3VE4A

Structures of ict and pr1 intermediates from time-resolved laue crystallography
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Luminescent protein
molecule keywords Photoactive yellow protein
publication title Volume-conserving trans-cis isomerization pathways in photoactive yellow protein visualized by picosecond X-ray crystallography
pubmed doi rcsb
source organism Halorhodospira halophila
total genus 39
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2012-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3ve4A00
2D02A 1LSWA 4L9FA 2QHKA 3MJQA 3EWKA 5F69A 4WF0A 3UE6A 4M4XA 4XT2B 3E4OA 3EEHA 1D7EA 4HJ3A 2L0WA 1T1CA 1XJ2A 3B33A 2V1AA 4I3AA 2VEAA 4MN5A 5A8BA 5HWTA 1OT9A 3NOUC 4R38A 4GS9A 2OWJA 3UB9A 5AVFA 1P0ZA 3HJIA 3UB8A 3ICYA 3LICA 1NWZA 4R6LA 3OLOA 1N9NA 4HI4A 3UB7A 3H7WB 4PKYG 2PR5A 4R70A 4I5SA 4L9GA 1VB6A 3MQOA 4HJ4A 2L1MA 1DRMA 3CWFA 4BBTA 4JGQA 1GSXA 3LIFA 1XJ6A 4HOIA 3RTYA 4HIAA 4F3LB 3IS2B 2B02A 3SW1A 3LIDA 4EESA 5AVEA 2YKHA 3FG8A 2V1BA 4I39A 1OJGA 1OTEA 3F1OB 4HY8A 3P7NA 2H28A 1XJ3A 2WKRA 2KDKA 1N9OA 4NXBA 3MXQA 1T18A 3C2WA 4HP9A 3D72A 5DJTA 4XT2A 2QJ5A 4I3JA 1S1YA 3C8CA 1DP8A 1S67L 4EETB 5I5LA 3LYXA 3VE3A 2VV7A 1OTIA 2VLGA 2INWA 4HH2A 4I38A 2PYPA 4JGOA 2K7SA 2JN7A 1G28A 5IU1A 3KX0X 3H7WA 2QWSA 5F5YA 1S1ZA 2OWHA 5TBMB 1T1AA 4EQ1A 1OTBA 3BY9A 3UMDA 4WLAA 5F68A 1D06A 3F1PB 2PR6A 5G4YA 5HSQA 5DKKA 4F3LA 4HH3A 3IS2A 4KQDA 2V9AA 4LPZA 1N9LA 2PYRA 3F1NB 2OOLA 1OT6A 4HHDA 1LSVA 1LSXA 4GHIB 3UB6A 5J7EA 4HNBA 1V9ZA 1UWPX 2ZOIA 3F1OA 3NOTC 1DP9A 4B9OA 2V0WA 4EERA 2JHEA 1P97A 3HJKA 3PHYA 4L9EA 5G4ZA 4LRYC 4KUKA 2W0NA 3H82B 5IS1A 1LT0A 5DJUA 2PDRA 2KX6A 2WKPA 3E4PA 4HJ6A 2ZOHA 1UWNX 3GECA 1X0OA 2VV6A 4K08A 3BY8A 3A0RA 2A24B 3LIBA 1F9IA 1S66L 5HDCA 1LL8A 1UGUA 1BYWA 2EA9A 4PKYA 5HD3A 3A0VA 1S4RA 2QKPA 2J80A 5TBMA 1JNUA 1MZUA 1TS8A 4HQAA 4JGPA 1OJ5A 2Z6CA 3RH8B 5EFWA 3LUQA 4NXGA 3H9WA 5J3WA 3F1PA 2BASA 3CAXA 4H6JB 5KIZA 3E4QA 3NOPC 5HWVA 4EW7A 2WKQA 3NHQA 5F6AA 1TS7A 3VE4A 4EXOA 5DKLA 1GSWA 1XJ4A 3F1NA 3MR0A 3ULFA 2V0UA 4GHIA 1F98A 1XFNA 2PHYA 3NJAA 3GDIA 2GJ3A 3ZQ5A 2M1CA 2ZBBA 2PD8A 4DJ3A 2PD7A 4GCZA 3LI8A 1OTDA 1S4SA 4E04A 3K3CA 3LIAA 4WUJA 4DJ2A 5HDSA 3MFXA 1DP6A 1GSVA 5HWWA 4NXEA 3H82A 2CMNA 4GS9B 4YWZA 3T50A 3LIEA 5HZHA 3IBRA 2VV8A 5J4EA 4MN6A 4LRXC 2R78A 2L4RA 5HDDA 2A24A 1WA9A 4LRZE 2P7JA 4I3IA 1KOUA 1V9YA 3MQQA 1T1BA 3VOLA 4EEUA 3G6OA 3CLOA 5HD5A 2Z6DA 4WN5A 1TS0A 2W27A 2QJ7A 3UMEA 1OTAA 4WL9A 4R3AA 3K3DA 3BWLA 3LI9A 4GW9A 4RQ9A 4HP4A 4NXFA 1T19A 3PYPA 2D01A 4EEPA 2HV1A 4BBVA 4H6JA 1Y28A 1ODVA 3FC7A 3A0SA 4KUOA 2YKFA 1EW0A 4LLOB 4BBUA 4JGRA 1XFQA 2I9VA 1TS6A
chains in the Genus database with same CATH superfamily
2QHKA 4GLQA 5E43A 1K54C 1NY0A 4OOLA 1K4FA 4WF0A 3UE6A 5CHJA 5AJGA 4XT2B 4BLMA 3T1QB 3NCKA 1XPBA 4OLGA 2XFSA 2HDUA 2VA0A 5FASA 4GJ4A 4LCMA 1T1CA 3WRZA 2J9OA 4ZAMA 4P6BA 2V1AA 2VEAA 5HWTA 3NOUC 4LENA 4YINA 3SS4A 3RXXA 1XGJA 3UB8A 2J7VA 3ICYA 3LICA 1C3BA 2W1TA 4X55A 3T4SA 3V3SA 5EVIC 1QMEA 4MBKA 3KSHA 3OPPA 4DDYA 1G6AA 2WYXA 2A49A 2I72A 3WRTA 2A3UA 2FZ0A 2H0YA 1VB6A 3LY4A 3MQOA 5AQ9A 1DRMA 3LCEA 3CWFA 4BBTA 3E98A 3R7WB 3RJUA 1KDSA 3W8KA 3Q7VB 4HIAA 4F3LB 4KZBA 2ZC7A 3S7PA 3BLMA 4EESA 4MMNA 2PBYA 5KSHA 2JKTM 3EOIA 5FA7A 4WMCA 3C30A 1NXYA 4HY8A 4CLCA 3QHYA 2VGKA 3O5YA 2FFYA 2HJ9C 3P7NA 4R3JA 3UDXA 1XJ3A 1ES4A 2KDKA 4QHCA 5DF7A 5E2GA 3IBJA 2G2WA 4EBPA 1N9OA 4NXBA 2WZXA 4E6WA 2OSUA 2UV0E 1I5QA 5EVID 2ZQAA 3HLEA 5FDSA 4EUZA 2X01A 1KVMA 3E0YA 2M7UA 4OH0A 4XT2A 4I3JA 4O8GA 3C8CA 5EUAA 4RA7A 3DWKA 4KZ9A 4PM8A 5HAPA 1XKZA 1JVJA 4S2OA 3UPOA 2XF3A 3N6IA 3S7QA 3VP1A 2INWA 5AQ7A 3ZYTA 4ARZB 1FR6A 2PYPA 1KGGA 2EWWA 1ONHA 2K7SA 4DXCA 3OCNA 2JN7A 1G28A 3VOYA 1F2KA 5IU1A 5EPHA 1VETB 3MBZA 2OWHA 4BL2A 2VK3A 3IF6C 4FTXA 1T1AA 3VP4A 4ZJ1A 1M40A 3ITAA 4DE3A 1D06A 3Q07A 1YQSA 1J9MA 2ZM8A 3R7WA 5HSQA 3Q7VA 4MLLA 4F3LA 5FEFA 4S2NA 4ETXA 3LR3A 3GR2A 4XUZA 2HDQA 2V9AA 1GHIA 3UDFA 1YLPA 5CEBA 5HAIA 3L7HA 3LR4A 4RX3A 5J7EA 4QY5A 3EQVA 1G5UA 2EXBA 1DP9A 4R23A 4EERA 2V2FF 4P85A 2V20A 3BLSA 4CPKA 3I7JA 2H0TA 4HESA 2ZQCA 4UAAA 1IKGA 1F5MA 4BENA 5CGWA 3A3IA 4B93A 4KUKA 1K6SA 2W0NA 5IS1A 2EX9A 5L10A 3E2KA 4RX2A 3G4PA 3HUNA 2P9VB 3RFBA 5DTKA 3FKVA 2DMWA 3SH7A 2ZOHA 5L8MA 1UWNX 4WMCD 3HVFA 3Q81A 3BY8A 4CLCD 4YOFA 4R1GA 3LIBA 4ESPA 4G3VA 5FATA 4EU0A 1S66L 5GLCA 4ARZA 1EI5A 2WKHA 3PAEA 5HX9A 3EGDC 4WELA 2DCFA 2W3FA 4IVKA 5FQKA 1BTLA 1DJBA 2QKPA 3ZVWA 3OBFA 1VETA 3T4QA 3QP1A 5FQMA 2R9WA 3IT9A 1MZUA 4JXGA 5CRFA 1OJ5A 2K31A 4OPZA 2B95A 3FWLA 3RH8B 5HL1A 3LUQA 4UA9A 2JKGA 3H9WA 1W63Q 1FSWA 4WZ5A 5AQAA 3D4FA 3Q7ZA 3SS5A 3DBAA 3NHQA 5F6AA 3MR0A 4Y7PA 3ULFA 3DWZA 2V0UA 4BMWA 1IELA 1MWTA 3U2AA 3ZQ5A 5E2EA 2NUTC 4IEDA 2M1CA 4FSFA 4II7A 1BLCA 3O3VA 4E3LA 1MWSA 3LI8A 1ESIA 3SOIA 4E04A 3K3CA 4AFIA 3IWIA 3EQUA 4ID4A 4JBFA 4LCLA 2CMNA 4GS9B 3IHAA 1WYBA 4Y0UA 1FOFA 5J4EA 2P9VA 5FQ9A 4WBGA 2W3EA 2R78A 2L4RA 3C7UA 4QB8A 2EWVA 2Y2NA 1W7FA 4Y15A 2EFXA 1SHVA 4E3OA 1PZOA 1YLYA 1WA9A 4LRZE 2P7JA 4OQGA 1WE4A 3MQQA 3VOLA 3MZEA 3E2LA 3PBSA 3G6OA 3NBLA 