3VE4A

Structures of ict and pr1 intermediates from time-resolved laue crystallography
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
publication title Volume-conserving trans-cis isomerization pathways in photoactive yellow protein visualized by picosecond X-ray crystallography
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Luminescent protein
total genus 39
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2012-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3ve4A00
1XFQA 3D72A 5G4YA 3MQOA 4B9OA 2VV6A 2K7SA 2V0UA 1P97A 4R6LA 1OTIA 2WKRA 3NOUC 3PHYA 5AVEA 1BYWA 2OWHA 3HJIA 5DJTA 5DJUA 1TS8A 1LSWA 4HOIA 4HH2A 3A0VA 4WN5A 3E4OA 4MN6A 3BY9A 1KOUA 2QJ5A 3IS2B 3IS2A 3C8CA 2ZBBA 4F3LB 4F3LA 3A0RA 3IBRA 5A8BA 4HI4A 1VB6A 5HWVA 1T1AA 2V9AA 4HP4A 3CLOA 4GCZA 4LRZE 1OJ5A 2JHEA 5HD3A 4HQAA 4EQ1A 3LI8A 3UB9A 2ZOIA 4JGOA 2W0NA 3LIDA 3H7WB 3H7WA 5F69A 5HWTA 3K3DA 4EEUA 3G6OA 3UMDA 3GDIA 4HHDA 4YWZA 3KX0X 5J4EA 1ODVA 1UGUA 5IS1A 3PYPA 1V9ZA 3UMEA 3BWLA 4LRYC 1S1YA 4KUOA 1S1ZA 5KIZA 4HJ3A 4EETB 4NXGA 1F9IA 4NXEA 4MN5A 4R3AA 2H28A 1DP8A 4HJ4A 1S66L 4I3AA 4PKYG 4JGQA 1T1BA 1N9LA 5J7EA 4K08A 4HP9A 4WUJA 4BBTA 1GSWA 4L9EA 3LI9A 3UE6A 3UB8A 3F1PB 3F1PA 1N9NA 3VE3A 5IU1A 1XFNA 3NOTC 3MFXA 4LLOB 2L4RA 2VLGA 3ICYA 1MZUA 2HV1A 2INWA 4EERA 4GW9A 2OOLA 2OWJA 3C2WA 5F6AA 4PKYA 3FC7A 5HD5A 5I5LA 3OLOA 2V1BA 3E4QA 3SW1A 4NXBA 3LIBA 2KX6A 1TS0A 1F98A 3VE4A 2PHYA 1TS7A 2V0WA 1OTDA 2B02A 2P7JA 1UWNX 5HWWA 4LRXC 3NHQA 2R78A 5J3WA 1LT0A 4HJ6A 2W27A 3K3CA 3FG8A 2A24B 1DP9A 2A24A 2PYPA 3F1OB 3F1OA 1JNUA 2BASA 3UB6A 4GHIB 4GHIA 1D7EA 5F5YA 4I3IA 2JN7A 2Z6DA 3LIAA 1WA9A 4EXOA 1OTBA 5DKKA 4DJ2A 1G28A 3UB7A 4GS9B 4GS9A 2WKPA 4WF0A 4HH3A 4R70A 1TS6A 2I9VA 4L9GA 4L9FA 3MXQA 4HIAA 2QHKA 2L0WA 1D06A 2PR6A 2VV8A 4WLAA 3E4PA 2WKQA 4BBVA 1T18A 2V1AA 2EA9A 2GJ3A 1GSXA 5EFWA 1DP6A 4I3JA 2D02A 3LIEA 1GSVA 4KUKA 3F1NB 3F1NA 4BBUA 4E04A 2PD8A 4I5SA 3ULFA 1N9OA 1LL8A 4XT2B 4XT2A 5HDCA 3P7NA 5G4ZA 3BY8A 4HY8A 4EW7A 4NXFA 2VEAA 5TBMB 5HSQA 5TBMA 1P0ZA 1T19A 2VV7A 1XJ4A 1OTEA 3H9WA 4DJ3A 1XJ3A 5F68A 3CWFA 3MJQA 4EESA 1T1CA 1OT6A 5HZHA 5HDDA 1V9YA 3CAXA 3B33A 1DRMA 2Z6CA 1Y28A 3GECA 1XJ6A 3RTYA 1OTAA 1UWPX 4RQ9A 1S67L 5HDSA 4R38A 4JGPA 4I39A 1OJGA 1LSXA 3NOPC 1LSVA 4HNBA 3NJAA 1XJ2A 3H82B 3H82A 3RH8B 3EWKA 2PDRA 2L1MA 2ZOHA 3A0SA 1X0OA 2CMNA 1S4RA 4LPZA 4I38A 3MR0A 2QWSA 4WL9A 2PYRA 5AVFA 4M4XA 4H6JB 2YKHA 4H6JA 3LIFA 2KDKA 3ZQ5A 2YKFA 3EEHA 2PR5A 3T50A 2J80A 4KQDA 3LUQA 3LICA 4JGRA 1S4SA 2QKPA 2D01A 2M1CA 5DKLA 4EEPA 1NWZA 2PD7A 2QJ7A 3VOLA 1OT9A 3HJKA 3LYXA 1EW0A 3MQQA
chains in the Genus database with same CATH superfamily
4GDBA 3BW6A 5G4YA 5HL6A 3MQOA 4X1MA 2V0UA 2CC1A 5EOOA 5AVEA 1NJ4A 5CTMA 5F1GA 4KZAA 2OWHA 5DJUA 1LSWA 4HOIA 4HH2A 3A0VA 5FQMA 2Y2HA 3UN7A 2QJ5A 3BRMA 3MF0A 3Q1FA 5CHJA 3IS2B 3IS2A 3C8CA 4WMCD 4F3LB 4F3LA 3A0RA 3BYDA 3IBRA 5EM1A 5A8BA 1ES2A 3ZG7B 5F83A 5BOHA 3SH9A 2EX6A 2WKIA 2HP5A 1T1AA 3BQAA 2NUPC 3SS4A 4HP4A 1WYCA 4GCZA 5L2FA 1XGIA 2FH5A 2EWWA 4JPMA 1FILA 3VFHA 4Y7PA 2JHEA 2HZ5A 1PWCA 4Y0TA 4HQAA 1NYMA 4YFMA 3TRCA 1PW1A 3UPOA 2JE5A 4B88A 3LI8A 2I72A 4KQOA 3SS3A 3T1RA 3H7WB 1YPRA 3H7WA 4QY6A 3ZG9B 3C38A 4LENA 4P6ZM 4P6BA 3PBTA 2HJEA 4E3LA 1IKGA 2ZC6B 1TDLA 2EXBA 5CHMA 2XA7M 4P85A 4IJGA 5GLDA 5EOEA 3G2YA 3MZDA 3GDIA 4EU0A 1K56D 2XD1A 1FQGA 4GN2A 1UGUA 1QMEA 2PBDP 2XLNA 3PYPA 1V9ZA 2Y91A 3T4OA 1S1YA 4KUOA 5KIZA 3IX4A 4LFUA 2LB5A 4M3KA 2OAQ1 4HJ3A 3OPLA 3V5MA 1K57A 3D4FA 4MN5A 5K5BA 4GNUA 3A3JA 1DP8A 4AFIA 3IBJA 4EUVA 1MKIA 3HLFA 3GR2A 3IQAA 2WGVA 3NDGA 2UWXA 4O01A 3ZGAB 1MC0A 1N9LA 3HL9A 2DRWA 5J7EA 3QP8A 1LI0A 2Y2KA 2XFSA 2RL3A 3OCLA 1BULA 1ZTUA 1K54A 1HTZA 3LI9A 1JWZA 1RCJA 3LR3A 4DDSA 3F1PB 3F1PA 1N9NA 3VE3A 5IU1A 3IWQA 4MMNA 4OP8A 4K0XA 2XRNA 1SKFA 3K2NA 5FEGA 3LY3A 1FR6A 3LEZA 2Y2QA 4JLFA 2V1BA 1M40A 3E4QA 2WKHA 5L09A 3S1YA 5HAQA 3VE4A 2PHYA 3HUNA 4KG6A 3CI6A 1TS7A 4ZRRA 3C4PA 2B02A 2XR0A 4OVDA 3Q7VB 3Q7VA 5HWWA 3NHQA 3MSHA 4EQIA 3NCKA 2PYPA 3F1OB 3F1OA 2OLVA 3UB6A 2EWVA 2JN7A 3T4QA 1RGYA 4EXOA 3O5YA 4E3MA 5DKKA 2V2FF 1PFLA 4CLCD 3IF6B 3IF6A 3IWIA 4QB8A 5D3OA 5DVAA 1SKOB 2WGIA 1SKOA 2X71A 3FV7A 3B3XA 4IUHA 4RA7A 4LCMA 3BFFA 4OQ0A 1G28A 1L3LA 3WRZA 2WKPA 5TR7A 3DTEA 1TS6A 2Y55A 2ZM8A 4ESPA 1ES4A 1LL5A 1XA7A 4L9FA 2VA0A 2Z2LB 1P9RA 1KGGA 4HIAA 2QHKA 4KZ6A 4GD6A 3S7PA 3OOVA 4PPRA 2WAFA 2EFUA 3E4PA 2WKQA 1T18A 4Y3IA 4EBLA 2HP9A 2Y2JA 4DE2A 5EFWA 3P09A 3ZNYA 5DTKA 3NIAA 2VJWA 1GSVA 3IXHA 1ZG6A 4E04A 1MXOA 3QP5A 5EVIB 5EVIA 1VM1A 2W1TB 2W1TA 4QJGA 4MDZA 4BD1A 3IHAA 4EW7A 5KMWA 1S6RA 2V1ZA 5HSQA 1T19A 2IWDA 3P01A 1C3BA 3FKWA 2Q0OA 5E43A 2EX9A 5F68A 4GZBA 3UDXA 1T1CA 4EBNA 1V9YA 1H8ZA 1YQSA 1YLJA 1F2KA 1DRMA 1K54C 2XEPA 1IKIA 1HLUP 3S7NA 4NETA 1J9MA 4RQ9A 1S67L 3NI9A 5FQJA 4DXBA 4S2JA 1LSVA 1GHMA 1XJ2A 3QP1A 1IEMA 3ZNTA 5F82A 4UA7A 1TDGA 2PDRA 3MXRA 2A3UA 4FH2A 4ZDXA 1K55A 1JTDA 2ZMAA 3GVBA 4C75A 3CUEC 4EV4A 1X0OA 3IHBA 1ZHHB 3V50A 1K4EA 4UQIS 3M2JA 4I38A 5IT5A 3OPPA 2BLSA 4GDNA 3IXBA 3WS4A 3ZQ5A 3EEHA 1PNEA 4JXSA 3V3SA 3LUQA 4EBPA 