3KO6A

Crystal structure of yeast free methionine-r-sulfoxide reductase ykg9 in complex with the substrate
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
176
structure length
176
Chain Sequence
STGFHHADHVNYSSNLNKEEILEQLLLSYEGLSDGQVNWVCNLSNASSLIWHAYKSLAVDINWAGFYVTQASEENTLILGPFQGKVACQMIQFGKGVCGTAASTKETQIVPDVNKYPGHIACDGETKSEIVVPIISNDGKTLGVIDIDCLDYEGFDHVDKEFLEKLAKLINKSCVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0067 GAF domain-containing protein YKL069W
publication title Crystal structure of yeast free methionine-R-sulfoxide reductase Ykg9 in complex with the substrate
rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
total genus 57
structure length 176
sequence length 176
chains with identical sequence B
ec nomenclature ec 1.8.4.14: L-methionine (R)-S-oxide reductase.
pdb deposition date 2009-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13185 GAF_2 GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3ko6A00
2O0YA 4MMNA 3E98A 3S7QA 1YSQA 4BWIA 4GLQA 4O8GA 4MDZA 4Q0HA 4Y5FA 2OOLA 4Z1WA 5HPIA 2LB9A 2Y8HA 3NHQA 2KOIA 2W3EA 2W1RA 4EUVA 4RQ9A 2O9BA 2LB5A 4EU0A 3O5YA 2M7VA 3ZQ5A 3OBFA 4ETXA 3NOTC 4MCWA 2XROA 2W3FA 3KSIA 2W3DA 4QPRA 3HCYA 3D3OA 4LRYC 5DFXA 4Y2FA 2GX5A 3OOVA 2IA2A 4IUKA 1STZA 5L8MA 4G3VA 2K31A 5HL6A 2W1TA 3CITA 2VKSA 4G3WA 4GW9A 3IBJA 4FOFA 4Y3IA 3EEAA 2VJWA 5I5LA 1YSPA 2G7UA 1TF1A 3MMHA 3TRCA 4IUHA 3E0YA 4O01A 3DBAA 3MF0A 5HSQA 4LRZE 3LFVA 2Y79A 4MN7A 2XRNA 2W1TB 3KSHA 4R6LA 4PAUA 4G3KA 5LBRA 2QYBA 2VEAA 4CQHA 2W3HA 5K5BA 4LRXC 2ZMFA 2VZWA 3C2WA 3G6OA 3K2NA 4ME4A 2KLIA 1YKDA 3KSFA 3NOUC 3KSGA 4DN0A 2W3GA 3BJNA 2B18A 1F5MA 3R4KA 1VHMA 5HPFA 4ZRRA 4ETZA 3S7OA 3S7PA 4DMZA 5AJGA 3MQ0A 3S7NA 1MC0A 2K2NA 5C5KA 2XSSA 5TJJA 4E04A 1TD5A 2O9AA 5DFYA 2M7UA 4R70A 3VV4A 4Q0JA 4YNRA 3KO6A 2O9CA 1MKMA 3CI6A 4Q0IA 4O0PA 1ZTUA 4IJGA 2HGVA 3W2ZA 2O99A 3IBRA 3NOPC 3RFBA 4YOFA
chains in the Genus database with same CATH superfamily
4WLAA 3G4PA 4HHDA 3E98A 4HY8A 1FCNA 5GHXA 1DP9A 3T4KA 3GVBA 3GR2A 4H8RA 2YKHA 1S66L 1ALQA 4HBTA 4UAAA 4JXSA 1YLZA 5A90A 4NXFA 5FASA 3VMAA 4BL2A 1I5QA 2O9BA 1TEMA 3UDFA 4XUZA 1N4OA 5F83A 5F69A 5DKLA 5DFXA 1XPBA 1K57C 1D7EA 4WF0A 5HD5A 2VGJA 5HAQA 1BTLA 2XFTA 1BLCA 5HL1A 4Y3IA 3M2KA 1I2SA 3ZHHA 1CJFA 2VV6A 3EQUA 4JLFA 2WKPA 1FR6A 3MZFA 4EEPA 4R4RA 2NUTC 5A91A 4I39A 1FOFA 1IOUA 1GHMA 3C2WA 3OLOA 3G6OA 4PPRA 1PW8A 1YKDA 4OPYA 4OPZA 2B18A 2VA0A 4LV3A 3W4OA 4KENB 3LIBA 1BLSA 3T4QA 3BQAA 5A8BA 2R9WA 4P6ZM 3VP0A 2FFYA 1RGYA 1P9WA 4NK3A 3UDIA 3LY3A 3RJUA 5JYPA 1PZPA 5AVFA 4B9OA 3LR0A 4OKPA 1BLHA 3U4LP 2J9PA 4RX2A 1VB6A 2WKEA 1WYBA 1L0FA 3V5MA 1XA1A 5I94A 1VETA 3UE1A 3RXWA 3GSGA 2FH5A 3IS2B 2Y91A 3BRMA 2BG1A 2QZ6A 3HL9A 2M7VA 3HJKA 2XROA 3BFFA 4Y13A 4KZ9A 3KYQA 3GV9A 3WS5A 3ZNTA 3T1XA 4X68A 3CITA 3H82B 4G3WA 4YFMA 3IBJA 1KE3A 4KG6A 1AWIA 4X55A 4DE3A 1GSVA 2WGVA 3H7WA 5JYOA 4MN5A 2PAVP 5EM0A 2V1AA 4X6TA 1YLYA 3F1PB 4C6YA 3Q7VB 2ZC7A 3L7HA 5F1FA 4ETZA 5MC7A 3CG5A 4E3IA 4DMZA 1NXYA 2HZ5A 1VQQA 4HNBA 2KX6A 2WADA 3N8LA 2Y2MA 3CUEC 3UPNA 1CEFA 2XDMA 4PM5A 2Y59A 3M6HA 3LCEA 3MZDA 4R38A 3CPTB 3FPWA 5E2EA 2B5RA 3G2YA 1IELA 2J3TD 1RCJA 1MY8A 2Y2HA 3R7WA 1L3LA 3NDEA 3D4FA 3VP1A 2Y2IA 1OTEA 1ONGA 1OTBA 4BWIA 1XJ6A 4MDZA 4O7DA 2P74A 5HWVA 1LLBA 3ZNYA 4PMAA 1PZOA 4IBXA 1MWTA 1UGUA 4Y17A 2V20A 2H5SA 2P08A 4RA7A 3IF6B 3OCNA 1MXOA 5GL9A 4LENA 2IA2A 3DTKA 2XA7M 4U0XA 2C5WB 1K4FA 4JGPA 5FQ9A 3TE8A 2JCHA 4KQDA 3WS4A 4KZ4A 1DJBA 3LIEA 1ES3A 3BLSA 1PI4A 3FG8A 4KUKA 4H6JA 3UMEA 4WZ4A 2OAQ1 1T1AA 2Y2PA 1NLYA 1TVFA 3WWXA 2D01A 2ZL1B 3G30A 4HBUA 1GHPA 2VZWA 3UNWA 2ZQ9A 1TS7A 3KSFA 2WGWA 2WZXA 4OPQA 4DN0A 2HP9A 1MWRA 4XT2B 4ZRRA 3A3IA 4F3LB 1YAXA 5TBMA 3CLOA 3ZG5A 3ICYA 3UDXA 1G6OA 4BD1A 4WYYA 2JHEA 2Y55A 1ZG6A 4NXEA 2GZAA 1GHIA 2V0WA 3S22A 1LI0A 1N9OA 3BFEA 5D3OA 2WKIA 3RFBA 4GS9B 4KZ6A 3HVFA 3PBOA 5G18A 3V39A 4BJPA 4R23A 1BT5A 4CPKA 4L9FA 4HEFA 5FQJA 3CUEA 2EX2A 1ES5A 2LB9A 4DF6A 1P0ZA 2JKFA 5FI2A 5F1GA 5FEFA 3MXSA 5DJTA 3OBFA 3B42A 3NOTC 1QMFA 2V1ZA 4MCWA 4S2OA 3W8KA 2ZM8A 3A0RA 1G6AA 3C5AA 4L0LA 4OONA 3TG9A 2ZC3B 3CHWP 5FAPA 3T1SA 4RX3A 2QHKA 3MQQA 1LT0A 4BBTA 4CJNA 1FILA 2EWVA 4HIAA 4JBFA 4N1HA 1JNUA 1LSXA 3ZFZA 4RYEA 3LEZA 1F9IA 2XRNA 5EPHA 2ZQ8A 5EVLA 3NC8A 2WKRA 5CHUA 5KSHA 4N92A 2ZC6B 3VSLA 3TW8A 5FL3A 4UQIM 1KOUA 2I72A 2E8JA 1PWDA 1OJ5A 3R4KA 1ODVA 4S2PA 3KX0X 5E2FA 1GSWA 2PYPA 3IF6C 5AJGA 2Y2KA 3VE4A 5CTMA 5U47A 1MC0A 3PAGA 4JGRA 5DFYA 4DJ2A 3P09A 1OT6A 3HJIA 4HP4A 3GQZA 4OP5A 3SW1A 5DF9A 2BASA 3EGXC 1W8QA 1E4DA 1LL8A 1NRFA 3SS4A 4MN6A 4XXRA 1YLWA 4ZAMA 3FKWA 3UB5P 4WELA 1IKGA 3EGDC 3VP4A 2G2WA 2Q0OA 4GDBA 1W5DA 3ULFA 1WA9A 4BBUA 3H82A 3DW0A 1NRJA 4ARZB 1Z6FA 5CGWA 4DDSA 5M18A 3Q81A 3QP1A 2K31A 5EFWA 4GW9A 3F1PA 