3CLOA 1N9BA 3HUMA 4MN7A 3ZGAB 3NULA 3AGFA 3UMEA 1ES3A 4R3AA 1H5XA 2QMIA 3LI9A 4QY6A 3V39A 4R3BA 4RQ9A 3CG5A 3W4PA 4NXFA 1T19A 4FD8A 4E3MA 4ME4A 4KQQA 3UY6A 4JKTA 4MCWA 3UO9A 1FCMA 4E3JA 5EVIB 1Y28A 2Q9MA 1PW8A 1W79A 1W63M 4KUOA 2WAEA 4KZ7A 2Y8HA 4S2JA 1VHMA 4OPYA 3PXPA 2D02A 3VSLA 4L9FA 4B4XA 3B47A 1FQGA 3MJQA 4U0XA 2OAP1 1CEFA 1VQQA 1JTGA 2VGJA 5F69A 4M4XA 4A5RA 3ZG5A 1SDNA 2WGVA 4PM6A 3QP2A 4CJNA 1O07A 3UDIA 2OAQ1 2ZC6B 5FEGA 3GVBA 4ZRRA 3VV4A 2L0WA 3BEBA 2VX8A 3IX3A 2ZC5B 2DRWA 3B33A 3VFFA 4KZ3A 4I3AA 4MN5A 3OPLA 3BFEA 1CJFA 2EX2A 2KOIA 3A3EA 4BQMA 2XH9A 4X1LA 1K25A 4GS9A 2OWJA 1NWZA 5L2FA 4E6XA 3OLOA 1K57A 4HEFA 4HI4A 4QPRA 1YSPA 3H7WB 4JF5A 2W1RA 4R70A 1MKIA 5KZHA 1L0EA 3ZG9B 2ZMAA 4U0TA 5CTNA 3AGDA 2WK0A 4FOFA 4GNUA 4G3WA 2W1TB 1NRJA 3JVVA 3PBQA 2WGIA 2WKEA 1XJ6A 3HBRA 4UQIS 3IS2B 2B02A 3SW1A 2GZAA 1MWUA 1W5DA 2XD5A 2W3GA 4JXVA 2J3TD 3FG8A 3CPTB 2V1BA 2ZMVA 4I39A 4Y3IA 1CI9A 2XA7M 5EVIA 3QP8A 2WKRA 3IF6B 2XA7S 1IOUA 2Y2GA 4N92A 4JXWA 4OKPA 3UE1A 3MXQA 3N8SA 3MF0A 1T18A 5TR7A 1BT5A 4X25A 1S0WA 3C2WA 1AWIA 2Y2OA 5HAQA 1O7EA 1K4EA 2WADA 4H8RA 2EX6A 5DJTA 3M2KA 2QJ5A 1S1YA 1NRFA 4K0WA 4K0XA 3QNBA 2Y2LA 3CMZA 3SS3A 5FQIA 3VFHA 2ACGA 2VV7A 1K6RA 3EEAA 5J8XA 1AXBA 4JGOA 3OCLA 1L0DA 4PHTA 3HL9A 1IFQA 1PI5A 3H7WA 3LR5A 3NDEA 1S1ZA 3TSGA 5HPFA 1KVLA 5M1AA 3G2YA 5CHUA 4IUHA 3FKWA 1OTBA 4EBNA 3G35A 2ZM2A 3LO7A 5F68A 3UMDA 4BD0A 1KGFA 5FI2A 3U4LP 2HF6A 2V1ZA 3P09A 2Q0OA 4BD1A 3IS2A 3CI6A 4LPZA 3A3JA 3ZCZA 3V67A 5HARA 4HBTA 3F1NB 2OOLA 1OT6A 1LSXA 3UB6A 2VKSA 3CPTA 2WGWB 1LI9A 1ALQA 2IWBA 1MWRA 3PAGA 2ZOIA 4ZJ3A 4B9OA 2JHEA 2ZQ7A 3DAVA 1TEMA 3IF6A 1MY8A 3HJKA 3TJZC 1FIKA 1BUEA 1JWVA 2HJEA 5FAPA 2M7VA 3ITBA 1RCJA 3ZDJA 4JF6A 1LT0A 4DDSA 2BTFP 5CECA 3DW0A 4OOYA 3GECA 1NJ4A 2VV6A 4ZDXA 4K08A 3S1YA 3RXWA 3G2ZA 1KGEA 2LB9A 4GB7A 1F9IA 4PM5A 3IXHA 1YKDA 1BYWA 2H10A 1BSGA 4B4ZA 4IJGA 5GHYA 3JVUA 4WM9A 2H5SA 1IYQA 3PBTA 3D3OA 3P01A 1TS8A 3FV7A 4BL3A 5GLDA 5EECA 2XROA 1SDEA 3TOIA 3MXSA 4M3KA 5EFWA 4Z9QA 1LI0A 3UE3A 5E2HA 5J3WA 5EVEA 2BASA 1YMSA 3FZCA 2A2LA 1KE3A 3CJMA 4KQOA 4H6JB 4OONA 3TW8A 4KG5A 4EQIA 5KIZA 3UPPA 4EW7A 2XK1A 5LBRA 2WKQA 2Z2LB 2JBFA 4EXOA 5DKLA 4QJGA 3F1NA 3Q1FA 2ZC4B 2K2NA 4QWOA 3NIAA 2WGWA 3OC2A 1XFNA 4E3NA 1YAXA 3GDIA 3CUEC 3QP4A 4JF4A 3NC8A 1L0FA 3WWXA 1XXMA 3ZG8B 3HLWA 5FQQA 1OTDA 1S4SA 4FH4A 4DJ2A 3S4XA 2O9AA 2HDSA 1LHYA 5HWWA 4KZ6A 1YSQA 3LIEA 5CHMA 3S22A 1HVBA 1PYYA 4PM9A 2PT7A 3UPNA 4MN6A 3ZG7B 4LRXC 1QMFA 2FH5A 4OLDA 3QNCA 1H8MA 1SCWA 1CEGA 5JYOA 4I3IA 3JPUA 1KOUA 1V9YA 5DTSA 1K38A 4EEUA 2KLIA 3B3XA 5AQBA 5HD5A 3BFFA 1BLPA 2W27A 2XD1A 3CHWP 3V5MA 5G18A 1OTAA 3BWLA 3M6HA 1YPRA 2C5WB 3T4KA 1ZG6A 1NLZA 3C38A 1D1JA 2D01A 3BECA 1PZPA 3QP5A 4H6JA 1I2WA 1BULA 1GA0A 5FSRA 3ZVTA 2YKFA 4C3QA 4JGRA 3PR6A 3LY3A 1LSWA 3W2ZA 1IKIA 1MC0A 1FILA 2WKIA 5DTTA 3E4OA 3V3RA 3EEHA 4IBXA 3VP3A 3WS1A 4P6ZM 5M18A 5GHZA 1SKFA 4P6ZS 1RGZA 1JWPA 4N1XA 4K91A 4X68A 3D9YA 2PBDP 1Y54A 2QPNA 3UB9A 3IX4A 1P0ZA 3HJIA 4G3KA 1BLSA 1FSYA 1MBLA 3BYDA 3UB7A 2HP9A 3AGEA 2Z2MB 3O86A 2Y2JA 3HLCA 4L9GA 1IEMA 3LEQA 4S2PA 2XDMA 3HLDA 3LIFA 3PBNA 1W8QA 5CX7A 2XRNA 4HOIA 3RTYA 4GDNA 4S2LA 1ZG4A 3IWOA 5K5BA 1ZHHB 1CI8A 4Q0HA 1PWDA 3OZHA 5TFQA 3Q82A 3GTCA 4Q0IA 1ERQA 2IWCA 3ZFZA 5FL3A 1LLBA 1Q2PA 3V50A 4S2MA 3GQZA 2Y91A 3LFVA 2MJ6A 1LL9A 1OTEA 2VJWA 2H28A 2G7UA 4WEKA 4EBLA 4OP8A 4N9KA 3OPHA 4HP9A 3BFCA 5A91A 4Q0JA 3MFDA 4R4SA 3D72A 4X1MA 3MQ0A 4XUXA 4EETB 3MMHA 5I5LA 3T4JA 4D2OA 3W4OA 3GRJA 1CQAA 3VE3A 1NYYA 1OMEA 1OTIA 4LGWA 1ACFA 4WZ4A 1VEUB 1JWZA 2HP6A 4HH2A 3VMAA 1ONGA 5M19A 3S7OA 3TG9A 4C75A 3KX0X 2DNSA 5EV0A 2QWSA 5F5YA 3UNWA 4X53A 1YMXA 4R0QA 4DXBA 2ZL1B 4OPQA 4NK3A 2WAFA 1U60A 2Y2MA 4KQRA 4WLAA 4FCFA 2VZWA 2PR6A 3UB5P 1L0GA 5G4YA 5HPIA 5CEDA 4HH3A 2BLSA 2ZMFA 1K54A 4KQDA 2B18A 4Z1WA 1GCEA 1N9LA 1A0KA 4NG2A 3C7VA 2PYRA 4XXRA 3DTMA 4HHDA 1P9RA 4Y5FA 3JYIA 2RL3A 4UQIM 3OPRA 1M6KA 2LB5A 1V9ZA 4O01A 1MXOA 4UEYA 3NOTC 3N8LA 1E25A 1P97A 3K2NA 1YLJA 2WUQA 3SH9A 3KSIA 4L9EA 4P87A 2W3HA 3EGXC 4IBRA 1YLTA 3FPVA 3IQAA 5EOEA 3H82B 1K0KA 4PAUA 5DJUA 4PPRA 4N1HA 2WKPA 4KZAA 3UN7A 4JPMA 4HJ6A 2VGLM 4D60A 2Y79A 1K56A 1X0OA 4F94A 2HPBA 5CGSA 3SH8A 2X71A 2VGLS 4L0LA 4IUKA 2A24B 1CK3A 3QP6A 1VEUA 1UGUA 3A3FA 2EA9A 3MXRA 4PKYA 1DJAA 2Y2PA 5HD3A 4DRTA 1CF0A 3KYEA 5L07A 3A0VA 4GD6A 1S4RA 2J80A 1JNUA 1K55C 4O7DA 2CC1A 2ZL1A 3WS2A 3HUOA 4MDZA 4NXGA 4GOGA 3W4QA 3R4KA 1H0MA 3PBOA 5KMWA 5L09A 1FCNA 1E3UA 2O9BA 5CTMA 3FPWA 4QU3A 3IHBA 1GHMA 1TS7A 2ZJ9A 1H8ZA 1MKMA 2EXAA 3BQAA 1YM1A 4YFMA 5GLAA 2ZQ9A 5BOHA 2PHYA 4DE2A 3NJAA 3BFDA 3MKFA 4Y0TA 5FI7A 4GCZA 3BFGA 3BQ8A 4RYEA 5HDSA 1DP6A 1GSVA 4NXEA 3H82A 1ES2A 1KE4A 4YWZA 3T50A 2Y59A 5I94A 5HZHA 4Y0OA 1RGYA 3BJNA 3ZNTA 4LV2A 5FDHA 3IF5A 4UA7A 2A24A 3DTKA 4OQIA 1T1BA 1ESUA 3CUEA 5A92A 1OPXA 2JCHA 1FR1A 3IXBA 4WN5A 5JYPA 5EM1A 1G6OA 4EWFA 2C6WB 2Q9NA 1PIOA 4WEJA 2O0YA 3K3DA 2E8JA 4GW9A 5TJJA 4MBHA 1K56D 1IYSA 4QD4A 4GN2A 2O9CA 2G2UA 2IA2A 1Z6FA 2Y2HA 2J9PA 5D3OA 1PNEA 3FC7A 3KSGA 3DTEA 4PM7A 2O99A 1XFQA 1RP5A 1H3QA 1Y4OA 3CITA 1PFLA 2B5RA 