4PKYA

Arnt/hif transcription factor/coactivator complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
104
structure length
101
Chain Sequence
TRFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNDEIEYIICTNTNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Aryl hydrocarbon receptor nuclear translocator
publication title Coiled-coil Coactivators Play a Structural Role Mediating Interactions in Hypoxia-inducible Factor Heterodimerization.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/cell cycle
total genus 28
structure length 101
sequence length 104
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14598 PAS_11 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4pkyA00
3F1PB 1T1CA 3LIFA 4R38A 1LL8A 5TBMB 3HJKA 1S67L 2R78A 3A0VA 4LRZE 4YWZA 1GSXA 1LSXA 1S4SA 3BY9A 2PD8A 3KX0X 5HDSA 1BYWA 1XJ2A 1XJ4A 1OTAA 3IBRA 4LLOB 3VE4A 1OJGA 1JNUA 4KQDA 4WL9A 4JGOA 5F6AA 4BBVA 1DRMA 1TS0A 5TBMA 5DJUA 1XFNA 2Z6DA 3CAXA 4LRXC 2VV7A 2OWJA 1UWPX 5HZHA 4F3LB 2ZOHA 3SW1A 3LI8A 4BBTA 5I5LA 1S4RA 5AVEA 4L9FA 4HHDA 4I3JA 3H82B 5IS1A 4EQ1A 4HJ3A 4HJ4A 4LRYC 3UB9A 3C2WA 4HJ6A 4HP9A 3MR0A 5A8BA 5HD5A 4R70A 1T18A 2QKPA 2QWSA 3F1OB 2V1AA 5F68A 1DP6A 3FC7A 4PKYG 1GSVA 4E04A 5DJTA 3NHQA 3OLOA 4EESA 5HWTA 4HI4A 2WKPA 4EETB 2P7JA 4WLAA 1WA9A 2CMNA 1V9ZA 1F98A 1DP9A 2GJ3A 2A24B 1ODVA 2PDRA 3UB8A 3LI9A 5HDCA 2KDKA 5DKKA 1GSWA 4JGRA 1D7EA 2KX6A 1D06A 3UMDA 1S66L 2QJ7A 3B33A 1T1AA 3EWKA 1OT9A 5HD3A 5J4EA 3T50A 4R6LA 3ICYA 1S1ZA 2A24A 4EEUA 4GS9B 4HNBA 3VOLA 4JGPA 3P7NA 1MZUA 4HP4A 2YKHA 4GHIA 1P97A 2V1BA 3MQOA 1OTEA 4L9GA 3CWFA 1OTBA 3F1PA 4KUOA 3LIEA 1NWZA 2PR6A 1P0ZA 4R3AA 3IS2B 4GCZA 5HDDA 5J3WA 1KOUA 3GECA 4GS9A 3MXQA 4NXFA 3EEHA 4EEPA 1DP8A 2K7SA 4XT2B 1G28A 3LYXA 5AVFA 3A0RA 5G4ZA 3NOUC 3H7WB 3PYPA 2L1MA 1Y28A 2WKRA 4EXOA 4LPZA 1XJ6A 3LUQA 3NJAA 3GDIA 5G4YA 3LIAA 3C8CA 4HY8A 1XJ3A 4XT2A 2EA9A 4F3LA 2VEAA 3NOTC 2W0NA 3VE3A 2ZBBA 2JHEA 3H82A 3FG8A 2VV8A 4KUKA 4HOIA 2HV1A 4NXEA 1V9YA 4H6JB 2B02A 1LSWA 2L0WA 3F1OA 2PD7A 3K3DA 1TS6A 1X0OA 2D02A 2M1CA 3UB7A 5DKLA 1UWNX 5F5YA 4EERA 5F69A 1EW0A 3E4PA 1XFQA 4I38A 4I39A 4WN5A 2BASA 3UMEA 3LICA 3MJQA 3H9WA 4L9EA 2ZOIA 2VLGA 3LIDA 4BBUA 3CLOA 2V0UA 1N9LA 3E4QA 5IU1A 3G6OA 3ZQ5A 1F9IA 2INWA 4B9OA 2PYRA 5HSQA 2PR5A 2VV6A 3PHYA 2QHKA 2V0WA 3UE6A 4JGQA 4WUJA 4I3IA 1LT0A 2PYPA 3HJIA 5HWWA 4NXBA 3F1NB 1T19A 3ULFA 1LSVA 1VB6A 5J7EA 4HH2A 3K3CA 2OWHA 2Z6CA 4K08A 4NXGA 3IS2A 4PKYA 4DJ3A 1OTDA 2YKFA 3MQQA 2JN7A 1TS7A 3F1NA 2J80A 2D01A 3BY8A 5KIZA 4MN6A 2H28A 4MN5A 2W27A 1T1BA 1OTIA 3BWLA 3H7WA 2WKQA 3LIBA 4DJ2A 3RH8B 3RTYA 1OJ5A 2L4RA 5HWVA 3E4OA 1UGUA 3D72A 4HIAA 3MFXA 2I9VA 3NOPC 1S1YA 2V9AA 4HH3A 4EW7A 1N9OA 4GW9A 4RQ9A 4I3AA 4WF0A 1N9NA 4HQAA 1TS8A 4H6JA 2QJ5A 2PHYA 4GHIB 3UB6A 3A0SA 4M4XA 4I5SA 5EFWA 2OOLA 1OT6A
chains in the Genus database with same CATH superfamily
4RYEA 1EROA 3IT9A 3VFHA 4R38A 3WS0A 1YLPA 5FEGA 1GSXA 1FCNA 1HTZA 3BLSA 1MWTA 5F83A 1BYWA 4JBFA 1XJ2A 4CQHA 2JKFA 4WEKA 3LGOA 1OJGA 1JNUA 2WUQA 5DTTA 3BEBA 4KQDA 5F6AA 1IELA 1HZOA 5TBMA 2P74A 3DWZA 5CGWA 3G34A 1FR6A 4EV4A 2VV7A 5HAIA 1HLUP 3UNWA 1VEUA 4F3LB 4E3IA 3SH7A 3SW1A 5CHUA 3G30A 3NDEA 1LI9A 3T12B 1YLZA 1CI8A 4I3JA 5J8XA 4EQ1A 3UB9A 3GVBA 3MFDA 3MR0A 3TJZC 1L2SA 5A8BA 1M6KA 3PR6A 5HD5A 4E6WA 1CEGA 1MWRA 3IXBA 2QKPA 2ZD8A 5L09A 5F68A 1DP6A 4PKYG 1C3BA 2WAFA 3S7OA 4E04A 2JKTI 5DJTA 4S2NA 2ZC5B 5DTSA 2WKPA 5HWTA 4E3KA 2B18A 2W1TA 2XA7M 1YT4A 2PRFA 5L07A 4LV3A 4OOMA 1BLSA 3EOIA 2PDRA 3EEAA 3SS3A 3GQZA 3LI9A 2CC1A 3PAEA 5FSRA 1GSWA 2KX6A 3DTEA 4PHTA 3G32A 2BLSA 5DFYA 1IFQA 3EWKA 5HARA 4Q0HA 5HD3A 2Y2JA 1ESUA 3UDFA 4EBPA 1JVJA 1TEMA 4LV2A 4ESPA 3ICYA 4RVAA 4KZ9A 3B3XA 3MQ0A 3OCLA 4EU0A 2J8YA 5DF8A 1IOUA 4JGPA 4X56A 2HDSA 2YKHA 1G6AA 2V1BA 5FI2A 4L9GA 3IH9A 4IHQA 1OTBA 3OZHA 4KUOA 5E2HA 1VETA 1ES3A 3PBNA 4R3AA 3MZFA 5FL3A 3IF6B 2R9XA 4MN7A 2WADA 3Q1FA 2Y2OA 3BFFA 1KOUA 2HJ9C 2VJWA 3MXQA 4A5RA 4WZ5C 5KSHA 4IUHA 4OLDA 1MPLA 4WYYA 1S6RA 5G4ZA 4KQQA 2ZQ9A 5FDHA 5FI7A 3PYPA 2HP5A 4LPZA 2VX8A 3ZVWA 4DE0A 3OPRA 2ZM8A 4YOFA 4HY8A 2RL3A 3GR2A 4F3LA 5CHJA 1WYBA 2GZAA 5HL1A 5HAQA 1XGIA 1RCJA 1Y4OA 2XR0A 1LI0A 2VV8A 1EWZA 3IF6C 1PFLA 2NUTC 2XEPA 1I2SA 5DTKA 1V9YA 2WGVA 3W4PA 5EVEA 1BLHA 3N7WA 3ZCZA 5CXWA 3FKWA 1TS6A 2D02A 2VA0A 4BJPA 1CEFA 3UB7A 5F5YA 1ES5A 2HDQA 1TDGA 1KDSA 3IX8A 3QP6A 4QHCA 3TRCA 3C7VA 1ES4A 2W3GA 3AGDA 4WMCD 4ARZA 2HF6A 5FAOA 2WGWB 3LIDA 4CLCB 