3KO6A

Crystal structure of yeast free methionine-r-sulfoxide reductase ykg9 in complex with the substrate
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
176
structure length
176
Chain Sequence
STGFHHADHVNYSSNLNKEEILEQLLLSYEGLSDGQVNWVCNLSNASSLIWHAYKSLAVDINWAGFYVTQASEENTLILGPFQGKVACQMIQFGKGVCGTAASTKETQIVPDVNKYPGHIACDGETKSEIVVPIISNDGKTLGVIDIDCLDYEGFDHVDKEFLEKLAKLINKSCVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords UPF0067 GAF domain-containing protein YKL069W
publication title Crystal structure of yeast free methionine-R-sulfoxide reductase Ykg9 in complex with the substrate
rcsb
source organism Saccharomyces cerevisiae
total genus 57
structure length 176
sequence length 176
chains with identical sequence B
ec nomenclature ec 1.8.4.14: L-methionine (R)-S-oxide reductase.
pdb deposition date 2009-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13185 GAF_2 GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3ko6A00
5HSQA 2ZMFA 2VZWA 4RQ9A 4ME4A 5HL6A 2VJWA 3VV4A 2GX5A 4O8GA 1YSQA 2W1RA 1STZA 4Q0HA 4LRYC 3NOTC 4O0PA 3OBFA 5LBRA 3K2NA 4Q0IA 5K5BA 4LRZE 3KSFA 5DFXA 2KOIA 2XSSA 2M7UA 2XRNA 1YKDA 4IUKA 2K2NA 4Y2FA 3MQ0A 1TD5A 4G3KA 2G7UA 5L8MA 3CI6A 4EU0A 3C2WA 2M7VA 4O01A 3IBJA 4ETZA 5C5KA 4LRXC 3TRCA 2HGVA 2W3DA 4CQHA 2XROA 2O0YA 4G3VA 3MF0A 2VEAA 3NOUC 2K31A 2B18A 4YNRA 3KSIA 5HPFA 2VKSA 4EUVA 3S7NA 3NOPC 4QPRA 4FOFA 3W2ZA 2W3GA 4R6LA 4R70A 3LFVA 1MKMA 3IBRA 5HPIA 4Q0JA 4GW9A 2W1TA 4GLQA 4ZRRA 3OOVA 4MN7A 2KLIA 3MMHA 1VHMA 3E98A 3D3OA 4PAUA 2W3FA 3NHQA 4MCWA 3KSGA 2O9CA 4MDZA 4DMZA 2OOLA 2O99A 2W1TB 4MMNA 4Y5FA 3O5YA 3KO6A 5DFYA 2LB5A 2LB9A 4IJGA 4ETXA 4DN0A 3E0YA 3KSHA 2W3EA 1TF1A 1ZTUA 2QYBA 1F5MA 4Z1WA 5AJGA 3S7QA 3G6OA 2W3HA 3BJNA 3EEAA 2O9AA 4YOFA 5I5LA 2Y8HA 3S7PA 4BWIA 3CITA 3RFBA 4IUHA 2O9BA 2Y79A 3R4KA 3ZQ5A 4G3WA 1YSPA 4Y3IA 3DBAA 2IA2A 5TJJA 3S7OA 3HCYA 4E04A 1MC0A
chains in the Genus database with same CATH superfamily
3G2ZA 2ZMFA 1YLZA 5DJTA 3LY3A 4M4XA 2W1RA 4EETB 2P08A 5KMWA 3LO7A 4GB7A 1MWSA 5DF7A 4GHIA 1GSVA 1VEUB 2MJ6A 3CWFA 4G3KA 1P9RA 2BASA 2GDNA 3BY8A 2XK1A 3HUNA 2EXAA 4K91A 3ZFZA 4EW7A 4QD4A 5FQMA 1BSGA 2V9AA 3OPRA 3UE3A 3L7HA 5TBMB 2E8JA 4R1GA 3UY6A 3VP4A 1BULA 3DAVA 3RXXA 1P97A 3MJQA 4YFMA 3LR0A 4GLQA 1MXOA 4ZRRA 2Y2JA 5FI7A 3MMHA 1VHMA 2FZ0A 1K4FA 1YLJA 3HL9A 4ZAMA 5EM1A 3LGOA 2O99A 3GSGA 5HDCA 2X01A 3HLBA 4XT2B 5AQBA 2FFFB 1NY0A 1SKOB 1C3BA 3LEQA 1EROA 4WL9A 3K3DA 3PBNA 3SW1A 5IU1A 3HLEA 3EEAA 2PU2A 5HFOA 3G2YA 3JVVA 4GS9A 4RX2A 5F69A 1IFQA 5BOHA 4X25A 4U0TA 1YT4A 3CLOA 1NWZA 2QZ6A 2Y2LA 3O88A 5HW3A 4LLOB 5HSQA 1I2SA 3A0RA 2XDMA 3CMZA 1Z6FA 1XX2A 5AQ7A 3K2NA 1E3UD 3DWZA 3ZYTA 1D1JA 5HAQA 1NLYA 4KG5A 1F98A 3UPOA 4WN5A 3KYZA 3LIDA 4PM7A 1CJFA 2H0YA 3C2WA 4OH0A 3IWIA 2ZC3B 5HD5A 1S6RA 1TDGA 2VV8A 4OQIA 4BD0A 4KZ3A 4OQGA 2WAFA 2ZQDA 5L07A 1N9NA 5DJUA 3BFGA 3IF5A 4JXGA 1PYYA 2WGIA 3IQAA 4JGPA 2WGVA 2PYPA 5FDHA 2ZJ9A 4UQIS 2R9WA 3UDXA 3Q7ZA 1OTAA 1LT0A 4F94A 4UA9A 1W8QA 1JWVA 4Z1WA 5FASA 4HEFA 1ONGA 2P7JA 2OAP1 3A3EA 3MZEA 2VA0A 2JN7A 2GZAA 4A5RA 2Y79A 4U3TA 3EOIA 2J3WA 1PWCA 2VGKA 5F1GA 1DJAA 4S2MA 1L0FA 1BLHA 1PWDA 4H6JA 1IYSA 3FKWA 1PNEA 1YSQA 1STZA 2P9VB 3T1SA 3UE6A 3UE0A 4C75A 1JTDA 4M3KA 2JC7A 4P0MA 1ESUA 1ES3A 3A0SA 1ONHA 3SOIA 1PWGA 4MN5A 4CPKA 3G4PA 3P7NA 4O7DA 3TSGA 2Y2PA 4EESA 1MWRA 2PDRA 2HDRA 5EFWA 5CX7A 2VEAA 2V1BA 1G6OA 5J7EA 4YNRA 4HOIA 3IS2A 2EX9A 2JHEA 3FZCA 5L09A 3IXGA 4Y17A 4WELA 3MBZA 4NETA 5DF8A 3D3OA 4BLMA 1JVJA 4HHDA 5D3OA 1BLCA 3V3SA 4X68A 3E0YA 1DJBA 1M6KA 1XFQA 1XJ3A 1XA7A 3LR4A 4E3LA 1K56A 4KG2A 5J8XA 4OOLA 3CPTA 1OTDA 5KSCA 5EUAA 2X71A 5J3WA 1IEMA 2NUTC 1I5QA 3R4KA 1L0GA 4R4RA 5EVIA 3ZDJA 1LHYA 4NXGA 5HWTA 2Z6DA 4C3QA 4BBUA 4RQ9A 2GX5A 4I39A 4QB8A 3VE3A 3BECA 1PZPA 4I38A 3C4OA 4EEUA 2OWJA 4E3OA 2VGJA 4QWOA 3V5MA 3MFDA 4N1HA 1K6RA 2JKFA 3V67A 1F9IA 4GCZA 3LIFA 5E2EA 3BQ8A 1IKIA 5DKKA 2QHKA 2P74A 4DKIA 4GN2A 5EVIC 4R6LA 4CLCA 3UMEA 1D06A 2W1TA 4IVKA 5IT5A 3CG5A 5DTSA 2UWXA 3UNWA 1Y4OA 3LCEA 3PHYA 4MMNA 1T1BA 3TE8A 3KO6A 1JWPA 2XFSA 3ITAA 3H7WB 4DN0A 5FEFA 3F1OA 3LR3A 1LL9A 2Y2OA 1NZUA 3HVFA 5GHXA 4HJ6A 5TFQA 4WYYA 4FTXA 1L3LA 1H8YA 3RTYA 4KG6A 3C7VA 3W8KA 3SS3A 4DXBA 3BJNA 4S2LA 3SH7A 3LIAA 4YOFA 1SHVA 4EQIA 4UA6A 1SZVA 4NKPA 1T18A 4BENA 5FL3A 4U0XA 3A0VA 4CLCC 1KGFA 1MC0A 4S2JA 4IBXA 2V8FA 2A24A 1MY8A 4ME4A 1E4DA 1HZOA 1IYOA 2FH5A 1S4SA 3F1PA 1T1AA 3HLGA 4DE0A 3DWKA 3IHAA 2G2WA 2K7SA 4EU0A 4ZDXA 3PBOA 2YKHA 1W7FA 4Y0UA 5AQ9A 3TG9A 3Q81A 3VOYA 4KZAA 4CQHA 5GLDA 4X69A 1O7EA 4JGRA 1YLTA 3UPPA 2EFUA 4K08A 1ES4A 3IX8A 4EUZA 3WRTA 3CUEC 3KYEA 4LV3A 3CHWP 1LLBA 1TEMA 4WMCD 3IX3A 4UQIM 2B5RA 4R38A 4EEPA 1ZC2A 5L10A 3NHQA 1P0ZA 3ZG5A 3FKVA 2ZL1A 1K25A 1CEGA 5AVEA 4Y5FA 1DJCA 