3KO6A

Crystal structure of yeast free methionine-r-sulfoxide reductase ykg9 in complex with the substrate
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
176
structure length
176
Chain Sequence
STGFHHADHVNYSSNLNKEEILEQLLLSYEGLSDGQVNWVCNLSNASSLIWHAYKSLAVDINWAGFYVTQASEENTLILGPFQGKVACQMIQFGKGVCGTAASTKETQIVPDVNKYPGHIACDGETKSEIVVPIISNDGKTLGVIDIDCLDYEGFDHVDKEFLEKLAKLINKSCVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of yeast free methionine-R-sulfoxide reductase Ykg9 in complex with the substrate
rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
molecule keywords UPF0067 GAF domain-containing protein YKL069W
total genus 57
structure length 176
sequence length 176
chains with identical sequence B
ec nomenclature ec 1.8.4.14: L-methionine (R)-S-oxide reductase.
pdb deposition date 2009-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13185 GAF_2 GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3ko6A00
3ZQ5A 3E0YA 3MF0A 5DFXA 3E98A 2O0YA 5DFYA 3R4KA 3NOUC 2M7UA 2W3HA 4Q0HA 4LRZE 4ZRRA 2W3EA 2XROA 4Q0JA 2O99A 5I5LA 4Y5FA 4IJGA 2Y79A 3IBJA 2GX5A 3DBAA 3OOVA 3IBRA 5LBRA 4ETXA 4QPRA 3C2WA 4RQ9A 3S7QA 1TF1A 2O9BA 4YOFA 4GLQA 4Z1WA 2IA2A 2VEAA 5K5BA 3S7NA 2M7VA 1TD5A 2B18A 4PAUA 2XRNA 4FOFA 4DMZA 4MDZA 2O9AA 5HPFA 2LB9A 1YKDA 3S7OA 2KLIA 5HPIA 4ME4A 3KSHA 4O0PA 4G3WA 4O8GA 4IUHA 2G7UA 5HL6A 4MMNA 3KO6A 3W2ZA 2W1TA 3S7PA 4G3VA 1YSQA 4O01A 2O9CA 3EEAA 2K31A 3MMHA 1MC0A 4Y2FA 3NOTC 2W1RA 3BJNA 3HCYA 1ZTUA 2HGVA 4G3KA 4LRXC 3O5YA 2QYBA 2KOIA 3OBFA 3CITA 5TJJA 2OOLA 3NOPC 3K2NA 4EU0A 5HSQA 2K2NA 2Y8HA 2ZMFA 4IUKA 4YNRA 4CQHA 1VHMA 2VJWA 2W3FA 2LB5A 4R6LA 3RFBA 2VKSA 4Y3IA 4MCWA 5L8MA 4GW9A 2W1TB 2W3DA 4DN0A 2VZWA 3TRCA 3KSGA 3VV4A 4BWIA 3MQ0A 1F5MA 2W3GA 1YSPA 5AJGA 4E04A 4LRYC 5C5KA 3NHQA 1MKMA 3CI6A 3LFVA 4MN7A 3G6OA 2XSSA 4ETZA 3KSFA 4EUVA 4Q0IA 3KSIA 1STZA 3D3OA 4R70A
chains in the Genus database with same CATH superfamily
2ZM8A 3A3JA 5DKLA 4K08A 3SOIA 1YMSA 2V0UA 3LY3A 3UO9A 1ZG4A 1K38A 4Q0JA 3WS0A 3D9YA 3OCNA 5EFWA 4IJGA 1PI5A 3BEBA 1RGZA 3UE6A 1TDLA 5A8BA 4NXGA 4X53A 3GTCA 4GLQA 3MQQA 1TS6A 5HAQA 3PXPA 3LICA 5AVEA 2ZOHA 3QP2A 3H9WA 1GA9A 4MDZA 4OLDA 1VETB 4OP5A 1Z09A 4QB8A 4XUZA 4BMWA 2ZOIA 1OJ5A 5HL6A 3E4OA 1N9BA 4L0LA 3DTKA 1BLCA 2Y2MA 4R1GA 3CZDA 3G35A 3Q7ZA 3SW1A 5FI7A 4E3IA 1VEUA 3EGXC 4I3IA 3HCYA 5HWWA 5CERA 4XXRA 5KMWA 3F1NA 4OOMA 4JGQA 3WS4A 4PKYG 4KG2A 4WELA 2QHKA 3HUNA 2VJWA 3ZHHA 4MCWA 1K57A 4NXEA 4BQMA 4Q8IA 3BFGA 2VV6A 3HUMA 5TFQA 3LIFA 3BM6A 2ZQAA 3N8SA 4DDSA 1L0FA 4DDYA 2HDQA 1K25A 3IF6C 1ESUA 4GHIB 3MZEA 1PW8A 1N4OA 3B42A 4HJ4A 3UE3A 3D3OA 2VV8A 1DP8A 3U4LP 3MF0A 1MWUA 3HBRA 5CHMA 4PM7A 2W3HA 4MBFA 1ERMA 2WK0A 1NLZA 4WEKA 2HP5A 3O88A 3NJAA 3O3VA 3ZG5A 4HESA 3IBRA 4ETXA 5GLDA 1Q2PA 3IH9A 2FZ0A 2J9PA 3SS4A 1YLJA 2ZC7A 3A3EA 1HZOA 4OQHA 3MSHA 2ZC6B 3H82B 3IWQA 3P7NA 4WLAA 1LT0A 4OONA 5HAIA 4UEYA 2XK1A 4KG6A 2ZC3B 4IEDA 2VK3A 4G3WA 5E2HA 4KQRA 1D7EA 4GNUA 1FQGA 2J3WA 4PM8A 4R3BA 4B93A 4R4RA 3NIAA 3HLBA 1MC0A 1Y4OA 4UHUA 3MKFA 2V8FA 4PKYA 3UE0A 3HLFA 2Y4AA 1DJBA 4IBRA 1MBLA 4LV2A 5HX9A 4B88A 3ZG9B 4BENA 5TR7A 1OPXA 3DWKA 2D02A 3SZTA 3LR0A 1N9OA 2ZL1B 4MNRA 2EX6A 2WAFA 3FPWA 3HLGA 2L4RA 4NXFA 3G2ZA 4QU3A 3RXXA 5FEGA 1O7EA 5E43A 3T1QB 3QP4A 3NECA 2XSSA 3VE3A 2WKRA 5BOHA 3A0VA 1XKZA 2QMIA 3HLDA 4R70A 3AGDA 4I5SA 3ZG7B 3QP6A 3OLOA 3E98A 1YM1A 5EECA 3DW0A 2H5SA 5JYOA 2WKPA 1L3LA 2W3EA 2XROA 4HH2A 2O99A 1LL5A 1IEMA 5G18A 4UQIS 3SH8A 1GHIA 3W4OA 3ZNTA 3MXQA 5DF7A 3HJKA 1TVFA 3D4FA 3IQAA 4LV3A 2V2FF 3PTEA 2V1ZA 4X69A 5DF9A 4ME4A 3EEHA 1NY0A 3L7HA 1PFLA 3RTYA 4KZBA 4PMAA 3MXSA 4P85A 1CJFA 2PBDP 2VGKA 3BWLA 1HD8A 4ARZA 5DTTA 2P08A 1YT4A 3W4QA 2R9XA 4KQDA 2P74A 2HGVA 2R9WA 3IXGA 3IWIA 1J9MA 5TJJA 5L09A 4L9EA 1SKOB 3QNCA 4N92A 2Y2GA 1YLPA 1YPRA 2ZC5B 2OLVA 4E3LA 2ZMVA 1F5MA 3ZVTA 2GDNA 3BFFA 5AQ7A 3P98A 1GHMA 1E3UD 5FATA 5CX7A 1MKMA 1MZUA 4BL3A 3GVBA 3W4PA 4ETZA 2Y59A 2PYPA 1QMFA 1K0KA 3E0YA 1PI4A 5CTMA 1NYYA 1NZUA 3CG5A 3LO7A 3PAGA 3LY4A 3P01A 3VP4A 2PT7A 4EEUA 3DTIA 3V67A 1XFNA 3EOIA 4FSFA 2YKFA 1NXYA 1CF0A 1K4FA 2P9VB 3WS1A 3VP1A 3FWLA 1UWNX 2JHEA 4X1MA 5FDHA 3G32A 3ITBA 3GMWA 1KE4A 3Q82A 2L1MA 1YLZA 3MS6A 3T50A 4HOIA 5A90A 2JKTM 3NULA 1XPBA 1OTDA 1CK3A 4IUHA 2QJ5A 1FSWA 4CLCC 1DP6A 4EQIA 5CXWA 4LCLA 4O01A 4S2OA 4WMCA 1BLPA 1OT6A 3NOTC 4FUWA 3N4IA 1H5XA 3DAVA 3K3DA 3ZYTA 4KZ6A 1L0EA 3G4PA 4BLMA 1CI8A 3VSKA 3M6HA 3TG9A 4PM6A 2LB5A 4R6LA 4R23A 2VKSA 2XH9A 3DWZA 2JCHA 4OPQA 5L07A 5DF8A 3VV4A 3LIDA 4CLCE 3NCKA 2ACGA 3ZG8B 4S2NA 3CWFA 1W7FA 5IT5A 4JGOA 1S66L 2V1AA 1L2SA 2J3TC 4MN7A 3KSFA 4NEED 4PPRA 1W8QA 3ZQ5A 1ERQA 3KYQA 4OOYA 1E4DA 4Y13A 3HVFA 2H0YA 2J9OA 4LRZE 2INWA 3T1RA 4S2NC 4DF6A 4QD4A 1MXOA 1FCMA 5FAPA 2NUTC 