3VE4A

Structures of ict and pr1 intermediates from time-resolved laue crystallography
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
publication title Volume-conserving trans-cis isomerization pathways in photoactive yellow protein visualized by picosecond X-ray crystallography
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Luminescent protein
total genus 39
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2012-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3ve4A00
2PD7A 5DJTA 2D01A 2R78A 4BBTA 5HWWA 3LYXA 1VB6A 4HJ4A 3OLOA 4EESA 4H6JA 2ZOHA 3IS2A 2ZBBA 3MR0A 4GW9A 5HDDA 4I3AA 3GECA 1OTDA 4E04A 4R38A 2WKRA 4F3LA 3F1OB 1T1AA 1XFNA 2YKHA 5TBMA 1OJ5A 1Y28A 2V9AA 3MXQA 2PR6A 1GSXA 1GSWA 5J7EA 2QJ7A 3LIBA 1D7EA 2D02A 3PYPA 4I5SA 1JNUA 3ZQ5A 3GDIA 3F1PB 2OWHA 4GHIB 1S66L 4JGRA 4MN6A 4XT2B 3F1NB 1T19A 4PKYG 1OJGA 3LICA 2VV6A 2KDKA 3H7WA 2VLGA 3C8CA 4GS9B 4HI4A 1XJ6A 4HP9A 4KQDA 3EWKA 5HSQA 5J4EA 4GCZA 2J80A 3ICYA 4HIAA 5HD5A 5AVFA 1LSXA 1S4RA 1X0OA 3NOTC 3H82B 2JN7A 4LRXC 1N9LA 4YWZA 1TS0A 4JGQA 4EW7A 1T1CA 1MZUA 3LIEA 5AVEA 4I3JA 3VOLA 1V9ZA 4EERA 4K08A 1NWZA 3K3CA 1D06A 2PR5A 4NXBA 4HOIA 3EEHA 4WN5A 4KUKA 5DJUA 1LL8A 4HHDA 1OTAA 4GHIA 2OWJA 3A0SA 2V0UA 4HJ6A 3VE4A 5HZHA 4XT2A 2QKPA 2BASA 3UMEA 2V1AA 1OTEA 1P0ZA 1OT6A 3F1NA 4HH2A 5A8BA 4RQ9A 2K7SA 1GSVA 2L4RA 3LI8A 4LPZA 2QJ5A 1TS7A 4EETB 4MN5A 4M4XA 3G6OA 4WF0A 4L9FA 4WUJA 3P7NA 4R70A 5IU1A 2JHEA 5I5LA 4B9OA 1XJ3A 2INWA 3B33A 4DJ3A 1BYWA 1S4SA 2PHYA 2V1BA 4EEPA 2EA9A 4EQ1A 2QHKA 4EXOA 3E4QA 5J3WA 2CMNA 1S1YA 3BY8A 5F5YA 2WKPA 3RH8B 3K3DA 4HNBA 4NXEA 1T18A 4H6JB 3UE6A 3NHQA 5F69A 2W27A 3UB6A 4HJ3A 1S67L 1UWPX 1OT9A 1S1ZA 1XFQA 4HP4A 2L0WA 3LIDA 1TS8A 5F68A 5HWVA 2A24B 3F1OA 1KOUA 5HDCA 5HDSA 5G4YA 5KIZA 1N9OA 3VE3A 4HQAA 3LIFA 4L9EA 2PYRA 3IBRA 4LRZE 2HV1A 5F6AA 5EFWA 2YKFA 3F1PA 2I9VA 3T50A 3LI9A 3E4OA 3UB7A 4BBVA 3MJQA 3NJAA 2QWSA 2PD8A 1UGUA 2VV7A 3A0RA 5HWTA 4I38A 1ODVA 1T1BA 1LSWA 4GS9A 4LLOB 4R6LA 3HJIA 2Z6DA 3CAXA 3NOUC 2VEAA 1DP6A 4I39A 3D72A 3SW1A 2H28A 4LRYC 4HY8A 1EW0A 2KX6A 3MQOA 3NOPC 1TS6A 2PYPA 1DP9A 4KUOA 4L9GA 1OTBA 2A24A 3H82A 1V9YA 1LT0A 3E4PA 3C2WA 3HJKA 2WKQA 2GJ3A 1LSVA 5IS1A 5HD3A 2V0WA 2P7JA 1G28A 4DJ2A 1N9NA 2VV8A 2OOLA 3CWFA 1F98A 3IS2B 1XJ4A 4EEUA 4BBUA 2B02A 4F3LB 3BY9A 3MQQA 1P97A 2M1CA 4NXFA 5TBMB 3RTYA 5DKKA 3UMDA 3FG8A 1WA9A 3LIAA 3LUQA 3UB8A 4JGPA 5G4ZA 2PDRA 4NXGA 3KX0X 3MFXA 5DKLA 1OTIA 2ZOIA 3BWLA 3CLOA 2W0NA 1F9IA 4HH3A 4WL9A 3A0VA 4I3IA 1XJ2A 3FC7A 3UB9A 2L1MA 1DP8A 2Z6CA 1UWNX 1DRMA 4PKYA 4R3AA 3H7WB 4WLAA 3H9WA 3PHYA 3ULFA 4JGOA
chains in the Genus database with same CATH superfamily
2BLSA 4U0XA 4O0PA 4ESPA 3WWXA 2R78A 4BBTA 5HWWA 1ZHHB 4EESA 1BZAA 5L10A 3OZHA 4Y7PA 2JKRM 3G30A 4GD6A 5HARA 5HDDA 1PRQA 3U2AA 3G2YA 3MQ0A 4RX2A 4F3LA 4C3QA 3BFGA 2YKHA 1TD5A 3QP5A 4UHUA 3W4PA 2V9AA 3Q7VA 1S0WA 3CG5A 1F5MA 4R23A 3A3FA 5EV0A 5J7EA 1DY6A 2VK3A 1BUEA 5HPIA 1K54A 3ZHHA 2V8FA 5EVID 1DJBA 2X71A 3MXSA 4BQMA 2P04A 2HZ5A 4NEED 4BENA 4GOGA 1S66L 1K38A 3QP8A 4X69A 4PM8A 4EBLA 3IF5A 4PKYG 1CI8A 1F2KA 4O01A 4Y0OA 1XGIA 2KDKA 2VLGA 3QNBA 1S6RA 3C8CA 4GS9B 2Z2LB 4MBKA 4KZ6A 4DE0A 4HP9A 3O5YA 3VP1A 3P09A 2P74A 1JTDA 2J80A 4OOMA 5EPHA 3T4LA 3DTIA 1O7EA 1LSXA 4ZDXA 3OPLA 4KG2A 3UDIA 3NOTC 4BD1A 2XFSA 1AXBA 1N9LA 2Y2QA 3VSLA 3BFCA 1TS0A 3A3JA 4EW7A 3ITAA 2DNSA 1BLCA 3WS2A 4MLLA 4I3JA 1V9ZA 2JKGA 4OLDA 2H10A 4OH0A 2ZL1A 3ZNYA 3K3CA 2PR5A 2JKTM 5TFQA 3ZFZA 3W8KA 3OPRA 1LL8A 3ISGA 4GHIA 3UY6A 2V0UA 4OOYA 2BASA 2JKFA 3NCKA 1OTEA 2PU4A 1BLPA 1YKDA 1OT6A 4HH2A 3N8LA 4ZJ2A 2K7SA 1GSVA 3LI8A 4IUHA 4FD8A 4N1XA 3Q82A 4ZTKA 4LPZA 1K55A 1TS7A 4EETB 3RFBA 2XLNA 2XGNA 3OPHA 3IQAA 5K5BA 4L9FA 3WRZA 4R70A 5DTTA 3OCNA 3GTCA 2EWVA 5IU1A 3MFDA 5A91A 1MKIA 5TGFA 4CJNA 2J3WA 5CHMA 4R3BA 4UAAA 3NC8A 4B9OA 3GMWA 2KOIA 4MCWA 1K56D 5GHZA 1O07A 1JWZA 1MWRA 4EXOA 5U47A 2X02A 2CMNA 1MWUA 4GLQA 2QMIA 2B18A 3RH8B 2GNXA 4DE2A 3S7OA 2ZQDA 2XR0A 3UE6A 3NULA 3FV7A 1KE0A 5F69A 3GVBA 1W63M 4S2IA 2W27A 1CK3A 2AVXA 4HJ3A 4QWOA 2J3TC 1S67L 1UWPX 4Q0HA 3S7PA 3IT9A 2ZM0A 3JVUA 5IHVA 1TS8A 5F68A 5FQ9A 3M2JA 3ZG7B 4MDZA 1KGEA 1BLSA 2JE5A 1TF1A 2A24B 2PBYA 3M6HA 3L9KA 1N9BA 3F1OA 3G32A 3SS4A 1G68A 4U0TA 4MBHA 5L09A 4LV0A 2VJWA 3LO7A 5G18A 4DDYA 2HV1A 2OLUA 3BLMA 3S7QA 3IHAA 4JBFA 5F6AA 3D9YA 2YKFA 2H5SA 2I9VA 3T50A 3LI9A 3E4OA 3FKWA 4DRTA 3UB7A 4KZ5A 1NRFA 1ZTUA 4G3KA 1CJFA 1RP5A 4PHTA 1YAXA 3V3RA 4DN0A 3A0RA 4LCMA 1ODVA 1QMEA 1T1BA 4LLOB 4OPYA 3RXXA 5CEBA 3HJIA 2Y2NA 2P08A 2PBDP 2HP5A 3WS1A 5J8XA 1IFQA 4S2MA 2NUPC 1K4FA 1NLYA 2IA2A 2VGKA 4GZBA 4HY8A 3IXBA 5E2HA 1EW0A 3HLEA 3C7UA 4ETZA 1FSWA 1TS6A 2PYPA 4R4SA 4P85A 2LB5A 2HGVA 3FKVA 1OTBA 3H82A 4P6ZM 4JF4A 4Q0JA 2WKIA 3LEQA 4Y3IA 1N4OA 3NDEA 2W3GA 3HLFA 1Q2PA 1ZG6A 4HBUA 4KZ7A 2FH5A 4CLCA 1FCMA 2VV8A 3CWFA 1W8QA 4E3OA 1XPBA 5TJJA 3MMHA 4Z1WA 5CTMA 3T4TA 4ZBEA 3NBLA 1CF0A 2B02A 3NECA 2V20A 3ZYTA 1P97A 1W5DA 2EX6A 3DWZA 5TBMB 1TDGA 3UMDA 2V1ZA 5CGWA 4DF6A 3AGDA 2PDRA 4NXGA 5GHYA 4K0XA 3HLCA 3T1QB 5DKLA 3ZG5A 2ZOIA 3BWLA 3HUOA 