1DP6A 1XA7A 4EBNA 4QD4A 3Q7VA 3FKVA 3NCKA 5IT5A 4FH2A 4OOYA 3A0SA 2A3UA 4MN7A 4M3KA 3BFDA 2QYBA 4R3AA 3T4SA 2UWXA 2PR6A 2H10A 5AQAA 2J8YA 3NOUC 1N9LA 3CPTA 4B4ZA 3A0VA 2ZM0A 4ID4A 2J9OA 5HDSA 3IT9A 5EVID 5GHZA 5EOOA 1PFLA 1TS0A 4DE1A 1U60A 3MZEA 2XFSA 4KUOA 4X56A 1K56D 4F94A 2HJEA 4S2MA 4Q0IA 1J9MA 2JKTI 1BZAA 4WZ5C 4FSFA 4D60A 5FAQA 4MMNA 2INWA 3IF6A 3VP2A 3B33A 1X0OA 1IYQA 2KOIA 1NLZA 4OVDA 1S1ZA 1PYYA 2WUQA 2Y4AA 3FZCA 3PBRA 3IXGA 1DJAA 3S4XA 1KDWA 5DF8A 5CHMA 5FATA 3LGOA 5DF7A 5L8MA 1IYSA 1H8MA 2J3TC 1NYMA 1L2SA 2ZL1A 3G35A 2A24B 1XKZA 2JE5A 1Z09A 4S2IA 4KZ5A 2EFXA 2DNSA 3LEQA 4X1MA 5AQBA 4LRZE 2XK1A 3TSGA 4F3LA 4ZTKA 3HLGA 2W3HA 5K5BA 4E6WA 3A3FA 4PM7A 1LSVA 3K3CA 4L9EA 3Q07A 1XP4A 3P01A 1YM1A 4LV0A 5DKKA 3GTCA 2ZLYA 3IX8A 3S7PA 3ZYTA 3F1OA 3MQ0A 2ZC5B 4GS9A 3UE6A 4EUZA 2HV1A 4ESPA 3C8CA 4R70A 1SCWA 3F1NB 4KG2A 1D1JA 3UPPA 4NKPA 4NXBA 3UN7A 1ZTUA 5IHVA 4A5RA 3IBRA 2JKRM 5A92A 2O0YA 4R3BA 1YQSA 1PNEA 1G68A 5EVEA 2Y2NA 5TR7A 4O8GA 4KG5A 3MJQA 3A3EA 3IWQA 4GN2A 1MWSA 2Y2QA 2P9VB 3RTYA 2IWDA 5CRFA 4JXWA 2R9XA 3HCYA 1ERMA 2XR0A 4WZ5A 2XLNA 2HPBA 1OPXA 3OPHA 1GA0A 5DVAA 1ZKJA 1OJGA 2G7UA 2DMWA 4I5SA 4N9LA 2EWWA 3IWOA 4OOLA 4R6LA 2PD8A 3FPVA 1KGGA 1MPLA 1TDGA 5G4YA 2HDSA 3FC7A 5KSCA 3OC2A 3K2NA 5E2GA 1Q2QA 5EVIB 3BJNA 3EWKA 2WZZA 3DTIA 4HH3A 2NUPC 3C4OA 4CLCB 1EWZA 4K0XA 3LR4A 3T4LA 2YKFA 3JVVA 2VLGA 3O3VA 4E04A 4DE0A 3HLDA 3ISGA 3LIFA 3KO6A 5EECA 3V3RA 5L2FA 1K57A 5EOEA 2QJ7A 4P85A 4JKTA 4O0PA 2GJ3A 3VOLA 1G5UA 3PBSA 4C75A 3BW6A 3E2KA 3NIAA 4QY6A 1PRQA 4LFUA 4ARZA 2VX8A 1YMSA 3VFHA 5FDHA 1EW0A 4Z1WA 5J8XA 3GMWA 5F6AA 3Q82A 3N4IA 3KYZA 3AGFA 5F82A 2MJ6A 3LICA 3ZQ5A 4X69A 4BD0A 1PI5A 4R1GA 4EEUA 3SH7A 1ACFA 1K25A 3BY9A 3KYEA 1S0WA 2Z6CA 5AQ7A 3E0YA 5BOHA 2W0NA 2G2UA 5CEBA 4B93A 3LFVA 2PDRA 4PM6A 4QHCA 2UV0E 2Y79A 1XGJA 3JYIA 1D06A 2ZQ7A 1UWPX 2JKTM 2VEAA 2OV5A 4RVAA 2CC1A 5GLCA 2IWBA 3WS0A 3UB7A 3A3JA 3LUQA 4R3JA 5DTTA 2FFFB 1JWVA 5HZHA 1F5MA 1EROA 3N6IA 3BLMA 1Y4OA 4Y0UA 3PAEA 2HP5A 1IKIA 2PU2A 4OOMA 1PW1A 2H28A 2K2NA 3ZVWA 4EWFA 3WRTA 3T50A 2ACGA 2O9AA 4QWOA 1SZVA 3HBRA 5J4EA 1F2KA 3UE3A 4JPMA 1T1CA 4LPZA 3K3DA 2H0TA 3HREA 4R0QA 3MSHA 2DRWA 1WE4A 1YSQA 4GKUA 1UWNX 5L09A 1JTDA 1L0GA 1K55C 1OT9A 3LIAA 1E3UA 5EVIC 4OH0A 1HZOA 1T1BA 4KZAA 4CLCC 2WAFA 4GDNA 3SZTA 1KVMA 1RP5A 4BL3A 3IHAA 3QHYA 2VKSA 1S6RA 3EEAA 1KGEA 3V67A 3M2JA 1OTIA 3G31A 5KIZA 4LLOB 4GD8A 2OWHA 4XUXA 2KDKA 4GOGA 2PT7A 4LRXC 2ZMFA 4HQAA 5FI7A 3D9YA 3C7VA 1S4SA 4U0TA 1HD8A 3T12B 2JN7A 1XX2A 2P7JA 3LYXA 1H3QA 4PKYG 4UEYA 4QJGA 3P98A 1P97A 2ZQDA 1NWZA 2WAEA 1W8YA 5FDSA 3S1YA 5G4ZA 1TD5A 2Y2GA 2Q9MA 3I7JA 3UMDA 2O9CA 4WN5A 4Z9QA 5DTKA 4E3LA 4QU3A 3VOZA 4YOFA 4IBRA 4ZDXA 3IXDA 4LCMA 1LI9A 3E4PA 4NXGA 4HESA 3E4QA 5HWTA 3E4OA 2QKPA 3FWLA 2W3EA 3W4PA 2BTFP 4EUVA 4FUWA 2LB5A 2WGIA 1BULA 3O5YA 4WMCA 2ZJ9A 3IS2A 2D02A 3O88A 3UB6A 1W79A 2W3DA 4EQ1A 3MKEA 4KQOA 3OOVA 2EX8A 1SDEA 3CWFA 4IVKA 1OTDA 5FAOA 1JTGA 1ONHA 1S1YA 4L9GA 2PU4A 3EOIA 3HLCA 3BYDA 5HX9A 1KVLA 4K08A 2EA9A 4E3MA 1AXBA 3HUNA 5F5YA 3H7WB 4OLDA 1K55A 2J3WA 1NZUA 3MKFA 5GLAA 5F68A 3DAVA 3VOYA 2W1TB 5CHJA 2A49A 5LBRA 4KQQA 4IEDA 3A3DA 4Y0TA 4E3NA 3V50A 1QMEA 2EFUA 3N8RA 1FCOA 5GLDA 4IVIA 1SKFA 5HPFA 1XJ2A 3LI9A 3WS2A 3S7OA 3OZHA 3QNCA 3E2LA 4N1XA 4GB7A 3OCLA 4P6ZS 2X01A 3HUMA 2GDNA 3BY8A 3MS6A 3FV7A 3NI9A 4BQMA 4KZ3A 3RH8B 4FTXA 1CK3A 1T18A 4D2OA 4II7A 4PM9A 2GNXA 2AVXA 2VGLM 2Z2LB 5AVEA 3S7QA 4UA7A 3QP2A 4Q0HA 1K54C 4DKIA 3BQ8A 1YMXA 1NYYA 2V8CA 2V8FA 2XD1A 1G28A 2OLVA 1CI9A 3C4PA 4X1LA 3BECA 2WK0A 4LRYC 4LCLA 3NY4A 2WKHA 5HFOA 1YT4A 3Q1FA 3IH9A 5HL6A 1TS8A 2B02A 2RL3A 1GCEA 1KE4A 5J7EA 2VJWA 3PHYA 3OPPA 2ZBBA 1DP8A 1XJ3A 3WS1A 4BLMA 4DXBA 1XFQA 4Y0OA 1RGZA 3IX4A 5FA7A 5FQMA 3TJZC 2ZC4B 3KSHA 1DY6A 2PHYA 2VV8A 4MBKA 4S2KA 2WGWB 1NY0A 5CXWA 1ZG4A 5TFQA 1IYPA 2QMIA 2KLIA 1CEGA 1A0KA 5TBMB 2Y2OA 1FQGA 4MLLA 3HLWA 2OAP1 1FR1A 1VM1A 3MFDA 1BLPA 3C7UA 3QP4A 4ZJ2A 4XT2A 3DTEA 4I3IA 4EQIA 3NJAA 4MBHA 3MXRA 3QP6A 4DXCA 4EW7A 1OTAA 2FZ0A 4IJGA 3IXBA 2O99A 3T1QB 2HDRA 3VFFA 4S2NC 4WBGA 2XD5A 3B47A 2VK3A 4GD6A 3LR5A 1H0MA 4MBFA 2JBFA 4KZ7A 3MFXA 4UA6A 3MR0A 4CLCE 1MWUA 2HP6A 4HH2A 4UA9A 2I9VA 3OPLA 1BSGA 2XA7S 5HW3A 1H8YA 2WKQA 1CI8A 3O86A 1LSWA 3N7WA 5TGFA 2V9AA 3L9KA 1K54A 4LGWA 5I5LA 3TRCA 4IUHA 5L10A 2W27A 1ESUA 3IHBA 1K4EA 2ZOIA 2HF6A 1ZC2A 2Z6DA 3M6BA 4PAUA 4NEED 1L0EA 4CQHA 4Y7PA 4X25A 5CERA 3O87A 4MEZA 1PIOA 1K0KA 4YINA 3BEBA 3PBNA 3AGDA 4Y15A 3S7NA 2QPNA 5TJJA 4NG2A 1NJ4A 3T4TA 1ESIA 1MZUA 4JXGA 4OLGA 3IQAA 5E43A 3LI8A 2L1MA 4DJ3A 2PBYA 2DCFA 3BM6A 2WYXA 4GHIB 4HP9A 2HGVA 3PYPA 3CMZA 3IH8A 5FQKA 5CTNA 4ZJ3A 4GLQA 1MBLA 3ZG7B 2R78A 1M6KA 5J3WA 4WM9A 5EE8A 3ITBA 3U2AA 4BBVA 4JXVA 2W3FA 3UPOA 4K91A 5HDCA 4S2JA 4G3VA 1K6SA 4LV1A 