2HF6A 4FH2A 3B47A 1ESIA 3R7WB 3WWXA 3IXBA 2VA0A 3QHYA 3MBZA 4JGPA 5GLBA 3BLMA 2AVXA 3C4OA 4X68A 3W8KA 2OAP1 1IYOA 1G6OA 3BW6A 3QNBA 1LSWA 2Y2OA 1K55A 1IYPA 2O9CA 1H3QA 5HDCA 4LENA 1SCWA 3A3FA 3QP5A 4RX3A 3UB9A 3R7WA 5M1AA 1IKIA 4DE3A 1SKFA 3O5YA 4KUKA 5KZHA 5FQJA 4P0MA 4DXCA 2X01A 4CLCA 4MN5A 4HY8A 3S4XA 1T18A 5AQBA 1SDEA 2G2WA 4E6XA 1H8ZA 3FPVA 3UPOA 1LI0A 5E2EA 5HFOA 5IS1A 4LFUA 3A3IA 5F68A 1D06A 3PYPA 2GNXA 5CHJA 2V8CA 5HAPA 4HP4A 4YFMA 3UB5P 2XFTA 5F69A 5KSHA 4I38A 3KX0X 2P7JA 4B9OA 3CAXA 2R78A 4HQAA 3T4JA 5DVAA 5FDSA 2E8IA 4Y5FA 1XX2A 4CLCD 5J8XA 2ZBBA 1GA0A 3GDIA 2X02A 4OPYA 4S2KA 4OQ0A 4JKTA 3S7NA 3ZFZA 2M7VA 4FH4A 4PAUA 2XRNA 4H8RA 3M2KA 2XA7M 5FQKA 1KDSA 4JXWA 1KGEA 1T19A 5HPIA 2CC1A 2HDSA 2WUQA 4KZAA 3EQUA 4I39A 1K4EA 4OKPA 3BFDA 1BLSA 1CI9A 2W0NA 1YSQA 2ZQ8A 2EFXA 4DXBA 3UB6A 4DE1A 1ZTUA 4G3KA 5CGSA 2J3TD 3LI9A 3IS2B 1FILA 2GJ3A 4BBUA 4DJ2A 3OZHA 4YNRA 4CQHA 2BLSA 1VHMA 3C38A 2P04A 5EM1A 2Q0OA 3UPPA 2HP6A 4R3AA 1XGJA 5EVIB 1OTBA 2B95A 4IVIA 1GSVA 4HJ6A 3NHQA 4F3LB 1L0DA 3CPTA 1VQQA 1ES5A 2W27A 3FG8A 1STZA 4EERA 4WZ5A 2J8YA 4KZ4A 4XT2B 3OPRA 2A3UA 2QWSA 4GCZA 4FTXA 1RCJA 3VE4A 4ID4A 3U2AA 4F3LA 4OOLA 2Z6CA 5FEFA 4GN2A 2FH5A 1CEFA 1TD5A 1ZG6A 4FOFA 4BD1A 5E2GA 2EX9A 1W63Q 3FC7A 4OLGA 2G7UA 1KVMA 4HIAA 1HVBA 4OH0A 4QY5A 2WGVA 4N9KA 3S7PA 3FKVA 4Y2FA 4YWZA 1FCNA 4GZBA 1GHPA 2WKIA 2JKTI 4KZ7A 5G4ZA 4IBXA 4PM5A 4OPZA 1TDGA 5KSCA 1MPLA 3T4QA 3RFBA 3MFDA 3V39A 5MC7A 2HP9A 2ZLYA 3WS2A 2W1TB 5AQ9A 1OJGA 4HBUA 2EX2A 5FI6A 2A24A 3GSGA 4GOGA 3V3SA 2P9VA 1LSVA 1GCEA 3DTEA 4X56A 4KENB 1GSWA 3LEZA 2WZXA 3VFFA 4K0XA 4EETB 4EU0A 3CUEC 4DJ3A 1JWPA 1SKOA 4JBFA 2EXBA 2OSUA 5DFYA 2HDRA 1XP4A 2M7UA 1RP5A 5GHYA 1PRQA 4R4SA 4B4ZA 1J3WA 5AQAA 4S2IA 3MKEA 2WYXA 1PNEA 3UN7A 3AGEA 1I5QA 4HEFA 5AVFA 2VEAA 5K5BA 3T4KA 3ZDJA 3LIEA 4N1HA 3GR2A 4LV0A 5EE8A 3KSHA 1KE0A 3IF6A 5EV0A 1M6KA 4RYEA 3EWKA 4X6TA 2L0WA 3MZFA 3HUOA 1XXMA 3MMHA 3OPLA 3BJNA 2WGWB 1P9RA 2Y91A 2KDKA 4K91A 1ZKJA 5HL1A 1H8YA 1KGFA 2OOLA 3BLSA 3E4PA 4E3JA 1PWGA 1U60A 3Q81A 4FCFA 4EBPA 3Q1FA 4U0TA 1S1ZA 1G68A 4A5RA 3K3CA 2JKFA 4KQOA 3UNWA 4DE2A 2EX8A 3JYIA 1K55C 4ZJ2A 2RL3A 3BY9A 4WZ4A 5DTKA 4LRYC 2Z2LB 2PAVP 2WGIA 4MN6A 4EUVA 4D60A 3MJQA 2RCXA 3NDEA 1OTEA 4YINA 2XD1A 2JN7A 2XA7S 2JKRM 3SH7A 2YKHA 1NRJA 3LUQA 4KUOA 5GL9A 2ZM2A 3QP1A 3N6IA 4GD8A 1BZAA 1BSGA 2OWJA 4QPRA 4Y15A 1JVJA 4E3MA 3VP0A 2HZ5A 4Z1WA 2B02A 3A3DA 1KOUA 2VGLM 2KX6A 1WA9A 4EBNA 4MLLA 1EWZA 4JF6A 4M4XA 3TW8A 3O86A 1BYWA 4H6JA 5EVID 4JPMA 2Y2IA 2DCFA 3M6BA 3IHAA 1LL9A 1LHYA 3HLCA 5GLAA 1TS7A 4GHIA 4WYYA 3BQ8A 4OP8A 1LL8A 2ZQDA 3UE1A 3IHBA 4B4XA 2VGJA 3F1OB 3BYDA 4E6WA 4Y3IA 4GW9A 5EPHA 3IF5A 4BJPA 5DJTA 3FZCA 1YMXA 1ODVA 4ESPA 3KSGA 4N9LA 3BRMA 1V9ZA 1K57C 5J4EA 3MZDA 5AJGA 1VEUB 4GDBA 1PWCA 4BBVA 3F1NB 4ZJ1A 3GV9A 3I7JA 1DY6A 4DKIA 1X0OA 3CJMA 5L8MA 3IH8A 3UPNA 1M40A 3PBOA 4HBTA 4JXVA 1DRMA 3SS3A 4M3KA 5EVLA 2ZQCA 3NY4A 4N1XA 2JKRI 3HLWA 5FQMA 2Y55A 4MBHA 3O87A 2Y2NA 4HI4A 2CMNA 2Z6DA 1TF1A 3C7VA 5IHVA 4CJNA 1ONGA 3T12B 5F1FA 2IA2A 4NXBA 3B33A 4HHDA 3OPHA 3CLOA 2VV7A 4QJGA 3TSGA 3MXRA 2G2UA 4DMZA 3OC2A 1LSXA 5HDDA 4PM9A 1BTLA 3F1PB 3VFHA 1YQSA 3G30A 3W2ZA 1XGIA 2V9AA 1KGGA 4LLOB 1V9YA 1W63M 1ZC2A 1T1BA 4S2PA 4BBTA 5HWTA 3M2JA 4FD8A 4BD0A 4C75A 4Z9QA 4NG2A 3VMAA 3H82A 1NZOA 1XA7A 3T4LA 3N8LA 1NYMA 4P6ZS 2Y8HA 1ES2A 3F1PA 1PW1A 5CTNA 2WKEA 1JWVA 5FA7A 2J80A 1XFQA 3NI9A 2QKPA 5F1GA 1XA1A 5CGWA 4AFIA 1XJ4A 4E04A 3C30A 1K54A 4LPZA 3PBTA 1DJCA 3N8RA 3E2LA 4WN5A 1MY8A 1F98A 1P97A 1RGYA 3Q07A 3UY6A 1F2KA 5DFXA 4GS9A 3IWOA 3T1XA 2J7VA 3S22A 2EFUA 3R4KA 4Q0HA 3D72A 3C4PA 4ZRRA 1N9LA 3TOIA 3IX4A 1I2SA 4D2OA 4RQ9A 4S2JA 4EV4A 1PWDA 4Y0OA 2BTFP 3IXHA 1BULA 1S0WA 4ZJ3A 1XJ2A 5HPFA 2LB9A 1Y54A 2M1CA 3S7OA 2XD5A 2DNSA 4O0PA 5L2FA 2PYRA 4OVDA 4X1LA 3CUEA 3Q7VB 2C6WB 4JF5A 2JBFA 5FASA 3WS5A 2XEPA 2PU2A 3BY8A 4JF4A 1L0GA 2D01A 4KZ9A 1AXBA 5HW3A 3LIBA 2K2NA 1OTAA 3NDGA 2W3FA 2UV0E 3PBSA 5CEBA 2I9VA 3IT9A 3N7WA 1MWTA 1H8MA 4RX2A 3PBNA 5DTSA 4ZBEA 3HJIA 4MEZA 3LR3A 5F5YA 4NETA 2DRWA 4UA7A 4EUZA 2DMWA 4U0XA 3RH8B 1PZOA 1K56D 3KSIA 5CRFA 2OV5A 2B18A 2HJEA 1WYCA 2ZD8A 1DJAA 5FAOA 2Y2JA 5J7EA 3BQAA 4KG5A 2E8JA 2Z2MB 4U3TA 1IYQA 4I3JA 4WBGA 2IWBA 2Y2PA 1KDWA 2PBYA 1UWPX 2O9BA 3ICYA 4WM9A 5F6AA 1NRFA 1ACFA 4ZDXA 5IU1A 5F82A 3RXWA 4S2MA 4IHQA 2O9AA 1YKDA 3LYXA 4DRTA 4OPRA 1EROA 3KYEA 3LGOA 4HNBA 3T1SA 1YLYA 4GDNA 4G3VA 1OT9A 2MJ6A 5CGXA 3ITAA 4WMCD 1SDNA 2W1RA 4L9FA 2Y2QA 2PR5A 4QHCA 3AGFA 2OWHA 5HSQA 2QJ7A 1E25A 3IF6B 2EXAA 5FAQA 5U47A 4WL9A 4Y17A 1PYYA 1JNUA 5FQQA 3TRCA 3ZVWA 3TE8A 1F9IA 1MKIA 2WGWA 1FR6A 1I2WA 4DE0A 3CI6A 4LCMA 4L9GA 3LCEA 4LGWA 5TBMA 4WUJA 1G5UA 2FFFB 3MQOA 5TGFA 2VGLS 1QMEA 1K54C 1FCOA 1S1YA 1MWRA 2O0YA 1S6RA 3B3XA 1VETA 3NOUC 3LIAA 