4Y15A 3V50A 3MR0A 1W63M 2WKPA 2Y2GA 5FEGA 2A3UA 2DNSA 2HV1A 4X53A 2Q0OA 4II7A 1KDWA 5EOOA 3C38A 3RH8B 2A24B 4HESA 5CHJA 3TJZC 2X02A 1L2SA 2OLVA 4CLCE 4S2IA 5M1AA 2WKRA 2QJ7A 5CGXA 1ALQA 2V8CA 4E3KA 1RP5A 3P98A 5CGWA 4JXWA 5DF9A 1Z09A 4LRYC 2HJ9C 1EW0A 3ITBA 2KOIA 4QY6A 3IF6B 3H82A 5FI6A 4Y2FA 2ZQAA 3MXRA 3C7UA 3N8SA 4N9KA 3DTMA 4BL3A 2W3DA 3P09A 3ZNTA 1QMEA 4G3VA 3SS4A 2QKPA 5A93A 3NOUC 4OP8A 1GA9A 3BLMA 3BFEA 3C30A 1ZKJA 2ZL1B 2JBFA 1AWIA 3LFVA 1ERMA 5HPIA 1T19A 3N6IA 3LIBA 5EECA 4XUXA 1LL5A 4GJ4A 4P85A 2HP6A 4BMWA 4R4SA 5CHMA 1BLPA 3MFXA 3CJMA 1G6AA 1BYWA 4Q8IA 3OPHA 5EV0A 1K38A 1ZHHB 1G28A 2PU4A 5GLCA 3GTCA 3BYDA 1UWNX 4UHUA 2J9PA 4DDYA 2PD8A 3LICA 1W5DA 5CTMA 3S22A 4EBNA 3QNCA 5FQJA 3BFCA 3UO9A 1TS7A 4B4ZA 3FWLA 3OPLA 1RCJA 5EVEA 1OT9A 1ODVA 1XP4A 4KZ4A 3Q82A 4NXEA 4Y3IA 3HCYA 3E2KA 5M19A 5A90A 5HWVA 4KZ8A 2VJWA 2ZC5B 1SDEA 3GR2A 1DP9A 1CF0A 4P6ZS 3OCLA 3G32A 5LBRA 5K5BA 2GNXA 5A8BA 2HDSA 2XH9A 1G5UA 5FA7A 3GDIA 1KE4A 4WUJA 3BM6A 2H0TA 4PKYA 5L8MA 3PBSA 4GHIB 2E8IA 2DMWA 2ZLYA 2ZC4B 1K4EA 4Z9QA 3WS0A 1NZOA 4BJPA 2EX2A 1IKGA 1FIKA 1FOFA 4QPRA 2WUQA 2JKTM 5CGSA 4NXFA 3IH9A 4EBLA 3M2KA 2RL3A 3BEBA 4MDZA 4BBTA 1MWTA 1S4RA 2VX8A 5EVLA 2D01A 3Q07A 1GSXA 3B3XA 1GHIA 3IXHA 4LCMA 1W79A 2XF3A 1N9LA 5F82A 4RYEA 5AJGA 4P6BA 1OPXA 3IXBA 3T1XA 1GCEA 3U4LP 2Y2KA 3I7JA 1PRQA 2PR6A 1IYQA 2ZMVA 3O3VA 3AGDA 4OPYA 2L0WA 2VK3A 4S2NA 2EA9A 3JPUA 3S7OA 4KUOA 4GS9B 3ZVWA 4N92A 1W8YA 2JE5A 4LV1A 3VOZA 1LSVA 1XGIA 4OOMA 2JCHA 2Y55A 2QJ5A 3KSFA 2H10A 2EFXA 4FCFA 2XSSA 3BLSA 4UA7A 2Q9MA 2HF6A 4IUKA 4F3LA 4FD8A 4I3AA 5CHUA 2INWA 3W4PA 3T4QA 4KUKA 3LI8A 2PT7A 1BZAA 3CZDA 3IHBA 2XR0A 5HARA 1ZG4A 2V1ZA 4S2NC 1VETA 2HDQA 4N9LA 1K56D 2Z2LB 4MLLA 2VKSA 4ARZA 4WEJA 3W2ZA 3F1NA 5CECA 4HJ3A 3PBQA 1DP6A 4DXCA 2A2LA 4BQMA 4Q0JA 4GW9A 2ZM0A 1FCNA 3EEHA 5L2FA 3MQOA 1SDNA 3ZHHA 1F2KA 1CEFA 5EVID 1CQAA 1OMEA 1HVBA 1J3WA 1H8ZA 2RCXA 5FQ9A 1A0KA 4LFUA 4WEKA 1PI5A 1YLPA 4OVDA 2QYBA 3S7QA 4RVAA 1FQGA 1BT5A 1BUEA 1AXBA 4L9EA 3L9KA 5HL1A 3BW6A 4E3MA 5DKLA 1TS6A 3IWOA 2I72A 5HDDA 2L1MA 3DBAA 2HP5A 3PXPA 1N9BA 1VB6A 3VP3A 2J80A 3N4IA 3ZG9B 4O8GA 3VE4A 4ZJ1A 1OT6A 3GV9A 3NIAA 1KDSA 2WYXA 4CLCD 4FH2A 2V0WA 4H6JB 4WZ5C 4KZBA 2XRNA 4LPZA 4GD8A 1GA0A 4I3JA 3HBRA 5AQAA 2Y2NA 3WS1A 3T4TA 4ARZB 2HGVA 4WZ4A 3GECA 4NXBA 4JKTA 4KZ9A 2EWVA 4EQ1A 2FFYA 1Q2QA 1PFLA 1E25A 2K31A 1UWPX 1FR1A 3FG8A 2W27A 5FAQA 4QHCA 1MPLA 3G35A 4IHQA 1NRJA 2PRFA 3QHYA 3T4LA 4I5SA 3IS2B 3VFFA 2ZOIA 2UV0E 3VOLA 3BWLA 4GNUA 4PMAA 4R3AA 2J7VA 3O5YA 4YINA 4YWZA 3UPNA 1PZOA 4HIAA 4IJGA 4ESPA 4KZ6A 4L9GA 3JYIA 5EOEA 2NUPC 4C6YA 2Y2QA 2W3HA 3V3RA 1XJ2A 4X56A 5KSHA 3DTIA 1LI9A 1ESIA 4WLAA 3BY9A 1HTZA 3CPTB 3PBRA 4P6ZM 1H0MA 1KGEA 1S66L 2PD7A 3G31A 4FSFA 1OJ5A 1Y28A 2C5WB 4HH3A 4RX3A 5EVIB 1H8MA 1NJ4A 1XJ6A 4AFIA 3LI9A 1NRFA 1UGUA 2D02A 2Y2HA 5DTTA 4KQDA 4MBHA 3CUEA 3T4KA 3M6HA 4NEED 1N9OA 2QMIA 2HDUA 4JLFA 4JF6A 2Y59A 1JWZA 1U60A 3MF0A 1IOUA 3A3IA 3B47A 3IXDA 1EWZA 5F6AA 2CMNA 1FCOA 3QP6A 2R78A 4DE2A 1SKFA 3ZG0A 3E4QA 4OONA 2WKQA 4R70A 3QP2A 4BBVA 4Y0TA 3IWQA 2Y2MA 2ZD8A 5G4ZA 3WS2A 1EI5A 3HLDA 2OLUA 4CLCB 3KSGA 1KGGA 3NDEA 2W1TB 3U2AA 2LB5A 4HQAA 1XGJA 1NYYA 1YLYA 1Q2PA 2W3EA 1O07A 2QPNA 4B88A 2M1CA 3F1OB 2O9AA 4BWIA 4D60A 3MXQA 1W63Q 3UB5P 3QP8A 1XKZA 3UN7A 1OTEA 3C8CA 5FQIA 3BRMA 2BG1A 2VLGA 4WF0A 2VZWA 3N7WA 2OSUA 1K54A 3A3FA 1T1CA 2PBYA 4LRZE 4NK3A 1PW1A 3WS4A 3D9YA 3DTKA 3EGDC 5KIZA 3Q7VA 2OV5A 1TD5A 4GOGA 4ZJ3A 3T12B 2GJ3A 2JKRI 3A3JA 3F1PB 5TBMA 5C5KA 3TRCA 3SS5A 3W4OA 5FQQA 2O0YA 2P04A 1KVMA 4OQ0A 2JKTI 2ZQ7A 4JXVA 2R9XA 1FR6A 3IX4A 4I3IA 3NOPC 2DCFA 1ES5A 4IEDA 2H28A 1XFNA 5HDSA 3HUMA 3N8LA 3OOVA 2WKIA 5FI2A 1K54C 4MCWA 4OOYA 4DMZA 2WZZA 3VMAA 4LV0A 4E3IA 3T4OA 4ETXA 1LI0A 3K3CA 1XPBA 1GHPA 4PM6A 4QU3A 1RGZA 2XEPA 5E2HA 4UEYA 2VV6A 1X0OA 5HZHA 1F5MA 1FSWA 1S1YA 3PR6A 2XD1A 4EERA 2PR5A 2BLSA 3WS5A 3S4XA 3M6BA 1TS0A 4S2PA 2XA7S 1OTIA 5HAIA 4E6WA 1Y54A 4IUHA 5CEDA 2WKHA 3HLFA 4PM5A 3E4PA 4KZ5A 4G3WA 1TVFA 1MZUA 1MWUA 4D2OA 1D7EA 5HAPA 3Q7VB 5HL6A 3VV4A 2EX6A 2PHYA 4Q0HA 4MEZA 4N1XA 3HUOA 4LCLA 3ZGAB 4HBTA 3MS6A 1HLUP 2WAEA 4R23A 1YKDA 2CC1A 4PHTA 2Y91A 3MQ0A 4RA7A 2ZQ8A 5GL9A 4X55A 3PAEA 5CEBA 3H82B 1L0EA 4MBFA 4QJGA 2VGLS 2OWHA 3TW8A 4LENA 3FPVA 4OQHA 3IT9A 4ZBEA 2C6WB 3FPWA 2B18A 3KSIA 2I9VA 4HNBA 5IS1A 3IH8A 1S1ZA 2G2UA 1MKMA 5EPHA 1DY6A 1NYMA 2J3TC 3LYXA 4PM9A 4MN7A 3NJAA 2JKRM 1CI8A 5FAPA 4Y0OA 2B02A 4E3NA 3ZCZA 2ZBBA 2QWSA 3R7WA 3P01A 2WADA 3BFDA 1FSYA 4K0WA 3LR5A 4DE1A 5CRFA 1ACFA 3O86A 4KQOA 3G6OA 4DF6A 4BD1A 5GLAA 5JYPA 4JF5A 2BTFP 2Y2IA 3EWKA 4KQQA 3HJIA 4EXOA 2IWCA 3MKEA 3ZQ5A 3OPPA 1LSWA 3AGEA 3EQVA 1WE4A 4E04A 2P9VA 5CTNA 4Y7PA 4ID4A 4OP5A 1G68A 4GDNA 2ACGA 2HJEA 4OPRA 2V0UA 1K55A 5G4YA 4XUZA 1J9MA 4OKPA 