3KO6A

Crystal structure of yeast free methionine-r-sulfoxide reductase ykg9 in complex with the substrate
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
176
structure length
176
Chain Sequence
STGFHHADHVNYSSNLNKEEILEQLLLSYEGLSDGQVNWVCNLSNASSLIWHAYKSLAVDINWAGFYVTQASEENTLILGPFQGKVACQMIQFGKGVCGTAASTKETQIVPDVNKYPGHIACDGETKSEIVVPIISNDGKTLGVIDIDCLDYEGFDHVDKEFLEKLAKLINKSCVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of yeast free methionine-R-sulfoxide reductase Ykg9 in complex with the substrate
rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
molecule keywords UPF0067 GAF domain-containing protein YKL069W
total genus 57
structure length 176
sequence length 176
chains with identical sequence B
ec nomenclature ec 1.8.4.14: L-methionine (R)-S-oxide reductase.
pdb deposition date 2009-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13185 GAF_2 GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3ko6A00
2B18A 4YOFA 5TJJA 3O5YA 2KLIA 4YNRA 4Z1WA 3NOUC 2W3DA 2W3FA 2O9AA 3VV4A 4EU0A 5AJGA 5LBRA 4Y3IA 2W3HA 3MF0A 4O0PA 4CQHA 4O01A 4Y2FA 2VJWA 4IJGA 5DFXA 2VEAA 4FOFA 2QYBA 1TD5A 3ZQ5A 3D3OA 4MDZA 1YSPA 3OOVA 2LB9A 2XSSA 1ZTUA 4ME4A 1MC0A 5L8MA 4Y5FA 5HSQA 3RFBA 3IBJA 1VHMA 2G7UA 2XROA 4GLQA 2VKSA 3S7OA 4IUHA 3MQ0A 4LRZE 4IUKA 3S7PA 1YKDA 4EUVA 4R6LA 2K2NA 5K5BA 5HL6A 2W3GA 3R4KA 3KO6A 2ZMFA 3KSHA 4G3VA 3CI6A 2O9BA 4MCWA 3KSIA 2O0YA 5HPIA 3S7QA 2W1RA 1STZA 1MKMA 2W3EA 4G3WA 4PAUA 2O9CA 3KSFA 3NOPC 4MN7A 4BWIA 3BJNA 4Q0IA 3CITA 2W1TA 3IBRA 2KOIA 3E98A 1YSQA 5I5LA 1TF1A 3C2WA 3EEAA 3NHQA 4RQ9A 3NOTC 4GW9A 3G6OA 2Y79A 4O8GA 2HGVA 3S7NA 2LB5A 3TRCA 5C5KA 4Q0JA 4DMZA 2XRNA 4E04A 3W2ZA 4ZRRA 2VZWA 3LFVA 3E0YA 2W1TB 3HCYA 2M7UA 3MMHA 5DFYA 2K31A 2Y8HA 4ETZA 4MMNA 1F5MA 4G3KA 2GX5A 3DBAA 4LRXC 3KSGA 2OOLA 3K2NA 3OBFA 4LRYC 4R70A 4QPRA 5HPFA 4ETXA 4DN0A 2IA2A 2O99A 2M7VA 4Q0HA
chains in the Genus database with same CATH superfamily
4MNRA 5EECA 3IH8A 5L07A 1T19A 2V8FA 4YNRA 1N9LA 1ES5A 3NULA 4X69A 1K38A 3G35A 1K57C 4I39A 3GVBA 3U2AA 2HP5A 3KX0X 3O86A 3A3JA 1WE4A 2GJ3A 3UDXA 3EQUA 4UEYA 1FOFA 4GCZA 3ZFZA 4FTXA 5EM0A 2X01A 3C4PA 1K55C 4OH0A 1PWCA 2VX8A 5CGXA 5E2HA 2L1MA 5EVIA 4S2NC 4FSFA 3MZDA 5KZHA 3FYZA 2O9BA 2AVXA 1MBLA 1MKMA 2W3EA 3H7WB 3HLFA 4WYYA 5HD5A 3BJNA 4M4XA 4JXGA 3WS0A 4BD1A 4GHIB 1E3UA 1NZOA 3EQVA 3O88A 4OPZA 3E2LA 5FQQA 4H6JB 3G2YA 3PYPA 5EFWA 2Y79A 3M6HA 1KE0A 4JBFA 4S2OA 2EA9A 4QU3A 3HCYA 3LR0A 2B5RA 2KX6A 3MMHA 4JF6A 1V9ZA 4MMNA 3DTIA 1MPLA 2XLNA 3PR6A 3HLEA 5TJJA 2VV7A 3IXHA 3LR5A 2WAEA 3PBTA 3UMEA 3SS3A 3EGDC 2HP9A 3H7WA 4CLCD 1XJ2A 3ITBA 1KGEA 4EQ1A 4HESA 2VV8A 2R78A 5DFXA 3GQZA 4DE2A 5F1FA 3ZQ5A 5DF7A 3IWOA 1CQAA 3RFBA 1NJ4A 3T4KA 3IX8A 1JNUA 3T4SA 3KO6A 3KSHA 1G28A 4X55A 1STZA 1PWDA 4IEDA 5F1GA 4S2LA 4WZ5A 3LI8A 2X71A 3NOPC 3C5AA 5FL3A 5J4EA 1YQSA 3ZNTA 4WMCD 5I94A 2W27A 2ZQ9A 4OP5A 1N9BA 3PTEA 1TF1A 2QMIA 4P87A 5E2GA 3BECA 4QHCA 1D06A 3NECA 4ZRRA 4GOGA 2W1TB 3KYQA 2CC1A 4HEFA 2Y91A 4WMCA 4N1XA 1J3WA 3OZHA 1DJAA 2IWBA 2OOLA 4PPRA 2J3TD 2VK3A 3TG9A 1WA9A 2FFYA 4EBPA 4EERA 2HZ5A 3HLWA 5EVIB 4DDYA 3FKWA 1LL5A 1SKOB 4JGOA 5EVIC 2CMNA 4O0PA 3T4QA 4LGWA 4Y17A 2WADA 2ZM0A 4F3LB 1RGYA 2Q9NA 3QP5A 1EWZA 5CX7A 4X56A 5E2FA 3IX4A 2HDSA 2JKGA 5HAIA 1T1BA 2OV5A 1VM1A 2EX6A 3UB8A 4EUVA 1S0WA 1DY6A 2WUQA 3BM6A 5HPIA 1NYMA 1XKZA 1FCMA 3T1SA 2RL3A 4HHDA 4PAUA 3CAXA 1PWGA 5AVEA 1TS7A 2QHKA 3UB7A 1FCNA 3LEZA 4DJ3A 3JPUA 2WGIA 3UE0A 2FH5A 3LIEA 3SOIA 1YSQA 1S1ZA 3LGOA 4KUKA 4GDBA 3IS2A 3MZFA 2EX8A 1CI8A 1P97A 3OCLA 2WGWA 4NKPA 5HARA 4X53A 2VZWA 5DFYA 5GLBA 1MWSA 3EEHA 4R38A 1W63M 5AQ9A 2WYXA 2HP6A 3OBFA 5DF8A 2P74A 2IA2A 2QJ5A 2VGJA 1KVMA 3H9WA 5HAQA 3VFHA 3ZHHA 3A0VA 4MN5A 4ARZB 2XK1A 1OTIA 1NLZA 3UDFA 4EU0A 3OCNA 4OKPA 1N9NA 1K0KA 2VA0A 3MF0A 4CLCB 3F1PB 5KSHA 3BLMA 4UA6A 2J3WA 3IWIA 1JTGA 4IVKA 4LV1A 4FOFA 2QYBA 4P6ZS 4NEED 3CJMA 1YMXA 1VETB 1XGIA 3CG5A 4Q8IA 2Y2HA 4K0XA 2XFTA 4HNBA 4R1GA 3SH7A 3IBJA 4PHTA 1W5DA 4PKYA 3VP1A 5FA7A 1FQGA 3S7OA 4H6JA 3JYIA 5FI2A 3S7PA 4OLDA 3SW1A 5M18A 4GKUA 3WS5A 1JWPA 3BW6A 4ZBEA 4IBRA 4PM7A 3HVFA 3IWQA 2PAVP 4HI4A 5TR7A 1GCEA 4KZ5A 1M6KA 3UO9A 3JVVA 4R4RA 3NJAA 5FAQA 4HP4A 4CJNA 3OPLA 2H5SA 3T4LA 5FASA 3Q1FA 4MN6A 4RQ9A 4X68A 4XUZA 2D01A 3D4FA 4OQHA 5L10A 3S7NA 4Q0JA 3MR0A 2G2WA 4BBVA 3VMAA 4ZJ3A 4EV4A 3F1OB 5CHMA 3QP8A 3PHYA 2ZC7A 3H82B 4LRXC 4KENB 4QPRA 2PDRA 1OT6A 4JGRA 3S1YA 1LT0A 3VFFA 3DTEA 4GN2A 3SH9A 3VP4A 3FC7A 1H8ZA 5HWWA 2JCHA 5DJTA 4BBUA 3VSKA 3UE6A 3QP4A 3QP6A 1YSPA 4DE3A 4Y0UA 1N4OA 5FDSA 1CJFA 2EX2A 2KDKA 4HH2A 3TE8A 1UGUA 3FPWA 1AWIA 5MC7A 2Y2JA 1FR6A 3VOLA 4F94A 2WKRA 4B93A 5IU1A 2UV0E 5FQIA 1XP4A 3A3DA 3MBZA 4K0WA 4G3VA 3LI9A 1PZOA 4DE0A 2V1ZA 1Z09A 5DVAA 3HBRA 4E3NA 2XD5A 