2HPBA 2W0NA 4BLMA 3FPWA 2LB9A 3S4XA 1I2WA 1STZA 1ERMA 2ZQ9A 1K57A 3HLDA 4EWFA 2ZC5B 3PTEA 1D1JA 1IKGA 3S22A 4E3MA 2G2WA 3HLWA 3O86A 3PBSA 4O7DA 3CITA 4E3KA 2D01A 4O8GA 1VB6A 4HJ4A 3OLOA 1FIKA 1W63Q 3BYDA 2H0YA 3B42A 4P6ZS 3ZG0A 3EOIA 3GECA 4BWIA 1HZOA 3UPNA 1OTDA 2I72A 4QJGA 2WKRA 1C3BA 1XFNA 1RGYA 3MXQA 5DF7A 3W2ZA 3WS5A 3M2KA 1ES5A 5AQBA 3T4SA 2XROA 3LCEA 1MPLA 3V50A 3ZQ5A 2Y91A 3ZG9B 1KDSA 1L0DA 1FQGA 4NETA 2W1TA 3HREA 2XEPA 5FAPA 1KVMA 1H8MA 4MN6A 3TE8A 1E4DA 4ZJ3A 3UE0A 1YMSA 1XXMA 1PWGA 2WGWA 1MWSA 4E3IA 1XX2A 5DF9A 2IWDA 1VEUA 2Q9NA 5JYPA 3DTKA 4PM7A 2OLVA 5FEFA 5J4EA 3HL9A 4GCZA 3ICYA 3W4OA 3KYQA 5AVFA 1YSPA 2ZC4B 3RXWA 1YLPA 3DTMA 2J8YA 1NY0A 3VOYA 1S4RA 5BOHA 1X0OA 2W3EA 3IF6C 4XUZA 3PAGA 1JWVA 4MMNA 4YWZA 4YINA 1LHYA 4N9KA 5EE8A 2ZLYA 4ARZB 2QYBA 1MZUA 2ZQAA 4KQQA 4BJPA 3CPTB 2WK0A 2DCFA 3OCLA 3EEAA 2WGIA 1K56A 2VGJA 4CLCE 5I94A 4Y15A 3TSGA 4G3WA 3T4QA 2WADA 3BEBA 3IXGA 5FI2A 4X68A 4ZAMA 3SH9A 3IX3A 1D06A 2O0YA 3EEHA 3UE3A 4GJ4A 3K2NA 1SDNA 1OTAA 4ME4A 3T4JA 3VE4A 2QKPA 2XD5A 2V1AA 4JLFA 2O99A 2PAVP 5A8BA 3VMAA 4RQ9A 1I2SA 4FCFA 2L4RA 3DTEA 3C5AA 3ITBA 4KZAA 3UDXA 1HD8A 5GLAA 4IHQA 2KLIA 3V3SA 3UPOA 4MN5A 4M4XA 4WF0A 3SS3A 3P7NA 3LR3A 2V8CA 2JHEA 2JC7A 1CEFA 5KSHA 1XJ3A 4K91A 3VP2A 1S4SA 2V1BA 4EEPA 2EA9A 4Y17A 3T12B 2QHKA 1GCEA 5HPFA 1IYSA 3LEZA 3OPPA 3MZEA 4IUKA 5F5YA 1HTZA 3C4PA 2WAEA 3K3DA 4HNBA 1IELA 2EX2A 5F1FA 1Q2QA 3QP6A 3GRJA 3CI6A 2UWXA 3ZVWA 1CI9A 2ZC7A 4OLGA 3AGFA 3P01A 1OT9A 3PBTA 2K31A 1DJCA 2Y59A 1YPRA 3OC2A 3DBAA 1L3LA 1YMXA 1YLZA 5HWVA 4EUVA 4YFMA 2Y55A 5TR7A 1KOUA 2HDUA 2J9PA 2HDSA 2RCXA 3MSHA 3RJUA 3BFEA 1JTGA 2Q0OA 4ETXA 1K6SA 4IBRA 3CUEA 4E3NA 1XP4A 2PYRA 4LRZE 2O9CA 5DFYA 3HCYA 5CGSA 5GHXA 3UPPA 3F1PA 2DRWA 4R0QA 2ZC6B 1KGGA 1LL5A 1EWZA 4BBVA 2XFTA 4XUXA 4WZ4A 2P9VB 3MJQA 1KE4A 1BSGA 5E2GA 2Y2MA 4GN2A 3BW6A 3LR4A 4KG6A 2QWSA 2G2UA 4LV2A 4OQGA 1UGUA 5CECA 3PBOA 2K2NA 3KYEA 3T1XA 4QY6A 3UN7A 5KMWA 4JXGA 4R6LA 2ZC3B 2Z6DA 4A5RA 4QHCA 3C7VA 4OONA 4UEYA 5L8MA 3W4QA 2QZ6A 3N4IA 1ZG4A 4EBPA 3MQOA 3LFVA 5DF8A 5F1GA 2PU2A 4BL3A 3HUMA 3IWQA 2A24A 3LGOA 4E3LA 1YLYA 2Y2IA 5M18A 3E4PA 3C2WA 4S2NA 4K0WA 3P98A 3MXRA 5L07A 5GL9A 2WAFA 4IBXA 1E3UA 5IS1A 5HD3A 2V0WA 1IYPA 2WGVA 1N9NA 3IS2B 4NKPA 2ZM2A 4OP5A 1XJ4A 4HEFA 2Y2KA 1P9WA 5FQKA 5A92A 3R7WB 3BY9A 2VGLM 4U3TA 5FA7A 3UNWA 3RTYA 1NXYA 3FG8A 1WA9A 3LIAA 2R9WA 3UB5P 2J3TD 3PBRA 3NI9A 4JXWA 4X6TA 1K54C 5A93A 4MEZA 2R9XA 5M1AA 1ONGA 5HAQA 2EX9A 1QMFA 1PFLA 4C6YA 2ZD8A 2Y8HA 1LI0A 5FAQA 3EQVA 1OPXA 4DXBA 4HH3A 4WL9A 4FSFA 3A0VA 2G7UA 4I3IA 4UA6A 4F94A 1BULA 1DP8A 5EM1A 1IEMA 4JXSA 3QP4A 4RVAA 1L0FA 4PKYA 2VZWA 3H7WB 3MBZA 4WLAA 1NJ4A 1W8YA 4R4RA 3D4FA 2ZQCA 3H9WA 5HL1A 1FR6A 3ULFA 4D60A 5DJTA 2Y2OA 2GDNA 1ES2A 2Y2HA 3LYXA 1GHPA 2IWCA 2XF3A 3LR0A 4H6JA 5IT5A 2ZOHA 4KENB 2Y2GA 3MR0A 4KZ3A 4JXVA 4R38A 4IVKA 3GQZA 1PI4A 3F1OB 1PIOA 1XGJA 4OKPA 3KSGA 3E98A 1Z6FA 1P9RA 5TBMA 1OJ5A 1FSYA 5CGXA 4MBFA 4IVIA 4HESA 3L7HA 3LIBA 4IJGA 1D7EA 2HJ9C 1WYCA 3PYPA 2E8IA 5HX9A 4WEJA 3GDIA 2VGLS 5FDHA 4II7A 1EI5A 3A3IA 5CX7A 4UA7A 4DE3A 4JGRA 4XT2B 3DWKA 1PZPA 4DMZA 2XH9A 1G5UA 1T19A 1SKFA 3F1NB 2XA7M 4Y2FA 3B47A 1K55C 1PYYA 2VV6A 3Q1FA 2J7VA 2Z2MB 1XJ6A 1U60A 2GZAA 5CXWA 5LBRA 4Z9QA 2B95A 4Y0UA 3UO9A 3Q81A 3FWLA 5EM0A 3O87A 3EQUA 1ES3A 3E0YA 3TRCA 1JVJA 3IF6B 3H82B 4LRXC 4PAUA 4JGQA 3IXHA 1DJAA 2WUQA 3LIEA 5AVEA 5EVIA 3VOLA 4FUWA 4WELA 3C38A 5DTKA 1BTLA 4QU3A 4EERA 4M3KA 2OSUA 3AGEA 2DMWA 3EGDC 1HLUP 3S7NA 2WKEA 3WRTA 3G35A 2QPNA 1SDEA 4HHDA 3HVFA 3WS0A 4ZJ1A 1YLTA 4HJ6A 3IH9A 5E2FA 5HZHA 1GA0A 1NZUA 4L0LA 1SKOB 1P0ZA 5FDSA 4N1HA 5EOOA 1PWDA 2EFXA 1FR1A 2XDMA 4OQIA 2JCHA 3BLSA 2QJ5A 2W3DA 4ID4A 2EFUA 1W79A 5FQIA 4PMAA 2OV5A 4WUJA 5HAIA 3VSKA 2XA7S 3N8RA 4GDNA 3JVVA 2VA0A 5I5LA 4KQRA 2INWA 2PT7A 3B33A 1BYWA 4UQIM 4KZBA 1KDWA 4X25A 1YM1A 1S1YA 2W3FA 3CZDA 4X1MA 2FZ0A 2O9BA 2WKPA 4CPKA 1VETB 4DE1A 3BJNA 1YQSA 4MNRA 1T18A 4NXEA 5EUAA 1GA9A 3NHQA 3KSIA 1TEMA 1RCJA 1L0EA 3NDGA 3SH7A 5F83A 5KSCA 1S1ZA 1XFQA 1XA1A 2L0WA 5CERA 4JF5A 4LGWA 1WE4A 3LIDA 3FPVA 4B93A 4R1GA 4B88A 5AQ7A 1PNEA 2VX8A 4OVDA 1SCWA 3CHWP 3MKFA 1SHVA 4WM9A 2M7VA 5HDCA 2FFYA 1FCNA 4KZ8A 1OMEA 5HDSA 5G4YA 3VV4A 4WMCD 2EWWA 2XQZA 4CLCC 1N9OA 3VE3A 4HQAA 5CEDA 2X01A 3BQAA 5GLCA 2W1TB 3LIFA 4S2JA 5FSRA 3BFDA 1K6RA 5HW3A 2HDQA 3E2LA 4CLCD 1ZKJA 2WKHA 3ZVTA 1PW1A 4UA9A 1VEUB 5FI6A 1KE3A 3NJAA 4YNRA 4OPQA 4YOFA 3T1SA 4NG2A 3JPUA 2XK1A 1M6KA 2JKRI 2VV7A 4UQIS 2WZZA 5HWTA 2VKSA 3WS4A 3V5MA 4E6XA 4GS9A 1LSWA 4KZ4A 4N9LA 1YSQA 4EQIA 3VFHA 3VP0A 3D72A 3SW1A 4B4XA 1K57C 1NZOA 4LRYC 4RA7A 1MWTA 2MJ6A 3SOIA 2KX6A 5EVIC 3NOPC 3HUNA 4EU0A 4Q8IA 1DP9A 4L9GA 2EXBA 1V9YA 1XA7A 1LI9A 1L2SA 3HJKA 5E2EA 4PPRA 1FCOA 5F82A 4PM9A 4EV4A 2WKQA 1LSVA 3T4OA 3LY4A 4CQHA 3Q7ZA 2HF6A 4ZRRA 3IHBA 1G28A 5CTNA 2A3UA 4DJ2A 4RX3A 2BG1A 2HJEA 5FQMA 1ESUA 1I5QA 4X53A 2FFFB 4BBUA 1PI5A 1ES4A 4F3LB 3MQQA 4GB7A 2P9VA 4NXFA 1J3WA 1ERQA 2H0TA 3Q7VB 3LUQA 1MY8A 5G4ZA 3TOIA 3IBJA 5E43A 3C30A 3MFXA 2E8JA 2OAQ1 2OAP1 3CLOA 2ZMFA 5FASA 3BECA 3N8SA 4LCLA 3KO6A 