1NXYA 1Y54A 4JGRA 1CI8A 3BFDA 3DBAA 2D01A 4BMWA 3IH9A 4BD0A 2WZZA 1NZOA 4N1XA 1A0KA 4HBUA 4ETXA 3LYXA 3HBRA 1ESUA 1KVLA 2IA2A 4O0PA 4X25A 2K7SA 5F1FA 1CEFA 1OTIA 1Q2PA 3NOUC 1CQAA 4O8GA 3BLMA 4BLMA 5A90A 5DJTA 3JPUA 1TS8A 3T4JA 4Q0JA 3E2KA 2K31A 2VGLS 3VP4A 4MBKA 4N9LA 3VP0A 4IEDA 4MN6A 4WN5A 5DFYA 2OLUA 3BY9A 1KOUA 3BQ8A 3BM6A 1BLSA 2AVXA 2ZBBA 4KZ7A 3IF5A 2ZQ8A 1W5DA 4K0WA 3U2AA 2O9AA 1FCOA 4NG2A 3C7UA 2J9OA 1ZKJA 5DF9A 1KGEA 4DMZA 1SDNA 3T1XA 1OJ5A 5CEBA 3TE8A 5FASA 1SHVA 4UAAA 2PBYA 5HD3A 1HZOA 3R7WB 4X55A 3R7WA 4N9KA 2JBFA 2WZXA 1ES3A 3ITBA 4EQ1A 1DJAA 3UB9A 3HLCA 1SDEA 3QP4A 4MLLA 5HWTA 4ZBEA 1L0GA 3VFFA 2P74A 1BSGA 2W3FA 1MWUA 4EEUA 1OMEA 3VSKA 5KSHA 3OZHA 4MCWA 3G6OA 4MNRA 1H5XA 4HHDA 5M1AA 1VEUB 1VEUA 5J4EA 3G4PA 4MBFA 1ODVA 3FPWA 2QMIA 5IS1A 4R1GA 2G7UA 1WE4A 1L0FA 4LRYC 1QMFA 3GTCA 1FSWA 4QU3A 3HREA 4X1LA 1F9IA 3JVUA 2H28A 4S2KA 4E3JA 1RP5A 3KSGA 3FZCA 2JKTM 4Y17A 3SOIA 4Q8IA 1S66L 2BG1A 4I3AA 4WBGA 4S2LA 2EXAA 2FFFB 1T1BA 3RJUA 3NECA 2XFTA 4HP9A 3TG9A 1IOUA 1N4OA 2X01A 4BBTA 5AQ9A 3VP1A 2IWCA 4LV2A 2XQZA 4L9EA 3V39A 1W8YA 5GHZA 4X56A 4IVKA 4OOMA 1MWTA 5FAQA 1XFNA 3MFXA 2IWBA 1YLWA 5GLAA 5FI6A 2HV1A 4HEFA 4GW9A 3I7JA 2OOLA 1MWRA 1AXBA 5HD5A 4E3KA 3OLOA 1TVFA 2WYXA 3BEBA 2PRFA 3SW1A 4NXBA 3LIBA 1TS0A 2ZQ9A 3FYZA 4KG5A 2HDSA 3EQVA 3ZVWA 1F98A 1O7EA 5HFOA 4X68A 1MBLA 1FCNA 4ME4A 1PWGA 2P7JA 3UE3A 1UWNX 4G3WA 3WRTA 2WAEA 3SZTA 4BWIA 5HARA 2VGJA 1JNUA 1YLTA 2BASA 3FKVA 5FDSA 2P04A 4IUKA 4GHIB 4GHIA 1D7EA 1E3UD 4U0XA 3LIAA 1WA9A 4FUWA 5AQ7A 3Q07A 4DJ2A 4DN0A 1PI4A 1L2SA 1PRQA 4S2NC 3WS5A 4WEKA 2EFXA 2UV0E 3IT9A 4C3QA 5DF8A 3UB7A 3BFCA 2GDNA 4HH3A 2NUTC 4Q0HA 3T12B 5FDHA 1HD8A 3A3EA 4X6TA 3IXGA 2XDMA 3VP3A 5LBRA 1CK3A 2ZL1B 2ZL1A 3HCYA 2L0WA 5HAPA 2PR6A 3PBRA 4WLAA 3D3OA 4FD8A 4KENB 3QP2A 2V1AA 3PBSA 2GJ3A 1GSXA 1Z6FA 4UQIM 5E2FA 4CQHA 4X69A 4I3JA 2VK3A 1GHPA 2FFYA 3AGFA 4E3IA 1G5UA 3WS2A 3HUMA 4KUKA 2HDRA 3WWXA 2E8JA 4BBUA 4GLQA 3ULFA 2J7VA 2E8IA 3NC8A 5FI7A 4XT2B 4XT2A 4KZ8A 4ZJ3A 3P7NA 4OOLA 2VEAA 1K25A 5FAOA 3N8LA 3OBFA 1XJ4A 4KZ5A 3QNBA 3N4IA 1G68A 4FOFA 2KOIA 5CXWA 4YINA 1BLCA 5CX7A 3Q7ZA 3CUEA 3MJQA 4EESA 4XUXA 3O86A 1OT6A 5HZHA 5HDDA 3B47A 3CAXA 3GMWA 3B33A 4QY5A 2HGVA 2Z6CA 3GECA 5HX9A 3JYIA 4A5RA 3PTEA 2H10A 4B4ZA 4R38A 2V20A 2VGLM 5FAPA 1GCEA 4I39A 3UPPA 1OJGA 1S0WA 3NOPC 5EUAA 3H82B 3H82A 3KYZA 3MXSA 2ZM2A 4CLCC 3EWKA 4OPRA 1D1JA 3Q82A 4QHCA 2DNSA 4IBXA 3ZG8B 4II7A 4UHUA 2ZOHA 3MMHA 4BENA 3A0SA 1KDWA 3HLEA 2PT7A 4LPZA 4NKPA 1ZC2A 3EGXC 5E2EA 4WL9A 2PYRA 1YKDA 3T1QB 1GA9A 4P0MA 3T50A 4JBFA 5DF7A 5DFXA 3UE1A 3LICA 4WELA 2ZC3B 4OOYA 2Q9MA 1S4SA 2HDQA 2ZQDA 3CMZA 3ISGA 2JCHA 2ZMFA 5I94A 1OT9A 3ZG5A 4HBTA 3RXXA 3L9KA 1XFQA 1I5QA 4FH4A 3WS0A 4B9OA 2VV6A 5GHYA 2ZJ9A 2HP6A 2M7VA 1P97A 1MKMA 2DMWA 3C5AA 2WKRA 3PHYA 4PM7A 2W3DA 2PU4A 3HJIA 2V8FA 1FR1A 4FSFA 1IFQA 1W8QA 4KZBA 4G3VA 3E4OA 1GA0A 3OC2A 2G2UA 2WUQA 2G2WA 4EWFA 5CRFA 2OAP1 4E3OA 3MBZA 1ONHA 4HI4A 4BL3A 1H0MA 4X53A 3V3RA 4IVIA 5HL1A 5HWVA 2J3TD 3MS6A 2JKRI 3PBQA 2ZC7A 4R23A 4ZTKA 4DDYA 4RX3A 4ZJ2A 2WK0A 3KSFA 1VQQA 3A3FA 3W4QA 3KSIA 5FSRA 4OQGA 2ZOIA 3LR5A 3JVVA 1ONGA 5FI2A 2W0NA 1AWIA 3LIDA 3G31A 3C7VA 4DXCA 2ZLYA 1YLZA 3HVFA 5L07A 5EVLA 3UNWA 2XD5A 1IYQA 2Y2IA 1NYYA 3UMDA 2QYBA 2GX5A 3KX0X 5CHUA 5HW3A 3CJMA 2J3WA 3UMEA 4OPYA 4MN7A 4JXVA 3LO7A 5EECA 4B4XA 4G3KA 1S1ZA 3DTMA 3KSHA 4WMCA 3BECA 4L0LA 1KE0A 4NXGA 4NXEA 2R9XA 4PM9A 2ZQCA 1K4FA 3MZEA 4JKTA 4HJ4A 3ZYTA 3R4KA 4BL2A 4OLGA 3E0YA 1FIKA 5M19A 1MY8A 3EGDC 4YOFA 4U0TA 3CZDA 1ERMA 2WGWB 1DJCA 2W1RA 2WGWA 4KQRA 5FEFA 1JTGA 3LCEA 3TJZC 3G35A 4R0QA 1PW8A 2B5RA 5A91A 3DTIA 2XROA 1G6OA 4LLOB 2VLGA 4OKPA 5CGSA 3ICYA 3AGEA 4B93A 4EERA 2OWJA 3C2WA 1K56A 5F6AA 4Z9QA 3T4SA 3FC7A 5I5LA 4GKUA 4C6YA 2K2NA 3NULA 2GNXA 3N6IA 5AQBA 2Q9NA 3ZFZA 4IHQA 1I2WA 4S2NA 4PAUA 5E2GA 1E25A 3NDEA 1ES5A 3N8RA 3SH8A 3HUOA 3HLWA 1OTDA 5HAIA 2PAVP 3S7OA 4ETZA 4PM8A 5EVEA 4LRXC 3LR4A 2R78A 5J3WA 2GZAA 1FCMA 2W27A 3K3CA 3LGOA 1JVJA 1NRJA 3W4PA 1K6RA 2JC7A 1OPXA 1PZOA 2Y2MA 5F5YA 2A49A 4I3IA 1ERQA 2Z6DA 1H8MA 2X02A 4JF6A 1OTBA 2ZM0A 2JKFA 5GHXA 3GQZA 3UY6A 5TJJA 1FOFA 3IH8A 2Y2GA 1STZA 3UDFA 2O99A 3E98A 3OPRA 4GS9B 4GS9A 2JKGA 3MKFA 1IYOA 2H0TA 2HF6A 1XKZA 3MXQA 3LFVA 3IXDA 3SH7A 4JXWA 4HESA 4UA6A 5EM0A 2HPBA 2W3GA 4E6WA 4NK3A 1BT5A 2EA9A 5EV0A 1YM1A 4OH0A 1LL9A 4FCFA 1DP6A 4LV1A 5CGXA 1KE3A 3RFBA 5E2HA 1K38A 3F1NB 3F1NA 4D60A 3G34A 2HDUA 3N7WA 1HVBA 3LR0A 3W4OA 2W3HA 2ZMVA 3NBLA 4HY8A 4MEZA 3VOZA 5TBMB 5TBMA 4CLCB 4CLCA 2VV7A 3MKEA 5M18A 4WZ5C 1XJ3A 3O3VA 1K6SA 3CPTB 3CPTA 4ZAMA 1VETB 1VETA 1GHIA 1Y28A 1XJ6A 5HPIA 1KE4A 3VP2A 4DE0A 4DF6A 5FATA 4WZ4A 5HDSA 4JGPA 3M6HA 1LSXA 2BTFP 3GV9A 4HNBA 4GJ4A 5DTTA 3NJAA 3SS5A 4Y0UA 1IELA 3T1SA 2Y79A 2ACGA 2KLIA 2L1MA 1P9WA 2HJ9C 2P08A 1YSQA 3HLGA 1BLPA 1BTLA 2WKEA 3M6BA 4ID4A 2OSUA 3UDIA 2CMNA 1S4RA 1VHMA 2QWSA 1PIOA 4M4XA 1BLHA 3DW0A 4H6JB 2YKHA 4H6JA 3CG5A 1KVMA 4H8RA 2YKFA 2O9BA 4Y5FA 2PR5A 1YLPA 4LCLA 2J80A 4Z1WA 4PHTA 3N8SA 3B42A 1E4DA 3L7HA 3DTKA 4O7DA 4MBHA 1F5MA 5CGWA 4EEPA 3WS1A 5MC7A 