4PKYA

Arnt/hif transcription factor/coactivator complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
104
structure length
101
Chain Sequence
TRFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNDEIEYIICTNTNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/cell cycle
molecule keywords Aryl hydrocarbon receptor nuclear translocator
publication title Coiled-coil Coactivators Play a Structural Role Mediating Interactions in Hypoxia-inducible Factor Heterodimerization.
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 101
sequence length 104
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14598 PAS_11 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4pkyA00
4L9FA 1EW0A 1D7EA 1GSXA 2V9AA 2VV8A 2L4RA 4H6JA 4R3AA 5F6AA 4LRZE 2A24A 2V1AA 2HV1A 5HWWA 5HDSA 4WLAA 4GS9A 4I38A 2OOLA 3LICA 1DP9A 1GSVA 3MR0A 3EWKA 2VV6A 4BBUA 4LLOB 1T1AA 1OTBA 2A24B 5EFWA 4GW9A 3H7WA 2D02A 1N9OA 3MQQA 3FC7A 2YKFA 2K7SA 3UB8A 3ZQ5A 3UMEA 3MQOA 1OTDA 5TBMA 1T19A 2JHEA 5G4YA 2OWHA 4PKYA 3NHQA 5IU1A 3UB7A 3E4OA 1DP6A 3E4QA 3H82A 3VE3A 2J80A 2ZBBA 4F3LA 4HJ4A 5TBMB 1TS0A 4GHIA 4JGPA 2M1CA 2QKPA 1KOUA 4PKYG 3RTYA 5J4EA 1TS7A 3OLOA 3UB9A 4HP9A 2Z6CA 3VE4A 4MN5A 4JGQA 4R6LA 1DP8A 3MFXA 4I39A 4LPZA 3HJKA 4HI4A 1OT6A 4HY8A 4KQDA 5HD3A 1GSWA 5HDDA 3MJQA 4B9OA 5G4ZA 4K08A 3E4PA 5AVFA 1D06A 4I3JA 5J3WA 4M4XA 2WKQA 2QJ5A 4I3IA 3F1NA 3A0VA 4HP4A 4EESA 4BBVA 4GCZA 3SW1A 1LSVA 4L9GA 1LT0A 4KUKA 4HQAA 4E04A 4HOIA 4L9EA 4EEPA 4NXBA 3F1NB 2D01A 2VLGA 4R38A 4H6JB 2PDRA 4JGOA 3LIAA 1P97A 2L0WA 1F98A 2YKHA 4EW7A 3IS2A 5KIZA 4GS9B 4LRXC 2WKRA 3G6OA 3NOUC 1OT9A 1TS6A 4WUJA 1N9NA 3FG8A 2QHKA 3H7WB 3IBRA 4WF0A 4R70A 5DKLA 5I5LA 3CWFA 2P7JA 3PYPA 3BWLA 1S1ZA 3C2WA 3UB6A 4DJ3A 5HZHA 5DJUA 4EQ1A 5J7EA 2I9VA 3GECA 3NJAA 4HIAA 2CMNA 2L1MA 4LRYC 2PYRA 1XJ4A 3H82B 4F3LB 2JN7A 4JGRA 3F1PA 2PD8A 4GHIB 3LI8A 4I5SA 4EEUA 2VV7A 3CLOA 1S4RA 1X0OA 4EETB 1OTIA 2V1BA 4XT2A 1XFNA 1MZUA 1V9ZA 2BASA 2V0WA 3GDIA 4RQ9A 1OJ5A 4KUOA 1OJGA 2B02A 3LIEA 4NXEA 3UMDA 4HJ6A 3LI9A 2KDKA 2INWA 2ZOIA 1WA9A 1S1YA 1BYWA 2R78A 2ZOHA 4I3AA 5F69A 3T50A 1XFQA 5HSQA 5DKKA 5HWTA 4YWZA 3PHYA 2EA9A 2QJ7A 3BY9A 3NOTC 1ODVA 1V9YA 1LSWA 4HNBA 3MXQA 1XJ3A 5F5YA 1OTAA 1F9IA 2PYPA 1T18A 4HJ3A 1S66L 2V0UA 3D72A 3LYXA 4EERA 5HWVA 1P0ZA 4DJ2A 3CAXA 3LUQA 3ULFA 3LIDA 2PHYA 1VB6A 3LIFA 2W0NA 3NOPC 3H9WA 2Z6DA 4HH3A 2VEAA 3IS2B 3K3CA 1T1CA 2WKPA 3BY8A 5AVEA 3C8CA 4HHDA 5A8BA 2PD7A 3VOLA 5HD5A 2KX6A 2H28A 3RH8B 3P7NA 3KX0X 1XJ2A 1XJ6A 3UE6A 3B33A 1S67L 1UGUA 2PR5A 3HJIA 4EXOA 1OTEA 5F68A 1DRMA 1NWZA 3ICYA 3EEHA 4WN5A 1LL8A 1TS8A 2QWSA 5HDCA 3LIBA 3F1OA 1N9LA 1LSXA 3K3DA 1T1BA 3F1PB 1JNUA 4BBTA 3A0SA 2PR6A 5IS1A 2W27A 1UWPX 1S4SA 4XT2B 1G28A 4HH2A 4MN6A 3A0RA 1UWNX 3F1OB 4NXFA 4NXGA 2OWJA 4WL9A 2GJ3A 1Y28A 5DJTA
chains in the Genus database with same CATH superfamily
2IWDA 3QNCA 4L9FA 3C4PA 1EW0A 1CEGA 1K6RA 4H6JA 4R3AA 4KG2A 1KDWA 2A24A 3G31A 2RL3A 5HWWA 3Q7VA 3OBFA 3KSIA 4KZ3A 2ZMFA 1W79A 4BL3A 2VV6A 4LV3A 2DRWA 4R4RA 1STZA 5EFWA 4GB7A 3KSFA 3PBOA 3FC7A 3PBRA 3CZDA 3JVUA 3UPPA 1K54C 3MQOA 1OTDA 3VV4A 5TBMA 3UPNA 5GLAA 1U60A 1MWRA 4EBPA 3BEBA 1TEMA 2WGWA 2UWXA 1ZC2A 4DMZA 4OH0A 2V8CA 2Y2MA 3E4OA 3E4QA 5F1FA 4MLLA 4Y13A 3A3DA 2ZBBA 1KGEA 3MXSA 4IVIA 5CRFA 2Y91A 4JKTA 2M1CA 1KOUA 3ZVWA 1XA1A 5DF7A 3RTYA 5J4EA 5L8MA 4HBUA 3GMWA 3UB9A 4HP9A 2FFYA 3PBQA 1XP4A 1XGJA 5EPHA 1HLUP 3LCEA 5HL1A 5KMWA 4R6LA 4BL2A 4S2LA 4UA9A 5HPIA 4XUXA 1IKGA 3LR0A 4HY8A 3Q07A 5HD3A 3EEAA 5HDDA 4N92A 4K08A 4KG6A 3ZDJA 4FUWA 5CHUA 4R0QA 5AVFA 2Z2LB 4JF4A 4X69A 2VGLS 4IEDA 2XFTA 3IF5A 3NY4A 1H5XA 4M4XA 4IBRA 4HP4A 4ZTKA 4GCZA 3WRZA 1PWCA 3ZCZA 3DW0A 2Z2MB 2XF3A 4KUKA 5EVLA 2QZ6A 5FAPA 4E3MA 2W1TA 1S6RA 1F2KA 4PM9A 1IYOA 5CTMA 4N9KA 2EX6A 2Y2LA 4S2NA 1PI5A 1P97A 4DE2A 4D2OA 3DAVA 4LGWA 4MBKA 2XGNA 3S22A 4EW7A 2WKRA 3G6OA 3NI9A 2VKSA 3NOUC 3EGDC 4RX2A 3MZFA 4U0TA 1TS6A 3ZG0A 4EWFA 4KZ6A 1YSQA 3O5YA 4ARZA 3H7WB 2O9CA 3CWFA 2P7JA 2J9PA 3R4KA 2K2NA 4P6ZS 1FIKA 3CI6A 4JLFA 5FI2A 1Q2PA 3BLMA 5J7EA 1CI8A 3JVVA 3RXXA 2VZWA 4IVKA 4UEYA 4HIAA 2L1MA 2X02A 1L3LA 1NYMA 4LRYC 1XJ4A 3OPPA 3H82B 5FQMA 4Q0HA 4QD4A 4F3LB 2EWWA 3SOIA 2ZM8A 1BTLA 4GHIB 4I5SA 4S2PA 2V20A 3D3OA 3LY3A 1W8QA 4E6WA 3LGOA 3UE1A 3ISGA 3IX3A 5FDHA 5CGSA 2HPBA 4WMCD 2A49A 5A91A 4RQ9A 1PWGA 3O88A 4JXSA 4MBFA 4NXEA 3T12B 2IWBA 3DWKA 2INWA 2WKEA 4UHUA 5FAOA 1ZKJA 3UO9A 1S1YA 4OOLA 3PXPA 3Q82A 4NEED 4I3AA 5F69A 1NZUA 3T50A 5HSQA 2NUPC 3MFDA 1BUEA 2WKIA 3W4OA 3NOTC 5CECA 4HNBA 1XJ3A 3QP5A 4B93A 4ZRRA 1T18A 4WM9A 1S66L 2B95A 3SZTA 2V0UA 2ZQDA 2QPNA 5FQIA 1RCJA 5DFXA 5EM1A 2PHYA 2XD5A 1MWSA 1VB6A 2OLVA 3KO6A 4YOFA 2W0NA 1XGIA 3TRCA 3VFFA 2Y2PA 3S1YA 1NJ4A 3B3XA 3IS2B 2JKRI 4K91A 2M7UA 2FH5A 2WKPA 4OKPA 5AQ7A 4O7DA 4DXCA 3IX4A 5AVEA 2Y2NA 3C8CA 1HZOA 5F83A 5E2GA 5EVEA 3VOLA 3HLEA 2KX6A 3VMAA 2XH9A 3ITAA 3CUEA 2KLIA 1D1JA 4L0LA 3OPRA 2QMIA 4CLCA 1S67L 1UGUA 2HDUA 1VM1A 4PPRA 3O87A 1H3QA 4ZAMA 1I2WA 1PNEA 2XD1A 3IF6A 1Y54A 4WEJA 3IH8A 1TVFA 3BFGA 3GR2A 1KVLA 3K3DA 1T1BA 2R9XA 3F1PB 3IX8A 4KQOA 2DMWA 2PR6A 4GOGA 