2ZQ9A 2VX8A 4II7A 4QWOA 5J3WA 2A2LA 4GD6A 1LI9A 3LR4A 3DBAA 3OOVA 5LBRA 4JXSA 1UGUA 4H6JB 3LEQA 1VM1A 3T4SA 5EVIC 1W5DA 4E3NA 5FSRA 5EOOA 2HJ9C 5GHZA 3PAEA 2Q9MA 2A49A 3JVVA 4LV1A 3PBQA 2WKQA 4O8GA 2XR0A 4CLCB 1BT5A 3VP2A 1H0MA 5KIZA 4CPKA 5E2FA 4F94A 1AWIA 5CECA 5D3OA 3EGDC 3NBLA 4WZ5C 2BASA 5EOEA 3UB8A 4OQGA 5FI2A 3A0RA 3FV7A 4R3JA 3OBFA 3CITA 4ZAMA 3IX3A 4R38A 3A0SA 4C3QA 1HLUP 4JGRA 2I72A 2H10A 1KE3A 4KZ8A 3H7WA 3C8CA 3ZGAB 3GECA 3GRJA 3HL9A 2EWVA 1IYSA 5M18A 2H0TA 2OAQ1 3E4QA 4P6ZM 4EESA 4X55A 1YSPA 3GQZA 2WKHA 2UWXA 3G2YA 2EA9A 2JC7A 5G4YA 3VOLA 4NKPA 3LFVA 3G6OA 3VOYA 3C7UA 4X25A 2V20A 1Q2QA 4GKUA 1ONHA 3F1OA 3H7WB 3HREA 2WADA 3SH9A 4P87A 4E3KA 2EWWA 5CHUA 3JPUA 1S67L 1JWZA 1FOFA 2WZZA 5I5LA 1PZPA 4UAAA 3RJUA 3UMEA 1LLBA 5HDSA 2XFSA 1S4RA 3S1YA 1A0KA 3P09A 1NJ4A 3ZNYA 1SZVA 3DTMA 1FIKA 1TS8A 3CMZA 4Y0UA 5I94A 1S4SA 3IS2A 4E3OA 2KLIA 1W79A 1OTIA 4EEPA 2ZQ7A 1YAXA 3OCLA 3V3RA 1KVLA 2XLNA 4MMNA 4PHTA 1N9NA 3KO6A 2XF3A 5DJUA 1SHVA 4EQ1A 2K31A 4UA6A 2XDMA 1IKGA 3V5MA 5EM0A 1ES4A 3CPTB 2QYBA 5F83A 1T1AA 5HZHA 1BUEA 4GS9B 1FSYA 1XJ6A 2QPNA 4MBKA 3FYZA 4O7DA 1D1JA 3UDIA 4BWIA 3MQ0A 1EW0A 1IOUA 4OQIA 1ALQA 2PU4A 5FQIA 3VSLA 5C5KA 1JTGA 2ZMAA 1XJ3A 3CHWP 3QP8A 1DP9A 2PD7A 4Q0IA 2BG1A 1FR1A 2Q9NA 3EQVA 3UDFA 2ZL1A 3HLEA 4QY6A 4UA9A 1O07A 5EVIA 4IVKA 4WEJA 1OMEA 3IBJA 2GX5A 3E2KA 1P9WA 4GB7A 3S7QA 1G6AA 1W8YA 4ARZB 4YOFA 3FKWA 4R0QA 3UDXA 4Y7PA 3WRZA 3BFEA 1K6SA 4BL2A 1YLWA 3SS5A 3ULFA 2V1BA 4C6YA 4XT2A 3VP3A 5HARA 2OLUA 2W1TA 3MR0A 4NK3A 3EEAA 1ZHHB 3BFCA 1BLHA 5GLCA 2XGNA 3ZG0A 3G31A 3OPPA 1JTDA 3NOPC 3K2NA 1HTZA 2JE5A 2ZMFA 2VLGA 3PBRA 5DKKA 4HJ3A 3Q7VA 2Y2LA 2HPBA 2W3DA 4DN0A 1T1CA 2WAEA 4EXOA 2PR6A 3WRTA 2W3GA 1E3UA 2JKGA 3T4OA 5A92A 1WE4A 2B5RA 2PRFA 2ZM0A 1IELA 4KZ5A 4KZ3A 1Z6FA 2Y2HA 5L10A 1VB6A 4KQQA 5A93A 3C5AA 4P6BA 1WYBA 4ZTKA 5JYPA 1G28A 1K56A 2QZ6A 2Y2KA 4RA7A 3UMDA 5CEDA 1GSXA 2FFYA 4Y0TA 2HDUA 2PD8A 3ISGA 4HP9A 2NUPC 1NWZA 2A24B 2ZJ9A 2Y79A 3KYZA 3MFXA 4UQIM 1TEMA 3C2WA 2PHYA 2V0WA 4JXGA 5HWVA 1NLYA 1PIOA 2X71A 5A91A 3L9KA 1TS0A 2HV1A 4EW7A 1Y28A 2PDRA 3JVUA 5EUAA 2C5WB 1IFQA 3VOZA 5FL3A 5EVEA 1YLTA 2IWCA 3IX8A 3G34A 3T4TA 2IWDA 1K6RA 3UB7A 1CQAA 4JLFA 1CEGA 5GHXA 3NC8A 4LRXC 3PHYA 1C3BA 4XUXA 5TBMB 2KOIA 3IXDA 3PR6A 4K0WA 4EWFA 1P0ZA 2H28A 4I3AA 3LR5A 3ZCZA 4IUKA 2ZC4B 4S2LA 5FQ9A 3BECA 2GZAA 5HD3A 3V50A 2VZWA 3LI8A 1ES3A 1EI5A 3TJZC 5HD5A 1MWSA 5M19A 2K7SA 4WF0A 4RVAA 4GJ4A 2XQZA 4EBLA 4HH3A
chains in the Genus database with same CATH topology
3ZQ5A 1S1YA 2O0YA 3KYQA 2JN7A 2XA7S 2JKRM 3NOUC 5DKLA 2YKHA 3LIAA 1NRJA 3LUQA 4K08A 4KUOA 2INWA 2VX8A 4LRZE 2V0UA 4II7A 4Q0JA 5J3WA 2A2LA 3OCNA 5EFWA 4IJGA 3LR4A 3DBAA 3OOVA 5LBRA 3UE6A 2OWJA 5A8BA 1UGUA 4H6JB 4QPRA 4NXGA 3T4SA 4GLQA 3MQQA 2NUTC 2HF6A 3B47A 1TS6A 4Z1WA 3R7WB 3PXPA 3LICA 5AVEA 2HJ9C 2VA0A 2B02A 2ZOHA 4MDZA 3H9WA 3JVVA 4JGPA 1KOUA 2VGLM 2KX6A 1WA9A 3PBQA 4M4XA 3TW8A 4BMWA 2OAP1 2WKQA 2ZOIA 4O8GA 4CLCB 1OJ5A 5HL6A 1G6OA 5KIZA 3E4OA 3BW6A 4L0LA 1BYWA 1LSWA 3EGDC 4H6JA 2O9CA 3SW1A 1H3QA 5HDCA 2BASA 3EGXC 4I3IA 3UB9A 3R7WA 3HCYA 5HWWA 3UB8A 3F1NA 3A0RA 4OOMA 1TS7A 3O5YA 4GHIA 4JGQA 3BQ8A 3OBFA 3CITA 4PKYG 1LL8A 4R38A 3A0SA 4WELA 2QHKA 4KUKA 4JGRA 2VJWA 3F1OB 3H7WA 3C8CA 4CLCA 4Y3IA 3GECA 4MCWA 4GW9A 2EWVA 4HY8A 1T18A 4MN5A 4BJPA 4NXEA 5DJTA 1ODVA 2OAQ1 3E4QA 3FPVA 3KSGA 4P6ZM 4EESA 1V9ZA 1YSPA 2VV6A 5J4EA 3LIFA 5AJGA 5IS1A 2EA9A 5F68A 1D06A 5G4YA 3VOLA 3PYPA 4NKPA 4BBVA 2GNXA 3LFVA 3F1NB 3G6OA 4GHIB 3B42A 4HJ4A 4HP4A 1X0OA 3UE3A 3D3OA 5L8MA 2VV8A 5KSHA 5F69A 4I38A 1DP8A 3PBOA 3F1OA 3KX0X 3MF0A 3H7WB 2P7JA 1DRMA 4B9OA 3CAXA 2EWWA 2R78A 4HQAA 2W3HA 3T4JA 1S67L 1NLZA 4WEKA 2JKRI 5I5LA 4Y5FA 3NJAA 4CLCD 2ZBBA 3UMEA 3IBRA 4ETXA 5HDSA 4HI4A 1S4RA 2CMNA 2Z6DA 1TF1A 3GDIA 2FZ0A 2IA2A 4NXBA 3S7NA 3B33A 4HHDA 2M7VA 3CLOA 4PAUA 1TS8A 2VV7A 2XRNA 3H82B 1S4SA 3P7NA 2XA7M 1LT0A 4WLAA 4DMZA 3IS2A 2KLIA 1T19A 3OC2A 4UEYA 5HPIA 1LSXA 1OTIA 5HDDA 3F1PB 4EEPA 4G3WA 1YAXA 3EQUA 3OCLA 4I39A 4PHTA 4MMNA 1D7EA 1N9NA 3KO6A 5DJUA 3W2ZA 2J3WA 2V9AA 2W0NA 1YSQA 4LLOB 1V9YA 4B93A 4EQ1A 1W63M 2K31A 1MC0A 1T1BA 4BBTA 5HWTA 3UB6A 4PKYA 1ZTUA 4G3KA 3H82A 2J3TD 2QYBA 3LI9A 3IS2B 2GJ3A 1T1AA 4BBUA 4DJ2A 3T4LA 5HZHA 4P6ZS 2Y8HA 4YNRA 4CQHA 3F1PA 1VHMA 3C38A 2P04A 1OPXA 2D02A 4GS9B 2J80A 1XJ6A 1XFQA 3LR0A 1N9OA 4R3AA 2QKPA 1OTBA 4BWIA 3FPWA 3MQ0A 1EW0A 1GSVA 2L4RA 1IOUA 4HJ6A 4NXFA 4AFIA 1XJ4A 4E04A 3C30A 5C5KA 3NHQA 4LPZA 3PBTA 1XJ3A 4F3LB 2XSSA 3VE3A 4WN5A 2W27A 3FG8A 2WKRA 3A0VA 1F98A 1DP9A 2PD7A 1P97A 4Q0IA 1STZA 4R70A 4I5SA 4EERA 5DFXA 3EQVA 3OLOA 3E98A 4GS9A 3R4KA 4Q0HA 3D72A 2WKPA 4ZRRA 2W3EA 2XROA 4HH2A 2O99A 1N9LA 4XT2B 4WEJA 2QWSA 4GCZA 4UQIS 3IBJA 2GX5A 3VE4A 1P9WA 4RQ9A 3S7QA 3U2AA 4ARZB 