4WBGA 2Y2PA 3G2ZA 3R4KA 3FC7A 3G31A 3UB9A 2L1MA 3QP1A 2NUTC 2Z6CA 1UWNX 1DRMA 3LR5A 5GLBA 1H3QA 2JKTI 1IKIA 4Y13A 5MC7A 4JGOA 4OPZA 3KSHA 3SS5A 2PD7A 5FL3A 4OPRA 1WYBA 3ZDJA 1J9MA 3MKEA 5EECA 5GLDA 3IS2A 4Q0IA 1Z09A 5CHJA 4P87A 2ZBBA 4GW9A 5DVAA 4I3AA 5CHUA 4E04A 3R7WA 4KZ9A 1RGZA 3T4KA 3DW0A 1FOFA 1T1AA 3ZG8B 1M40A 1Y28A 2ZM8A 5CRFA 4GDBA 2PR6A 4Y5FA 3S1YA 1GSXA 1GSWA 5FQQA 2QJ7A 3GSGA 2HP6A 1H5XA 2D02A 4I5SA 3NIAA 4QD4A 2ZL1B 1JNUA 4MN7A 4FOFA 3F1PB 2V2FF 1AWIA 1PZOA 3A3EA 4S2PA 4C75A 2OWHA 4GHIB 3IH8A 3OBFA 3Q07A 3BQ8A 4PM5A 4KQOA 4WZ5A 1ZC2A 3FYZA 1OJGA 2J9OA 4OQ0A 1VHMA 1LLBA 3LICA 1Y54A 1KVLA 3H7WA 4QY5A 4HI4A 2M7UA 4S2OA 1IOUA 4KQDA 3EWKA 5HSQA 4BL2A 3QP2A 4GD8A 3G34A 4HIAA 3TW8A 5HD5A 2Y2JA 4R3JA 5FATA 3A3DA 5HFOA 4B4ZA 2EX8A 1ONHA 1TDLA 1GHIA 4KG5A 3HBRA 4GNUA 2HP9A 2JN7A 3BM6A 4OQHA 2WYXA 4G3VA 1EROA 3B3XA 2BTFP 1T1CA 1MKMA 4H8RA 3MS6A 4LENA 2UV0E 3ZGAB 3UDFA 4X56A 4K08A 4E3JA 5AQ9A 3JYIA 1HVBA 3IX4A 2ZMAA 1NWZA 3OOVA 2IWBA 5HAPA 5FAOA 1XKZA 4HOIA 4NXBA 3C4OA 4WN5A 4KUKA 5DJUA 3IWIA 2OWJA 3A0SA 4XT2A 3EGXC 3UMEA 3M6BA 4DDSA 3F1NA 3G4PA 5HL6A 5AQAA 1MXOA 2A2LA 4X55A 1NRJA 1A0KA 3CJMA 3NY4A 3TG9A 3G6OA 3VOZA 3CUEC 5M19A 1E25A 3O3VA 2W1RA 2W3HA 2Y4AA 2JBFA 3N7WA 3HLGA 3PR6A 2ZQ7A 2HDRA 1MC0A 4E6WA 4DJ3A 2PHYA 3N6IA 1PWCA 1MBLA 4JKTA 4WMCA 3V39A 5FEGA 4EQ1A 2C5WB 3IF6A 3MZFA 4FTXA 3E4QA 1K25A 1Y4OA 5J3WA 3BY8A 3KSFA 4IEDA 2C6WB 4LV3A 3MF0A 4H6JB 1K0KA 5FQJA 4S2KA 4FH4A 4JF6A 1IYQA 5L2FA 2Q9MA 4QB8A 1W7FA 3UB6A 5KZHA 4HP4A 3QNCA 3SZTA 3ZCZA 5D3OA 1H8ZA 2ACGA 3PBQA 3CMZA 3GV9A 2PRFA 4LV1A 5DTSA 1SKOA 3TJZC 4S2NC 4D2OA 5KIZA 1BLHA 5JYOA 2Y2LA 3D3OA 3VP4A 3IXDA 4P6BA 4CLCB 1G6OA 3UE1A 1NYMA 2O9AA 4NK3A 4BMWA 1KGFA 4L9EA 3IBRA 4WZ5C 1E3UD 4DXCA 5EFWA 3E2KA 3V67A 5EVLA 3PAEA 3IX8A 3MZDA 2B5RA 4S2LA 4EUZA 1H8YA 2PD8A 1FILA 3LY3A 5C5KA 1VETA 4EBNA 4I38A 3BFFA 2A49A 3I7JA 1GHMA 1VM1A 1NLZA 3CAXA 4DKIA 1H0MA 3KYZA 2VEAA 3NOUC 1DP6A 4I39A 1YT4A 1IYOA 2H28A 3PBNA 3HLBA 2XRNA 4OOLA 1NYYA 3DAVA 1SZVA 4N92A 5EVIB 2RL3A 5AJGA 1TVFA 4KUOA 1L0GA 2WZXA 1YLJA 4WYYA 1JWPA 1LT0A 2GX5A 1CQAA 3IWOA 4Y0TA 2GJ3A 4ARZA 3FZCA 3U4LP 3O88A 2P7JA 3CPTA 4JPMA 3ZNTA 4BD0A 2OOLA 2CC1A 1F98A 4EEUA 4X1LA 1CEGA 5A90A 4XXRA 2EXAA 2M1CA 2ZQ8A 3T1RA 1ACFA 5EOEA 5DKKA 4HBTA 4PM6A 3UB8A 4JGPA 1K4EA 2ZJ9A 3PXPA 5DFXA 4WEKA 2XSSA 2XD1A 1VQQA 4FH2A 4AFIA 3KX0X 4LFUA 1OTIA 2Y79A 3VFFA 4P0MA 1F9IA 1PW8A 3VP3A 4GKUA 3GR2A 1XJ2A 1BT5A 2ZMVA 2WGWB 3QHYA 5FI7A 1G6AA 1YLWA 1ALQA 4R3AA 3BRMA 1ESIA 4RYEA 3PHYA 4OP8A 1LL9A 4QPRA 5EVEA 3SH8A
chains in the Genus database with same CATH topology
2PD7A 5FL3A 5DJTA 4O0PA 2D01A 2R78A 4BBTA 5HWWA 3LYXA 4O8GA 1VB6A 1ZHHB 4HJ4A 3OLOA 4EESA 3LR0A 4H6JA 5IT5A 1W63Q 2ZOHA 3B42A 4P6ZS 3IS2A 4Q0IA 2JKRM 2ZBBA 3MR0A 4GW9A 5HDDA 4I3AA 3EOIA 3GECA 4BWIA 1OTDA 3U2AA 4E04A 4R38A 2WKRA 3R7WA 3MQ0A 3T4KA 3F1OB 4F3LA 3KSGA 1T1AA 1XFNA 3E98A 2YKHA 1P9RA 5TBMA 1OJ5A 1Y28A 1TD5A 2V9AA 3MXQA 2PR6A 4Y5FA 3W2ZA 1F5MA 1GSXA 1GSWA 5J7EA 2QJ7A 3LIBA 4IJGA 1D7EA 3T4SA 2D02A 2XROA 2HJ9C 3PYPA 5HPIA 4I5SA 1JNUA 4WEJA 3GDIA 3ZQ5A 4MN7A 2VGLS 4FOFA 3F1PB 4II7A 2P04A 5CX7A 4NEED 2W1TA 2OWHA 4GHIB 1S66L 3OBFA 4JGRA 1H8MA 4MN6A 4XT2B 3BQ8A 4DMZA 3TE8A 4KQOA 3F1NB 1T19A 4PKYG 1OJGA 2XA7M 1VHMA 4Y2FA 3B47A 3LICA 4O01A 5DF9A 2VV6A 2KDKA 3H7WA 2VLGA 3C8CA 4GS9B 4HI4A 2M7UA 1XJ6A 4HP9A 3O5YA 1IOUA 2GZAA 4KQDA 3EWKA 5LBRA 5HSQA 5J4EA 4GCZA 2J80A 4OOMA 3T4LA 3ICYA 4HIAA 3TW8A 5HD5A 3KYQA 5AVFA 1YSPA 1LSXA 3EQUA 3E0YA 1S4RA 1X0OA 2W3EA 3TRCA 3NOTC 3H82B 2JN7A 4LRXC 4PAUA 4MMNA 1N9LA 4G3VA 4YWZA 1TS0A 4JGQA 4EW7A 1T1CA 1MKMA 4ARZB 2QYBA 1MZUA 3LIEA 5AVEA 4BJPA 4I3JA 3VOLA 4WELA 3OCLA 3EEAA 3C38A 4CLCE 1V9ZA 4EERA 4G3WA 4K08A 3T4QA 1NWZA 3K3CA 3OOVA 1D06A 2DMWA 2PR5A 3EGDC 2JKTM 3S7NA 2O0YA 4NXBA 4HOIA 3EEHA 4WN5A 4KUKA 3UE3A 5DJUA 1LL8A 4GJ4A 3K2NA 4HHDA 1OTAA 4GHIA 2OWJA 3A0SA 4ME4A 3T4JA 2V0UA 4HJ6A 3VE4A 5HZHA 4XT2A 2QKPA 2BASA 3EGXC 3UMEA 2V1AA 2O99A 1OTEA 4L0LA 1P0ZA 1YKDA 1OT6A 3F1NA 4HH2A 5HL6A 5A8BA 4RQ9A 2A2LA 2K7SA 1GSVA 2L4RA 1NRJA 3LI8A 4IUHA 4LPZA 2QJ5A 4IHQA 1TS7A 2KLIA 2W3DA 4EETB 3RFBA 4MN5A 4M4XA 3G6OA 3CUEC 4WF0A 2W1RA 4L9FA 5K5BA 2W3HA 4WUJA 3P7NA 4R70A 2XA7S 3OCNA 3LR3A 2EWVA 5IU1A 3JVVA 2JHEA 2VA0A 5I5LA 2J3WA 3PR6A 4B9OA 2KOIA 5KSHA 1XJ3A 4MCWA 1MC0A 2INWA 2PT7A 3B33A 4DJ3A 1BYWA 1S4SA 2PHYA 2V1BA 4UQIM 4EEPA 2EA9A 4EQ1A 2QHKA 4EXOA 5HPFA 3E4QA 5J3WA 4IUKA 2CMNA 1S1YA 2W3FA 3BY8A 3KSFA 5F5YA 2FZ0A 2O9BA 4GLQA 2WKPA 2B18A 3MF0A 3RH8B 3K3DA 4HNBA 2GNXA 3BJNA 3S7OA 4NXEA 1T18A 4H6JB 3UE6A 3CI6A 3NHQA 3KSIA 5F69A 1W63M 2W27A 3UB6A 4HJ3A 2J3TC 1S67L 1UWPX 3P01A 1OT9A 1S1ZA 1XFQA 3PBTA 4HP4A 4Q0HA 2K31A 3S7PA 2L0WA 3JVUA 3LIDA 3PBQA 3FPVA 1TS8A 3OC2A 3DBAA 5F68A 4B93A 4MDZA 2VX8A 5HWVA 4EUVA 1TF1A 2A24B 3TJZC 2M7VA 3F1OA 1KOUA 5HDCA 5HDSA 5G4YA 5KIZA 3VV4A 2EWWA 3D3OA 4CLCC 1N9OA 3VE3A 4HQAA 3BQAA 4CLCB 1G6OA 4ETXA 2W1TB 3CUEA 2O9AA 3LIFA 4BMWA 4L9EA 2PYRA 2VJWA 3IBRA 4LRZE 2O9CA 2HV1A 5DFYA 3HCYA 3S7QA 5F6AA 5EFWA 2YKFA 3F1PA 2I9VA 3T50A 3LI9A 4CLCD 