1V9ZA 4S2NA 2W1TA 3MXQA 2Q9NA 4E3JA 2ZM2A 1H8ZA 1VEUB 3PTEA 2ZD8A 4GNUA 4QB8A 3DBAA 4LV2A 2HJ9C 4I38A 3MBZA 4P87A 4EESA 4WEKA 5EUAA 1GA9A 1XFNA 4UQIS 1FIKA 1KDSA 5A93A 1SKOB 1TS6A 3QP5A 3VE3A 2M1CA 1DRMA 1YLPA 5FQIA 4JF5A 4MNRA 3TOIA 4JGQA 2V2FF 3N8SA 1LL5A 3ZG0A 1I2WA 3C30A 2B95A 3IXHA 5C5KA 3SOIA 2Z2MB 3VV4A 3ZDJA 1H5XA 4GJ4A 4YNRA 1T19A 2X71A 3EEHA 2PD7A 2RCXA 2OSUA 5HARA 4C3QA 1SHVA 5AQ9A 4EBLA 2XEPA 1Y28A 3HLEA 2X02A 2VGKA 3B3XA 1TDLA 4OQ0A 4EXOA 2E8IA 2IWCA 2OOLA 3ITAA 4EV4A 2EXAA 4OQIA 4RQ9A 2P04A 4EU0A 2EXBA 3HLFA 1PWCA 3PXPA 3KSIA 3D3OA 1GSXA 4Y2FA 4AFIA 4JF6A 5CGXA 3FYZA 4IUKA 1STZA 3VP3A 3LIDA 5FI6A 4Q8IA 1XGIA 1CQAA 1N9BA 3EQVA 4HOIA 2XH9A 3SS3A 1YSPA 1TF1A 4X53A 1LHYA 3MMHA 4P0MA 3DWKA 4DDYA 2QWSA 3GRJA 4FCFA 1BUEA 3JPUA 1K38A 2A24A 3GDIA 3MF0A 4KZBA 1N9NA 5M19A 1V9YA 4G3KA 1IEMA 3BWLA 3NBLA 3SH8A 1JWZA 1IFQA 1Q2PA 3UY6A 3QP8A 5DJUA 4KQRA 1KGFA 4DRTA 3CJMA 3F1OB 3KSGA 3JVUA 4BMWA 2XF3A 2VGLS 2J80A 3ZVTA 1P9RA 2A2LA 2EX6A 3UO9A 2Y2JA 2L0WA 3OPRA 1W7FA 3H9WA 4UHUA 5HD3A 1FCMA 1IYOA 3CI6A 3PR6A 4EBPA 3F1NA 1DJCA 1O07A 4NETA 2VV7A 3RXXA 1KE0A 3NECA 1JWPA 5KZHA 3D72A 2XQZA 1ZHHB 4PKYA 3ZCZA 2JKRI 4WUJA 4Y5FA 4I3JA 2Y8HA 3IWIA 2W1RA 1CF0A 1E25A 4HI4A 1E3UD 4ETXA 5IU1A 2C6WB 2P9VA 1VETB 2GX5A 4EETB 3MQOA 1YLJA 1MKIA 4OPRA 2H0YA 3ZGAB 3LY4A 2ZMAA 2PYRA 4HJ6A 4FOFA 2ZOHA 1F98A 1JVJA 4JF4A 5FQQA 1XJ4A 4O01A 2K7SA 3Q7ZA 2ZQAA 1OMEA 2HDQA 5CEDA 4M4XA 1W63M 3DWZA 2PR5A 3T4OA 1J3WA 4FD8A 3PBTA 4N9KA 2EX9A 2OLUA 1EI5A 3VSKA 5FSRA 4B4XA 3UB9A 3NDGA 4GCZA 4ME4A 4KZ8A 5HAIA 2W3GA 1BYWA 4OQHA 1VHMA 3NULA 3ZG9B 3CAXA 2HDUA 4DE2A 1HLUP 5EV0A 1S67L 4GHIA 5EVIA 5L07A 2JKGA 3G32A 4E6XA 4P6BA 4CLCA 2M7UA 3C38A 5HAPA 1FSYA 4GZBA 4EERA 1K56A 1ES2A 2XGNA 3GECA 3QNBA 1W63Q 3HLBA 3V3SA 1ERQA 4B88A 5CX7A 4HJ3A 3W2ZA 3NOPC 5DTSA 4HJ4A 1YPRA 5KMWA 1NZOA 1O7EA 2L4RA 1HVBA 4E3KA 5GLBA 4WEJA 4OP8A 3ZG8B 1K6RA 2Y2LA 5HPIA 1C3BA 3NHQA 4U3TA 3R7WB 1VEUA 4I3AA 5HDDA 4E3OA 4WMCD 2J7VA 1YLTA 3BFCA 4WL9A 4QPRA 5EM1A 5CECA 3T1RA 3W4QA 1L0DA 4IHQA 4YWZA 4QY5A 3G34A 4S2LA 2ZMVA 5HWWA 2V0UA 1HTZA 4ZJ1A 2JC7A 2OWJA 4OQGA 1SKOA 5IS1A 5FEGA 2CMNA 3LR3A 5HSQA 1SDNA 3WRZA 5M1AA 4CLCD 1FSWA 2PBDP 1WYCA 5GHYA 4JGOA 1XXMA 1PWGA 1LL9A 4K0WA 5CGSA 2ZQCA 5E2HA 4H6JB 3BFGA 3SS5A 3PBQA 1ES4A 2PRFA 1Y54A 3P7NA 2XSSA 3LO7A 3IX3A 4R4SA 4PHTA 4FH4A 4Q0JA 3DTMA 2QJ5A 1M40A 2BLSA 1MKMA 3HUOA 4BENA 4ZBEA 4PM8A 3AGEA 3T4JA 2V1BA 3IF5A 3SH9A 3G2ZA 3UB8A 1S4RA 3UE0A 3CZDA
chains in the Genus database with same CATH topology
4WLAA 4HHDA 3E98A 4HY8A 4MN6A 1YSQA 1DP9A 4GLQA 3T4KA 2YKHA 4WELA 1S66L 1UWNX 3EGDC 2R78A 3ULFA 4NXFA 5J3WA 1OT9A 3LIAA 1WA9A 4BBUA 3H82A 2O9BA 1T1BA 3U2AA 4BBVA 1NRJA 4ARZB 2W3FA 4CLCC 5F69A 5DKLA 5DFXA 5HDCA 1D7EA 4G3VA 4WF0A 2K31A 5HD5A 5EFWA 1V9ZA 2W1TA 3MXQA 2VKSA 4GW9A 3F1PA 1DP6A 4Y3IA 3EEAA 3V67A 2VV6A 3EQUA 3DBAA 5IT5A 2HJ9C 1OTIA 4I38A 3A0SA 5KIZA 4LLOB 4EESA 4MN7A 2WKPA 4WEKA 4EEPA 1XFNA 2OWHA 4UQIS 2QYBA 2KDKA 2PT7A 2NUTC 1TS6A 4R3AA 3T4SA 3VE3A 4I39A 2M1CA 1DRMA 2ZMFA 4LRXC 2PR6A 4HQAA 1IOUA 3C2WA 3OLOA 1S4SA 3G6OA 1YKDA 3NOUC 2JN7A 1N9LA 2B18A 4JGQA 2P7JA 2VA0A 3LYXA 1H3QA 3A0VA 4PKYG 4UEYA 1P97A 5HDSA 3C30A 1NWZA 5C5KA 1TS0A 5G4ZA 3LIBA 1TD5A 3T4QA 3BQAA 5A8BA 3VV4A 4P6ZM 4GJ4A 4KUOA 4YNRA 3UMDA 1P9WA 1T19A 2O9CA 3EEHA 2HJEA 4WN5A 2PD7A 4Q0IA 2JKTI 5AVFA 4B9OA 3LR0A 4FSFA 4YOFA 1VB6A 4MMNA 1Y28A 2INWA 3E4PA 4NXGA 3E4QA 5HWTA 4EXOA 2OOLA 2FH5A 3B33A 1X0OA 3E4OA 2QKPA 3IS2B 2KOIA 2W3EA 1NLZA 4EUVA 4RQ9A 2LB5A 1S1ZA 2P04A 3O5YA 4EU0A 2M7VA 3HJKA 3IS2A 2D02A 2XROA 3UB6A 3PXPA 3KSIA 2W3DA 4EQ1A 3PBRA 3D3OA 1GSXA 4Y2FA 4AFIA 4KQOA 3OOVA 3CWFA 3KYQA 4IUKA 1OTDA 1STZA 5L8MA 1H8MA 3LIDA 1S1YA 4L9GA 2J3TC 3CITA 3EOIA 3H82B 3EQVA 4G3WA 3IBJA 4K08A 2A24B 2EA9A 4HOIA 5F5YA 3H7WB 1YSPA 1TF1A 3MMHA 2QWSA 1GSVA 2J3WA 2A24A 3GDIA 3MF0A 4LRZE 3H7WA 5F68A 4MN5A 4F3LA 1N9NA 2W1TB 1V9YA 4G3KA 2V1AA 5LBRA 3F1PB 2W3HA 5K5BA 3BWLA 1LSVA 3K3CA 4L9EA 1IFQA 3P01A 5DJUA 3F1OB 3KSGA 5DKKA 3JVUA 4BMWA 2VGLS 2J80A 5HPFA 4ETZA 5MC7A 1P9RA 1XJ2A 3LI9A 2A2LA 3S7OA 3S7PA 3F1OA 3ZYTA 4DMZA 3MQ0A 4HNBA 2KX6A 3OCLA 4P6ZS 2L0WA 4GS9A 3UE6A 3CUEC 2HV1A 3BY8A 3C8CA 4R70A 3H9WA 5HD3A 3F1NB 4R38A 3FPWA 4NKPA 4NXBA 3RH8B 3CI6A 3PR6A 3F1NA 1T18A 1ZTUA 4II7A 2VV7A 2J3TD 3IBRA 2JKRM 3R7WA 2GNXA 2O0YA 2VGLM 1OTEA 3S7QA 5AVEA 3D72A 1OTBA 1ZHHB 4BWIA 4PKYA 2JKRI 1XJ6A 4O8GA 4MDZA 4Q0HA 4WUJA 4Y5FA 3BQ8A 3MJQA 5HWVA 4I3JA 2Y8HA 1UGUA 2W1RA 1G28A 3RTYA 4HI4A 2P08A 4ETXA 5IU1A 3HCYA 4LRYC 2GX5A 4EETB 3OCNA 2IA2A 3MQOA 2XA7M 4JGPA 5HL6A 1OPXA 1TS8A 3TE8A 2B02A 2PYRA 4HJ6A 4FOFA 2ZOHA 4KQDA 1F98A 5J7EA 2VJWA 1OJGA 3PHYA 1XJ4A 2G7UA 2ZBBA 1DP8A 3LIEA 1XJ3A 2DMWA 1S4RA 4O01A 2K7SA 4I5SA 3FG8A 4KUKA 2EWWA 1XFQA 