3CLOA 4ZJ1A 2EXBA 2B5RA 3E4QA 4AFIA 1BT5A 1PWCA 1K56D 4Y15A 4JKTA 3ZQ5A 4NETA 4WZ5A 3T4JA 3DBAA 1J9MA 2K31A 4OQGA 5HSQA 2VV6A 2R9WA 2E8IA 5DF9A 2EWVA 4DE1A 4QY6A 3ITBA 3O5YA 5EOEA 4ZAMA 4S2LA 3Q7ZA 2QHKA 5EVID 3UE1A 1E3UD 4ID4A 3WWXA 2JC7A 4JGQA 3FWLA 3EGDC 2H0TA 4CPKA 1IYPA 3LR0A 2EX2A 4DKIA 3QP4A 3F1NB 5GHZA 2Y2NA 4KENB 3ULFA 3LR3A 1SDNA 4HH2A 3Q81A 4DE3A 4BQMA 4K08A 3BQAA 1ERMA 2ZQ7A 3OCNA 3PBQA 3IF6A 4Y17A 2IWDA 1OTDA 4CLCC 3U2AA 3SZTA 4NKPA 3VP3A 3IX4A 5EM0A 2XH9A 3BFEA 3VV4A 5AJGA 1XGJA 1FSYA 2FZ0A 4M3KA 4O7DA 2BG1A 2Y2QA 3BY8A 5L8MA 3SH8A 4GLQA 2W27A 1ESIA 1EI5A 1T1BA 4JF5A 4CLCE 4MBFA 1Q2QA 2J3WA 3V50A 4K0WA 2PAVP 1N9BA 1FR1A 2IWBA 2WZXA 1ACFA 2P04A 1CQAA 3C5AA 4UA9A 4DXBA 4RA7A 4XXRA 4P6ZM 4LV1A 3ISGA 4PM8A 2V9AA 3EGXC 3JVVA 3T4SA 4EW7A 2VK3A 4N9KA 4GW9A 3WS2A 2FFYA 4HQAA 1G6OA 2OAP1 1TS8A 5TR7A 4JLFA 2XROA 1TVFA 5HAPA 1XA7A 3PBSA 4JXSA 5EFWA 1OT6A 4GD8A 1T1CA 3LIFA 4DRTA 2A2LA 5TBMB 3HJKA 1NRJA 2XFSA 1NJ4A 4LRZE 1KE0A 1CF0A 5CEBA 1S4SA 1YLJA 2LB5A 3KX0X 5M19A 4JPMA 2HP6A 1IYOA 5GHYA 2WGWA 3IBRA 1AWIA 1VEUB 1K38A 3S22A 4C3QA 4EQIA 1DRMA 4OKPA 3C7UA 3EQVA 2Y2MA 3O87A 1JTGA 5DJUA 2Z6DA 3R7WA 2MJ6A 2PBDP 2J7VA 3FV7A 2XK1A 2UV0E 5BOHA 3B47A 3CZDA 3IBJA 5M1AA 2OWJA 4U0XA 5GLBA 5TGFA 2HZ5A 4IEDA 3PTEA 4HESA 2ZOHA 4WBGA 3VOZA 1W79A 1PWGA 5L2FA 5AVEA 3R4KA 5KSCA 3H82B 4GOGA 1VM1A 2XQZA 4HJ3A 4Y7PA 1HVBA 2XSSA 5C5KA 4HJ6A 2DNSA 2H5SA 4S2IA 1PNEA 3VP0A 4KZ3A 5A91A 4R70A 2QWSA 3F1OB 5K5BA 3E0YA 4S2OA 1PZOA 2G2WA 3OLOA 4MNRA 3IWOA 2Y59A 4R4RA 4Y0TA 2CMNA 3FYZA 4BD0A 1V9ZA 4BMWA 5E2FA 3B42A 1FIKA 4OOYA 5DKKA 5EPHA 5FQ9A 1D7EA 1SKFA 4QB8A 3UMDA 2QJ7A 4S2NC 1NYYA 4B4ZA 1VETB 3M2JA 3UDIA 2W1RA 3Q82A 4C75A 1L0GA 3C38A 4OP8A 2V8CA 2M7VA 4PMAA 1K54C 3T1QB 4E3NA 1S1ZA 2J9PA 4E3MA 3T4KA 5CGXA 4HNBA 2X01A 3VOLA 4UQIS 3P7NA 5JYPA 3D4FA 1P97A 2M7UA 3MQOA 1OTEA 4X69A 3CWFA 1NLZA 4O01A 5HW3A 3VP4A 3LIEA 1P0ZA 3QP8A 2ZL1A 1L0FA 2WK0A 4KQOA 4GDBA 3JPUA 5J3WA 5FQJA 3GMWA 2Y2PA 3UY6A 4GS9A 4P0MA 4ZJ2A 2OLUA 3IH8A 4OPYA 4R23A 3IXGA 1DP8A 3PBTA 2EWWA 4OPZA 3OBFA 3FZCA 3A0RA 3NCKA 4GDNA 1IEMA 1SCWA 1MWUA 2QMIA 3NOUC 3A3IA 5EVIB 3LUQA 4LFUA 3MXRA 3NJAA 2XF3A 4B88A 4PM7A 3QNCA 5G4YA 5MC7A 4MEZA 3RFBA 5HPFA 2KOIA 4RX3A 3NOTC 2W0NA 1TD5A 4FD8A 3TW8A 1L0DA 3VFFA 4DDSA 2JHEA 5KZHA 3H82A 3P98A 3FG8A 2J3TC 2H0YA 1MKMA 1QMEA 4ARZB 3OOVA 2ZQDA 1K25A 3BLMA 1K54A 5KMWA 2WKHA 3FKVA 3NI9A 3CUEC 4BD1A 3F1OA 1GA9A 3HLFA 3K3DA 3OPPA 3TSGA 4R3JA 1GA0A 1PRQA 4X1MA 3WS1A 2ZC3B 4GZBA 2Y55A 3E4PA 4I38A 4I39A 4KZ4A 4N9LA 4OVDA 3MJQA 3NY4A 4Y0UA 2Y4AA 2ZJ9A 2QPNA 3G4PA 1PZPA 5EVIC 2VLGA 1MXOA 3UPNA 3LEZA 2XFTA 5IU1A 5FQIA 4Y5FA 2PYRA 2PR5A 3GTCA 1IKGA 1H8ZA 4IUKA 2HGVA 1F2KA 3VMAA 3N4IA 3ZG0A 2I72A 2OSUA 5G18A 2HJEA 1K6RA 2W3HA 1YLWA 3CITA 3ZGAB 4I3IA 1LT0A 4PPRA 4Y0OA 1T19A 1ZKJA 4OLGA 1LSVA 3N6IA 4JF6A 2PU4A 1WE4A 3O3VA 4LGWA 4LENA 3CJMA 3SH9A 5HPIA 4K0XA 1SKOB 4PAUA 4GN2A 4NXGA 3S7PA 3DWKA 4Z9QA 4WMCA 2Q9MA 3BFCA 5A93A 2G7UA 2JN7A 4K91A 3CHWP 2Y2HA 4KZ8A 3GSGA 1K56A 4EUZA 4DN0A 3CUEA 4ZBEA 1S0WA 2VKSA 2J80A 3W4OA 5KIZA 4MN6A 3IF5A 4IVKA 4MN5A 3G2YA 2NUPC 1OTIA 2QZ6A 3HCYA 1K0KA 5GLCA 4D2OA 3S4XA 3KO6A 4XUZA 1O07A 1MKIA 5EVIA 1E3UA 2EXAA 5CGSA 3RH8B 4JF4A 3KSFA 3HUOA 3RTYA 1OJ5A 5F1FA 3GV9A 1UGUA 5HFOA 3AGEA 2K2NA 1LLBA 4EBNA 1RGZA 3E2LA 1WYCA 2I9VA 1S1YA 4LCMA 4HH3A 3V5MA 1N9OA 2EFUA 1IKIA 1N9NA 1LL9A 2WYXA 5EE8A 3ZNTA 2PHYA 3A0SA 4M4XA 3IWIA 3T4LA 5CHMA 4EUVA 5A92A 3F1PB 1DJCA 2ZMVA 3QHYA 1LL8A 1RGYA 3R7WB 4R1GA 1S67L 3A0VA 4YWZA 4N1HA 1LSXA 3BY9A 4Y3IA 4Y13A 3NDGA 5HDSA 4KZ7A 1Z6FA 1OTAA 3LFVA 2ZC7A 2E8JA 3M6HA 2PU2A 5FQMA 4UEYA 4P85A 4ZRRA 4WM9A 4BBVA 3UB5P 3NULA 5GLDA 1YKDA 3V39A 5DF7A 3CPTB 3JYIA 3CAXA 4OQIA 4MCWA 5TJJA 4PM9A 5L10A 2ZQAA 2ZMFA 4EWFA 3N8SA 4S2JA 5HZHA 3A3EA 3VSKA 1A0KA 5I5LA 5I94A 4L9FA 4WZ4A 5GHXA 2VGLM 4HJ4A 2GNXA 4LRYC 1FILA 3C2WA 1GCEA 2H10A 2WKIA 4O0PA 2Y91A 2UWXA 1SKOA 3UE3A 4QPRA 1T18A 4Q8IA 2VZWA 2V1AA 4P6BA 5TFQA 1NY0A 5FQQA 5FI6A 2OLVA 1GSVA 4HBTA 2J9OA 4X68A 2Z2LB 2O9BA 4HBUA 3NHQA 3BM6A 4P87A 5FAPA 4HI4A 4EETB 3S7QA 2P7JA 4QD4A 1L0EA 4LV0A 4OONA 1DP9A 2GJ3A 4KQRA 5EOOA 5HDCA 5JYOA 4MMNA 1NXYA 1KVLA 3WRZA 4JGRA 4OPQA 1VQQA 4FSFA 4KZBA 1D06A 1GHIA 3NBLA 4FCFA 1W7FA 1MY8A 3B33A 3P01A 4DXCA 3KSGA 1HD8A 3G31A 3SS5A 3LY3A 3PXPA 1TF1A 2ZL1B 4R6LA 3DTKA 4MBKA 3UO9A 2A24A 1PW8A 3IXHA 3QNBA 4GS9B 1ZTUA 4UA7A 2C5WB 2DRWA 4GB7A 2XLNA 1BULA 1ZHHB 2Y2IA 3SS4A 5CTNA 