1NWZA 2PD7A 2QJ7A 3VOLA 3MQ0A 4WYYA 5FQIA 1K0KA 1W63M 3KO6A 4OONA 3MQQA 2Y2OA 1YLYA 1N9BA 3D72A 3DWZA 3OPHA 5HPFA 4U3TA 4R6LA 5KZHA 4K91A 1EWZA 1BYWA 1XGJA 4LV0A 2JKTI 3EQUA 2VGKA 4ARZB 4ARZA 3VOYA 1ACFA 4E3NA 2Y59A 2JKRM 3D9YA 5AJGA 4Y0OA 3LEQA 2PU2A 3ZDJA 1PI5A 3OCNA 5IHVA 1VB6A 2ZC5B 1I2SA 4RX2A 3S4XA 4S2IA 3KYQA 3C4OA 5FQKA 5U47A 2V9AA 3GRJA 3CLOA 2FZ0A 4LRZE 5CTNA 3NY4A 1YMSA 5L10A 3PAEA 3IX8A 3AGDA 1PWDA 4JGOA 3VMAA 4LV3A 2OV5A 1DJBA 4R3BA 1ALQA 5F69A 2ZQ7A 5CECA 3K3DA 1NRFA 3IX3A 3BFGA 1W79A 1PYYA 3FPVA 5EE8A 4YWZA 3U4LP 4S2OA 3UPNA 1Z09A 3QHYA 5A92A 4R4SA 3MZFA 4D2OA 1W7FA 3DAVA 4KZ4A 4JXGA 3QP6A 2VKSA 3BWLA 4RYEA 1LLBA 2ZD8A 4R4RA 1XXMA 1Y4OA 4OPQA 4EETB 4R3AA 3ITAA 5AQAA 3EEAA 3A3IA 1G6AA 3T4LA 4PKYG 4JGQA 3BLSA 3O88A 1H3QA 2Y8HA 4FTXA 4E6XA 3PXPA 4S2PA 4K08A 4PM5A 3VV4A 4WUJA 3DWKA 1XPBA 2Y4AA 4R3JA 4EUZA 4KG2A 3EOIA 1GSWA 1IYSA 4GOGA 1FSYA 3UE6A 3MFDA 3UB8A 4N1HA 1K57C 2WADA 3NOTC 1NY0A 2J3TC 2L4RA 3FWLA 1MZUA 2INWA 1ZG4A 1M6KA 1L0DA 4P6ZS 3RXWA 4QD4A 4PKYA 3ZCZA 1NLYA 2XA7S 2KX6A 3W2ZA 4KZ3A 2EX8A 1XP4A 4PM6A 2ZQAA 1YT4A 3ZHHA 3ZG0A 4CPKA 4DE1A 3A3DA 4DKIA 1DY6A 2V0WA 2XGNA 4WM9A 5J8XA 4P87A 4CJNA 3TSGA 4UEYA 3UE0A 1LT0A 4HJ6A 4XUZA 5EPHA 3FG8A 2A24B 3QNCA 1DP9A 2A24A 1CJFA 4N92A 4GD8A 1KDSA 2EX2A 3TOIA 3G32A 3UB5P 5FA7A 5A93A 2LB9A 2A2LA 4QPRA 4F94A 1KGFA 3HLDA 2RCXA 1J3WA 1CF0A 3CHWP 2O0YA 3VSLA 5FQ9A 3V67A 2XH9A 4BJPA 4WF0A 3LY4A 3IWOA 4R70A 1TF1A 4QWOA 2I9VA 4OP5A 4L9GA 1ESIA 1JWVA 1YMXA 2Y2LA 3GSGA 5JYOA 1BZAA 2VX8A 2W3EA 4OPZA 3HLBA 5C5KA 1SCWA 1D06A 2VV8A 2DCFA 1MPLA 4DE3A 4BBVA 5G18A 4WZ5A 2H5SA 3IF6C 1LHYA 1TEMA 3BJNA 5TFQA 4DRTA 2XSSA 4UA9A 2D02A 4OQHA 3LIEA 3Q81A 3P98A 2M7UA 2QPNA 1EI5A 3G30A 2H0YA 2PD8A 4I5SA 1N9OA 2B95A 4OLDA 1LL8A 2P9VB 2P9VA 5HDCA 3E2LA 4BQMA 5G4ZA 1E3UA 3S7QA 3BY8A 3T4TA 4NXFA 5GL9A 2XK1A 1P0ZA 4JF5A 4KZ9A 5TGFA 4S2MA 4PMAA 1NZUA 1OTEA 4Y15A 3H9WA 3TW8A 1WYBA 4DJ3A 1YSPA 5GLCA 4CLCE 3CWFA 3G2ZA 3CITA 3UO9A 1W63Q 3KYEA 5FQQA 2MJ6A 1JWPA 4GB7A 4Y2FA 4LGWA 3RTYA 1OTAA 5DTSA 4OQIA 1UWPX 5EVIC 1H8YA 1YAXA 1RGZA 3C30A 1O07A 3O87A 2XF3A 1Q2QA 1CI9A 1U60A 3PBNA 5EVID 2J8YA 4Y13A 3RH8B 5KSCA 1CEGA 1L0EA 1NLZA 3PR6A 3PAGA 3PBOA 1IYPA 2J9PA 2ZC4B 1XX2A 2O9CA 2C6WB 2VZWA 4ZJ1A 2Y2NA 3M2KA 5CERA 1LI9A 4KQQA 4WEJA 3MR0A 5AVFA 3LIFA 4IBRA 2KDKA 1BUEA 1EROA 1PZPA 5FL3A 2R9WA 4KQDA 2Y2PA 3ZVTA 2QKPA 3W8KA 5JYPA 2V8CA 5GLBA 2M1CA 4NEED 5DKLA 1MWSA 1TD5A 4YNRA 4XXRA 4Q0IA 2QZ6A 2C5WB 5CEDA 3BFEA 4JF4A 1K55C 4RVAA 1SZVA 3HJKA 3T4KA 2Z2MB 1XA1A 3S22A 2B18A 1EW0A 5L8MA
chains in the Genus database with same CATH topology
1XFQA 2IA2A 3D72A 3BW6A 5G4YA 4O0PA 3MQOA 5HL6A 4B9OA 2VV6A 2K7SA 5HPFA 2M7VA 2V0UA 1P97A 1MKMA 4R6LA 1OTIA 2DMWA 2WKRA 3NOUC 3PHYA 2W3DA 5AVEA 1BYWA 4O8GA 2OWHA 3HJIA 5DJTA 5DJUA 4FSFA 1TS8A 3T4JA 2JKTI 3EQUA 4Q0JA 4ARZB 4ARZA 1LSWA 1IFQA 2K31A 2VGLS 4HOIA 2JKRM 1W63M 3A0VA 4G3VA 3E4OA 4HH2A 4MN6A 4WN5A 5DFYA 3OC2A 3BY9A 1KOUA 2QJ5A 3BQ8A 3MF0A 5AJGA 2OAP1 3IS2B 3IS2A 3C8CA 2ZBBA 4F3LB 4F3LA 3A0RA 3IBRA 3OCNA 5A8BA 4HI4A 1VB6A 3U2AA 2O9AA 5HWVA 2J3TD 3KYQA 2JKRI 3PBQA 1T1AA 3BQAA 2NUPC 2V9AA 4HP4A 3CLOA 4GCZA 2FZ0A 4LRZE 5DF9A 4DMZA 2FH5A 2EWWA 1OJ5A 3TE8A 3KSFA 2JHEA 5HD3A 4HQAA 3R7WB 3TRCA 3R7WA 3KSIA 4EQ1A 3LI8A 3UB9A 2ZOIA 3LR5A 3JVVA 4JGOA 4KQOA 2W0NA 3LIDA 3H7WB 3H7WA 3C38A 4P6ZM 3PBTA 5F69A 5HWTA 2HJEA 3K3DA 2W3FA 4EEUA 2XA7M 5KSHA 4IJGA 4MCWA 3G6OA 3FPVA 3UMDA 2QYBA 2GX5A 3GDIA 4EU0A 4HHDA 4YWZA 3KX0X 5J4EA 1ODVA 3FPWA 1UGUA 5IS1A 2G7UA 2J3WA 3PYPA 1V9ZA 3UMEA 2VKSA 3BWLA 4LRYC 4MN7A 3T4OA 1S1YA 4KUOA 4G3KA 1S1ZA 3KSHA 5KIZA 2LB5A 2OAQ1 4HJ3A 4EETB 4L0LA 4NXGA 1F9IA 4NXEA 4MN5A 5K5BA 3JVUA 4R3AA 2H28A 3KSGA 2JKTM 1DP8A 3EEAA 4AFIA 3IBJA 3T4LA 4HJ4A 1S66L 4EUVA 4I3AA 3ZYTA 3R4KA 4PKYG 3E0YA 4JGQA 4O01A 1MC0A 1T1BA 1H3QA 2Y8HA 1N9LA 3PXPA 5J7EA 4K08A 4HP9A 3EGDC 3VV4A 1IOUA 4YOFA 4WUJA 3OCLA 4BBTA 1ZTUA 3EOIA 2W1RA 1GSWA 4L9EA 4OOMA 3LI9A 3TJZC 3UE6A 3UB8A 3LR3A 3F1PB 3F1PA 1N9NA 1G6OA 5IU1A 3VE3A 1XFNA 3NOTC 2J3TC 3MFXA 4LLOB 2XROA 4MMNA 2L4RA 2VLGA 3ICYA 1MZUA 2HV1A 2INWA 4B93A 2XRNA 4GW9A 4EERA 2OOLA 2OWJA 3C2WA 4P6ZS 3K2NA 5F6AA 3T4SA 4PKYA 3FC7A 5HD5A 5I5LA 3OLOA 2K2NA 1NLYA 2V1BA 2XA7S 3E4QA 2GNXA 3SW1A 4NXBA 3LIBA 2KX6A 1TS0A 3W2ZA 3EQVA 4IHQA 1F98A 4PAUA 3VE4A 2PHYA 3CI6A 1TS7A 4ZRRA 4ME4A 2V0WA 1OTDA 2B02A 2P7JA 3UE3A 1UWNX 4G3WA 3S7OA 4ETZA 5HWWA 4LRXC 4BWIA 3LR4A 3NHQA 2R78A 4UEYA 5J3WA 1LT0A 4HJ6A 2GZAA 2W27A 3K3CA 3FG8A 2A24B 1DP9A 1NRJA 2A24A 2PYPA 3F1OB 3F1OA 1JNUA 1OPXA 2BASA 3UB6A 2P04A 4IUKA 4GHIB 4GHIA 1D7EA 5F5YA 2EWVA 4I3IA 2JN7A 2Z6DA 3LIAA 1H8MA 1WA9A 3T4QA 4EXOA 1OTBA 3O5YA 2LB9A 5DKKA 2A2LA 4QPRA 4CLCD 4DJ2A 4DN0A 5TJJA 4IUHA 1STZA 2O99A 4WEKA 3E98A 2O0YA 1G28A 3V67A 3UB7A 4GS9B 4BJPA 4GS9A 2WKPA 4HH3A 4WF0A 2NUTC 4Q0HA 4R70A 1TF1A 1TS6A 2HF6A 2I9VA 4L9GA 4L9FA 2VA0A 1P9RA 3MXQA 5LBRA 3LFVA 4HIAA 2QHKA 2VX8A 2W3EA 3HCYA 2L0WA 5C5KA 3S7PA 1D06A 3OOVA 2PR6A 2VV8A 3PBRA 4WLAA 2W3GA 3E4PA 3D3OA 2WKQA 4BBVA 1T18A 4Y3IA 2V1AA 2EA9A 3PBSA 2GJ3A 1GSXA 4UQIM 