3MXQA 4F3LA 4OOLA 2Z6CA 4YOFA 3HJKA 2FH5A 1TD5A 4FOFA 1XJ2A 5HPFA 1W63Q 2LB9A 2M1CA 3S7OA 3FC7A 5DF9A 4ME4A 3ULFA 3EEHA 2V1BA 4O0PA 2PYRA 2G7UA 3RTYA 4XT2A 4HIAA 3CUEA 2W1TA 3MR0A 3BWLA 3S7PA 3EEAA 4ARZA 2P08A 4Y2FA 1ZHHB 4YWZA 3BY8A 2D01A 4KQDA 2JKTI 5G4ZA 2HGVA 5TJJA 3LIBA 3NOPC 3K2NA 2K2NA 1OTAA 2ZMFA 3T4QA 2W3FA 3RFBA 4L9EA 3PBSA 2VLGA 3PBRA 5MC7A 2I9VA 5DKKA 4HJ3A 2W1TB 1H8MA 2W3DA 4DN0A 1OJGA 1T1CA 4EXOA 2PR6A 2ZMVA 3PBNA 1F5MA 2W3GA 2A24A 3HJIA 3T4OA 3LR3A 5F5YA 1LSVA 5CX7A 1MKMA 1MZUA 2DMWA 3RH8B 1VB6A 4ETZA 1GSWA 2PYPA 3KSIA 4EETB 2HJEA 2B18A 4EU0A 3CUEC 1G28A 3E0YA 4DJ3A 5DFYA 3UMDA 2M7UA 1GSXA 3P01A 5J7EA 3BQAA 2PD8A 2PT7A 4EEUA 4HP9A 2NUPC 3V67A 1XFNA 3EOIA 1NWZA 2A24B 4I3JA 4FSFA 2Y79A 2YKFA 3KYZA 3MFXA 4UQIM 3C2WA 1UWPX 2PHYA 2V0WA 2O9BA 3ICYA 5HWVA 1NLYA 1UWNX 2JHEA 5F6AA 5AVFA 2VEAA 5K5BA 3T4KA 5IU1A 1TS0A 2HV1A 3LIEA 4IHQA 2O9AA 2L1MA 4EW7A 1YKDA 3T50A 4HOIA 3LYXA 1Y28A 2JKTM 2PDRA 3JVUA 3KSHA 1OTDA 1IFQA 4IUHA 2QJ5A 4HNBA 4CLCC 1DP6A 3EWKA 2L0WA 5FL3A 4G3VA 4O01A 1OT9A 2MJ6A 3MMHA 1OT6A 3NOTC 2W1RA 4L9FA 3BJNA 1P9RA 3T4TA 3K3DA 2PR5A 3ZYTA 2KDKA 3UB7A 4LRXC 3PHYA 5TBMB 2KOIA 2OWHA 3PR6A 1P0ZA 2OOLA 5HSQA 2QJ7A 2H28A 3E4PA 4I3AA 3LR5A 4IUKA 2LB5A 4R6LA 2VKSA 4WL9A 1S1ZA 2GZAA 1JNUA 5HD3A 3K3CA 2VZWA 3TRCA 4KQOA 3LI8A 3LIDA 3TE8A 3VV4A 4CLCE 1F9IA 3BY9A 3CWFA 5IT5A 4LRYC 3TJZC 4JGOA 1S66L 3CI6A 2V1AA 4L9GA 2J3TC 5HD5A 4MN7A 3KSFA 5TBMA 2K7SA 4WUJA 4MN6A 4EUVA 4WF0A 3MQOA 3MJQA 4GJ4A 4NEED 4HH3A 1OTEA 2VGLS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZQ5 A;  3E0Y A;  3MF0 A;  5DFX A;  3E98 A;  2O0Y A;  5DFY A;  3R4K A;  3NOU C;  2M7U A;  2W3H A;  4Q0H A;  4LRZ E;  4ZRR A;  2W3E A;  2XRO A;  4Q0J A;  2O99 A;  5I5L A;  4Y5F A;  4IJG A;  2Y79 A;  3IBJ A;  2GX5 A;  3DBA A;  3OOV A;  3IBR A;  5LBR A;  4ETX A;  4QPR A;  3C2W A;  4RQ9 A;  3S7Q A;  1TF1 A;  2O9B A;  4YOF A;  4GLQ A;  4Z1W A;  2IA2 A;  2VEA A;  5K5B A;  3S7N A;  2M7V A;  1TD5 A;  2B18 A;  4PAU A;  2XRN A;  4FOF A;  4DMZ A;  4MDZ A;  2O9A A;  5HPF A;  2LB9 A;  1YKD A;  3S7O A;  2KLI A;  5HPI A;  4ME4 A;  3KSH A;  4O0P A;  4G3W A;  4O8G A;  4IUH A;  2G7U A;  5HL6 A;  4MMN A;  3KO6 A;  3W2Z A;  2W1T A;  3S7P A;  4G3V A;  1YSQ A;  4O01 A;  2O9C A;  3EEA A;  2K31 A;  3MMH A;  1MC0 A;  4Y2F A;  3NOT C;  2W1R A;  3BJN A;  3HCY A;  1ZTU A;  2HGV A;  4G3K A;  4LRX C;  3O5Y A;  2QYB A;  2KOI A;  3OBF A;  3CIT A;  5TJJ A;  2OOL A;  3NOP C;  3K2N A;  4EU0 A;  5HSQ A;  2K2N A;  2Y8H A;  2ZMF A;  4IUK A;  4YNR A;  4CQH A;  1VHM A;  2VJW A;  2W3F A;  2LB5 A;  4R6L A;  3RFB A;  2VKS A;  4Y3I A;  4MCW A;  5L8M A;  4GW9 A;  2W1T B;  2W3D A;  4DN0 A;  2VZW A;  3TRC A;  3KSG A;  3VV4 A;  4BWI A;  3MQ0 A;  1F5M A;  2W3G A;  1YSP A;  5AJG A;  4E04 A;  4LRY C;  5C5K A;  3NHQ A;  1MKM A;  3CI6 A;  3LFV A;  4MN7 A;  3G6O A;  2XSS A;  4ETZ A;  3KSF A;  4EUV A;  4Q0I A;  3KSI A;  1STZ A;  3D3O A;  4R70 A; 
#chains in the Genus database with same CATH topology
 2ZM8 A;  3A3J A;  5DKL A;  4K08 A;  3SOI A;  1YMS A;  2V0U A;  3LY3 A;  3UO9 A;  1ZG4 A;  1K38 A;  4Q0J A;  3WS0 A;  3D9Y A;  3OCN A;  5EFW A;  4IJG A;  1PI5 A;  3BEB A;  1RGZ A;  3UE6 A;  1TDL A;  5A8B A;  4NXG A;  4X53 A;  3GTC A;  4GLQ A;  3MQQ A;  1TS6 A;  5HAQ A;  3PXP A;  3LIC A;  5AVE A;  2ZOH A;  3QP2 A;  3H9W A;  1GA9 A;  4MDZ A;  4OLD A;  1VET B;  4OP5 A;  1Z09 A;  4QB8 A;  4XUZ A;  4BMW A;  2ZOI A;  1OJ5 A;  5HL6 A;  3E4O A;  1N9B A;  4L0L A;  3DTK A;  1BLC A;  2Y2M A;  4R1G A;  3CZD A;  3G35 A;  3Q7Z A;  3SW1 A;  5FI7 A;  4E3I A;  1VEU A;  3EGX C;  4I3I A;  3HCY A;  5HWW A;  5CER A;  4XXR A;  5KMW A;  3F1N A;  4OOM A;  4JGQ A;  3WS4 A;  4PKY G;  4KG2 A;  4WEL A;  2QHK A;  3HUN A;  2VJW A;  3ZHH A;  4MCW A;  1K57 A;  4NXE A;  4BQM A;  4Q8I A;  3BFG A;  2VV6 A;  3HUM A;  5TFQ A;  3LIF A;  3BM6 A;  2ZQA A;  3N8S A;  4DDS A;  1L0F A;  4DDY A;  2HDQ A;  1K25 A;  3IF6 C;  1ESU A;  4GHI B;  3MZE A;  1PW8 A;  1N4O A;  3B42 A;  4HJ4 A;  3UE3 A;  3D3O A;  2VV8 A;  1DP8 A;  3U4L P;  3MF0 A;  1MWU A;  3HBR A;  5CHM A;  4PM7 A;  2W3H A;  4MBF A;  1ERM A;  2WK0 A;  1NLZ A;  4WEK A;  2HP5 A;  3O88 A;  3NJA A;  3O3V A;  3ZG5 A;  4HES A;  3IBR A;  4ETX A;  5GLD A;  1Q2P A;  3IH9 A;  2FZ0 A;  2J9P A;  3SS4 A;  1YLJ A;  2ZC7 A;  3A3E A;  1HZO A;  4OQH A;  3MSH A;  2ZC6 B;  3H82 B;  3IWQ A;  3P7N A;  4WLA A;  1LT0 A;  4OON A;  5HAI A;  4UEY A;  2XK1 A;  4KG6 A;  2ZC3 B;  4IED A;  2VK3 A;  4G3W A;  5E2H A;  4KQR A;  1D7E A;  4GNU A;  1FQG A;  2J3W A;  4PM8 A;  4R3B A;  4B93 A;  4R4R A;  3NIA A;  3HLB A;  1MC0 A;  1Y4O A;  4UHU A;  3MKF A;  2V8F A;  4PKY A;  3UE0 A;  3HLF A;  2Y4A A;  1DJB A;  4IBR A;  1MBL A;  4LV2 A;  5HX9 A;  4B88 