4UA6A 3EWKA 3T1RA 1TF1A 1L2SA 4NKPA 2QYBA 5GLBA 1D7EA 3HLFA 5DF9A 4E3IA 2J3WA 4HJ3A 4DN0A 3C4PA 5C5KA 3ISGA 3T4TA 1Z09A 3VP0A 1E3UD 3WS0A 4Y2FA 1XJ2A 2GNXA 2PU4A 5EE8A 3T1SA 2OLVA 4ZJ2A 5A8BA 1OT9A 4ZTKA 1ES5A 2JC7A 4R38A 5AVFA 4R6LA 1YT4A 3NECA 4PMAA 4DKIA 1YLZA 1N9NA 1ERMA 4CLCC 4RVAA 2R9XA 4PKYG 2PR5A 5F1FA 5GL9A 1PW1A 4WYYA 4I5SA 2RCXA 4HJ4A 2L1MA 2GX5A 1WYCA 4UHUA 4JGQA 1GSXA 5EM0A 3KYZA 3LIDA 1W8YA 3T12B 4JLFA 3A3DA 4EV4A 4LV1A 4R4RA 5F82A 3LR0A 5AVEA 3MKEA 5E2FA 3KSFA 2YKHA 4DE1A 1SKOB 2QZ6A 1OJGA 4Y13A 3LEZA 3F1OB 4NETA 5HW3A 2HP5A 2HZ5A 4X69A 5FQJA 2XFTA 4YNRA 5IT5A 2ZQ8A 5TGFA 4EUVA 3NY4A 1HTZA 2PRFA 3MSHA 3VOZA 3IX8A 4BJPA 2OV5A 1PWGA 2JKTI 1DP8A 1S67L 2PAVP 4S2NC 3LYXA 4MEZA 3G31A 3IXGA 4JXSA 5EOOA 5HFOA 1L3LA 2VLGA 4IHQA 1XA7A 4CLCE 5CGXA 5DFXA 4GD8A 4I38A 1MPLA 4OQHA 3ZG0A 3HLBA 1XGIA 3MZDA 1E4DA 1NYMA 1SZVA 4GZBA 3CZDA 2Y2KA 5TBMB 4LV0A 1IYPA 4EQ1A 2P08A 4P0MA 2E8IA 3BY9A 4C6YA 4LFUA 2Y2IA 4DF6A 2Y2QA 3IH9A 3GSGA 5DVAA 3F1PB 1ZC2A 5A90A 4FUWA 3OOVA 5DKKA 2ZC3B 2OLUA 1NZOA 3HLGA 3S7NA 4X56A 2XR0A 1JTDA 2AVXA 4KZ8A 2V8CA 1LSVA 4MBFA 3VSKA 4GHIB 3SZTA 4B88A 1SKOA 4HNBA 4Y17A 1ZTUA 3N7WA 1UWPX 1I2SA 2ZD8A 3NDGA 3F1OA 4KZ5A 4KG6A 2V0WA 3ZNYA 1YLWA 1PRQA 3IH8A 2J8YA 2ZM0A 3C5AA 3PHYA 2JE5A 4KENB 5G4ZA 1BZAA 2JKRM 4NEED 4DE0A 4LRYC 5F83A 1XP4A 5CXWA 2W3DA 2PDRA 2KX6A 4FH2A 3E4PA 1GA9A 4GKUA 5FAQA 5MC7A 1TVFA 1N4OA 2P74A 3FYZA 4WZ5C 4OVDA 5FAOA 5A93A 2X02A 4X6TA 3A0RA 4ETZA 2NUPC 5KSCA 2HDRA 5HDCA 3KYQA 1LL8A 5DF8A 3MS6A 4E3KA 3GV9A 3BM6A 1DJCA 3M6BA 4N9LA 1DY6A 4DMZA 1IYOA 1KE0A 2JKFA 3TE8A 5TBMA 1HD8A 1NLYA 3T1XA 4HQAA 4JGPA 2Z6CA 2FFFB 3G30A 3T4LA 3LGOA 2Y55A 4U3TA 1KDWA 3F1PA 3VP2A 4S2IA 3CAXA 1FCOA 3E4QA 3NOPC 5HL6A 4GDBA 5HWVA 5GHXA 3M2JA 2XEPA 5CERA 3VE4A 3L9KA 2J3TC 4Q8IA 1GSWA 1XJ4A 3MZFA 4GHIA 1LL5A 2PU2A 2XQZA 1F98A 2IWDA 3NI9A 4KG2A 2GJ3A 1J3WA 2Y4AA 3B42A 3PTEA 2ZBBA 2PD8A 2GDNA 3IXDA 2P04A 4ZBEA 4BWIA 3UE0A 1K55A 2BG1A 4DJ3A 3N8RA 3C4OA 1PWCA 2PD7A 1HLUP 3G34A 3T4OA 2EFUA 3LIAA 4WUJA 2XSSA 3HREA 3P98A 1TD5A 3MFXA 4MNRA 1STZA 5EVLA 4OQ0A 4CQHA 1TDGA 3KO6A 1EROA 3GMWA 5IHVA 3IBRA 2VV8A 3G32A 4OP5A 2ZQDA 1H8YA 3O87A 5HDDA 1PI4A 1Q2QA 4KZ4A 4LV3A 2ZLYA 2V8FA 3ZHHA 1XX2A 2XLNA 4HBUA 3HCYA 5U47A 3DTIA 4OPRA 2Z6DA 3IWQA 1HZOA 1EWZA 1VM1A 3PBRA 2WZZA 4OOMA 1TS0A 2UWXA 1XA1A 2QJ7A 3N4IA 4WL9A 1TDLA 1ZKJA 3O88A 5FI6A 3TRCA 4HP4A 3BRMA 1G68A 3BW6A 5DFYA 1BLHA 5F1GA 3PYPA 4EEPA 2JKRI 1S6RA 1P9WA 4IVIA 1NZUA 2HV1A 4BBVA 2XGNA 4CLCB 2EX8A 1ODVA 1K57C 1GHPA 3A0SA 2HGVA 4S2KA 3WS4A 1EW0A 4LLOB 4BBUA 3WS5A 4O0PA 2I9VA 1TS6A
chains in the Genus database with same CATH topology
3PXPA 2D02A 1LSWA 4L9FA 3W2ZA 2QHKA 3B47A 4GLQA 3MJQA 1H3QA 1MC0A 3CITA 2OAP1 4OOLA 3EWKA 5F69A 1TF1A 4WF0A 3UE6A 4M4XA 5AJGA 4XT2B 3E4OA 3EEHA 4NKPA 4P6ZM 2QYBA 1D7EA 5DF9A 4P6ZS 2OAQ1 2VA0A 4GJ4A 3PR6A 2J3WA 4HJ3A 4DN0A 4ZRRA 5C5KA 3VV4A 2L0WA 3T4TA 1T1CA 2VX8A 4Y2FA 1XJ2A 2GNXA 3B33A 2V1AA 4I3AA 2VEAA 4MN5A 5A8BA 2KOIA 5HWTA 1OT9A 3NOUC 4R38A 4GS9A 2OWJA 3UB9A 5AVFA 1P0ZA 3HJIA 4G3KA 3ICYA 3LICA 1NWZA 4R6LA 3UB8A 3OLOA 1N9NA 2W1TA 4HI4A 3T4SA 4QPRA 3UB7A 4CLCC 1YSPA 3H7WB 2W1RA 4PKYG 2PR5A 4R70A 3KSHA 4I5SA 2FZ0A 4L9GA 1VB6A 3MQOA 4HJ4A 2L1MA 4FOFA 4G3WA 2W1TB 2GX5A 1DRMA 1NRJA 3CWFA 3JVVA 4BBTA 4JGQA 1GSXA 3PBQA 3LIFA 3E98A 3PBNA 3R7WB 5CX7A 1XJ6A 2XRNA 4HOIA 3RTYA 4HIAA 4F3LB 4UQIS 3S7PA 3IS2B 3KYZA 5K5BA 2B02A 3SW1A 3LIDA 1ZHHB 2GZAA 4Q0HA 4EESA 3LR0A 5AVEA 4Q0IA 4MMNA 2W3GA 5FL3A 3KSFA 2YKHA 5KSHA 2J3TD 2JKTM 3EOIA 3FG8A 2V1BA 2ZMVA 4I39A 1OJGA 4Y3IA 3LFVA 2MJ6A 3C30A 1OTEA 2VJWA 3F1OB 4HY8A 4CLCA 3O5YA 2HJ9C 2XA7M 3P7NA 2H28A 1XJ3A 2WKRA 2G7UA 4O0PA 2XA7S 2KDKA 4WEKA 1IOUA 4YNRA 3IBJA 5IT5A 1N9OA 4NXBA 3MXQA 4EUVA 3MF0A 1T18A 3C2WA 4HP9A 4Q0JA 3D72A 3E0YA 5DJTA 4XT2A 2M7UA 4BJPA 2QJ5A 4JGRA 4I3JA 1S1YA 4O8GA 2JKTI 3C8CA 1DP8A 3MQ0A 1S67L 4EETB 3MMHA 5I5LA 3T4JA 3LYXA 3VE3A 2VV7A 1OTIA 2VLGA 4IHQA 3S7QA 3EEAA 4CLCE 5DFXA 2INWA 3ZYTA 4HH2A 4ARZB 4I38A 2PYPA 4JGOA 2EWWA 3OCLA 2K7SA 3OCNA 3S7OA 2JN7A 4PHTA 1G28A 5IU1A 3KX0X 1IFQA 3H7WA 2QWSA 5F5YA 3LR5A 1S1ZA 2OWHA 5HPFA 5TBMB 4IUHA 1T1AA 4EQ1A 2P08A 1OTBA 3BY9A 3UMDA 4WLAA 5F68A 1D06A 2VZWA 3F1PB 2HF6A 2PR6A 3R7WA 5G4YA 3OOVA 5HPIA 5HSQA 5DKKA 4F3LA 4HH3A 4ETXA 3IS2A 2ZMFA 3LR3A 3CI6A 4KQDA 2B18A 4Z1WA 2V9AA 4LPZA 1N9LA 3S7NA 3V67A 2PYRA 3F1NB 2OOLA 1OT6A 4HHDA 1LSVA 1P9RA 1LSXA 3LR4A 4GHIB 4Y5FA 3UB6A 5J7EA 2VKSA 4UQIM 3EQVA 4HNBA 1ZTUA 2LB5A 1V9ZA 1UWPX 4O01A 2ZOIA 4UEYA 3F1OA 3NOTC 1DP9A 4B9OA 2V0WA 4EERA 2JHEA 1P97A 3HJKA 3K2NA 3TJZC 3PHYA 1F5MA 3KSIA 4L9EA 2W3HA 3EGXC 2HJEA 5G4ZA 2JKRM 4NEED 3FPVA 2M7VA 4B93A 4LRYC 4KUKA 2W0NA 3H82B 2W3DA 1LT0A 5IS1A 4PAUA 5DJUA 2PDRA 2KX6A 2WKPA 3E4PA 5MC7A 3RFBA 2DMWA 4HJ6A 2VGLM 2ZOHA 2Y79A 5L8MA 1UWNX 3GECA 1X0OA 2VV6A 2VGLS 4K08A 4L0LA 3BY8A 4CLCD 4IUKA 2LB9A 4YOFA 3A0RA 4ETZA 2A24B 3LIBA 2NUPC 1F9IA 4G3VA 4EU0A 1S66L 5HDCA 3KYQA 1LL8A 1UGUA 1YKDA 1BYWA 2EA9A 4PKYA 4ARZA 5HD3A 4IJGA 3EGDC 4WELA 2W3FA 3A0VA 1S4RA 2QKPA 3JVUA 4DMZA 3OBFA 2J80A 3T4QA 3TE8A 