3A3DA 3F1PA 1K4FA 3RJUA 1MC0A 5CX7A 1XXMA 1NWZA 2PR6A 1YPRA 3BFDA 2KLIA 3IS2B 5HDDA 3G35A 5EUAA 1BLCA 3GECA 2V1ZA 4EEPA 4ZDXA 3KSHA 2JKRI 2K7SA 3ITAA 2XDMA 4BENA 1G28A 3LYXA 3W4QA 2X02A 4P6ZS 5FDSA 5FATA 1AXBA 3CPTA 2JBFA 2WKRA 4EXOA 1XJ6A 2ZLYA 1NLYA 3D9YA 2Q9NA 3GDIA 2XGNA 3LIAA 3C8CA 2A3UA 3PBRA 1K6SA 4XT2A 1ZG4A 5CRFA 3MKFA 2VEAA 2EFXA 2XRNA 3VE3A 2ZBBA 2P08A 1CJFA 4HOIA 5CERA 2HV1A 1E25A 4NXEA 3Q7VB 2HP9A 2IA2A 2L0WA 1X0OA 1KVMA 1P9RA 2M1CA 4EERA 2PBYA 5F69A 3ZFZA 1EW0A 3MKEA 4WN5A 4NK3A 2ZQCA 5D3OA 5GL9A 2O9CA 2OV5A 3H9WA 5M18A 2ZOIA 4JXGA 4DE2A 3A3FA 4GD6A 1ERQA 2Y8HA 4Y2FA 1N9LA 4KG6A 3JVUA 1DJAA 1Q2PA 2ZC6B 5E43A 3U4LP 3HLBA 4PM6A 2INWA 4B9OA 1G68A 3NC8A 4IJGA 3MSHA 2BTFP 4DMZA 1U60A 1KE4A 2ZQ8A 4UAAA 3HVFA 1XP4A 3BRMA 4WELA 3UE6A 2PYPA 3HJIA 3HLGA 5AQAA 5HWWA 2B95A 1Y54A 3V3RA 5DVAA 3V67A 4NXBA 4FUWA 2WGIA 1ZC2A 3WS5A 5EECA 4BLMA 3DAVA 1VB6A 1L3LA 3K3CA 3K2NA 4NG2A 2Y2GA 2Z6CA 4WEJA 1YLTA 3MZDA 1W63Q 3BQ8A 1LL5A 1J3WA 1H8MA 3IS2A 3LR4A 4RX2A 4DJ3A 4JXVA 4KZAA 3MQQA 1TS7A 2GX5A 4MLLA 4OH0A 3UPOA 3P09A 3E2KA 2C6WB 2ZMAA 1YSPA 4XUXA 2WZZA 1BSGA 3N8RA 1PYYA 3S1YA 2WKQA 5EV0A 1YQSA 5CTMA 3LIBA 3T1SA 4R3BA 2P9VB 3KYEA 1H0MA 2O9AA 1BTLA 1BUEA 3BYDA 1NZUA 2L4RA 5HWVA 2A49A 3E4OA 1FSWA 4OOLA 3E98A 2PT7A 4HIAA 3RXWA 3MFXA 3VP1A 3NOPC 3BJNA 2OAQ1 4MBHA 3Q7VA 1ALQA 3MBZA 3MS6A 2QJ5A 4GHIB 2HDRA 4ME4A 3T4QA 1YMXA 1FCOA 3VSLA 5IT5A 4BL2A 1IYSA 4JXWA 4DF6A 4GKUA 2JKGA 4N92A 1K57C 3LY4A 2GDNA 3O86A 2R78A 4X1LA 3ZG5A 1NYMA 5AQBA 2PD8A 3WRTA 4NEED 4X53A 3UN7A 5AQ9A 1H5XA 1XJ4A 4LLOB 3VE4A 3AGFA 2HPBA 4D60A 2EX8A 4MDZA 4WL9A 4G3VA 1PW1A 3T1RA 4JGOA 3OPLA 1KGFA 1TS0A 1P9WA 5FEFA 4ETZA 1FQGA 3HLDA 1XFNA 5FA7A 3L7HA 5FASA 3CMZA 3T4TA 4LRXC 3NIAA 1UWPX 2XA7S 3MMHA 3UDXA 2JE5A 4R4SA 4QWOA 3LI8A 5CECA 4BBTA 2V2FF 4Q0IA 1F5MA 3DTMA 1S4RA 4S2MA 3MF0A 1KDWA 4G3KA 4HHDA 4LCLA 2DMWA 1H3QA 5IS1A 1CI9A 3TG9A 4ZJ3A 3ZG9B 4HP9A 1NZOA 3UE0A 1BZAA 3IX3A 5AQ7A 3WS4A 3BW6A 3PAGA 5FAQA 1PWDA 3L9KA 3QP1A 2Q0OA 5IHVA 2ZM2A 3FC7A 3EQUA 3M2KA 2JCHA 1IYQA 4EESA 3D3OA 5U47A 3C30A 3DTIA 1GHPA 4WLAA 4G3WA 1WA9A 1K55C 5F1GA 1O7EA 1K57A 4YFMA 1JWZA 2FH5A 1F98A 2XD1A 4UHUA 4BWIA 3A3JA 4OQHA 3PBOA 2A24B 1ODVA 3UB8A 3LR5A 3M6BA 2KDKA 1OPXA 4E6XA 1ONHA 1XPBA 2P9VA 2DCFA 3MZEA 1S66L 1MBLA 5A90A 1T1AA 2Y2LA 4R0QA 1OT9A 5HL6A 3ZG7B 1XX2A 2J3TD 1CK3A 1YLYA 5J4EA 2ACGA 2JKRM 3T50A 3CG5A 3T1XA 4EEUA 4OPRA 2AVXA 1MZUA 4HP4A 2G2UA 4GHIA 1W8YA 4H8RA 3KYZA 4KZ5A 4O8GA 3DW0A 5E2GA 2WAEA 4N1XA 3UPPA 5LBRA 4GCZA 3C4PA 4B93A 3IQAA 4BL3A 1RP5A 5E2EA 1YMSA 2W3EA 2W3DA 2O0YA 1SHVA 4KG5A 1OMEA 4NXFA 3EEHA 3ZYTA 3W2ZA 5EM1A 1JWPA 4XT2B 1ZG6A 1NRFA 4KG2A 1JTDA 5AVFA 1DJBA 3BFGA 4F94A 4Z1WA 1PIOA 4OP5A 4HEFA 3OPHA 3FPWA 3NECA 4QJGA 3H7WB 3CI6A 2L1MA 3I7JA 1Y28A 1K55A 3FPVA 4X6TA 2IWCA 1QMFA 2HDUA 2QYBA 1XJ3A 3G2ZA 1W63M 2EA9A 3BECA 3LEQA 4QY5A 4CJNA 2WKEA 3O88A 4KUKA 3C4OA 1Z09A 4E3LA 2RCXA 4H6JB 2B02A 4GNUA 4PM5A 1LSWA 4QU3A 3HBRA 4S2PA 4ETXA 3VOYA 1KE3A 3RXXA 4II7A 1YAXA 1GHMA 2PD7A 3TE8A 1KGEA 1TDLA 3HREA 5CEDA 1SDEA 5DKLA 1UWNX 1BLPA 5HX9A 1YM1A 1XFQA 1FOFA 4FH4A 2VGJA 5F82A 2BASA 1D1JA 3SOIA 4DDYA 3UMEA 4U3TA 3LICA 1W5DA 3KYQA 3HLWA 4L9EA 4X55A 3V3SA 2V20A 2Z2MB 4BBUA 2V0UA 1M40A 1MWSA 3IWQA 3G6OA 1SZVA 3HLEA 1F9IA 3IHAA 1KGGA 2XD5A 1LHYA 2FFFB 4OQ0A 3VP2A 1PI5A 3PHYA 4YNRA 3KSIA 2VGLS 2LB9A 3S7NA 1E4DA 3ZHHA 4C6YA 1I2WA 2V0WA 3QP2A 4CLCA 4WUJA 4ZTKA 1XA1A 2EX9A 2Y2KA 1W8QA 3TOIA 5GLAA 1STZA 1K4EA 3ZDJA 5J7EA 3ZNYA 4YINA 3HLCA 2X71A 2OWHA 4GJ4A 2O99A 1H8YA 2W3FA 3LCEA 1JWVA 2JKTM 1VHMA 4IBXA 2VGKA 4PKYA 4UQIM 3N8LA 2YKFA 2EX6A 3IXDA 4FH2A 4UA6A 3F1NA 3HL9A 3OC2A 1ONGA 2D01A 4U0TA 3HUNA 3W8KA 1PI4A 2W1TB 2H28A 3MXSA 5FQKA 3BWLA 4B4XA 3LO7A 4X25A 3H7WA 1YSQA 1I5QA 4IVIA 4DJ2A 4CLCD 1FCMA 4E3OA 2ZM0A 4EBLA 4S2KA 3Q07A 3HUMA 5EVLA 1N4OA 2Y79A 5DFXA 1XKZA 4Q0JA 3D72A 2ZC4B 3QP5A 3IHBA 1ES2A 4E3JA 3GRJA 4RQ9A 4I3AA 1DY6A 4WF0A 4FTXA 1G5UA 2V8FA 3T4OA 4L0LA 4H6JA 4IBRA 3UB6A 4FOFA 3ZG8B 4I5SA 3ZVTA 2OOLA 4KZ6A
chains in the Genus database with same CATH topology