3NECA 5E43A 1NXYA 5A92A 1I2WA 3GVBA 4E3JA 2K2NA 3T4SA 2OAQ1 2G7UA 3KX0X 2DRWA 3IBJA 4HP4A 3SH8A 2EXBA 2WK0A 4R0QA 5I94A 3B33A 4KQRA 4EV4A 1LL8A 4OLDA 4ZJ2A 1L0DA 3VP2A 1KE3A 5KZHA 5HPFA 1BLSA 3S7NA 2VV7A 3C5AA 1H3QA 1E3UA 4ZTKA 3VSLA 4B9OA 3WWXA 4B4XA 4DRTA 3R7WB 3HREA 3NBLA 3M2JA 3ZG8B 4PAUA 2W3FA 3MZDA 1K55C 2OOLA 4DJ2A 1V9ZA 3UB7A 1WYBA 3EGXC 1LSXA 3UB6A 3ZG7B 3PAGA 4GKUA 3SZTA 3EQUA 1TF1A 1KE0A 1ERQA 5AVFA 2B95A 4WM9A 4DE3A 1YMXA 1YQSA 3S1YA 4MN6A 2Y8HA 5DVAA 2ZQCA 5HWWA 4GZBA 4WZ5A 5IHVA 1V9YA 3W4QA 3ICYA 1CK3A 1P9WA 3HLWA 1VQQA 2J8YA 3V39A 4IBRA 1YMSA 4JGQA 3JVUA 2V1AA 3CAXA 4S2KA 5FQKA 4O0PA 3QP5A 4EWFA 1YM1A 3FYZA 3MZFA 4H8RA 4Q0IA 4K0XA 4R3BA 1N4OA 1JTGA 3DTEA 4FH4A 1OTBA 3PTEA 2ZMAA 3CI6A 3NDGA 4F3LB 1ES2A 1KOUA 2ZOHA 4XXRA 5G18A 4LGWA 1BTLA 2V20A 3NULA 5E2FA 2XD5A 3GRJA 4L0LA 4MNRA 4B93A 5DTKA 4Y13A 2IWDA 3IBRA 5F5YA 5FAOA 3PBTA 4L9FA 1VETB 3E4OA 3DW0A 3NC8A 2YKFA 2KLIA 3H7WA 3F1NB 2XGNA 3T1RA 4EBPA 2JKGA 4R3JA 5F68A 2W0NA 3MKFA 3KYQA 3RJUA 3KSHA 3QNBA 2WZXA 2XA7M 4HH2A 1ZG6A 3VFHA 1GHMA 5CXWA 2IWBA 1OJGA 2ZC6B 3OZHA 4BL2A 3C4PA 3B42A 4HJ4A 5I5LA 3SH9A 3RFBA 3UB9A 2O9BA 1KVLA 3A3DA 4JF4A 5GHZA 2IA2A 5TJJA 1FILA 3OCNA 1QMFA 1XXMA 3NCKA 4WBGA 3GQZA 3OC2A 4HP9A 4KZ7A 4PM8A 5JYOA 3O87A 5M18A 1XA1A 3NOTC 2PBDP 3H9WA 2KDKA 2V2FF 3FC7A 3Q1FA 3MXSA 2WGWA 1CI9A 1PW8A 2H5SA 5HX9A 2VGLM 4MBKA 3HJKA 2M7VA 4HBUA 5GHYA 2ZQ9A 2XROA 3RXWA 2J9OA 3QP4A 1DRMA 5FDSA 3UB8A 1IELA 4X1LA 5CERA 2KX6A 3NI9A 2Y4AA 1GSWA 4FOFA 1TS8A 2W3GA 1PI4A 4GDBA 3BFFA 3FV7A 3LEZA 3ULFA 2AVXA 2PAVP 2PYRA 1SCWA 1S67L 5HD3A 4PKYG 3LY4A 3ISGA 5F1FA 2O9CA 5TR7A 5DFYA 1K57A 4JPMA 1MKIA 2LB9A 2EWWA 3D4FA 3E2LA 4X6TA 4IVIA 2XLNA 1DP8A 1YAXA 5FSRA 1ZTUA 3UDFA 3MQQA 4GD6A 4HY8A 4P87A 1YLWA 3TOIA 3T50A 1XJ4A 4E6XA 4LV2A 2EX8A 4JXSA 4X1MA 3S7PA 3D72A 5EM0A 1S0WA 1FCMA 1YSPA 2WKEA 3LIEA 5FATA 3T4JA 4DJ3A 1K0KA 1PIOA 4CJNA 3ZVTA 2WGWB 2L4RA 3UMDA 1WA9A 3IF6A 3N8RA 2XFTA 3OBFA 5J4EA 5MC7A 2ZC7A 3MSHA 4KENB 4JBFA 4QY5A 1IYPA 5EE8A 4OPZA 5DFXA 1K57C 5TGFA 2M7UA 1H5XA 3VP1A 3QP1A 1RGYA 3UE1A 5U47A 5F83A 3G34A 4O01A 3OLOA 1TDLA 4ETZA 4LRXC 2ZM8A 1VEUA 3VSKA 4JGOA 4EUVA 4S2OA 3T1QB 3LUQA 4UAAA 1K6SA 1WYCA 2ZM2A 4OPQA 4FUWA 1MBLA 3IF6C 1HD8A 3E98A 3VP0A 3ZNYA 2HP9A 3GMWA 3UDIA 2HZ5A 2J3TD 1NLZA 4DDSA 2Z2MB 1YPRA 4PPRA 5GLBA 3HLCA 5E2GA 2A49A 4XT2A 2XQZA 3G30A 1JNUA 3PYPA 4WMCA 3AGFA 1M40A 1SKOA 2Q9NA 3NY4A 3CITA 4HI4A 5A91A 4OLGA 3WRZA 1VM1A 3BQAA 4NG2A 2Z6CA 2HPBA
chains in the Genus database with same CATH topology
1VB6A 2ZMFA 2A24A 2J80A 4ME4A 5DJTA 4O8GA 4M4XA 2HJEA 2W1RA 3VE4A 4EETB 2P08A 2V0UA 2FH5A 1OT6A 5G4YA 1S4SA 4CLCD 2V0WA 4H6JB 4GHIA 3F1PA 1GSVA 1T1AA 2XRNA 4LPZA 4I3JA 2K2NA 2MJ6A 3T4SA 3CWFA 2OAQ1 4G3KA 2G7UA 2K7SA 1P9RA 2BASA 3T4TA 3BY8A 3KX0X 4EU0A 3PBOA 2YKHA 3IBJA 4HP4A 4EW7A 4ARZB 2HGVA 3GECA 4NXBA 2EWVA 4CQHA 2V9AA 3B33A 4EQ1A 4JGRA 3UE3A 1LL8A 2K31A 1UWPX 4K08A 5TBMB 3FG8A 2W27A 3CUEC 4IHQA 5HPFA 1NRJA 1P97A 3S7NA 2VV7A 1H3QA 3MJQA 4B9OA 4UQIM 3T4LA 3LR0A 4R38A 3R7WB 4GLQA 4ZRRA 4I5SA 4EEPA 3IS2B 3MMHA 1VHMA 2ZOIA 2FZ0A 4PAUA 2W3FA 3BWLA 3NHQA 3VOLA 1P0ZA 2OOLA 2O99A 5HDCA 5AVEA 4XT2B 4DJ2A 4Y5FA 4R3AA 3O5YA 4YWZA 1V9ZA 3UB7A 3EGXC 4HIAA 1LSXA 4IJGA 3MR0A 1W63M 3UB6A 4WL9A 4L9GA 2WKPA 3EQUA 2HV1A 3K3DA 3PBNA 3SW1A 1TF1A 5IU1A 2NUPC 5AVFA 2W3HA 4II7A 3EEAA 1XJ2A 3C38A 3RH8B 4MN6A 5KSHA 3JVVA 2A24B 2Y8HA 4GS9A 3TJZC 5F69A 1IFQA 5HWWA 4WLAA 3BY9A 4CLCE 1V9YA 3ICYA 3CLOA 3PBRA 1NWZA 2WKRA 4P6ZM 2QJ7A 1P9WA 1S66L 4LLOB 5HSQA 2PD7A 4FSFA 4JGQA 1OJ5A 1Y28A 2V1AA 3JVUA 3A0RA 4HH3A 3CAXA 5DF9A 1H8MA 4AFIA 1XJ6A 4LRYC 2HJ9C 4O0PA 4CLCC 3LI9A 3K2NA 1UGUA 1EW0A 4Q0IA 3ZYTA 1NLYA 2D02A 2KOIA 3H82A 1F98A 4KQDA 4Y2FA 3CUEA 3T4KA 4WN5A 3KYZA 4NEED 1N9OA 3LIDA 1OTBA 3CI6A 3C2WA 4F3LB 1KOUA 2ZOHA 2W3DA 5HD5A 4G3VA 2VV8A 3MF0A 1IOUA 3B47A 2QKPA 3NOUC 5F6AA 2CMNA 4L0LA 3C30A 1N9NA 2R78A 4B93A 3E4QA 2WKQA 4R70A 3LFVA 5DJUA 4BBVA 3IBRA 5F5YA 5HPIA 1T19A 3PBTA 3LIBA 4L9FA 3E4OA 2YKFA 5G4ZA 4JGPA 2KLIA 3H7WA 3F1NB 2PYPA 4GJ4A 4CLCB 3KSGA 4BMWA 4UQIS 2W1TB 5F68A 3MFXA 2W0NA 3KYQA 3U2AA 1BYWA 2LB5A 4HQAA 1ZHHB 1G28A 3KSHA 1OTAA 1LT0A 1UWNX 2W3EA 2XA7M 4HH2A 2PD8A 3LICA 4Z1WA 1OJGA 2P7JA 2M1CA 3F1OB 2OAP1 2O9AA 1TS7A 3B42A 4HJ4A 2VA0A 5I5LA 2JN7A 2GZAA 4BWIA 3RFBA 1OT9A 3UB9A 2O9BA 2Y79A 1ODVA 3EOIA 3MXQA 1W63Q 2J3WA 4NXEA 4Y3IA 2IA2A 5TJJA 3HCYA 3OCNA 1OTEA 3C8CA 5HWVA 2VLGA 4WF0A 2VZWA 3OC2A 4HP9A 4H6JA 2VJWA 1YSQA 1STZA 1DP9A 4P6ZS 3NOTC 3OCLA 1T1CA 3UE6A 3H9WA 5LBRA 2KDKA 5K5BA 4LRZE 3FC7A 2GNXA 5A8BA 3A0SA 3EGDC 5KIZA 3GDIA 4WUJA 1TD5A 2VGLM 4PKYA 5L8MA 4MN5A 2GJ3A 3PBSA 2JKRI 4GHIB 3HJKA 2M7VA 3F1PB 3P7NA 2DMWA 5TBMA 5C5KA 3TRCA 4EESA 2PDRA 2XROA 2O0YA 2P04A 5EFWA 5CX7A 2JKTI 1DRMA 