5TBMA 3PBTA 1JNUA 3D3OA 3P01A 1NLYA 1MZUA 1TS8A 2XROA 4HQAA 4JGPA 1OJ5A 2K31A 4MDZA 2Z6CA 3T4LA 3RH8B 5EFWA 3LUQA 4NXGA 3H9WA 3R4KA 1W63Q 3UE3A 5J3WA 3F1PA 2BASA 2A2LA 3CAXA 3PBOA 4H6JB 4KQOA 3TW8A 5KIZA 3E4QA 2O9BA 3NOPC 5HL6A 5HWVA 3FPWA 4EW7A 5LBRA 2WKQA 3DBAA 3NHQA 5F6AA 1TS7A 3VE4A 4EXOA 1MKMA 2J3TC 5DKLA 1GSWA 1XJ4A 3F1NA 3MR0A 3BQAA 3ULFA 2K2NA 2V0UA 4GHIA 4BMWA 1F98A 3OC2A 1XFNA 2PHYA 3NJAA 1YAXA 3GDIA 2GJ3A 3U2AA 3ZQ5A 2NUTC 3B42A 3CUEC 2M1CA 2ZBBA 2PD8A 2P04A 4FSFA 4BWIA 4II7A 4DJ3A 2PD7A 4GCZA 3T4OA 3LI8A 3BQ8A 1OTDA 1S4SA 4E04A 3K3CA 3LIAA 4AFIA 4WUJA 4DJ2A 2XSSA 2O9AA 3EQUA 1TD5A 3MFXA 5HDSA 1DP6A 1GSVA 5HWWA 1STZA 4NXEA 3H82A 2CMNA 4CQHA 4GS9B 4YWZA 3KO6A 3T50A 1YSQA 3LIEA 5HZHA 3IBRA 2VV8A 5J4EA 2PT7A 4MN6A 4LRXC 2FH5A 2W3EA 3BJNA 2R78A 2L4RA 2EWVA 1H8MA 5HDDA 2A24A 1WA9A 4LRZE 2P7JA 4I3IA 1KOUA 1V9YA 3MQQA 1T1BA 3VOLA 4EEUA 2KLIA 3CUEA 1OPXA 3PBSA 3G6OA 3HCYA 3CLOA 5HD5A 2Z6DA 4WN5A 3PBRA 4OOMA 4MN7A 1G6OA 1TS0A 2W27A 2QJ7A 3UMEA 4WEJA 1OTAA 2O0YA 4WL9A 4R3AA 3K3DA 3BWLA 3LI9A 4GW9A 5TJJA 4RQ9A 3TRCA 4HP4A 3BW6A 5DFYA 3T4KA 2O9CA 4NXFA 1T19A 1NLZA 3C38A 3PYPA 2D01A 4EEPA 2JKRI 2IA2A 1P9WA 2HV1A 4ME4A 4BBVA 4H6JA 4CLCB 4MCWA 1Y28A 1ODVA 3FC7A 1W63M 3A0SA 2HGVA 4KUOA 2YKFA 3KSGA 1EW0A 4LLOB 2Y8HA 4BBUA 1VHMA 2O99A 1XFQA 2I9VA 1TS6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D02 A;  1LSW A;  4L9F A;  2QHK A;  3MJQ A;  3EWK A;  5F69 A;  4WF0 A;  3UE6 A;  4M4X A;  4XT2 B;  3E4O A;  3EEH A;  1D7E A;  4HJ3 A;  2L0W A;  1T1C A;  1XJ2 A;  3B33 A;  2V1A A;  4I3A A;  2VEA A;  4MN5 A;  5A8B A;  5HWT A;  1OT9 A;  3NOU C;  4R38 A;  4GS9 A;  2OWJ A;  3UB9 A;  5AVF A;  1P0Z A;  3HJI A;  3UB8 A;  3ICY A;  3LIC A;  1NWZ A;  4R6L A;  3OLO A;  1N9N A;  4HI4 A;  3UB7 A;  3H7W B;  4PKY G;  2PR5 A;  4R70 A;  4I5S A;  4L9G A;  1VB6 A;  3MQO A;  4HJ4 A;  2L1M A;  1DRM A;  3CWF A;  4BBT A;  4JGQ A;  1GSX A;  3LIF A;  1XJ6 A;  4HOI A;  3RTY A;  4HIA A;  4F3L B;  3IS2 B;  2B02 A;  3SW1 A;  3LID A;  4EES A;  5AVE A;  2YKH A;  3FG8 A;  2V1B A;  4I39 A;  1OJG A;  1OTE A;  3F1O B;  4HY8 A;  3P7N A;  2H28 A;  1XJ3 A;  2WKR A;  2KDK A;  1N9O A;  4NXB A;  3MXQ A;  1T18 A;  3C2W A;  4HP9 A;  3D72 A;  5DJT A;  4XT2 A;  2QJ5 A;  4I3J A;  1S1Y A;  3C8C A;  1DP8 A;  1S67 L;  4EET B;  5I5L A;  3LYX A;  3VE3 A;  2VV7 A;  1OTI A;  2VLG A;  2INW A;  4HH2 A;  4I38 A;  2PYP A;  4JGO A;  2K7S A;  2JN7 A;  1G28 A;  5IU1 A;  3KX0 X;  3H7W A;  2QWS A;  5F5Y A;  1S1Z A;  2OWH A;  5TBM B;  1T1A A;  4EQ1 A;  1OTB A;  3BY9 A;  3UMD A;  4WLA A;  5F68 A;  1D06 A;  3F1P B;  2PR6 A;  5G4Y A;  5HSQ A;  5DKK A;  4F3L A;  4HH3 A;  3IS2 A;  4KQD A;  2V9A A;  4LPZ A;  1N9L A;  2PYR A;  3F1N B;  2OOL A;  1OT6 A;  4HHD A;  1LSV A;  1LSX A;  4GHI B;  3UB6 A;  5J7E A;  4HNB A;  1V9Z A;  1UWP X;  2ZOI A;  3F1O A;  3NOT C;  1DP9 A;  4B9O A;  2V0W A;  4EER A;  2JHE A;  1P97 A;  3HJK A;  3PHY A;  4L9E A;  5G4Z A;  4LRY C;  4KUK A;  2W0N A;  3H82 B;  5IS1 A;  1LT0 A;  5DJU A;  2PDR A;  2KX6 A;  2WKP A;  3E4P A;  4HJ6 A;  2ZOH A;  1UWN X;  3GEC A;  1X0O A;  2VV6 A;  4K08 A;  3BY8 A;  3A0R A;  2A24 B;  3LIB A;  1F9I A;  1S66 L;  5HDC A;  1LL8 A;  1UGU A;  1BYW A;  2EA9 A;  4PKY A;  5HD3 A;  3A0V A;  1S4R A;  2QKP A;  2J80 A;  5TBM A;  1JNU A;  1MZU A;  1TS8 A;  4HQA A;  4JGP A;  1OJ5 A;  2Z6C A;  3RH8 B;  5EFW A;  3LUQ A;  4NXG A;  3H9W A;  5J3W A;  3F1P A;  2BAS A;  3CAX A;  4H6J B;  5KIZ A;  3E4Q A;  3NOP C;  5HWV A;  4EW7 A;  2WKQ A;  3NHQ A;  5F6A A;  1TS7 A;  3VE4 A;  4EXO A;  5DKL A;  1GSW A;  1XJ4 A;  3F1N A;  3MR0 A;  3ULF A;  2V0U A;  4GHI A;  1F98 A;  1XFN A;  2PHY A;  3NJA A;  3GDI A;  2GJ3 A;  3ZQ5 A;  2M1C A;  2ZBB A;  2PD8 A;  4DJ3 A;  2PD7 A;  4GCZ A;  3LI8 A;  1OTD A;  1S4S A;  4E04 A;  3K3C A;  3LIA A;  4WUJ A;  4DJ2 A;  5HDS A;  3MFX A;  1DP6 A;  1GSV A;  5HWW A;  4NXE A;  3H82 A;  2CMN A;  4GS9 B;  4YWZ A;  3T50 A;  3LIE A;  5HZH A;  3IBR A;  2VV8 A;  5J4E A;  4MN6 A;  4LRX C;  2R78 A;  2L4R A;  5HDD A;  2A24 A;  1WA9 A;  4LRZ E;  2P7J A;  4I3I A;  1KOU A;  1V9Y A;  3MQQ A;  1T1B A;  3VOL A;  4EEU A;  3G6O A;  3CLO A;  5HD5 A;  2Z6D A;  4WN5 A;  1TS0 A;  2W27 A;  2QJ7 A;  3UME A;  1OTA A;  4WL9 A;  4R3A A;  3K3D A;  3BWL A;  3LI9 A;  4GW9 A;  4RQ9 A;  4HP4 A;  4NXF A;  1T19 A;  3PYP A;  2D01 A;  4EEP A;  2HV1 A;  4BBV A;  4H6J A;  1Y28 A;  1ODV A;  3FC7 A;  3A0S A;  4KUO A;  2YKF A;  1EW0 A;  4LLO B;  4BBU A;  4JGR A;  1XFQ A;  2I9V A;  1TS6 A; 
#chains in the Genus database with same CATH topology