A;  3ZG9 B;  4BEN A;  5TR7 A;  1OPX A;  3DWK A;  2D02 A;  3SZT A;  3LR0 A;  1N9O A;  2ZL1 B;  4MNR A;  2EX6 A;  2WAF A;  3FPW A;  3HLG A;  2L4R A;  4NXF A;  3G2Z A;  4QU3 A;  3RXX A;  5FEG A;  1O7E A;  5E43 A;  3T1Q B;  3QP4 A;  3NEC A;  2XSS A;  3VE3 A;  2WKR A;  5BOH A;  3A0V A;  1XKZ A;  2QMI A;  3HLD A;  4R70 A;  3AGD A;  4I5S A;  3ZG7 B;  3QP6 A;  3OLO A;  3E98 A;  1YM1 A;  5EEC A;  3DW0 A;  2H5S A;  5JYO A;  2WKP A;  1L3L A;  2W3E A;  2XRO A;  4HH2 A;  2O99 A;  1LL5 A;  1IEM A;  5G18 A;  4UQI S;  3SH8 A;  1GHI A;  3W4O A;  3ZNT A;  3MXQ A;  5DF7 A;  3HJK A;  1TVF A;  3D4F A;  3IQA A;  4LV3 A;  2V2F F;  3PTE A;  2V1Z A;  4X69 A;  5DF9 A;  4ME4 A;  3EEH A;  1NY0 A;  3L7H A;  1PFL A;  3RTY A;  4KZB A;  4PMA A;  3MXS A;  4P85 A;  1CJF A;  2PBD P;  2VGK A;  3BWL A;  1HD8 A;  4ARZ A;  5DTT A;  2P08 A;  1YT4 A;  3W4Q A;  2R9X A;  4KQD A;  2P74 A;  2HGV A;  2R9W A;  3IXG A;  3IWI A;  1J9M A;  5TJJ A;  5L09 A;  4L9E A;  1SKO B;  3QNC A;  4N92 A;  2Y2G A;  1YLP A;  1YPR A;  2ZC5 B;  2OLV A;  4E3L A;  2ZMV A;  1F5M A;  3ZVT A;  2GDN A;  3BFF A;  5AQ7 A;  3P98 A;  1GHM A;  1E3U D;  5FAT A;  5CX7 A;  1MKM A;  1MZU A;  4BL3 A;  3GVB A;  3W4P A;  4ETZ A;  2Y59 A;  2PYP A;  1QMF A;  1K0K A;  3E0Y A;  1PI4 A;  5CTM A;  1NYY A;  1NZU A;  3CG5 A;  3LO7 A;  3PAG A;  3LY4 A;  3P01 A;  3VP4 A;  2PT7 A;  4EEU A;  3DTI A;  3V67 A;  1XFN A;  3EOI A;  4FSF A;  2YKF A;  1NXY A;  1CF0 A;  1K4F A;  2P9V B;  3WS1 A;  3VP1 A;  3FWL A;  1UWN X;  2JHE A;  4X1M A;  5FDH A;  3G32 A;  3ITB A;  3GMW A;  1KE4 A;  3Q82 A;  2L1M A;  1YLZ A;  3MS6 A;  3T50 A;  4HOI A;  5A90 A;  2JKT M;  3NUL A;  1XPB A;  1OTD A;  1CK3 A;  4IUH A;  2QJ5 A;  1FSW A;  4CLC C;  1DP6 A;  4EQI A;  5CXW A;  4LCL A;  4O01 A;  4S2O A;  4WMC A;  1BLP A;  1OT6 A;  3NOT C;  4FUW A;  3N4I A;  1H5X A;  3DAV A;  3K3D A;  3ZYT A;  4KZ6 A;  1L0E A;  3G4P A;  4BLM A;  1CI8 A;  3VSK A;  3M6H A;  3TG9 A;  4PM6 A;  2LB5 A;  4R6L A;  4R23 A;  2VKS A;  2XH9 A;  3DWZ A;  2JCH A;  4OPQ A;  5L07 A;  5DF8 A;  3VV4 A;  3LID A;  4CLC E;  3NCK A;  2ACG A;  3ZG8 B;  4S2N A;  3CWF A;  1W7F A;  5IT5 A;  4JGO A;  1S66 L;  2V1A A;  1L2S A;  2J3T C;  4MN7 A;  3KSF A;  4NEE D;  4PPR A;  1W8Q A;  3ZQ5 A;  1ERQ A;  3KYQ A;  4OOY A;  1E4D A;  4Y13 A;  3HVF A;  2H0Y A;  2J9O A;  4LRZ E;  2INW A;  3T1R A;  4S2N C;  4DF6 A;  4QD4 A;  1MXO A;  1FCM A;  5FAP A;  2NUT C;  2HF6 A;  4FH2 A;  3B47 A;  1ESI A;  3R7W B;  3WWX A;  3IXB A;  2VA0 A;  3QHY A;  3MBZ A;  4JGP A;  5GLB A;  3BLM A;  2AVX A;  3C4O A;  4X68 A;  3W8K A;  2OAP 1;  1IYO A;  1G6O A;  3BW6 A;  3QNB A;  1LSW A;  2Y2O A;  1K55 A;  1IYP A;  2O9C A;  1H3Q A;  5HDC A;  4LEN A;  1SCW A;  3A3F A;  3QP5 A;  4RX3 A;  3UB9 A;  3R7W A;  5M1A A;  1IKI A;  4DE3 A;  1SKF A;  3O5Y A;  4KUK A;  5KZH A;  5FQJ A;  4P0M A;  4DXC A;  2X01 A;  4CLC A;  4MN5 A;  4HY8 A;  3S4X A;  1T18 A;  5AQB A;  1SDE A;  2G2W A;  4E6X A;  1H8Z A;  3FPV A;  3UPO A;  1LI0 A;  5E2E A;  5HFO A;  5IS1 A;  4LFU A;  3A3I A;  5F68 A;  1D06 A;  3PYP A;  2GNX A;  5CHJ A;  2V8C A;  5HAP A;  4HP4 A;  4YFM A;  3UB5 P;  2XFT A;  5F69 A;  5KSH A;  4I38 A;  3KX0 X;  2P7J A;  4B9O A;  3CAX A;  2R78 A;  4HQA A;  3T4J A;  5DVA A;  5FDS A;  2E8I A;  4Y5F A;  1XX2 A;  4CLC D;  5J8X A;  2ZBB A;  1GA0 A;  3GDI A;  2X02 A;  4OPY A;  4S2K A;  4OQ0 A;  4JKT A;  3S7N A;  3ZFZ A;  2M7V A;  4FH4 A;  4PAU A;  2XRN A;  4H8R A;  3M2K A;  2XA7 M;  5FQK A;  1KDS A;  4JXW A;  1KGE A;  1T19 A;  5HPI A;  2CC1 A;  2HDS A;  2WUQ A;  4KZA A;  3EQU A;  4I39 A;  1K4E A;  4OKP A;  3BFD A;  1BLS A;  1CI9 A;  2W0N A;  1YSQ A;  2ZQ8 A;  2EFX A;  4DXB A;  3UB6 A;  4DE1 A;  1ZTU A;  4G3K A;  5CGS A;  2J3T D;  3LI9 A;  3IS2 B;  1FIL A;  2GJ3 A;  4BBU A;  4DJ2 A;  3OZH A;  4YNR A;  4CQH A;  2BLS A;  1VHM A;  3C38 A;  2P04 A;  5EM1 A;  2Q0O A;  3UPP A;  2HP6 A;  4R3A A;  1XGJ A;  5EVI B;  1OTB A;  2B95 A;  4IVI A;  1GSV A;  4HJ6 A;  3NHQ A;  4F3L B;  1L0D A;  3CPT A;  1VQQ A;  1ES5 A;  2W27 A;  3FG8 A;  1STZ A;  4EER A;  4WZ5 A;  2J8Y A;  4KZ4 A;  4XT2 B;  3OPR A;  2A3U A;  2QWS A;  4GCZ A;  4FTX A;  1RCJ A;  3VE4 A;  4ID4 A;  3U2A A;  4F3L A;  4OOL A;  2Z6C A;  5FEF A;  4GN2 A;  2FH5 A;  1CEF A;  1TD5 A;  1ZG6 A;  4FOF A;  4BD1 A;  5E2G A;  2EX9 A;  1W63 Q;  3FC7 A;  4OLG A;  2G7U A;  1KVM A;  4HIA A;  1HVB A;  4OH0 A;  4QY5 A;  2WGV A;  4N9K A;  3S7P A;  3FKV A;  4Y2F A;  4YWZ A;  1FCN A;  4GZB A;  1GHP A;  2WKI A;  2JKT I;  4KZ7 A;  5G4Z A;  4IBX A;  4PM5 A;  4OPZ A;  1TDG A;  5KSC A;  1MPL A;  3T4Q A;  3RFB A;  3MFD A;  3V39 A;  5MC7 A;  2HP9 A;  2ZLY A;  3WS2 A;  2W1T B;  5AQ9 A;  1OJG A;  4HBU A;  2EX2 A;  5FI6 A;  2A24 A;  3GSG A;  4GOG A;  