5JYPA 1PIOA 2O0YA 1NLYA 3W4QA 3PAEA 3SH9A 4XT2B 2PAVP 3HUOA 1G28A 3QHYA 1FSYA 2ZQ7A 4MN6A 3A3FA 1LI0A 4C3QA 4E3OA 3ZHHA 4WL9A 1ZG4A 5KZHA 5IT5A 3PTEA 4KZAA 4WZ5C 2X01A 1K55A 1D7EA 5FAQA 1ES2A 3D4FA 5E2EA 4LRZE 1NLZA 3JPUA 1SHVA 5HDSA 1SDNA 5DTSA 1GSVA 3CJMA 1PFLA 3MR0A 5L10A 2XA7M 1G68A 5E43A 3TE8A 1OTBA 5HAIA 5L07A 2ZQAA 4OQGA 1MY8A 1FCOA 3H7WA 2V8FA 2YKFA 4YFMA 3ZQ5A 2C5WB 3UMEA 5KSHA 3T4QA 4GLQA 3LEZA 4GDNA 5G4YA 3SS4A 3IWOA 3NHQA 2H5SA 4ZJ1A 2E8JA 1YLJA 4MDZA 2VGKA 3H82A 1K54A 1YMSA 4F3LA 4QB8A 4U3TA 4X6TA 1NRJA 2Y2QA 1TS0A 4GHIA 3UY6A 2JE5A 3SS5A 3QP6A 4UA6A 5CTNA 3NCKA 4PKYG 2W3HA 4NKPA 3QP4A 2O9AA 3NDEA 2W3DA 3MF0A 4O01A 2B18A 4BMWA 2G2UA 3NIAA 3T1XA 2Z6CA 4JGQA 1BLPA 4F94A 4C75A 3VOZA 1E25A 2ZQ8A 3MFXA 2DCFA 3TOIA 4LPZA 2O9BA 3HJKA 3OPLA 2ZL1A 4Y15A 5FEGA 2H10A 3V67A 4KQDA 1FSWA 1GSWA 3P98A 3VP1A 4B9OA 5G4ZA 3QP8A 4E3IA 1Q2QA 3BQAA 2Y2JA 3ZNYA 3IWQA 1D06A 4IUKA 4JXWA 2QJ5A 3ITBA 4I3IA 2Y2IA 3A0VA 1H8ZA 1PZPA 4EQIA 1GCEA 4EESA 3SW1A 3ZYTA 4L9GA 1LT0A 2VGJA 1MWUA 3BM6A 1SCWA 1LL9A 2JC7A 1RP5A 4EEPA 3CHWP 4PAUA 3F1NB 5FI7A 4JBFA 2W3EA 2D01A 2XDMA 1L0FA 4FCFA 1K57C 3DTKA 2PDRA 1KE4A 3IQAA 5DTKA 3HLBA 3OOVA 2BLSA 1F98A 3BW6A 1FR6A 1YMXA 3IS2A 5EOEA 2P04A 2P08A 1JWVA 4DRTA 5E2HA 4JXVA 3T1QB 3ZG8B 1MBLA 4WUJA 1N9NA 3FG8A 5DVAA 2QHKA 2HDRA 1DJBA 3CG5A 3IBRA 2JKRM 5DKLA 1CEFA 1ESIA 2ACGA 1S1ZA 3C2WA 4MN7A 3UB6A 2HGVA 4DJ3A 1A0KA 5FASA 4R3BA 2GZAA 3Q1FA 5F82A 2CMNA 3LR3A 2HF6A 3G32A 3MMHA 1FOFA 5HFOA 2JCHA 5HAPA 3F1PA 4WMCA 4OOMA 4B88A 3WS5A 1S4RA 2EX8A 4WYYA 4XT2A 1G5UA 5GLDA 3ZG7B 3VP4A 3GTCA 1KDSA 1EROA 2CC1A 4UAAA 1OJ5A 4KUOA 3SH8A 1VHMA 3LIEA 1BLCA 4AFIA 2PRFA 1NRFA 4HJ6A 2EXAA 1K6SA 4OQIA 4ZBEA 4EU0A 2Q9NA 2ZOIA 2ZM2A 4GN2A 3LR5A 1MC0A 3VP0A 2ZOHA 4NETA 3MZEA 3QNBA 1XX2A 4P0MA 1SKOB 1IYPA 4PM8A 2HJ9C 4JXGA 2FZ0A 1Z09A 5M1AA 1VETB 2Y2OA 5CX7A 2EA9A 2QJ7A 3V3SA 1V9YA 3MXQA 2Y2KA 3G34A 5F5YA 3HLFA 1K56A 2ZQ9A 5BOHA 1F9IA 3MBZA 1W5DA 4BENA 1ONHA 4RA7A 3D9YA 3OPHA 4X53A 4EERA 3CMZA 1EWZA 3DBAA 2VX8A 4ME4A 3CAXA 1CF0A 3LUQA 4KZ8A 3I7JA 3R7WB 3TSGA 3ULFA 4S2KA 2JKTI 4E6XA 4EBNA 4OPQA 3AGEA 4ESPA 4WEKA 3GQZA 5G18A 5FDSA 2WUQA 2XRNA 1VQQA 1IYSA 4LFUA 2XEPA 2BG1A 3IXBA 5A8BA 3HCYA 4GNUA 5GL9A 4CLCE 5HD5A 2Y8HA 1YQSA 2H28A 2EFXA 2WAEA 4UQIM 1DJCA 2ZLYA 3RH8B 3P7NA 2ZC3B 2XK1A 1CK3A 1XJ2A 5GLCA 3G2ZA 1S0WA 3UE6A 2WK0A 3B33A 4UA7A 2P9VA 1C3BA 3BYDA 3WS4A 3T4LA 2PBDP 3ICYA 1LL8A 2PBYA 3C7UA 2G2WA 4X55A 4KQQA 2BTFP 3F1OA 3LIBA 1N9LA 1LSXA 1ES4A 3UDXA 5CGXA 2WGIA 3A0SA 3M6BA 4K0XA 3W2ZA 1FR1A 3FYZA 4RYEA 1S4SA 1VEUB 2XSSA 5D3OA 3A0RA 1UWNX 3RFBA 4XUZA 1FCNA 2XQZA 1LI9A 1Y28A 5A93A 1DY6A 3MSHA 4FH4A 3UE0A 3NBLA 3VP2A 5HPFA 3IHBA 1ERMA 4Q0JA 4H8RA 5A92A 1GSXA 1E3UD 2VV8A 3M2JA 4GJ4A 4R23A 2K31A 2OAQ1 4KZ7A 4KENB 5FATA 3N7WA 3PBNA 5HARA 4WLAA 4WZ5A 4KZ4A 3LICA 3A3JA 4ZJ2A 3EWKA 4LLOB 4B4XA 1W8YA 1T1AA 5CEBA 4A5RA 1O07A 2FFFB 1K56D 2A24B 3G30A 4IJGA 1TD5A 4G3KA 5KSCA 1I5QA 4EUVA 4E3LA 2D02A 1N9OA 4BQMA 3UNWA 3UB8A 2Y4AA 3E0YA 1PWDA 4XXRA 4BD1A 4BJPA 1T19A 3N8LA 3LEQA 3BFFA 4WZ4A 3L7HA 3LFVA 2JHEA 2WADA 3QP2A 4PKYA 1W63Q 5IU1A 3T4SA 1RGYA 3IXHA 1HD8A 3KSHA 1DP6A 4HJ4A 2H0YA 5TBMB 1YLTA 1TF1A 4B4ZA 2WGWB 3T4KA 4CJNA 3A3EA 1Z6FA 2IA2A 2O99A 3G35A 3VE4A 1MKIA 1P9WA 3PAGA 2LB5A 3IHAA 2VA0A 2J3TC 3UDFA 3C5AA 4I39A 4WELA 5FEFA 3A3IA 2OV5A 1DJAA 2J3WA 1YAXA 2JKGA 2ZC7A 3MJQA 3GV9A 5EE8A 1FQGA 2OSUA 1PZOA 3HVFA 1IYQA 4WBGA 5L09A 3HLWA 3FKVA 3MQ0A 2XROA 2HP6A 4I3JA 3IT9A 5J3WA 2WKQA 2EXBA 1SKOA 5FQKA 2PT7A 4BBVA 2J3TD 1ZG6A 3E2LA 4S2OA 5MC7A 1BLHA 3VFHA 3MS6A 5FQ9A 3T4OA 2Y55A 2J9OA 3W8KA 4E04A 4HOIA 4FH2A 4L9EA 3TJZC 3SH7A 5IHVA 1ONGA 1YM1A 2XR0A 4NXBA 4OVDA 1MXOA 1IKIA 4DE1A 4Y17A 3R7WA 4PM5A 1I2SA 1FILA 3U4LP 1CJFA 3EOIA 3S7PA 2L0WA 1RGZA 1YT4A 2W1TB 4GS9B 4Y7PA 3KYZA 3UB5P 2HDSA 1XA7A 5AJGA 2JKTM 2H0TA 3NULA 3KSGA 5CHJA 1WYCA 4R70A 1H8YA 2G7UA 5I5LA 2EX9A 1L0GA 3BWLA 4FOFA 5GHZA 3HLCA 4CLCC 5HZHA 3IXGA 5DF9A 2ZQCA 4EQ1A 2MJ6A 3W4PA 3NJAA 3B47A 1JTDA 3IF6C 4ARZB 3S7OA 4X1LA 2PYRA 4LENA 3N8SA 5TFQA 1YSPA 2ZMAA 3GVBA 4QJGA 3LI8A 4QY6A 1NYYA 2VV7A 4LCMA 3CLOA 1BULA 3RJUA 4II7A 1JWZA 1X0OA 3OC2A 1OTIA 1VEUA 4QWOA 2ZJ9A 1XFNA 1MZUA 5DFYA 5EVIC 1YLYA 3C4OA 2DNSA 4QU3A 3DTEA 1TDGA 2WZXA 4S2IA 4LCLA 3IH9A 3LO7A 1K55C 3N8RA 4P87A 1CQAA 4JF5A 3GRJA 4OP8A 3P09A 3LI9A 1KGFA 2KDKA 4Z1WA 3GSGA 1F5MA 5HW3A 4MBHA 3NDGA 2M7VA 1WA9A 3S4XA 1ES3A 2R78A 1K25A 1P9RA 4DN0A 2HZ5A 5DKKA 4O8GA 3E2KA 4YWZA 3WS2A 5EVID 5L2FA 4Y3IA 3BY9A 3EQUA 3CPTB 2ZC5B 4QY5A 1ODVA 2NUTC 1LSWA 4KZ5A 1YPRA 4IHQA 1OTAA 1M40A 4NG2A 5JYOA 2ZC6B 1WYBA 3T1SA 3M6HA 3LYXA 3D72A 5EUAA 4DJ2A 1LL5A 3VOYA 3LIDA 4OQ0A 1W63M 3G2YA 3LIFA 1QMFA 4YNRA 2P74A 1OMEA 3L9KA 3H9WA 2Z6DA 4PMAA 5FSRA 1ES5A 4R4SA 5C5KA 5CGWA 4HH3A 5FA7A 2VEAA 4C6YA 4UQIS 4X25A 3FPVA 1XPBA 3BLSA 1PRQA 3G4PA 3UPOA 3OCNA 4Y0UA 4Y0OA 1OPXA 2PD7A 3T4TA 1SZVA 4PM6A 3P01A 1HVBA 3LY4A 2X71A 4ID4A 1SKFA 3Q81A 2WZZA 3HLGA 5EECA 1PW1A 4GD6A 4CQHA 1XJ6A 5DTTA 2QYBA 3S7NA 4IBXA 3N6IA 2XFSA 2PR5A 4MNRA 4GDBA 4OLGA 3EEHA 2EFUA 1TS8A 4LV2A 4N9LA 3PBSA 3NC8A 1G6OA 