3E4OA 3UB7A 4BBVA 3V67A 3MJQA 3NJAA 4YNRA 3BW6A 1ZTUA 4G3KA 3LR4A 4YOFA 2QWSA 1YAXA 4PHTA 2PD8A 1UGUA 2JKRI 4DN0A 2VV7A 5C5KA 3PBOA 3A0RA 2K2NA 4UQIS 5HWTA 2VKSA 4I38A 1ODVA 1T1BA 1LSWA 4GS9A 4LLOB 4R6LA 1NLZA 3HJIA 2Z6DA 3CAXA 1YSQA 3KYZA 2P08A 2VEAA 3NOUC 1DP6A 4I39A 4UEYA 5L8MA 3D72A 3SW1A 2H28A 1IFQA 4LRYC 3PBNA 2NUPC 1NLYA 2IA2A 4HY8A 2XRNA 2MJ6A 1EW0A 2KX6A 3MQOA 3NOPC 4OOLA 4ETZA 3LFVA 4EU0A 5AJGA 1TS6A 2PYPA 1DP9A 4KUOA 4L9GA 2LB5A 2HGVA 1OTBA 2A24A 3H82A 1V9YA 4P6ZM 1LT0A 3E4PA 3C2WA 2GX5A 3HJKA 4Q0JA 4Y3IA 2WKQA 2GJ3A 1LSVA 2W3GA 3T4OA 4ARZA 5IS1A 5HD3A 2V0WA 4CQHA 2P7JA 2HF6A 4ZRRA 1G28A 2FH5A 4CLCA 4DJ2A 1N9NA 2VV8A 2HJEA 2OOLA 3CWFA 1F98A 3IS2B 4NKPA 1XJ4A 5TJJA 4EEUA 3MMHA 4Z1WA 3T4TA 1P9WA 4BBUA 3R7WB 2B02A 4F3LB 3BY9A 3MQQA 3ZYTA 1P97A 2M1CA 2VGLM 4NXFA 5TBMB 3RTYA 5DKKA 3UMDA 3FG8A 1WA9A 3LIAA 3LUQA 3UB8A 4JGPA 2J3TD 3PBRA 5G4ZA 2PDRA 3PXPA 4NXGA 5DFXA 3IBJA 4WEKA 2XSSA 3C30A 4AFIA 3KX0X 3MFXA 5DKLA 1OTIA 2OAQ1 2ZOIA 2Y79A 3BWLA 2Y8HA 2OAP1 3CLOA 2W0NA 3EQVA 1F9IA 1OPXA 3FPWA 2LB9A 4HH3A 2ZMFA 4WL9A 4FSFA 3A0VA 2G7UA 3KO6A 4I3IA 1STZA 3R4KA 1XJ2A 3FC7A 3UB9A 2L1MA 2ZMVA 1DP8A 2NUTC 2Z6CA 1UWNX 1DRMA 4PKYA 2VZWA 3LR5A 4R3AA 3H7WB 1H3QA 4WLAA 2JKTI 3H9WA 3PHYA 3ULFA 3PBSA 4JGOA 4QPRA 5MC7A 3KSHA 3CITA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PD7 A;  5DJT A;  2D01 A;  2R78 A;  4BBT A;  5HWW A;  3LYX A;  1VB6 A;  4HJ4 A;  3OLO A;  4EES A;  4H6J A;  2ZOH A;  3IS2 A;  2ZBB A;  3MR0 A;  4GW9 A;  5HDD A;  4I3A A;  3GEC A;  1OTD A;  4E04 A;  4R38 A;  2WKR A;  4F3L A;  3F1O B;  1T1A A;  1XFN A;  2YKH A;  5TBM A;  1OJ5 A;  1Y28 A;  2V9A A;  3MXQ A;  2PR6 A;  1GSX A;  1GSW A;  5J7E A;  2QJ7 A;  3LIB A;  1D7E A;  2D02 A;  3PYP A;  4I5S A;  1JNU A;  3ZQ5 A;  3GDI A;  3F1P B;  2OWH A;  4GHI B;  1S66 L;  4JGR A;  4MN6 A;  4XT2 B;  3F1N B;  1T19 A;  4PKY G;  1OJG A;  3LIC A;  2VV6 A;  2KDK A;  3H7W A;  2VLG A;  3C8C A;  4GS9 B;  4HI4 A;  1XJ6 A;  4HP9 A;  4KQD A;  3EWK A;  5HSQ A;  5J4E A;  4GCZ A;  2J80 A;  3ICY A;  4HIA A;  5HD5 A;  5AVF A;  1LSX A;  1S4R A;  1X0O A;  3NOT C;  3H82 B;  2JN7 A;  4LRX C;  1N9L A;  4YWZ A;  1TS0 A;  4JGQ A;  4EW7 A;  1T1C A;  1MZU A;  3LIE A;  5AVE A;  4I3J A;  3VOL A;  1V9Z A;  4EER A;  4K08 A;  1NWZ A;  3K3C A;  1D06 A;  2PR5 A;  4NXB A;  4HOI A;  3EEH A;  4WN5 A;  4KUK A;  5DJU A;  1LL8 A;  4HHD A;  1OTA A;  4GHI A;  2OWJ A;  3A0S A;  2V0U A;  4HJ6 A;  3VE4 A;  5HZH A;  4XT2 A;  2QKP A;  2BAS A;  3UME A;  2V1A A;  1OTE A;  1P0Z A;  1OT6 A;  3F1N A;  4HH2 A;  5A8B A;  4RQ9 A;  2K7S A;  1GSV A;  2L4R A;  3LI8 A;  4LPZ A;  2QJ5 A;  1TS7 A;  4EET B;  4MN5 A;  4M4X A;  3G6O A;  4WF0 A;  4L9F A;  4WUJ A;  3P7N A;  4R70 A;  5IU1 A;  2JHE A;  5I5L A;  4B9O A;  1XJ3 A;  2INW A;  3B33 A;  4DJ3 A;  1BYW A;  1S4S A;  2PHY A;  2V1B A;  4EEP A;  2EA9 A;  4EQ1 A;  2QHK A;  4EXO A;  3E4Q A;  5J3W A;  2CMN A;  1S1Y A;  3BY8 A;  5F5Y A;  2WKP A;  3RH8 B;  3K3D A;  4HNB A;  4NXE A;  1T18 A;  4H6J B;  3UE6 A;  3NHQ A;  5F69 A;  2W27 A;  3UB6 A;  4HJ3 A;  1S67 L;  1UWP X;  1OT9 A;  1S1Z A;  1XFQ A;  4HP4 A;  2L0W A;  3LID A;  1TS8 A;  5F68 A;  5HWV A;  2A24 B;  3F1O A;  1KOU A;  5HDC A;  5HDS A;  5G4Y A;  5KIZ A;  1N9O A;  3VE3 A;  4HQA A;  3LIF A;  4L9E A;  2PYR A;  3IBR A;  4LRZ E;  2HV1 A;  5F6A A;  5EFW A;  2YKF A;  3F1P A;  2I9V A;  3T50 A;  3LI9 A;  3E4O A;  3UB7 A;  4BBV A;  3MJQ A;  3NJA A;  2QWS A;  2PD8 A;  1UGU A;  2VV7 A;  3A0R A;  5HWT A;  4I38 A;  1ODV A;  1T1B A;  1LSW A;  4GS9 A;  4LLO B;  4R6L A;  3HJI A;  2Z6D A;  3CAX A;  3NOU C;  2VEA A;  1DP6 A;  4I39 A;  3D72 A;  3SW1 A;  2H28 A;  4LRY C;  4HY8 A;  1EW0 A;  2KX6 A;  3MQO A;  3NOP C;  1TS6 A;  2PYP A;  1DP9 A;  4KUO A;  4L9G A;  1OTB A;  2A24 A;  3H82 A;  1V9Y A;  1LT0 A;  3E4P A;  3C2W A;  3HJK A;  2WKQ A;  2GJ3 A;  1LSV A;  5IS1 A;  5HD3 A;  2V0W A;  2P7J A;  1G28 A;  4DJ2 A;  1N9N A;  2VV8 A;  2OOL A;  3CWF A;  1F98 A;  3IS2 B;  1XJ4 A;  4EEU A;  4BBU A;  2B02 A;  4F3L B;  3BY9 A;  3MQQ A;  1P97 A;  2M1C A;  4NXF A;  5TBM B;  3RTY A;  5DKK A;  3UMD A;  3FG8 A;  1WA9 A;  3LIA A;  3LUQ A;  3UB8 A;  4JGP A;  5G4Z A;  2PDR A;  4NXG A;  3KX0 X;  3MFX A;  5DKL A;  1OTI A;  2ZOI A;  3BWL A;  3CLO A;  2W0N A;  1F9I A;  4HH3 A;  4WL9 A;  3A0V A;  4I3I A;  1XJ2 A;  3FC7 A;  3UB9 A;  2L1M A;  1DP8 A;  2Z6C A;  1UWN X;  1DRM A;  4PKY A;  4R3A A;  3H7W B;  4WLA A;  3H9W A;  3PHY A;  3ULF A;  4JGO A; 
#chains in the Genus database with same CATH topology