3F1PB 1T1CA 3LIFA 4R38A 2ZMVA 1LL8A 2A2LA 5TBMB 3HJKA 1NRJA 3R7WB 1S67L 2R78A 3A0VA 4LRZE 4YWZA 1GSXA 1LSXA 1S4SA 3BY9A 2PD8A 2LB5A 3KX0X 4Y3IA 5HDSA 4NEED 1BYWA 1XJ2A 1XJ4A 1OTAA 3IBRA 3LFVA 4CQHA 4LLOB 3VE4A 4WEKA 1OJGA 1JNUA 4UEYA 4MDZA 4KQDA 4G3VA 4WL9A 4JGOA 4ZRRA 5F6AA 4BBVA 1DRMA 1TS0A 1P9WA 1YKDA 3EQVA 4ETZA 5TBMA 5DJUA 1XFNA 2Z6DA 3R7WA 2MJ6A 3CAXA 4MCWA 5TJJA 3T4TA 3B47A 4LRXC 3IBJA 2VV7A 2OWJA 1UWPX 2XA7S 2ZMFA 3MMHA 5HZHA 4F3LB 2ZOHA 3SW1A 3LI8A 4BBTA 4Q0IA 1F5MA 5I5LA 1S4RA 3MF0A 5AVEA 3R4KA 4G3KA 4L9FA 4HHDA 4I3JA 3H82B 2DMWA 1H3QA 5IS1A 2VGLM 4EQ1A 4HJ3A 4HJ4A 2GNXA 4LRYC 3UB9A 2XSSA 3C2WA 5C5KA 4HJ6A 4HP9A 3MR0A 3TJZC 4O0PA 5A8BA 3UE3A 3PR6A 3BW6A 5HD5A 4QPRA 4R70A 1T18A 2QKPA 2QWSA 2VZWA 3F1OB 2V1AA 5F68A 1DP6A 3FC7A 4PKYG 5K5BA 1GSVA 3E0YA 3S7OA 4E04A 2JKTI 2O9BA 3EQUA 5DJTA 3NHQA 3OLOA 4EESA 3D3OA 2WKPA 4HI4A 5HWTA 4EETB 3S7QA 2P7JA 3C30A 4WLAA 4G3WA 1WA9A 2B18A 2W1TA 2CMNA 2XA7M 1V9ZA 2FH5A 1F98A 4BMWA 4BWIA 1DP9A 2GJ3A 3PBOA 2A24B 4OOMA 3EOIA 3B42A 1ODVA 2PDRA 3EEAA 3UB8A 3LR5A 3LI9A 5HDCA 4MMNA 2KDKA 5DKKA 1OPXA 1GSWA 4JGRA 1D7EA 4FSFA 2KX6A 1D06A 3UMDA 1S66L 2QJ7A 4PHTA 3B33A 5DFYA 3P01A 1IFQA 1T1AA 3EWKA 1OT9A 3KSGA 5HL6A 4Q0HA 5HD3A 2W1RA 2J3TD 3PXPA 1TF1A 5J4EA 2JKRM 3C38A 3T50A 2M7VA 4R6LA 3ICYA 1S1ZA 2A24A 3MQ0A 3T4KA 4EEUA 3OCLA 4EU0A 4GS9B 1ZTUA 4HNBA 1IOUA 3VOLA 4JGPA 4UQIS 3P7NA 1MZUA 4HP4A 2YKHA 1ZHHB 4GHIA 1P97A 2M7UA 2V1BA 3MQOA 3KYZA 1OTEA 4L9GA 4O8GA 4IHQA 3CWFA 1NLZA 1OTBA 3F1PA 4O01A 4KUOA 1MC0A 5CX7A 3LIEA 1NWZA 2PR6A 1P0ZA 3PBNA 4R3AA 2KLIA 3IS2B 5LBRA 5FL3A 4GCZA 5HDDA 4B93A 4MN7A 4KQOA 5J3WA 1KOUA 3GECA 2HJ9C 2W3DA 2W3EA 2VJWA 4GS9A 2O0YA 3MXQA 4NXFA 5KSHA 3EEHA 3ZYTA 4EEPA 4IUHA 3KSHA 2JKRI 3W2ZA 1DP8A 2K7SA 4XT2B 3PBTA 1G28A 2EWWA 3LYXA 5AVFA 4Z1WA 3OBFA 3A0RA 5G4ZA 4P6ZS 3NOUC 3FPWA 3H7WB 3PYPA 3CI6A 2L1MA 1Y28A 2WKRA 4EXOA 3FPVA 4LPZA 1XJ6A 3LUQA 2VX8A 1NLYA 3NJAA 3GDIA 5G4YA 5MC7A 3LIAA 3C8CA 4YOFA 4HY8A 3RFBA 2QYBA 3PBRA 1XJ3A 5HPFA 1W63M 2KOIA 4XT2A 2EA9A 4F3LA 2VEAA 3NOTC 2W0NA 1TD5A 2XRNA 2GZAA 3TW8A 3VE3A 2ZBBA 2JHEA 3H82A 3FG8A 2P08A 2VV8A 2J3TC 4KUKA 4HOIA 1MKMA 2NUTC 2HV1A 4ARZB 4NXEA 1V9YA 3OOVA 4H6JB 2B02A 1LSWA 2IA2A 4ETXA 3CUEC 2L0WA 3F1OA 4II7A 1YAXA 2PD7A 3TE8A 3K3DA 1TS6A 1X0OA 2D02A 2VA0A 1P9RA 4BJPA 2M1CA 3UB7A 5DKLA 1UWNX 5F5YA 4EERA 5F69A 1EW0A 3E4PA 1XFQA 4I38A 4I39A 4WN5A 2BASA 3UMEA 3LICA 3TRCA 2O9CA 3KYQA 3MJQA 3H9WA 2W3GA 4L9EA 4ARZA 2HF6A 2ZOIA 2VLGA 3LIDA 4CLCB 4BBUA 3CLOA 2Y8HA 2V0UA 4Y2FA 1N9LA 3E4QA 3JVUA 4AFIA 5IU1A 3G6OA 3ZQ5A 1F9IA 3T4JA 3DBAA 4Y5FA 2INWA 2K31A 4B9OA 2PYRA 5HSQA 2PR5A 2VV6A 5DF9A 2EWVA 4IUKA 2HGVA 4IJGA 3PHYA 4YNRA 3KSIA 2VGLS 2LB9A 3O5YA 3S7NA 2HJEA 4DMZA 2W3HA 2QHKA 3CITA 2V0WA 4WELA 3UE6A 4CLCA 4JGQA 4WUJA 4I3IA 1LT0A 2PYPA 3HJIA 3EGDC 5HWWA 3LR0A 3V67A 4NXBA 3F1NB 1T19A 3ULFA 1STZA 1LSVA 1VB6A 3LR3A 5J7EA 4HH2A 3K3CA 3K2NA 2OWHA 4GJ4A 4WEJA 2Z6CA 5HPIA 2O99A 2W3FA 4K08A 1W63Q 3BQ8A 2JKTM 1VHMA 4PAUA 3BQAA 3OCNA 4NXGA 3S7PA 1H8MA 3PBQA 3IS2A 3LR4A 4PKYA 4DJ3A 1OTDA 4UQIM 4CLCC 2YKFA 3U2AA 4NKPA 3MQQA 2G7UA 2JN7A 1TS7A 2GX5A 3VV4A 5AJGA 3F1NA 4DN0A 2FZ0A 3CUEA 3OC2A 2VKSA 2J80A 2D01A 3BY8A 5KIZA 1YSPA 4MN6A 5L8MA 2W1TB 2H28A 4MN5A 4GLQA 2W27A 2NUPC 1T1BA 1OTIA 4CLCE 3BWLA 3HCYA 3H7WA 2WKQA 1YSQA 2J3WA 3KO6A 3LIBA 4DJ2A 4CLCD 3RH8B 3KSFA 2O9AA 2P04A 3RTYA 1OJ5A 2L4RA 5HWVA 3E4OA 1UGUA 4OOLA 4P6ZM 2Y79A 5DFXA 3E98A 2K2NA 4Q0JA 3D72A 2PT7A 4HIAA 3MFXA 2I9VA 3NOPC 1S1YA 2V9AA 3EGXC 3BJNA 4HH3A 3JVVA 3T4SA 4EW7A 1N9OA 4GW9A 2OAQ1 4RQ9A 4I3AA 4WF0A 1N9NA 4HQAA 1G6OA 2OAP1 1TS8A 4H6JA 4L0LA 3T4OA 2XROA 2QJ5A 2PHYA 4GHIB 3UB6A 4FOFA 3A0SA 3PBSA 4I5SA 4M4XA 5EFWA 3T4LA 4ME4A 2OOLA 3T4QA 4EUVA 1OT6A 5IT5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F1P B;  1T1C A;  3LIF A;  4R38 A;  1LL8 A;  5TBM B;  3HJK A;  1S67 L;  2R78 A;  3A0V A;  4LRZ E;  4YWZ A;  1GSX A;  1LSX A;  1S4S A;  3BY9 A;  2PD8 A;  3KX0 X;  5HDS A;  1BYW A;  1XJ2 A;  1XJ4 A;  1OTA A;  3IBR A;  4LLO B;  3VE4 A;  1OJG A;  1JNU A;  4KQD A;  4WL9 A;  4JGO A;  5F6A A;  4BBV A;  1DRM A;  1TS0 A;  5TBM A;  5DJU A;  1XFN A;  2Z6D A;  3CAX A;  4LRX C;  2VV7 A;  2OWJ A;  1UWP X;  5HZH A;  4F3L B;  2ZOH A;  3SW1 A;  3LI8 A;  4BBT A;  5I5L A;  1S4R A;  5AVE A;  4L9F A;  4HHD A;  4I3J A;  3H82 B;  5IS1 A;  4EQ1 A;  4HJ3 A;  4HJ4 A;  4LRY C;  3UB9 A;  3C2W A;  4HJ6 A;  4HP9 A;  3MR0 A;  5A8B A;  5HD5 A;  4R70 A;  1T18 A;  2QKP A;  2QWS A;  3F1O B;  2V1A A;  5F68 A;  1DP6 A;  3FC7 A;  4PKY G;  1GSV A;  4E04 A;  5DJT A;  3NHQ A;  3OLO A;  4EES A;  5HWT A;  4HI4 A;  2WKP A;  4EET B;  2P7J A;  4WLA A;  1WA9 A;  2CMN A;  1V9Z A;  1F98 A;  1DP9 A;  2GJ3 A;  2A24 B;  1ODV A;  2PDR A;  3UB8 A;  3LI9 A;  5HDC A;  2KDK A;  5DKK A;  1GSW A;  4JGR A;  