1GHMA 4Y15A 3P7NA 3L7HA 2K7SA 1W7FA 2Y2QA 4EQIA 4JGPA 5G18A 5DTSA 4HOIA 3PBOA 3KYZA 5CEDA 3D9YA 2HV1A 3MKEA 3U4LP 4FCFA 3LO7A 3QHYA 4F3LA 1BULA 4KQRA 4LRYC 2JC7A 4QJGA 3FWLA 4Y13A 2M7VA 3MSHA 4OONA 3UMDA 1L0DA 2V2FF 1K54A 2VGKA 2IWCA 3VV4A 4NXEA 4WM9A 1W63Q 1ALQA 3W4QA 5EOEA 2E8IA 3WRTA 3IH9A 2W0NA 3I7JA 1RGZA 1XPBA 4PM8A 3D3OA 4MDZA 4QB8A 1L3LA 3BWLA 2G2UA 3OOVA 4RVAA 1DRMA 2ZQ7A 3F1NB 2ZQCA 3B47A 3UE1A 4BL2A 1K56D 1E25A 2P9VA 1OJ5A 3ZG9B 1IYSA 2WKHA 1IFQA 3HUNA 5K5BA 4GD6A 4HY8A 3GTCA 4E6XA 3S7QA 2W1RA 3IXBA 2WKEA 2V1BA 3DWZA 5KSCA 5CXWA 5IT5A 4MN7A 2D02A 4LCLA 4LV2A 1ONHA 3ZYTA 3LYXA 4KZBA 2PR6A 3BFCA 1Z6FA 3MXQA 4EEPA 1FSYA 4FH4A 2WGWB 2J7VA 3IS2B 4O8GA 4WL9A 3C38A 2P04A 3W4PA 2PBDP 1NY0A 4R3BA 3UN7A 3LFVA 1BLHA 1YLYA 1OJGA 5HL1A 3OC2A 2C5WB 1UWNX 4B88A 1S66L 1W8YA 1F5MA 3LIDA 4UQIM 2EFUA 1S6RA 4GS9B 4OQGA 3S22A 2M1CA 2O99A 1JWVA 4R23A 3UY6A 4YOFA 3UPOA 1FCOA 2ZL1B 4RYEA 4OQ0A 2XH9A 3T1XA 2OAP1 4E3KA 4DXBA 4YINA 3ITAA 2XA7S 3FKVA 5FEGA 2Y55A 3WRZA 4UQIS 1PRQA 2VEAA 1OMEA 3DWKA 5AQAA 1KGFA 2XSSA 3M2JA 1W8QA 3G31A 1LL8A 4GZBA 2H0TA 2VKSA 1S67L 1HZOA 4GB7A 1I5QA 5GL9A 3RJUA 3CMZA 1NYYA 2EFXA 2ZM8A 5J8XA 3G34A 2XEPA 3NY4A 2QJ7A 3G32A 2ZD8A 4MCWA 3KSIA 2O0YA 4WZ4A 1TS6A 1K4EA 1HVBA 3HJIA 5GLCA 2ZBBA 3LEQA 3CPTA 3T50A 4EBLA 1WYBA 4KUOA 4YFMA 3QNCA 4PM5A 5CECA 2WK0A 4R3JA 5D3OA 5DJUA 5TBMA 1D7EA 4OOLA 4NXBA 2JKRI 2ZQAA 1IKGA 1LHYA 4EWFA 2XRNA 3F1OA 4HJ3A 2V8CA 3BLSA 4OOYA 2PD8A 3LY3A 1CEFA 5HX9A 4X25A 1G6AA 4EESA 1MY8A 3TJZC 4OVDA 3KSGA 4FH2A 3K2NA 2A49A 5CHUA 4Q0HA 2B02A 1ES4A 3BFDA 1KE3A 3T1RA 1BUEA 3ZG8B 2GZAA 2XF3A 4RX3A 2KLIA 4QY5A 5EVEA 1MXOA 3BYDA 1PIOA 3HUMA 5LBRA 2ZMVA 4BMWA 4NXGA 1IELA 4JGQA 1ESUA 3LUQA 1ONGA 1L2SA 3VOZA 4CPKA 3B33A 5FQMA 3PAEA 2XA7M 3EOIA 4L9GA 3HUOA 2QPNA 4K08A 3UPNA 4XXRA 1SZVA 4EW7A 4HP9A 3O3VA 1BLCA 4LLOB 4L0LA 5HL6A 4R4SA 2Y2IA 2NUPC 5HWVA 3V39A 4G3WA 2OLUA 1BYWA 3PBNA 2ZL1A 4BWIA 4P85A 3UDIA 3A0SA 2J8YA 4U3TA 1HD8A 4NG2A 5FATA 5M19A 4DE1A 4JXSA 1BTLA 3EEAA 3NOTC 1H3QA 5G4ZA 4JXWA 1GA9A 4UA9A 4A5RA 4HBTA 2JKTI 3E4PA 2LB5A 2BLSA 2V1AA 3MJQA 3LR4A 2XDMA 1H5XA 4R0QA 2K31A 1JVJA 2OAQ1 2HJEA 4GNUA 3Q82A 1LI9A 5HPFA 5TGFA 4S2JA 1PYYA 1XFQA 4BBTA 3F1PA 2J9OA 3IXGA 4HBUA 1KDSA 3NOUC 5L2FA 5F82A 2WKIA 1Q2PA 4Y3IA 3Q7VB 1ZG4A 4KQQA 3V3RA 3NDGA 3RTYA 5GLDA 3N7WA 3N4IA 5F6AA 3NI9A 1TD5A 2P7JA 5CTNA 1YPRA 2INWA 1CI9A 5A92A 1VHMA 2BTFP 3BRMA 3ZG5A 3BFEA 1NRJA 2HDUA 2QWSA 3RH8B 3OPPA 3FZCA 3IXDA 4KZ6A 3SS5A 4EETB 1ZC2A 4BL3A 4I3JA 1SKOA 2ZMFA 1ES2A 3LIAA 1BSGA 3MFDA 4KZAA 3P98A 3CLOA 2VGLS 2ZQDA 3FV7A 5FQ9A 3BEBA 4H8RA 3OPRA 3CZDA 1XXMA 5FAPA 3LIBA 1TS0A 3R7WA 5HZHA 4X1MA 3E4OA 4DKIA 3WWXA 3RXWA 5DKKA 4KQOA 5E2EA 3A3FA 1GHIA 3BFFA 1X0OA 4GW9A 4KG6A 2DMWA 1JTDA 2ZLYA 4LFUA 1YT4A 1YLJA 3TRCA 4DMZA 3B3XA 1IKIA 3W2ZA 1ERMA 1LI0A 5JYPA 5A91A 2V0WA 4HH3A 3ZG0A 4ETZA 2UWXA 3RXXA 1LSWA 3IF6B 3Q7ZA 1L0GA 4DN0A 3ZDJA 2B18A 1GSWA 3GR2A 3N8RA 2OLVA 3MQOA 3WS2A 4AFIA 1F9IA 5CERA 1TS8A 2H28A 5AJGA 5DKLA 3GSGA 4DXCA 1DP9A 2W3HA 5HDSA 3H82A 4O01A 3BQ8A 4C3QA 2YKHA 1YLWA 1IOUA 4OP8A 1DJBA 1HLUP 4E3LA 1Q2QA 4I5SA 1BLPA 4IBXA 1RP5A 1ZKJA 5F83A 1VEUB 3LCEA 5EVID 2PD7A 3MQ0A 4LRZE 3SS4A 4S2MA 3E4QA 1MKIA 4E3MA 3MQQA 2PT7A 3LICA 1QMEA 3PBRA 3V5MA 3ULFA 3CI6A 4OPYA 4O7DA 1PFLA 3VP2A 3KSFA 1U60A 4BJPA 1EROA 2IWDA 5CEBA 3UB9A 5J3WA 1ODVA 4UA7A 1W79A 2BG1A 4MBFA 2WAFA 5FAOA 1I2WA 3T4TA 1SKFA 2ZC6B 1AXBA 1K4FA 1K25A 5A93A 1FR1A 1PZPA 4WUJA 4BLMA 3NDEA 2Y2LA 3A3IA 2ZC3B 5FQKA 4FUWA 1XGJA 3FPVA 1OTBA 1P0ZA 2JBFA 4YWZA 1YLPA 2FZ0A 4UAAA 2QKPA 5HAPA 1L0EA 3EWKA 3CWFA 1YM1A 3C8CA 1G6OA 2ZM2A 2B95A 2MJ6A 3QP1A 4C75A 2ZQ8A 3ICYA 3JVUA 2VJWA 4FD8A 1Y54A 3DTKA 2EXBA 5EVLA 5HFOA 4B9OA 1SCWA 1ZTUA 3T4OA 1MC0A 5L8MA 5TFQA 5GLAA 4ZTKA 4GLQA 5CHJA 2L4RA 2A24A 1P9WA 4ZDXA 1CEGA 4CLCE 1YMSA 1LSXA 5DF9A 1VQQA 1HTZA 2Y2PA 5BOHA 4QD4A 3PXPA 3HLGA 1T1CA 3VP3A 3ZCZA 1O07A 1OPXA 2Y2GA 4GDNA 4HQAA 5I5LA 4ZJ1A 4LCMA 2VLGA 3N8SA 4XT2A 1PI4A 2JE5A 1S4SA 3SH8A 3A0RA 4R3AA 3TW8A 4JLFA 1E4DA 4NETA 1ZG6A 4G3KA 1KDWA 3O87A 3T4JA 2W3DA 2WKPA 5CGSA 2A24B 1H8YA 1OTEA 2J3TC 3UPPA 1D1JA 5HDCA 3PBQA 3TOIA 1WYCA 3QP2A 4GS9A 2HDRA 4WZ5C 4I3AA 3HLDA 4MLLA 3KYEA 4WEKA 3IX3A 4I3IA 1TDGA 2Y59A 4ME4A 4WELA 5HSQA 1XJ4A 3HLBA 4P0MA 5HW3A 4X1LA 1GHPA 3LIFA 4N92A 1SDEA 1K54C 5FSRA 1YKDA 4BENA 1ERQA 1L0FA 1QMFA 2Y2MA 3V67A 2WGVA 2PU2A 4KQDA 4EUZA 4E6WA 1XX2A 2JKRM 3BFGA 1G5UA 3E2KA 4DF6A 4KZ3A 3E98A 3WS1A 1Y4OA 1F98A 1F2KA 2V0UA 3FG8A 3GRJA 3DTMA 3GMWA 2X02A 2ZJ9A 1K6SA 1FSWA 4MBHA 1NLYA 1GSXA 2Y8HA 5KMWA 5AQBA 3DBAA 2NUTC 4CLCC 4WEJA 3ISGA 2OSUA 4B4XA 1LLBA 5GHZA 3GDIA 4KG5A 2YKFA 1E3UD 3MXSA 5EM1A 3VE3A 4ESPA 3HJKA 2W3FA 3CHWP 2O9AA 2EWVA 3LR3A 4CLCA 3G2ZA 1GSVA 3IF6C 2GNXA 3MS6A 1VB6A 