2ZMVA 3BJNA 1ZHHB 2PU2A 1K4FA 1JNUA 4CLCB 3M2KA 5CXWA 5IS1A 1L0EA 4RX3A 3FKWA 3IF6B 1M6KA 4OP5A 4DE0A 4X1MA 4BLMA 1GHMA 4YINA 3ZFZA 1J9MA 4HH2A 1E3UA 4GD8A 3OZHA 4MMNA 3HBRA 4IUHA 4MCWA 5J8XA 1KVMA 4NXGA 4ZJ3A 2GJ3A 5CHMA 2Y59A 1H0MA 5DF8A 3BECA 3HUNA 3T4JA 2V9AA 2WGVA 4OPRA 2L4RA 1PYYA 5F6AA 5EVIB 3SS3A 5TR7A 2V1AA 2HV1A 4G3WA 1W7FA 4M3KA 4O0PA 4EV4A 2PU4A 4GS9A 1YLWA 2LB9A 4I38A 2OOLA 1DP9A 3FZCA 4BBUA 5K5BA 1IEMA 2HDQA 4LV0A 1ACFA 1MPLA 2GNXA 4GW9A 3B42A 3MQQA 1K0KA 2K7SA 2J8YA 2OLUA 1CI9A 2AVXA 2C6WB 1TDLA 2OWHA 4HESA 1GA0A 2ZC4B 5U47A 4E3KA 3DWZA 1BLSA 3UB7A 3DTMA 3LR4A 3VE3A 2J80A 5FI6A 4JGPA 3OCLA 4NK3A 2QKPA 1N9BA 3KYEA 1TS7A 3OLOA 3AGDA 4P6BA 3V39A 4Z9QA 1QMEA 1NXYA 3PBTA 2ZM0A 3U2AA 4MN5A 5GLBA 4EBLA 1DP8A 3TG9A 2R9WA 2HJEA 4KZBA 4HI4A 1OT6A 5A90A 2GX5A 5LBRA 1XXMA 3VP3A 4R1GA 4BD0A 3E4PA 4QPRA 5AQ9A 1Y4OA 3MKEA 4KQRA 2EX2A 3WRTA 1SDEA 2ZD8A 3S7QA 2ZL1B 3F1NA 3C38A 5GHXA 4OPYA 3O3VA 3RXWA 4DF6A 2RCXA 1LSVA 1HTZA 3CPTA 5F1GA 2WAFA 2XA7S 1BZAA 2VGLM 4S2NC 4HQAA 3V3RA 2XLNA 1FCMA 2VJWA 3KYQA 3EQVA 1AWIA 4PM7A 2V1ZA 2VLGA 3EGXC 4R38A 5HL6A 4H6JB 1GA9A 4R3JA 3ZGAB 4JGOA 5EM0A 2Y79A 3LIAA 4OQHA 5GHYA 2UV0E 2Q0OA 4OONA 1IFQA 1MWTA 3Q7VB 2YKHA 3BRMA 5KIZA 3UDIA 4LRXC 4ETZA 1GHIA 4RVAA 1J3WA 1GHPA 1OT9A 5AQBA 1H8MA 5AQAA 4E3JA 4FSFA 1AXBA 3ZG9B 1O7EA 4WF0A 3HREA 1WE4A 3VSKA 3PYPA 5CERA 4EUZA 1G6AA 2JBFA 2A2LA 3QP1A 5DJUA 2HP5A 4X68A 2I9VA 3GECA 3ZG5A 1N4OA 5HAQA 1IELA 2OAP1 4P6ZM 4OOYA 3C30A 2JN7A 4JGRA 1LLBA 2GDNA 4ETXA 2PD8A 2Y2GA 3JYIA 4EEUA 4Q8IA 4BWIA 4EETB 2W3FA 2V1BA 1L2SA 2WYXA 4JPMA 1IOUA 1V9ZA 3TW8A 2E8IA 2BASA 4S2MA 2V0WA 1JWPA 3WS1A 4KZ9A 3GDIA 4GKUA 3MKFA 4E3NA 4N1XA 1YKDA 1NY0A 5FQJA 5TJJA 1OJGA 3ZVTA 2B02A 3MXRA 3UMDA 1VETA 2IWCA 4GZBA 4Y5FA 3IXDA 2V2FF 1PI4A 4S2JA 5EVIA 3E98A 3DTIA 4X56A 1BYWA 5EV0A 1ERQA 4Y2FA 4OLDA 3CITA 1K4EA 1E4DA 2KOIA 5M19A 3FPWA 4HBTA 1XFQA 4JF6A 2W3GA 3PR6A 2A3UA 5HWTA 3PHYA 1LHYA 5EOOA 5FQQA 1JTGA 5I94A 3AGFA 2J7VA 2PYPA 3BFCA 4HJ3A 5HWVA 4K0WA 3V50A 1MKMA 1P0ZA 3IWIA 3FV7A 3N4IA 3NECA 1K57A 3BFEA 1ALQA 3BQ8A 3WS0A 3NOPC 4DKIA 3V5MA 1L0DA 4DDYA 3K3CA 5CEDA 1XKZA 3CUEC 1T1CA 4KG5A 3O86A 1NZOA 1ESUA 4MEZA 1JVJA 4DDSA 3BFDA 3BY8A 2EWVA 4CPKA 4Q0IA 1KGGA 1BT5A 3UN7A 4HHDA 4P85A 5HX9A 2WKHA 4OPZA 3HUMA 1KE3A 3C7VA 2HP9A 3UE3A 4PHTA 2Y2HA 3KX0X 4FTXA 4G3VA 5FL3A 3MZDA 4N1HA 2VK3A 2W1RA 4ZDXA 2Q9MA 4DXBA 3HJIA 4EXOA 1OTEA 5F68A 4Y0TA 1DRMA 1NWZA 3T1RA 4FD8A 4QHCA 4WN5A 1EI5A 2QWSA 1ZTUA 2I72A 5HDCA 4CLCD 3K2NA 1YLZA 3Q7ZA 4BBTA 1KE0A 3HL9A 2P9VB 3IBJA 4HEFA 2B5RA 4D60A 1PW8A 5E2FA 4LV1A 1BSGA 2W27A 1YLPA 1UWPX 3HLDA 3WWXA 4DE3A 3ZNTA 1K38A 4U0XA 3F1OB 4NXFA 5M18A 2OWJA 5TGFA 2JKFA 3FWLA 3VSLA 5DJTA
chains in the Genus database with same CATH topology
5HPFA 4L9FA 1EW0A 4Q0JA 1D7EA 3T4JA 1GSXA 2V9AA 2VV8A 2L4RA 4GJ4A 4H6JA 4R3AA 5F6AA 2K31A 2OAQ1 4LRZE 2A24A 2V1AA 1NLZA 2HV1A 4G3WA 4O0PA 3PBNA 5HWWA 5HDSA 3OBFA 4WLAA 3KSIA 4GS9A 2LB9A 4I38A 2OOLA 3LICA 1DP9A 1GSVA 2ZMFA 3MR0A 3EWKA 2VV6A 4BBUA 2XA7M 4LLOB 3TE8A 1T1AA 1OTBA 1STZA 5K5BA 2A24B 4IJGA 5EFWA 1TD5A 4G3KA 2GNXA 4EUVA 4GW9A 3KSFA 3H7WA 2D02A 1N9OA 3B42A 3FC7A 3MQQA 2YKFA 3PBOA 3PBRA 2K7SA 3JVUA 3UB8A 3ZQ5A 3UMEA 5KSHA 3E0YA 3T4QA 3MQOA 4BJPA 4GLQA 1OTDA 3VV4A 5TBMA 1T19A 3LFVA 2JHEA 5G4YA 2OWHA 4PKYA 1W63Q 3NHQA 5IU1A 3T4SA 4DMZA 3UB7A 4MDZA 3KSHA 3E4OA 1DP6A 3E4QA 3LR4A 3H82A 3VE3A 2J80A 2ZBBA 4F3LA 4HJ4A 1NRJA 5TBMB 1TS0A 4GHIA 4JGPA 1TF1A 2M1CA 3OCLA 2QKPA 1KOUA 3T4KA 4PKYG 3RTYA 2W3HA 4NKPA 5J4EA 5L8MA 1TS7A 3OLOA 3UB9A 4HP9A 2IA2A 2O9AA 3PBQA 2O99A 2W3DA 3MF0A 4O01A 2B18A 4BMWA 2Z6CA 3PBTA 3U2AA 3VE4A 1P9WA 4MN5A 4JGQA 2LB5A 2VA0A 2J3TC 4R6LA 1DP8A 3MFXA 4I39A 4LPZA 4WELA 2HJEA 2O9BA 3HJKA 4HI4A 5HPIA 1OT6A 2GX5A 5LBRA 2J3WA 3LR0A 4HY8A 1YAXA 4KQDA 5HD3A 3V67A 1GSWA 3EEAA 5HDDA 3MJQA 4B9OA 5G4ZA 4K08A 3E4PA 4QPRA 3BQAA 5AVFA 1D06A 3MQ0A 2XROA 2VGLS 4IUKA 4I3JA 5J3WA 4M4XA 2WKQA 3S7QA 2QJ5A 4I3IA 3F1NA 3A0VA 3C38A 4HP4A 4EESA 2PT7A 4BBVA 4GCZA 3SW1A 3ZYTA 1LSVA 4L9GA 2J3TD 5MC7A 1LT0A 2XA7S 2VGLM 4KUKA 3T4OA 4HQAA 4E04A 4HOIA 4L9EA 2W1TA 3TJZC 4EEPA 2VJWA 3KYQA 4NXBA 4PAUA 3F1NB 3EQVA 2W3EA 2D01A 2VLGA 3EGXC 3R7WA 4R38A 5HL6A 4H6JB 2PDRA 4JGOA 2Y79A 3LIAA 3OOVA 1P97A 3EOIA 3S7PA 2L0WA 1IFQA 1F98A 2YKHA 2W1TB 3BW6A 3IS2A 4EW7A 5KIZA 4GS9B 2P04A 4LRXC 2P08A 2WKRA 3KYZA 3G6OA 4ETZA 2VKSA 3NOUC 3EGDC 1OT9A 5AJGA 1H8MA 1TS6A 4WUJA 1N9NA 2JKTM 3FG8A 1YSQA 4FSFA 2QHKA 3KSGA 3O5YA 4ARZA 3H7WB 2O9CA 3IBRA 2JKRM 4WF0A 4R70A 5DKLA 2G7UA 5I5LA 3CWFA 2P7JA 3PYPA 3R4KA 2K2NA 3BWLA 4P6ZS 3CI6A 1S1ZA 3C2WA 4FOFA 2A2LA 2HGVA 4MN7A 3UB6A 4DJ3A 4CLCC 5HZHA 5DJUA 5DF9A 4EQ1A 5J7EA 2MJ6A 2I9VA 3JVVA 2GZAA 3GECA 2VZWA 3NJAA 3B47A 4ARZB 4HIAA 4UEYA 2CMNA 2L1MA 3LR3A 2HF6A 2OAP1 3S7OA 4LRYC 2PYRA 1XJ4A 3MMHA 3H82B 4P6ZM 4Q0HA 1YSPA 4F3LB 3C30A 2EWWA 2JN7A 4JGRA 3F1PA 4ETXA 2PD8A 4GHIB 4OOMA 3LI8A 4I5SA 3D3OA 4EEUA 2VV7A 4BWIA 3CLOA 1S4RA 4II7A 1X0OA 4EETB 3OC2A 2W3FA 1OTIA 2V1BA 4XT2A 1IOUA 1XFNA 1MZUA 5DFYA 1V9ZA 3TW8A 2BASA 2V0WA 3GDIA 4RQ9A 1YKDA 1OJ5A 4KUOA 1VHMA 