5EFWA 4CQHA 3BJNA 2XSSA 1DP6A 4I3JA 2D02A 2VJWA 3LIEA 3RFBA 1GSVA 2M7UA 4KUKA 3F1NB 3F1NA 4BBUA 4GLQA 4E04A 2PD8A 4I5SA 3ULFA 1N9OA 1LL8A 4XT2B 4XT2A 5HDCA 3LR0A 3P7NA 2W1TB 2W1TA 2W3HA 2ZMVA 4MDZA 4OOLA 5G4ZA 3S7QA 3BY8A 4HY8A 3T4TA 4NXFA 4EW7A 2VEAA 5TBMB 5HSQA 1P0ZA 5TBMA 1T19A 3P01A 4CLCB 4CLCA 3OBFA 2VV7A 1XJ4A 1OTEA 3H9WA 4FOFA 2KOIA 3TW8A 4DJ3A 1XJ3A 1YSPA 5CX7A 4CLCE 3CUEA 5F68A 3CWFA 3MJQA 4EESA 3CITA 1T1CA 1W63Q 1OT6A 5HZHA 5HDDA 1V9YA 3B47A 3CAXA 2MJ6A 3B33A 1DRMA 2HGVA 2Z6CA 1Y28A 3GECA 4Y2FA 1XJ6A 3RTYA 5HPIA 3S7NA 1OTAA 1UWPX 1YAXA 4RQ9A 1S67L 5HDSA 4R38A 3C30A 4JGPA 2VGLM 4I39A 1OJGA 1LSXA 3NOPC 3PBNA 1LSVA 4HNBA 4GJ4A 3NJAA 1XJ2A 3H82B 3H82A 3KYZA 4CLCC 2Y79A 3RH8B 3EWKA 1NLZA 2KLIA 2PDRA 3PR6A 2L1MA 1P9WA 2HJ9C 3PBOA 4II7A 2P08A 1YSQA 2ZOHA 3MMHA 2O9CA 3A0SA 2VZWA 3CUEC 2PT7A 1X0OA 2CMNA 1ZHHB 1S4RA 4LPZA 4NKPA 4UQIS 4I38A 4WEJA 3EGXC 1VHMA 3MR0A 5IT5A 2QWSA 4WL9A 2PYRA 1YKDA 5AVFA 4M4XA 4H6JB 2YKHA 4H6JA 3LIFA 2KDKA 3ZQ5A 2YKFA 2O9BA 3EEHA 4Y5FA 5FL3A 2PR5A 3T50A 2J80A 4KQDA 4PHTA 5DFXA 3LUQA 4Z1WA 3B42A 3LICA 4WELA 4JGRA 1S4SA 3DBAA 2QKPA 2D01A 1F5MA 2M1CA 4BMWA 4NEED 5DKLA 4EEPA 5MC7A 1NWZA 2ZMFA 2PD7A 1TD5A 4YNRA 2QJ7A 3VOLA 4Q0IA 1OT9A 3MQ0A 3T4KA 3HJKA 4ETXA 3LYXA 2B18A 1EW0A 3KO6A 5L8MA 3MQQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XFQ A;  3D72 A;  5G4Y A;  3MQO A;  4B9O A;  2VV6 A;  2K7S A;  2V0U A;  1P97 A;  4R6L A;  1OTI A;  2WKR A;  3NOU C;  3PHY A;  5AVE A;  1BYW A;  2OWH A;  3HJI A;  5DJT A;  5DJU A;  1TS8 A;  1LSW A;  4HOI A;  4HH2 A;  3A0V A;  4WN5 A;  3E4O A;  4MN6 A;  3BY9 A;  1KOU A;  2QJ5 A;  3IS2 B;  3IS2 A;  3C8C A;  2ZBB A;  4F3L B;  4F3L A;  3A0R A;  3IBR A;  5A8B A;  4HI4 A;  1VB6 A;  5HWV A;  1T1A A;  2V9A A;  4HP4 A;  3CLO A;  4GCZ A;  4LRZ E;  1OJ5 A;  2JHE A;  5HD3 A;  4HQA A;  4EQ1 A;  3LI8 A;  3UB9 A;  2ZOI A;  4JGO A;  2W0N A;  3LID A;  3H7W B;  3H7W A;  5F69 A;  5HWT A;  3K3D A;  4EEU A;  3G6O A;  3UMD A;  3GDI A;  4HHD A;  4YWZ A;  3KX0 X;  5J4E A;  1ODV A;  1UGU A;  5IS1 A;  3PYP A;  1V9Z A;  3UME A;  3BWL A;  4LRY C;  1S1Y A;  4KUO A;  1S1Z A;  5KIZ A;  4HJ3 A;  4EET B;  4NXG A;  1F9I A;  4NXE A;  4MN5 A;  4R3A A;  2H28 A;  1DP8 A;  4HJ4 A;  1S66 L;  4I3A A;  4PKY G;  4JGQ A;  1T1B A;  1N9L A;  5J7E A;  4K08 A;  4HP9 A;  4WUJ A;  4BBT A;  1GSW A;  4L9E A;  3LI9 A;  3UE6 A;  3UB8 A;  3F1P B;  3F1P A;  1N9N A;  3VE3 A;  5IU1 A;  1XFN A;  3NOT C;  3MFX A;  4LLO B;  2L4R A;  2VLG A;  3ICY A;  1MZU A;  2HV1 A;  2INW A;  4EER A;  4GW9 A;  2OOL A;  2OWJ A;  3C2W A;  5F6A A;  4PKY A;  3FC7 A;  5HD5 A;  5I5L A;  3OLO A;  2V1B A;  3E4Q A;  3SW1 A;  4NXB A;  3LIB A;  2KX6 A;  1TS0 A;  1F98 A;  3VE4 A;  2PHY A;  1TS7 A;  2V0W A;  1OTD A;  2B02 A;  2P7J A;  1UWN X;  5HWW A;  4LRX C;  3NHQ A;  2R78 A;  5J3W A;  1LT0 A;  4HJ6 A;  2W27 A;  3K3C A;  3FG8 A;  2A24 B;  1DP9 A;  2A24 A;  2PYP A;  3F1O B;  3F1O A;  1JNU A;  2BAS A;  3UB6 A;  4GHI B;  4GHI A;  1D7E A;  5F5Y A;  4I3I A;  2JN7 A;  2Z6D A;  3LIA A;  1WA9 A;  4EXO A;  1OTB A;  5DKK A;  4DJ2 A;  1G28 A;  3UB7 A;  4GS9 B;  4GS9 A;  2WKP A;  4WF0 A;  4HH3 A;  4R70 A;  1TS6 A;  2I9V A;  4L9G A;  4L9F A;  3MXQ A;  4HIA A;  2QHK A;  2L0W A;  1D06 A;  2PR6 A;  2VV8 A;  4WLA A;  3E4P A;  2WKQ A;  4BBV A;  1T18 A;  2V1A A;  2EA9 A;  2GJ3 A;  1GSX A;  5EFW A;  1DP6 A;  4I3J A;  2D02 A;  3LIE A;  1GSV A;  4KUK A;  3F1N B;  3F1N A;  4BBU A;  4E04 A;  2PD8 A;  4I5S A;  3ULF A;  1N9O A;  1LL8 A;  4XT2 B;  4XT2 A;  5HDC A;  3P7N A;  5G4Z A;  3BY8 A;  4HY8 A;  4EW7 A;  4NXF A;  2VEA A;  5TBM B;  5HSQ A;  5TBM A;  1P0Z A;  1T19 A;  2VV7 A;  1XJ4 A;  1OTE A;  3H9W A;  4DJ3 A;  1XJ3 A;  5F68 A;  3CWF A;  3MJQ A;  4EES A;  1T1C A;  1OT6 A;  5HZH A;  5HDD A;  1V9Y A;  3CAX A;  3B33 A;  1DRM A;  2Z6C A;  1Y28 A;  3GEC A;  1XJ6 A;  3RTY A;  1OTA A;  1UWP X;  4RQ9 A;  1S67 L;  5HDS A;  4R38 A;  4JGP A;  4I39 A;  1OJG A;  1LSX A;  3NOP C;  1LSV A;  4HNB A;  3NJA A;  1XJ2 A;  3H82 B;  3H82 A;  3RH8 B;  3EWK A;  2PDR A;  2L1M A;  2ZOH A;  3A0S A;  1X0O A;  2CMN A;  1S4R A;  4LPZ A;  4I38 A;  3MR0 A;  2QWS A;  4WL9 A;  2PYR A;  5AVF A;  4M4X A;  4H6J B;  2YKH A;  4H6J A;  3LIF A;  2KDK A;  3ZQ5 A;  2YKF A;  3EEH A;  2PR5 A;  3T50 A;  2J80 A;  4KQD A;  3LUQ A;  3LIC A;  4JGR A;  1S4S A;  2QKP A;  2D01 A;  2M1C A;  5DKL A;  4EEP A;  1NWZ A;  2PD7 A;  2QJ7 A;  3VOL A;  1OT9 A;  3HJK A;  3LYX A;  1EW0 A;  3MQQ A; 
#chains in the Genus database with same CATH topology