4HJ6A 3QNBA 3IF5A 1OTDA 2Z6DA 1ES3A 2LB9A 3IF6A 3HREA 1NZUA 4Y5FA 2JKFA 3GECA 3N8LA 1J9MA 2WKQA 1TVFA 4HIAA 3DAVA 2W3GA 1A0KA 3R4KA 4QY6A 4WLAA 1KOUA 1I2SA 2EX9A 5JYOA 4JF5A 3IQAA 1G68A 5GHYA 1EW0A 4KZ7A 1MWRA 3CITA 3G4PA 5FEFA 4N9KA 4KG2A 3IBRA 2Z2MB 1IYPA 3T12B 3AGEA 2A3UA 3ZVTA 4E3IA 4ARZA 4P6ZM 3G30A 5AQ7A 1PW1A 1OTAA 2ZC4B 1DJCA 4PM6A 1TEMA 2Z6CA 3E0YA 4DDSA 4UHUA 5EPHA 4PM9A 2GX5A 5G4YA 4WN5A 2XR0A 3S4XA 4R70A 4IHQA 4X6TA 2G7UA 4LV0A 2PYRA 3O5YA 3BY8A 3VE4A 4Z1WA 4S2KA 4II7A 4GD8A 1BT5A 3Q7VA 5FDHA 3K3DA 5F5YA 3HL9A 1PW8A 4JXVA 4CQHA 4ZJ2A 2L0WA 4KZ4A 3OLOA 1MZUA 1LSVA 4U0TA 4XUXA 2R9WA 5A90A 5FI7A 3SZTA 3MKFA 1C3BA 2R9XA 3V3SA 2FFFB 2P9VB 1VETA 5F69A 1IEMA 1YAXA 1H0MA 1MWUA 3P01A 1KVLA 3MXRA 5TBMB 4K91A 3LY4A 3R7WB 2K2NA 3VP0A 1TDLA 1S1YA 2DCFA 3UE3A 4GHIA 4JF4A 4N9LA 4I38A 5FQJA 2EWWA 3CPTB 3MFXA 5M1AA 1T18A 4HJ4A 1XA1A 4PMAA 3C7UA 3BY9A 3V50A 3PAGA 2VGLM 1NWZA 2W1TA 3NC8A 3C7VA 4MBKA 1XFNA 2I9VA 3DW0A 2QZ6A 4D2OA 2J9PA 1XJ3A 2XFSA 4Y0TA 1GA0A 2ZC5B 3CUEC 3K3CA 2DNSA 5HWTA 4XT2B 5EOOA 5AVFA 4WBGA 4E04A 5C5KA 3W8KA 3UB6A 4DJ2A 2PBYA 4EXOA 2M7UA 1P9RA 1K56A 1FILA 2XQZA 4L9EA 5FI6A 3Q07A 4OQIA 3D72A 1UWPX 2OWJA 3T1QB 2OWHA 1N9OA 1SHVA 5EUAA 2ZOIA 2VV6A 3M6BA 1NXYA 4LENA 2ACGA 3IHAA 1NRFA 2Y2KA 4BQMA 1CK3A 1M40A 1LL9A 2J80A 1RCJA 1EI5A 5DTTA 4LPZA 4WF0A 3IT9A 3VOYA 4NXFA 4ID4A 3TSGA 5KIZA 3F1NA 1PI5A 2XD1A 4C6YA 1MWTA 1Y28A 2PHYA 5F68A 1VEUA 4U0XA 3ZNYA 1H8MA 2PU4A 4IUKA 4GJ4A 4L9FA 2GDNA 3C30A 4Y7PA 3M2KA 3N6IA 2DRWA 5CTMA 1ZHHB 3EGXC 2JHEA 4S2IA 4N1HA 4BD0A 2EXAA 3UB5P 2H0YA 2O9CA 5CRFA 3ZVWA 1IYQA 4D60A 3C4OA 4Q0IA 4RX2A 4OPQA 4OOMA 3NBLA 3GV9A 4JPMA 3IHBA 1T1AA 4P6BA 2H10A 2E8JA 2BASA 5HDDA 4M3KA 1K55A 2A2LA 3A3EA 2HPBA 3AGDA 4S2NA 4ZAMA 3ZGAB 1V9YA 1O7EA 2Y2NA 1K6RA 4KZ8A 2Z2LB 4Y0OA 4KZ9A 5L09A 1PNEA 3ZG7B 3WS4A 5EE8A 1DP8A 1BLSA 4ETXA 1YLZA 4S2PA 2JN7A 4PKYG 4IVIA 4Z9QA 3PBSA 1DP6A 4RA7A 4OPRA 4EBNA 2PRFA 1S4RA 2WZZA 4LV3A 3HLCA 4Y2FA 5U47A 4EEUA 4IJGA 4OLGA 5J7EA 4MEZA 2C6WB 5HD3A 3VSLA 2HDQA 2I72A 5E43A 1XA7A 1ACFA 2V20A 2RCXA 4E3JA 2XROA 2XGNA 2HJ9C 4IUHA 2PR5A 3CUEA 3NIAA 1YLTA 4R6LA 2PYPA 3UNWA 4QWOA 4B4ZA 2P08A 1BZAA 2ZMAA 3MZEA 2Y4AA 3BQAA 5IHVA 4NK3A 1JWZA 1KE4A 2HF6A 1CF0A 4E3OA 3NCKA 1XJ6A 2KOIA 4JKTA 5CGWA 3C2WA 3NHQA 5EV0A 5IS1A 3Q81A 1FIKA 2Q9MA 3P09A 1SDNA 1OT9A 3G6OA 2Y2OA 2WZXA 3L9KA 2V9AA 1ESIA 2HGVA 3W4OA 2JKTM 4DRTA 2ZOHA 5GHXA 1IYOA 3B42A 2Q0OA 3OPHA 5A8BA 3AGFA 1KGGA 5DTKA 1K57A
chains in the Genus database with same CATH topology
1XFQA 3GDIA 4BBTA 1OT6A 2YKFA 3F1PA 4JGRA 1LT0A 1T19A 3VE3A 3HJKA 4YNRA 3NOUC 2W3FA 2O9AA 2EWVA 1N9LA 3LR3A 4CLCA 1GSVA 4Y3IA 4I39A 3FC7A 3U2AA 5HWWA 5DJTA 3KX0X 3RTYA 5F6AA 2GNXA 4BBUA 3UE6A 1TD5A 1VB6A 4HJ6A 1OTDA 2Z6DA 1YSPA 2P7JA 2GJ3A 2LB9A 3EQUA 4UEYA 2KDKA 2INWA 4Y5FA 4GCZA 4HH2A 3TE8A 1UGUA 1VHMA 3GECA 3FPWA 1NRJA 2QWSA 5MC7A 2WKQA 3RH8B 4HIAA 3VOLA 2VX8A 2L1MA 2WKRA 4EETB 2W3GA 4I3JA 5IU1A 4B93A 4FSFA 3R4KA 3LIAA 2ZMFA 4G3VA 4WLAA 2O9BA 1KOUA 3LI9A 3CLOA 2VGLS 1MKMA 2W3EA 3H7WB 3LIBA 1EW0A 5HD5A 1TS0A 3BJNA 4M4XA 3R7WA 3CITA 5HZHA 3P7NA 3E4OA 4GHIB 2K7SA 3IBRA 4JGPA 5DKKA 4KQOA 4HOIA 3EQVA 4H6JB 4ARZA 3PBOA 4P6ZM 4GW9A 1X0OA 3KYZA 2DMWA 3PYPA 5EFWA 2Y79A 2HV1A 1OTAA 2EA9A 3TRCA 4DMZA 3W2ZA 2V0WA 4HH3A 3E0YA 2Z6CA 3LR0A 3HCYA 2KX6A 3MMHA 4ETZA 4F3LA 1V9ZA 4MMNA 1LSWA 2GX5A 5G4YA 4WN5A 4LRYC 3PR6A 4IHQA 4R70A 4DN0A 2G7UA 2M7VA 2B18A 1GSWA 2PYRA 5TJJA 3O5YA 2VV7A 3BY8A 3UMDA 3MQOA 3VE4A 4Z1WA 3LR5A 4II7A 4AFIA 1F9IA 3VV4A 3PBTA 1TS8A 3UMEA 2H28A 4NXEA 5AJGA 5DKLA 3EGDC 1W63Q 3K3DA 5F5YA 1DP9A 2W3HA 3H7WA 1XJ2A 4CLCD 5HDSA 3H82A 4CQHA 2L0WA 4O01A 4EQ1A 3BQ8A 2VV8A 3OLOA 2YKHA 1MZUA 1LSVA 2R78A 5DFXA 2W0NA 1IOUA 3ZQ5A 3D3OA 4MDZA 4I5SA 3BWLA 3OOVA 1DRMA 3F1NB 3B47A 3RFBA 5F69A 2PD7A 3MQ0A 3T4KA 1JNUA 1YAXA 4LRZE 3E4QA 3T4SA 3MQQA 3P01A 2PT7A 5TBMB 3LICA 1OJ5A 3R7WB 3PBRA 2K2NA 1IFQA 5K5BA 4HY8A 3ULFA 1S1YA 3UE3A 3KO6A 4GHIA 3KSHA 1G28A 3CI6A 4I38A 2EWWA 3S7QA 2W1RA 1STZA 2V1BA 3MFXA 1T18A 4HJ4A 3KSFA 3LI8A 5IT5A 3NOPC 4MN7A 2D02A 4BJPA 3BY9A 3ZYTA 3LYXA 5FL3A 2VGLM 5J4EA 1NWZA 2PR6A 3UB9A 5J3WA 2W1TA 1ODVA 1XFNA 2W27A 2I9VA 3MXQA 3T4TA 4EEPA 1TF1A 1XJ3A 3CUEC 3K3CA 5HWTA 3IS2B 4XT2B 4O8GA 5AVFA 4WL9A 4E04A 5C5KA 3C38A 3UB6A 1D06A 2P04A 4DJ2A 4EXOA 4ZRRA 4WUJA 3LFVA 2M7UA 2W1TB 1OJGA 3KYQA 3OC2A 1P9RA 1UWNX 1S66L 3FPVA 1F5MA 1OTBA 1P0ZA 3LIDA 4L9EA 2OOLA 4UQIM 4YWZA 2J3TD 2FZ0A 4GS9B 3D72A 2M1CA 2O99A 2OWJA 1UWPX 1WA9A 2OWHA 1N9OA 4YOFA 2QKPA 4EERA 3EWKA 2ZOIA 3CWFA 3C8CA 1G6OA 2VV6A 2MJ6A 2OAP1 4JGOA 2CMNA 2XA7S 3ICYA 4O0PA 3JVUA 3T4QA 2VJWA 4UQIS 2J80A 2VEAA 4F3LB 4LPZA 4WF0A 4B9OA 4NXFA 2XSSA 5CX7A 1ZTUA 3T4OA 1LL8A 1MC0A 5KIZA 3F1NA 5L8MA 1T1BA 1Y28A 2PHYA 5F68A 4GLQA 