A;  2XLN A;  5GLC A;  1K54 C;  4DRT A;  3WS4 A;  4NET A;  3GSG A;  3WS0 A;  2E8I A;  1KE4 A;  3IHB A;  4O7D A;  4OVD A;  5EVL A;  1O7E A;  1K25 A;  3HLG A;  4QD4 A;  2Y91 A;  3ZHH A;  2V20 A;  2EX6 A;  3S22 A;  2HP5 A;  3N7W A;  4WEJ A;  5E2G A;  5AQ7 A;  3BFD A;  3G32 A;  4E6X A;  3TOI A;  4IED A;  4BD0 A;  5FDH A;  3ZVT A;  3UNW A;  2BLS A;  4EWF A;  5HW3 A;  5DTK A;  2XDM A;  1EWZ A;  4X6T A;  4KZ3 A;  1LI9 A;  1IKG A;  1DY6 A;  1K6R A;  1XA7 A;  1XPB A;  2R9W A;  3A3I A;  5EOO A;  5EUA A;  1PZP A;  4C3Q A;  4S2N C;  4DF6 A;  3C4P A;  4KG2 A;  1FCO A;  1KGE A;  4X53 A;  3UE3 A;  4L0L A;  3HLW A;  1IEM A;  3W8K A;  4BLM A;  4OP5 A;  3HLD A;  3OPR A;  4WM9 A;  3MKF A;  5CHM A;  2B5R A;  3ZG8 B;  3Q82 A;  2WYX A;  2QMI A;  1KVL A;  3SH9 A;  4PM5 A;  2X01 A;  4FCF A;  4B88 A;  4WEL A;  4DE0 A;  2XEP A;  3G30 A;  4QHC A;  3IXB A;  3UDI A;  3QNB A;  3PBO A;  3AGF A;  3PBQ A;  4B4Z A;  3BFF A;  3BRM A;  4RA7 A;  4FH2 A;  4OP8 A;  5GL9 A;  1NRF A;  5DTS A;  4E3N A;  1MWS A;  4KZ8 A;  4WZ4 A;  4D2O A;  1YT4 A;  3HRE A;  3DW0 A;  4JPM A;  3A3J A;  4EBP A;  3GV9 A;  3LY4 A;  1O07 A;  4CPK A;  3GTC A;  1FSW A;  3NY4 A;  4DDS A;  4FD8 A;  4ZAM A;  4HBU A;  3N4I A;  5HAP A;  5M19 A;  2Y4A A;  1L0F A;  2ZLY A;  4IBX A;  5EPH A;  5FAS A;  3VP4 A;  2J9O A;  3NCK A;  4GB7 A;  5FI7 A;  1Z6F A;  1K56 D;  5CHJ A;  2Y2Q A;  4ZDX A;  1K56 A;  3IF6 C;  1YMS A;  2XR0 A;  2X02 A;  3ZNY A;  4R4R A;  3VP3 A;  1LL5 A;  2XQZ A;  3VP1 A;  1YMX A;  1XGI A;  5TFQ A;  3C4O A;  3FYZ A;  5GHX A;  2ZC4 B;  1TDL A;  2WUQ A;  3G2Z A;  4Q8I A;  1BLS A;  4N9K A;  5L2F A;  1I2W A;  1BZA A;  4OQI A;  4UAA A;  4WZ5 C;  1N9B A;  2DCF A;  5FAP A;  3HLB A;  4P85 A;  1JWV A;  4PMA A;  3ITB A;  2OSU A;  5AQA A;  3G34 A;  2XD5 A;  3SS4 A;  1E4D A;  4HEF A;  1NZU A;  3ZG0 A;  5CGX A;  5DF9 A;  3WWX A;  1KVM A;  4RYE A;  4DXC A;  4E6W A;  1K4F A;  4KQQ A;  4PM8 A;  1NXY A;  1CEG A;  2EFX A;  3WS1 A;  2ZMA A;  3OZH A;  4LCM A;  4R4S A;  3V39 A;  5KSH A;  1PWG A;  1ES4 A;  1YM1 A;  4IBR A;  4OPQ A;  5CGS A;  3N8R A;  3GR2 A;  3N8L A;  3O86 A;  4FSF A;  4R0Q A;  1W8Y A;  5J8X A;  1JTG A;  1FR6 A;  3N8S A;  5I94 A;  3DTM A;  4S2I A;  1NJ4 A;  5FSR A;  3HUN A;  4ZJ2 A;  1YLP A;  4ZJ3 A;  3Q7Z A;  4S2O A;  4S2J A;  5CTM A;  2JCH A;  4WYY A;  3BM6 A;  2WKE A;  2UWX A;  2EXB A;  2FFY A;  3M6H A;  1PZO A;  2V2F F;  4EBL A;  1SKF A;  1ESU A;  