 2QHK A;  4GLQ A;  5E43 A;  1K54 C;  1NY0 A;  4OOL A;  1K4F A;  4WF0 A;  3UE6 A;  5CHJ A;  5AJG A;  4XT2 B;  4BLM A;  3T1Q B;  3NCK A;  1XPB A;  4OLG A;  2XFS A;  2HDU A;  2VA0 A;  5FAS A;  4GJ4 A;  4LCM A;  1T1C A;  3WRZ A;  2J9O A;  4ZAM A;  4P6B A;  2V1A A;  2VEA A;  5HWT A;  3NOU C;  4LEN A;  4YIN A;  3SS4 A;  3RXX A;  1XGJ A;  3UB8 A;  2J7V A;  3ICY A;  3LIC A;  1C3B A;  2W1T A;  4X55 A;  3T4S A;  3V3S A;  5EVI C;  1QME A;  4MBK A;  3KSH A;  3OPP A;  4DDY A;  1G6A A;  2WYX A;  2A49 A;  2I72 A;  3WRT A;  2A3U A;  2FZ0 A;  2H0Y A;  1VB6 A;  3LY4 A;  3MQO A;  5AQ9 A;  1DRM A;  3LCE A;  3CWF A;  4BBT A;  3E98 A;  3R7W B;  3RJU A;  1KDS A;  3W8K A;  3Q7V B;  4HIA A;  4F3L B;  4KZB A;  2ZC7 A;  3S7P A;  3BLM A;  4EES A;  4MMN A;  2PBY A;  5KSH A;  2JKT M;  3EOI A;  5FA7 A;  4WMC A;  3C30 A;  1NXY A;  4HY8 A;  4CLC A;  3QHY A;  2VGK A;  3O5Y A;  2FFY A;  2HJ9 C;  3P7N A;  4R3J A;  3UDX A;  1XJ3 A;  1ES4 A;  2KDK A;  4QHC A;  5DF7 A;  5E2G A;  3IBJ A;  2G2W A;  4EBP A;  1N9O A;  4NXB A;  2WZX A;  4E6W A;  2OSU A;  2UV0 E;  1I5Q A;  5EVI D;  2ZQA A;  3HLE A;  5FDS A;  4EUZ A;  2X01 A;  1KVM A;  3E0Y A;  2M7U A;  4OH0 A;  4XT2 A;  4I3J A;  4O8G A;  3C8C A;  5EUA A;  4RA7 A;  3DWK A;  4KZ9 A;  4PM8 A;  5HAP A;  1XKZ A;  1JVJ A;  4S2O A;  3UPO A;  2XF3 A;  3N6I A;  3S7Q A;  3VP1 A;  2INW A;  5AQ7 A;  3ZYT A;  4ARZ B;  1FR6 A;  2PYP A;  1KGG A;  2EWW A;  1ONH A;  2K7S A;  4DXC A;  3OCN A;  2JN7 A;  1G28 A;  3VOY A;  1F2K A;  5IU1 A;  5EPH A;  1VET B;  3MBZ A;  2OWH A;  4BL2 A;  2VK3 A;  3IF6 C;  4FTX A;  1T1A A;  3VP4 A;  4ZJ1 A;  1M40 A;  3ITA A;  4DE3 A;  1D06 A;  3Q07 A;  1YQS A;  1J9M A;  2ZM8 A;  3R7W A;  5HSQ A;  3Q7V A;  4MLL A;  4F3L A;  5FEF A;  4S2N A;  4ETX A;  3LR3 A;  3GR2 A;  4XUZ A;  2HDQ A;  2V9A A;  1GHI A;  3UDF A;  1YLP A;  5CEB A;  5HAI A;  3L7H A;  3LR4 A;  4RX3 A;  5J7E A;  4QY5 A;  3EQV A;  1G5U A;  2EXB A;  1DP9 A;  4R23 A;  4EER A;  2V2F F;  4P85 A;  2V20 A;  3BLS A;  4CPK A;  3I7J A;  2H0T A;  4HES A;  2ZQC A;  4UAA A;  1IKG A;  1F5M A;  4BEN A;  5CGW A;  3A3I A;  4B93 A;  4KUK A;  1K6S A;  2W0N A;  5IS1 A;  2EX9 A;  5L10 A;  3E2K A;  4RX2 A;  3G4P A;  3HUN A;  2P9V B;  3RFB A;  5DTK A;  3FKV A;  2DMW A;  3SH7 A;  2ZOH A;  5L8M A;  1UWN X;  4WMC D;  3HVF A;  3Q81 A;  3BY8 A;  4CLC D;  4YOF A;  4R1G A;  3LIB A;  4ESP A;  4G3V A;  5FAT A;  4EU0 A;  1S66 L;  5GLC A;  4ARZ A;  1EI5 A;  2WKH A;  3PAE A;  5HX9 A;  3EGD C;  4WEL A;  2DCF A;  2W3F A;  4IVK A;  5FQK A;  1BTL A;  1DJB A;  2QKP A;  3ZVW A;  3OBF A;  1VET A;  3T4Q A;  3QP1 A;  5FQM A;  2R9W A;  3IT9 A;  1MZU A;  4JXG A;  5CRF A;  1OJ5 A;  2K31 A;  4OPZ A;  2B95 A;  3FWL A;  3RH8 B;  5HL1 A;  3LUQ A;  4UA9 A;  2JKG A;  3H9W A;  1W63 Q;  1FSW A;  4WZ5 A;  5AQA A;  3D4F A;  3Q7Z A;  3SS5 A;  3DBA A;  3NHQ A;  5F6A A;  3MR0 A;  4Y7P A;  3ULF A;  3DWZ A;  2V0U A;  4BMW A;  1IEL A;  1MWT A;  3U2A A;  3ZQ5 A;  5E2E A;  2NUT C;  4IED A;  2M1C A;  4FSF A;  4II7 A;  1BLC A;  3O3V A;  4E3L A;  1MWS A;  3LI8 A;  1ESI A;  3SOI A;  4E04 A;  3K3C A;  4AFI A;  3IWI A;  3EQU A;  4ID4 A;  4JBF A;  4LCL A;  2CMN A;  4GS9 B;  3IHA A;  1WYB A;  4Y0U A;  1FOF A;  5J4E A;  2P9V A;  5FQ9 A;  4WBG A;  2W3E A;  2R78 A;  2L4R A;  3C7U A;  4QB8 A;  2EWV A;  2Y2N A;  1W7F A;  4Y15 A;  2EFX A;  1SHV A;  4E3O A;  1PZO A;  1YLY A;  1WA9 A;  4LRZ E;  2P7J A;  4OQG A;  1WE4 A;  3MQQ A;  3VOL A;  3MZE A;  3E2L A;  3PBS A;  3G6O A;  3NBL A;  3CLO A;  1N9B A;  3HUM A;  4MN7 A;  3ZGA B;  3NUL A;  3AGF A;  3UME A;  1ES3 A;  4R3A A;  1H5X A;  2QMI A;  3LI9 A;  4QY6 A;  3V39 A;  4R3B A;  4RQ9 A;  3CG5 A;  3W4P A;  4NXF A;  1T19 A;  4FD8 A;  4E3M A;  4ME4 A;  4KQQ A;  3UY6 A;  4JKT A;  4MCW A;  3UO9 A;  1FCM A;  4E3J A;  5EVI B;  1Y28 A;  2Q9M A;  1PW8 A;  1W79 A;  1W63 M;  4KUO A;  2WAE A;  4KZ7 A;  2Y8H A;  4S2J A;  1VHM A;  4OPY A;  3PXP A;  2D02 A;  3VSL A;  4L9F A;  4B4X A;  3B47 A;  1FQG A;  3MJQ A;  4U0X A;  2OAP 1;  1CEF A;  1VQQ A;  1JTG A;  2VGJ A;  5F69 A;  4M4X A;  4A5R A;  3ZG5 A;  1SDN A;  2WGV A;  4PM6 A;  3QP2 A;  4CJN A;  1O07 A;  3UDI A;  2OAQ 1;  2ZC6 B;  5FEG A;  3GVB A;  4ZRR A;  3VV4 A;  2L0W A;  3BEB A;  2VX8 A;  3IX3 A;  2ZC5 B;  2DRW A;  3B33 A;  3VFF A;  4KZ3 A;  4I3A A;  4MN5 A;  3OPL A;  3BFE A;  1CJF A;  2EX2 A;  2KOI A;  3A3E A;  4BQM A;  2XH9 A;  4X1L A;  1K25 A;  4GS9 A;  2OWJ A;  1NWZ A;  5L2F A;  4E6X A;  3OLO A;  1K57 A;  4HEF A;  4HI4 A;  4QPR A;  1YSP A;  3H7W B;  4JF5 A;  2W1R A;  4R70 A;  1MKI A;  5KZH A;  1L0E A;  3ZG9 B;  2ZMA A;  4U0T A;  5CTN A;  3AGD A;  2WK0 A;  4FOF A;  4GNU A;  4G3W A;  2W1T B;  1NRJ A;  3JVV A;  3PBQ A;  2WGI A;  2WKE A;  1XJ6 A;  3HBR A;  4UQI S;  3IS2 B;  2B02 A;  3SW1 A;  2GZA A;  1MWU A;  1W5D A;  2XD5 A;  2W3G A;  4JXV A;  2J3T D;  3FG8 A;  3CPT B;  2V1B A;  2ZMV A;  4I39 A;  4Y3I A;  1CI9 A;  2XA7 M;  5EVI A;  3QP8 A;  2WKR A;  3IF6 B;  2XA7 S;  1IOU A;  2Y2G A;  4N92 A;  4JXW A;  4OKP A;  3UE1 A;  3MXQ A;  3N8S A;  3MF0 A;  1T18 A;  5TR7 A;  1BT5 A;  4X25 A;  1S0W A;  3C2W A;  1AWI A;  2Y2O A;  5HAQ A;  1O7E A;  1K4E A;  2WAD A;  4H8R A;  2EX6 A;  5DJT A;  3M2K A;  2QJ5 A;  1S1Y A;  1NRF A;  4K0W A;  4K0X A;  3QNB A;  2Y2L A;  3CMZ A;  3SS3 A;  5FQI A;  3VFH A;  2ACG A;  2VV7 A;  1K6R A;  3EEA A;  5J8X A;  1AXB A;  4JGO A;  3OCL A;  1L0D A;  4PHT A;  3HL9 A;  1IFQ A;  1PI5 A;  3H7W A;  3LR5 A;  3NDE A;  1S1Z A;  3TSG A;  5HPF A;  1KVL A;  5M1A A;  3G2Y A;  5CHU A;  4IUH