 4GDB A;  3BW6 A;  5G4Y A;  5HL6 A;  3MQO A;  4X1M A;  2V0U A;  2CC1 A;  5EOO A;  5AVE A;  1NJ4 A;  5CTM A;  5F1G A;  4KZA A;  2OWH A;  5DJU A;  1LSW A;  4HOI A;  4HH2 A;  3A0V A;  5FQM A;  2Y2H A;  3UN7 A;  2QJ5 A;  3BRM A;  3MF0 A;  3Q1F A;  5CHJ A;  3IS2 B;  3IS2 A;  3C8C A;  4WMC D;  4F3L B;  4F3L A;  3A0R A;  3BYD A;  3IBR A;  5EM1 A;  5A8B A;  1ES2 A;  3ZG7 B;  5F83 A;  5BOH A;  3SH9 A;  2EX6 A;  2WKI A;  2HP5 A;  1T1A A;  3BQA A;  2NUP C;  3SS4 A;  4HP4 A;  1WYC A;  4GCZ A;  5L2F A;  1XGI A;  2FH5 A;  2EWW A;  4JPM A;  1FIL A;  3VFH A;  4Y7P A;  2JHE A;  2HZ5 A;  1PWC A;  4Y0T A;  4HQA A;  1NYM A;  4YFM A;  3TRC A;  1PW1 A;  3UPO A;  2JE5 A;  4B88 A;  3LI8 A;  2I72 A;  4KQO A;  3SS3 A;  3T1R A;  3H7W B;  1YPR A;  3H7W A;  4QY6 A;  3ZG9 B;  3C38 A;  4LEN A;  4P6Z M;  4P6B A;  3PBT A;  2HJE A;  4E3L A;  1IKG A;  2ZC6 B;  1TDL A;  2EXB A;  5CHM A;  2XA7 M;  4P85 A;  4IJG A;  5GLD A;  5EOE A;  3G2Y A;  3MZD A;  3GDI A;  4EU0 A;  1K56 D;  2XD1 A;  1FQG A;  4GN2 A;  1UGU A;  1QME A;  2PBD P;  2XLN A;  3PYP A;  1V9Z A;  2Y91 A;  3T4O A;  1S1Y A;  4KUO A;  5KIZ A;  3IX4 A;  4LFU A;  2LB5 A;  4M3K A;  2OAQ 1;  4HJ3 A;  3OPL A;  3V5M A;  1K57 A;  3D4F A;  4MN5 A;  5K5B A;  4GNU A;  3A3J A;  1DP8 A;  4AFI A;  3IBJ A;  4EUV A;  1MKI A;  3HLF A;  3GR2 A;  3IQA A;  2WGV A;  3NDG A;  2UWX A;  4O01 A;  3ZGA B;  1MC0 A;  1N9L A;  3HL9 A;  2DRW A;  5J7E A;  3QP8 A;  1LI0 A;  2Y2K A;  2XFS A;  2RL3 A;  3OCL A;  1BUL A;  1ZTU A;  1K54 A;  1HTZ A;  3LI9 A;  1JWZ A;  1RCJ A;  3LR3 A;  4DDS A;  3F1P B;  3F1P A;  1N9N A;  3VE3 A;  5IU1 A;  3IWQ A;  4MMN A;  4OP8 A;  4K0X A;  2XRN A;  1SKF A;  3K2N A;  5FEG A;  3LY3 A;  1FR6 A;  3LEZ A;  2Y2Q A;  4JLF A;  2V1B A;  1M40 A;  3E4Q A;  2WKH A;  5L09 A;  3S1Y A;  5HAQ A;  3VE4 A;  2PHY A;  3HUN A;  4KG6 A;  3CI6 A;  1TS7 A;  4ZRR A;  3C4P A;  2B02 A;  2XR0 A;  4OVD A;  3Q7V B;  3Q7V A;  5HWW A;  3NHQ A;  3MSH A;  4EQI A;  3NCK A;  2PYP A;  3F1O B;  3F1O A;  2OLV A;  3UB6 A;  2EWV A;  2JN7 A;  3T4Q A;  1RGY A;  4EXO A;  3O5Y A;  4E3M A;  5DKK A;  2V2F F;  1PFL A;  4CLC D;  3IF6 B;  3IF6 A;  3IWI A;  4QB8 A;  5D3O A;  5DVA A;  1SKO B;  2WGI A;  1SKO A;  2X71 A;  3FV7 A;  3B3X A;  4IUH A;  4RA7 A;  4LCM A;  3BFF A;  4OQ0 A;  1G28 A;  1L3L A;  3WRZ A;  2WKP A;  5TR7 A;  3DTE A;  1TS6 A;  2Y55 A;  2ZM8 A;  4ESP A;  1ES4 A;  1LL5 A;  1XA7 A;  4L9F A;  2VA0 A;  2Z2L B;  1P9R A;  1KGG A;  4HIA A;  2QHK A;  4KZ6 A;  4GD6 A;  3S7P A;  3OOV A;  4PPR A;  2WAF A;  2EFU A;  3E4P A;  2WKQ A;  1T18 A;  4Y3I A;  4EBL A;  2HP9 A;  2Y2J A;  4DE2 A;  5EFW A;  3P09 A;  3ZNY A;  5DTK A;  3NIA A;  2VJW A;  1GSV A;  3IXH A;  1ZG6 A;  4E04 A;  1MXO A;  3QP5 A;  5EVI B;  5EVI A;  1VM1 A;  2W1T B;  2W1T A;  4QJG A;  4MDZ A;  4BD1 A;  3IHA A;  4EW7 A;  5KMW A;  1S6R A;  2V1Z A;  5HSQ A;  1T19 A;  2IWD A;  3P01 A;  1C3B A;  3FKW A;  2Q0O A;  5E43 A;  2EX9 A;  5F68 A;  4GZB A;  3UDX A;  1T1C A;  4EBN A;  1V9Y A;  1H8Z A;  1YQS A;  1YLJ A;  1F2K A;  1DRM A;  1K54 C;  2XEP A;  1IKI A;  1HLU P;  3S7N A;  4NET A;  1J9M A;  4RQ9 A;  1S67 L;  3NI9 A;  5FQJ A;  4DXB A;  4S2J A;  1LSV A;  1GHM A;  1XJ2 A;  3QP1 A;  1IEM A;  3ZNT A;  5F82 A;  4UA7 A;  1TDG A;  2PDR A;  3MXR A;  2A3U A;  4FH2 A;  4ZDX A;  1K55 A;  1JTD A;  2ZMA A;  3GVB A;  4C75 A;  3CUE C;  4EV4 A;  1X0O A;  3IHB A;  1ZHH B;  3V50 A;  1K4E A;  4UQI S;  3M2J A;  4I38 A;  5IT5 A;  3OPP A;  2BLS A;  4GDN A;  3IXB A;  3WS4 A;  3ZQ5 A;  3EEH A;  1PNE A;  4JXS A;  3V3S A;  3LUQ A;  4EBP A;  1NXY A;  1Y54 A;  4JGR A;  1CI8 A;  3BFD A;  3DBA A;  2D01 A;  4BMW A;  3IH9 A;  4BD0 A;  2WZZ A;  1NZO A;  4N1X A;  1A0K A;  4HBU A;  4ETX A;  3LYX A;  3HBR A;  1ESU A;  1KVL A;  2IA2 A;  4O0P A;  4X25 A;  2K7S A;  5F1F A;  1CEF A;  1OTI A;  1Q2P A;  3NOU C;  1CQA A;  4O8G A;  3BLM A;  4BLM A;  5A90 A;  5DJT A;  3JPU A;  1TS8 A;  3T4J A;  4Q0J A;  3E2K A;  2K31 A;  2VGL S;  3VP4 A;  4MBK A;  4N9L A;  3VP0 A;  4IED A;  4MN6 A;  4WN5 A;  5DFY A;  2OLU A;  3BY9 A;  1KOU A;  3BQ8 A;  3BM6 A;  1BLS A;  2AVX A;  2ZBB A;  4KZ7 A;  3IF5 A;  2ZQ8 A;  1W5D A;  4K0W A;  3U2A A;  2O9A A;  1FCO A;  4NG2 A;  3C7U A;  2J9O A;  1ZKJ A;  5DF9 A;  1KGE A;  4DMZ A;  1SDN A;  3T1X A;  1OJ5 A;  5CEB A;  3TE8 A;  5FAS A;  1SHV A;  4UAA A;  2PBY A;  5HD3 A;  1HZO A;  3R7W B;  4X55 A;  3R7W A;  4N9K A;  2JBF A;  2WZX A;  1ES3 A;  3ITB A;  4EQ1 A;  1DJA A;  3UB9 A;  3HLC A;  1SDE A;  3QP4 A;  4MLL A;  5HWT A;  4ZBE A;  1L0G A;  3VFF A;  2P74 A;  1BSG A;  2W3F A;  1MWU A;  4EEU A;  1OME A;  3VSK A;  5KSH A;  3OZH A;  4MCW A;  3G6O A;  4MNR A;  1H5X A;  4HHD A;  5M1A A;  1VEU B;  1VEU A;  5J4E A;  3G4P A;  4MBF A;  1ODV A;  3FPW A;  2QMI A;  5IS1 A;  4R1G A;  2G7U A;  1WE4 A;  1L0F A;  4LRY C;  1QMF A;  3GTC A;  1FSW A;  4QU3 A;  3HRE A;  4X1L A;  1F9I A;  3JVU A;  2H28 A;  4S2K A;  4E3J A;  1RP5 A;  3KSG A;  3FZC A;  2JKT M;  4Y17 A;  3SOI A;  4Q8I A;  1S66 L;  2BG1 A;  4I3A A;  4WBG A;  4S2L A;  2EXA A;  2FFF B;  1T1B A;  3RJU A;  3NEC A;  2XFT A;  4HP9 A;  3TG9 A;  1IOU A;  1N4O A;  2X01 A;  4BBT A;  5AQ9 A;  3VP1 A;  2IWC A;  4LV2 A;  2XQZ A;  4L9E A;  3V39 A;  1W8Y A;  5GHZ A;  4X56 A;  4IVK A;  4OOM A;  1MWT A;  5FAQ A;  1XFN A;  3MFX A;  2IWB A;  1YLW A;  5GLA A;  5FI6 A;  2HV1 A;  4HEF A;  4GW9 A;  3I7J A;  2OOL A;  1MWR A;  1AXB A;  5HD5 A;  4E3K A;  3OLO A;  1TVF A;  2WYX A;  3BEB A;  2PRF A;  3SW1 A;  4NXB A;  3LIB A;  1TS0 A;  2ZQ9 A;  3FYZ A;  4KG5 A;  2HDS A;  3EQV