3V3S A;  2P9V A;  1LSV A;  1GCE A;  3DTE A;  4X56 A;  4KEN B;  1GSW A;  3LEZ A;  2WZX A;  3VFF A;  4K0X A;  4EET B;  4EU0 A;  3CUE C;  4DJ3 A;  1JWP A;  1SKO A;  4JBF A;  2EXB A;  2OSU A;  5DFY A;  2HDR A;  1XP4 A;  2M7U A;  1RP5 A;  5GHY A;  1PRQ A;  4R4S A;  4B4Z A;  1J3W A;  5AQA A;  4S2I A;  3MKE A;  2WYX A;  1PNE A;  3UN7 A;  3AGE A;  1I5Q A;  4HEF A;  5AVF A;  2VEA A;  5K5B A;  3T4K A;  3ZDJ A;  3LIE A;  4N1H A;  3GR2 A;  4LV0 A;  5EE8 A;  3KSH A;  1KE0 A;  3IF6 A;  5EV0 A;  1M6K A;  4RYE A;  3EWK A;  4X6T A;  2L0W A;  3MZF A;  3HUO A;  1XXM A;  3MMH A;  3OPL A;  3BJN A;  2WGW B;  1P9R A;  2Y91 A;  2KDK A;  4K91 A;  1ZKJ A;  5HL1 A;  1H8Y A;  1KGF A;  2OOL A;  3BLS A;  3E4P A;  4E3J A;  1PWG A;  1U60 A;  3Q81 A;  4FCF A;  4EBP A;  3Q1F A;  4U0T A;  1S1Z A;  1G68 A;  4A5R A;  3K3C A;  2JKF A;  4KQO A;  3UNW A;  4DE2 A;  2EX8 A;  3JYI A;  1K55 C;  4ZJ2 A;  2RL3 A;  3BY9 A;  4WZ4 A;  5DTK A;  4LRY C;  2Z2L B;  2PAV P;  2WGI A;  4MN6 A;  4EUV A;  4D60 A;  3MJQ A;  2RCX A;  3NDE A;  1OTE A;  4YIN A;  2XD1 A;  2JN7 A;  2XA7 S;  2JKR M;  3SH7 A;  2YKH A;  1NRJ A;  3LUQ A;  4KUO A;  5GL9 A;  2ZM2 A;  3QP1 A;  3N6I A;  4GD8 A;  1BZA A;  1BSG A;  2OWJ A;  4QPR A;  4Y15 A;  1JVJ A;  4E3M A;  3VP0 A;  2HZ5 A;  4Z1W A;  2B02 A;  3A3D A;  1KOU A;  2VGL M;  2KX6 A;  1WA9 A;  4EBN A;  4MLL A;  1EWZ A;  4JF6 A;  4M4X A;  3TW8 A;  3O86 A;  1BYW A;  4H6J A;  5EVI D;  4JPM A;  2Y2I A;  2DCF A;  3M6B A;  3IHA A;  1LL9 A;  1LHY A;  3HLC A;  5GLA A;  1TS7 A;  4GHI A;  4WYY A;  3BQ8 A;  4OP8 A;  1LL8 A;  2ZQD A;  3UE1 A;  3IHB A;  4B4X A;  2VGJ A;  3F1O B;  3BYD A;  4E6W A;  4Y3I A;  4GW9 A;  5EPH A;  3IF5 A;  4BJP A;  5DJT A;  3FZC A;  1YMX A;  1ODV A;  4ESP A;  3KSG A;  4N9L A;  3BRM A;  1V9Z A;  1K57 C;  5J4E A;  3MZD A;  5AJG A;  1VEU B;  4GDB A;  1PWC A;  4BBV A;  3F1N B;  4ZJ1 A;  3GV9 A;  3I7J A;  1DY6 A;  4DKI A;  1X0O A;  3CJM A;  5L8M A;  3IH8 A;  3UPN A;  1M40 A;  3PBO A;  4HBT A;  4JXV A;  1DRM A;  3SS3 A;  4M3K A;  5EVL A;  2ZQC A;  3NY4 A;  4N1X A;  2JKR I;  3HLW A;  5FQM A;  2Y55 A;  4MBH A;  3O87 A;  2Y2N A;  4HI4 A;  2CMN A;  2Z6D A;  1TF1 A;  3C7V A;  5IHV A;  4CJN A;  1ONG A;  3T12 B;  5F1F A;  2IA2 A;  4NXB A;  3B33 A;  4HHD A;  3OPH A;  3CLO A;  2VV7 A;  4QJG A;  3TSG A;  3MXR A;  2G2U A;  4DMZ A;  3OC2 A;  1LSX A;  5HDD A;  4PM9 A;  1BTL A;  3F1P B;  3VFH A;  1YQS A;  3G30 A;  3W2Z A;  1XGI A;  2V9A A;  1KGG A;  4LLO B;  1V9Y A;  1W63 M;  1ZC2 A;  1T1B A;  4S2P A;  4BBT A;  5HWT A;  3M2J A;  4FD8 A;  4BD0 A;  4C75 A;  4Z9Q A;  4NG2 A;  3VMA A;  3H82 A;  1NZO A;  1XA7 A;  3T4L A;  3N8L A;  1NYM A;  4P6Z S;  2Y8H A;  1ES2 A;  3F1P A;  1PW1 A;  5CTN A;  2WKE A;  1JWV A;  5FA7 A;  2J80 A;  1XFQ A;  3NI9 A;  2QKP A;  5F1G A;  1XA1 A;  5CGW A;  4AFI A;  1XJ4 A;  4E04 A;  3C30 A;  1K54 A;  4LPZ A;  3PBT A;  1DJC A;  3N8R A;  3E2L A;  4WN5 A;  1MY8 A;  1F98 A;  1P97 A;  1RGY A;  3Q07 A;  3UY6 A;  1F2K A;  5DFX A;  4GS9 A;  3IWO A;  3T1X A;  2J7V A;  3S22 A;  2EFU A;  3R4K A;  4Q0H A;  3D72 A;  3C4P A;  4ZRR A;  1N9L A;  3TOI A;  3IX4 A;  1I2S A;  4D2O A;  4RQ9 A;  4S2J A;  4EV4 A;  1PWD A;  4Y0O A;  2BTF P;  3IXH A;  1BUL A;  1S0W A;  4ZJ3 A;  1XJ2 A;  5HPF A;  2LB9 A;  1Y54 A;  2M1C A;  3S7O A;  2XD5 A;  2DNS A;  4O0P A;  5L2F A;  2PYR A;  4OVD A;  4X1L A;  3CUE A;  3Q7V B;  2C6W B;  4JF5 A;  2JBF A;  5FAS A;  3WS5 A;  2XEP A;  2PU2 A;  3BY8 A;  4JF4 A;  1L0G A;  2D01 A;  4KZ9 A;  1AXB A;  5HW3 A;  3LIB A;  2K2N A;  1OTA A;  3NDG A;  2W3F A;  2UV0 E;  3PBS A;  5CEB A;  2I9V A;  3IT9 A;  3N7W A;  1MWT A;  1H8M A;  4RX2 A;  3PBN A;  5DTS A;  4ZBE A;  3HJI A;  4MEZ A;  3LR3 A;  5F5Y A;  4NET A;  2DRW A;  4UA7 A;  4EUZ A;  2DMW A;  4U0X A;  3RH8 B;  1PZO A;  1K56 D;  3KSI A;  5CRF A;  2OV5 A;  2B18 A;  2HJE A;  1WYC A;  2ZD8 A;  1DJA A;  5FAO A;  2Y2J A;  5J7E A;  3BQA A;  4KG5 A;  2E8J A;  2Z2M B;  4U3T A;  1IYQ A;  4I3J A;  4WBG A;  2IWB A;  2Y2P A;  1KDW A;  2PBY A;  1UWP X;  2O9B A;  3ICY A;  4WM9 A;  5F6A A;  1NRF A;  1ACF A;  4ZDX A;  5IU1 A;  5F82 A;  3RXW A;  4S2M A;  4IHQ A;  2O9A A;  1YKD A;  3LYX A;  4DRT A;  4OPR A;  1ERO A;  3KYE A;  3LGO A;  4HNB A;  3T1S A;  1YLY A;  4GDN A;  4G3V A;  1OT9 A;  2MJ6 A;  5CGX A;  3ITA A;  4WMC D;  1SDN A;  2W1R A;  4L9F A;  2Y2Q A;  2PR5 A;  4QHC A;  3AGF A;  2OWH A;  5HSQ A;  2QJ7 A;  1E25 A;  3IF6 B;  2EXA A;  5FAQ A;  5U47 A;  4WL9 A;  4Y17 A;  1PYY A;  1JNU A;  5FQQ A;  3TRC A;  3ZVW A;  3TE8 A;  1F9I A;  1MKI A;  2WGW A;  1FR6 A;  1I2W A;  4DE0 A;  3CI6 A;  4LCM A;  4L9G A;  3LCE A;  4LGW A;  5TBM A;  4WUJ A;  1G5U A;  2FFF B;  3MQO A;  5TGF A;  2VGL S;  1QME A;  1K54 C;  1FCO A;  1S1Y