1D7E A;  2KX6 A;  1D06 A;  3UMD A;  1S66 L;  2QJ7 A;  3B33 A;  1T1A A;  3EWK A;  1OT9 A;  5HD3 A;  5J4E A;  3T50 A;  4R6L A;  3ICY A;  1S1Z A;  2A24 A;  4EEU A;  4GS9 B;  4HNB A;  3VOL A;  4JGP A;  3P7N A;  1MZU A;  4HP4 A;  2YKH A;  4GHI A;  1P97 A;  2V1B A;  3MQO A;  1OTE A;  4L9G A;  3CWF A;  1OTB A;  3F1P A;  4KUO A;  3LIE A;  1NWZ A;  2PR6 A;  1P0Z A;  4R3A A;  3IS2 B;  4GCZ A;  5HDD A;  5J3W A;  1KOU A;  3GEC A;  4GS9 A;  3MXQ A;  4NXF A;  3EEH A;  4EEP A;  1DP8 A;  2K7S A;  4XT2 B;  1G28 A;  3LYX A;  5AVF A;  3A0R A;  5G4Z A;  3NOU C;  3H7W B;  3PYP A;  2L1M A;  1Y28 A;  2WKR A;  4EXO A;  4LPZ A;  1XJ6 A;  3LUQ A;  3NJA A;  3GDI A;  5G4Y A;  3LIA A;  3C8C A;  4HY8 A;  1XJ3 A;  4XT2 A;  2EA9 A;  4F3L A;  2VEA A;  3NOT C;  2W0N A;  3VE3 A;  2ZBB A;  2JHE A;  3H82 A;  3FG8 A;  2VV8 A;  4KUK A;  4HOI A;  2HV1 A;  4NXE A;  1V9Y A;  4H6J B;  2B02 A;  1LSW A;  2L0W A;  3F1O A;  2PD7 A;  3K3D A;  1TS6 A;  1X0O A;  2D02 A;  2M1C A;  3UB7 A;  5DKL A;  1UWN X;  5F5Y A;  4EER A;  5F69 A;  1EW0 A;  3E4P A;  1XFQ A;  4I38 A;  4I39 A;  4WN5 A;  2BAS A;  3UME A;  3LIC A;  3MJQ A;  3H9W A;  4L9E A;  2ZOI A;  2VLG A;  3LID A;  4BBU A;  3CLO A;  2V0U A;  1N9L A;  3E4Q A;  5IU1 A;  3G6O A;  3ZQ5 A;  1F9I A;  2INW A;  4B9O A;  2PYR A;  5HSQ A;  2PR5 A;  2VV6 A;  3PHY A;  2QHK A;  2V0W A;  3UE6 A;  4JGQ A;  4WUJ A;  4I3I A;  1LT0 A;  2PYP A;  3HJI A;  5HWW A;  4NXB A;  3F1N B;  1T19 A;  3ULF A;  1LSV A;  1VB6 A;  5J7E A;  4HH2 A;  3K3C A;  2OWH A;  2Z6C A;  4K08 A;  4NXG A;  3IS2 A;  4PKY A;  4DJ3 A;  1OTD A;  2YKF A;  3MQQ A;  2JN7 A;  1TS7 A;  3F1N A;  2J80 A;  2D01 A;  3BY8 A;  5KIZ A;  4MN6 A;  2H28 A;  4MN5 A;  2W27 A;  1T1B A;  1OTI A;  3BWL A;  3H7W A;  2WKQ A;  3LIB A;  4DJ2 A;  3RH8 B;  3RTY A;  1OJ5 A;  2L4R A;  5HWV A;  3E4O A;  1UGU A;  3D72 A;  4HIA A;  3MFX A;  2I9V A;  3NOP C;  1S1Y A;  2V9A A;  4HH3 A;  4EW7 A;  1N9O A;  4GW9 A;  4RQ9 A;  4I3A A;  4WF0 A;  1N9N A;  4HQA A;  1TS8 A;  4H6J A;  2QJ5 A;  2PHY A;  4GHI B;  3UB6 A;  3A0S A;  4M4X A;  4I5S A;  5EFW A;  2OOL A;  1OT6 A; 
#chains in the Genus database with same CATH topology
 4RYE A;  1ERO A;  3IT9 A;  3VFH A;  4R38 A;  3WS0 A;  1YLP A;  5FEG A;  1GSX A;  1FCN A;  1HTZ A;  3BLS A;  1MWT A;  5F83 A;  1BYW A;  4JBF A;  1XJ2 A;  4CQH A;  2JKF A;  4WEK A;  3LGO A;  1OJG A;  1JNU A;  2WUQ A;  5DTT A;  3BEB A;  4KQD A;  5F6A A;  1IEL A;  1HZO A;  5TBM A;  2P74 A;  3DWZ A;  5CGW A;  3G34 A;  1FR6 A;  4EV4 A;  2VV7 A;  5HAI A;  1HLU P;  3UNW A;  1VEU A;  4F3L B;  4E3I A;  3SH7 A;  3SW1 A;  5CHU A;  3G30 A;  3NDE A;  1LI9 A;  3T12 B;  1YLZ A;  1CI8 A;  4I3J A;  5J8X A;  4EQ1 A;  3UB9 A;  3GVB A;  3MFD A;  3MR0 A;  3TJZ C;  1L2S A;  5A8B A;  1M6K A;  3PR6 A;  5HD5 A;  4E6W A;  1CEG A;  1MWR A;  3IXB A;  2QKP A;  2ZD8 A;  5L09 A;  5F68 A;  1DP6 A;  4PKY G;  1C3B A;  2WAF A;  3S7O A;  4E04 A;  2JKT I;  5DJT A;  4S2N A;  2ZC5 B;  5DTS A;  2WKP A;  5HWT A;  4E3K A;  2B18 A;  2W1T A;  2XA7 M;  1YT4 A;  2PRF A;  5L07 A;  4LV3 A;  4OOM A;  1BLS A;  3EOI A;  2PDR A;  3EEA A;  3SS3 A;  3GQZ A;  3LI9 A;  2CC1 A;  3PAE A;  5FSR A;  1GSW A;  2KX6 A;  3DTE A;  4PHT A;  3G32 A;  2BLS A;  5DFY A;  1IFQ A;  3EWK A;  5HAR A;  4Q0H A;  5HD3 A;  2Y2J A;  1ESU A;  3UDF A;  4EBP A;  1JVJ A;  1TEM A;  4LV2 A;  4ESP A;  3ICY A;  4RVA A;  4KZ9 A;  3B3X A;  3MQ0 A;  3OCL A;  4EU0 A;  2J8Y A;  5DF8 A;  1IOU A;  4JGP A;  4X56 A;  2HDS A;  2YKH A;  1G6A A;  2V1B A;  5FI2 A;  4L9G A;  3IH9 A;  4IHQ A;  1OTB A;  3OZH A;  4KUO A;  5E2H A;  1VET A;  1ES3 A;  3PBN A;  4R3A A;  3MZF A;  5FL3 A;  3IF6 B;  2R9X A;  4MN7 A;  2WAD A;  3Q1F A;  2Y2O A;  3BFF A;  1KOU A;  2HJ9 C;  2VJW A;  3MXQ A;  4A5R A;  4WZ5 C;  5KSH A;  4IUH A;  4OLD A;  1MPL A;  4WYY A;  1S6R A;  5G4Z A;  4KQQ A;  2ZQ9 A;  5FDH A;  5FI7 A;  3PYP A;  2HP5 A;  4LPZ A;  2VX8 A;  3ZVW A;  4DE0 A;  3OPR A;  2ZM8 A;  4YOF A;  4HY8 A;  2RL3 A;  3GR2 A;  4F3L A;  5CHJ A;  1WYB A;  2GZA A;  5HL1 A;  5HAQ A;  1XGI A;  1RCJ A;  1Y4O A;  2XR0 A;  1LI0 A;  2VV8 A;  1EWZ A;  3IF6 C;  1PFL A;  2NUT C;  2XEP A;  1I2S A;  5DTK A;  1V9Y A;  2WGV A;  3W4P A;  5EVE A;  1BLH A;  3N7W A;  3ZCZ A;  5CXW A;  3FKW A;  1TS6 A;  2D02 A;  2VA0 A;  4BJP A;  1CEF A;  3UB7 A;  5F5Y A;  1ES5 A;  2HDQ A;  1TDG A;  1KDS A;  3IX8 A;  3QP6 A;  4QHC A;  3TRC A;  3C7V A;  1ES4 A;  2W3G A;  3AGD A;  