A;  3FKW A;  1OTB A;  4EBN A;  3G35 A;  2ZM2 A;  3LO7 A;  5F68 A;  3UMD A;  4BD0 A;  1KGF A;  5FI2 A;  3U4L P;  2HF6 A;  2V1Z A;  3P09 A;  2Q0O A;  4BD1 A;  3IS2 A;  3CI6 A;  4LPZ A;  3A3J A;  3ZCZ A;  3V67 A;  5HAR A;  4HBT A;  3F1N B;  2OOL A;  1OT6 A;  1LSX A;  3UB6 A;  2VKS A;  3CPT A;  2WGW B;  1LI9 A;  1ALQ A;  2IWB A;  1MWR A;  3PAG A;  2ZOI A;  4ZJ3 A;  4B9O A;  2JHE A;  2ZQ7 A;  3DAV A;  1TEM A;  3IF6 A;  1MY8 A;  3HJK A;  3TJZ C;  1FIK A;  1BUE A;  1JWV A;  2HJE A;  5FAP A;  2M7V A;  3ITB A;  1RCJ A;  3ZDJ A;  4JF6 A;  1LT0 A;  4DDS A;  2BTF P;  5CEC A;  3DW0 A;  4OOY A;  3GEC A;  1NJ4 A;  2VV6 A;  4ZDX A;  4K08 A;  3S1Y A;  3RXW A;  3G2Z A;  1KGE A;  2LB9 A;  4GB7 A;  1F9I A;  4PM5 A;  3IXH A;  1YKD A;  1BYW A;  2H10 A;  1BSG A;  4B4Z A;  4IJG A;  5GHY A;  3JVU A;  4WM9 A;  2H5S A;  1IYQ A;  3PBT A;  3D3O A;  3P01 A;  1TS8 A;  3FV7 A;  4BL3 A;  5GLD A;  5EEC A;  2XRO A;  1SDE A;  3TOI A;  3MXS A;  4M3K A;  5EFW A;  4Z9Q A;  1LI0 A;  3UE3 A;  5E2H A;  5J3W A;  5EVE A;  2BAS A;  1YMS A;  3FZC A;  2A2L A;  1KE3 A;  3CJM A;  4KQO A;  4H6J B;  4OON A;  3TW8 A;  4KG5 A;  4EQI A;  5KIZ A;  3UPP A;  4EW7 A;  2XK1 A;  5LBR A;  2WKQ A;  2Z2L B;  2JBF A;  4EXO A;  5DKL A;  4QJG A;  3F1N A;  3Q1F A;  2ZC4 B;  2K2N A;  4QWO A;  3NIA A;  2WGW A;  3OC2 A;  1XFN A;  4E3N A;  1YAX A;  3GDI A;  3CUE C;  3QP4 A;  4JF4 A;  3NC8 A;  1L0F A;  3WWX A;  1XXM A;  3ZG8 B;  3HLW A;  5FQQ A;  1OTD A;  1S4S A;  4FH4 A;  4DJ2 A;  3S4X A;  2O9A A;  2HDS A;  1LHY A;  5HWW A;  4KZ6 A;  1YSQ A;  3LIE A;  5CHM A;  3S22 A;  1HVB A;  1PYY A;  4PM9 A;  2PT7 A;  3UPN A;  4MN6 A;  3ZG7 B;  4LRX C;  1QMF A;  2FH5 A;  4OLD A;  3QNC A;  1H8M A;  1SCW A;  1CEG A;  5JYO A;  4I3I A;  3JPU A;  1KOU A;  1V9Y A;  5DTS A;  1K38 A;  4EEU A;  2KLI A;  3B3X A;  5AQB A;  5HD5 A;  3BFF A;  1BLP A;  2W27 A;  2XD1 A;  3CHW P;  3V5M A;  5G18 A;  1OTA A;  3BWL A;  3M6H A;  1YPR A;  2C5W B;  3T4K A;  1ZG6 A;  1NLZ A;  3C38 A;  1D1J A;  2D01 A;  3BEC A;  1PZP A;  3QP5 A;  4H6J A;  1I2W A;  1BUL A;  1GA0 A;  5FSR A;  3ZVT A;  2YKF A;  4C3Q A;  4JGR A;  3PR6 A;  3LY3 A;  1LSW A;  3W2Z A;  1IKI A;  1MC0 A;  1FIL A;  2WKI A;  5DTT A;  3E4O A;  3V3R A;  3EEH A;  4IBX A;  3VP3 A;  3WS1 A;  4P6Z M;  5M18 A;  5GHZ A;  1SKF A;  4P6Z S;  1RGZ A;  1JWP A;  4N1X A;  4K91 A;  4X68 A;  3D9Y A;  2PBD P;  1Y54 A;  2QPN A;  3UB9 A;  3IX4 A;  1P0Z A;  3HJI A;  4G3K A;  1BLS A;  1FSY A;  1MBL A;  3BYD A;  3UB7 A;  2HP9 A;  3AGE A;  2Z2M B;  3O86 A;  2Y2J A;  3HLC A;  4L9G A;  1IEM A;  3LEQ A;  4S2P A;  2XDM A;  3HLD A;  3LIF A;  3PBN A;  1W8Q A;  5CX7 A;  2XRN A;  4HOI A;  3RTY A;  4GDN A;  4S2L A;  1ZG4 A;  3IWO A;  5K5B A;  1ZHH B;  1CI8 A;  4Q0H A;  1PWD A;  3OZH A;  5TFQ A;  3Q82 A;  3GTC A;  4Q0I A;  1ERQ A;  2IWC A;  3ZFZ A;  5FL3 A;  1LLB A;  1Q2P A;  3V50 A;  4S2M A;  3GQZ A;  2Y91 A;  3LFV A;  2MJ6 A;  1LL9 A;  1OTE A;  2VJW A;  2H28 A;  2G7U A;  4WEK A;  4EBL A;  4OP8 A;  4N9K A;  3OPH A;  4HP9 A;  3BFC A;  5A91 A;  4Q0J A;  3MFD A;  4R4S A;  3D72 A;  4X1M A;  3MQ0 A;  4XUX A;  4EET B;  3MMH A;  5I5L A;  3T4J A;  4D2O A;  3W4O A;  3GRJ A;  1CQA A;  3VE3 A;  1NYY A;  1OME A;  1OTI A;  4LGW A;  1ACF A;  4WZ4 A;  1VEU B;  1JWZ A;  2HP6 A;  4HH2 A;  3VMA A;  1ONG A;  5M19 A;  3S7O A;  3TG9 A;  4C75 A;  3KX0 X;  2DNS A;  5EV0 A;  2QWS A;  5F5Y A;  3UNW A;  4X53 A;  1YMX A;  4R0Q A;  4DXB A;  2ZL1 B;  4OPQ A;  4NK3 A;  2WAF A;  1U60 A;  2Y2M A;  4KQR A;  4WLA A;  4FCF A;  2VZW A;  2PR6 A;  3UB5 P;  1L0G A;  5G4Y A;  5HPI A;  5CED A;  4HH3 A;  2BLS A;  2ZMF A;  1K54 A;  4KQD A;  2B18 A;  4Z1W A;  1GCE A;  1N9L A;  1A0K A;  4NG2 A;  3C7V A;  2PYR A;  4XXR A;  3DTM A;  4HHD A;  1P9R A;  4Y5F A;  3JYI A;  2RL3 A;  4UQI M;  3OPR A;  1M6K A;  2LB5 A;  1V9Z A;  4O01 A;  1MXO A;  4UEY A;  3NOT C;  3N8L A;  1E25 A;  1P97 A;  3K2N A;  1YLJ A;  2WUQ A;  3SH9 A;  3KSI A;  4L9E A;  4P87 A;  2W3H A;  3EGX C;  4IBR A;  1YLT A;  3FPV A;  3IQA A;  5EOE A;  3H82 B;  1K0K A;  4PAU A;  5DJU A;  4PPR A;  4N1H A;  2WKP A;  4KZA A;  3UN7 A;  4JPM A;  4HJ6 A;  2VGL M;  4D60 A;  2Y79 A;  1K56 A;  1X0O A;  4F94 A;  2HPB A;  5CGS A;  3SH8 A;  2X71 A;  2VGL S;  4L0L A;  4IUK A;  2A24 B;  1CK3 A;  3QP6 A;  1VEU A;  1UGU A;  3A3F A;  2EA9 A;  3MXR A;  4PKY A;  1DJA A;  2Y2P A;  5HD3 A;  4DRT A;  1CF0 A;  3KYE A;  5L07 A;  3A0V A;  4GD6 A;  1S4R A;  2J80 A;  1JNU A;  1K55 C;  4O7D A;  2CC1 A;  2ZL1 A;  3WS2 A;  3HUO A;  4MDZ A;  4NXG A;  4GOG A;  3W4Q A;  3R4K A;  1H0M A;  3PBO A;  5KMW A;  5L09 A;  1FCN A;  1E3U A;  2O9B A;  5CTM A;  3FPW A;  4QU3 A;  3IHB A;  1GHM A;  1TS7 A;  2ZJ9 A;  1H8Z A;  1MKM A;  2EXA A;  3BQA A;  1YM1 A;  4YFM A;  5GLA A;  2ZQ9 A;  5BOH A;  2PHY A;  4DE2 A;  3NJA A;  3BFD A;  3MKF A;  4Y0T A;  5FI7 A;  4GCZ A;  3BFG A;  3BQ8 A;  4RYE A;  5HDS A;  1DP6 A;  1GSV A;  4NXE A;  3H82 A;  1ES2 A;  1KE4 A;  4YWZ A;  3T50 A;  2Y59 A;  5I94 A;  5HZH A;  4Y0O A;  1RGY A;  3BJN A;  3ZNT A;  4LV2 A;  5FDH