2VEAA 3UB8A 2V1BA 4BJPA 1G6OA 5J7EA 2KX6A 4YNRA 1GSWA 4HOIA 4I3IA 3NOPC 3IS2A 4QPRA 4FOFA 1TS8A 2JKTM 2JHEA 2W3GA 4NXFA 2H28A 1XFNA 3ULFA 5HDSA 2PYRA 1S67L 3OOVA 5HD3A 4WELA 4PKYG 3D3OA 4MCWA 2O9CA 4MDZA 4BBTA 4DMZA 1S4RA 2VX8A 4HHDA 5DFYA 2D01A 2LB9A 2EWWA 3T4OA 4ETXA 1GSXA 3E0YA 3K3CA 1DP8A 1YAXA 1N9LA 1XFQA 1XJ3A 3LR4A 4UEYA 1ZTUA 3MQQA 2VV6A 1X0OA 5HZHA 4HY8A 1F5MA 5AJGA 1S1YA 3PR6A 1OPXA 3T50A 4OOLA 1XJ4A 4EERA 2PR5A 2PR6A 1OTDA 1TS0A 2ZMVA 2XA7S 5J3WA 1OTIA 3S7PA 2L0WA 2NUTC 4IUHA 3R4KA 3D72A 2EA9A 3E4PA 4G3WA 1YSPA 3T4JA 3LIEA 3S7OA 4NXGA 1MZUA 4KUOA 4DJ3A 4GS9B 5HWTA 1D7EA 2Z6DA 4BBUA 2L4RA 4RQ9A 1WA9A 3UMDA 5HL6A 3VV4A 2GX5A 2PHYA 4I39A 4Q0HA 1LSVA 3VE3A 3OBFA 5J4EA 5MC7A 4OOMA 4I38A 2QJ5A 4EEUA 3KSFA 5DFXA 2XSSA 2M7UA 1YKDA 2HF6A 2OWJA 4IUKA 4F3LA 4I3AA 4PHTA 2INWA 3MQ0A 3T4QA 3H82B 4KUKA 4O01A 3OLOA 4ETZA 4LRXC 3LI8A 3V67A 2PT7A 1F9IA 4GCZA 2VGLS 2OWHA 3TW8A 3LIFA 3BQ8A 4JGOA 5DKKA 2QHKA 3FPVA 3FPWA 2B18A 3KSIA 2I9VA 4HNBA 2VKSA 4ARZA 4EUVA 5IS1A 1S1ZA 4WEJA 3W2ZA 3F1NA 4R6LA 4HJ3A 3LUQA 3PBQA 1DP6A 1MKMA 4CLCA 3UMEA 1D06A 2A2LA 4Q0JA 4GW9A 2W1TA 2J3TC 3EEHA 3LYXA 5IT5A 4MN7A 3MQOA 3E98A 3NJAA 2JKRM 3PHYA 4MMNA 1T1BA 2B02A 3TE8A 3KO6A 2ZBBA 2J3TD 2QWSA 1NLZA 3H7WB 3R7WA 4DN0A 3P01A 3F1OA 3LR3A 4WEKA 2QYBA 4HJ6A 3LR5A 3RTYA 4XT2A 3S7QA 4KQOA 3G6OA 4L9EA 1JNUA 3PYPA 3BJNA 3LIAA 4YOFA 3BW6A 3CITA 3EWKA 5DKLA 1TS6A 3HJIA 4EXOA 4HI4A 3ZQ5A 5HDDA 1LSWA 3EQVA 4NKPA 2L1MA 3DBAA 1T18A 4E04A 5FL3A 3BQAA 3A0VA 2Z6CA 1MC0A 3PXPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HSQ A;  2ZMF A;  2VZW A;  4RQ9 A;  4ME4 A;  5HL6 A;  2VJW A;  3VV4 A;  2GX5 A;  4O8G A;  1YSQ A;  2W1R A;  1STZ A;  4Q0H A;  4LRY C;  3NOT C;  4O0P A;  3OBF A;  5LBR A;  3K2N A;  4Q0I A;  5K5B A;  4LRZ E;  3KSF A;  5DFX A;  2KOI A;  2XSS A;  2M7U A;  2XRN A;  1YKD A;  4IUK A;  2K2N A;  4Y2F A;  3MQ0 A;  1TD5 A;  4G3K A;  2G7U A;  5L8M A;  3CI6 A;  4EU0 A;  3C2W A;  2M7V A;  4O01 A;  3IBJ A;  4ETZ A;  5C5K A;  4LRX C;  3TRC A;  2HGV A;  2W3D A;  4CQH A;  2XRO A;  2O0Y A;  4G3V A;  3MF0 A;  2VEA A;  3NOU C;  2K31 A;  2B18 A;  4YNR A;  3KSI A;  5HPF A;  2VKS A;  4EUV A;  3S7N A;  3NOP C;  4QPR A;  4FOF A;  3W2Z A;  2W3G A;  4R6L A;  4R70 A;  3LFV A;  1MKM A;  3IBR A;  5HPI A;  4Q0J A;  4GW9 A;  2W1T A;  4GLQ A;  4ZRR A;  3OOV A;  4MN7 A;  2KLI A;  3MMH A;  1VHM A;  3E98 A;  3D3O A;  4PAU A;  2W3F A;  3NHQ A;  4MCW A;  3KSG A;  2O9C A;  4MDZ A;  4DMZ A;  2OOL A;  2O99 A;  2W1T B;  4MMN A;  4Y5F A;  3O5Y A;  3KO6 A;  5DFY A;  2LB5 A;  2LB9 A;  4IJG A;  4ETX A;  4DN0 A;  3E0Y A;  3KSH A;  2W3E A;  1TF1 A;  1ZTU A;  2QYB A;  1F5M A;  4Z1W A;  5AJG A;  3S7Q A;  3G6O A;  2W3H A;  3BJN A;  3EEA A;  2O9A A;  4YOF A;  5I5L A;  2Y8H A;  3S7P A;  4BWI A;  3CIT A;  3RFB A;  4IUH A;  2O9B A;  2Y79 A;  3R4K A;  3ZQ5 A;  4G3W A;  1YSP A;  4Y3I A;  3DBA A;  2IA2 A;  5TJJ A;  3S7O A;  3HCY A;  4E04 A;  1MC0 A; 
#chains in the Genus database with same CATH topology
 3G2Z A;  2ZMF A;  1YLZ A;  5DJT A;  3LY3 A;  4M4X A;  2W1R A;  4EET B;  2P08 A;  5KMW A;  3LO7 A;  4GB7 A;  1MWS A;  5DF7 A;  4GHI A;  1GSV A;  1VEU B;  2MJ6 A;  3CWF A;  4G3K A;  1P9R A;  2BAS A;  2GDN A;  3BY8 A;  2XK1 A;  3HUN A;  2EXA A;  4K91 A;  3ZFZ A;  4EW7 A;  4QD4 A;  5FQM A;  1BSG A;  2V9A A;  3OPR A;  3UE3 A;  3L7H A;  5TBM B;  2E8J A;  4R1G A;  3UY6 A;  3VP4 A;  1BUL A;  3DAV A;  3RXX A;  1P97 A;  3MJQ A;  4YFM A;  3LR0 A;  4GLQ A;  1MXO A;  4ZRR A;  2Y2J A;  5FI7 A;  3MMH A;  1VHM A;  2FZ0 A;  1K4F A;  1YLJ A;  3HL9 A;  4ZAM A;  5EM1 A;  3LGO A;  2O99 A;  3GSG A;  5HDC A;  2X01 A;  3HLB A;  4XT2 B;  5AQB A;  2FFF B;  1NY0 A;  1SKO B;  1C3B A;  3LEQ A;  1ERO A;  4WL9 A;  3K3D A;  3PBN A;  3SW1 A;  5IU1 A;  3HLE A;  3EEA A;  2PU2 A;  5HFO A;  3G2Y A;  3JVV A;  4GS9 A;  4RX2 A;  5F69 A;  1IFQ A;  5BOH A;  4X25 A;  4U0T A;  1YT4 A;  3CLO A;  1NWZ A;  2QZ6 A;  2Y2L A;  3O88 A;  5HW3 A;  4LLO B;  5HSQ A;  1I2S A;  3A0R A;  2XDM A;  3CMZ A;  1Z6F A;  1XX2 A;  5AQ7 A;  3K2N A;  1E3U D;  3DWZ A;  3ZYT A;  1D1J A;  5HAQ A;  1NLY A;  4KG5 A;  1F98 A;  3UPO A;  4WN5 A;  3KYZ A;  3LID A;  4PM7 A;  1CJF A;  2H0Y A;  3C2W A;  4OH0 A;  3IWI A;  2ZC3 B;  5HD5 A;  1S6R A;  1TDG A;  2VV8 A;  4OQI A;  4BD0 A;  4KZ3 A;  4OQG A;  2WAF A;  2ZQD A;  5L07 A;  1N9N A;  5DJU A;  3BFG A;  3IF5 A;  4JXG A;  1PYY A;  2WGI A;  3IQA A;  4JGP A;  2WGV A;  2PYP A;  5FDH A;  2ZJ9 A;  4UQI S;  2R9W A;  3UDX A;  3Q7Z A;  1OTA A;  1LT0 A;  4F94 A;  4UA9 A;  1W8Q A;  1JWV A;  4Z1W A;  5FAS A;  4HEF A;  1ONG A;  2P7J A;  2OAP 1;  3A3E A;  3MZE A;  2VA0 A;  2JN7 A;  2GZA A;  4A5R A;  2Y79 A;  4U3T A;  3EOI A;  2J3W A;  1PWC A;  2VGK A;  5F1G