5TJJA 1OJGA 2B02A 3LIEA 4AFIA 4NXEA 3UMDA 4HJ6A 3LI9A 4Y5FA 2KDKA 2INWA 4Z1WA 1F5MA 4EU0A 3E98A 2ZOIA 2M7VA 3LR5A 1WA9A 1MC0A 1S1YA 1BYWA 4OOLA 4Y2FA 3CITA 2R78A 2ZOHA 3PXPA 4NEED 2KOIA 4I3AA 1P9RA 5F69A 4DN0A 3FPWA 3T50A 1XFQA 5HSQA 2NUPC 2W3GA 3PR6A 5DKKA 4O8GA 2HJ9C 5HWTA 2FZ0A 4YWZA 3PHYA 5CX7A 4Y3IA 2EA9A 2QJ7A 3BY9A 3EQUA 3NOTC 1ODVA 2NUTC 1V9YA 1LSWA 4HNBA 3MXQA 1XJ3A 5F5YA 4IHQA 4B93A 1OTAA 1F9IA 4ZRRA 2PYPA 1T18A 1S66L 4HJ3A 2V0UA 3D72A 3LYXA 4EERA 5HWVA 3DBAA 1MKMA 1P0ZA 2VX8A 4ME4A 4DJ2A 3CAXA 3LUQA 3ULFA 3LIDA 5DFXA 3R7WB 1W63M 2PHYA 2JKTI 1VB6A 3BQ8A 3KO6A 4YOFA 3LIFA 4YNRA 2W0NA 3TRCA 3NOPC 3H9WA 2Z6DA 4WEKA 5C5KA 4HH3A 2VEAA 3IS2B 3K3CA 2JKRI 2M7UA 3CUEC 1T1CA 2FH5A 2WKPA 4UQIS 3FPVA 2XRNA 3BY8A 2EWVA 4Q0IA 5AVEA 3C8CA 4HHDA 5A8BA 3OCNA 3HCYA 1OPXA 2PD7A 3T4TA 3VOLA 4CLCE 5HD5A 2Y8HA 2KX6A 2H28A 3P01A 4UQIM 3RH8B 3UE3A 4PHTA 3CUEA 2KLIA 3P7NA 4L0LA 3KX0X 1XJ2A 4CQHA 1XJ6A 4G3VA 2QYBA 5FL3A 3S7NA 3UE6A 3B33A 4CLCA 1S67L 1UGUA 2W1RA 1H3QA 2PR5A 3HJIA 4EXOA 3T4LA 1OTEA 5F68A 1DRMA 1NWZA 3ICYA 3EEHA 4WEJA 4WN5A 1LL8A 1TS8A 3PBSA 2QWSA 1ZTUA 3F1OA 3LIBA 5HDCA 1N9LA 1LSXA 4CLCD 3K3DA 1T1BA 1G6OA 3F1PB 3K2NA 1ZHHB 2ZMVA 3BJNA 1JNUA 4CLCB 4BBTA 3A0SA 4KQOA 2DMWA 2PR6A 3IBJA 5IS1A 2O0YA 2W27A 1UWPX 1NLYA 3W2ZA 1S4SA 4XT2B 1G28A 4HH2A 2XSSA 4MN6A 3A0RA 1UWNX 3RFBA 3F1OB 4MMNA 4NXFA 4IUHA 4MCWA 4NXGA 2OWJA 4WL9A 2GJ3A 1Y28A 5IT5A 5DJTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L9F A;  1EW0 A;  1D7E A;  1GSX A;  2V9A A;  2VV8 A;  2L4R A;  4H6J A;  4R3A A;  5F6A A;  4LRZ E;  2A24 A;  2V1A A;  2HV1 A;  5HWW A;  5HDS A;  4WLA A;  4GS9 A;  4I38 A;  2OOL A;  3LIC A;  1DP9 A;  1GSV A;  3MR0 A;  3EWK A;  2VV6 A;  4BBU A;  4LLO B;  1T1A A;  1OTB A;  2A24 B;  5EFW A;  4GW9 A;  3H7W A;  2D02 A;  1N9O A;  3MQQ A;  3FC7 A;  2YKF A;  2K7S A;  3UB8 A;  3ZQ5 A;  3UME A;  3MQO A;  1OTD A;  5TBM A;  1T19 A;  2JHE A;  5G4Y A;  2OWH A;  4PKY A;  3NHQ A;  5IU1 A;  3UB7 A;  3E4O A;  1DP6 A;  3E4Q A;  3H82 A;  3VE3 A;  2J80 A;  2ZBB A;  4F3L A;  4HJ4 A;  5TBM B;  1TS0 A;  4GHI A;  4JGP A;  2M1C A;  2QKP A;  1KOU A;  4PKY G;  3RTY A;  5J4E A;  1TS7 A;  3OLO A;  3UB9 A;  4HP9 A;  2Z6C A;  3VE4 A;  4MN5 A;  4JGQ A;  4R6L A;  1DP8 A;  3MFX A;  4I39 A;  4LPZ A;  3HJK A;  4HI4 A;  1OT6 A;  4HY8 A;  4KQD A;  5HD3 A;  1GSW A;  5HDD A;  3MJQ A;  4B9O A;  5G4Z A;  4K08 A;  3E4P A;  5AVF A;  1D06 A;  4I3J A;  5J3W A;  4M4X A;  2WKQ A;  2QJ5 A;  4I3I A;  3F1N A;  3A0V A;  4HP4 A;  4EES A;  4BBV A;  4GCZ A;  3SW1 A;  1LSV A;  4L9G A;  1LT0 A;  4KUK A;  4HQA A;  4E04 A;  4HOI A;  4L9E A;  4EEP A;  4NXB A;  3F1N B;  2D01 A;  2VLG A;  4R38 A;  4H6J B;  2PDR A;  4JGO A;  3LIA A;  1P97 A;  2L0W A;  1F98 A;  2YKH A;  4EW7 A;  3IS2 A;  5KIZ A;  4GS9 B;  4LRX C;  2WKR A;  3G6O A;  3NOU C;  1OT9 A;  1TS6 A;  4WUJ A;  1N9N A;  3FG8 A;  2QHK A;  3H7W B;  3IBR A;  4WF0 A;  4R70 A;  5DKL A;  5I5L A;  3CWF A;  2P7J A;  3PYP A;  3BWL A;  1S1Z A;  3C2W A;  3UB6 A;  4DJ3 A;  5HZH A;  5DJU A;  4EQ1 A;  5J7E A;  2I9V A;  3GEC A;  3NJA A;  4HIA A;  2CMN A;  2L1M A;  4LRY C;  2PYR A;  1XJ4 A;  3H82 B;  4F3L B;  2JN7 A;  4JGR A;  3F1P A;  2PD8 A;  4GHI B;  3LI8 A;  4I5S A;  4EEU A;  2VV7 A;  3CLO A;  1S4R A;  1X0O A;  4EET B;  1OTI A;  2V1B A;  4XT2 A;  1XFN A;  1MZU A;  1V9Z A;  2BAS A;  2V0W A;  3GDI A;  4RQ9 A;  1OJ5 A;  4KUO A;  1OJG A;  2B02 A;  3LIE A;  4NXE A;  3UMD A;  4HJ6 A;  3LI9 A;  2KDK A;  2INW A;  2ZOI A;  1WA9 A;  1S1Y A;  1BYW A;  2R78 A;  2ZOH A;  4I3A A;  5F69 A;  3T50 A;  1XFQ A;  5HSQ A;  5DKK A;  5HWT A;  4YWZ A;  3PHY A;  2EA9 A;  2QJ7 A;  3BY9 A;  3NOT C;  1ODV A;  1V9Y A;  1LSW A;  4HNB A;  3MXQ A;  1XJ3 A;  5F5Y A;  1OTA A;  1F9I A;  2PYP A;  1T18 A;  4HJ3 A;  1S66 L;  2V0U A;  3D72 A;  3LYX A;  4EER A;  5HWV A;  1P0Z A;  4DJ2 A;  3CAX A;  3LUQ A;  3ULF A;  3LID A;  2PHY A;  1VB6 A;  3LIF A;  2W0N A;  3NOP C;  3H9W A;  2Z6D A;  4HH3 A;  2VEA A;  3IS2 B;  3K3C A;  1T1C A;  2WKP A;  3BY8 A;  5AVE A;  3C8C A;  4HHD A;  5A8B A;  2PD7 A;  3VOL A;  5HD5 A;  2KX6 A;  2H28 A;  3RH8 B;  3P7N A;  3KX0 X;  1XJ2 A;  1XJ6 A;  3UE6 A;  3B33 A;  1S67 L;  1UGU A;  2PR5 A;  3HJI A;  4EXO A;  1OTE A;  5F68 A;  1DRM A;  1NWZ A;  3ICY A;  3EEH A;  4WN5 A;  1LL8 A;  1TS8 A;  2QWS A;  5HDC A;  3LIB A;  3F1O A;  1N9L A;  1LSX A;  3K3D A;  1T1B A;  3F1P B;  1JNU A;  4BBT A;  3A0S A;  2PR6 A;  5IS1 A;  2W27 A;  1UWP X;  1S4S A;  4XT2 B;  1G28 A;  4HH2 A;  4MN6 A;  3A0R A;  1UWN X;  3F1O B;  4NXF A;  4NXG A;  2OWJ A;  4WL9 A;  2GJ3 A;  1Y28 A;  5DJT A; 
#chains in the Genus database with same CATH topology