4WMC D;  4ARZ A;  2HF6 A;  5FAO A;  2WGW B;  3LID A;  4CLC B;  3CLO A;  4ZJ1 A;  2EXB A;  2B5R A;  3E4Q A;  4AFI A;  1BT5 A;  1PWC A;  1K56 D;  4Y15 A;  4JKT A;  3ZQ5 A;  4NET A;  4WZ5 A;  3T4J A;  3DBA A;  1J9M A;  2K31 A;  4OQG A;  5HSQ A;  2VV6 A;  2R9W A;  2E8I A;  5DF9 A;  2EWV A;  4DE1 A;  4QY6 A;  3ITB A;  3O5Y A;  5EOE A;  4ZAM A;  4S2L A;  3Q7Z A;  2QHK A;  5EVI D;  3UE1 A;  1E3U D;  4ID4 A;  3WWX A;  2JC7 A;  4JGQ A;  3FWL A;  3EGD C;  2H0T A;  4CPK A;  1IYP A;  3LR0 A;  2EX2 A;  4DKI A;  3QP4 A;  3F1N B;  5GHZ A;  2Y2N A;  4KEN B;  3ULF A;  3LR3 A;  1SDN A;  4HH2 A;  3Q81 A;  4DE3 A;  4BQM A;  4K08 A;  3BQA A;  1ERM A;  2ZQ7 A;  3OCN A;  3PBQ A;  3IF6 A;  4Y17 A;  2IWD A;  1OTD A;  4CLC C;  3U2A A;  3SZT A;  4NKP A;  3VP3 A;  3IX4 A;  5EM0 A;  2XH9 A;  3BFE A;  3VV4 A;  5AJG A;  1XGJ A;  1FSY A;  2FZ0 A;  4M3K A;  4O7D A;  2BG1 A;  2Y2Q A;  3BY8 A;  5L8M A;  3SH8 A;  4GLQ A;  2W27 A;  1ESI A;  1EI5 A;  1T1B A;  4JF5 A;  4CLC E;  4MBF A;  1Q2Q A;  2J3W A;  3V50 A;  4K0W A;  2PAV P;  1N9B A;  1FR1 A;  2IWB A;  2WZX A;  1ACF A;  2P04 A;  1CQA A;  3C5A A;  4UA9 A;  4DXB A;  4RA7 A;  4XXR A;  4P6Z M;  4LV1 A;  3ISG A;  4PM8 A;  2V9A A;  3EGX C;  3JVV A;  3T4S A;  4EW7 A;  2VK3 A;  4N9K A;  4GW9 A;  3WS2 A;  2FFY A;  4HQA A;  1G6O A;  2OAP 1;  1TS8 A;  5TR7 A;  4JLF A;  2XRO A;  1TVF A;  5HAP A;  1XA7 A;  3PBS A;  4JXS A;  5EFW A;  1OT6 A;  4GD8 A;  1T1C A;  3LIF A;  4DRT A;  2A2L A;  5TBM B;  3HJK A;  1NRJ A;  2XFS A;  1NJ4 A;  4LRZ E;  1KE0 A;  1CF0 A;  5CEB A;  1S4S A;  1YLJ A;  2LB5 A;  3KX0 X;  5M19 A;  4JPM A;  2HP6 A;  1IYO A;  5GHY A;  2WGW A;  3IBR A;  1AWI A;  1VEU B;  1K38 A;  3S22 A;  4C3Q A;  4EQI A;  1DRM A;  4OKP A;  3C7U A;  3EQV A;  2Y2M A;  3O87 A;  1JTG A;  5DJU A;  2Z6D A;  3R7W A;  2MJ6 A;  2PBD P;  2J7V A;  3FV7 A;  2XK1 A;  2UV0 E;  5BOH A;  3B47 A;  3CZD A;  3IBJ A;  5M1A A;  2OWJ A;  4U0X A;  5GLB A;  5TGF A;  2HZ5 A;  4IED A;  3PTE A;  4HES A;  2ZOH A;  4WBG A;  3VOZ A;  1W79 A;  1PWG A;  5L2F A;  5AVE A;  3R4K A;  5KSC A;  3H82 B;  4GOG A;  1VM1 A;  2XQZ A;  4HJ3 A;  4Y7P A;  1HVB A;  2XSS A;  5C5K A;  4HJ6 A;  2DNS A;  2H5S A;  4S2I A;  1PNE A;  3VP0 A;  4KZ3 A;  5A91 A;  4R70 A;  2QWS A;  3F1O B;  5K5B A;  3E0Y A;  4S2O A;  1PZO A;  2G2W A;  3OLO A;  4MNR A;  3IWO A;  2Y59 A;  4R4R A;  4Y0T A;  2CMN A;  3FYZ A;  4BD0 A;  1V9Z A;  4BMW A;  5E2F A;  3B42 A;  1FIK A;  4OOY A;  5DKK A;  5EPH A;  5FQ9 A;  1D7E A;  1SKF A;  4QB8 A;  3UMD A;  2QJ7 A;  4S2N C;  1NYY A;  4B4Z A;  1VET B;  3M2J A;  3UDI A;  2W1R A;  3Q82 A;  4C75 A;  1L0G A;  3C38 A;  4OP8 A;  2V8C A;  2M7V A;  4PMA A;  1K54 C;  3T1Q B;  4E3N A;  1S1Z A;  2J9P A;  4E3M A;  3T4K A;  5CGX A;  4HNB A;  2X01 A;  3VOL A;  4UQI S;  3P7N A;  5JYP A;  3D4F A;  1P97 A;  2M7U A;  3MQO A;  1OTE A;  4X69 A;  3CWF A;  1NLZ A;  4O01 A;  5HW3 A;  3VP4 A;  3LIE A;  1P0Z A;  3QP8 A;  2ZL1 A;  1L0F A;  2WK0 A;  4KQO A;  4GDB A;  3JPU A;  5J3W A;  5FQJ A;  3GMW A;  2Y2P A;  3UY6 A;  4GS9 A;  4P0M A;  4ZJ2 A;  2OLU A;  3IH8 A;  4OPY A;  4R23 A;  3IXG A;  1DP8 A;  3PBT A;  2EWW A;  4OPZ A;  3OBF A;  3FZC A;  3A0R A;  3NCK A;  4GDN A;  1IEM A;  1SCW A;  1MWU A;  2QMI A;  3NOU C;  3A3I A;  5EVI B;  3LUQ A;  4LFU A;  3MXR A;  3NJA A;  2XF3 A;  4B88 A;  4PM7 A;  3QNC A;  5G4Y A;  5MC7 A;  4MEZ A;  3RFB A;  5HPF A;  2KOI A;  4RX3 A;  3NOT C;  2W0N A;  1TD5 A;  4FD8 A;  3TW8 A;  1L0D A;  3VFF A;  4DDS A;  2JHE A;  5KZH A;  3H82 A;  3P98 A;  3FG8 A;  2J3T C;  2H0Y A;  1MKM A;  1QME A;  4ARZ B;  3OOV A;  2ZQD A;  1K25 A;  3BLM A;  1K54 A;  5KMW A;  2WKH A;  3FKV A;  3NI9 A;  3CUE C;  4BD1 A;  3F1O A;  1GA9 A;  3HLF A;  3K3D A;  3OPP A;  3TSG A;  4R3J A;  1GA0 A;  1PRQ A;  4X1M A;  3WS1 A;  2ZC3 B;  4GZB A;  2Y55 A;  3E4P A;  4I38 A;  4I39 A;  4KZ4 A;  4N9L A;  4OVD A;  3MJQ A;  3NY4 A;  4Y0U A;  2Y4A A;  2ZJ9 A;  2QPN A;  3G4P A;  1PZP A;  5EVI C;  2VLG A;  1MXO A;  3UPN A;  3LEZ A;  2XFT A;  5IU1 A;  5FQI A;  4Y5F A;  2PYR A;  2PR5 A;  3GTC A;  1IKG A;  1H8Z A;  4IUK A;  2HGV A;  1F2K A;  3VMA A;  3N4I A;  3ZG0 A;  2I72 A;  2OSU A;  5G18 A;  2HJE A;  1K6R A;  2W3H A;  1YLW A;  3CIT A;  3ZGA B;  4I3I A;  1LT0 A;  4PPR A;  4Y0O A;  1T19 A;  1ZKJ A;  4OLG A;  1LSV A;  3N6I A;  4JF6 A;  2PU4 A;  1WE4 A;  3O3V A;  4LGW A;  4LEN A;  3CJM A;  3SH9 A;  5HPI A;  4K0X A;  1SKO B;  4PAU A;  