4H6JA 3UMEA 3TJZC 2OAQ1 1T1AA 4M4XA 1W63M 2PR5A 3KSHA 4OOLA 1NLYA 3T4OA 4R6LA 3PBTA 3FPVA 2PD8A 2PHYA 2D01A 2VV8A 5G4YA 3FC7A 3OC2A 3UB9A 2VZWA 1TS7A 3K2NA 4GCZA 2KLIA 4ME4A 3KSFA 4DN0A 2W3GA 3BJNA 3EWKA 5TBMB 1BYWA 1VHMA 3CAXA 4HH3A 4XT2B 4ZRRA 2OAP1 4F3LB 2NUPC 4CLCB 1S67L 4GHIA 1YAXA 3LR4A 5TBMA 3CLOA 3T4LA 2YKFA 3JVVA 2VLGA 3ICYA 4XT2A 1G6OA 4I3IA 4E04A 4CLCA 2JHEA 2M7UA 3NJAA 3C38A 4NXEA 4EERA 2GZAA 3LIFA 2V0WA 3KO6A 3GECA 1N9OA 4EW7A 2QJ7A 1W63Q 1OTAA 2FZ0A 4O0PA 2GJ3A 3VOLA 4IJGA 5CX7A 4HJ3A 3PBSA 3W2ZA 2O99A 3NOPC 3RFBA 4HJ4A 4GS9B 3BW6A 2L4RA 3PBOA 4ARZA 4BJPA 2VX8A 3B47A 4WEJA 4L9FA 3LR5A 1EW0A 4Z1WA 3CUEA 5HPIA 3MFXA 5F6AA 2LB9A 3MR0A 3NHQA 3KYZA 1P0ZA 3R7WB 4CLCE 2MJ6A 3LICA 4I3AA 5DJTA 5HDDA 3ZQ5A 3OBFA 3B42A 3NOTC 4MCWA 4HH2A 4WL9A 4QPRA 2I9VA 3A0RA 2XA7S 2WKQA 1LSWA 4IHQA 4YWZA 4L0LA 3PYPA 4EEUA 2V9AA 2ZMVA 5HWWA 2V0UA 3BY9A 2QHKA 3MQQA 1LT0A 2OWJA 2Z6CA 5IS1A 5I5LA 4BBTA 3TRCA 2EWVA 3E0YA 4HIAA 4IUHA 2CMNA 2W0NA 3LR3A 1JNUA 1LSXA 2W27A 5HSQA 2ZOIA 4B93A 3LFVA 2PDRA 2HF6A 2Y79A 2Z6DA 1F9IA 2XRNA 1D06A 4PAUA 1UWPX 4NEED 2JKTM 2WKRA 2VEAA 4CLCD 4CQHA 5KSHA 4JGOA 3TW8A 5FL3A 4UQIM 1KOUA 3UB7A 3LUQA 1OJ5A 5HZHA 1F5MA 4H6JB 3R4KA 1ODVA 3KX0X 1GSWA 2PYPA 3PBNA 5AJGA 3VE4A 3PBQA 4OOMA 2H28A 3S7NA 1MC0A 2K2NA 3P7NA 2XSSA 5TJJA 3T50A 4JGRA 4PHTA 2O9AA 3T4TA 5DFYA 1MZUA 4DJ2A 4Q0JA 5J4EA 1OT6A 2QJ5A 3HJIA 3LI8A 3UE3A 4HP4A 1T1CA 1MKMA 2L1MA 4DJ3A 4LPZA 5DF9A 2BASA 3SW1A 4GHIB 3EGXC 4HP9A 3T4JA 2V1BA 2HGVA 3UB8A 1LL8A 3K3DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O0Y A;  4MMN A;  3E98 A;  3S7Q A;  1YSQ A;  4BWI A;  4GLQ A;  4O8G A;  4MDZ A;  4Q0H A;  4Y5F A;  2OOL A;  4Z1W A;  5HPI A;  2LB9 A;  2Y8H A;  3NHQ A;  2KOI A;  2W3E A;  2W1R A;  4EUV A;  4RQ9 A;  2O9B A;  2LB5 A;  4EU0 A;  3O5Y A;  2M7V A;  3ZQ5 A;  3OBF A;  4ETX A;  3NOT C;  4MCW A;  2XRO A;  2W3F A;  3KSI A;  2W3D A;  4QPR A;  3HCY A;  3D3O A;  4LRY C;  5DFX A;  4Y2F A;  2GX5 A;  3OOV A;  2IA2 A;  4IUK A;  1STZ A;  5L8M A;  4G3V A;  2K31 A;  5HL6 A;  2W1T A;  3CIT A;  2VKS A;  4G3W A;  4GW9 A;  3IBJ A;  4FOF A;  4Y3I A;  3EEA A;  2VJW A;  5I5L A;  1YSP A;  2G7U A;  1TF1 A;  3MMH A;  3TRC A;  4IUH A;  3E0Y A;  4O01 A;  3DBA A;  3MF0 A;  5HSQ A;  4LRZ E;  3LFV A;  2Y79 A;  4MN7 A;  2XRN A;  2W1T B;  3KSH A;  4R6L A;  4PAU A;  4G3K A;  5LBR A;  2QYB A;  2VEA A;  4CQH A;  2W3H A;  5K5B A;  4LRX C;  2ZMF A;  2VZW A;  3C2W A;  3G6O A;  3K2N A;  4ME4 A;  2KLI A;  1YKD A;  3KSF A;  3NOU C;  3KSG A;  4DN0 A;  2W3G A;  3BJN A;  2B18 A;  1F5M A;  3R4K A;  1VHM A;  5HPF A;  4ZRR A;  4ETZ A;  3S7O A;  3S7P A;  4DMZ A;  5AJG A;  3MQ0 A;  3S7N A;  1MC0 A;  2K2N A;  5C5K A;  2XSS A;  5TJJ A;  4E04 A;  1TD5 A;  2O9A A;  5DFY A;  2M7U A;  4R70 A;  3VV4 A;  4Q0J A;  4YNR A;  3KO6 A;  2O9C A;  1MKM A;  3CI6 A;  4Q0I A;  4O0P A;  1ZTU A;  4IJG A;  2HGV A;  3W2Z A;  2O99 A;  3IBR A;  3NOP C;  3RFB A;  4YOF A; 
#chains in the Genus database with same CATH topology
 4WLA A;  3G4P A;  4HHD A;  3E98 A;  4HY8 A;  1FCN A;  5GHX A;  1DP9 A;  3T4K A;  3GVB A;  3GR2 A;  4H8R A;  2YKH A;  1S66 L;  1ALQ A;  4HBT A;  4UAA A;  4JXS A;  1YLZ A;  5A90 A;  4NXF A;  5FAS A;  3VMA A;  4BL2 A;  1I5Q A;  2O9B A;  1TEM A;  3UDF A;  4XUZ A;  1N4O A;  5F83 A;  5F69 A;  5DKL A;  5DFX A;  1XPB A;  1K57 C;  1D7E A;  4WF0 A;  5HD5 A;  2VGJ A;  5HAQ A;  1BTL A;  2XFT A;  1BLC A;  5HL1 A;  4Y3I A;  3M2K A;  1I2S A;  3ZHH A;  1CJF A;  2VV6 A;  3EQU A;  4JLF A;  2WKP A;  1FR6 A;  3MZF A;  4EEP A;  4R4R A;  2NUT C;  5A91 A;  4I39 A;  1FOF A;  1IOU A;  1GHM A;  3C2W A;  3OLO A;  3G6O A;  4PPR A;  1PW8 A;  1YKD A;  4OPY A;  4OPZ A;  2B18 A;  2VA0 A;  4LV3 A;  3W4O A;  4KEN B;  3LIB A;  1BLS A;  3T4Q A;  3BQA A;  5A8B A;  2R9W A;  4P6Z M;  3VP0 A;  2FFY A;  1RGY A;  1P9W A;  4NK3 A;  3UDI A;  3LY3 A;  3RJU A;  5JYP A;  1PZP A;  5AVF A;  4B9O A;  3LR0 A;  4OKP A;  1BLH A;  3U4L P;  2J9P A;  4RX2 A;  1VB6 A;  2WKE A;  1WYB A;  1L0F A;  3V5M A;  1XA1 A;  5I94 A;  1VET A;  3UE1 A;  3RXW A;  3GSG A;  2FH5 A;  3IS2 B;  2Y91 A;  3BRM A;  2BG1 A;  2QZ6 A;  3HL9 A;  2M7V A;  3HJK A;  2XRO A;  3BFF A;  4Y13 A;  4KZ9 A;  3KYQ A;  3GV9 A;  3WS5 A;  3ZNT A;  3T1X A;  4X68 A;  3CIT A;  3H82 B;  4G3W A;  4YFM A;  3IBJ A;  1KE3 A;  4KG6 A;  1AWI A;  4X55 A;  4DE3 A;  1GSV A;  2WGV A;  3H7W A;  5JYO A;  4MN5 A;  2PAV P;  5EM0 A;  2V1A A;  4X6T A;  1YLY A;  3F1P B;  4C6Y A;  3Q7V B;  2ZC7 A;  3L7H A;  5F1F A;  4ETZ A;  5MC7 A;  3CG5 A;  4E3I A;  4DMZ A;  1NXY A;  2HZ5 A;  1VQQ A;  4HNB A;  2KX6 A;  2WAD A;  3N8L A;  2Y2M A;  3CUE C;  3UPN A;  1CEF A;  2XDM A;  4PM5 A;  2Y59 A;  3M6H A;  3LCE A;  3MZD A;  4R38 A;  3CPT B;  3FPW