 2IWD A;  3QNC A;  4L9F A;  3C4P A;  1EW0 A;  1CEG A;  1K6R A;  4H6J A;  4R3A A;  4KG2 A;  1KDW A;  2A24 A;  3G31 A;  2RL3 A;  5HWW A;  3Q7V A;  3OBF A;  3KSI A;  4KZ3 A;  2ZMF A;  1W79 A;  4BL3 A;  2VV6 A;  4LV3 A;  2DRW A;  4R4R A;  1STZ A;  5EFW A;  4GB7 A;  3KSF A;  3PBO A;  3FC7 A;  3PBR A;  3CZD A;  3JVU A;  3UPP A;  1K54 C;  3MQO A;  1OTD A;  3VV4 A;  5TBM A;  3UPN A;  5GLA A;  1U60 A;  1MWR A;  4EBP A;  3BEB A;  1TEM A;  2WGW A;  2UWX A;  1ZC2 A;  4DMZ A;  4OH0 A;  2V8C A;  2Y2M A;  3E4O A;  3E4Q A;  5F1F A;  4MLL A;  4Y13 A;  3A3D A;  2ZBB A;  1KGE A;  3MXS A;  4IVI A;  5CRF A;  2Y91 A;  4JKT A;  2M1C A;  1KOU A;  3ZVW A;  1XA1 A;  5DF7 A;  3RTY A;  5J4E A;  5L8M A;  4HBU A;  3GMW A;  3UB9 A;  4HP9 A;  2FFY A;  3PBQ A;  1XP4 A;  1XGJ A;  5EPH A;  1HLU P;  3LCE A;  5HL1 A;  5KMW A;  4R6L A;  4BL2 A;  4S2L A;  4UA9 A;  5HPI A;  4XUX A;  1IKG A;  3LR0 A;  4HY8 A;  3Q07 A;  5HD3 A;  3EEA A;  5HDD A;  4N92 A;  4K08 A;  4KG6 A;  3ZDJ A;  4FUW A;  5CHU A;  4R0Q A;  5AVF A;  2Z2L B;  4JF4 A;  4X69 A;  2VGL S;  4IED A;  2XFT A;  3IF5 A;  3NY4 A;  1H5X A;  4M4X A;  4IBR A;  4HP4 A;  4ZTK A;  4GCZ A;  3WRZ A;  1PWC A;  3ZCZ A;  3DW0 A;  2Z2M B;  2XF3 A;  4KUK A;  5EVL A;  2QZ6 A;  5FAP A;  4E3M A;  2W1T A;  1S6R A;  1F2K A;  4PM9 A;  1IYO A;  5CTM A;  4N9K A;  2EX6 A;  2Y2L A;  4S2N A;  1PI5 A;  1P97 A;  4DE2 A;  4D2O A;  3DAV A;  4LGW A;  4MBK A;  2XGN A;  3S22 A;  4EW7 A;  2WKR A;  3G6O A;  3NI9 A;  2VKS A;  3NOU C;  3EGD C;  4RX2 A;  3MZF A;  4U0T A;  1TS6 A;  3ZG0 A;  4EWF A;  4KZ6 A;  1YSQ A;  3O5Y A;  4ARZ A;  3H7W B;  2O9C A;  3CWF A;  2P7J A;  2J9P A;  3R4K A;  2K2N A;  4P6Z S;  1FIK A;  3CI6 A;  4JLF A;  5FI2 A;  1Q2P A;  3BLM A;  5J7E A;  1CI8 A;  3JVV A;  3RXX A;  2VZW A;  4IVK A;  4UEY A;  4HIA A;  2L1M A;  2X02 A;  1L3L A;  1NYM A;  4LRY C;  1XJ4 A;  3OPP A;  3H82 B;  5FQM A;  4Q0H A;  4QD4 A;  4F3L B;  2EWW A;  3SOI A;  2ZM8 A;  1BTL A;  4GHI B;  4I5S A;  4S2P A;  2V20 A;  3D3O A;  3LY3 A;  1W8Q A;  4E6W A;  3LGO A;  3UE1 A;  3ISG A;  3IX3 A;  5FDH A;  5CGS A;  2HPB A;  4WMC D;  2A49 A;  5A91 A;  4RQ9 A;  1PWG A;  3O88 A;  4JXS A;  4MBF A;  4NXE A;  3T12 B;  2IWB A;  3DWK A;  2INW A;  2WKE A;  4UHU A;  5FAO A;  1ZKJ A;  3UO9 A;  1S1Y A;  4OOL A;  3PXP A;  3Q82 A;  4NEE D;  4I3A A;  5F69 A;  1NZU A;  3T50 A;  5HSQ A;  2NUP C;  3MFD A;  1BUE A;  2WKI A;  3W4O A;  3NOT C;  5CEC A;  4HNB A;  1XJ3 A;  3QP5 A;  4B93 A;  4ZRR A;  1T18 A;  4WM9 A;  1S66 L;  2B95 A;  3SZT A;  2V0U A;  2ZQD A;  2QPN A;  5FQI A;  1RCJ A;  5DFX A;  5EM1 A;  2PHY A;  2XD5 A;  1MWS A;  1VB6 A;  2OLV A;  3KO6 A;  4YOF A;  2W0N A;  1XGI A;  3TRC A;  3VFF A;  2Y2P A;  3S1Y A;  1NJ4 A;  3B3X A;  3IS2 B;  2JKR I;  4K91 A;  2M7U A;  2FH5 A;  2WKP A;  4OKP A;  5AQ7 A;  4O7D A;  4DXC A;  3IX4 A;  5AVE A;  2Y2N A;  3C8C A;  1HZO A;  5F83 A;  5E2G A;  5EVE A;  3VOL A;  3HLE A;  2KX6 A;  3VMA A;  2XH9 A;  3ITA A;  3CUE A;  2KLI A;  1D1J A;  4L0L A;  3OPR A;  2QMI A;  4CLC A;  1S67 L;  1UGU A;  2HDU A;  1VM1 A;  4PPR A;  3O87 A;  1H3Q A;  4ZAM A;  1I2W A;  1PNE A;  2XD1 A;  3IF6 A;  1Y54 A;  4WEJ A;  3IH8 A;  1TVF A;  3BFG A;  3GR2 A;  1KVL A;  3K3D A;  1T1B A;  2R9X A;  3F1P B;  3IX8 A;  4KQO A;  2DMW A;  2PR6 A;  4GOG A;  5JYP A;  1PIO A;  2O0Y A;  1NLY A;  3W4Q A;  3PAE A;  3SH9 A;  4XT2 B;  2PAV P;  3HUO A;  1G28 A;  3QHY A;  1FSY A;  2ZQ7 A;  4MN6 A;  3A3F A;  1LI0 A;  4C3Q A;  4E3O A;  3ZHH A;  4WL9 A;  1ZG4 A;  5KZH A;  5IT5 A;  3PTE A;  4KZA A;  4WZ5 C;  2X01 A;  1K55 A;  1D7E A;  5FAQ A;  1ES2 A;  3D4F A;  5E2E A;  4LRZ E;  1NLZ A;  3JPU A;  1SHV A;  5HDS A;  1SDN A;  5DTS A;  1GSV A;  3CJM A;  1PFL A;  3MR0 A;  5L10 A;  2XA7 M;  1G68 A;  5E43 A;  3TE8 A;  1OTB A;  5HAI A;  5L07 A;  2ZQA A;  4OQG A;  1MY8 A;  1FCO A;  3H7W A;  2V8F A;  2YKF A;  4YFM A;  3ZQ5 A;  2C5W B;  3UME A;  5KSH A;  3T4Q A;  4GLQ A;  3LEZ A;  4GDN A;  5G4Y A;  3SS4 A;  3IWO A;  3NHQ A;  2H5S A;  4ZJ1 A;  2E8J A;  1YLJ A;  4MDZ A;  2VGK A;  3H82 A;  1K54 A;  1YMS A;  4F3L A;  4QB8 A;  4U3T A;  4X6T A;  1NRJ A;  2Y2Q A;  1TS0 A;  4GHI A;  3UY6 A;  2JE5 A;  3SS5 A;  3QP6 A;  4UA6 A;  5CTN A;  3NCK A;  4PKY G;  2W3H A;  4NKP A;  3QP4 A;  2O9A A;  3NDE A;  2W3D A;  3MF0 A;  4O01 A;  2B18 A;  4BMW A;  2G2U A;  3NIA A;  3T1X A;  2Z6C A;  4JGQ A;  1BLP A;  4F94 A;  4C75 A;  3VOZ A;  1E25 A;  2ZQ8 A;  3MFX A;  2DCF A;  3TOI A;  4LPZ A;  2O9B A;  3HJK A;  3OPL A;  2ZL1 A;  4Y15 A;  5FEG A;  2H10 A;  3V67 A;  4KQD A;  1FSW A;  1GSW A;  3P98 A;  3VP1 A;  4B9O A;  5G4Z A;  3QP8 A;  4E3I A;  1Q2Q A;  3BQA A;  2Y2J A;  3ZNY A;  3IWQ A;  1D06 A;  4IUK A;  4JXW A;  2QJ5 A;  3ITB A;  4I3I A;  2Y2I A;  3A0V A;  1H8Z A;  1PZP A;  4EQI A;  1GCE A;  4EES A;  3SW1 A;  3ZYT A;  4L9G A;  1LT0 A;  2VGJ A;  1MWU A;  3BM6 A;  1SCW A;  1LL9 A;  2JC7 A;  1RP5 A;  4EEP A;  3CHW P;  4PAU A;  3F1N B;  5FI7 A;  4JBF A;  2W3E A;  2D01 A;  2XDM A;  1L0F A;  4FCF A;  1K57 C;  3DTK A;  2PDR A;  1KE4 A;  3IQA A;  5DTK A;  3HLB A;  3OOV A;  2BLS A;  1F98 A;  3BW6 A;  1FR6 A;  1YMX A;  3IS2 A;  5EOE A;  2P04 A;  2P08 A;  1JWV A;  4DRT A;  5E2H A;  4JXV A;  3T1Q B;  3ZG8 B;  1MBL A;  4WUJ A;  1N9N A;  3FG8 A;  5DVA A;  2QHK A;  2HDR A;  1DJB A;  3CG5 A;  3IBR A;  2JKR M;  5DKL A;  1CEF A;  1ESI A;  2ACG A;  1S1Z A;  3C2W A;  4MN7 A;  3UB6 A;  2HGV A;  4DJ3 A;  1A0K A;  5FAS A;  4R3B A;  2GZA A;  3Q1F A;  5F82 