 2BLS A;  4U0X A;  4O0P A;  4ESP A;  3WWX A;  2R78 A;  4BBT A;  5HWW A;  1ZHH B;  4EES A;  1BZA A;  5L10 A;  3OZH A;  4Y7P A;  2JKR M;  3G30 A;  4GD6 A;  5HAR A;  5HDD A;  1PRQ A;  3U2A A;  3G2Y A;  3MQ0 A;  4RX2 A;  4F3L A;  4C3Q A;  3BFG A;  2YKH A;  1TD5 A;  3QP5 A;  4UHU A;  3W4P A;  2V9A A;  3Q7V A;  1S0W A;  3CG5 A;  1F5M A;  4R23 A;  3A3F A;  5EV0 A;  5J7E A;  1DY6 A;  2VK3 A;  1BUE A;  5HPI A;  1K54 A;  3ZHH A;  2V8F A;  5EVI D;  1DJB A;  2X71 A;  3MXS A;  4BQM A;  2P04 A;  2HZ5 A;  4NEE D;  4BEN A;  4GOG A;  1S66 L;  1K38 A;  3QP8 A;  4X69 A;  4PM8 A;  4EBL A;  3IF5 A;  4PKY G;  1CI8 A;  1F2K A;  4O01 A;  4Y0O A;  1XGI A;  2KDK A;  2VLG A;  3QNB A;  1S6R A;  3C8C A;  4GS9 B;  2Z2L B;  4MBK A;  4KZ6 A;  4DE0 A;  4HP9 A;  3O5Y A;  3VP1 A;  3P09 A;  2P74 A;  1JTD A;  2J80 A;  4OOM A;  5EPH A;  3T4L A;  3DTI A;  1O7E A;  1LSX A;  4ZDX A;  3OPL A;  4KG2 A;  3UDI A;  3NOT C;  4BD1 A;  2XFS A;  1AXB A;  1N9L A;  2Y2Q A;  3VSL A;  3BFC A;  1TS0 A;  3A3J A;  4EW7 A;  3ITA A;  2DNS A;  1BLC A;  3WS2 A;  4MLL A;  4I3J A;  1V9Z A;  2JKG A;  4OLD A;  2H10 A;  4OH0 A;  2ZL1 A;  3ZNY A;  3K3C A;  2PR5 A;  2JKT M;  5TFQ A;  3ZFZ A;  3W8K A;  3OPR A;  1LL8 A;  3ISG A;  4GHI A;  3UY6 A;  2V0U A;  4OOY A;  2BAS A;  2JKF A;  3NCK A;  1OTE A;  2PU4 A;  1BLP A;  1YKD A;  1OT6 A;  4HH2 A;  3N8L A;  4ZJ2 A;  2K7S A;  1GSV A;  3LI8 A;  4IUH A;  4FD8 A;  4N1X A;  3Q82 A;  4ZTK A;  4LPZ A;  1K55 A;  1TS7 A;  4EET B;  3RFB A;  2XLN A;  2XGN A;  3OPH A;  3IQA A;  5K5B A;  4L9F A;  3WRZ A;  4R70 A;  5DTT A;  3OCN A;  3GTC A;  2EWV A;  5IU1 A;  3MFD A;  5A91 A;  1MKI A;  5TGF A;  4CJN A;  2J3W A;  5CHM A;  4R3B A;  4UAA A;  3NC8 A;  4B9O A;  3GMW A;  2KOI A;  4MCW A;  1K56 D;  5GHZ A;  1O07 A;  1JWZ A;  1MWR A;  4EXO A;  5U47 A;  2X02 A;  2CMN A;  1MWU A;  4GLQ A;  2QMI A;  2B18 A;  3RH8 B;  2GNX A;  4DE2 A;  3S7O A;  2ZQD A;  2XR0 A;  3UE6 A;  3NUL A;  3FV7 A;  1KE0 A;  5F69 A;  3GVB A;  1W63 M;  4S2I A;  2W27 A;  1CK3 A;  2AVX A;  4HJ3 A;  4QWO A;  2J3T C;  1S67 L;  1UWP X;  4Q0H A;  3S7P A;  3IT9 A;  2ZM0 A;  3JVU A;  5IHV A;  1TS8 A;  5F68 A;  5FQ9 A;  3M2J A;  3ZG7 B;  4MDZ A;  1KGE A;  1BLS A;  2JE5 A;  1TF1 A;  2A24 B;  2PBY A;  3M6H A;  3L9K A;  1N9B A;  3F1O A;  3G32 A;  3SS4 A;  1G68 A;  4U0T A;  4MBH A;  5L09 A;  4LV0 A;  2VJW A;  3LO7 A;  5G18 A;  4DDY A;  2HV1 A;  2OLU A;  3BLM A;  3S7Q A;  3IHA A;  4JBF A;  5F6A A;  3D9Y A;  2YKF A;  2H5S A;  2I9V A;  3T50 A;  3LI9 A;  3E4O A;  3FKW A;  4DRT A;  3UB7 A;  4KZ5 A;  1NRF A;  1ZTU A;  4G3K A;  1CJF A;  1RP5 A;  4PHT A;  1YAX A;  3V3R A;  4DN0 A;  3A0R A;  4LCM A;  1ODV A;  1QME A;  1T1B A;  4LLO B;  4OPY A;  3RXX A;  5CEB A;  3HJI A;  2Y2N A;  2P08 A;  2PBD P;  2HP5 A;  3WS1 A;  5J8X A;  1IFQ A;  4S2M A;  2NUP C;  1K4F A;  1NLY A;  2IA2 A;  2VGK A;  4GZB A;  4HY8 A;  3IXB A;  5E2H A;  1EW0 A;  3HLE A;  3C7U A;  4ETZ A;  1FSW A;  1TS6 A;  2PYP A;  4R4S A;  4P85 A;  2LB5 A;  2HGV A;  3FKV A;  1OTB A;  3H82 A;  4P6Z M;  4JF4 A;  4Q0J A;  2WKI A;  3LEQ A;  4Y3I A;  1N4O A;  3NDE A;  2W3G A;  3HLF A;  1Q2P A;  1ZG6 A;  4HBU A;  4KZ7 A;  2FH5 A;  4CLC A;  1FCM A;  2VV8 A;  3CWF A;  1W8Q A;  4E3O A;  1XPB A;  5TJJ A;  3MMH A;  4Z1W A;  5CTM A;  3T4T A;  4ZBE A;  3NBL A;  1CF0 A;  2B02 A;  3NEC A;  2V20 A;  3ZYT A;  1P97 A;  1W5D A;  2EX6 A;  3DWZ A;  5TBM B;  1TDG A;  3UMD A;  2V1Z A;  5CGW A;  4DF6 A;  3AGD A;  2PDR A;  4NXG A;  5GHY A;  4K0X A;  3HLC A;  3T1Q B;  5DKL A;  3ZG5 A;  2ZOI A;  3BWL A;  3HUO A;  2HPB A;  2W0N A;  4BLM A;  3FPW A;  2LB9 A;  3S4X A;  1I2W A;  1STZ A;  1ERM A;  2ZQ9 A;  1K57 A;  3HLD A;  4EWF A;  2ZC5 B;  3PTE A;  1D1J A;  1IKG A;  3S22 A;  4E3M A;  2G2W A;  3HLW A;  3O86 A;  3PBS A;  4O7D A;  3CIT A;  4E3K A;  2D01 A;  4O8G A;  1VB6 A;  4HJ4 A;  3OLO A;  1FIK A;  1W63 Q;  3BYD A;  2H0Y A;  3B42 A;  4P6Z S;  3ZG0 A;  3EOI A;  3GEC A;  4BWI A;  1HZO A;  3UPN A;  1OTD A;  2I72 A;  4QJG A;  2WKR A;  1C3B A;  1XFN A;  1RGY A;  3MXQ A;  5DF7 A;  3W2Z A;  3WS5 A;  3M2K A;  1ES5 A;  5AQB A;  3T4S A;  2XRO A;  3LCE A;  1MPL A;  3V50 A;  3ZQ5 A;  2Y91 A;  3ZG9 B;  1KDS A;  1L0D A;  1FQG A;  4NET A;  2W1T A;  3HRE A;  2XEP A;  5FAP A;  1KVM A;  1H8M A;  4MN6 A;  3TE8 A;  1E4D A;  4ZJ3 A;  3UE0 A;  1YMS A;  1XXM A;  1PWG A;  2WGW A;  1MWS A;  4E3I A;  1XX2 A;  5DF9 A;  2IWD A;  1VEU A;  2Q9N A;  5JYP A;  3DTK A;  4PM7 A;  2OLV A;  5FEF A;  5J4E A;  3HL9 A;  4GCZ A;  3ICY A;  3W4O A;  3KYQ A;  5AVF A;  1YSP A;  2ZC4 B;  3RXW A;  1YLP A;  3DTM A;  2J8Y A;  1NY0 A;  3VOY A;  1S4R A;  5BOH A;  1X0O A;  2W3E A;  3IF6 C;  4XUZ A;  3PAG A;  1JWV A;  4MMN A;  4YWZ A;  4YIN A;  1LHY A;  4N9K A;  5EE8 A;  2ZLY A;  4ARZ B;  2QYB A;  1MZU A;  2ZQA A;  4KQQ A;  4BJP A;  3CPT B;  2WK0 A;  2DCF A;  3OCL A;  3EEA A;  2WGI A;  1K56 A;  2VGJ A;  4CLC E;  5I94 A;  4Y15 A;  3TSG A;  4G3W A;  3T4Q A;  2WAD A;  3BEB A;  3IXG A;  5FI2 A;  4X68 A;  4ZAM A;  3SH9 A;  3IX3 A;  1D06 A;  2O0Y A;  3EEH A;  3UE3 A;  4GJ4 A;  3K2N A;  1SDN A;  1OTA A;  4ME4 A;  3T4J A;  3VE4 A;  2QKP A;  2XD5 A;  2V1A A;  4JLF A;  2O99 A;  2PAV P;  5A8B A;  3VMA A;  4RQ9 A;  1I2S A;  4FCF A;  2L4R A;  3DTE A;  3C5A A;  3ITB A;  4KZA A;  3UDX A;  1HD8 A;  5GLA A;  4IHQ A;  2KLI A;  3V3S A;  3UPO A;  4MN5 A;  4M4X A;  4WF0 A;  3SS3 A;  3P7N A;  3LR3 A;  2V8C A;  2JHE A;  2JC7 A;  1CEF A;  5KSH A;  1XJ3 A;  4K91 A;  3VP2 A;  1S4S A;  2V1B A;  4EEP A;  2EA9 A;  4Y17 A;  3T12 B;  2QHK A;  1GCE A;  5HPF A;  1IYS A;  3LEZ A;  3OPP A;  3MZE A;  4IUK A;  5F5Y A;  1HTZ A;  3C4P A;  2WAE A;  3K3D A;  4HNB A;  1IEL A;  2EX2 A;  5F1F A;  1Q2Q A;  3QP6 A;  3GRJ A;  3CI6 A;  2UWX A;  3ZVW A;  1CI9 A;  2ZC7 A;  4OLG A;  3AGF A;  3P01 A;  1OT9 A;  3PBT A;  2K31 A;  1DJC A;  2Y59 A;  1YPR A;  3OC2 A;  3DBA A;  1L3L A;  1YMX A;  1YLZ A;  5HWV A;  4EUV A;  4YFM A;  2Y55 A;  5TR7 A;  1KOU A;  2HDU A;  2J9P A;  2HDS A;  2RCX A;  3MSH A;  3RJU A;  3BFE A;  1JTG A;  2Q0O A;  4ETX A;  1K6S A;  4IBR A;  3CUE A;  4E3N A;  1XP4 A;  2PYR A;  4LRZ E;  2O9C A;  5DFY A;  3HCY A;  5CGS A;  5GHX A;  3UPP A;  3F1P A;  2DRW A;  4R0Q A;  2ZC6 B;  1KGG A;  1LL5 A;  1EWZ A;  4BBV A;  2XFT A;  4XUX A;  4WZ4 A;  2P9V B;  3MJQ A;  1KE4 A;  1BSG A;  5E2G A;  2Y2M A;  4GN2 A;  3BW6 A;  3LR4 A;  4KG6 A;  2QWS A;  2G2U A;  4LV2 A;  4OQG A;  1UGU A;  5CEC A;  3PBO A;  2K2N A;  3KYE A;  3T1X A;  4QY6 A;  3UN7 A;  5KMW A;  4JXG A;  4R6L A;  2ZC3 B;  2Z6D A;  4A5R A;  4QHC A;  3C7V A;  4OON A;  4UEY A;  5L8M A;  3W4Q A;  2QZ6 A;  3N4I A;  1ZG4 A;  4EBP A;  3MQO A;  3LFV A;  5DF8 A;  5F1G A;  2PU2 A;  4BL3 A;  3HUM A;  3IWQ A;  2A24 A;  3LGO A;  4E3L A;  1YLY A;  2Y2I A;  5M18 A;  3E4P A;  3C2W A;  4S2N A;  4K0W A;  3P98 A;  3MXR A;  5L07 A;  5GL9 A;  2WAF A;  4IBX A;  1E3U A;  5IS1 A;  5HD3 A;  2V0W A;  1IYP A;  2WGV A;  1N9N A;  3IS2 B;  4NKP A;  2ZM2 A;  4OP5 A;  1XJ4 A;  4HEF A;  2Y2K A;  1P9W A;  5FQK A;  5A92 A;  3R7W B;  3BY9 A;  2VGL M;  4U3T A;  5FA7 A;  3UNW A;  3RTY A;  1NXY A;  3FG8 A;  1WA9 A;  3LIA A;  2R9W A;  3UB5 P;  2J3T D;  3PBR A;  3NI9 A;  4JXW A;  4X6T A;  1K54 C;  5A93 A;  4MEZ A;  2R9X A;  5M1A A;  1ONG A;  5HAQ A;  2EX9 A;  1QMF A;  1PFL A;  4C6Y A;  2ZD8 A;  2Y8H A;  1LI0 A;  5FAQ A;  3EQV A;  1OPX A;  4DXB A;  4HH3 A;  4WL9 A;  4FSF A;  3A0V A;  2G7U A;  4I3I A;  4UA6 A;  4F94 A;  1BUL A;  1DP8 A;  5EM1 A;  1IEM A;  4JXS A;  3QP4 A;  4RVA A;  1L0F A;  4PKY A;  2VZW A;  3H7W B;  3MBZ A;  4WLA A;  1NJ4 A;  1W8Y A;  4R4R A;  3D4F A;  2ZQC A;  3H9W A;  5HL1 A;  1FR6 A;  3ULF A;  4D60 A;  5DJT A;  2Y2O A;  2GDN A;  1ES2 A;  2Y2H A;  3LYX A;  1GHP A;  2IWC A;  2XF3 A;  3LR0 A;  4H6J A;  5IT5 A;  2ZOH A;  4KEN B;  2Y2G A;  3MR0 A;  4KZ3 A;  4JXV A;  4R38 A;  4IVK A;  3GQZ A;  1PI4 A;  3F1O B;  1PIO A;  1XGJ A;  4OKP A;  3KSG A;  3E98 A;  1Z6F A;  1P9R A;  5TBM A;  1OJ5 A;  1FSY A;  5CGX A;  4MBF A;  4IVI A;  4HES A;  3L7H A;  3LIB A;  4IJG A;  1D7E A;  2HJ9 C;  1WYC A;  3PYP A;  2E8I A;  5HX9 A;  4WEJ A;  3GDI A;  2VGL S;  5FDH A;  4II7 A;  1EI5 A;  3A3I A;  5CX7 A;  4UA7 A;  4DE3 A;  4JGR A;  4XT2 B;  3DWK A;  1PZP A;  4DMZ A;  2XH9 A;  1G5U A;  1T19 A;  1SKF A;  3F1N B;  2XA7 M;  4Y2F A;  3B47 A;  1K55 C;  1PYY A;  2VV6 A;  3Q1F A;  2J7V A;  2Z2M B;  1XJ6 A;  1U60 A;  2GZA A;  5CXW A;  5LBR A;  4Z9Q A;  2B95 A;  4Y0U A;  3UO9 A;  3Q81 A;  3FWL A;  5EM0 A;  3O87 A;  3EQU A;  1ES3 A;  3E0Y A;  3TRC A;  1JVJ A;  3IF6 B;  3H82 B;  4LRX C;  4PAU A;  4JGQ A;  3IXH A;  1DJA A;  2WUQ A;  3LIE A;  5AVE A;  5EVI A;  3VOL A;  4FUW A;  4WEL A;  3C38 A;  5DTK A;  1BTL A;  4QU3 A;  4EER A;  4M3K A;  2OSU A;  3AGE A;  2DMW A;  3EGD C;  1HLU P;  3S7N A;  2WKE A;  3WRT A;  3G35 A;  2QPN A;  1SDE A;  4HHD A;  3HVF A;  3WS0 A;  4ZJ1 A;  1YLT A;  4HJ6 A;  3IH9 A;  5E2F A;  5HZH A;  1GA0 A;  1NZU A;  4L0L A;  1SKO B;  1P0Z A;  5FDS A;  4N1H A;  5EOO A;  1PWD A;  2EFX A;  1FR1 A;  2XDM A;  4OQI A;  2JCH A;  3BLS A;  2QJ5 A;  2W3D A;  4ID4 A;  2EFU A;  1W79 A;  5FQI A;  4PMA A;  2OV5 A;  4WUJ A;  5HAI A;  3VSK A;  2XA7 S;  3N8R A;  4GDN A;  3JVV A;  2VA0 A;  5I5L A;  4KQR A;  2INW A;  2PT7 A;  3B33 A;  1BYW A;  4UQI M;  4KZB A;  1KDW A;  4X25 A;  1YM1 A;  1S1Y A;  2W3F A;  3CZD A;  4X1M A;  2FZ0 A;  2O9B A;  2WKP A;  4CPK A;  1VET B;  4DE1 A;  3BJN A;  1YQS A;  4MNR A;  1T18 A;  4NXE A;  5EUA A;  1GA9 A;  3NHQ A;  3KSI A;  1TEM A;  1RCJ A;  1L0E A;  3NDG A;  3SH7 A;  5F83 A;  5KSC A;  1S1Z A;  1XFQ A;  1XA1 A;  2L0W A;  5CER A;  4JF5 A;  4LGW A;  1WE4 A;  3LID A;  3FPV A;  4B93 A;  4R1G A;  4B88 A;  5AQ7 A;  1PNE A;  2VX8 A;  4OVD A;  1SCW A;  3CHW P;  3MKF A;  1SHV A;  4WM9 A;  2M7V A;  5HDC A;  2FFY A;  1FCN A;  4KZ8 A;  1OME A;  5HDS A;  5G4Y A;  3VV4 A;  4WMC D;  2EWW A;  2XQZ A;  4CLC C;  1N9O A;  3VE3 A;  4HQA A;  5CED A;  2X01 A;  3BQA A;  5GLC A;  2W1T B;  3LIF A;  4S2J A;  5FSR A;  3BFD A;  1K6R A;  5HW3 A;  2HDQ A;  3E2L A;  4CLC D;  1ZKJ A;  2WKH A;  3ZVT A;  1PW1 A;  4UA9 A;  1VEU B;  5FI6 A;  1KE3 A;  3NJA A;  4YNR A;  4OPQ A;  4YOF A;  3T1S A;  4NG2 A;  3JPU A;  2XK1 A;  1M6K A;  2JKR I;  2VV7 A;  4UQI S;  2WZZ A;  5HWT A;  2VKS A;  3WS4 A;  3V5M A;  4E6X A;  4GS9 A;  1LSW A;  4KZ4 A;  4N9L A;  1YSQ A;  4EQI A;  3VFH A;  3VP0 A;  3D72 A;  3SW1 A;  4B4X A;  1K57 C;  1NZO A;  4LRY C;  4RA7 A;  1MWT A;  2MJ6 A;  3SOI A;  2KX6 A;  5EVI C;  3NOP C;  3HUN A;  4EU0 A;  4Q8I A;  1DP9 A;  4L9G A;  2EXB A;  1V9Y A;  1XA7 A;  1LI9 A;  1L2S A;  3HJK