2VKSA 1S67L 3UB8A 1H8MA 2L4RA 4IUKA 4GJ4A 2A24A 4L9FA 4EUVA 1P9WA 3C30A 4CLCE 1LSXA 1ZHHB 3EGXC 2JHEA 2QJ7A 4MCWA 3KSIA 2O0YA 5DF9A 5HPIA 1TS6A 4HHDA 3HJIA 4PAUA 3CAXA 2O9CA 2ZBBA 5AVEA 1TS7A 2QHKA 3T50A 3UB7A 3PXPA 4Q0IA 4KUOA 1T1CA 4DJ3A 4OOMA 2FH5A 1OPXA 5DJUA 5TBMA 3LIEA 1D7EA 4HQAA 1YSQA 5I5LA 1S1ZA 4KUKA 4OOLA 1T1AA 2VLGA 3IS2A 4NXBA 4XT2A 2BASA 5HDDA 1P97A 3OCLA 2JKRI 2A2LA 4NKPA 1S4SA 2XRNA 1V9YA 3F1OA 4HJ3A 2VZWA 2PD8A 5DFYA 3A0RA 4R3AA 3TW8A 3EEHA 4R38A 4EESA 1W63M 3TJZC 4G3KA 3KSGA 1DP8A 3K2NA 3OBFA 4ETXA 2QJ5A 2JN7A 2IA2A 4Q0HA 2B02A 4PKYG 3H9WA 2GZAA 3A0VA 2KLIA 4MN5A 4ARZB 3T4JA 1OTIA 3PBSA 1NLZA 2W3DA 2WKPA 2A24B 1DP6A 1OTEA 4EU0A 3OCNA 2J3TC 5LBRA 2ZMVA 1N9NA 5HDCA 2VA0A 3MF0A 4BMWA 3PBQA 4CLCB 4NXGA 1S4RA 4JGQA 3F1PB 3LUQA 5KSHA 4Y2FA 2J3WA 4EEUA 4GS9A 4IJGA 5J7EA 4FOFA 5HD3A 2QYBA 4P6ZS 4NEED 4I3AA 3B33A 4WEKA 2XA7M 4I3IA 3EOIA 4ME4A 4WELA 4L9GA 4HNBA 5HSQA 1XJ4A 3IBJA 4PHTA 4PKYA 2XROA 2HJ9C 3S7OA 3LIFA 4K08A 4IUHA 4H6JA 2PR5A 4EW7A 3CUEA 4HP9A 3S7PA 1YKDA 4LLOB 3SW1A 4R6LA 4L0LA 2PYPA 5HL6A 3BW6A 3V67A 2P08A 4HI4A 2NUPC 5HWVA 4KQDA 4G3WA 3BQAA 1BYWA 3PBNA 4BWIA 2JKRM 2HF6A 3JVVA 3A0SA 3NJAA 4HP4A 1XJ6A 2KOIA 3T4LA 3E98A 4MN6A 1F98A 3C2WA 3EEAA 3NHQA 4RQ9A 3NOTC 1H3QA 5IS1A 5G4ZA 3FG8A 2V0UA 1OT9A 2D01A 3G6OA 2V9AA 2JKTI 3E4PA 2HGVA 2JKTM 2LB5A 3S7NA 2V1AA 4Q0JA 3MR0A 4BBVA 3MJQA 2ZOHA 3LR4A 3F1OB 3B42A 3PHYA 1NLYA 1GSXA 2K31A 2Y8HA 5A8BA 2OAQ1 3H82B 2HJEA 3DBAA 2NUTC 4LRXC 4CLCC 4WEJA 5HPFA 4QPRA 2PDRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B18 A;  4YOF A;  5TJJ A;  3O5Y A;  2KLI A;  4YNR A;  4Z1W A;  3NOU C;  2W3D A;  2W3F A;  2O9A A;  3VV4 A;  4EU0 A;  5AJG A;  5LBR A;  4Y3I A;  2W3H A;  3MF0 A;  4O0P A;  4CQH A;  4O01 A;  4Y2F A;  2VJW A;  4IJG A;  5DFX A;  2VEA A;  4FOF A;  2QYB A;  1TD5 A;  3ZQ5 A;  3D3O A;  4MDZ A;  1YSP A;  3OOV A;  2LB9 A;  2XSS A;  1ZTU A;  4ME4 A;  1MC0 A;  5L8M A;  4Y5F A;  5HSQ A;  3RFB A;  3IBJ A;  1VHM A;  2G7U A;  2XRO A;  4GLQ A;  2VKS A;  3S7O A;  4IUH A;  3MQ0 A;  4LRZ E;  4IUK A;  3S7P A;  1YKD A;  4EUV A;  4R6L A;  2K2N A;  5K5B A;  5HL6 A;  2W3G A;  3R4K A;  3KO6 A;  2ZMF A;  3KSH A;  4G3V A;  3CI6 A;  2O9B A;  4MCW A;  3KSI A;  2O0Y A;  5HPI A;  3S7Q A;  2W1R A;  1STZ A;  1MKM A;  2W3E A;  4G3W A;  4PAU A;  2O9C A;  3KSF A;  3NOP C;  4MN7 A;  4BWI A;  3BJN A;  4Q0I A;  3CIT A;  2W1T A;  3IBR A;  2KOI A;  3E98 A;  1YSQ A;  5I5L A;  1TF1 A;  3C2W A;  3EEA A;  3NHQ A;  4RQ9 A;  3NOT C;  4GW9 A;  3G6O A;  2Y79 A;  4O8G A;  2HGV A;  3S7N A;  2LB5 A;  3TRC A;  5C5K A;  4Q0J A;  4DMZ A;  2XRN A;  4E04 A;  3W2Z A;  4ZRR A;  2VZW A;  3LFV A;  3E0Y A;  2W1T B;  3HCY A;  2M7U A;  3MMH A;  5DFY A;  2K31 A;  2Y8H A;  4ETZ A;  4MMN A;  1F5M A;  4G3K A;  2GX5 A;  3DBA A;  4LRX C;  3KSG A;  2OOL A;  3K2N A;  3OBF A;  4LRY C;  4R70 A;  4QPR A;  5HPF A;  4ETX A;  4DN0 A;  2IA2 A;  2O99 A;  2M7V A;  4Q0H A; 
#chains in the Genus database with same CATH topology
 4MNR A;  5EEC A;  3IH8 A;  5L07 A;  1T19 A;  2V8F A;  4YNR A;  1N9L A;  1ES5 A;  3NUL A;  4X69 A;  1K38 A;  3G35 A;  1K57 C;  4I39 A;  3GVB A;  3U2A A;  2HP5 A;  3KX0 X;  3O86 A;  3A3J A;  1WE4 A;  2GJ3 A;  3UDX A;  3EQU A;  4UEY A;  1FOF A;  4GCZ A;  3ZFZ A;  4FTX A;  5EM0 A;  2X01 A;  3C4P A;  1K55 C;  4OH0 A;  1PWC A;  2VX8 A;  5CGX A;  5E2H A;  2L1M A;  5EVI A;  4S2N C;  4FSF A;  3MZD A;  5KZH A;  3FYZ A;  2O9B A;  2AVX A;  1MBL A;  1MKM A;  2W3E A;  3H7W B;  3HLF A;  4WYY A;  5HD5 A;  3BJN A;  4M4X A;  4JXG A;  3WS0 A;  4BD1 A;  4GHI B;  1E3U A;  1NZO A;  3EQV A;  3O88 A;  4OPZ A;  3E2L A;  5FQQ A;  4H6J B;  3G2Y A;  3PYP A;  5EFW A;  2Y79 A;  3M6H A;  1KE0 A;  4JBF A;  4S2O A;  2EA9 A;  4QU3 A;  3HCY A;  3LR0 A;  2B5R A;  2KX6 A;  3MMH A;  4JF6 A;  1V9Z A;  4MMN A;  3DTI A;  1MPL A;  2XLN A;  3PR6 A;  3HLE A;  5TJJ A;  2VV7 A;  3IXH A;  3LR5 A;  2WAE A;  3PBT A;  3UME A;  3SS3 A;  3EGD C;  2HP9 A;  3H7W A;  4CLC D;  1XJ2 A;  3ITB A;  1KGE A;  4EQ1 A;  4HES A;  2VV8 A;  2R78 A;  5DFX A;  3GQZ A;  4DE2 A;  5F1F A;  3ZQ5 A;  5DF7 A;  3IWO A;  1CQA A;  3RFB A;  1NJ4 A;  3T4K A;  3IX8 A;  1JNU A;  3T4S A;  3KO6 A;  3KSH A;  1G28 A;  4X55 A;  1STZ A;  1PWD A;  4IED A;  5F1G A;  4S2L A;  4WZ5 A;  3LI8 A;  2X71 A;  3NOP C;  3C5A A;  5FL3 A;  5J4E A;  1YQS A;  3ZNT A;  4WMC D;  5I94 A;  2W27 A;  2ZQ9 A;  4OP5 A;  1N9B A;  3PTE A;  1TF1 A;  2QMI A;  4P87 A;  5E2G A;  3BEC A;  4QHC A;  1D06 A;  3NEC A;  4ZRR A;  4GOG A;  2W1T B;  3KYQ A;  2CC1 A;  4HEF A;  2Y91 A;  4WMC A;  4N1X A;  1J3W A;  3OZH A;  1DJA A;  2IWB A;  2OOL A;  4PPR A;  2J3T D;  2VK3 A;  3TG9 A;  1WA9 A;  2FFY A;  4EBP A;  4EER A;  2HZ5 A;  3HLW A;  5EVI B;  4DDY