A;  3IF5 A;  4UA7 A;  2A24 A;  3DTK A;  4OQI A;  1T1B A;  1ESU A;  3CUE A;  5A92 A;  1OPX A;  2JCH A;  1FR1 A;  3IXB A;  4WN5 A;  5JYP A;  5EM1 A;  1G6O A;  4EWF A;  2C6W B;  2Q9N A;  1PIO A;  4WEJ A;  2O0Y A;  3K3D A;  2E8J A;  4GW9 A;  5TJJ A;  4MBH A;  1K56 D;  1IYS A;  4QD4 A;  4GN2 A;  2O9C A;  2G2U A;  2IA2 A;  1Z6F A;  2Y2H A;  2J9P A;  5D3O A;  1PNE A;  3FC7 A;  3KSG A;  3DTE A;  4PM7 A;  2O99 A;  1XFQ A;  1RP5 A;  1H3Q A;  1Y4O A;  3CIT A;  1PFL A;  2B5R A;  4UA6 A;  3EWK A;  3T1R A;  1TF1 A;  1L2S A;  4NKP A;  2QYB A;  5GLB A;  1D7E A;  3HLF A;  5DF9 A;  4E3I A;  2J3W A;  4HJ3 A;  4DN0 A;  3C4P A;  5C5K A;  3ISG A;  3T4T A;  1Z09 A;  3VP0 A;  1E3U D;  3WS0 A;  4Y2F A;  1XJ2 A;  2GNX A;  2PU4 A;  5EE8 A;  3T1S A;  2OLV A;  4ZJ2 A;  5A8B A;  1OT9 A;  4ZTK A;  1ES5 A;  2JC7 A;  4R38 A;  5AVF A;  4R6L A;  1YT4 A;  3NEC A;  4PMA A;  4DKI A;  1YLZ A;  1N9N A;  1ERM A;  4CLC C;  4RVA A;  2R9X A;  4PKY G;  2PR5 A;  5F1F A;  5GL9 A;  1PW1 A;  4WYY A;  4I5S A;  2RCX A;  4HJ4 A;  2L1M A;  2GX5 A;  1WYC A;  4UHU A;  4JGQ A;  1GSX A;  5EM0 A;  3KYZ A;  3LID A;  1W8Y A;  3T12 B;  4JLF A;  3A3D A;  4EV4 A;  4LV1 A;  4R4R A;  5F82 A;  3LR0 A;  5AVE A;  3MKE A;  5E2F A;  3KSF A;  2YKH A;  4DE1 A;  1SKO B;  2QZ6 A;  1OJG A;  4Y13 A;  3LEZ A;  3F1O B;  4NET A;  5HW3 A;  2HP5 A;  2HZ5 A;  4X69 A;  5FQJ A;  2XFT A;  4YNR A;  5IT5 A;  2ZQ8 A;  5TGF A;  4EUV A;  3NY4 A;  1HTZ A;  2PRF A;  3MSH A;  3VOZ A;  3IX8 A;  4BJP A;  2OV5 A;  1PWG A;  2JKT I;  1DP8 A;  1S67 L;  2PAV P;  4S2N C;  3LYX A;  4MEZ A;  3G31 A;  3IXG A;  4JXS A;  5EOO A;  5HFO A;  1L3L A;  2VLG A;  4IHQ A;  1XA7 A;  4CLC E;  5CGX A;  5DFX A;  4GD8 A;  4I38 A;  1MPL A;  4OQH A;  3ZG0 A;  3HLB A;  1XGI A;  3MZD A;  1E4D A;  1NYM A;  1SZV A;  4GZB A;  3CZD A;  2Y2K A;  5TBM B;  4LV0 A;  1IYP A;  4EQ1 A;  2P08 A;  4P0M A;  2E8I A;  3BY9 A;  4C6Y A;  4LFU A;  2Y2I A;  4DF6 A;  2Y2Q A;  3IH9 A;  3GSG A;  5DVA A;  3F1P B;  1ZC2 A;  5A90 A;  4FUW A;  3OOV A;  5DKK A;  2ZC3 B;  2OLU A;  1NZO A;  3HLG A;  3S7N A;  4X56 A;  2XR0 A;  1JTD A;  2AVX A;  4KZ8 A;  2V8C A;  1LSV A;  4MBF A;  3VSK A;  4GHI B;  3SZT A;  4B88 A;  1SKO A;  4HNB A;  4Y17 A;  1ZTU A;  3N7W A;  1UWP X;  1I2S A;  2ZD8 A;  3NDG A;  3F1O A;  4KZ5 A;  4KG6 A;  2V0W A;  3ZNY A;  1YLW A;  1PRQ A;  3IH8 A;  2J8Y A;  2ZM0 A;  3C5A A;  3PHY A;  2JE5 A;  4KEN B;  5G4Z A;  1BZA A;  2JKR M;  4NEE D;  4DE0 A;  4LRY C;  5F83 A;  1XP4 A;  5CXW A;  2W3D A;  2PDR A;  2KX6 A;  4FH2 A;  3E4P A;  1GA9 A;  4GKU A;  5FAQ A;  5MC7 A;  1TVF A;  1N4O A;  2P74 A;  3FYZ A;  4WZ5 C;  4OVD A;  5FAO A;  5A93 A;  2X02 A;  4X6T A;  3A0R A;  4ETZ A;  2NUP C;  5KSC A;  2HDR A;  5HDC A;  3KYQ A;  1LL8 A;  5DF8 A;  3MS6 A;  4E3K A;  3GV9 A;  3BM6 A;  1DJC A;  3M6B A;  4N9L A;  1DY6 A;  4DMZ A;  1IYO A;  1KE0 A;  2JKF A;  3TE8 A;  5TBM A;  1HD8 A;  1NLY A;  3T1X A;  4HQA A;  4JGP A;  2Z6C A;  2FFF B;  3G30 A;  3T4L A;  3LGO A;  2Y55 A;  4U3T A;  1KDW A;  3F1P A;  3VP2 A;  4S2I A;  3CAX A;  1FCO A;  3E4Q A;  3NOP C;  5HL6 A;  4GDB A;  5HWV A;  5GHX A;  3M2J A;  2XEP A;  5CER A;  3VE4 A;  3L9K A;  2J3T C;  4Q8I A;  1GSW A;  1XJ4 A;  3MZF A;  4GHI A;  1LL5 A;  2PU2 A;  2XQZ A;  1F98 A;  2IWD A;  3NI9 A;  4KG2 A;  2GJ3 A;  1J3W A;  2Y4A A;  3B42 A;  3PTE A;  2ZBB A;  2PD8 A;  2GDN A;  3IXD A;  2P04 A;  4ZBE A;  4BWI A;  3UE0 A;  1K55 A;  2BG1 A;  4DJ3 A;  3N8R A;  3C4O A;  1PWC A;  2PD7 A;  1HLU P;  3G34 A;  3T4O A;  2EFU A;  3LIA A;  4WUJ A;  2XSS A;  3HRE A;  3P98 A;  1TD5 A;  3MFX A;  4MNR A;  1STZ A;  5EVL A;  4OQ0 A;  4CQH A;  1TDG A;  3KO6 A;  1ERO A;  3GMW A;  5IHV A;  3IBR A;  2VV8 A;  3G32 A;  4OP5 A;  2ZQD A;  1H8Y A;  3O87 A;  5HDD A;  1PI4 A;  1Q2Q A;  4KZ4 A;  4LV3 A;  2ZLY A;  2V8F A;  3ZHH A;  1XX2 A;  2XLN A;  4HBU A;  3HCY A;  5U47 A;  3DTI A;  4OPR A;  2Z6D A;  3IWQ A;  1HZO A;  1EWZ A;  1VM1 A;  3PBR A;  2WZZ A;  4OOM A;  1TS0 A;  2UWX A;  1XA1 A;  2QJ7 A;  3N4I A;  4WL9 A;  1TDL A;  1ZKJ A;  3O88 A;  5FI6 A;  3TRC A;  4HP4 A;  3BRM A;  1G68 A;  3BW6 A;  5DFY A;  1BLH A;  5F1G A;  3PYP A;  4EEP A;  2JKR I;  1S6R A;  1P9W A;  4IVI A;  1NZU A;  2HV1 A;  4BBV A;  2XGN A;  4CLC B;  2EX8 A;  1ODV A;  1K57 C;  1GHP A;  3A0S A;  2HGV A;  4S2K A;  3WS4 A;  1EW0 A;  4LLO B;  4BBU A;  3WS5 A;  4O0P A;  2I9V A;  1TS6 A; 
#chains in the Genus database with same CATH homology