A;  5E2E A;  4PPR A;  1FCO A;  5F82 A;  4PM9 A;  4EV4 A;  2WKQ A;  1LSV A;  3T4O A;  3LY4 A;  4CQH A;  3Q7Z A;  2HF6 A;  4ZRR A;  3IHB A;  1G28 A;  5CTN A;  2A3U A;  4DJ2 A;  4RX3 A;  2BG1 A;  2HJE A;  5FQM A;  1ESU A;  1I5Q A;  4X53 A;  2FFF B;  4BBU A;  1PI5 A;  1ES4 A;  4F3L B;  3MQQ A;  4GB7 A;  2P9V A;  4NXF A;  1J3W A;  1ERQ A;  2H0T A;  3Q7V B;  3LUQ A;  1MY8 A;  5G4Z A;  3TOI A;  3IBJ A;  5E43 A;  3C30 A;  3MFX A;  2E8J A;  2OAQ 1;  2OAP 1;  3CLO A;  2ZMF A;  5FAS A;  3BEC A;  3N8S A;  4LCL A;  3KO6 A;  4WBG A;  2Y2P A;  3G2Z A;  3R4K A;  3FC7 A;  3G31 A;  3UB9 A;  2L1M A;  3QP1 A;  2NUT C;  2Z6C A;  1UWN X;  1DRM A;  3LR5 A;  5GLB A;  1H3Q A;  2JKT I;  1IKI A;  4Y13 A;  5MC7 A;  4JGO A;  4OPZ A;  3KSH A;  3SS5 A;  2PD7 A;  5FL3 A;  4OPR A;  1WYB A;  3ZDJ A;  1J9M A;  3MKE A;  5EEC A;  5GLD A;  3IS2 A;  4Q0I A;  1Z09 A;  5CHJ A;  4P87 A;  2ZBB A;  4GW9 A;  5DVA A;  4I3A A;  5CHU A;  4E04 A;  3R7W A;  4KZ9 A;  1RGZ A;  3T4K A;  3DW0 A;  1FOF A;  1T1A A;  3ZG8 B;  1M40 A;  1Y28 A;  2ZM8 A;  5CRF A;  4GDB A;  2PR6 A;  4Y5F A;  3S1Y A;  1GSX A;  1GSW A;  5FQQ A;  2QJ7 A;  3GSG A;  2HP6 A;  1H5X A;  2D02 A;  4I5S A;  3NIA A;  4QD4 A;  2ZL1 B;  1JNU A;  4MN7 A;  4FOF A;  3F1P B;  2V2F F;  1AWI A;  1PZO A;  3A3E A;  4S2P A;  4C75 A;  2OWH A;  4GHI B;  3IH8 A;  3OBF A;  3Q07 A;  3BQ8 A;  4PM5 A;  4KQO A;  4WZ5 A;  1ZC2 A;  3FYZ A;  1OJG A;  2J9O A;  4OQ0 A;  1VHM A;  1LLB A;  3LIC A;  1Y54 A;  1KVL A;  3H7W A;  4QY5 A;  4HI4 A;  2M7U A;  4S2O A;  1IOU A;  4KQD A;  3EWK A;  5HSQ A;  4BL2 A;  3QP2 A;  4GD8 A;  3G34 A;  4HIA A;  3TW8 A;  5HD5 A;  2Y2J A;  4R3J A;  5FAT A;  3A3D A;  5HFO A;  4B4Z A;  2EX8 A;  1ONH A;  1TDL A;  1GHI A;  4KG5 A;  3HBR A;  4GNU A;  2HP9 A;  2JN7 A;  3BM6 A;  4OQH A;  2WYX A;  4G3V A;  1ERO A;  3B3X A;  2BTF P;  1T1C A;  1MKM A;  4H8R A;  3MS6 A;  4LEN A;  2UV0 E;  3ZGA B;  3UDF A;  4X56 A;  4K08 A;  4E3J A;  5AQ9 A;  3JYI A;  1HVB A;  3IX4 A;  2ZMA A;  1NWZ A;  3OOV A;  2IWB A;  5HAP A;  5FAO A;  1XKZ A;  4HOI A;  4NXB A;  3C4O A;  4WN5 A;  4KUK A;  5DJU A;  3IWI A;  2OWJ A;  3A0S A;  4XT2 A;  3EGX C;  3UME A;  3M6B A;  4DDS A;  3F1N A;  3G4P A;  5HL6 A;  5AQA A;  1MXO A;  2A2L A;  4X55 A;  1NRJ A;  1A0K A;  3CJM A;  3NY4 A;  3TG9 A;  3G6O A;  3VOZ A;  3CUE C;  5M19 A;  1E25 A;  3O3V A;  2W1R A;  2W3H A;  2Y4A A;  2JBF A;  3N7W A;  3HLG A;  3PR6 A;  2ZQ7 A;  2HDR A;  1MC0 A;  4E6W A;  4DJ3 A;  2PHY A;  3N6I A;  1PWC A;  1MBL A;  4JKT A;  4WMC A;  3V39 A;  5FEG A;  4EQ1 A;  2C5W B;  3IF6 A;  3MZF A;  4FTX A;  3E4Q A;  1K25 A;  1Y4O A;  5J3W A;  3BY8 A;  3KSF A;  4IED A;  2C6W B;  4LV3 A;  3MF0 A;  4H6J B;  1K0K A;  5FQJ A;  4S2K A;  4FH4 A;  4JF6 A;  1IYQ A;  5L2F A;  2Q9M A;  4QB8 A;  1W7F A;  3UB6 A;  5KZH A;  4HP4 A;  3QNC A;  3SZT A;  3ZCZ A;  5D3O A;  1H8Z A;  2ACG A;  3PBQ A;  3CMZ A;  3GV9 A;  2PRF A;  4LV1 A;  5DTS A;  1SKO A;  3TJZ C;  4S2N C;  4D2O A;  5KIZ A;  1BLH A;  5JYO A;  2Y2L A;  3D3O A;  3VP4 A;  3IXD A;  4P6B A;  4CLC B;  1G6O A;  3UE1 A;  1NYM A;  2O9A A;  4NK3 A;  4BMW A;  1KGF A;  4L9E A;  3IBR A;  4WZ5 C;  1E3U D;  4DXC A;  5EFW A;  3E2K A;  3V67 A;  5EVL A;  3PAE A;  3IX8 A;  3MZD A;  2B5R A;  4S2L A;  4EUZ A;  1H8Y A;  2PD8 A;  1FIL A;  3LY3 A;  5C5K A;  1VET A;  4EBN A;  4I38 A;  3BFF A;  2A49 A;  3I7J A;  1GHM A;  1VM1 A;  1NLZ A;  3CAX A;  4DKI A;  1H0M A;  3KYZ A;  2VEA A;  3NOU C;  1DP6 A;  4I39 A;  1YT4 A;  1IYO A;  2H28 A;  3PBN A;  3HLB A;  2XRN A;  4OOL A;  1NYY A;  3DAV A;  1SZV A;  4N92 A;  5EVI B;  2RL3 A;  5AJG A;  1TVF A;  4KUO A;  1L0G A;  2WZX A;  1YLJ A;  4WYY A;  1JWP A;  1LT0 A;  2GX5 A;  1CQA A;  3IWO A;  4Y0T A;  2GJ3 A;  4ARZ A;  3FZC A;  3U4L P;  3O88 A;  2P7J A;  3CPT A;  4JPM A;  3ZNT A;  4BD0 A;  2OOL A;  2CC1 A;  1F98 A;  4EEU A;  4X1L A;  1CEG A;  5A90 A;  4XXR A;  2EXA A;  2M1C A;  2ZQ8 A;  3T1R A;  1ACF A;  5EOE A;  5DKK A;  4HBT A;  4PM6 A;  3UB8 A;  4JGP A;  1K4E A;  2ZJ9 A;  3PXP A;  5DFX A;  4WEK A;  2XSS A;  2XD1 A;  1VQQ A;  4FH2 A;  4AFI A;  3KX0 X;  4LFU A;  1OTI A;  2Y79 A;  3VFF A;  4P0M A;  1F9I A;  1PW8 A;  3VP3 A;  4GKU A;  3GR2 A;  1XJ2 A;  1BT5 A;  2ZMV A;  2WGW B;  3QHY A;  5FI7 A;  1G6A A;  1YLW A;  1ALQ A;  4R3A A;  3BRM A;  1ESI A;  4RYE A;  3PHY A;  4OP8 A;  1LL9 A;  4QPR A;  5EVE A;  3SH8 A; 
#chains in the Genus database with same CATH homology