A;  2CMN A;  3LR3 A;  2HF6 A;  3G32 A;  3MMH A;  1FOF A;  5HFO A;  2JCH A;  5HAP A;  3F1P A;  4WMC A;  4OOM A;  4B88 A;  3WS5 A;  1S4R A;  2EX8 A;  4WYY A;  4XT2 A;  1G5U A;  5GLD A;  3ZG7 B;  3VP4 A;  3GTC A;  1KDS A;  1ERO A;  2CC1 A;  4UAA A;  1OJ5 A;  4KUO A;  3SH8 A;  1VHM A;  3LIE A;  1BLC A;  4AFI A;  2PRF A;  1NRF A;  4HJ6 A;  2EXA A;  1K6S A;  4OQI A;  4ZBE A;  4EU0 A;  2Q9N A;  2ZOI A;  2ZM2 A;  4GN2 A;  3LR5 A;  1MC0 A;  3VP0 A;  2ZOH A;  4NET A;  3MZE A;  3QNB A;  1XX2 A;  4P0M A;  1SKO B;  1IYP A;  4PM8 A;  2HJ9 C;  4JXG A;  2FZ0 A;  1Z09 A;  5M1A A;  1VET B;  2Y2O A;  5CX7 A;  2EA9 A;  2QJ7 A;  3V3S A;  1V9Y A;  3MXQ A;  2Y2K A;  3G34 A;  5F5Y A;  3HLF A;  1K56 A;  2ZQ9 A;  5BOH A;  1F9I A;  3MBZ A;  1W5D A;  4BEN A;  1ONH A;  4RA7 A;  3D9Y A;  3OPH A;  4X53 A;  4EER A;  3CMZ A;  1EWZ A;  3DBA A;  2VX8 A;  4ME4 A;  3CAX A;  1CF0 A;  3LUQ A;  4KZ8 A;  3I7J A;  3R7W B;  3TSG A;  3ULF A;  4S2K A;  2JKT I;  4E6X A;  4EBN A;  4OPQ A;  3AGE A;  4ESP A;  4WEK A;  3GQZ A;  5G18 A;  5FDS A;  2WUQ A;  2XRN A;  1VQQ A;  1IYS A;  4LFU A;  2XEP A;  2BG1 A;  3IXB A;  5A8B A;  3HCY A;  4GNU A;  5GL9 A;  4CLC E;  5HD5 A;  2Y8H A;  1YQS A;  2H28 A;  2EFX A;  2WAE A;  4UQI M;  1DJC A;  2ZLY A;  3RH8 B;  3P7N A;  2ZC3 B;  2XK1 A;  1CK3 A;  1XJ2 A;  5GLC A;  3G2Z A;  1S0W A;  3UE6 A;  2WK0 A;  3B33 A;  4UA7 A;  2P9V A;  1C3B A;  3BYD A;  3WS4 A;  3T4L A;  2PBD P;  3ICY A;  1LL8 A;  2PBY A;  3C7U A;  2G2W A;  4X55 A;  4KQQ A;  2BTF P;  3F1O A;  3LIB A;  1N9L A;  1LSX A;  1ES4 A;  3UDX A;  5CGX A;  2WGI A;  3A0S A;  3M6B A;  4K0X A;  3W2Z A;  1FR1 A;  3FYZ A;  4RYE A;  1S4S A;  1VEU B;  2XSS A;  5D3O A;  3A0R A;  1UWN X;  3RFB A;  4XUZ A;  1FCN A;  2XQZ A;  1LI9 A;  1Y28 A;  5A93 A;  1DY6 A;  3MSH A;  4FH4 A;  3UE0 A;  3NBL A;  3VP2 A;  5HPF A;  3IHB A;  1ERM A;  4Q0J A;  4H8R A;  5A92 A;  1GSX A;  1E3U D;  2VV8 A;  3M2J A;  4GJ4 A;  4R23 A;  2K31 A;  2OAQ 1;  4KZ7 A;  4KEN B;  5FAT A;  3N7W A;  3PBN A;  5HAR A;  4WLA A;  4WZ5 A;  4KZ4 A;  3LIC A;  3A3J A;  4ZJ2 A;  3EWK A;  4LLO B;  4B4X A;  1W8Y A;  1T1A A;  5CEB A;  4A5R A;  1O07 A;  2FFF B;  1K56 D;  2A24 B;  3G30 A;  4IJG A;  1TD5 A;  4G3K A;  5KSC A;  1I5Q A;  4EUV A;  4E3L A;  2D02 A;  1N9O A;  4BQM A;  3UNW A;  3UB8 A;  2Y4A A;  3E0Y A;  1PWD A;  4XXR A;  4BD1 A;  4BJP A;  1T19 A;  3N8L A;  3LEQ A;  3BFF A;  4WZ4 A;  3L7H A;  3LFV A;  2JHE A;  2WAD A;  3QP2 A;  4PKY A;  1W63 Q;  5IU1 A;  3T4S A;  1RGY A;  3IXH A;  1HD8 A;  3KSH A;  1DP6 A;  4HJ4 A;  2H0Y A;  5TBM B;  1YLT A;  1TF1 A;  4B4Z A;  2WGW B;  3T4K A;  4CJN A;  3A3E A;  1Z6F A;  2IA2 A;  2O99 A;  3G35 A;  3VE4 A;  1MKI A;  1P9W A;  3PAG A;  2LB5 A;  3IHA A;  2VA0 A;  2J3T C;  3UDF A;  3C5A A;  4I39 A;  4WEL A;  5FEF A;  3A3I A;  2OV5 A;  1DJA A;  2J3W A;  1YAX A;  2JKG A;  2ZC7 A;  3MJQ A;  3GV9 A;  5EE8 A;  1FQG A;  2OSU A;  1PZO A;  3HVF A;  1IYQ A;  4WBG A;  5L09 A;  3HLW A;  3FKV A;  3MQ0 A;  2XRO A;  2HP6 A;  4I3J A;  3IT9 A;  5J3W A;  2WKQ A;  2EXB A;  1SKO A;  5FQK A;  2PT7 A;  4BBV A;  2J3T D;  1ZG6 A;  3E2L A;  4S2O A;  5MC7 A;  1BLH A;  3VFH A;  3MS6 A;  5FQ9 A;  3T4O A;  2Y55 A;  2J9O A;  3W8K A;  4E04 A;  4HOI A;  4FH2 A;  4L9E A;  3TJZ C;  3SH7 A;  5IHV A;  1ONG A;  1YM1 A;  2XR0 A;  4NXB A;  4OVD A;  1MXO A;  1IKI A;  4DE1 A;  4Y17 A;  3R7W A;  4PM5 A;  1I2S A;  1FIL A;  3U4L P;  1CJF A;  3EOI A;  3S7P A;  2L0W A;  1RGZ A;  1YT4 A;  2W1T B;  4GS9 B;  4Y7P A;  3KYZ A;  3UB5 P;  2HDS A;  1XA7 A;  5AJG A;  2JKT M;  2H0T A;  3NUL A;  3KSG A;  5CHJ A;  1WYC A;  4R70 A;  1H8Y A;  2G7U A;  5I5L A;  2EX9 A;  1L0G A;  3BWL A;  4FOF A;  5GHZ A;  3HLC A;  4CLC C;  5HZH A;  3IXG A;  5DF9 A;  2ZQC A;  4EQ1 A;  2MJ6 A;  3W4P A;  3NJA A;  3B47 A;  1JTD A;  3IF6 C;  4ARZ B;  3S7O A;  4X1L A;  2PYR A;  4LEN A;  3N8S A;  5TFQ A;  1YSP A;  2ZMA A;  3GVB A;  4QJG A;  3LI8 A;  4QY6 A;  1NYY A;  2VV7 A;  4LCM A;  3CLO A;  1BUL A;  3RJU A;  4II7 A;  1JWZ A;  1X0O A;  3OC2 A;  1OTI A;  1VEU A;  4QWO A;  2ZJ9 A;  1XFN A;  1MZU A;  5DFY A;  5EVI C;  1YLY A;  3C4O A;  2DNS A;  4QU3 A;  3DTE A;  1TDG A;  2WZX A;  4S2I A;  4LCL A;  3IH9 A;  3LO7 A;  1K55 C;  3N8R A;  4P87 A;  1CQA A;  4JF5 A;  3GRJ A;  4OP8 A;  3P09 A;  3LI9 A;  1KGF A;  2KDK A;  4Z1W A;  3GSG A;  1F5M A;  5HW3 A;  4MBH A;  3NDG A;  2M7V A;  1WA9 A;  3S4X A;  1ES3 A;  2R78 A;  1K25 A;  1P9R A;  4DN0 A;  2HZ5 A;  5DKK A;  4O8G A;  3E2K A;  4YWZ A;  3WS2 A;  5EVI D;  5L2F A;  4Y3I A;  3BY9 A;  3EQU A;  3CPT B;  2ZC5 B;  4QY5 A;  1ODV A;  2NUT C;  1LSW A;  4KZ5 A;  1YPR A;  4IHQ A;  1OTA A;  1M40 A;  4NG2 A;  5JYO A;  2ZC6 B;  1WYB A;  3T1S A;  3M6H A;  3LYX A;  3D72 A;  5EUA A;  4DJ2 A;  1LL5 A;  3VOY A;  3LID A;  4OQ0 A;  1W63 M;  3G2Y A;  3LIF A;  1QMF A;  4YNR A;  2P74 A;  1OME A;  3L9K A;  3H9W A;  2Z6D A;  4PMA A;  5FSR A;  1ES5 A;  4R4S A;  5C5K A;  5CGW A;  4HH3 A;  5FA7 A;  2VEA A;  4C6Y A;  4UQI S;  4X25 A;  3FPV A;  1XPB A;  3BLS A;  1PRQ A;  3G4P A;  3UPO A;  3OCN A;  4Y0U