A;  3ZVW A;  1F98 A;  1O7E A;  5HFO A;  4X68 A;  1MBL A;  1FCN A;  4ME4 A;  1PWG A;  2P7J A;  3UE3 A;  1UWN X;  4G3W A;  3WRT A;  2WAE A;  3SZT A;  4BWI A;  5HAR A;  2VGJ A;  1JNU A;  1YLT A;  2BAS A;  3FKV A;  5FDS A;  2P04 A;  4IUK A;  4GHI B;  4GHI A;  1D7E A;  1E3U D;  4U0X A;  3LIA A;  1WA9 A;  4FUW A;  5AQ7 A;  3Q07 A;  4DJ2 A;  4DN0 A;  1PI4 A;  1L2S A;  1PRQ A;  4S2N C;  3WS5 A;  4WEK A;  2EFX A;  2UV0 E;  3IT9 A;  4C3Q A;  5DF8 A;  3UB7 A;  3BFC A;  2GDN A;  4HH3 A;  2NUT C;  4Q0H A;  3T12 B;  5FDH A;  1HD8 A;  3A3E A;  4X6T A;  3IXG A;  2XDM A;  3VP3 A;  5LBR A;  1CK3 A;  2ZL1 B;  2ZL1 A;  3HCY A;  2L0W A;  5HAP A;  2PR6 A;  3PBR A;  4WLA A;  3D3O A;  4FD8 A;  4KEN B;  3QP2 A;  2V1A A;  3PBS A;  2GJ3 A;  1GSX A;  1Z6F A;  4UQI M;  5E2F A;  4CQH A;  4X69 A;  4I3J A;  2VK3 A;  1GHP A;  2FFY A;  3AGF A;  4E3I A;  1G5U A;  3WS2 A;  3HUM A;  4KUK A;  2HDR A;  3WWX A;  2E8J A;  4BBU A;  4GLQ A;  3ULF A;  2J7V A;  2E8I A;  3NC8 A;  5FI7 A;  4XT2 B;  4XT2 A;  4KZ8 A;  4ZJ3 A;  3P7N A;  4OOL A;  2VEA A;  1K25 A;  5FAO A;  3N8L A;  3OBF A;  1XJ4 A;  4KZ5 A;  3QNB A;  3N4I A;  1G68 A;  4FOF A;  2KOI A;  5CXW A;  4YIN A;  1BLC A;  5CX7 A;  3Q7Z A;  3CUE A;  3MJQ A;  4EES A;  4XUX A;  3O86 A;  1OT6 A;  5HZH A;  5HDD A;  3B47 A;  3CAX A;  3GMW A;  3B33 A;  4QY5 A;  2HGV A;  2Z6C A;  3GEC A;  5HX9 A;  3JYI A;  4A5R A;  3PTE A;  2H10 A;  4B4Z A;  4R38 A;  2V20 A;  2VGL M;  5FAP A;  1GCE A;  4I39 A;  3UPP A;  1OJG A;  1S0W A;  3NOP C;  5EUA A;  3H82 B;  3H82 A;  3KYZ A;  3MXS A;  2ZM2 A;  4CLC C;  3EWK A;  4OPR A;  1D1J A;  3Q82 A;  4QHC A;  2DNS A;  4IBX A;  3ZG8 B;  4II7 A;  4UHU A;  2ZOH A;  3MMH A;  4BEN A;  3A0S A;  1KDW A;  3HLE A;  2PT7 A;  4LPZ A;  4NKP A;  1ZC2 A;  3EGX C;  5E2E A;  4WL9 A;  2PYR A;  1YKD A;  3T1Q B;  1GA9 A;  4P0M A;  3T50 A;  4JBF A;  5DF7 A;  5DFX A;  3UE1 A;  3LIC A;  4WEL A;  2ZC3 B;  4OOY A;  2Q9M A;  1S4S A;  2HDQ A;  2ZQD A;  3CMZ A;  3ISG A;  2JCH A;  2ZMF A;  5I94 A;  1OT9 A;  3ZG5 A;  4HBT A;  3RXX A;  3L9K A;  1XFQ A;  1I5Q A;  4FH4 A;  3WS0 A;  4B9O A;  2VV6 A;  5GHY A;  2ZJ9 A;  2HP6 A;  2M7V A;  1P97 A;  1MKM A;  2DMW A;  3C5A A;  2WKR A;  3PHY A;  4PM7 A;  2W3D A;  2PU4 A;  3HJI A;  2V8F A;  1FR1 A;  4FSF A;  1IFQ A;  1W8Q A;  4KZB A;  4G3V A;  3E4O A;  1GA0 A;  3OC2 A;  2G2U A;  2WUQ A;  2G2W A;  4EWF A;  5CRF A;  2OAP 1;  4E3O A;  3MBZ A;  1ONH A;  4HI4 A;  4BL3 A;  1H0M A;  4X53 A;  3V3R A;  4IVI A;  5HL1 A;  5HWV A;  2J3T D;  3MS6 A;  2JKR I;  3PBQ A;  2ZC7 A;  4R23 A;  4ZTK A;  4DDY A;  4RX3 A;  4ZJ2 A;  2WK0 A;  3KSF A;  1VQQ A;  3A3F A;  3W4Q A;  3KSI A;  5FSR A;  4OQG A;  2ZOI A;  3LR5 A;  3JVV A;  1ONG A;  5FI2 A;  2W0N A;  1AWI A;  3LID A;  3G31 A;  3C7V A;  4DXC A;  2ZLY A;  1YLZ A;  3HVF A;  5L07 A;  5EVL A;  3UNW A;  2XD5 A;  1IYQ A;  2Y2I A;  1NYY A;  3UMD A;  2QYB A;  2GX5 A;  3KX0 X;  5CHU A;  5HW3 A;  3CJM A;  2J3W A;  3UME A;  4OPY A;  4MN7 A;  4JXV A;  3LO7 A;  5EEC A;  4B4X A;  4G3K A;  1S1Z A;  3DTM A;  3KSH A;  4WMC A;  3BEC A;  4L0L A;  1KE0 A;  4NXG A;  4NXE A;  2R9X A;  4PM9 A;  2ZQC A;  1K4F A;  3MZE A;  4JKT A;  4HJ4 A;  3ZYT A;  3R4K A;  4BL2 A;  4OLG A;  3E0Y A;  1FIK A;  5M19 A;  1MY8 A;  3EGD C;  4YOF A;  4U0T A;  3CZD A;  1ERM A;  2WGW B;  1DJC A;  2W1R A;  2WGW A;  4KQR A;  5FEF A;  1JTG A;  3LCE A;  3TJZ C;  3G35 A;  4R0Q A;  1PW8 A;  2B5R A;  5A91 A;  3DTI A;  2XRO A;  1G6O A;  4LLO B;  2VLG A;  4OKP A;  5CGS A;  3ICY A;  3AGE A;  4B93 A;  4EER A;  2OWJ A;  3C2W A;  1K56 A;  5F6A A;  4Z9Q A;  3T4S A;  3FC7 A;  5I5L A;  4GKU A;  4C6Y A;  2K2N A;  3NUL A;  2GNX A;  3N6I A;  5AQB A;  2Q9N A;  3ZFZ A;  4IHQ A;  1I2W A;  4S2N A;  4PAU A;  5E2G A;  1E25 A;  3NDE A;  1ES5 A;  3N8R A;  3SH8 A;  3HUO A;  3HLW A;  1OTD A;  5HAI A;  2PAV P;  3S7O A;  4ETZ A;  4PM8 A;  5EVE A;  4LRX C;  3LR4 A;  2R78 A;  5J3W A;  2GZA A;  1FCM A;  2W27 A;  3K3C A;  3LGO A;  1JVJ A;  1NRJ A;  3W4P A;  1K6R A;  2JC7 A;  1OPX A;  1PZO A;  2Y2M A;  5F5Y A;  2A49 A;  4I3I A;  1ERQ A;  2Z6D A;  1H8M A;  2X02 A;  4JF6 A;  1OTB A;  2ZM0 A;  2JKF A;  5GHX A;  3GQZ A;  3UY6 A;  5TJJ A;  1FOF A;  3IH8 A;  2Y2G A;  1STZ A;  3UDF A;  2O99 A;  3E98 A;  3OPR A;  4GS9 B;  4GS9 A;  2JKG A;  3MKF A;  1IYO A;  2H0T A;  2HF6 A;  1XKZ A;  3MXQ A;  3LFV A;  3IXD A;  3SH7 A;  4JXW A;  4HES A;  4UA6 A;  5EM0 A;  2HPB A;  2W3G A;  4E6W A;  4NK3 A;  1BT5 A;  2EA9 A;  5EV0 A;  1YM1 A;  4OH0 A;  1LL9 A;  4FCF A;  1DP6 A;  4LV1 A;  5CGX A;  1KE3 A;  3RFB A;  5E2H A;  1K38 A;  3F1N B;  3F1N A;  4D60 A;  3G34 A;  2HDU A;  3N7W A;  1HVB A;  3LR0 A;  3W4O A;  2W3H A;  2ZMV A;  3NBL A;  4HY8 A;  4MEZ A;  3VOZ A;  5TBM B;  5TBM A;  4CLC B;  4CLC A;  2VV7 A;  3MKE A;  5M18 A;  4WZ5 C;  1XJ3 A;  3O3V A;  1K6S A;  3CPT B;  3CPT A;  4ZAM A;  1VET B;  1VET A;  1GHI A;  1Y28 A;  1XJ6 A;  5HPI A;  1KE4 A;  3VP2 A;  4DE0 A;  4DF6 A;  5FAT A;  4WZ4 A;  5HDS A;  4JGP A;  3M6H A;  1LSX A;  2BTF P;  3GV9 A;  4HNB A;  4GJ4 