A;  5E2E A;  2B5R A;  3G2Y A;  1IEL A;  2J3T D;  1RCJ A;  1MY8 A;  2Y2H A;  3R7W A;  1L3L A;  3NDE A;  3D4F A;  3VP1 A;  2Y2I A;  1OTE A;  1ONG A;  1OTB A;  4BWI A;  1XJ6 A;  4MDZ A;  4O7D A;  2P74 A;  5HWV A;  1LLB A;  3ZNY A;  4PMA A;  1PZO A;  4IBX A;  1MWT A;  1UGU A;  4Y17 A;  2V20 A;  2H5S A;  2P08 A;  4RA7 A;  3IF6 B;  3OCN A;  1MXO A;  5GL9 A;  4LEN A;  2IA2 A;  3DTK A;  2XA7 M;  4U0X A;  2C5W B;  1K4F A;  4JGP A;  5FQ9 A;  3TE8 A;  2JCH A;  4KQD A;  3WS4 A;  4KZ4 A;  1DJB A;  3LIE A;  1ES3 A;  3BLS A;  1PI4 A;  3FG8 A;  4KUK A;  4H6J A;  3UME A;  4WZ4 A;  2OAQ 1;  1T1A A;  2Y2P A;  1NLY A;  1TVF A;  3WWX A;  2D01 A;  2ZL1 B;  3G30 A;  4HBU A;  1GHP A;  2VZW A;  3UNW A;  2ZQ9 A;  1TS7 A;  3KSF A;  2WGW A;  2WZX A;  4OPQ A;  4DN0 A;  2HP9 A;  1MWR A;  4XT2 B;  4ZRR A;  3A3I A;  4F3L B;  1YAX A;  5TBM A;  3CLO A;  3ZG5 A;  3ICY A;  3UDX A;  1G6O A;  4BD1 A;  4WYY A;  2JHE A;  2Y55 A;  1ZG6 A;  4NXE A;  2GZA A;  1GHI A;  2V0W A;  3S22 A;  1LI0 A;  1N9O A;  3BFE A;  5D3O A;  2WKI A;  3RFB A;  4GS9 B;  4KZ6 A;  3HVF A;  3PBO A;  5G18 A;  3V39 A;  4BJP A;  4R23 A;  1BT5 A;  4CPK A;  4L9F A;  4HEF A;  5FQJ A;  3CUE A;  2EX2 A;  1ES5 A;  2LB9 A;  4DF6 A;  1P0Z A;  2JKF A;  5FI2 A;  5F1G A;  5FEF A;  3MXS A;  5DJT A;  3OBF A;  3B42 A;  3NOT C;  1QMF A;  2V1Z A;  4MCW A;  4S2O A;  3W8K A;  2ZM8 A;  3A0R A;  1G6A A;  3C5A A;  4L0L A;  4OON A;  3TG9 A;  2ZC3 B;  3CHW P;  5FAP A;  3T1S A;  4RX3 A;  2QHK A;  3MQQ A;  1LT0 A;  4BBT A;  4CJN A;  1FIL A;  2EWV A;  4HIA A;  4JBF A;  4N1H A;  1JNU A;  1LSX A;  3ZFZ A;  4RYE A;  3LEZ A;  1F9I A;  2XRN A;  5EPH A;  2ZQ8 A;  5EVL A;  3NC8 A;  2WKR A;  5CHU A;  5KSH A;  4N92 A;  2ZC6 B;  3VSL A;  3TW8 A;  5FL3 A;  4UQI M;  1KOU A;  2I72 A;  2E8J A;  1PWD A;  1OJ5 A;  3R4K A;  1ODV A;  4S2P A;  3KX0 X;  5E2F A;  1GSW A;  2PYP A;  3IF6 C;  5AJG A;  2Y2K A;  3VE4 A;  5CTM A;  5U47 A;  1MC0 A;  3PAG A;  4JGR A;  5DFY A;  4DJ2 A;  3P09 A;  1OT6 A;  3HJI A;  4HP4 A;  3GQZ A;  4OP5 A;  3SW1 A;  5DF9 A;  2BAS A;  3EGX C;  1W8Q A;  1E4D A;  1LL8 A;  1NRF A;  3SS4 A;  4MN6 A;  4XXR A;  1YLW A;  4ZAM A;  3FKW A;  3UB5 P;  4WEL A;  1IKG A;  3EGD C;  3VP4 A;  2G2W A;  2Q0O A;  4GDB A;  1W5D A;  3ULF A;  1WA9 A;  4BBU A;  3H82 A;  3DW0 A;  1NRJ A;  4ARZ B;  1Z6F A;  5CGW A;  4DDS A;  5M18 A;  3Q81 A;  3QP1 A;  2K31 A;  5EFW A;  4GW9 A;  3F1P A;  1DP6 A;  1XA7 A;  4EBN A;  4QD4 A;  3Q7V A;  3FKV A;  3NCK A;  5IT5 A;  4FH2 A;  4OOY A;  3A0S A;  2A3U A;  4MN7 A;  4M3K A;  3BFD A;  2QYB A;  4R3A A;  3T4S A;  2UWX A;  2PR6 A;  2H10 A;  5AQA A;  2J8Y A;  3NOU C;  1N9L A;  3CPT A;  4B4Z A;  3A0V A;  2ZM0 A;  4ID4 A;  2J9O A;  5HDS A;  3IT9 A;  5EVI D;  5GHZ A;  5EOO A;  1PFL A;  1TS0 A;  4DE1 A;  1U60 A;  3MZE A;  2XFS A;  4KUO A;  4X56 A;  1K56 D;  4F94 A;  2HJE A;  4S2M A;  4Q0I A;  1J9M A;  2JKT I;  1BZA A;  4WZ5 C;  4FSF A;  4D60 A;  5FAQ A;  4MMN A;  2INW A;  3IF6 A;  3VP2 A;  3B33 A;  1X0O A;  1IYQ A;  2KOI A;  1NLZ A;  4OVD A;  1S1Z A;  1PYY A;  2WUQ A;  2Y4A A;  3FZC A;  3PBR A;  3IXG A;  1DJA A;  3S4X A;  1KDW A;  5DF8 A;  5CHM A;  5FAT A;  3LGO A;  5DF7 A;  5L8M A;  1IYS A;  1H8M A;  2J3T C;  1NYM A;  1L2S A;  2ZL1 A;  3G35 A;  2A24 B;  1XKZ A;  2JE5 A;  1Z09 A;  4S2I A;  4KZ5 A;  2EFX A;  2DNS A;  3LEQ A;  4X1M A;  5AQB A;  4LRZ E;  2XK1 A;  3TSG A;  4F3L A;  4ZTK A;  3HLG A;  2W3H A;  5K5B A;  4E6W A;  3A3F A;  4PM7 A;  1LSV A;  3K3C A;  4L9E A;  3Q07 A;  1XP4 A;  3P01 A;  1YM1 A;  4LV0 A;  5DKK A;  3GTC A;  2ZLY A;  3IX8 A;  3S7P A;  3ZYT A;  3F1O A;  3MQ0 A;  2ZC5 B;  4GS9 A;  3UE6 A;  4EUZ A;  2HV1 A;  4ESP A;  3C8C A;  4R70 A;  1SCW A;  3F1N B;  4KG2 A;  1D1J A;  3UPP A;  4NKP A;  4NXB A;  3UN7 A;  1ZTU A;  5IHV A;  4A5R A;  3IBR A;  2JKR M;  5A92 A;  2O0Y A;  4R3B A;  1YQS A;  1PNE A;  1G68 A;  5EVE A;  2Y2N A;  5TR7 A;  4O8G A;  4KG5 A;  3MJQ A;  3A3E A;  3IWQ A;  4GN2 A;  1MWS A;  2Y2Q A;  2P9V B;  3RTY A;  2IWD A;  5CRF A;  4JXW A;  2R9X A;  3HCY A;  1ERM A;  2XR0 A;  4WZ5 A;  2XLN A;  2HPB A;  1OPX A;  3OPH A;  1GA0 A;  5DVA A;  1ZKJ A;  1OJG A;  2G7U A;  2DMW A;  4I5S A;  4N9L A;  2EWW A;  3IWO A;  4OOL A;  4R6L A;  2PD8 A;  3FPV A;  1KGG A;  1MPL A;  1TDG A;  5G4Y A;  2HDS A;  3FC7 A;  5KSC A;  3OC2 A;  3K2N A;  5E2G A;  1Q2Q A;  5EVI B;  3BJN A;  3EWK A;  2WZZ A;  3DTI A;  4HH3 A;  2NUP C;  3C4O A;  4CLC B;  1EWZ A;  4K0X A;  3LR4 A;  3T4L A;  2YKF A;  3JVV A;  2VLG A;  3O3V A;  4E04 A;  4DE0 A;  3HLD A;  3ISG A;  3LIF A;  3KO6 A;  5EEC A;  3V3R A;  5L2F A;  1K57 A;  5EOE A;  2QJ7 A;  4P85 A;  4JKT A;  4O0P A;  2GJ3 A;  3VOL A;  1G5U A;  3PBS A;  4C75 A;  3BW6 A;  3E2K A;  3NIA A;  4QY6 A;  1PRQ A;  4LFU A;  4ARZ A;  2VX8 A;  1YMS A;  3VFH A;  5FDH A;  1EW0 A;  4Z1W A;  5J8X A;  3GMW A;  5F6A A;  3Q82 A;  3N4I A;  3KYZ A;  3AGF A;  5F82 A;  2MJ6 A;  3LIC A;  3ZQ5 A;  4X69 A;  4BD0 A;  1PI5 A;  4R1G A;  4EEU A;  3SH7 A;  1ACF A;  1K25 A;  3BY9 A;  3KYE A;  1S0W A;  2Z6C A;  5AQ7 A;  3E0Y A;  5BOH A;  2W0N A;  2G2U A;  5CEB A;  4B93 A;  3LFV A;  2PDR A;  4PM6 A;  4QHC A;  2UV0 E;  2Y79 A;  1XGJ A;  3JYI A;  1D06 A;  2ZQ7 A;  1UWP X;  2JKT M;  2VEA A;  2OV5 A;  4RVA A;  2CC1 A;  5GLC A;  2IWB A;  3WS0 A;  3UB7 A;  3A3J A;  3LUQ A;  4R3J A;  5DTT A;  2FFF B;  1JWV A;  5HZH A;  1F5M A;  1ERO A;  3N6I A;  3BLM A;  1Y4O A;  4Y0U A;  3PAE A;  2HP5 A;  1IKI A;  2PU2 A;  4OOM A;  1PW1 A;  2H28 A;  2K2N A;  3ZVW A;  4EWF A;  3WRT A;  3T50 A;  2ACG A;  2O9A A;  4QWO A;  1SZV A;  3HBR A;  5J4E A;  1F2K A;  3UE3 A;  4JPM A;  1T1C A;  4LPZ A;  3K3D A;  2H0T A;  3HRE A;  4R0Q A;  3MSH A;  2DRW A;  1WE4 A;  1YSQ A;  4GKU A;  1UWN X;  5L09 A;  1JTD A;  1L0G A;  1K55 C;  1OT9 A;  3LIA A;  1E3U A;  5EVI C;  4OH0 A;  1HZO A;  1T1B A;  4KZA A;  4CLC C;  2WAF A;  4GDN A;  3SZT A;  1KVM A;  1RP5 A;  4BL3 A;  3IHA A;  3QHY A;  2VKS A;  1S6R A;  3EEA A;  1KGE A;  3V67 A;  3M2J A;  1OTI A;  3G31 A;  5KIZ A;  4LLO B;  4GD8 A;  2OWH A;  4XUX A;  2KDK A;  4GOG A;  2PT7 A;  4LRX C;  2ZMF A;  4HQA A;  5FI7 A;  3D9Y A;  3C7V A;  1S4S A;  4U0T A;  1HD8 A;  3T12 B;  2JN7 A;  1XX2 A;  2P7J A;  3LYX A;  1H3Q A;  4PKY G;  4UEY A;  4QJG A;  3P98 A;  1P97 A;  2ZQD A;  1NWZ A;  2WAE A;  1W8Y A;  5FDS A;  3S1Y A;  5G4Z A;  1TD5 A;  2Y2G A;  2Q9M A;  3I7J A;  3UMD A;  2O9C A;  4WN5 A;  4Z9Q A;  5DTK A;  4E3L A;  4QU3 A;  3VOZ A;  4YOF A;  4IBR A;  4ZDX A;  3IXD A;  4LCM A;  1LI9 A;  3E4P A;  4NXG A;  4HES A;  3E4Q A;  5HWT A;  3E4O A;  2QKP A;  3FWL A;  2W3E A;  3W4P A;  2BTF P;  4EUV A;  4FUW A;  2LB5 A;  2WGI A;  1BUL A;  3O5Y A;  4WMC A;  2ZJ9 A;  3IS2 A;  2D02 A;  3O88 A;  3UB6 A;  1W79 A;  2W3D A;  4EQ1 A;  3MKE A;  4KQO A;  3OOV A;  2EX8 A;  1SDE A;  3CWF A;  4IVK A;  1OTD A;  5FAO A;  1JTG A;  1ONH A;  1S1Y A;  4L9G A;  2PU4 A;  3EOI A;  3HLC A;  3BYD A;  5HX9 A;  1KVL A;  4K08 A;  2EA9 A;  4E3M A;  1AXB A;  3HUN A;  5F5Y A;  3H7W B;  4OLD A;  1K55 A;  2J3W A;  1NZU A;  3MKF A;  5GLA A;  5F68 A;  3DAV A;  3VOY A;  2W1T B;  5CHJ A;  2A49 A;  5LBR A;  4KQQ A;  4IED A;  3A3D A;  4Y0T A;  4E3N A;  3V50 A;  1QME A;  2EFU A;  3N8R A;  1FCO A;  5GLD A;  4IVI A;  1SKF A;  5HPF A;  1XJ2 A;  3LI9 A;  3WS2 A;  3S7O A;  3OZH A;  3QNC A;  3E2L A;  4N1X A;  4GB7 A;  3OCL A;  4P6Z S;  2X01 A;  3HUM A;  2GDN A;  3BY8 A;  3MS6 A;  3FV7 A;  3NI9 A;  4BQM A;  4KZ3 A;  3RH8 B;  4FTX A;  1CK3 A;  1T18 A;  4D2O A;  4II7 A;  4PM9 A;  2GNX A;  2AVX A;  2VGL M;  2Z2L B;  5AVE A;  3S7Q A;  4UA7 A;  3QP2 A;  4Q0H A;  1K54 C;  4DKI A;  3BQ8 A;  1YMX A;  1NYY A;  2V8C A;  2V8F A;  2XD1 A;  1G28 A;  2OLV A;  1CI9 A;  3C4P A;  4X1L A;  3BEC A;  2WK0 A;  4LRY C;  4LCL A;  3NY4 A;  2WKH A;  5HFO A;  1YT4 A;  3Q1F A;  3IH9 A;  5HL6 A;  1TS8 A;  2B02 A;  2RL3 A;  1GCE A;  1KE4 A;  5J7E A;  2VJW A;  3PHY A;  3OPP A;  2ZBB A;  1DP8 A;  1XJ3 A;  3WS1 A;  4BLM A;  4DXB A;  1XFQ A;  4Y0O A;  1RGZ A;  3IX4 A;  5FA7 A;  5FQM A;  3TJZ C;  2ZC4 B;  3KSH A;  1DY6 A;  2PHY A;  2VV8 A;  4MBK A;  4S2K A;  2WGW B;  1NY0 A;  5CXW A;  1ZG4 A;  5TFQ A;  1IYP A;  2QMI A;  2KLI A;  1CEG A;  1A0K A;  5TBM B;  2Y2O A;  1FQG A;  4MLL A;  3HLW A;  2OAP 1;  1FR1 A;  1VM1 A;  3MFD A;  1BLP A;  3C7U A;  3QP4 A;  4ZJ2 A;  4XT2 A;  3DTE A;  4I3I A;  4EQI A;  3NJA A;  4MBH A;  3MXR A;  3QP6 A;  4DXC A;  4EW7 A;  1OTA A;  2FZ0 A;  4IJG A;  3IXB A;  2O99 A;  3T1Q B;  2HDR A;  3VFF A;  4S2N C;  4WBG A;  2XD5 A;  3B47 A;  2VK3 A;  4GD6 A;  3LR5 A;  1H0M A;  4MBF A;  2JBF A;  4KZ7 A;  3MFX A;  4UA6 A;  3MR0 A;  4CLC E;  1MWU A;  2HP6 A;  4HH2 A;  4UA9 A;  2I9V A;  3OPL A;  1BSG A;  2XA7 S;  5HW3 A;  1H8Y A;  2WKQ A;  1CI8 A;  3O86 A;  1LSW A;  3N7W A;  5TGF A;  2V9A A;  3L9K A;  1K54 A;  4LGW A;  5I5L A;  3TRC A;  4IUH A;  5L10 A;  2W27 A;  1ESU A;  3IHB A;  1K4E A;  2ZOI A;  2HF6 A;  1ZC2 A;  2Z6D A;  3M6B A;  4PAU A;  4NEE D;  1L0E A;  4CQH A;  4Y7P A;  4X25 A;  5CER A;  3O87 A;  4MEZ A;  1PIO A;  1K0K A;  4YIN A;  3BEB A;  3PBN A;  3AGD A;  4Y15 A;  3S7N A;  2QPN A;  5TJJ A;  4NG2 A;  1NJ4 A;  3T4T A;  1ESI A;  1MZU A;  4JXG A;  4OLG A;  3IQA A;  5E43 A;  3LI8 A;  2L1M A;  4DJ3 A;  2PBY A;  2DCF A;  3BM6 A;  2WYX A;  4GHI B;  4HP9 A;  2HGV A;  3PYP A;  3CMZ A;  3IH8 A;  5FQK A;  5CTN A;  4ZJ3 A;  4GLQ A;  1MBL A;  3ZG7 B;  2R78 A;  1M6K A;  5J3W A;  4WM9 A;  5EE8 A;  3ITB A;  3U2A A;  4BBV A;  4JXV A;  2W3F A;  3UPO A;  