A;  3FKW A;  1LL5 A;  1SKO B;  4JGO A;  5EVI C;  2CMN A;  4O0P A;  3T4Q A;  4LGW A;  4Y17 A;  2WAD A;  2ZM0 A;  4F3L B;  1RGY A;  2Q9N A;  3QP5 A;  1EWZ A;  5CX7 A;  4X56 A;  5E2F A;  3IX4 A;  2HDS A;  2JKG A;  5HAI A;  1T1B A;  2OV5 A;  1VM1 A;  2EX6 A;  3UB8 A;  4EUV A;  1S0W A;  1DY6 A;  2WUQ A;  3BM6 A;  5HPI A;  1NYM A;  1XKZ A;  1FCM A;  3T1S A;  2RL3 A;  4HHD A;  4PAU A;  3CAX A;  1PWG A;  5AVE A;  1TS7 A;  2QHK A;  3UB7 A;  1FCN A;  3LEZ A;  4DJ3 A;  3JPU A;  2WGI A;  3UE0 A;  2FH5 A;  3LIE A;  3SOI A;  1YSQ A;  1S1Z A;  3LGO A;  4KUK A;  4GDB A;  3IS2 A;  3MZF A;  2EX8 A;  1CI8 A;  1P97 A;  3OCL A;  2WGW A;  4NKP A;  5HAR A;  4X53 A;  2VZW A;  5DFY A;  5GLB A;  1MWS A;  3EEH A;  4R38 A;  1W63 M;  5AQ9 A;  2WYX A;  2HP6 A;  3OBF A;  5DF8 A;  2P74 A;  2IA2 A;  2QJ5 A;  2VGJ A;  1KVM A;  3H9W A;  5HAQ A;  3VFH A;  3ZHH A;  3A0V A;  4MN5 A;  4ARZ B;  2XK1 A;  1OTI A;  1NLZ A;  3UDF A;  4EU0 A;  3OCN A;  4OKP A;  1N9N A;  1K0K A;  2VA0 A;  3MF0 A;  4CLC B;  3F1P B;  5KSH A;  3BLM A;  4UA6 A;  2J3W A;  3IWI A;  1JTG A;  4IVK A;  4LV1 A;  4FOF A;  2QYB A;  4P6Z S;  4NEE D;  3CJM A;  1YMX A;  1VET B;  1XGI A;  3CG5 A;  4Q8I A;  2Y2H A;  4K0X A;  2XFT A;  4HNB A;  4R1G A;  3SH7 A;  3IBJ A;  4PHT A;  1W5D A;  4PKY A;  3VP1 A;  5FA7 A;  1FQG A;  3S7O A;  4H6J A;  3JYI A;  5FI2 A;  3S7P A;  4OLD A;  3SW1 A;  5M18 A;  4GKU A;  3WS5 A;  1JWP A;  3BW6 A;  4ZBE A;  4IBR A;  4PM7 A;  3HVF A;  3IWQ A;  2PAV P;  4HI4 A;  5TR7 A;  1GCE A;  4KZ5 A;  1M6K A;  3UO9 A;  3JVV A;  4R4R A;  3NJA A;  5FAQ A;  4HP4 A;  4CJN A;  3OPL A;  2H5S A;  3T4L A;  5FAS A;  3Q1F A;  4MN6 A;  4RQ9 A;  4X68 A;  4XUZ A;  2D01 A;  3D4F A;  4OQH A;  5L10 A;  3S7N A;  4Q0J A;  3MR0 A;  2G2W A;  4BBV A;  3VMA A;  4ZJ3 A;  4EV4 A;  3F1O B;  5CHM A;  3QP8 A;  3PHY A;  2ZC7 A;  3H82 B;  4LRX C;  4KEN B;  4QPR A;  2PDR A;  1OT6 A;  4JGR A;  3S1Y A;  1LT0 A;  3VFF A;  3DTE A;  4GN2 A;  3SH9 A;  3VP4 A;  3FC7 A;  1H8Z A;  5HWW A;  2JCH A;  5DJT A;  4BBU A;  3VSK A;  3UE6 A;  3QP4 A;  3QP6 A;  1YSP A;  4DE3 A;  4Y0U A;  1N4O A;  5FDS A;  1CJF A;  2EX2 A;  2KDK A;  4HH2 A;  3TE8 A;  1UGU A;  3FPW A;  1AWI A;  5MC7 A;  2Y2J A;  1FR6 A;  3VOL A;  4F94 A;  2WKR A;  4B93 A;  5IU1 A;  2UV0 E;  5FQI A;  1XP4 A;  3A3D A;  3MBZ A;  4K0W A;  4G3V A;  3LI9 A;  1PZO A;  4DE0 A;  2V1Z A;  1Z09 A;  5DVA A;  3HBR A;  4E3N A;  2XD5 A;  1GHM A;  4Y15 A;  3P7N A;  3L7H A;  2K7S A;  1W7F A;  2Y2Q A;  4EQI A;  4JGP A;  5G18 A;  5DTS A;  4HOI A;  3PBO A;  3KYZ A;  5CED A;  3D9Y A;  2HV1 A;  3MKE A;  3U4L P;  4FCF A;  3LO7 A;  3QHY A;  4F3L A;  1BUL A;  4KQR A;  4LRY C;  2JC7 A;  4QJG A;  3FWL A;  4Y13 A;  2M7V A;  3MSH A;  4OON A;  3UMD A;  1L0D A;  2V2F F;  1K54 A;  2VGK A;  2IWC A;  3VV4 A;  4NXE A;  4WM9 A;  1W63 Q;  1ALQ A;  3W4Q A;  5EOE A;  2E8I A;  3WRT A;  3IH9 A;  2W0N A;  3I7J A;  1RGZ A;  1XPB A;  4PM8 A;  3D3O A;  4MDZ A;  4QB8 A;  1L3L A;  3BWL A;  2G2U A;  3OOV A;  4RVA A;  1DRM A;  2ZQ7 A;  3F1N B;  2ZQC A;  3B47 A;  3UE1 A;  4BL2 A;  1K56 D;  1E25 A;  2P9V A;  1OJ5 A;  3ZG9 B;  1IYS A;  2WKH A;  1IFQ A;  3HUN A;  5K5B A;  4GD6 A;  4HY8 A;  3GTC A;  4E6X A;  3S7Q A;  2W1R A;  3IXB A;  2WKE A;  2V1B A;  3DWZ A;  5KSC A;  5CXW A;  5IT5 A;  4MN7 A;  2D02 A;  4LCL A;  4LV2 A;  1ONH A;  3ZYT A;  3LYX A;  4KZB A;  2PR6 A;  3BFC A;  1Z6F A;  3MXQ A;  4EEP A;  1FSY A;  4FH4 A;  2WGW B;  2J7V A;  3IS2 B;  4O8G A;  4WL9 A;  3C38 A;  2P04 A;  3W4P A;  2PBD P;  1NY0 A;  4R3B A;  3UN7 A;  3LFV A;  1BLH A;  1YLY A;  1OJG A;  5HL1 A;  3OC2 A;  2C5W B;  1UWN X;  4B88 A;  1S66 L;  1W8Y A;  1F5M A;  3LID A;  4UQI M;  2EFU A;  1S6R A;  4GS9 B;  4OQG A;  3S22 A;  2M1C A;  2O99 A;  1JWV A;  4R23 A;  3UY6 A;  4YOF A;  3UPO A;  1FCO A;  2ZL1 B;  4RYE A;  4OQ0 A;  2XH9 A;  3T1X A;  2OAP 1;  4E3K A;  4DXB A;  4YIN A;  3ITA A;  2XA7 S;  3FKV A;  5FEG A;  2Y55 A;  3WRZ A;  4UQI S;  1PRQ A;  2VEA A;  1OME A;  3DWK A;  5AQA A;  1KGF A;  2XSS A;  3M2J A;  1W8Q A;  3G31 A;  1LL8 A;  4GZB A;  2H0T A;  2VKS A;  1S67 L;  1HZO A;  4GB7 A;  1I5Q A;  5GL9 A;  3RJU A;  3CMZ A;  1NYY A;  2EFX A;  2ZM8 A;  5J8X A;  3G34 A;  2XEP A;  3NY4 A;  2QJ7 A;  3G32 A;  2ZD8 A;  4MCW A;  3KSI A;  2O0Y A;  4WZ4 A;  1TS6 A;  1K4E A;  1HVB A;  3HJI A;  5GLC A;  2ZBB A;  3LEQ A;  3CPT A;  3T50 A;  4EBL A;  1WYB A;  4KUO A;  4YFM A;  3QNC A;  4PM5 A;  5CEC A;  2WK0 A;  4R3J A;  5D3O A;  5DJU A;  5TBM A;  1D7E A;  4OOL A;  4NXB A;  2JKR I;  2ZQA A;  1IKG A;  1LHY A;  4EWF A;  2XRN A;  3F1O A;  4HJ3 A;  2V8C A;  3BLS A;  4OOY A;  2PD8 A;  3LY3 A;  1CEF A;  5HX9 A;  4X25 A;  1G6A A;  4EES A;  1MY8 A;  3TJZ C;  4OVD A;  3KSG A;  4FH2 A;  