A;  5DTT A;  3NJA A;  3SS5 A;  4Y0U A;  1IEL A;  3T1S A;  2Y79 A;  2ACG A;  2KLI A;  2L1M A;  1P9W A;  2HJ9 C;  2P08 A;  1YSQ A;  3HLG A;  1BLP A;  1BTL A;  2WKE A;  3M6B A;  4ID4 A;  2OSU A;  3UDI A;  2CMN A;  1S4R A;  1VHM A;  2QWS A;  1PIO A;  4M4X A;  1BLH A;  3DW0 A;  4H6J B;  2YKH A;  4H6J A;  3CG5 A;  1KVM A;  4H8R A;  2YKF A;  2O9B A;  4Y5F A;  2PR5 A;  1YLP A;  4LCL A;  2J80 A;  4Z1W A;  4PHT A;  3N8S A;  3B42 A;  1E4D A;  3L7H A;  3DTK A;  4O7D A;  4MBH A;  1F5M A;  5CGW A;  4EEP A;  3WS1 A;  5MC7 A;  1NWZ A;  2PD7 A;  2QJ7 A;  3VOL A;  3MQ0 A;  4WYY A;  5FQI A;  1K0K A;  1W63 M;  3KO6 A;  4OON A;  3MQQ A;  2Y2O A;  1YLY A;  1N9B A;  3D72 A;  3DWZ A;  3OPH A;  5HPF A;  4U3T A;  4R6L A;  5KZH A;  4K91 A;  1EWZ A;  1BYW A;  1XGJ A;  4LV0 A;  2JKT I;  3EQU A;  2VGK A;  4ARZ B;  4ARZ A;  3VOY A;  1ACF A;  4E3N A;  2Y59 A;  2JKR M;  3D9Y A;  5AJG A;  4Y0O A;  3LEQ A;  2PU2 A;  3ZDJ A;  1PI5 A;  3OCN A;  5IHV A;  1VB6 A;  2ZC5 B;  1I2S A;  4RX2 A;  3S4X A;  4S2I A;  3KYQ A;  3C4O A;  5FQK A;  5U47 A;  2V9A A;  3GRJ A;  3CLO A;  2FZ0 A;  4LRZ E;  5CTN A;  3NY4 A;  1YMS A;  5L10 A;  3PAE A;  3IX8 A;  3AGD A;  1PWD A;  4JGO A;  3VMA A;  4LV3 A;  2OV5 A;  1DJB A;  4R3B A;  1ALQ A;  5F69 A;  2ZQ7 A;  5CEC A;  3K3D A;  1NRF A;  3IX3 A;  3BFG A;  1W79 A;  1PYY A;  3FPV A;  5EE8 A;  4YWZ A;  3U4L P;  4S2O A;  3UPN A;  1Z09 A;  3QHY A;  5A92 A;  4R4S A;  3MZF A;  4D2O A;  1W7F A;  3DAV A;  4KZ4 A;  4JXG A;  3QP6 A;  2VKS A;  3BWL A;  4RYE A;  1LLB A;  2ZD8 A;  4R4R A;  1XXM A;  1Y4O A;  4OPQ A;  4EET B;  4R3A A;  3ITA A;  5AQA A;  3EEA A;  3A3I A;  1G6A A;  3T4L A;  4PKY G;  4JGQ A;  3BLS A;  3O88 A;  1H3Q A;  2Y8H A;  4FTX A;  4E6X A;  3PXP A;  4S2P A;  4K08 A;  4PM5 A;  3VV4 A;  4WUJ A;  3DWK A;  1XPB A;  2Y4A A;  4R3J A;  4EUZ A;  4KG2 A;  3EOI A;  1GSW A;  1IYS A;  4GOG A;  1FSY A;  3UE6 A;  3MFD A;  3UB8 A;  4N1H A;  1K57 C;  2WAD A;  3NOT C;  1NY0 A;  2J3T C;  2L4R A;  3FWL A;  1MZU A;  2INW A;  1ZG4 A;  1M6K A;  1L0D A;  4P6Z S;  3RXW A;  4QD4 A;  4PKY A;  3ZCZ A;  1NLY A;  2XA7 S;  2KX6 A;  3W2Z A;  4KZ3 A;  2EX8 A;  1XP4 A;  4PM6 A;  2ZQA A;  1YT4 A;  3ZHH A;  3ZG0 A;  4CPK A;  4DE1 A;  3A3D A;  4DKI A;  1DY6 A;  2V0W A;  2XGN A;  4WM9 A;  5J8X A;  4P87 A;  4CJN A;  3TSG A;  4UEY A;  3UE0 A;  1LT0 A;  4HJ6 A;  4XUZ A;  5EPH A;  3FG8 A;  2A24 B;  3QNC A;  1DP9 A;  2A24 A;  1CJF A;  4N92 A;  4GD8 A;  1KDS A;  2EX2 A;  3TOI A;  3G32 A;  3UB5 P;  5FA7 A;  5A93 A;  2LB9 A;  2A2L A;  4QPR A;  4F94 A;  1KGF A;  3HLD A;  2RCX A;  1J3W A;  1CF0 A;  3CHW P;  2O0Y A;  3VSL A;  5FQ9 A;  3V67 A;  2XH9 A;  4BJP A;  4WF0 A;  3LY4 A;  3IWO A;  4R70 A;  1TF1 A;  4QWO A;  2I9V A;  4OP5 A;  4L9G A;  1ESI A;  1JWV A;  1YMX A;  2Y2L A;  3GSG A;  5JYO A;  1BZA A;  2VX8 A;  2W3E A;  4OPZ A;  3HLB A;  5C5K A;  1SCW A;  1D06 A;  2VV8 A;  2DCF A;  1MPL A;  4DE3 A;  4BBV A;  5G18 A;  4WZ5 A;  2H5S A;  3IF6 C;  1LHY A;  1TEM A;  3BJN A;  5TFQ A;  4DRT A;  2XSS A;  4UA9 A;  2D02 A;  4OQH A;  3LIE A;  3Q81 A;  3P98 A;  2M7U A;  2QPN A;  1EI5 A;  3G30 A;  2H0Y A;  2PD8 A;  4I5S A;  1N9O A;  2B95 A;  4OLD A;  1LL8 A;  2P9V B;  2P9V A;  5HDC A;  3E2L A;  4BQM A;  5G4Z A;  1E3U A;  3S7Q A;  3BY8 A;  3T4T A;  4NXF A;  5GL9 A;  2XK1 A;  1P0Z A;  4JF5 A;  4KZ9 A;  5TGF A;  4S2M A;  4PMA A;  1NZU A;  1OTE A;  4Y15 A;  3H9W A;  3TW8 A;  1WYB A;  4DJ3 A;  1YSP A;  5GLC A;  4CLC E;  3CWF A;  3G2Z A;  3CIT A;  3UO9 A;  1W63 Q;  3KYE A;  5FQQ A;  2MJ6 A;  1JWP A;  4GB7 A;  4Y2F A;  4LGW A;  3RTY A;  1OTA A;  5DTS A;  4OQI A;  1UWP X;  5EVI C;  1H8Y A;  1YAX A;  1RGZ A;  3C30 A;  1O07 A;  3O87 A;  2XF3 A;  1Q2Q A;  1CI9 A;  1U60 A;  3PBN A;  5EVI D;  2J8Y A;  4Y13 A;  3RH8 B;  5KSC A;  1CEG A;  1L0E A;  1NLZ A;  3PR6 A;  3PAG A;  3PBO A;  1IYP A;  2J9P A;  2ZC4 B;  1XX2 A;  2O9C A;  2C6W B;  2VZW A;  4ZJ1 A;  2Y2N A;  3M2K A;  5CER A;  1LI9 A;  4KQQ A;  4WEJ A;  3MR0 A;  5AVF A;  3LIF A;  4IBR A;  2KDK A;  1BUE A;  1ERO A;  1PZP A;  5FL3 A;  2R9W A;  4KQD A;  2Y2P A;  3ZVT A;  2QKP A;  3W8K A;  5JYP A;  2V8C A;  5GLB A;  2M1C A;  4NEE D;  5DKL A;  1MWS A;  1TD5 A;  4YNR A;  4XXR A;  4Q0I A;  2QZ6 A;  2C5W B;  5CED A;  3BFE A;  4JF4 A;  1K55 C;  4RVA A;  1SZV A;  3HJK A;  3T4K A;  2Z2M B;  1XA1 A;  3S22 A;  2B18 A;  1EW0 A;  5L8M A; 
#chains in the Genus database with same CATH homology