4GN2 A;  4NXG A;  3S7P A;  3DWK A;  4Z9Q A;  4WMC A;  2Q9M A;  3BFC A;  5A93 A;  2G7U A;  2JN7 A;  4K91 A;  3CHW P;  2Y2H A;  4KZ8 A;  3GSG A;  1K56 A;  4EUZ A;  4DN0 A;  3CUE A;  4ZBE A;  1S0W A;  2VKS A;  2J80 A;  3W4O A;  5KIZ A;  4MN6 A;  3IF5 A;  4IVK A;  4MN5 A;  3G2Y A;  2NUP C;  1OTI A;  2QZ6 A;  3HCY A;  1K0K A;  5GLC A;  4D2O A;  3S4X A;  3KO6 A;  4XUZ A;  1O07 A;  1MKI A;  5EVI A;  1E3U A;  2EXA A;  5CGS A;  3RH8 B;  4JF4 A;  3KSF A;  3HUO A;  3RTY A;  1OJ5 A;  5F1F A;  3GV9 A;  1UGU A;  5HFO A;  3AGE A;  2K2N A;  1LLB A;  4EBN A;  1RGZ A;  3E2L A;  1WYC A;  2I9V A;  1S1Y A;  4LCM A;  4HH3 A;  3V5M A;  1N9O A;  2EFU A;  1IKI A;  1N9N A;  1LL9 A;  2WYX A;  5EE8 A;  3ZNT A;  2PHY A;  3A0S A;  4M4X A;  3IWI A;  3T4L A;  5CHM A;  4EUV A;  5A92 A;  3F1P B;  1DJC A;  2ZMV A;  3QHY A;  1LL8 A;  1RGY A;  3R7W B;  4R1G A;  1S67 L;  3A0V A;  4YWZ A;  4N1H A;  1LSX A;  3BY9 A;  4Y3I A;  4Y13 A;  3NDG A;  5HDS A;  4KZ7 A;  1Z6F A;  1OTA A;  3LFV A;  2ZC7 A;  2E8J A;  3M6H A;  2PU2 A;  5FQM A;  4UEY A;  4P85 A;  4ZRR A;  4WM9 A;  4BBV A;  3UB5 P;  3NUL A;  5GLD A;  1YKD A;  3V39 A;  5DF7 A;  3CPT B;  3JYI A;  3CAX A;  4OQI A;  4MCW A;  5TJJ A;  4PM9 A;  5L10 A;  2ZQA A;  2ZMF A;  4EWF A;  3N8S A;  4S2J A;  5HZH A;  3A3E A;  3VSK A;  1A0K A;  5I5L A;  5I94 A;  4L9F A;  4WZ4 A;  5GHX A;  2VGL M;  4HJ4 A;  2GNX A;  4LRY C;  1FIL A;  3C2W A;  1GCE A;  2H10 A;  2WKI A;  4O0P A;  2Y91 A;  2UWX A;  1SKO A;  3UE3 A;  4QPR A;  1T18 A;  4Q8I A;  2VZW A;  2V1A A;  4P6B A;  5TFQ A;  1NY0 A;  5FQQ A;  5FI6 A;  2OLV A;  1GSV A;  4HBT A;  2J9O A;  4X68 A;  2Z2L B;  2O9B A;  4HBU A;  3NHQ A;  3BM6 A;  4P87 A;  5FAP A;  4HI4 A;  4EET B;  3S7Q A;  2P7J A;  4QD4 A;  1L0E A;  4LV0 A;  4OON A;  1DP9 A;  2GJ3 A;  4KQR A;  5EOO A;  5HDC A;  5JYO A;  4MMN A;  1NXY A;  1KVL A;  3WRZ A;  4JGR A;  4OPQ A;  1VQQ A;  4FSF A;  4KZB A;  1D06 A;  1GHI A;  3NBL A;  4FCF A;  1W7F A;  1MY8 A;  3B33 A;  3P01 A;  4DXC A;  3KSG A;  1HD8 A;  3G31 A;  3SS5 A;  3LY3 A;  3PXP A;  1TF1 A;  2ZL1 B;  4R6L A;  3DTK A;  4MBK A;  3UO9 A;  2A24 A;  1PW8 A;  3IXH A;  3QNB A;  4GS9 B;  1ZTU A;  4UA7 A;  2C5W B;  2DRW A;  4GB7 A;  2XLN A;  1BUL A;  1ZHH B;  2Y2I A;  3SS4 A;  5CTN A;  3A3D A;  3F1P A;  1K4F A;  3RJU A;  1MC0 A;  5CX7 A;  1XXM A;  1NWZ A;  2PR6 A;  1YPR A;  3BFD A;  2KLI A;  3IS2 B;  5HDD A;  3G35 A;  5EUA A;  1BLC A;  3GEC A;  2V1Z A;  4EEP A;  4ZDX A;  3KSH A;  2JKR I;  2K7S A;  3ITA A;  2XDM A;  4BEN A;  1G28 A;  3LYX A;  3W4Q A;  2X02 A;  4P6Z S;  5FDS A;  5FAT A;  1AXB A;  3CPT A;  2JBF A;  2WKR A;  4EXO A;  1XJ6 A;  2ZLY A;  1NLY A;  3D9Y A;  2Q9N A;  3GDI A;  2XGN A;  3LIA A;  3C8C A;  2A3U A;  3PBR A;  1K6S A;  4XT2 A;  1ZG4 A;  5CRF A;  3MKF A;  2VEA A;  2EFX A;  2XRN A;  3VE3 A;  2ZBB A;  2P08 A;  1CJF A;  4HOI A;  5CER A;  2HV1 A;  1E25 A;  4NXE A;  3Q7V B;  2HP9 A;  2IA2 A;  2L0W A;  1X0O A;  1KVM A;  1P9R A;  2M1C A;  4EER A;  2PBY A;  5F69 A;  3ZFZ A;  1EW0 A;  3MKE A;  4WN5 A;  4NK3 A;  2ZQC A;  5D3O A;  5GL9 A;  2O9C A;  2OV5 A;  3H9W A;  5M18 A;  2ZOI A;  4JXG A;  4DE2 A;  3A3F A;  4GD6 A;  1ERQ A;  2Y8H A;  4Y2F A;  1N9L A;  4KG6 A;  3JVU A;  1DJA A;  1Q2P A;  2ZC6 B;  5E43 A;  3U4L P;  3HLB A;  4PM6 A;  2INW A;  4B9O A;  1G68 A;  3NC8 A;  4IJG A;  3MSH A;  2BTF P;  4DMZ A;  1U60 A;  1KE4 A;  2ZQ8 A;  4UAA A;  3HVF A;  1XP4 A;  3BRM A;  4WEL A;  3UE6 A;  2PYP A;  3HJI A;  3HLG A;  5AQA A;  5HWW A;  2B95 A;  1Y54 A;  3V3R A;  5DVA A;  3V67 A;  4NXB A;  4FUW A;  2WGI A;  1ZC2 A;  3WS5 A;  5EEC A;  4BLM A;  3DAV A;  1VB6 A;  1L3L A;  3K3C A;  3K2N A;  4NG2 A;  2Y2G A;  2Z6C A;  4WEJ A;  1YLT A;  3MZD A;  1W63 Q;  3BQ8 A;  1LL5 A;  1J3W A;  1H8M A;  3IS2 A;  3LR4 A;  4RX2 A;  4DJ3 A;  4JXV A;  4KZA A;  3MQQ A;  1TS7 A;  2GX5 A;  4MLL A;  4OH0 A;  3UPO A;  3P09 A;  3E2K A;  2C6W B;  2ZMA A;  1YSP A;  4XUX A;  2WZZ A;  1BSG A;  3N8R A;  1PYY A;  3S1Y A;  2WKQ A;  5EV0 A;  1YQS A;  5CTM A;  3LIB A;  3T1S A;  4R3B A;  2P9V B;  3KYE A;  1H0M A;  2O9A A;  1BTL A;  1BUE A;  3BYD A;  1NZU A;  2L4R A;  5HWV A;  2A49 A;  3E4O A;  1FSW A;  4OOL A;  3E98 A;  2PT7 A;  4HIA A;  3RXW A;  3MFX A;  3VP1 A;  3NOP C;  3BJN A;  2OAQ 1;  4MBH A;  3Q7V A;  1ALQ A;  3MBZ A;  3MS6 A;  2QJ5 A;  4GHI B;  2HDR A;  4ME4 A;  3T4Q A;  1YMX A;  1FCO A;  3VSL A;  5IT5 A;  4BL2 A;  1IYS A;  4JXW