 3PXP A;  2D02 A;  1LSW A;  4L9F A;  3W2Z A;  2QHK A;  3B47 A;  4GLQ A;  3MJQ A;  1H3Q A;  1MC0 A;  3CIT A;  2OAP 1;  4OOL A;  3EWK A;  5F69 A;  1TF1 A;  4WF0 A;  3UE6 A;  4M4X A;  5AJG A;  4XT2 B;  3E4O A;  3EEH A;  4NKP A;  4P6Z M;  2QYB A;  1D7E A;  5DF9 A;  4P6Z S;  2OAQ 1;  2VA0 A;  4GJ4 A;  3PR6 A;  2J3W A;  4HJ3 A;  4DN0 A;  4ZRR A;  5C5K A;  3VV4 A;  2L0W A;  3T4T A;  1T1C A;  2VX8 A;  4Y2F A;  1XJ2 A;  2GNX A;  3B33 A;  2V1A A;  4I3A A;  2VEA A;  4MN5 A;  5A8B A;  2KOI A;  5HWT A;  1OT9 A;  3NOU C;  4R38 A;  4GS9 A;  2OWJ A;  3UB9 A;  5AVF A;  1P0Z A;  3HJI A;  4G3K A;  3ICY A;  3LIC A;  1NWZ A;  4R6L A;  3UB8 A;  3OLO A;  1N9N A;  2W1T A;  4HI4 A;  3T4S A;  4QPR A;  3UB7 A;  4CLC C;  1YSP A;  3H7W B;  2W1R A;  4PKY G;  2PR5 A;  4R70 A;  3KSH A;  4I5S A;  2FZ0 A;  4L9G A;  1VB6 A;  3MQO A;  4HJ4 A;  2L1M A;  4FOF A;  4G3W A;  2W1T B;  2GX5 A;  1DRM A;  1NRJ A;  3CWF A;  3JVV A;  4BBT A;  4JGQ A;  1GSX A;  3PBQ A;  3LIF A;  3E98 A;  3PBN A;  3R7W B;  5CX7 A;  1XJ6 A;  2XRN A;  4HOI A;  3RTY A;  4HIA A;  4F3L B;  4UQI S;  3S7P A;  3IS2 B;  3KYZ A;  5K5B A;  2B02 A;  3SW1 A;  3LID A;  1ZHH B;  2GZA A;  4Q0H A;  4EES A;  3LR0 A;  5AVE A;  4Q0I A;  4MMN A;  2W3G A;  5FL3 A;  3KSF A;  2YKH A;  5KSH A;  2J3T D;  2JKT M;  3EOI A;  3FG8 A;  2V1B A;  2ZMV A;  4I39 A;  1OJG A;  4Y3I A;  3LFV A;  2MJ6 A;  3C30 A;  1OTE A;  2VJW A;  3F1O B;  4HY8 A;  4CLC A;  3O5Y A;  2HJ9 C;  2XA7 M;  3P7N A;  2H28 A;  1XJ3 A;  2WKR A;  2G7U A;  4O0P A;  2XA7 S;  2KDK A;  4WEK A;  1IOU A;  4YNR A;  3IBJ A;  5IT5 A;  1N9O A;  4NXB A;  3MXQ A;  4EUV A;  3MF0 A;  1T18 A;  3C2W A;  4HP9 A;  4Q0J A;  3D72 A;  3E0Y A;  5DJT A;  4XT2 A;  2M7U A;  4BJP A;  2QJ5 A;  4JGR A;  4I3J A;  1S1Y A;  4O8G A;  2JKT I;  3C8C A;  1DP8 A;  3MQ0 A;  1S67 L;  4EET B;  3MMH A;  5I5L A;  3T4J A;  3LYX A;  3VE3 A;  2VV7 A;  1OTI A;  2VLG A;  4IHQ A;  3S7Q A;  3EEA A;  4CLC E;  5DFX A;  2INW A;  3ZYT A;  4HH2 A;  4ARZ B;  4I38 A;  2PYP A;  4JGO A;  2EWW A;  3OCL A;  2K7S A;  3OCN A;  3S7O A;  2JN7 A;  4PHT A;  1G28 A;  5IU1 A;  3KX0 X;  1IFQ A;  3H7W A;  2QWS A;  5F5Y A;  3LR5 A;  1S1Z A;  2OWH A;  5HPF A;  5TBM B;  4IUH A;  1T1A A;  4EQ1 A;  2P08 A;  1OTB A;  3BY9 A;  3UMD A;  4WLA A;  5F68 A;  1D06 A;  2VZW A;  3F1P B;  2HF6 A;  2PR6 A;  3R7W A;  5G4Y A;  3OOV A;  5HPI A;  5HSQ A;  5DKK A;  4F3L A;  4HH3 A;  4ETX A;  3IS2 A;  2ZMF A;  3LR3 A;  3CI6 A;  4KQD A;  2B18 A;  4Z1W A;  2V9A A;  4LPZ A;  1N9L A;  3S7N A;  3V67 A;  2PYR A;  3F1N B;  2OOL A;  1OT6 A;  4HHD A;  1LSV A;  1P9R A;  1LSX A;  3LR4 A;  4GHI B;  4Y5F A;  3UB6 A;  5J7E A;  2VKS A;  4UQI M;  3EQV A;  4HNB A;  1ZTU A;  2LB5 A;  1V9Z A;  1UWP X;  4O01 A;  2ZOI A;  4UEY A;  3F1O A;  3NOT C;  1DP9 A;  4B9O A;  2V0W A;  4EER A;  2JHE A;  1P97 A;  3HJK A;  3K2N A;  3TJZ C;  3PHY A;  1F5M A;  3KSI A;  4L9E A;  2W3H A;  3EGX C;  2HJE A;  5G4Z A;  2JKR M;  4NEE D;  3FPV A;  2M7V A;  4B93 A;  4LRY C;  4KUK A;  2W0N A;  3H82 B;  2W3D A;  1LT0 A;  5IS1 A;  4PAU A;  5DJU A;  2PDR A;  2KX6 A;  2WKP A;  3E4P A;  5MC7 A;  3RFB A;  2DMW A;  4HJ6 A;  2VGL M;  2ZOH A;  2Y79 A;  5L8M A;  1UWN X;  3GEC A;  1X0O A;  2VV6 A;  2VGL S;  4K08 A;  4L0L A;  3BY8 A;  4CLC D;  4IUK A;  2LB9 A;  4YOF A;  3A0R A;  4ETZ A;  2A24 B;  3LIB A;  2NUP C;  1F9I A;  4G3V A;  4EU0 A;  1S66 L;  5HDC A;  3KYQ A;  1LL8 A;  1UGU A;  1YKD A;  1BYW A;  2EA9 A;  4PKY A;  4ARZ A;  5HD3 A;  4IJG A;  3EGD C;  4WEL A;  2W3F A;  3A0V A;  1S4R A;  2QKP A;  3JVU A;  4DMZ A;  3OBF A;  2J80 A;  3T4Q A;  3TE8 A;  5TBM A;  3PBT A;  1JNU A;  3D3O A;  3P01 A;  1NLY A;  1MZU A;  1TS8 A;  2XRO A;  4HQA A;  4JGP A;  1OJ5 A;  2K31 A;  4MDZ A;  2Z6C A;  3T4L A;  3RH8 B;  5EFW A;  3LUQ A;  4NXG A;  3H9W A;  3R4K A;  1W63 Q;  3UE3 A;  5J3W A;  3F1P A;  2BAS A;  2A2L A;  3CAX A;  3PBO A;  4H6J B;  4KQO A;  3TW8 A;  5KIZ A;  3E4Q A;  2O9B A;  3NOP C;  5HL6 A;  5HWV A;  3FPW A;  4EW7 A;  5LBR A;  2WKQ A;  3DBA A;  3NHQ A;  5F6A A;  1TS7 A;  3VE4 A;  4EXO A;  1MKM A;  2J3T C;  5DKL A;  1GSW A;  1XJ4 A;  3F1N A;  3MR0 A;  3BQA A;  3ULF A;  2K2N A;  2V0U A;  4GHI A;  4BMW A;  1F98 A;  3OC2 A;  1XFN A;  2PHY A;  3NJA A;  1YAX A;  3GDI A;  2GJ3 A;  3U2A A;  3ZQ5 A;  2NUT C;  3B42 A;  3CUE C;  2M1C A;  2ZBB A;  2PD8 A;  2P04 A;  4FSF A;  4BWI A;  4II7 A;  4DJ3 A;  2PD7 A;  4GCZ A;  3T4O A;  3LI8 A;  3BQ8 A;  1OTD A;  1S4S A;  4E04 A;  3K3C A;  3LIA A;  4AFI A;  4WUJ A;  4DJ2 A;  2XSS A;  2O9A A;  3EQU A;  1TD5 A;  3MFX A;  5HDS A;  1DP6 A;  1GSV A;  5HWW A;  1STZ A;  4NXE A;  3H82 A;  2CMN A;  4CQH A;  4GS9 B;  4YWZ A;  3KO6 A;  3T50 A;  1YSQ A;  3LIE A;  5HZH A;  3IBR A;  2VV8 A;  5J4E A;  2PT7 A;  4MN6 A;  4LRX C;  2FH5 A;  2W3E A;  3BJN A;  2R78 A;  2L4R A;  2EWV A;  1H8M A;  5HDD A;  2A24 A;  1WA9 A;  4LRZ E;  2P7J A;  4I3I A;  1KOU A;  1V9Y A;  3MQQ A;  1T1B A;  3VOL A;  4EEU A;  2KLI A;  3CUE A;  1OPX A;  3PBS A;  3G6O A;  3HCY A;  3CLO A;  5HD5 A;  2Z6D A;  4WN5 A;  3PBR A;  4OOM A;  4MN7 A;  1G6O A;  1TS0 A;  2W27 A;  2QJ7 A;  3UME A;  4WEJ A;  1OTA A;  2O0Y A;  4WL9 A;  4R3A A;  3K3D A;  3BWL A;  3LI9 A;  4GW9 A;  5TJJ A;  4RQ9 A;  3TRC A;  4HP4 A;  3BW6 A;  5DFY A;  3T4K A;  2O9C A;  4NXF A;  1T19 A;  1NLZ A;  3C38 A;  3PYP A;  2D01 A;  4EEP A;  2JKR I;  2IA2 A;  1P9W A;  2HV1 A;  4ME4 A;  4BBV A;  4H6J A;  4CLC B;  4MCW A;  1Y28 A;  1ODV A;  3FC7 A;  1W63 M;  3A0S A;  2HGV A;  4KUO A;  2YKF A;  3KSG A;  1EW0 A;  4LLO B;  2Y8H A;  4BBU A;  1VHM A;  2O99 A;  1XFQ A;  2I9V A;  1TS6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...