A;  1DJA A;  4S2M A;  1L0F A;  1BLH A;  1PWD A;  4H6J A;  1IYS A;  3FKW A;  1PNE A;  1YSQ A;  1STZ A;  2P9V B;  3T1S A;  3UE6 A;  3UE0 A;  4C75 A;  1JTD A;  4M3K A;  2JC7 A;  4P0M A;  1ESU A;  1ES3 A;  3A0S A;  1ONH A;  3SOI A;  1PWG A;  4MN5 A;  4CPK A;  3G4P A;  3P7N A;  4O7D A;  3TSG A;  2Y2P A;  4EES A;  1MWR A;  2PDR A;  2HDR A;  5EFW A;  5CX7 A;  2VEA A;  2V1B A;  1G6O A;  5J7E A;  4YNR A;  4HOI A;  3IS2 A;  2EX9 A;  2JHE A;  3FZC A;  5L09 A;  3IXG A;  4Y17 A;  4WEL A;  3MBZ A;  4NET A;  5DF8 A;  3D3O A;  4BLM A;  1JVJ A;  4HHD A;  5D3O A;  1BLC A;  3V3S A;  4X68 A;  3E0Y A;  1DJB A;  1M6K A;  1XFQ A;  1XJ3 A;  1XA7 A;  3LR4 A;  4E3L A;  1K56 A;  4KG2 A;  5J8X A;  4OOL A;  3CPT A;  1OTD A;  5KSC A;  5EUA A;  2X71 A;  5J3W A;  1IEM A;  2NUT C;  1I5Q A;  3R4K A;  1L0G A;  4R4R A;  5EVI A;  3ZDJ A;  1LHY A;  4NXG A;  5HWT A;  2Z6D A;  4C3Q A;  4BBU A;  4RQ9 A;  2GX5 A;  4I39 A;  4QB8 A;  3VE3 A;  3BEC A;  1PZP A;  4I38 A;  3C4O A;  4EEU A;  2OWJ A;  4E3O A;  2VGJ A;  4QWO A;  3V5M A;  3MFD A;  4N1H A;  1K6R A;  2JKF A;  3V67 A;  1F9I A;  4GCZ A;  3LIF A;  5E2E A;  3BQ8 A;  1IKI A;  5DKK A;  2QHK A;  2P74 A;  4DKI A;  4GN2 A;  5EVI C;  4R6L A;  4CLC A;  3UME A;  1D06 A;  2W1T A;  4IVK A;  5IT5 A;  3CG5 A;  5DTS A;  2UWX A;  3UNW A;  1Y4O A;  3LCE A;  3PHY A;  4MMN A;  1T1B A;  3TE8 A;  3KO6 A;  1JWP A;  2XFS A;  3ITA A;  3H7W B;  4DN0 A;  5FEF A;  3F1O A;  3LR3 A;  1LL9 A;  2Y2O A;  1NZU A;  3HVF A;  5GHX A;  4HJ6 A;  5TFQ A;  4WYY A;  4FTX A;  1L3L A;  1H8Y A;  3RTY A;  4KG6 A;  3C7V A;  3W8K A;  3SS3 A;  4DXB A;  3BJN A;  4S2L A;  3SH7 A;  3LIA A;  4YOF A;  1SHV A;  4EQI A;  4UA6 A;  1SZV A;  4NKP A;  1T18 A;  4BEN A;  5FL3 A;  4U0X A;  3A0V A;  4CLC C;  1KGF A;  1MC0 A;  4S2J A;  4IBX A;  2V8F A;  2A24 A;  1MY8 A;  4ME4 A;  1E4D A;  1HZO A;  1IYO A;  2FH5 A;  1S4S A;  3F1P A;  1T1A A;  3HLG A;  4DE0 A;  3DWK A;  3IHA A;  2G2W A;  2K7S A;  4EU0 A;  4ZDX A;  3PBO A;  2YKH A;  1W7F A;  4Y0U A;  5AQ9 A;  3TG9 A;  3Q81 A;  3VOY A;  4KZA A;  4CQH A;  5GLD A;  4X69 A;  1O7E A;  4JGR A;  1YLT A;  3UPP A;  2EFU A;  4K08 A;  1ES4 A;  3IX8 A;  4EUZ A;  3WRT A;  3CUE C;  3KYE A;  4LV3 A;  3CHW P;  1LLB A;  1TEM A;  4WMC D;  3IX3 A;  4UQI M;  2B5R A;  4R38 A;  4EEP A;  1ZC2 A;  5L10 A;  3NHQ A;  1P0Z A;  3ZG5 A;  3FKV A;  2ZL1 A;  1K25 A;  1CEG A;  5AVE A;  4Y5F A;  1DJC A;  4Y15 A;  3V50 A;  3MR0 A;  1W63 M;  2WKP A;  2Y2G A;  5FEG A;  2A3U A;  2DNS A;  2HV1 A;  4X53 A;  2Q0O A;  4II7 A;  1KDW A;  5EOO A;  3C38 A;  3RH8 B;  2A24 B;  4HES A;  5CHJ A;  3TJZ C;  2X02 A;  1L2S A;  2OLV A;  4CLC E;  4S2I A;  5M1A A;  2WKR A;  2QJ7 A;  5CGX A;  1ALQ A;  2V8C A;  4E3K A;  1RP5 A;  3P98 A;  5CGW A;  4JXW A;  5DF9 A;  1Z09 A;  4LRY C;  2HJ9 C;  1EW0 A;  3ITB A;  2KOI A;  4QY6 A;  3IF6 B;  3H82 A;  5FI6 A;  4Y2F A;  2ZQA A;  3MXR A;  3C7U A;  3N8S A;  4N9K A;  3DTM A;  4BL3 A;  2W3D A;  3P09 A;  3ZNT A;  1QME A;  4G3V A;  3SS4 A;  2QKP A;  5A93 A;  3NOU C;  4OP8 A;  1GA9 A;  3BLM A;  3BFE A;  3C30 A;  1ZKJ A;  2ZL1 B;  2JBF A;  1AWI A;  3LFV A;  1ERM A;  5HPI A;  1T19 A;  3N6I A;  3LIB A;  5EEC A;  4XUX A;  1LL5 A;  4GJ4 A;  4P85 A;  2HP6 A;  4BMW A;  4R4S A;  5CHM A;  1BLP A;  3MFX A;  3CJM A;  1G6A A;  1BYW A;  4Q8I A;  3OPH A;  5EV0 A;  1K38 A;  1ZHH B;  1G28 A;  2PU4 A;  5GLC A;  3GTC A;  3BYD A;  1UWN X;  4UHU A;  2J9P A;  4DDY A;  2PD8 A;  3LIC A;  1W5D A;  5CTM A;  3S22 A;  4EBN A;  3QNC A;  5FQJ A;  3BFC A;  3UO9 A;  1TS7 A;  4B4Z A;  3FWL A;  3OPL A;  1RCJ A;  5EVE A;  1OT9 A;  1ODV A;  1XP4 A;  4KZ4 A;  3Q82 A;  4NXE A;  4Y3I A;  3HCY A;  3E2K A;  5M19 A;  5A90 A;  5HWV A;  4KZ8 A;  2VJW A;  2ZC5 B;  1SDE A;  3GR2 A;  1DP9 A;  1CF0 A;  4P6Z S;  3OCL A;  3G32 A;  5LBR A;  5K5B A;  2GNX A;  5A8B A;  2HDS A;  2XH9 A;  1G5U A;  5FA7 A;  3GDI A;  1KE4 A;  4WUJ A;  3BM6 A;  2H0T A;  4PKY A;  5L8M A;  3PBS A;  4GHI B;  2E8I A;  2DMW A;  2ZLY A;  2ZC4 B;  1K4E A;  4Z9Q A;  3WS0 A;  1NZO A;  4BJP A;  2EX2 A;  1IKG A;  1FIK A;  1FOF A;  4QPR A;  2WUQ A;  2JKT M;  5CGS A;  4NXF A;  3IH9 A;  4EBL A;  3M2K A;  2RL3 A;  3BEB A;  4MDZ A;  4BBT A;  1MWT A;  1S4R A;  2VX8 A;  5EVL A;  2D01 A;  3Q07 A;  1GSX A;  3B3X A;  1GHI A;  3IXH A;  4LCM A;  1W79 A;  2XF3 A;  1N9L A;  5F82 A;  4RYE A;  5AJG A;  4P6B A;  1OPX A;  3IXB A;  3T1X A;  1GCE A;  3U4L P;  2Y2K A;  3I7J A;  1PRQ A;  2PR6 A;  1IYQ A;  2ZMV A;  3O3V A;  3AGD A;  4OPY A;  2L0W A;  2VK3 A;  4S2N A;  2EA9 A;  3JPU A;  3S7O A;  4KUO A;  4GS9 B;  3ZVW A;  4N92 A;  1W8Y A;  2JE5 A;  4LV1 A;  3VOZ A;  1LSV A;  1XGI A;  4OOM A;  2JCH A;  2Y55 A;  2QJ5 A;  3KSF A;  2H10 A;  2EFX A;  4FCF A;  2XSS A;  3BLS