1NY0 A;  3G35 A;  3HLE A;  3O87 A;  3ZCZ A;  4X55 A;  4RVA A;  5HAR A;  3MBZ A;  2HDR A;  5U47 A;  2H10 A;  5EEC A;  2IWC A;  4OON A;  1DJB A;  3PBR A;  1XA1 A;  1W5D A;  2ZM2 A;  1IYQ A;  1XKZ A;  4NK3 A;  5F1F A;  4JF6 A;  1MXO A;  3AGE A;  1PI5 A;  1H5X A;  1ERQ A;  2PBY A;  4LV1 A;  4UHU A;  1MKI A;  3VFH A;  1GHI A;  1PW1 A;  2XFT A;  5DVA A;  1FOF A;  5F82 A;  3HL9 A;  3IHA A;  5HL1 A;  2WGI A;  1MPL A;  1J9M A;  3JYI A;  1JTD A;  2OLU A;  3GVB A;  3C5A A;  2XK1 A;  4RX3 A;  1LL9 A;  3ZNT A;  1K55 A;  3VP2 A;  2HDS A;  5KSC A;  3CJM A;  4E3J A;  2ZC3 B;  3MXR A;  3OCL A;  1CI8 A;  1YLY A;  3I7J A;  4QU3 A;  4OPZ A;  5FQI A;  3UY6 A;  5CHU A;  3O3V A;  4E3K A;  1NZO A;  1TVF A;  3VOY A;  1ZG6 A;  4PPR A;  5CRF A;  5EVI C;  1BLH A;  2DRW A;  4BJP A;  3ISG A;  1KDW A;  4JXV A;  3NBL A;  3SS3 A;  4JXW A;  5BOH A;  1H8Z A;  1SDN A;  4JKT A;  5CXW A;  1KE3 A;  1ESI A;  4C75 A;  4JF4 A;  3C7V A;  4WMC D;  4X56 A;  2WGW A;  1XX2 A;  2WK0 A;  2HDQ A;  4MNR A;  4KG5 A;  4ZTK A;  3NDG A;  2R9X A;  4E3O A;  2X71 A;  2VGJ A;  4OOL A;  5CER A;  1YLW A;  2EX8 A;  2ZM8 A;  3WS5 A;  5EE8 A;  4XUZ A;  1CEF A;  4KEN B;  2Y2N A;  1U60 A;  4OPR A;  4Y0O A;  3Q07 A;  5GHY A;  3BLM A;  2JC7 A;  3UE1 A;  4JXG A;  3A3D A;  3MKE A;  5FQQ A;  3S1Y A;  1PIO A;  2H0T A;  1AXB A;  2WZX A;  4S2K A;  4S2N A;  1S6R A;  5CEC A;  4LEN A;  1L0G A;  2Y2P A;  2Y2G A;  4MBF A;  5GLD A;  4GN2 A;  3HUO A;  2J7V A;  3A3E A;  4S2P A;  1GA9 A;  4BQM A;  3SH7 A;  3M6B A;  4FH4 A;  4KZ9 A;  1ERO A;  3IXD A;  5FAT A;  4KZ5 A;  1W79 A;  3NDE A;  3UPP A;  3IT9 A;  4M3K A;  3UPN A;  1IYO A;  2JE5 A;  3OPH A;  5FQK A;  4OLD A;  5TR7 A;  4XUX A;  3VFF A;  1JWP A;  1BSG A;  2WGW B;  3BFE A;  3DWZ A;  5KZH A;  1KDS A;  1JWZ A;  3WRZ A;  2G2W A;  4Z9Q A;  3VP0 A;  2ZJ9 A;  1XXM A;  3LY3 A;  3NC8 A;  1E25 A;  1ZKJ A;  2PU4 A;  4R23 A;  4LV3 A;  3NIA A;  2ZQC A;  3HBR A;  1OME A;  2Z2M B;  4KZ4 A;  1MBL A;  2WKH A;  1RP5 A;  1N4O A;  1L2S A;  1K57 A;  1VM1 A;  2JBF A;  3UDX A;  3IF5 A;  3HUM A;  1KGG A;  4DDY A;  4CJN A;  4DE2 A;  4EV4 A;  3ZGA B;  2I72 A;  2XD1 A;  3W4P A;  4N1X A;  5AQ9 A;  1GHP A;  3P09 A;  4OKP A;  1YQS A;  4JLF A;  1BLC A;  1FSY A;  1FCM A;  3IXG A;  3PBN A;  5CED A;  5JYO A;  4PM9 A;  1Y54 A;  2WAE A;  3E2L A;  2Y2O A;  4WBG A;  5A92 A;  4E3L A;  5A91 A;  5GLA A;  4YIN A;  2ZC7 A;  1C3B A;  3C7U A;  3PTE A;  5HAQ A;  