4K91 A;  5HDC A;  4S2J A;  4G3V A;  1K6S A;  4LV1 A;  1V9Z A;  4S2N A;  2W1T A;  3MXQ A;  2Q9N A;  4E3J A;  2ZM2 A;  1H8Z A;  1VEU B;  3PTE A;  2ZD8 A;  4GNU A;  4QB8 A;  3DBA A;  4LV2 A;  2HJ9 C;  4I38 A;  3MBZ A;  4P87 A;  4EES A;  4WEK A;  5EUA A;  1GA9 A;  1XFN A;  4UQI S;  1FIK A;  1KDS A;  5A93 A;  1SKO B;  1TS6 A;  3QP5 A;  3VE3 A;  2M1C A;  1DRM A;  1YLP A;  5FQI A;  4JF5 A;  4MNR A;  3TOI A;  4JGQ A;  2V2F F;  3N8S A;  1LL5 A;  3ZG0 A;  1I2W A;  3C30 A;  2B95 A;  3IXH A;  5C5K A;  3SOI A;  2Z2M B;  3VV4 A;  3ZDJ A;  1H5X A;  4GJ4 A;  4YNR A;  1T19 A;  2X71 A;  3EEH A;  2PD7 A;  2RCX A;  2OSU A;  5HAR A;  4C3Q A;  1SHV A;  5AQ9 A;  4EBL A;  2XEP A;  1Y28 A;  3HLE A;  2X02 A;  2VGK A;  3B3X A;  1TDL A;  4OQ0 A;  4EXO A;  2E8I A;  2IWC A;  2OOL A;  3ITA A;  4EV4 A;  2EXA A;  4OQI A;  4RQ9 A;  2P04 A;  4EU0 A;  2EXB A;  3HLF A;  1PWC A;  3PXP A;  3KSI A;  3D3O A;  1GSX A;  4Y2F A;  4AFI A;  4JF6 A;  5CGX A;  3FYZ A;  4IUK A;  1STZ A;  3VP3 A;  3LID A;  5FI6 A;  4Q8I A;  1XGI A;  1CQA A;  1N9B A;  3EQV A;  4HOI A;  2XH9 A;  3SS3 A;  1YSP A;  1TF1 A;  4X53 A;  1LHY A;  3MMH A;  4P0M A;  3DWK A;  4DDY A;  2QWS A;  3GRJ A;  4FCF A;  1BUE A;  3JPU A;  1K38 A;  2A24 A;  3GDI A;  3MF0 A;  4KZB A;  1N9N A;  5M19 A;  1V9Y A;  4G3K A;  1IEM A;  3BWL A;  3NBL A;  3SH8 A;  1JWZ A;  1IFQ A;  1Q2P A;  3UY6 A;  3QP8 A;  5DJU A;  4KQR A;  1KGF A;  4DRT A;  3CJM A;  3F1O B;  3KSG A;  3JVU A;  4BMW A;  2XF3 A;  2VGL S;  2J80 A;  3ZVT A;  1P9R A;  2A2L A;  2EX6 A;  3UO9 A;  2Y2J A;  2L0W A;  3OPR A;  1W7F A;  3H9W A;  4UHU A;  5HD3 A;  1FCM A;  1IYO A;  3CI6 A;  3PR6 A;  4EBP A;  3F1N A;  1DJC A;  1O07 A;  4NET A;  2VV7 A;  3RXX A;  1KE0 A;  3NEC A;  1JWP A;  5KZH A;  3D72 A;  2XQZ A;  1ZHH B;  4PKY A;  3ZCZ A;  2JKR I;  4WUJ A;  4Y5F A;  4I3J A;  2Y8H A;  3IWI A;  2W1R A;  1CF0 A;  1E25 A;  4HI4 A;  1E3U D;  4ETX A;  5IU1 A;  2C6W B;  2P9V A;  1VET B;  2GX5 A;  4EET B;  3MQO A;  1YLJ A;  1MKI A;  4OPR A;  2H0Y A;  3ZGA B;  3LY4 A;  2ZMA A;  2PYR A;  4HJ6 A;  4FOF A;  2ZOH A;  1F98 A;  1JVJ A;  4JF4 A;  5FQQ A;  1XJ4 A;  4O01 A;  2K7S A;  3Q7Z A;  2ZQA A;  1OME A;  2HDQ A;  5CED A;  4M4X A;  1W63 M;  3DWZ A;  2PR5 A;  3T4O A;  1J3W A;  4FD8 A;  3PBT A;  4N9K A;  2EX9 A;  2OLU A;  1EI5 A;  3VSK A;  5FSR A;  4B4X A;  3UB9 A;  3NDG A;  4GCZ A;  4ME4 A;  4KZ8 A;  5HAI A;  2W3G A;  1BYW A;  4OQH A;  1VHM A;  3NUL A;  3ZG9 B;  3CAX A;  2HDU A;  4DE2 A;  1HLU P;  5EV0 A;  1S67 L;  4GHI A;  5EVI A;  5L07 A;  2JKG A;  3G32 A;  4E6X A;  4P6B A;  4CLC A;  2M7U A;  3C38 A;  5HAP A;  1FSY A;  4GZB A;  4EER A;  1K56 A;  1ES2 A;  2XGN A;  3GEC A;  3QNB A;  1W63 Q;  3HLB A;  3V3S A;  1ERQ A;  4B88 A;  5CX7 A;  4HJ3 A;  3W2Z A;  3NOP C;  5DTS A;  4HJ4 A;  1YPR A;  5KMW A;  1NZO A;  1O7E A;  2L4R A;  1HVB A;  4E3K A;  5GLB A;  4WEJ A;  4OP8 A;  3ZG8 B;  1K6R A;  2Y2L A;  5HPI A;  1C3B A;  3NHQ A;  4U3T A;  3R7W B;  1VEU A;  4I3A A;  5HDD A;  4E3O A;  4WMC D;  2J7V A;  1YLT A;  3BFC A;  4WL9 A;  4QPR A;  5EM1 A;  5CEC A;  3T1R A;  3W4Q A;  1L0D A;  4IHQ A;  4YWZ A;  4QY5 A;  3G34 A;  4S2L A;  2ZMV A;  5HWW A;  2V0U A;  1HTZ A;  4ZJ1 A;  2JC7 A;  2OWJ A;  4OQG A;  1SKO A;  5IS1 A;  5FEG A;  2CMN A;  3LR3 A;  5HSQ A;  1SDN A;  3WRZ A;  5M1A A;  4CLC D;  1FSW A;  2PBD P;  1WYC A;  5GHY A;  4JGO A;  1XXM A;  1PWG A;  1LL9 A;  4K0W A;  5CGS A;  2ZQC A;  5E2H A;  4H6J B;  3BFG A;  3SS5 A;  3PBQ A;  1ES4 A;  2PRF A;  1Y54 A;  3P7N A;  2XSS A;  3LO7 A;  3IX3 A;  4R4S A;  4PHT A;  4FH4 A;  4Q0J A;  3DTM A;  2QJ5 A;  1M40 A;  2BLS A;  1MKM A;  3HUO A;  4BEN A;  4ZBE A;  4PM8 A;  3AGE A;  3T4J A;  2V1B A;  3IF5 A;  3SH9 A;  3G2Z A;  3UB8 A;  1S4R A;  3UE0 A;  3CZD A; 
#chains in the Genus database with same CATH homology
 4WLA A;  4HHD A;  3E98 A;  4HY8 A;  4MN6 A;  1YSQ A;  1DP9 A;  4GLQ A;  3T4K A;  2YKH A;  4WEL A;  1S66 L;  1UWN X;  3EGD C;  2R78 A;  3ULF A;  4NXF A;  5J3W A;  1OT9 A;  3LIA A;  1WA9 A;  4BBU A;  3H82 A;  2O9B A;  1T1B A;  3U2A A;  4BBV A;  1NRJ A;  4ARZ B;  2W3F A;  4CLC C;  5F69 A;  5DKL A;  5DFX A;  5HDC A;  1D7E A;  4G3V A;  4WF0 A;  2K31 A;  5HD5 A;  5EFW A;  1V9Z A;  2W1T A;  3MXQ A;  2VKS A;  4GW9 A;  3F1P A;  1DP6 A;  4Y3I A;  3EEA A;  3V67 A;  2VV6 A;  3EQU A;  3DBA A;  5IT5 A;  2HJ9 C;  1OTI A;  4I38 A;  3A0S A;  5KIZ A;  4LLO B;  4EES A;  4MN7 A;  2WKP A;  4WEK A;  4EEP A;  1XFN A;  2OWH A;  4UQI S;  2QYB A;  2KDK A;  2PT7 A;  2NUT C;  1TS6 A;  4R3A A;  3T4S A;  3VE3 A;  4I39 A;  2M1C A;  1DRM A;  2ZMF A;  4LRX C;  2PR6 A;  4HQA A;  1IOU A;  3C2W A;  3OLO A;  1S4S A;  3G6O A;  1YKD A;  3NOU C;  2JN7 A;  1N9L A;  2B18 A;  4JGQ A;  2P7J A;  2VA0 A;  