A;  4UA7 A;  2Q9M A;  2HF6 A;  4IUK A;  4F3L A;  4FD8 A;  4I3A A;  5CHU A;  2INW A;  3W4P A;  3T4Q A;  4KUK A;  3LI8 A;  2PT7 A;  1BZA A;  3CZD A;  3IHB A;  2XR0 A;  5HAR A;  1ZG4 A;  2V1Z A;  4S2N C;  1VET A;  2HDQ A;  4N9L A;  1K56 D;  2Z2L B;  4MLL A;  2VKS A;  4ARZ A;  4WEJ A;  3W2Z A;  3F1N A;  5CEC A;  4HJ3 A;  3PBQ A;  1DP6 A;  4DXC A;  2A2L A;  4BQM A;  4Q0J A;  4GW9 A;  2ZM0 A;  1FCN A;  3EEH A;  5L2F A;  3MQO A;  1SDN A;  3ZHH A;  1F2K A;  1CEF A;  5EVI D;  1CQA A;  1OME A;  1HVB A;  1J3W A;  1H8Z A;  2RCX A;  5FQ9 A;  1A0K A;  4LFU A;  4WEK A;  1PI5 A;  1YLP A;  4OVD A;  2QYB A;  3S7Q A;  4RVA A;  1FQG A;  1BT5 A;  1BUE A;  1AXB A;  4L9E A;  3L9K A;  5HL1 A;  3BW6 A;  4E3M A;  5DKL A;  1TS6 A;  3IWO A;  2I72 A;  5HDD A;  2L1M A;  3DBA A;  2HP5 A;  3PXP A;  1N9B A;  1VB6 A;  3VP3 A;  2J80 A;  3N4I A;  3ZG9 B;  4O8G A;  3VE4 A;  4ZJ1 A;  1OT6 A;  3GV9 A;  3NIA A;  1KDS A;  2WYX A;  4CLC D;  4FH2 A;  2V0W A;  4H6J B;  4WZ5 C;  4KZB A;  2XRN A;  4LPZ A;  4GD8 A;  1GA0 A;  4I3J A;  3HBR A;  5AQA A;  2Y2N A;  3WS1 A;  3T4T A;  4ARZ B;  2HGV A;  4WZ4 A;  3GEC A;  4NXB A;  4JKT A;  4KZ9 A;  2EWV A;  4EQ1 A;  2FFY A;  1Q2Q A;  1PFL A;  1E25 A;  2K31 A;  1UWP X;  1FR1 A;  3FG8 A;  2W27 A;  5FAQ A;  4QHC A;  1MPL A;  3G35 A;  4IHQ A;  1NRJ A;  2PRF A;  3QHY A;  3T4L A;  4I5S A;  3IS2 B;  3VFF A;  2ZOI A;  2UV0 E;  3VOL A;  3BWL A;  4GNU A;  4PMA A;  4R3A A;  2J7V A;  3O5Y A;  4YIN A;  4YWZ A;  3UPN A;  1PZO A;  4HIA A;  4IJG A;  4ESP A;  4KZ6 A;  4L9G A;  3JYI A;  5EOE A;  2NUP C;  4C6Y A;  2Y2Q A;  2W3H A;  3V3R A;  1XJ2 A;  4X56 A;  5KSH A;  3DTI A;  1LI9 A;  1ESI A;  4WLA A;  3BY9 A;  1HTZ A;  3CPT B;  3PBR A;  4P6Z M;  1H0M A;  1KGE A;  1S66 L;  2PD7 A;  3G31 A;  4FSF A;  1OJ5 A;  1Y28 A;  2C5W B;  4HH3 A;  4RX3 A;  5EVI B;  1H8M A;  1NJ4 A;  1XJ6 A;  4AFI A;  3LI9 A;  1NRF A;  1UGU A;  2D02 A;  2Y2H A;  5DTT A;  4KQD A;  4MBH A;  3CUE A;  3T4K A;  3M6H A;  4NEE D;  1N9O A;  2QMI A;  2HDU A;  4JLF A;  4JF6 A;  2Y59 A;  1JWZ A;  1U60 A;  3MF0 A;  1IOU A;  3A3I A;  3B47 A;  3IXD A;  1EWZ A;  5F6A A;  2CMN A;  1FCO A;  3QP6 A;  2R78 A;  4DE2 A;  1SKF A;  3ZG0 A;  3E4Q A;  4OON A;  2WKQ A;  4R70 A;  3QP2 A;  4BBV A;  4Y0T A;  3IWQ A;  2Y2M A;  2ZD8 A;  5G4Z A;  3WS2 A;  1EI5 A;  3HLD A;  2OLU A;  4CLC B;  3KSG A;  1KGG A;  3NDE A;  2W1T B;  3U2A A;  2LB5 A;  4HQA A;  1XGJ A;  1NYY A;  1YLY A;  1Q2P A;  2W3E A;  1O07 A;  2QPN A;  4B88 A;  2M1C A;  3F1O B;  2O9A A;  4BWI A;  4D60 A;  3MXQ A;  1W63 Q;  3UB5 P;  3QP8 A;  1XKZ A;  3UN7 A;  1OTE A;  3C8C A;  5FQI A;  3BRM A;  2BG1 A;  2VLG A;  4WF0 A;  2VZW A;  3N7W A;  2OSU A;  1K54 A;  3A3F A;  1T1C A;  2PBY A;  4LRZ E;  4NK3 A;  1PW1 A;  3WS4 A;  3D9Y A;  3DTK A;  3EGD C;  5KIZ A;  3Q7V A;  2OV5 A;  1TD5 A;  4GOG A;  4ZJ3 A;  3T12 B;  2GJ3 A;  2JKR I;  3A3J A;  3F1P B;  5TBM A;  5C5K A;  3TRC A;  3SS5 A;  3W4O A;  5FQQ A;  2O0Y A;  2P04 A;  1KVM A;  4OQ0 A;  2JKT I;  2ZQ7 A;  4JXV A;  2R9X A;  1FR6 A;  3IX4 A;  4I3I A;  3NOP C;  2DCF A;  1ES5 A;  4IED A;  2H28 A;  1XFN A;  5HDS A;  3HUM A;  3N8L A;  3OOV A;  2WKI A;  5FI2 A;  1K54 C;  4MCW A;  4OOY A;  4DMZ A;  2WZZ A;  3VMA A;  4LV0 A;  4E3I A;  3T4O A;  4ETX A;  1LI0 A;  3K3C A;  1XPB A;  1GHP A;  4PM6 A;  4QU3 A;  1RGZ A;  2XEP A;  5E2H A;  4UEY A;  2VV6 A;  1X0O A;  5HZH A;  1F5M A;  1FSW A;  1S1Y A;  3PR6 A;  2XD1 A;  4EER A;  2PR5 A;  2BLS A;  3WS5 A;  3S4X A;  3M6B A;  1TS0 A;  4S2P A;  2XA7 S;  1OTI A;  5HAI A;  4E6W A;  1Y54 A;  4IUH A;  5CED A;  2WKH A;  3HLF A;  4PM5 A;  3E4P A;  4KZ5 A;  4G3W A;  1TVF A;  1MZU A;  1MWU A;  4D2O A;  1D7E A;  5HAP A;  3Q7V B;  5HL6 A;  3VV4 A;  2EX6 A;  2PHY A;  4Q0H A;  4MEZ A;  4N1X A;  3HUO A;  4LCL A;  3ZGA B;  4HBT A;  3MS6 A;  1HLU P;  2WAE A;  4R23 A;  1YKD A;  2CC1 A;  4PHT A;  2Y91 A;  3MQ0 A;  4RA7 A;  2ZQ8 A;  5GL9 A;  4X55 A;  3PAE A;  5CEB A;  3H82 B;  1L0E A;  4MBF A;  4QJG A;  2VGL S;  2OWH A;  3TW8 A;  4LEN A;  3FPV A;  4OQH A;  3IT9 A;  4ZBE A;  2C6W B;  3FPW A;  2B18 A;  3KSI A;  2I9V A;  4HNB A;  5IS1 A;  3IH8 A;  1S1Z A;  2G2U A;  1MKM A;  5EPH A;  1DY6 A;  1NYM A;  2J3T C;  3LYX A;  4PM9 A;  4MN7 A;  3NJA A;  2JKR M;  1CI8 A;  5FAP A;  4Y0O A;  2B02 A;  4E3N A;  3ZCZ A;  2ZBB A;  2QWS A;  3R7W A;  3P01 A;  2WAD A;  3BFD A;  1FSY A;  4K0W A;  3LR5 A;  4DE1 A;  5CRF A;  1ACF A;  3O86 A;  4KQO A;  3G6O A;  4DF6 A;  4BD1 A;  5GLA A;  5JYP A;  4JF5 A;  2BTF P;  2Y2I A;  3EWK A;  4KQQ A;  3HJI A;  4EXO A;  2IWC A;  3MKE A;  3ZQ5 A;  3OPP A;  1LSW A;  3AGE A;  3EQV A;  1WE4 A;  4E04 A;  2P9V A;  5CTN A;  4Y7P A;  4ID4 A;  4OP5 A;  1G68 A;  4GDN A;  2ACG A;  2HJE A;  4OPR A;  