 1XFQ A;  2IA2 A;  3D72 A;  3BW6 A;  5G4Y A;  4O0P A;  3MQO A;  5HL6 A;  4B9O A;  2VV6 A;  2K7S A;  5HPF A;  2M7V A;  2V0U A;  1P97 A;  1MKM A;  4R6L A;  1OTI A;  2DMW A;  2WKR A;  3NOU C;  3PHY A;  2W3D A;  5AVE A;  1BYW A;  4O8G A;  2OWH A;  3HJI A;  5DJT A;  5DJU A;  4FSF A;  1TS8 A;  3T4J A;  2JKT I;  3EQU A;  4Q0J A;  4ARZ B;  4ARZ A;  1LSW A;  1IFQ A;  2K31 A;  2VGL S;  4HOI A;  2JKR M;  1W63 M;  3A0V A;  4G3V A;  3E4O A;  4HH2 A;  4MN6 A;  4WN5 A;  5DFY A;  3OC2 A;  3BY9 A;  1KOU A;  2QJ5 A;  3BQ8 A;  3MF0 A;  5AJG A;  2OAP 1;  3IS2 B;  3IS2 A;  3C8C A;  2ZBB A;  4F3L B;  4F3L A;  3A0R A;  3IBR A;  3OCN A;  5A8B A;  4HI4 A;  1VB6 A;  3U2A A;  2O9A A;  5HWV A;  2J3T D;  3KYQ A;  2JKR I;  3PBQ A;  1T1A A;  3BQA A;  2NUP C;  2V9A A;  4HP4 A;  3CLO A;  4GCZ A;  2FZ0 A;  4LRZ E;  5DF9 A;  4DMZ A;  2FH5 A;  2EWW A;  1OJ5 A;  3TE8 A;  3KSF A;  2JHE A;  5HD3 A;  4HQA A;  3R7W B;  3TRC A;  3R7W A;  3KSI A;  4EQ1 A;  3LI8 A;  3UB9 A;  2ZOI A;  3LR5 A;  3JVV A;  4JGO A;  4KQO A;  2W0N A;  3LID A;  3H7W B;  3H7W A;  3C38 A;  4P6Z M;  3PBT A;  5F69 A;  5HWT A;  2HJE A;  3K3D A;  2W3F A;  4EEU A;  2XA7 M;  5KSH A;  4IJG A;  4MCW A;  3G6O A;  3FPV A;  3UMD A;  2QYB A;  2GX5 A;  3GDI A;  4EU0 A;  4HHD A;  4YWZ A;  3KX0 X;  5J4E A;  1ODV A;  3FPW A;  1UGU A;  5IS1 A;  2G7U A;  2J3W A;  3PYP A;  1V9Z A;  3UME A;  2VKS A;  3BWL A;  4LRY C;  4MN7 A;  3T4O A;  1S1Y A;  4KUO A;  4G3K A;  1S1Z A;  3KSH A;  5KIZ A;  2LB5 A;  2OAQ 1;  4HJ3 A;  4EET B;  4L0L A;  4NXG A;  1F9I A;  4NXE A;  4MN5 A;  5K5B A;  3JVU A;  4R3A A;  2H28 A;  3KSG A;  2JKT M;  1DP8 A;  3EEA A;  4AFI A;  3IBJ A;  3T4L A;  4HJ4 A;  1S66 L;  4EUV A;  4I3A A;  3ZYT A;  3R4K A;  4PKY G;  3E0Y A;  4JGQ A;  4O01 A;  1MC0 A;  1T1B A;  1H3Q A;  2Y8H A;  1N9L A;  3PXP A;  5J7E A;  4K08 A;  4HP9 A;  3EGD C;  3VV4 A;  1IOU A;  4YOF A;  4WUJ A;  3OCL A;  4BBT A;  1ZTU A;  3EOI A;  2W1R A;  1GSW A;  4L9E A;  4OOM A;  3LI9 A;  3TJZ C;  3UE6 A;  3UB8 A;  3LR3 A;  3F1P B;  3F1P A;  1N9N A;  1G6O A;  5IU1 A;  3VE3 A;  1XFN A;  3NOT C;  2J3T C;  3MFX A;  4LLO B;  2XRO A;  4MMN A;  2L4R A;  2VLG A;  3ICY A;  1MZU A;  2HV1 A;  2INW A;  4B93 A;  2XRN A;  4GW9 A;  4EER A;  2OOL A;  2OWJ A;  3C2W A;  4P6Z S;  3K2N A;  5F6A A;  3T4S A;  4PKY A;  3FC7 A;  5HD5 A;  5I5L A;  3OLO A;  2K2N A;  1NLY A;  2V1B A;  2XA7 S;  3E4Q A;  2GNX A;  3SW1 A;  4NXB A;  3LIB A;  2KX6 A;  1TS0 A;  3W2Z A;  3EQV A;  4IHQ A;  1F98 A;  4PAU A;  3VE4 A;  2PHY A;  3CI6 A;  1TS7 A;  4ZRR A;  4ME4 A;  2V0W A;  1OTD A;  2B02 A;  2P7J A;  3UE3 A;  1UWN X;  4G3W A;  3S7O A;  4ETZ A;  5HWW A;  4LRX C;  4BWI A;  3LR4 A;  3NHQ A;  2R78 A;  4UEY A;  5J3W A;  1LT0 A;  4HJ6 A;  2GZA A;  2W27 A;  3K3C A;  3FG8 A;  2A24 B;  1DP9 A;  1NRJ A;  2A24 A;  2PYP A;  3F1O B;  3F1O A;  1JNU A;  1OPX A;  2BAS A;  3UB6 A;  2P04 A;  4IUK A;  4GHI B;  4GHI A;  1D7E A;  5F5Y A;  2EWV A;  4I3I A;  2JN7 A;  2Z6D A;  3LIA A;  1H8M A;  1WA9 A;  3T4Q A;  4EXO A;  1OTB A;  3O5Y A;  2LB9 A;  5DKK A;  2A2L A;  4QPR A;  4CLC D;  4DJ2 A;  4DN0 A;  5TJJ A;  4IUH A;  1STZ A;  2O99 A;  4WEK A;  3E98 A;  2O0Y A;  1G28 A;  3V67 A;  3UB7 A;  4GS9 B;  4BJP A;  4GS9 A;  2WKP A;  4HH3 A;  4WF0 A;  2NUT C;  4Q0H A;  4R70 A;  1TF1 A;  1TS6 A;  2HF6 A;  2I9V A;  4L9G A;  4L9F A;  2VA0 A;  1P9R A;  3MXQ A;  5LBR A;  3LFV A;  4HIA A;  2QHK A;  2VX8 A;  2W3E A;  3HCY A;  2L0W A;  5C5K A;  3S7P A;  1D06 A;  3OOV A;  2PR6 A;  2VV8 A;  3PBR A;  4WLA A;  2W3G A;  3E4P A;  3D3O A;  2WKQ A;  4BBV A;  1T18 A;  4Y3I A;  2V1A A;  2EA9 A;  3PBS A;  2GJ3 A;  1GSX A;  4UQI M;  5EFW A;  4CQH A;  3BJN A;  2XSS A;  1DP6 A;  4I3J A;  2D02 A;  2VJW A;  3LIE A;  3RFB A;  1GSV A;  2M7U A;  4KUK A;  3F1N B;  3F1N A;  4BBU A;  4GLQ A;  4E04 A;  2PD8 A;  4I5S A;  3ULF A;  1N9O A;  1LL8 A;  4XT2 B;  4XT2 A;  5HDC A;  3LR0 A;  3P7N A;  2W1T B;  2W1T A;  2W3H A;  2ZMV A;  4MDZ A;  4OOL A;  5G4Z A;  3S7Q A;  3BY8 A;  4HY8 A;  3T4T A;  4NXF A;  4EW7 A;  2VEA A;  5TBM B;  5HSQ A;  1P0Z A;  5TBM A;  1T19 A;  3P01 A;  4CLC B;  4CLC A;  3OBF A;  2VV7 A;  1XJ4 A;  1OTE A;  3H9W A;  4FOF A;  2KOI A;  3TW8 A;  4DJ3 A;  1XJ3 A;  1YSP A;  5CX7 A;  4CLC E;  3CUE A;  5F68 A;  3CWF A;  3MJQ A;  4EES A;  3CIT A;  1T1C A;  1W63 Q;  1OT6 A;  5HZH A;  5HDD A;  1V9Y A;  3B47 A;  3CAX A;  2MJ6 A;  3B33 A;  1DRM A;  2HGV A;  2Z6C A;  1Y28 A;  3GEC A;  4Y2F A;  1XJ6 A;  3RTY A;  5HPI A;  3S7N A;  1OTA A;  1UWP X;  1YAX A;  4RQ9 A;  1S67 L;  5HDS A;  4R38 A;  3C30 A;  4JGP A;  2VGL M;  4I39 A;  1OJG A;  1LSX A;  3NOP C;  3PBN A;  1LSV A;  4HNB A;  4GJ4 A;  3NJA A;  1XJ2 A;  3H82 B;  3H82 A;  3KYZ A;  4CLC C;  2Y79 A;  3RH8 B;  3EWK A;  1NLZ A;  2KLI A;  2PDR A;  3PR6 A;  2L1M A;  1P9W A;  2HJ9 C;  3PBO A;  4II7 A;  2P08 A;  1YSQ A;  2ZOH A;  3MMH A;  2O9C A;  3A0S A;  2VZW A;  3CUE C;  2PT7 A;  1X0O A;  2CMN A;  1ZHH B;  1S4R A;  4LPZ A;  4NKP A;  4UQI S;  4I38 A;  4WEJ A;  3EGX C;  1VHM A;  3MR0 A;  5IT5 A;  2QWS A;  4WL9 A;  2PYR A;  1YKD A;  5AVF A;  4M4X A;  4H6J B;  2YKH A;  4H6J A;  3LIF A;  2KDK A;  3ZQ5 A;  2YKF A;  2O9B A;  3EEH A;  4Y5F A;  5FL3 A;  2PR5 A;  3T50 A;  2J80 A;  4KQD A;  4PHT A;  5DFX A;  3LUQ A;  4Z1W A;  3B42 A;  3LIC A;  4WEL A;  4JGR A;  1S4S A;  3DBA A;  2QKP A;  2D01 A;  1F5M A;  2M1C A;  4BMW A;  4NEE D;  5DKL A;  4EEP A;  5MC7 A;  1NWZ A;  2ZMF A;  2PD7 A;  1TD5 A;  4YNR A;  2QJ7 A;  3VOL A;  4Q0I A;  1OT9 A;  3MQ0 A;  3T4K A;  3HJK A;  4ETX A;  3LYX A;  2B18 A;  1EW0 A;  3KO6 A;  5L8M A;  3MQQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...