3LYX A;  1H3Q A;  3A0V A;  4PKY G;  4UEY A;  1P97 A;  5HDS A;  3C30 A;  1NWZ A;  5C5K A;  1TS0 A;  5G4Z A;  3LIB A;  1TD5 A;  3T4Q A;  3BQA A;  5A8B A;  3VV4 A;  4P6Z M;  4GJ4 A;  4KUO A;  4YNR A;  3UMD A;  1P9W A;  1T19 A;  2O9C A;  3EEH A;  2HJE A;  4WN5 A;  2PD7 A;  4Q0I A;  2JKT I;  5AVF A;  4B9O A;  3LR0 A;  4FSF A;  4YOF A;  1VB6 A;  4MMN A;  1Y28 A;  2INW A;  3E4P A;  4NXG A;  3E4Q A;  5HWT A;  4EXO A;  2OOL A;  2FH5 A;  3B33 A;  1X0O A;  3E4O A;  2QKP A;  3IS2 B;  2KOI A;  2W3E A;  1NLZ A;  4EUV A;  4RQ9 A;  2LB5 A;  1S1Z A;  2P04 A;  3O5Y A;  4EU0 A;  2M7V A;  3HJK A;  3IS2 A;  2D02 A;  2XRO A;  3UB6 A;  3PXP A;  3KSI A;  2W3D A;  4EQ1 A;  3PBR A;  3D3O A;  1GSX A;  4Y2F A;  4AFI A;  4KQO A;  3OOV A;  3CWF A;  3KYQ A;  4IUK A;  1OTD A;  1STZ A;  5L8M A;  1H8M A;  3LID A;  1S1Y A;  4L9G A;  2J3T C;  3CIT A;  3EOI A;  3H82 B;  3EQV A;  4G3W A;  3IBJ A;  4K08 A;  2A24 B;  2EA9 A;  4HOI A;  5F5Y A;  3H7W B;  1YSP A;  1TF1 A;  3MMH A;  2QWS A;  1GSV A;  2J3W A;  2A24 A;  3GDI A;  3MF0 A;  4LRZ E;  3H7W A;  5F68 A;  4MN5 A;  4F3L A;  1N9N A;  2W1T B;  1V9Y A;  4G3K A;  2V1A A;  5LBR A;  3F1P B;  2W3H A;  5K5B A;  3BWL A;  1LSV A;  3K3C A;  4L9E A;  1IFQ A;  3P01 A;  5DJU A;  3F1O B;  3KSG A;  5DKK A;  3JVU A;  4BMW A;  2VGL S;  2J80 A;  5HPF A;  4ETZ A;  5MC7 A;  1P9R A;  1XJ2 A;  3LI9 A;  2A2L A;  3S7O A;  3S7P A;  3F1O A;  3ZYT A;  4DMZ A;  3MQ0 A;  4HNB A;  2KX6 A;  3OCL A;  4P6Z S;  2L0W A;  4GS9 A;  3UE6 A;  3CUE C;  2HV1 A;  3BY8 A;  3C8C A;  4R70 A;  3H9W A;  5HD3 A;  3F1N B;  4R38 A;  3FPW A;  4NKP A;  4NXB A;  3RH8 B;  3CI6 A;  3PR6 A;  3F1N A;  1T18 A;  1ZTU A;  4II7 A;  2VV7 A;  2J3T D;  3IBR A;  2JKR M;  3R7W A;  2GNX A;  2O0Y A;  2VGL M;  1OTE A;  3S7Q A;  5AVE A;  3D72 A;  1OTB A;  1ZHH B;  4BWI A;  4PKY A;  2JKR I;  1XJ6 A;  4O8G A;  4MDZ A;  4Q0H A;  4WUJ A;  4Y5F A;  3BQ8 A;  3MJQ A;  5HWV A;  4I3J A;  2Y8H A;  1UGU A;  2W1R A;  1G28 A;  3RTY A;  4HI4 A;  2P08 A;  4ETX A;  5IU1 A;  3HCY A;  4LRY C;  2GX5 A;  4EET B;  3OCN A;  2IA2 A;  3MQO A;  2XA7 M;  4JGP A;  5HL6 A;  1OPX A;  1TS8 A;  3TE8 A;  2B02 A;  2PYR A;  4HJ6 A;  4FOF A;  2ZOH A;  4KQD A;  1F98 A;  5J7E A;  2VJW A;  1OJG A;  3PHY A;  1XJ4 A;  2G7U A;  2ZBB A;  1DP8 A;  3LIE A;  1XJ3 A;  2DMW A;  1S4R A;  4O01 A;  2K7S A;  4I5S A;  3FG8 A;  4KUK A;  2EWW A;  1XFQ A;  4H6J A;  3UME A;  3TJZ C;  2OAQ 1;  1T1A A;  4M4X A;  1W63 M;  2PR5 A;  3KSH A;  4OOL A;  1NLY A;  3T4O A;  4R6L A;  3PBT A;  3FPV A;  2PD8 A;  2PHY A;  2D01 A;  2VV8 A;  5G4Y A;  3FC7 A;  3OC2 A;  3UB9 A;  2VZW A;  1TS7 A;  3K2N A;  4GCZ A;  2KLI A;  4ME4 A;  3KSF A;  4DN0 A;  2W3G A;  3BJN A;  3EWK A;  5TBM B;  1BYW A;  1VHM A;  3CAX A;  4HH3 A;  4XT2 B;  4ZRR A;  2OAP 1;  4F3L B;  2NUP C;  4CLC B;  1S67 L;  4GHI A;  1YAX A;  3LR4 A;  5TBM A;  3CLO A;  3T4L A;  2YKF A;  3JVV A;  2VLG A;  3ICY A;  4XT2 A;  1G6O A;  4I3I A;  4E04 A;  4CLC A;  2JHE A;  2M7U A;  3NJA A;  3C38 A;  4NXE A;  4EER A;  2GZA A;  3LIF A;  2V0W A;  3KO6 A;  3GEC A;  1N9O A;  4EW7 A;  2QJ7 A;  1W63 Q;  1OTA A;  2FZ0 A;  4O0P A;  2GJ3 A;  3VOL A;  4IJG A;  5CX7 A;  4HJ3 A;  3PBS A;  3W2Z A;  2O99 A;  3NOP C;  3RFB A;  4HJ4 A;  4GS9 B;  3BW6 A;  2L4R A;  3PBO A;  4ARZ A;  4BJP A;  2VX8 A;  3B47 A;  4WEJ A;  4L9F A;  3LR5 A;  1EW0 A;  4Z1W A;  3CUE A;  5HPI A;  3MFX A;  5F6A A;  2LB9 A;  3MR0 A;  3NHQ A;  3KYZ A;  1P0Z A;  3R7W B;  4CLC E;  2MJ6 A;  3LIC A;  4I3A A;  5DJT A;  5HDD A;  3ZQ5 A;  3OBF A;  3B42 A;  3NOT C;  4MCW A;  4HH2 A;  4WL9 A;  4QPR A;  2I9V A;  3A0R A;  2XA7 S;  2WKQ A;  1LSW A;  4IHQ A;  4YWZ A;  4L0L A;  3PYP A;  4EEU A;  2V9A A;  2ZMV A;  5HWW A;  2V0U A;  3BY9 A;  2QHK A;  3MQQ A;  1LT0 A;  2OWJ A;  2Z6C A;  5IS1 A;  5I5L A;  4BBT A;  3TRC A;  2EWV A;  3E0Y A;  4HIA A;  4IUH A;  2CMN A;  2W0N A;  3LR3 A;  1JNU A;  1LSX A;  2W27 A;  5HSQ A;  2ZOI A;  4B93 A;  3LFV A;  2PDR A;  2HF6 A;  2Y79 A;  2Z6D A;  1F9I A;  2XRN A;  1D06 A;  4PAU A;  1UWP X;  4NEE D;  2JKT M;  2WKR A;  2VEA A;  4CLC D;  4CQH A;  5KSH A;  4JGO A;  3TW8 A;  5FL3 A;  4UQI M;  1KOU A;  3UB7 A;  3LUQ A;  1OJ5 A;  5HZH A;  1F5M A;  4H6J B;  3R4K A;  1ODV A;  3KX0 X;  1GSW A;  2PYP A;  3PBN A;  5AJG A;  3VE4 A;  3PBQ A;  4OOM A;  2H28 A;  3S7N A;  1MC0 A;  2K2N A;  3P7N A;  2XSS A;  5TJJ A;  3T50 A;  4JGR A;  4PHT A;  2O9A A;  3T4T A;  5DFY A;  1MZU A;  4DJ2 A;  4Q0J A;  5J4E A;  1OT6 A;  2QJ5 A;  3HJI A;  3LI8 A;  3UE3 A;  4HP4 A;  1T1C A;  1MKM A;  2L1M A;  4DJ3 A;  4LPZ A;  5DF9 A;  2BAS A;  3SW1 A;  4GHI B;  3EGX C;  4HP9 A;  3T4J A;  2V1B A;  2HGV A;  3UB8 A;  1LL8 A;  3K3D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...