A;  4Y0O A;  1OPX A;  2PD7 A;  3T4T A;  1SZV A;  4PM6 A;  3P01 A;  1HVB A;  3LY4 A;  2X71 A;  4ID4 A;  1SKF A;  3Q81 A;  2WZZ A;  3HLG A;  5EEC A;  1PW1 A;  4GD6 A;  4CQH A;  1XJ6 A;  5DTT A;  2QYB A;  3S7N A;  4IBX A;  3N6I A;  2XFS A;  2PR5 A;  4MNR A;  4GDB A;  4OLG A;  3EEH A;  2EFU A;  1TS8 A;  4LV2 A;  4N9L A;  3PBS A;  3NC8 A;  1G6O A;  2ZMV A;  3BJN A;  1ZHH B;  2PU2 A;  1K4F A;  1JNU A;  4CLC B;  3M2K A;  5CXW A;  5IS1 A;  1L0E A;  4RX3 A;  3FKW A;  3IF6 B;  1M6K A;  4OP5 A;  4DE0 A;  4X1M A;  4BLM A;  1GHM A;  4YIN A;  3ZFZ A;  1J9M A;  4HH2 A;  1E3U A;  4GD8 A;  3OZH A;  4MMN A;  3HBR A;  4IUH A;  4MCW A;  5J8X A;  1KVM A;  4NXG A;  4ZJ3 A;  2GJ3 A;  5CHM A;  2Y59 A;  1H0M A;  5DF8 A;  3BEC A;  3HUN A;  3T4J A;  2V9A A;  2WGV A;  4OPR A;  2L4R A;  1PYY A;  5F6A A;  5EVI B;  3SS3 A;  5TR7 A;  2V1A A;  2HV1 A;  4G3W A;  1W7F A;  4M3K A;  4O0P A;  4EV4 A;  2PU4 A;  4GS9 A;  1YLW A;  2LB9 A;  4I38 A;  2OOL A;  1DP9 A;  3FZC A;  4BBU A;  5K5B A;  1IEM A;  2HDQ A;  4LV0 A;  1ACF A;  1MPL A;  2GNX A;  4GW9 A;  3B42 A;  3MQQ A;  1K0K A;  2K7S A;  2J8Y A;  2OLU A;  1CI9 A;  2AVX A;  2C6W B;  1TDL A;  2OWH A;  4HES A;  1GA0 A;  2ZC4 B;  5U47 A;  4E3K A;  3DWZ A;  1BLS A;  3UB7 A;  3DTM A;  3LR4 A;  3VE3 A;  2J80 A;  5FI6 A;  4JGP A;  3OCL A;  4NK3 A;  2QKP A;  1N9B A;  3KYE A;  1TS7 A;  3OLO A;  3AGD A;  4P6B A;  3V39 A;  4Z9Q A;  1QME A;  1NXY A;  3PBT A;  2ZM0 A;  3U2A A;  4MN5 A;  5GLB A;  4EBL A;  1DP8 A;  3TG9 A;  2R9W A;  2HJE A;  4KZB A;  4HI4 A;  1OT6 A;  5A90 A;  2GX5 A;  5LBR A;  1XXM A;  3VP3 A;  4R1G A;  4BD0 A;  3E4P A;  4QPR A;  5AQ9 A;  1Y4O A;  3MKE A;  4KQR A;  2EX2 A;  3WRT A;  1SDE A;  2ZD8 A;  3S7Q A;  2ZL1 B;  3F1N A;  3C38 A;  5GHX A;  4OPY A;  3O3V A;  3RXW A;  4DF6 A;  2RCX A;  1LSV A;  1HTZ A;  3CPT A;  5F1G A;  2WAF A;  2XA7 S;  1BZA A;  2VGL M;  4S2N C;  4HQA A;  3V3R A;  2XLN A;  1FCM A;  2VJW A;  3KYQ A;  3EQV A;  1AWI A;  4PM7 A;  2V1Z A;  2VLG A;  3EGX C;  4R38 A;  5HL6 A;  4H6J B;  1GA9 A;  4R3J A;  3ZGA B;  4JGO A;  5EM0 A;  2Y79 A;  3LIA A;  4OQH A;  5GHY A;  2UV0 E;  2Q0O A;  4OON A;  1IFQ A;  1MWT A;  3Q7V B;  2YKH A;  3BRM A;  5KIZ A;  3UDI A;  4LRX C;  4ETZ A;  1GHI A;  4RVA A;  1J3W A;  1GHP A;  1OT9 A;  5AQB A;  1H8M A;  5AQA A;  4E3J A;  4FSF A;  1AXB A;  3ZG9 B;  1O7E A;  4WF0 A;  3HRE A;  1WE4 A;  3VSK A;  3PYP A;  5CER A;  4EUZ A;  1G6A A;  2JBF A;  2A2L A;  3QP1 A;  5DJU A;  2HP5 A;  4X68 A;  2I9V A;  3GEC A;  3ZG5 A;  1N4O A;  5HAQ A;  1IEL A;  2OAP 1;  4P6Z M;  4OOY A;  3C30 A;  2JN7 A;  4JGR A;  1LLB A;  2GDN A;  4ETX A;  2PD8 A;  2Y2G A;  3JYI A;  4EEU A;  4Q8I A;  4BWI A;  4EET B;  2W3F A;  2V1B A;  1L2S A;  2WYX A;  4JPM A;  1IOU A;  1V9Z A;  3TW8 A;  2E8I A;  2BAS A;  4S2M A;  2V0W A;  1JWP A;  3WS1 A;  4KZ9 A;  3GDI A;  4GKU A;  3MKF A;  4E3N A;  4N1X A;  1YKD A;  1NY0 A;  5FQJ A;  5TJJ A;  1OJG A;  3ZVT A;  2B02 A;  3MXR A;  3UMD A;  1VET A;  2IWC A;  4GZB A;  4Y5F A;  3IXD A;  2V2F F;  1PI4 A;  4S2J A;  5EVI A;  3E98 A;  3DTI A;  4X56 A;  1BYW A;  5EV0 A;  1ERQ A;  4Y2F A;  4OLD A;  3CIT A;  1K4E A;  1E4D A;  2KOI A;  5M19 A;  3FPW A;  4HBT A;  1XFQ A;  4JF6 A;  2W3G A;  3PR6 A;  2A3U A;  5HWT A;  3PHY A;  1LHY A;  5EOO A;  5FQQ A;  1JTG A;  5I94 A;  3AGF A;  2J7V A;  2PYP A;  3BFC A;  4HJ3 A;  5HWV A;  4K0W A;  3V50 A;  1MKM A;  1P0Z A;  3IWI A;  3FV7 A;  3N4I A;  3NEC A;  1K57 A;  3BFE A;  1ALQ A;  3BQ8 A;  3WS0 A;  3NOP C;  4DKI A;  3V5M A;  1L0D A;  4DDY A;  3K3C A;  5CED A;  1XKZ A;  3CUE C;  1T1C A;  4KG5 A;  3O86 A;  1NZO A;  1ESU A;  4MEZ A;  1JVJ A;  4DDS A;  3BFD A;  3BY8 A;  2EWV A;  4CPK A;  4Q0I A;  1KGG A;  1BT5 A;  3UN7 A;  4HHD A;  4P85 A;  5HX9 A;  2WKH A;  4OPZ A;  3HUM A;  1KE3 A;  3C7V A;  2HP9 A;  3UE3 A;  4PHT A;  2Y2H A;  3KX0 X;  4FTX A;  4G3V A;  5FL3 A;  3MZD A;  4N1H A;  2VK3 A;  2W1R A;  4ZDX A;  2Q9M A;  4DXB A;  3HJI A;  4EXO A;  1OTE A;  5F68 A;  4Y0T A;  1DRM A;  1NWZ A;  3T1R A;  4FD8 A;  4QHC A;  4WN5 A;  1EI5 A;  2QWS A;  1ZTU A;  2I72 A;  5HDC A;  4CLC D;  3K2N A;  1YLZ A;  3Q7Z A;  4BBT A;  1KE0 A;  3HL9 A;  2P9V B;  3IBJ A;  4HEF A;  2B5R A;  4D60 A;  1PW8 A;  5E2F A;  4LV1 A;  1BSG A;  2W27 A;  1YLP A;  1UWP X;  3HLD A;  3WWX A;  4DE3 A;  3ZNT A;  1K38 A;  4U0X A;  3F1O B;  4NXF A;  5M18 A;  2OWJ A;  5TGF A;  2JKF A;  3FWL A;  3VSL A;  5DJT A; 
#chains in the Genus database with same CATH homology