3K2N A;  2A49 A;  5CHU A;  4Q0H A;  2B02 A;  1ES4 A;  3BFD A;  1KE3 A;  3T1R A;  1BUE A;  3ZG8 B;  2GZA A;  2XF3 A;  4RX3 A;  2KLI A;  4QY5 A;  5EVE A;  1MXO A;  3BYD A;  1PIO A;  3HUM A;  5LBR A;  2ZMV A;  4BMW A;  4NXG A;  1IEL A;  4JGQ A;  1ESU A;  3LUQ A;  1ONG A;  1L2S A;  3VOZ A;  4CPK A;  3B33 A;  5FQM A;  3PAE A;  2XA7 M;  3EOI A;  4L9G A;  3HUO A;  2QPN A;  4K08 A;  3UPN A;  4XXR A;  1SZV A;  4EW7 A;  4HP9 A;  3O3V A;  1BLC A;  4LLO B;  4L0L A;  5HL6 A;  4R4S A;  2Y2I A;  2NUP C;  5HWV A;  3V39 A;  4G3W A;  2OLU A;  1BYW A;  3PBN A;  2ZL1 A;  4BWI A;  4P85 A;  3UDI A;  3A0S A;  2J8Y A;  4U3T A;  1HD8 A;  4NG2 A;  5FAT A;  5M19 A;  4DE1 A;  4JXS A;  1BTL A;  3EEA A;  3NOT C;  1H3Q A;  5G4Z A;  4JXW A;  1GA9 A;  4UA9 A;  4A5R A;  4HBT A;  2JKT I;  3E4P A;  2LB5 A;  2BLS A;  2V1A A;  3MJQ A;  3LR4 A;  2XDM A;  1H5X A;  4R0Q A;  2K31 A;  1JVJ A;  2OAQ 1;  2HJE A;  4GNU A;  3Q82 A;  1LI9 A;  5HPF A;  5TGF A;  4S2J A;  1PYY A;  1XFQ A;  4BBT A;  3F1P A;  2J9O A;  3IXG A;  4HBU A;  1KDS A;  3NOU C;  5L2F A;  5F82 A;  2WKI A;  1Q2P A;  4Y3I A;  3Q7V B;  1ZG4 A;  4KQQ A;  3V3R A;  3NDG A;  3RTY A;  5GLD A;  3N7W A;  3N4I A;  5F6A A;  3NI9 A;  1TD5 A;  2P7J A;  5CTN A;  1YPR A;  2INW A;  1CI9 A;  5A92 A;  1VHM A;  2BTF P;  3BRM A;  3ZG5 A;  3BFE A;  1NRJ A;  2HDU A;  2QWS A;  3RH8 B;  3OPP A;  3FZC A;  3IXD A;  4KZ6 A;  3SS5 A;  4EET B;  1ZC2 A;  4BL3 A;  4I3J A;  1SKO A;  2ZMF A;  1ES2 A;  3LIA A;  1BSG A;  3MFD A;  4KZA A;  3P98 A;  3CLO A;  2VGL S;  2ZQD A;  3FV7 A;  5FQ9 A;  3BEB A;  4H8R A;  3OPR A;  3CZD A;  1XXM A;  5FAP A;  3LIB A;  1TS0 A;  3R7W A;  5HZH A;  4X1M A;  3E4O A;  4DKI A;  3WWX A;  3RXW A;  5DKK A;  4KQO A;  5E2E A;  3A3F A;  1GHI A;  3BFF A;  1X0O A;  4GW9 A;  4KG6 A;  2DMW A;  1JTD A;  2ZLY A;  4LFU A;  1YT4 A;  1YLJ A;  3TRC A;  4DMZ A;  3B3X A;  1IKI A;  3W2Z A;  1ERM A;  1LI0 A;  5JYP A;  5A91 A;  2V0W A;  4HH3 A;  3ZG0 A;  4ETZ A;  2UWX A;  3RXX A;  1LSW A;  3IF6 B;  3Q7Z A;  1L0G A;  4DN0 A;  3ZDJ A;  2B18 A;  1GSW A;  3GR2 A;  3N8R A;  2OLV A;  3MQO A;  3WS2 A;  4AFI A;  1F9I A;  5CER A;  1TS8 A;  2H28 A;  5AJG A;  5DKL A;  3GSG A;  4DXC A;  1DP9 A;  2W3H A;  5HDS A;  3H82 A;  4O01 A;  3BQ8 A;  4C3Q A;  2YKH A;  1YLW A;  1IOU A;  4OP8 A;  1DJB A;  1HLU P;  4E3L A;  1Q2Q A;  4I5S A;  1BLP A;  4IBX A;  1RP5 A;  1ZKJ A;  5F83 A;  1VEU B;  3LCE A;  5EVI D;  2PD7 A;  3MQ0 A;  4LRZ E;  3SS4 A;  4S2M A;  3E4Q A;  1MKI A;  4E3M A;  3MQQ A;  2PT7 A;  3LIC A;  1QME A;  3PBR A;  3V5M A;  3ULF A;  3CI6 A;  4OPY A;  4O7D A;  1PFL A;  3VP2 A;  3KSF A;  1U60 A;  4BJP A;  1ERO A;  2IWD A;  5CEB A;  3UB9 A;  5J3W A;  1ODV A;  4UA7 A;  1W79 A;  2BG1 A;  4MBF A;  2WAF A;  5FAO A;  1I2W A;  3T4T A;  1SKF A;  2ZC6 B;  1AXB A;  1K4F A;  1K25 A;  5A93 A;  1FR1 A;  1PZP A;  4WUJ A;  4BLM A;  3NDE A;  2Y2L A;  3A3I A;  2ZC3 B;  5FQK A;  4FUW A;  1XGJ A;  3FPV A;  1OTB A;  1P0Z A;  2JBF A;  4YWZ A;  1YLP A;  2FZ0 A;  4UAA A;  2QKP A;  5HAP A;  1L0E A;  3EWK A;  3CWF A;  1YM1 A;  3C8C A;  1G6O A;  2ZM2 A;  2B95 A;  2MJ6 A;  3QP1 A;  4C75 A;  2ZQ8 A;  3ICY A;  3JVU A;  2VJW A;  4FD8 A;  1Y54 A;  3DTK A;  2EXB A;  5EVL A;  5HFO A;  4B9O A;  1SCW A;  1ZTU A;  3T4O A;  1MC0 A;  5L8M A;  5TFQ A;  5GLA A;  4ZTK A;  4GLQ A;  5CHJ A;  2L4R A;  2A24 A;  1P9W A;  4ZDX A;  1CEG A;  4CLC E;  1YMS A;  1LSX A;  5DF9 A;  1VQQ A;  1HTZ A;  2Y2P A;  5BOH A;  4QD4 A;  3PXP A;  3HLG A;  1T1C A;  3VP3 A;  3ZCZ A;  1O07 A;  1OPX A;  2Y2G A;  4GDN A;  4HQA A;  5I5L A;  4ZJ1 A;  4LCM A;  2VLG A;  3N8S A;  4XT2 A;  1PI4 A;  2JE5 A;  1S4S A;  3SH8 A;  3A0R A;  4R3A A;  3TW8 A;  4JLF A;  1E4D A;  4NET A;  1ZG6 A;  4G3K A;  1KDW A;  3O87 A;  3T4J A;  2W3D A;  2WKP A;  5CGS A;  2A24 B;  1H8Y A;  1OTE A;  2J3T C;  3UPP A;  1D1J A;  5HDC A;  3PBQ A;  3TOI A;  1WYC A;  3QP2 A;  4GS9 A;  2HDR A;  4WZ5 C;  4I3A A;  3HLD A;  4MLL A;  3KYE A;  4WEK A;  3IX3 A;  4I3I A;  1TDG A;  2Y59 A;  4ME4 A;  4WEL A;  5HSQ A;  1XJ4 A;  3HLB A;  4P0M A;  5HW3 A;  4X1L A;  1GHP A;  3LIF A;  4N92 A;  1SDE A;  1K54 C;  5FSR A;  1YKD A;  4BEN A;  1ERQ A;  1L0F A;  1QMF A;  2Y2M A;  3V67 A;  2WGV A;  2PU2 A;  4KQD A;  4EUZ A;  4E6W A;  1XX2 A;  2JKR M;  3BFG A;  1G5U A;  3E2K A;  4DF6 A;  4KZ3 A;  3E98 A;  3WS1 A;  1Y4O A;  1F98 A;  1F2K A;  2V0U A;  3FG8 A;  3GRJ A;  3DTM A;  3GMW A;  2X02 A;  2ZJ9 A;  1K6S A;  1FSW A;  4MBH A;  1NLY A;  1GSX A;  2Y8H A;  5KMW A;  5AQB A;  3DBA A;  2NUT C;  4CLC C;  4WEJ A;  3ISG A;  2OSU A;  4B4X A;  1LLB A;  5GHZ A;  3GDI A;  4KG5 A;  2YKF A;  1E3U D;  3MXS A;  5EM1 A;  3VE3 A;  4ESP A;  3HJK A;  2W3F A;  3CHW P;  2O9A A;  2EWV A;  3LR3 A;  4CLC