2V0U A;  1K55 A;  5G4Y A;  4XUZ A;  1J9M A;  4OKP A;  3NEC A;  5E43 A;  1NXY A;  5A92 A;  1I2W A;  3GVB A;  4E3J A;  2K2N A;  3T4S A;  2OAQ 1;  2G7U A;  3KX0 X;  2DRW A;  3IBJ A;  4HP4 A;  3SH8 A;  2EXB A;  2WK0 A;  4R0Q A;  5I94 A;  3B33 A;  4KQR A;  4EV4 A;  1LL8 A;  4OLD A;  4ZJ2 A;  1L0D A;  3VP2 A;  1KE3 A;  5KZH A;  5HPF A;  1BLS A;  3S7N A;  2VV7 A;  3C5A A;  1H3Q A;  1E3U A;  4ZTK A;  3VSL A;  4B9O A;  3WWX A;  4B4X A;  4DRT A;  3R7W B;  3HRE A;  3NBL A;  3M2J A;  3ZG8 B;  4PAU A;  2W3F A;  3MZD A;  1K55 C;  2OOL A;  4DJ2 A;  1V9Z A;  3UB7 A;  1WYB A;  3EGX C;  1LSX A;  3UB6 A;  3ZG7 B;  3PAG A;  4GKU A;  3SZT A;  3EQU A;  1TF1 A;  1KE0 A;  1ERQ A;  5AVF A;  2B95 A;  4WM9 A;  4DE3 A;  1YMX A;  1YQS A;  3S1Y A;  4MN6 A;  2Y8H A;  5DVA A;  2ZQC A;  5HWW A;  4GZB A;  4WZ5 A;  5IHV A;  1V9Y A;  3W4Q A;  3ICY A;  1CK3 A;  1P9W A;  3HLW A;  1VQQ A;  2J8Y A;  3V39 A;  4IBR A;  1YMS A;  4JGQ A;  3JVU A;  2V1A A;  3CAX A;  4S2K A;  5FQK A;  4O0P A;  3QP5 A;  4EWF A;  1YM1 A;  3FYZ A;  3MZF A;  4H8R A;  4Q0I A;  4K0X A;  4R3B A;  1N4O A;  1JTG A;  3DTE A;  4FH4 A;  1OTB A;  3PTE A;  2ZMA A;  3CI6 A;  3NDG A;  4F3L B;  1ES2 A;  1KOU A;  2ZOH A;  4XXR A;  5G18 A;  4LGW A;  1BTL A;  2V20 A;  3NUL A;  5E2F A;  2XD5 A;  3GRJ A;  4L0L A;  4MNR A;  4B93 A;  5DTK A;  4Y13 A;  2IWD A;  3IBR A;  5F5Y A;  5FAO A;  3PBT A;  4L9F A;  1VET B;  3E4O A;  3DW0 A;  3NC8 A;  2YKF A;  2KLI A;  3H7W A;  3F1N B;  2XGN A;  3T1R A;  4EBP A;  2JKG A;  4R3J A;  5F68 A;  2W0N A;  3MKF A;  3KYQ A;  3RJU A;  3KSH A;  3QNB A;  2WZX A;  2XA7 M;  4HH2 A;  1ZG6 A;  3VFH A;  1GHM A;  5CXW A;  2IWB A;  1OJG A;  2ZC6 B;  3OZH A;  4BL2 A;  3C4P A;  3B42 A;  4HJ4 A;  5I5L A;  3SH9 A;  3RFB A;  3UB9 A;  2O9B A;  1KVL A;  3A3D A;  4JF4 A;  5GHZ A;  2IA2 A;  5TJJ A;  1FIL A;  3OCN A;  1QMF A;  1XXM A;  3NCK A;  4WBG A;  3GQZ A;  3OC2 A;  4HP9 A;  4KZ7 A;  4PM8 A;  5JYO A;  3O87 A;  5M18 A;  1XA1 A;  3NOT C;  2PBD P;  3H9W A;  2KDK A;  2V2F F;  3FC7 A;  3Q1F A;  3MXS A;  2WGW A;  1CI9 A;  1PW8 A;  2H5S A;  5HX9 A;  2VGL M;  4MBK A;  3HJK A;  2M7V A;  4HBU A;  5GHY A;  2ZQ9 A;  2XRO A;  3RXW A;  2J9O A;  3QP4 A;  1DRM A;  5FDS A;  3UB8 A;  1IEL A;  4X1L A;  5CER A;  2KX6 A;  3NI9 A;  2Y4A A;  1GSW A;  4FOF A;  1TS8 A;  2W3G A;  1PI4 A;  4GDB A;  3BFF A;  3FV7 A;  3LEZ A;  3ULF A;  2AVX A;  2PAV P;  2PYR A;  1SCW A;  1S67 L;  5HD3 A;  4PKY G;  3LY4 A;  3ISG A;  5F1F A;  2O9C A;  5TR7 A;  5DFY A;  1K57 A;  4JPM A;  1MKI A;  2LB9 A;  2EWW A;  3D4F A;  3E2L A;  4X6T A;  4IVI A;  2XLN A;  1DP8 A;  1YAX A;  5FSR A;  1ZTU A;  3UDF A;  3MQQ A;  4GD6 A;  4HY8 A;  4P87 A;  1YLW A;  3TOI A;  3T50 A;  1XJ4 A;  4E6X A;  4LV2 A;  2EX8 A;  4JXS A;  4X1M A;  3S7P A;  3D72 A;  5EM0 A;  1S0W A;  1FCM A;  1YSP A;  2WKE A;  3LIE A;  5FAT A;  3T4J A;  4DJ3 A;  1K0K A;  1PIO A;  4CJN A;  3ZVT A;  2WGW B;  2L4R A;  3UMD A;  1WA9 A;  3IF6 A;  3N8R A;  2XFT A;  3OBF A;  5J4E A;  5MC7 A;  2ZC7 A;  3MSH A;  4KEN B;  4JBF A;  4QY5 A;  1IYP A;  5EE8 A;  4OPZ A;  5DFX A;  1K57 C;  5TGF A;  2M7U A;  1H5X A;  3VP1 A;  3QP1 A;  1RGY A;  3UE1 A;  5U47 A;  5F83 A;  3G34 A;  4O01 A;  3OLO A;  1TDL A;  4ETZ A;  4LRX C;  2ZM8 A;  1VEU A;  3VSK A;  4JGO A;  4EUV A;  4S2O A;  3T1Q B;  3LUQ A;  4UAA A;  1K6S A;  1WYC A;  2ZM2 A;  4OPQ A;  4FUW A;  1MBL A;  3IF6 C;  1HD8 A;  3E98 A;  3VP0 A;  3ZNY A;  2HP9 A;  3GMW A;  3UDI A;  2HZ5 A;  2J3T D;  1NLZ A;  4DDS A;  2Z2M B;  1YPR A;  4PPR A;  5GLB A;  3HLC A;  5E2G A;  2A49 A;  4XT2 A;  2XQZ A;  3G30 A;  1JNU A;  3PYP A;  4WMC A;  3AGF A;  1M40 A;  1SKO A;  2Q9N A;  3NY4 A;  3CIT A;  4HI4 A;  5A91 A;  4OLG A;  3WRZ A;  1VM1 A;  3BQA A;  4NG2 A;  2Z6C A;  2HPB A; 
#chains in the Genus database with same CATH homology
 1VB6 A;  2ZMF A;  2A24 A;  2J80 A;  4ME4 A;  5DJT A;  4O8G A;  4M4X A;  2HJE A;  2W1R A;  3VE4 A;  4EET B;  2P08 A;  2V0U A;  2FH5 A;  1OT6 A;  5G4Y A;  1S4S A;  4CLC D;  2V0W A;  4H6J B;  4GHI A;  3F1P A;  1GSV A;  1T1A A;  2XRN A;  4LPZ A;  4I3J A;  2K2N A;  2MJ6 A;  3T4S A;  3CWF A;  2OAQ 1;  4G3K A;  2G7U A;  2K7S A;  1P9R A;  2BAS A;  3T4T A;  3BY8 A;  3KX0 X;  4EU0 A;  3PBO A;  2YKH A;  3IBJ A;  4HP4 A;  4EW7 A;  4ARZ B;  2HGV A;  3GEC A;  4NXB A;  2EWV A;  4CQH A;  2V9A A;  3B33 A;  4EQ1 A;  4JGR A;  3UE3 A;  1LL8 A;  2K31 A;  1UWP X;  4K08 A;  5TBM B;  3FG8 A;  2W27 A;  3CUE C;  4IHQ A;  5HPF A;  1NRJ A;  1P97 A;  3S7N A;  2VV7 A;  1H3Q A;  3MJQ A;  4B9O A;  4UQI M;  3T4L A;  3LR0 A;  4R38 A;  3R7W B;  4GLQ A;  4ZRR A;  4I5S A;  4EEP A;  3IS2 B;  3MMH A;  1VHM A;  2ZOI A;  2FZ0 A;  4PAU A;  2W3F A;  3BWL A;  3NHQ A;  3VOL A;  1P0Z A;  2OOL A;  2O99 A;  