 2PD7 A;  5FL3 A;  5DJT A;  4O0P A;  2D01 A;  2R78 A;  4BBT A;  5HWW A;  3LYX A;  4O8G A;  1VB6 A;  1ZHH B;  4HJ4 A;  3OLO A;  4EES A;  3LR0 A;  4H6J A;  5IT5 A;  1W63 Q;  2ZOH A;  3B42 A;  4P6Z S;  3IS2 A;  4Q0I A;  2JKR M;  2ZBB A;  3MR0 A;  4GW9 A;  5HDD A;  4I3A A;  3EOI A;  3GEC A;  4BWI A;  1OTD A;  3U2A A;  4E04 A;  4R38 A;  2WKR A;  3R7W A;  3MQ0 A;  3T4K A;  3F1O B;  4F3L A;  3KSG A;  1T1A A;  1XFN A;  3E98 A;  2YKH A;  1P9R A;  5TBM A;  1OJ5 A;  1Y28 A;  1TD5 A;  2V9A A;  3MXQ A;  2PR6 A;  4Y5F A;  3W2Z A;  1F5M A;  1GSX A;  1GSW A;  5J7E A;  2QJ7 A;  3LIB A;  4IJG A;  1D7E A;  3T4S A;  2D02 A;  2XRO A;  2HJ9 C;  3PYP A;  5HPI A;  4I5S A;  1JNU A;  4WEJ A;  3GDI A;  3ZQ5 A;  4MN7 A;  2VGL S;  4FOF A;  3F1P B;  4II7 A;  2P04 A;  5CX7 A;  4NEE D;  2W1T A;  2OWH A;  4GHI B;  1S66 L;  3OBF A;  4JGR A;  1H8M A;  4MN6 A;  4XT2 B;  3BQ8 A;  4DMZ A;  3TE8 A;  4KQO A;  3F1N B;  1T19 A;  4PKY G;  1OJG A;  2XA7 M;  1VHM A;  4Y2F A;  3B47 A;  3LIC A;  4O01 A;  5DF9 A;  2VV6 A;  2KDK A;  3H7W A;  2VLG A;  3C8C A;  4GS9 B;  4HI4 A;  2M7U A;  1XJ6 A;  4HP9 A;  3O5Y A;  1IOU A;  2GZA A;  4KQD A;  3EWK A;  5LBR A;  5HSQ A;  5J4E A;  4GCZ A;  2J80 A;  4OOM A;  3T4L A;  3ICY A;  4HIA A;  3TW8 A;  5HD5 A;  3KYQ A;  5AVF A;  1YSP A;  1LSX A;  3EQU A;  3E0Y A;  1S4R A;  1X0O A;  2W3E A;  3TRC A;  3NOT C;  3H82 B;  2JN7 A;  4LRX C;  4PAU A;  4MMN A;  1N9L A;  4G3V A;  4YWZ A;  1TS0 A;  4JGQ A;  4EW7 A;  1T1C A;  1MKM A;  4ARZ B;  2QYB A;  1MZU A;  3LIE A;  5AVE A;  4BJP A;  4I3J A;  3VOL A;  4WEL A;  3OCL A;  3EEA A;  3C38 A;  4CLC E;  1V9Z A;  4EER A;  4G3W A;  4K08 A;  3T4Q A;  1NWZ A;  3K3C A;  3OOV A;  1D06 A;  2DMW A;  2PR5 A;  3EGD C;  2JKT M;  3S7N A;  2O0Y A;  4NXB A;  4HOI A;  3EEH A;  4WN5 A;  4KUK A;  3UE3 A;  5DJU A;  1LL8 A;  4GJ4 A;  3K2N A;  4HHD A;  1OTA A;  4GHI A;  2OWJ A;  3A0S A;  4ME4 A;  3T4J A;  2V0U A;  4HJ6 A;  3VE4 A;  5HZH A;  4XT2 A;  2QKP A;  2BAS A;  3EGX C;  3UME A;  2V1A A;  2O99 A;  1OTE A;  4L0L A;  1P0Z A;  1YKD A;  1OT6 A;  3F1N A;  4HH2 A;  5HL6 A;  5A8B A;  4RQ9 A;  2A2L A;  2K7S A;  1GSV A;  2L4R A;  1NRJ A;  3LI8 A;  4IUH A;  4LPZ A;  2QJ5 A;  4IHQ A;  1TS7 A;  2KLI A;  2W3D A;  4EET B;  3RFB A;  4MN5 A;  4M4X A;  3G6O A;  3CUE C;  4WF0 A;  2W1R A;  4L9F A;  5K5B A;  2W3H A;  4WUJ A;  3P7N A;  4R70 A;  2XA7 S;  3OCN A;  3LR3 A;  2EWV A;  5IU1 A;  3JVV A;  2JHE A;  2VA0 A;  5I5L A;  2J3W A;  3PR6 A;  4B9O A;  2KOI A;  5KSH A;  1XJ3 A;  4MCW A;  1MC0 A;  2INW A;  2PT7 A;  3B33 A;  4DJ3 A;  1BYW A;  1S4S A;  2PHY A;  2V1B A;  4UQI M;  4EEP A;  2EA9 A;  4EQ1 A;  2QHK A;  4EXO A;  5HPF A;  3E4Q A;  5J3W A;  4IUK A;  2CMN A;  1S1Y A;  2W3F A;  3BY8 A;  3KSF A;  5F5Y A;  2FZ0 A;  2O9B A;  4GLQ A;  2WKP A;  2B18 A;  3MF0 A;  3RH8 B;  3K3D A;  4HNB A;  2GNX A;  3BJN A;  3S7O A;  4NXE A;  1T18 A;  4H6J B;  3UE6 A;  3CI6 A;  3NHQ A;  3KSI A;  5F69 A;  1W63 M;  2W27 A;  3UB6 A;  4HJ3 A;  2J3T C;  1S67 L;  1UWP X;  3P01 A;  1OT9 A;  1S1Z A;  1XFQ A;  3PBT A;  4HP4 A;  4Q0H A;  2K31 A;  3S7P A;  2L0W A;  3JVU A;  3LID A;  3PBQ A;  3FPV A;  1TS8 A;  3OC2 A;  3DBA A;  5F68 A;  4B93 A;  4MDZ A;  2VX8 A;  5HWV A;  4EUV A;  1TF1 A;  2A24 B;  3TJZ C;  2M7V A;  3F1O A;  1KOU A;  5HDC A;  5HDS A;  5G4Y A;  5KIZ A;  3VV4 A;  2EWW A;  3D3O A;  4CLC C;  1N9O A;  3VE3 A;  4HQA A;  3BQA A;  4CLC B;  1G6O A;  4ETX A;  2W1T B;  3CUE A;  2O9A A;  3LIF A;  4BMW A;  4L9E A;  2PYR A;  2VJW A;  3IBR A;  4LRZ E;  2O9C A;  2HV1 A;  5DFY A;  3HCY A;  3S7Q A;  5F6A A;  5EFW A;  2YKF A;  3F1P A;  2I9V A;  3T50 A;  3LI9 A;  4CLC D;  3E4O A;  3UB7 A;  4BBV A;  3V67 A;  3MJQ A;  3NJA A;  4YNR A;  3BW6 A;  1ZTU A;  4G3K A;  3LR4 A;  4YOF A;  2QWS A;  1YAX A;  4PHT A;  2PD8 A;  1UGU A;  2JKR I;  4DN0 A;  2VV7 A;  5C5K A;  3PBO A;  3A0R A;  2K2N A;  4UQI S;  5HWT A;  2VKS A;  4I38 A;  1ODV A;  1T1B A;  1LSW A;  4GS9 A;  4LLO B;  4R6L A;  1NLZ A;  3HJI A;  2Z6D A;  3CAX A;  1YSQ A;  3KYZ A;  2P08 A;  2VEA A;  3NOU C;  1DP6 A;  4I39 A;  4UEY A;  5L8M A;  3D72 A;  3SW1 A;  2H28 A;  1IFQ A;  4LRY C;  3PBN A;  2NUP C;  1NLY A;  2IA2 A;  4HY8 A;  2XRN A;  2MJ6 A;  1EW0 A;  2KX6 A;  3MQO A;  3NOP C;  4OOL A;  4ETZ A;  3LFV A;  4EU0 A;  5AJG A;  1TS6 A;  2PYP A;  1DP9 A;  4KUO A;  4L9G A;  2LB5 A;  2HGV A;  1OTB A;  2A24 A;  3H82 A;  1V9Y A;  4P6Z M;  1LT0 A;  3E4P A;  3C2W A;  2GX5 A;  3HJK A;  4Q0J A;  4Y3I A;  2WKQ A;  2GJ3 A;  1LSV A;  2W3G A;  3T4O A;  4ARZ A;  5IS1 A;  5HD3 A;  2V0W A;  4CQH A;  2P7J A;  2HF6 A;  4ZRR A;  1G28 A;  2FH5 A;  4CLC A;  4DJ2 A;  1N9N A;  2VV8 A;  2HJE A;  2OOL A;  3CWF A;  1F98 A;  3IS2 B;  4NKP A;  1XJ4 A;  5TJJ A;  4EEU A;  3MMH A;  4Z1W A;  3T4T A;  1P9W A;  4BBU A;  3R7W B;  2B02 A;  4F3L B;  3BY9 A;  3MQQ A;  3ZYT A;  1P97 A;  2M1C A;  2VGL M;  4NXF A;  5TBM B;  3RTY A;  5DKK A;  3UMD A;  3FG8 A;  1WA9 A;  3LIA A;  3LUQ A;  3UB8 A;  4JGP A;  2J3T D;  3PBR A;  5G4Z A;  2PDR A;  3PXP A;  4NXG A;  5DFX A;  3IBJ A;  4WEK A;  2XSS A;  3C30 A;  4AFI A;  3KX0 X;  3MFX A;  5DKL A;  1OTI A;  2OAQ 1;  2ZOI A;  2Y79 A;  3BWL A;  2Y8H A;  2OAP 1;  3CLO A;  2W0N A;  3EQV A;  1F9I A;  1OPX A;  3FPW A;  2LB9 A;  4HH3 A;  2ZMF A;  4WL9 A;  4FSF A;  3A0V A;  2G7U A;  3KO6 A;  4I3I A;  1STZ A;  3R4K A;  1XJ2 A;  3FC7 A;  3UB9 A;  2L1M A;  2ZMV A;  1DP8 A;  2NUT C;  2Z6C A;  1UWN X;  1DRM A;  4PKY A;  2VZW A;  3LR5 A;  4R3A A;  3H7W B;  1H3Q A;  4WLA A;  2JKT I;  3H9W A;  3PHY A;  3ULF A;  3PBS A;  4JGO A;  4QPR A;  5MC7 A;  3KSH A;  3CIT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...