A;  3G2Z A;  1GSV A;  3IF6 C;  2GNX A;  3MS6 A;  1VB6 A;  4HJ6 A;  3QNB A;  3IF5 A;  1OTD A;  2Z6D A;  1ES3 A;  2LB9 A;  3IF6 A;  3HRE A;  1NZU A;  4Y5F A;  2JKF A;  3GEC A;  3N8L A;  1J9M A;  2WKQ A;  1TVF A;  4HIA A;  3DAV A;  2W3G A;  1A0K A;  3R4K A;  4QY6 A;  4WLA A;  1KOU A;  1I2S A;  2EX9 A;  5JYO A;  4JF5 A;  3IQA A;  1G68 A;  5GHY A;  1EW0 A;  4KZ7 A;  1MWR A;  3CIT A;  3G4P A;  5FEF A;  4N9K A;  4KG2 A;  3IBR A;  2Z2M B;  1IYP A;  3T12 B;  3AGE A;  2A3U A;  3ZVT A;  4E3I A;  4ARZ A;  4P6Z M;  3G30 A;  5AQ7 A;  1PW1 A;  1OTA A;  2ZC4 B;  1DJC A;  4PM6 A;  1TEM A;  2Z6C A;  3E0Y A;  4DDS A;  4UHU A;  5EPH A;  4PM9 A;  2GX5 A;  5G4Y A;  4WN5 A;  2XR0 A;  3S4X A;  4R70 A;  4IHQ A;  4X6T A;  2G7U A;  4LV0 A;  2PYR A;  3O5Y A;  3BY8 A;  3VE4 A;  4Z1W A;  4S2K A;  4II7 A;  4GD8 A;  1BT5 A;  3Q7V A;  5FDH A;  3K3D A;  5F5Y A;  3HL9 A;  1PW8 A;  4JXV A;  4CQH A;  4ZJ2 A;  2L0W A;  4KZ4 A;  3OLO A;  1MZU A;  1LSV A;  4U0T A;  4XUX A;  2R9W A;  5A90 A;  5FI7 A;  3SZT A;  3MKF A;  1C3B A;  2R9X A;  3V3S A;  2FFF B;  2P9V B;  1VET A;  5F69 A;  1IEM A;  1YAX A;  1H0M A;  1MWU A;  3P01 A;  1KVL A;  3MXR A;  5TBM B;  4K91 A;  3LY4 A;  3R7W B;  2K2N A;  3VP0 A;  1TDL A;  1S1Y A;  2DCF A;  3UE3 A;  4GHI A;  4JF4 A;  4N9L A;  4I38 A;  5FQJ A;  2EWW A;  3CPT B;  3MFX A;  5M1A A;  1T18 A;  4HJ4 A;  1XA1 A;  4PMA A;  3C7U A;  3BY9 A;  3V50 A;  3PAG A;  2VGL M;  1NWZ A;  2W1T A;  3NC8 A;  3C7V A;  4MBK A;  1XFN A;  2I9V A;  3DW0 A;  2QZ6 A;  4D2O A;  2J9P A;  1XJ3 A;  2XFS A;  4Y0T A;  1GA0 A;  2ZC5 B;  3CUE C;  3K3C A;  2DNS A;  5HWT A;  4XT2 B;  5EOO A;  5AVF A;  4WBG A;  4E04 A;  5C5K A;  3W8K A;  3UB6 A;  4DJ2 A;  2PBY A;  4EXO A;  2M7U A;  1P9R A;  1K56 A;  1FIL A;  2XQZ A;  4L9E A;  5FI6 A;  3Q07 A;  4OQI A;  3D72 A;  1UWP X;  2OWJ A;  3T1Q B;  2OWH A;  1N9O A;  1SHV A;  5EUA A;  2ZOI A;  2VV6 A;  3M6B A;  1NXY A;  4LEN A;  2ACG A;  3IHA A;  1NRF A;  2Y2K A;  4BQM A;  1CK3 A;  1M40 A;  1LL9 A;  2J80 A;  1RCJ A;  1EI5 A;  5DTT A;  4LPZ A;  4WF0 A;  3IT9 A;  3VOY A;  4NXF A;  4ID4 A;  3TSG A;  5KIZ A;  3F1N A;  1PI5 A;  2XD1 A;  4C6Y A;  1MWT A;  1Y28 A;  2PHY A;  5F68 A;  1VEU A;  4U0X A;  3ZNY A;  1H8M A;  2PU4 A;  4IUK A;  4GJ4 A;  4L9F A;  2GDN A;  3C30 A;  4Y7P A;  3M2K A;  3N6I A;  2DRW A;  5CTM A;  1ZHH B;  3EGX C;  2JHE A;  4S2I A;  4N1H A;  4BD0 A;  2EXA A;  3UB5 P;  2H0Y A;  2O9C A;  5CRF A;  3ZVW A;  1IYQ A;  4D60 A;  3C4O A;  4Q0I A;  4RX2 A;  4OPQ A;  4OOM A;  3NBL A;  3GV9 A;  4JPM A;  3IHB A;  1T1A A;  4P6B A;  2H10 A;  2E8J A;  2BAS A;  5HDD A;  4M3K A;  1K55 A;  2A2L A;  3A3E A;  2HPB A;  3AGD A;  4S2N A;  4ZAM A;  3ZGA B;  1V9Y A;  1O7E A;  2Y2N A;  1K6R A;  4KZ8 A;  2Z2L B;  4Y0O A;  4KZ9 A;  5L09 A;  1PNE A;  3ZG7 B;  3WS4 A;  5EE8 A;  1DP8 A;  1BLS A;  4ETX A;  1YLZ A;  4S2P A;  2JN7 A;  4PKY G;  4IVI A;  4Z9Q A;  3PBS A;  1DP6 A;  4RA7 A;  4OPR A;  4EBN A;  2PRF A;  1S4R A;  2WZZ A;  4LV3 A;  3HLC A;  4Y2F A;  5U47 A;  4EEU A;  4IJG A;  4OLG A;  5J7E A;  4MEZ A;  2C6W B;  5HD3 A;  3VSL A;  2HDQ A;  2I72 A;  5E43 A;  1XA7 A;  1ACF A;  2V20 A;  2RCX A;  4E3J A;  2XRO A;  2XGN A;  2HJ9 C;  4IUH A;  2PR5 A;  3CUE A;  3NIA A;  1YLT A;  4R6L A;  2PYP A;  3UNW A;  4QWO A;  4B4Z A;  2P08 A;  1BZA A;  2ZMA A;  3MZE A;  2Y4A A;  3BQA A;  5IHV A;  4NK3 A;  1JWZ A;  1KE4 A;  2HF6 A;  1CF0 A;  4E3O A;  3NCK A;  1XJ6 A;  2KOI A;  4JKT A;  5CGW A;  3C2W A;  3NHQ A;  5EV0 A;  5IS1 A;  3Q81 A;  1FIK A;  2Q9M A;  3P09 A;  1SDN A;  1OT9 A;  3G6O A;  2Y2O A;  2WZX A;  3L9K A;  2V9A A;  1ESI A;  2HGV A;  3W4O A;  2JKT M;  4DRT A;  2ZOH A;  5GHX A;  1IYO A;  3B42 A;  2Q0O A;  3OPH A;  5A8B A;  3AGF A;  1KGG A;  5DTK A;  1K57 A; 
#chains in the Genus database with same CATH homology
 1XFQ A;  3GDI A;  4BBT A;  1OT6 A;  2YKF A;  3F1P A;  4JGR A;  1LT0 A;  1T19 A;  3VE3 A;  3HJK A;  4YNR A;  3NOU C;  2W3F A;  2O9A A;  2EWV A;  1N9L A;  3LR3 A;  4CLC A;  1GSV A;  4Y3I A;  4I39 A;  3FC7 A;  3U2A A;  5HWW A;  5DJT A;  3KX0 X;  3RTY A;  5F6A A;  2GNX A;  4BBU A;  3UE6 A;  1TD5 A;  1VB6 A;  4HJ6 A;  1OTD A;  2Z6D A;  1YSP A;  2P7J A;  2GJ3 A;  2LB9 A;  3EQU A;  4UEY A;  2KDK A;  2INW A;  4Y5F A;  4GCZ A;  4HH2 A;  3TE8 A;  1UGU A;  1VHM A;  3GEC A;  3FPW A;  1NRJ A;  2QWS A;  5MC7 A;  2WKQ A;  3RH8 B;  4HIA A;  3VOL A;  2VX8 A;  2L1M A;  2WKR A;  4EET B;  2W3G A;  4I3J A;  5IU1 A;  4B93 A;  4FSF A;  3R4K A;  3LIA A;  2ZMF A;  4G3V A;  4WLA A;  2O9B A;  1KOU A;  3LI9 A;  3CLO A;  2VGL S;  1MKM A;  2W3E A;  3H7W B;  3LIB A;  1EW0 A;  5HD5 A;  1TS0 A;  3BJN A;  4M4X A;  3R7W A;  3CIT A;  5HZH A;  3P7N A;  3E4O A;  4GHI B;  2K7S A;  3IBR A;  4JGP A;  