2H0Y A;  1ZC2 A;  4QY6 A;  4GD8 A;  4X68 A;  4XXR A;  3TG9 A;  3HLC A;  3BLS A;  1M40 A;  3ZDJ A;  4OQ0 A;  3N6I A;  2H5S A;  3ZG9 B;  1HZO A;  5FQ9 A;  2Y2I A;  3SS5 A;  3PAE A;  3UPO A;  2A3U A;  1LHY A;  1WYC A;  4KZB A;  4DE3 A;  2Q9N A;  3OPP A;  3VOZ A;  2HP9 A;  1ONG A;  3UO9 A;  5DTT A;  1ES3 A;  3FKW A;  4PM7 A;  2IWD A;  4X69 A;  2Y2J A;  2EFU A;  1YLT A;  5E2F A;  1ES5 A;  2RL3 A;  4P87 A;  4KZ7 A;  4PM6 A;  3RXW A;  3E2K A;  1XP4 A;  5F83 A;  4LV0 A;  4GKU A;  4JXS A;  4MBH A;  4A5R A;  2WZZ A;  3G4P A;  4KG6 A;  3V5M A;  1IKI A;  5JYP A;  1ES2 A;  3RJU A;  2XGN A;  4Y0T A;  2ZQ7 A;  3FWL A;  1Q2P A;  1K55 C;  4P0M A;  4DE1 A;  3UN7 A;  3IF6 B;  1MWR A;  1FR1 A;  3IH9 A;  5HFO A;  5M1A A;  3OCN A;  3MXS A;  2J8Y A;  4EQI A;  4N1H A;  3A3F A;  4YFM A;  2C5W B;  1BTL A;  3S4X A;  2CC1 A;  2Y2K A;  5TGF A;  3MFD A;  3Q7V A;  3DWK A;  4ZBE A;  2WAF A;  2Y2L A;  4KQR A;  4U0T A;  1NYM A;  3OPL A;  3LCE A;  2WKI A;  1QMF A;  1XGJ A;  4S2M A;  2HPB A;  2A49 A;  1G68 A;  4KZA A;  4OPY A;  2Z2L B;  2GDN A;  3IH8 A;  4P6B A;  4GOG A;  1MWU A;  1SDE A;  4U0X A;  4UA7 A;  1NYY A;  1IYS A;  2ZD8 A;  2QPN A;  2ZQD A;  3FKV A;  4QB8 A;  3WS2 A;  1BT5 A;  1CK3 A;  4N92 A;  1KE0 A;  1YLZ A;  1I2S A;  1L0E A;  1K54 A;  2P9V A;  4QY5 A;  3Q81 A;  4OLG A;  5F1G A;  3HVF A;  5EOE A;  3VSK A;  5DF7 A;  1MY8 A;  3ZG5 A;  1FCN A;  4HBT A;  3V3S A;  2HDU A;  4WMC A;  1S0W A;  3MZF A;  4R3J A;  5CTN A;  4Y7P A;  3IWI A;  4BEN A;  3CMZ A;  1Q2Q A;  3UE0 A;  3B3X A;  3O88 A;  5CGW A;  1ALQ A;  3M2J A;  3HLF A;  3BFG A;  1HD8 A;  2ZQ8 A;  1LI0 A;  3CZD A;  3Q7V B;  4MLL A;  4IVI A;  1PYY A;  1WE4 A;  4R3B A;  3ITA A;  3QHY A;  1BLP A;  5EVI D;  1DJA A;  5FI2 A;  4GDB A;  2QZ6 A;  4LV2 A;  3P98 A;  4MBK A;  5EVI A;  5E2H A;  1K4E A;  1BUL A;  5DF8 A;  1L0D A;  5M18 A;  4OH0 A;  4U3T A;  4R1G A;  1GA0 A;  3QNC A;  1K38 A;  2ZM0 A;  1EI5 A;  2P9V B;  4BL3 A;  4DKI A;  4LCL A;  2DNS A;  1PWC A;  3CG5 A;  3W4Q A;  1HTZ A;  3M2K A;  5GHZ A;  1ZG4 A;  1K57 C;  3PBT A;  3D4F A;  4K0W A;  1H8Y A;  3G2Y A;  2WGV A;  1KGF A;  4F94 A;  4GD6 A;  3BEC A;  3GQZ A;  4JF5 A;  4ZJ1 A;  3TSG A;  4K91 A;  4WEK A;  4GDN A;  5D3O A;  2ZQ9 A;  1GHM A;  3PBS A;  4IVK A;  4E3M A;  2ZC6 B;  1WYB A;  1I5Q A;  5FAQ A;  2BG1 A;  2EXA A;  3RXX A;  2Y2M A;  2EX2 A;  5CEB A;  1RGY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...