5HDC A;  5AVE A;  4XT2 B;  4DJ2 A;  4Y5F A;  4R3A A;  3O5Y A;  4YWZ A;  1V9Z A;  3UB7 A;  3EGX C;  4HIA A;  1LSX A;  4IJG A;  3MR0 A;  1W63 M;  3UB6 A;  4WL9 A;  4L9G A;  2WKP A;  3EQU A;  2HV1 A;  3K3D A;  3PBN A;  3SW1 A;  1TF1 A;  5IU1 A;  2NUP C;  5AVF A;  2W3H A;  4II7 A;  3EEA A;  1XJ2 A;  3C38 A;  3RH8 B;  4MN6 A;  5KSH A;  3JVV A;  2A24 B;  2Y8H A;  4GS9 A;  3TJZ C;  5F69 A;  1IFQ A;  5HWW A;  4WLA A;  3BY9 A;  4CLC E;  1V9Y A;  3ICY A;  3CLO A;  3PBR A;  1NWZ A;  2WKR A;  4P6Z M;  2QJ7 A;  1P9W A;  1S66 L;  4LLO B;  5HSQ A;  2PD7 A;  4FSF A;  4JGQ A;  1OJ5 A;  1Y28 A;  2V1A A;  3JVU A;  3A0R A;  4HH3 A;  3CAX A;  5DF9 A;  1H8M A;  4AFI A;  1XJ6 A;  4LRY C;  2HJ9 C;  4O0P A;  4CLC C;  3LI9 A;  3K2N A;  1UGU A;  1EW0 A;  4Q0I A;  3ZYT A;  1NLY A;  2D02 A;  2KOI A;  3H82 A;  1F98 A;  4KQD A;  4Y2F A;  3CUE A;  3T4K A;  4WN5 A;  3KYZ A;  4NEE D;  1N9O A;  3LID A;  1OTB A;  3CI6 A;  3C2W A;  4F3L B;  1KOU A;  2ZOH A;  2W3D A;  5HD5 A;  4G3V A;  2VV8 A;  3MF0 A;  1IOU A;  3B47 A;  2QKP A;  3NOU C;  5F6A A;  2CMN A;  4L0L A;  3C30 A;  1N9N A;  2R78 A;  4B93 A;  3E4Q A;  2WKQ A;  4R70 A;  3LFV A;  5DJU A;  4BBV A;  3IBR A;  5F5Y A;  5HPI A;  1T19 A;  3PBT A;  3LIB A;  4L9F A;  3E4O A;  2YKF A;  5G4Z A;  4JGP A;  2KLI A;  3H7W A;  3F1N B;  2PYP A;  4GJ4 A;  4CLC B;  3KSG A;  4BMW A;  4UQI S;  2W1T B;  5F68 A;  3MFX A;  2W0N A;  3KYQ A;  3U2A A;  1BYW A;  2LB5 A;  4HQA A;  1ZHH B;  1G28 A;  3KSH A;  1OTA A;  1LT0 A;  1UWN X;  2W3E A;  2XA7 M;  4HH2 A;  2PD8 A;  3LIC A;  4Z1W A;  1OJG A;  2P7J A;  2M1C A;  3F1O B;  2OAP 1;  2O9A A;  1TS7 A;  3B42 A;  4HJ4 A;  2VA0 A;  5I5L A;  2JN7 A;  2GZA A;  4BWI A;  3RFB A;  1OT9 A;  3UB9 A;  2O9B A;  2Y79 A;  1ODV A;  3EOI A;  3MXQ A;  1W63 Q;  2J3W A;  4NXE A;  4Y3I A;  2IA2 A;  5TJJ A;  3HCY A;  3OCN A;  1OTE A;  3C8C A;  5HWV A;  2VLG A;  4WF0 A;  2VZW A;  3OC2 A;  4HP9 A;  4H6J A;  2VJW A;  1YSQ A;  1STZ A;  1DP9 A;  4P6Z S;  3NOT C;  3OCL A;  1T1C A;  3UE6 A;  3H9W A;  5LBR A;  2KDK A;  5K5B A;  4LRZ E;  3FC7 A;  2GNX A;  5A8B A;  3A0S A;  3EGD C;  5KIZ A;  3GDI A;  4WUJ A;  1TD5 A;  2VGL M;  4PKY A;  5L8M A;  4MN5 A;  2GJ3 A;  3PBS A;  2JKR I;  4GHI B;  3HJK A;  2M7V A;  3F1P B;  3P7N A;  2DMW A;  5TBM A;  5C5K A;  3TRC A;  4EES A;  2PDR A;  2XRO A;  2O0Y A;  2P04 A;  5EFW A;  5CX7 A;  2JKT I;  1DRM A;  2VEA A;  3UB8 A;  2V1B A;  4BJP A;  1G6O A;  5J7E A;  2KX6 A;  4YNR A;  1GSW A;  4HOI A;  4I3I A;  3NOP C;  3IS2 A;  4QPR A;  4FOF A;  1TS8 A;  2JKT M;  2JHE A;  2W3G A;  4NXF A;  2H28 A;  1XFN A;  3ULF A;  5HDS A;  2PYR A;  1S67 L;  3OOV A;  5HD3 A;  4WEL A;  4PKY G;  3D3O A;  4MCW A;  2O9C A;  4MDZ A;  4BBT A;  4DMZ A;  1S4R A;  2VX8 A;  4HHD A;  5DFY A;  2D01 A;  2LB9 A;  2EWW A;  3T4O A;  4ETX A;  1GSX A;  3E0Y A;  3K3C A;  1DP8 A;  1YAX A;  1N9L A;  1XFQ A;  1XJ3 A;  3LR4 A;  4UEY A;  1ZTU A;  3MQQ A;  2VV6 A;  1X0O A;  5HZH A;  4HY8 A;  1F5M A;  5AJG A;  1S1Y A;  3PR6 A;  1OPX A;  3T50 A;  4OOL A;  1XJ4 A;  4EER A;  2PR5 A;  2PR6 A;  1OTD A;  1TS0 A;  2ZMV A;  2XA7 S;  5J3W A;  1OTI A;  3S7P A;  2L0W A;  2NUT C;  4IUH A;  3R4K A;  3D72 A;  2EA9 A;  3E4P A;  4G3W A;  1YSP A;  3T4J A;  3LIE A;  3S7O A;  4NXG A;  1MZU A;  4KUO A;  4DJ3 A;  4GS9 B;  5HWT A;  1D7E A;  2Z6D A;  4BBU A;  2L4R A;  4RQ9 A;  1WA9 A;  3UMD A;  5HL6 A;  3VV4 A;  2GX5 A;  2PHY A;  4I39 A;  4Q0H A;  1LSV A;  3VE3 A;  3OBF A;  5J4E A;  5MC7 A;  4OOM A;  4I38 A;  2QJ5 A;  4EEU A;  3KSF A;  5DFX A;  2XSS A;  2M7U A;  1YKD A;  2HF6 A;  2OWJ A;  4IUK A;  4F3L A;  4I3A A;  4PHT A;  2INW A;  3MQ0 A;  3T4Q A;  3H82 B;  4KUK A;  4O01 A;  3OLO A;  4ETZ A;  4LRX C;  3LI8 A;  3V67 A;  2PT7 A;  1F9I A;  4GCZ A;  2VGL S;  2OWH A;  3TW8 A;  3LIF A;  3BQ8 A;  4JGO A;  5DKK A;  2QHK A;  3FPV A;  3FPW A;  2B18 A;  3KSI A;  2I9V A;  4HNB A;  2VKS A;  4ARZ A;  4EUV A;  5IS1 A;  1S1Z A;  4WEJ A;  3W2Z A;  3F1N A;  4R6L A;  4HJ3 A;  3LUQ A;  3PBQ A;  1DP6 A;  1MKM A;  4CLC A;  3UME A;  1D06 A;  2A2L A;  4Q0J A;  4GW9 A;  2W1T A;  2J3T C;  3EEH A;  3LYX A;  5IT5 A;  4MN7 A;  3MQO A;  3E98 A;  3NJA A;  2JKR M;  3PHY A;  4MMN A;  1T1B A;  2B02 A;  3TE8 A;  3KO6 A;  2ZBB A;  2J3T D;  2QWS A;  1NLZ A;  3H7W B;  3R7W A;  4DN0 A;  3P01 A;  3F1O A;  3LR3 A;  4WEK A;  2QYB A;  4HJ6 A;  3LR5 A;  3RTY A;  4XT2 A;  3S7Q A;  4KQO A;  3G6O A;  4L9E A;  1JNU A;  3PYP A;  3BJN A;  3LIA A;  4YOF A;  3BW6 A;  3CIT A;  3EWK A;  5DKL A;  1TS6 A;  3HJI A;  4EXO A;  4HI4 A;  3ZQ5 A;  5HDD A;  1LSW A;  3EQV A;  4NKP A;  2L1M A;  3DBA A;  1T18 A;  4E04 A;  5FL3 A;  3BQA A;  3A0V A;  2Z6C A;  1MC0 A;  3PXP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...