A;  1MWR A;  2O0Y A;  1S6R A;  3B3X A;  1VET A;  3NOU C;  3LIA A;  2ZQ9 A;  2VX8 A;  4II7 A;  4QWO A;  5J3W A;  2A2L A;  4GD6 A;  1LI9 A;  3LR4 A;  3DBA A;  3OOV A;  5LBR A;  4JXS A;  1UGU A;  4H6J B;  3LEQ A;  1VM1 A;  3T4S A;  5EVI C;  1W5D A;  4E3N A;  5FSR A;  5EOO A;  2HJ9 C;  5GHZ A;  3PAE A;  2Q9M A;  2A49 A;  3JVV A;  4LV1 A;  3PBQ A;  2WKQ A;  4O8G A;  2XR0 A;  4CLC B;  1BT5 A;  3VP2 A;  1H0M A;  5KIZ A;  4CPK A;  5E2F A;  4F94 A;  1AWI A;  5CEC A;  5D3O A;  3EGD C;  3NBL A;  4WZ5 C;  2BAS A;  5EOE A;  3UB8 A;  4OQG A;  5FI2 A;  3A0R A;  3FV7 A;  4R3J A;  3OBF A;  3CIT A;  4ZAM A;  3IX3 A;  4R38 A;  3A0S A;  4C3Q A;  1HLU P;  4JGR A;  2I72 A;  2H10 A;  1KE3 A;  4KZ8 A;  3H7W A;  3C8C A;  3ZGA B;  3GEC A;  3GRJ A;  3HL9 A;  2EWV A;  1IYS A;  5M18 A;  2H0T A;  2OAQ 1;  3E4Q A;  4P6Z M;  4EES A;  4X55 A;  1YSP A;  3GQZ A;  2WKH A;  2UWX A;  3G2Y A;  2EA9 A;  2JC7 A;  5G4Y A;  3VOL A;  4NKP A;  3LFV A;  3G6O A;  3VOY A;  3C7U A;  4X25 A;  2V20 A;  1Q2Q A;  4GKU A;  1ONH A;  3F1O A;  3H7W B;  3HRE A;  2WAD A;  3SH9 A;  4P87 A;  4E3K A;  2EWW A;  5CHU A;  3JPU A;  1S67 L;  1JWZ A;  1FOF A;  2WZZ A;  5I5L A;  1PZP A;  4UAA A;  3RJU A;  3UME A;  1LLB A;  5HDS A;  2XFS A;  1S4R A;  3S1Y A;  1A0K A;  3P09 A;  1NJ4 A;  3ZNY A;  1SZV A;  3DTM A;  1FIK A;  1TS8 A;  3CMZ A;  4Y0U A;  5I94 A;  1S4S A;  3IS2 A;  4E3O A;  2KLI A;  1W79 A;  1OTI A;  4EEP A;  2ZQ7 A;  1YAX A;  3OCL A;  3V3R A;  1KVL A;  2XLN A;  4MMN A;  4PHT A;  1N9N A;  3KO6 A;  2XF3 A;  5DJU A;  1SHV A;  4EQ1 A;  2K31 A;  4UA6 A;  2XDM A;  1IKG A;  3V5M A;  5EM0 A;  1ES4 A;  3CPT B;  2QYB A;  5F83 A;  1T1A A;  5HZH A;  1BUE A;  4GS9 B;  1FSY A;  1XJ6 A;  2QPN A;  4MBK A;  3FYZ A;  4O7D A;  1D1J A;  3UDI A;  4BWI A;  3MQ0 A;  1EW0 A;  1IOU A;  4OQI A;  1ALQ A;  2PU4 A;  5FQI A;  3VSL A;  5C5K A;  1JTG A;  2ZMA A;  1XJ3 A;  3CHW P;  3QP8 A;  1DP9 A;  2PD7 A;  4Q0I A;  2BG1 A;  1FR1 A;  2Q9N A;  3EQV A;  3UDF A;  2ZL1 A;  3HLE A;  4QY6 A;  4UA9 A;  1O07 A;  5EVI A;  4IVK A;  4WEJ A;  1OME A;  3IBJ A;  2GX5 A;  3E2K A;  1P9W A;  4GB7 A;  3S7Q A;  1G6A A;  1W8Y A;  4ARZ B;  4YOF A;  3FKW A;  4R0Q A;  3UDX A;  4Y7P A;  3WRZ A;  3BFE A;  1K6S A;  4BL2 A;  1YLW A;  3SS5 A;  3ULF A;  2V1B A;  4C6Y A;  4XT2 A;  3VP3 A;  5HAR A;  2OLU A;  2W1T A;  3MR0 A;  4NK3 A;  3EEA A;  1ZHH B;  3BFC A;  1BLH A;  5GLC A;  2XGN A;  3ZG0 A;  3G31 A;  3OPP A;  1JTD A;  3NOP C;  3K2N A;  1HTZ A;  2JE5 A;  2ZMF A;  2VLG A;  3PBR A;  5DKK A;  4HJ3 A;  3Q7V A;  2Y2L A;  2HPB A;  2W3D A;  4DN0 A;  1T1C A;  2WAE A;  4EXO A;  2PR6 A;  3WRT A;  2W3G A;  1E3U A;  2JKG A;  3T4O A;  5A92 A;  1WE4 A;  2B5R A;  2PRF A;  2ZM0 A;  1IEL A;  4KZ5 A;  4KZ3 A;  1Z6F A;  2Y2H A;  5L10 A;  1VB6 A;  4KQQ A;  5A93 A;  3C5A A;  4P6B A;  1WYB A;  4ZTK A;  5JYP A;  1G28 A;  1K56 A;  2QZ6 A;  2Y2K A;  4RA7 A;  3UMD A;  5CED A;  1GSX A;  2FFY A;  4Y0T A;  2HDU A;  2PD8 A;  3ISG A;  4HP9 A;  2NUP C;  1NWZ A;  2A24 B;  2ZJ9 A;  2Y79 A;  3KYZ A;  3MFX A;  4UQI M;  1TEM A;  3C2W A;  2PHY A;  2V0W A;  4JXG A;  5HWV A;  1NLY A;  1PIO A;  2X71 A;  5A91 A;  3L9K A;  1TS0 A;  2HV1 A;  4EW7 A;  1Y28 A;  2PDR A;  3JVU A;  5EUA A;  2C5W B;  1IFQ A;  3VOZ A;  5FL3 A;  5EVE A;  1YLT A;  2IWC A;  3IX8 A;  3G34 A;  3T4T A;  2IWD A;  1K6R A;  3UB7 A;  1CQA A;  4JLF A;  1CEG A;  5GHX A;  3NC8 A;  4LRX C;  3PHY A;  1C3B A;  4XUX A;  5TBM B;  2KOI A;  3IXD A;  3PR6 A;  4K0W A;  4EWF A;  1P0Z A;  2H28 A;  4I3A A;  3LR5 A;  3ZCZ A;  4IUK A;  2ZC4 B;  4S2L A;  5FQ9 A;  3BEC A;  2GZA A;  5HD3 A;  3V50 A;  2VZW A;  3LI8 A;  1ES3 A;  1EI5 A;  3TJZ C;  5HD5 A;  1MWS A;  5M19 A;  2K7S A;  4WF0 A;  4RVA A;  4GJ4 A;  2XQZ A;  4EBL A;  4HH3 A; 
#chains in the Genus database with same CATH homology
 3ZQ5 A;  1S1Y A;  2O0Y A;  3KYQ A;  2JN7 A;  2XA7 S;  2JKR M;  3NOU C;  5DKL A;  2YKH A;  3LIA A;  1NRJ A;  3LUQ A;  4K08 A;  4KUO A;  2INW A;  2VX8 A;  4LRZ E;  2V0U A;  4II7 A;  4Q0J A;  5J3W A;  2A2L A;  3OCN A;  5EFW A;  4IJG A;  3LR4 A;  3DBA A;  3OOV A;  5LBR A;  3UE6 A;  2OWJ A;  5A8B A;  1UGU A;  4H6J B;  4QPR A;  4NXG A;  3T4S A;  4GLQ A;  3MQQ A;  2NUT C;  2HF6 A;  3B47 A;  1TS6 A;  4Z1W A;  3R7W B;  3PXP A;  3LIC A;  5AVE A;  2HJ9 C;  2VA0 A;  2B02 A;  2ZOH A;  4MDZ A;  3H9W A;  3JVV A;  4JGP A;  1KOU A;  2VGL M;  2KX6 A;  1WA9 A;  3PBQ A;  4M4X A;  3TW8 A;  4BMW A;  2OAP 1;  2WKQ A;  2ZOI A;  4O8G A;  4CLC B;  1OJ5 A;  5HL6 A;  1G6O A;  5KIZ A;  3E4O A;  3BW6 A;  4L0L A;  1BYW A;  1LSW A;  3EGD C;  4H6J A;  2O9C A;  3SW1 A;  1H3Q A;  5HDC A;  2BAS A;  3EGX C;  4I3I A;  3UB9 A;  3R7W A;  3HCY A;  5HWW A;  3UB8 A;  3F1N A;  3A0R A;  4OOM A;  1TS7 A;  