5DKK A;  4KQO A;  4HOI A;  3EQV A;  4H6J B;  4ARZ A;  3PBO A;  4P6Z M;  4GW9 A;  1X0O A;  3KYZ A;  2DMW A;  3PYP A;  5EFW A;  2Y79 A;  2HV1 A;  1OTA A;  2EA9 A;  3TRC A;  4DMZ A;  3W2Z A;  2V0W A;  4HH3 A;  3E0Y A;  2Z6C A;  3LR0 A;  3HCY A;  2KX6 A;  3MMH A;  4ETZ A;  4F3L A;  1V9Z A;  4MMN A;  1LSW A;  2GX5 A;  5G4Y A;  4WN5 A;  4LRY C;  3PR6 A;  4IHQ A;  4R70 A;  4DN0 A;  2G7U A;  2M7V A;  2B18 A;  1GSW A;  2PYR A;  5TJJ A;  3O5Y A;  2VV7 A;  3BY8 A;  3UMD A;  3MQO A;  3VE4 A;  4Z1W A;  3LR5 A;  4II7 A;  4AFI A;  1F9I A;  3VV4 A;  3PBT A;  1TS8 A;  3UME A;  2H28 A;  4NXE A;  5AJG A;  5DKL A;  3EGD C;  1W63 Q;  3K3D A;  5F5Y A;  1DP9 A;  2W3H A;  3H7W A;  1XJ2 A;  4CLC D;  5HDS A;  3H82 A;  4CQH A;  2L0W A;  4O01 A;  4EQ1 A;  3BQ8 A;  2VV8 A;  3OLO A;  2YKH A;  1MZU A;  1LSV A;  2R78 A;  5DFX A;  2W0N A;  1IOU A;  3ZQ5 A;  3D3O A;  4MDZ A;  4I5S A;  3BWL A;  3OOV A;  1DRM A;  3F1N B;  3B47 A;  3RFB A;  5F69 A;  2PD7 A;  3MQ0 A;  3T4K A;  1JNU A;  1YAX A;  4LRZ E;  3E4Q A;  3T4S A;  3MQQ A;  3P01 A;  2PT7 A;  5TBM B;  3LIC A;  1OJ5 A;  3R7W B;  3PBR A;  2K2N A;  1IFQ A;  5K5B A;  4HY8 A;  3ULF A;  1S1Y A;  3UE3 A;  3KO6 A;  4GHI A;  3KSH A;  1G28 A;  3CI6 A;  4I38 A;  2EWW A;  3S7Q A;  2W1R A;  1STZ A;  2V1B A;  3MFX A;  1T18 A;  4HJ4 A;  3KSF A;  3LI8 A;  5IT5 A;  3NOP C;  4MN7 A;  2D02 A;  4BJP A;  3BY9 A;  3ZYT A;  3LYX A;  5FL3 A;  2VGL M;  5J4E A;  1NWZ A;  2PR6 A;  3UB9 A;  5J3W A;  2W1T A;  1ODV A;  1XFN A;  2W27 A;  2I9V A;  3MXQ A;  3T4T A;  4EEP A;  1TF1 A;  1XJ3 A;  3CUE C;  3K3C A;  5HWT A;  3IS2 B;  4XT2 B;  4O8G A;  5AVF A;  4WL9 A;  4E04 A;  5C5K A;  3C38 A;  3UB6 A;  1D06 A;  2P04 A;  4DJ2 A;  4EXO A;  4ZRR A;  4WUJ A;  3LFV A;  2M7U A;  2W1T B;  1OJG A;  3KYQ A;  3OC2 A;  1P9R A;  1UWN X;  1S66 L;  3FPV A;  1F5M A;  1OTB A;  1P0Z A;  3LID A;  4L9E A;  2OOL A;  4UQI M;  4YWZ A;  2J3T D;  2FZ0 A;  4GS9 B;  3D72 A;  2M1C A;  2O99 A;  2OWJ A;  1UWP X;  1WA9 A;  2OWH A;  1N9O A;  4YOF A;  2QKP A;  4EER A;  3EWK A;  2ZOI A;  3CWF A;  3C8C A;  1G6O A;  2VV6 A;  2MJ6 A;  2OAP 1;  4JGO A;  2CMN A;  2XA7 S;  3ICY A;  4O0P A;  3JVU A;  3T4Q A;  2VJW A;  4UQI S;  2J80 A;  2VEA A;  4F3L B;  4LPZ A;  4WF0 A;  4B9O A;  4NXF A;  2XSS A;  5CX7 A;  1ZTU A;  3T4O A;  1LL8 A;  1MC0 A;  5KIZ A;  3F1N A;  5L8M A;  1T1B A;  1Y28 A;  2PHY A;  5F68 A;  4GLQ A;  2VKS A;  1S67 L;  3UB8 A;  1H8M A;  2L4R A;  4IUK A;  4GJ4 A;  2A24 A;  4L9F A;  4EUV A;  1P9W A;  3C30 A;  4CLC E;  1LSX A;  1ZHH B;  3EGX C;  2JHE A;  2QJ7 A;  4MCW A;  3KSI A;  2O0Y A;  5DF9 A;  5HPI A;  1TS6 A;  4HHD A;  3HJI A;  4PAU A;  3CAX A;  2O9C A;  2ZBB A;  5AVE A;  1TS7 A;  2QHK A;  3T50 A;  3UB7 A;  3PXP A;  4Q0I A;  4KUO A;  1T1C A;  4DJ3 A;  4OOM A;  2FH5 A;  1OPX A;  5DJU A;  5TBM A;  3LIE A;  1D7E A;  4HQA A;  1YSQ A;  5I5L A;  1S1Z A;  4KUK A;  4OOL A;  1T1A A;  2VLG A;  3IS2 A;  4NXB A;  4XT2 A;  2BAS A;  5HDD A;  1P97 A;  3OCL A;  2JKR I;  2A2L A;  4NKP A;  1S4S A;  2XRN A;  1V9Y A;  3F1O A;  4HJ3 A;  2VZW A;  2PD8 A;  5DFY A;  3A0R A;  4R3A A;  3TW8 A;  3EEH A;  4R38 A;  4EES A;  1W63 M;  3TJZ C;  4G3K A;  3KSG A;  1DP8 A;  3K2N A;  3OBF A;  4ETX A;  2QJ5 A;  2JN7 A;  2IA2 A;  4Q0H A;  2B02 A;  4PKY G;  3H9W A;  2GZA A;  3A0V A;  2KLI A;  4MN5 A;  4ARZ B;  3T4J A;  1OTI A;  3PBS A;  1NLZ A;  2W3D A;  2WKP A;  2A24 B;  1DP6 A;  1OTE A;  4EU0 A;  3OCN A;  2J3T C;  5LBR A;  2ZMV A;  1N9N A;  5HDC A;  2VA0 A;  3MF0 A;  4BMW A;  3PBQ A;  4CLC B;  4NXG A;  1S4R A;  4JGQ A;  3F1P B;  3LUQ A;  5KSH A;  4Y2F A;  2J3W A;  4EEU A;  4GS9 A;  4IJG A;  5J7E A;  4FOF A;  5HD3 A;  2QYB A;  4P6Z S;  4NEE D;  4I3A A;  3B33 A;  4WEK A;  2XA7 M;  4I3I A;  3EOI A;  4ME4 A;  4WEL A;  4L9G A;  4HNB A;  5HSQ A;  1XJ4 A;  3IBJ A;  4PHT A;  4PKY A;  2XRO A;  2HJ9 C;  3S7O A;  3LIF A;  4K08 A;  4IUH A;  4H6J A;  2PR5 A;  4EW7 A;  3CUE A;  4HP9 A;  3S7P A;  1YKD A;  4LLO B;  3SW1 A;  4R6L A;  4L0L A;  2PYP A;  5HL6 A;  3BW6 A;  3V67 A;  2P08 A;  4HI4 A;  2NUP C;  5HWV A;  4KQD A;  4G3W A;  3BQA A;  1BYW A;  3PBN A;  4BWI A;  2JKR M;  2HF6 A;  3JVV A;  3A0S A;  3NJA A;  4HP4 A;  1XJ6 A;  2KOI A;  3T4L A;  3E98 A;  4MN6 A;  1F98 A;  3C2W A;  3EEA A;  3NHQ A;  4RQ9 A;  3NOT C;  1H3Q A;  5IS1 A;  5G4Z A;  3FG8 A;  2V0U A;  1OT9 A;  2D01 A;  3G6O A;  2V9A A;  2JKT I;  3E4P A;  2HGV A;  2JKT M;  2LB5 A;  3S7N A;  2V1A A;  4Q0J A;  3MR0 A;  4BBV A;  3MJQ A;  2ZOH A;  3LR4 A;  3F1O B;  3B42 A;  3PHY A;  1NLY A;  1GSX A;  2K31 A;  2Y8H A;  5A8B A;  2OAQ 1;  3H82 B;  2HJE A;  3DBA A;  2NUT C;  4LRX C;  4CLC C;  4WEJ A;  5HPF A;  4QPR A;  2PDR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...