 5HPF A;  4L9F A;  1EW0 A;  4Q0J A;  1D7E A;  3T4J A;  1GSX A;  2V9A A;  2VV8 A;  2L4R A;  4GJ4 A;  4H6J A;  4R3A A;  5F6A A;  2K31 A;  2OAQ 1;  4LRZ E;  2A24 A;  2V1A A;  1NLZ A;  2HV1 A;  4G3W A;  4O0P A;  3PBN A;  5HWW A;  5HDS A;  3OBF A;  4WLA A;  3KSI A;  4GS9 A;  2LB9 A;  4I38 A;  2OOL A;  3LIC A;  1DP9 A;  1GSV A;  2ZMF A;  3MR0 A;  3EWK A;  2VV6 A;  4BBU A;  2XA7 M;  4LLO B;  3TE8 A;  1T1A A;  1OTB A;  1STZ A;  5K5B A;  2A24 B;  4IJG A;  5EFW A;  1TD5 A;  4G3K A;  2GNX A;  4EUV A;  4GW9 A;  3KSF A;  3H7W A;  2D02 A;  1N9O A;  3B42 A;  3FC7 A;  3MQQ A;  2YKF A;  3PBO A;  3PBR A;  2K7S A;  3JVU A;  3UB8 A;  3ZQ5 A;  3UME A;  5KSH A;  3E0Y A;  3T4Q A;  3MQO A;  4BJP A;  4GLQ A;  1OTD A;  3VV4 A;  5TBM A;  1T19 A;  3LFV A;  2JHE A;  5G4Y A;  2OWH A;  4PKY A;  1W63 Q;  3NHQ A;  5IU1 A;  3T4S A;  4DMZ A;  3UB7 A;  4MDZ A;  3KSH A;  3E4O A;  1DP6 A;  3E4Q A;  3LR4 A;  3H82 A;  3VE3 A;  2J80 A;  2ZBB A;  4F3L A;  4HJ4 A;  1NRJ A;  5TBM B;  1TS0 A;  4GHI A;  4JGP A;  1TF1 A;  2M1C A;  3OCL A;  2QKP A;  1KOU A;  3T4K A;  4PKY G;  3RTY A;  2W3H A;  4NKP A;  5J4E A;  5L8M A;  1TS7 A;  3OLO A;  3UB9 A;  4HP9 A;  2IA2 A;  2O9A A;  3PBQ A;  2O99 A;  2W3D A;  3MF0 A;  4O01 A;  2B18 A;  4BMW A;  2Z6C A;  3PBT A;  3U2A A;  3VE4 A;  1P9W A;  4MN5 A;  4JGQ A;  2LB5 A;  2VA0 A;  2J3T C;  4R6L A;  1DP8 A;  3MFX A;  4I39 A;  4LPZ A;  4WEL A;  2HJE A;  2O9B A;  3HJK A;  4HI4 A;  5HPI A;  1OT6 A;  2GX5 A;  5LBR A;  2J3W A;  3LR0 A;  4HY8 A;  1YAX A;  4KQD A;  5HD3 A;  3V67 A;  1GSW A;  3EEA A;  5HDD A;  3MJQ A;  4B9O A;  5G4Z A;  4K08 A;  3E4P A;  4QPR A;  3BQA A;  5AVF A;  1D06 A;  3MQ0 A;  2XRO A;  2VGL S;  4IUK A;  4I3J A;  5J3W A;  4M4X A;  2WKQ A;  3S7Q A;  2QJ5 A;  4I3I A;  3F1N A;  3A0V A;  3C38 A;  4HP4 A;  4EES A;  2PT7 A;  4BBV A;  4GCZ A;  3SW1 A;  3ZYT A;  1LSV A;  4L9G A;  2J3T D;  5MC7 A;  1LT0 A;  2XA7 S;  2VGL M;  4KUK A;  3T4O A;  4HQA A;  4E04 A;  4HOI A;  4L9E A;  2W1T A;  3TJZ C;  4EEP A;  2VJW A;  3KYQ A;  4NXB A;  4PAU A;  3F1N B;  3EQV A;  2W3E A;  2D01 A;  2VLG A;  3EGX C;  3R7W A;  4R38 A;  5HL6 A;  4H6J B;  2PDR A;  4JGO A;  2Y79 A;  3LIA A;  3OOV A;  1P97 A;  3EOI A;  3S7P A;  2L0W A;  1IFQ A;  1F98 A;  2YKH A;  2W1T B;  3BW6 A;  3IS2 A;  4EW7 A;  5KIZ A;  4GS9 B;  2P04 A;  4LRX C;  2P08 A;  2WKR A;  3KYZ A;  3G6O A;  4ETZ A;  2VKS A;  3NOU C;  3EGD C;  1OT9 A;  5AJG A;  1H8M A;  1TS6 A;  4WUJ A;  1N9N A;  2JKT M;  3FG8 A;  1YSQ A;  4FSF A;  2QHK A;  3KSG A;  3O5Y A;  4ARZ A;  3H7W B;  2O9C A;  3IBR A;  2JKR M;  4WF0 A;  4R70 A;  5DKL A;  2G7U A;  5I5L A;  3CWF A;  2P7J A;  3PYP A;  3R4K A;  2K2N A;  3BWL A;  4P6Z S;  3CI6 A;  1S1Z A;  3C2W A;  4FOF A;  2A2L A;  2HGV A;  4MN7 A;  3UB6 A;  4DJ3 A;  4CLC C;  5HZH A;  5DJU A;  5DF9 A;  4EQ1 A;  5J7E A;  2MJ6 A;  2I9V A;  3JVV A;  2GZA A;  3GEC A;  2VZW A;  3NJA A;  3B47 A;  4ARZ B;  4HIA A;  4UEY A;  2CMN A;  2L1M A;  3LR3 A;  2HF6 A;  2OAP 1;  3S7O A;  4LRY C;  2PYR A;  1XJ4 A;  3MMH A;  3H82 B;  4P6Z M;  4Q0H A;  1YSP A;  4F3L B;  3C30 A;  2EWW A;  2JN7 A;  4JGR A;  3F1P A;  4ETX A;  2PD8 A;  4GHI B;  4OOM A;  3LI8 A;  4I5S A;  3D3O A;  4EEU A;  2VV7 A;  4BWI A;  3CLO A;  1S4R A;  4II7 A;  1X0O A;  4EET B;  3OC2 A;  2W3F A;  1OTI A;  2V1B A;  4XT2 A;  1IOU A;  1XFN A;  1MZU A;  5DFY A;  1V9Z A;  3TW8 A;  2BAS A;  2V0W A;  3GDI A;  4RQ9 A;  1YKD A;  1OJ5 A;  4KUO A;  1VHM A;  5TJJ A;  1OJG A;  2B02 A;  3LIE A;  4AFI A;  4NXE A;  3UMD A;  4HJ6 A;  3LI9 A;  4Y5F A;  2KDK A;  2INW A;  4Z1W A;  1F5M A;  4EU0 A;  3E98 A;  2ZOI A;  2M7V A;  3LR5 A;  1WA9 A;  1MC0 A;  1S1Y A;  1BYW A;  4OOL A;  4Y2F A;  3CIT A;  2R78 A;  2ZOH A;  3PXP A;  4NEE D;  2KOI A;  4I3A A;  1P9R A;  5F69 A;  4DN0 A;  3FPW A;  3T50 A;  1XFQ A;  5HSQ A;  2NUP C;  2W3G A;  3PR6 A;  5DKK A;  4O8G A;  2HJ9 C;  5HWT A;  2FZ0 A;  4YWZ A;  3PHY A;  5CX7 A;  4Y3I A;  2EA9 A;  2QJ7 A;  3BY9 A;  3EQU A;  3NOT C;  1ODV A;  2NUT C;  1V9Y A;  1LSW A;  4HNB A;  3MXQ A;  1XJ3 A;  5F5Y A;  4IHQ A;  4B93 A;  1OTA A;  1F9I A;  4ZRR A;  2PYP A;  1T18 A;  1S66 L;  4HJ3 A;  2V0U A;  3D72 A;  3LYX A;  4EER A;  5HWV A;  3DBA A;  1MKM A;  1P0Z A;  2VX8 A;  4ME4 A;  4DJ2 A;  3CAX A;  3LUQ A;  3ULF A;  3LID A;  5DFX A;  3R7W B;  1W63 M;  2PHY A;  2JKT I;  1VB6 A;  3BQ8 A;  3KO6 A;  4YOF A;  3LIF A;  4YNR A;  2W0N A;  3TRC A;  3NOP C;  3H9W A;  2Z6D A;  4WEK A;  5C5K A;  4HH3 A;  2VEA A;  3IS2 B;  3K3C A;  2JKR I;  2M7U A;  3CUE C;  1T1C A;  2FH5 A;  2WKP A;  4UQI S;  3FPV A;  2XRN A;  3BY8 A;  2EWV A;  4Q0I A;  5AVE A;  3C8C A;  4HHD A;  5A8B A;  3OCN A;  3HCY A;  1OPX A;  2PD7 A;  3T4T A;  3VOL A;  4CLC E;  5HD5 A;  2Y8H A;  2KX6 A;  2H28 A;  3P01 A;  4UQI M;  3RH8 B;  3UE3 A;  4PHT A;  3CUE A;  2KLI A;  3P7N A;  4L0L A;  3KX0 X;  1XJ2 A;  4CQH A;  1XJ6 A;  4G3V A;  2QYB A;  5FL3 A;  3S7N A;  3UE6 A;  3B33 A;  4CLC A;  1S67 L;  1UGU A;  2W1R A;  1H3Q A;  2PR5 A;  3HJI A;  4EXO A;  3T4L A;  1OTE A;  5F68 A;  1DRM A;  1NWZ A;  3ICY A;  3EEH A;  4WEJ A;  4WN5 A;  1LL8 A;  1TS8 A;  3PBS A;  2QWS A;  1ZTU A;  3F1O A;  3LIB A;  5HDC A;  1N9L A;  1LSX A;  4CLC D;  3K3D A;  1T1B A;  1G6O A;  3F1P B;  3K2N A;  1ZHH B;  2ZMV A;  3BJN A;  1JNU A;  4CLC B;  4BBT A;  3A0S A;  4KQO A;  2DMW A;  2PR6 A;  3IBJ A;  5IS1 A;  2O0Y A;  2W27 A;  1UWP X;  1NLY A;  3W2Z A;  1S4S A;  4XT2 B;  1G28 A;  4HH2 A;  2XSS A;  4MN6 A;  3A0R A;  1UWN X;  3RFB A;  3F1O B;  4MMN A;  4NXF A;  4IUH A;  4MCW A;  4NXG A;  2OWJ A;  4WL9 A;  2GJ3 A;  1Y28 A;  5IT5 A;  5DJT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...