3O5Y A;  4GHI A;  4JGQ A;  3BQ8 A;  3OBF A;  3CIT A;  4PKY G;  1LL8 A;  4R38 A;  3A0S A;  4WEL A;  2QHK A;  4KUK A;  4JGR A;  2VJW A;  3F1O B;  3H7W A;  3C8C A;  4CLC A;  4Y3I A;  3GEC A;  4MCW A;  4GW9 A;  2EWV A;  4HY8 A;  1T18 A;  4MN5 A;  4BJP A;  4NXE A;  5DJT A;  1ODV A;  2OAQ 1;  3E4Q A;  3FPV A;  3KSG A;  4P6Z M;  4EES A;  1V9Z A;  1YSP A;  2VV6 A;  5J4E A;  3LIF A;  5AJG A;  5IS1 A;  2EA9 A;  5F68 A;  1D06 A;  5G4Y A;  3VOL A;  3PYP A;  4NKP A;  4BBV A;  2GNX A;  3LFV A;  3F1N B;  3G6O A;  4GHI B;  3B42 A;  4HJ4 A;  4HP4 A;  1X0O A;  3UE3 A;  3D3O A;  5L8M A;  2VV8 A;  5KSH A;  5F69 A;  4I38 A;  1DP8 A;  3PBO A;  3F1O A;  3KX0 X;  3MF0 A;  3H7W B;  2P7J A;  1DRM A;  4B9O A;  3CAX A;  2EWW A;  2R78 A;  4HQA A;  2W3H A;  3T4J A;  1S67 L;  1NLZ A;  4WEK A;  2JKR I;  5I5L A;  4Y5F A;  3NJA A;  4CLC D;  2ZBB A;  3UME A;  3IBR A;  4ETX A;  5HDS A;  4HI4 A;  1S4R A;  2CMN A;  2Z6D A;  1TF1 A;  3GDI A;  2FZ0 A;  2IA2 A;  4NXB A;  3S7N A;  3B33 A;  4HHD A;  2M7V A;  3CLO A;  4PAU A;  1TS8 A;  2VV7 A;  2XRN A;  3H82 B;  1S4S A;  3P7N A;  2XA7 M;  1LT0 A;  4WLA A;  4DMZ A;  3IS2 A;  2KLI A;  1T19 A;  3OC2 A;  4UEY A;  5HPI A;  1LSX A;  1OTI A;  5HDD A;  3F1P B;  4EEP A;  4G3W A;  1YAX A;  3EQU A;  3OCL A;  4I39 A;  4PHT A;  4MMN A;  1D7E A;  1N9N A;  3KO6 A;  5DJU A;  3W2Z A;  2J3W A;  2V9A A;  2W0N A;  1YSQ A;  4LLO B;  1V9Y A;  4B93 A;  4EQ1 A;  1W63 M;  2K31 A;  1MC0 A;  1T1B A;  4BBT A;  5HWT A;  3UB6 A;  4PKY A;  1ZTU A;  4G3K A;  3H82 A;  2J3T D;  2QYB A;  3LI9 A;  3IS2 B;  2GJ3 A;  1T1A A;  4BBU A;  4DJ2 A;  3T4L A;  5HZH A;  4P6Z S;  2Y8H A;  4YNR A;  4CQH A;  3F1P A;  1VHM A;  3C38 A;  2P04 A;  1OPX A;  2D02 A;  4GS9 B;  2J80 A;  1XJ6 A;  1XFQ A;  3LR0 A;  1N9O A;  4R3A A;  2QKP A;  1OTB A;  4BWI A;  3FPW A;  3MQ0 A;  1EW0 A;  1GSV A;  2L4R A;  1IOU A;  4HJ6 A;  4NXF A;  4AFI A;  1XJ4 A;  4E04 A;  3C30 A;  5C5K A;  3NHQ A;  4LPZ A;  3PBT A;  1XJ3 A;  4F3L B;  2XSS A;  3VE3 A;  4WN5 A;  2W27 A;  3FG8 A;  2WKR A;  3A0V A;  1F98 A;  1DP9 A;  2PD7 A;  1P97 A;  4Q0I A;  1STZ A;  4R70 A;  4I5S A;  4EER A;  5DFX A;  3EQV A;  3OLO A;  3E98 A;  4GS9 A;  3R4K A;  4Q0H A;  3D72 A;  2WKP A;  4ZRR A;  2W3E A;  2XRO A;  4HH2 A;  2O99 A;  1N9L A;  4XT2 B;  4WEJ A;  2QWS A;  4GCZ A;  4UQI S;  3IBJ A;  2GX5 A;  3VE4 A;  1P9W A;  4RQ9 A;  3S7Q A;  3U2A A;  4ARZ B;  3MXQ A;  4F3L A;  4OOL A;  2Z6C A;  4YOF A;  3HJK A;  2FH5 A;  1TD5 A;  4FOF A;  1XJ2 A;  5HPF A;  1W63 Q;  2LB9 A;  2M1C A;  3S7O A;  3FC7 A;  5DF9 A;  4ME4 A;  3ULF A;  3EEH A;  2V1B A;  4O0P A;  2PYR A;  2G7U A;  3RTY A;  4XT2 A;  4HIA A;  3CUE A;  2W1T A;  3MR0 A;  3BWL A;  3S7P A;  3EEA A;  4ARZ A;  2P08 A;  4Y2F A;  1ZHH B;  4YWZ A;  3BY8 A;  2D01 A;  4KQD A;  2JKT I;  5G4Z A;  2HGV A;  5TJJ A;  3LIB A;  3NOP C;  3K2N A;  2K2N A;  1OTA A;  2ZMF A;  3T4Q A;  2W3F A;  3RFB A;  4L9E A;  3PBS A;  2VLG A;  3PBR A;  5MC7 A;  2I9V A;  5DKK A;  4HJ3 A;  2W1T B;  1H8M A;  2W3D A;  4DN0 A;  1OJG A;  1T1C A;  4EXO A;  2PR6 A;  2ZMV A;  3PBN A;  1F5M A;  2W3G A;  2A24 A;  3HJI A;  3T4O A;  3LR3 A;  5F5Y A;  1LSV A;  5CX7 A;  1MKM A;  1MZU A;  2DMW A;  3RH8 B;  1VB6 A;  4ETZ A;  1GSW A;  2PYP A;  3KSI A;  4EET B;  2HJE A;  2B18 A;  4EU0 A;  3CUE C;  1G28 A;  3E0Y A;  4DJ3 A;  5DFY A;  3UMD A;  2M7U A;  1GSX A;  3P01 A;  5J7E A;  3BQA A;  2PD8 A;  2PT7 A;  4EEU A;  4HP9 A;  2NUP C;  3V67 A;  1XFN A;  3EOI A;  1NWZ A;  2A24 B;  4I3J A;  4FSF A;  2Y79 A;  2YKF A;  3KYZ A;  3MFX A;  4UQI M;  3C2W A;  1UWP X;  2PHY A;  2V0W A;  2O9B A;  3ICY A;  5HWV A;  1NLY A;  1UWN X;  2JHE A;  5F6A A;  5AVF A;  2VEA A;  5K5B A;  3T4K A;  5IU1 A;  1TS0 A;  2HV1 A;  3LIE A;  4IHQ A;  2O9A A;  2L1M A;  4EW7 A;  1YKD A;  3T50 A;  4HOI A;  3LYX A;  1Y28 A;  2JKT M;  2PDR A;  3JVU A;  3KSH A;  1OTD A;  1IFQ A;  4IUH A;  2QJ5 A;  4HNB A;  4CLC C;  1DP6 A;  3EWK A;  2L0W A;  5FL3 A;  4G3V A;  4O01 A;  1OT9 A;  2MJ6 A;  3MMH A;  1OT6 A;  3NOT C;  2W1R A;  4L9F A;  3BJN A;  1P9R A;  3T4T A;  3K3D A;  2PR5 A;  3ZYT A;  2KDK A;  3UB7 A;  4LRX C;  3PHY A;  5TBM B;  2KOI A;  2OWH A;  3PR6 A;  1P0Z A;  2OOL A;  5HSQ A;  2QJ7 A;  2H28 A;  3E4P A;  4I3A A;  3LR5 A;  4IUK A;  2LB5 A;  4R6L A;  2VKS A;  4WL9 A;  1S1Z A;  2GZA A;  1JNU A;  5HD3 A;  3K3C A;  2VZW A;  3TRC A;  4KQO A;  3LI8 A;  3LID A;  3TE8 A;  3VV4 A;  4CLC E;  1F9I A;  3BY9 A;  3CWF A;  5IT5 A;  4LRY C;  3TJZ C;  4JGO A;  1S66 L;  3CI6 A;  2V1A A;  4L9G A;  2J3T C;  5HD5 A;  4MN7 A;  3KSF A;  5TBM A;  2K7S A;  4WUJ A;  4MN6 A;  4EUV A;  4WF0 A;  3MQO A;  3MJQ A;  4GJ4 A;  4NEE D;  4HH3 A;  1OTE A;  2VGL S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...