A;  4DF6 A;  4GKU A;  2JKG A;  4N92 A;  1K57 C;  3LY4 A;  2GDN A;  3O86 A;  2R78 A;  4X1L A;  3ZG5 A;  1NYM A;  5AQB A;  2PD8 A;  3WRT A;  4NEE D;  4X53 A;  3UN7 A;  5AQ9 A;  1H5X A;  1XJ4 A;  4LLO B;  3VE4 A;  3AGF A;  2HPB A;  4D60 A;  2EX8 A;  4MDZ A;  4WL9 A;  4G3V A;  1PW1 A;  3T1R A;  4JGO A;  3OPL A;  1KGF A;  1TS0 A;  1P9W A;  5FEF A;  4ETZ A;  1FQG A;  3HLD A;  1XFN A;  5FA7 A;  3L7H A;  5FAS A;  3CMZ A;  3T4T A;  4LRX C;  3NIA A;  1UWP X;  2XA7 S;  3MMH A;  3UDX A;  2JE5 A;  4R4S A;  4QWO A;  3LI8 A;  5CEC A;  4BBT A;  2V2F F;  4Q0I A;  1F5M A;  3DTM A;  1S4R A;  4S2M A;  3MF0 A;  1KDW A;  4G3K A;  4HHD A;  4LCL A;  2DMW A;  1H3Q A;  5IS1 A;  1CI9 A;  3TG9 A;  4ZJ3 A;  3ZG9 B;  4HP9 A;  1NZO A;  3UE0 A;  1BZA A;  3IX3 A;  5AQ7 A;  3WS4 A;  3BW6 A;  3PAG A;  5FAQ A;  1PWD A;  3L9K A;  3QP1 A;  2Q0O A;  5IHV A;  2ZM2 A;  3FC7 A;  3EQU A;  3M2K A;  2JCH A;  1IYQ A;  4EES A;  3D3O A;  5U47 A;  3C30 A;  3DTI A;  1GHP A;  4WLA A;  4G3W A;  1WA9 A;  1K55 C;  5F1G A;  1O7E A;  1K57 A;  4YFM A;  1JWZ A;  2FH5 A;  1F98 A;  2XD1 A;  4UHU A;  4BWI A;  3A3J A;  4OQH A;  3PBO A;  2A24 B;  1ODV A;  3UB8 A;  3LR5 A;  3M6B A;  2KDK A;  1OPX A;  4E6X A;  1ONH A;  1XPB A;  2P9V A;  2DCF A;  3MZE A;  1S66 L;  1MBL A;  5A90 A;  1T1A A;  2Y2L A;  4R0Q A;  1OT9 A;  5HL6 A;  3ZG7 B;  1XX2 A;  2J3T D;  1CK3 A;  1YLY A;  5J4E A;  2ACG A;  2JKR M;  3T50 A;  3CG5 A;  3T1X A;  4EEU A;  4OPR A;  2AVX A;  1MZU A;  4HP4 A;  2G2U A;  4GHI A;  1W8Y A;  4H8R A;  3KYZ A;  4KZ5 A;  4O8G A;  3DW0 A;  5E2G A;  2WAE A;  4N1X A;  3UPP A;  5LBR A;  4GCZ A;  3C4P A;  4B93 A;  3IQA A;  4BL3 A;  1RP5 A;  5E2E A;  1YMS A;  2W3E A;  2W3D A;  2O0Y A;  1SHV A;  4KG5 A;  1OME A;  4NXF A;  3EEH A;  3ZYT A;  3W2Z A;  5EM1 A;  1JWP A;  4XT2 B;  1ZG6 A;  1NRF A;  4KG2 A;  1JTD A;  5AVF A;  1DJB A;  3BFG A;  4F94 A;  4Z1W A;  1PIO A;  4OP5 A;  4HEF A;  3OPH A;  3FPW A;  3NEC A;  4QJG A;  3H7W B;  3CI6 A;  2L1M A;  3I7J A;  1Y28 A;  1K55 A;  3FPV A;  4X6T A;  2IWC A;  1QMF A;  2HDU A;  2QYB A;  1XJ3 A;  3G2Z A;  1W63 M;  2EA9 A;  3BEC A;  3LEQ A;  4QY5 A;  4CJN A;  2WKE A;  3O88 A;  4KUK A;  3C4O A;  1Z09 A;  4E3L A;  2RCX A;  4H6J B;  2B02 A;  4GNU A;  4PM5 A;  1LSW A;  4QU3 A;  3HBR A;  4S2P A;  4ETX A;  3VOY A;  1KE3 A;  3RXX A;  4II7 A;  1YAX A;  1GHM A;  2PD7 A;  3TE8 A;  1KGE A;  1TDL A;  3HRE A;  5CED A;  1SDE A;  5DKL A;  1UWN X;  1BLP A;  5HX9 A;  1YM1 A;  1XFQ A;  1FOF A;  4FH4 A;  2VGJ A;  5F82 A;  2BAS A;  1D1J A;  3SOI A;  4DDY A;  3UME A;  4U3T A;  3LIC A;  1W5D A;  3KYQ A;  3HLW A;  4L9E A;  4X55 A;  3V3S A;  2V20 A;  2Z2M B;  4BBU A;  2V0U A;  1M40 A;  1MWS A;  3IWQ A;  3G6O A;  1SZV A;  3HLE A;  1F9I A;  3IHA A;  1KGG A;  2XD5 A;  1LHY A;  2FFF B;  4OQ0 A;  3VP2 A;  1PI5 A;  3PHY A;  4YNR A;  3KSI A;  2VGL S;  2LB9 A;  3S7N A;  1E4D A;  3ZHH A;  4C6Y A;  1I2W A;  2V0W A;  3QP2 A;  4CLC A;  4WUJ A;  4ZTK A;  1XA1 A;  2EX9 A;  2Y2K A;  1W8Q A;  3TOI A;  5GLA A;  1STZ A;  1K4E A;  3ZDJ A;  5J7E A;  3ZNY A;  4YIN A;  3HLC A;  2X71 A;  2OWH A;  4GJ4 A;  2O99 A;  1H8Y A;  2W3F A;  3LCE A;  1JWV A;  2JKT M;  1VHM A;  4IBX A;  2VGK A;  4PKY A;  4UQI M;  3N8L A;  2YKF A;  2EX6 A;  3IXD A;  4FH2 A;  4UA6 A;  3F1N A;  3HL9 A;  3OC2 A;  1ONG A;  2D01 A;  4U0T A;  3HUN A;  3W8K A;  1PI4 A;  2W1T B;  2H28 A;  3MXS A;  5FQK A;  3BWL A;  4B4X A;  3LO7 A;  4X25 A;  3H7W A;  1YSQ A;  1I5Q A;  4IVI A;  4DJ2 A;  4CLC D;  1FCM A;  4E3O A;  2ZM0 A;  4EBL A;  4S2K A;  3Q07 A;  3HUM A;  5EVL A;  1N4O A;  2Y79 A;  5DFX A;  1XKZ A;  4Q0J A;  3D72 A;  2ZC4 B;  3QP5 A;  3IHB A;  1ES2 A;  4E3J A;  3GRJ A;  4RQ9 A;  4I3A A;  1DY6 A;  4WF0 A;  4FTX A;  1G5U A;  2V8F A;  3T4O A;  4L0L A;  4H6J A;  4IBR A;  3UB6 A;  4FOF A;  3ZG8 B;  4I5S A;  3ZVT A;  2OOL A;  4KZ6 A; 
#chains in the Genus database with same CATH homology
 3F1P B;  1T1C A;  3LIF A;  4R38 A;  2ZMV A;  1LL8 A;  2A2L A;  5TBM B;  3HJK A;  1NRJ A;  3R7W B;  1S67 L;  2R78 A;  3A0V A;  4LRZ E;  4YWZ A;  1GSX A;  1LSX A;  1S4S A;  3BY9 A;  2PD8 A;  2LB5 A;  3KX0 X;  4Y3I A;  5HDS A;  4NEE D;  1BYW A;  1XJ2 A;  1XJ4 A;  1OTA A;  3IBR A;  3LFV A;  4CQH A;  4LLO B;  3VE4 A;  4WEK A;  1OJG A;  1JNU A;  4UEY A;  4MDZ A;  4KQD A;  4G3V A;  4WL9 A;  4JGO A;  4ZRR A;  5F6A A;  4BBV A;  1DRM A;  1TS0 A;  1P9W A;  1YKD A;  3EQV A;  4ETZ A;  5TBM A;  5DJU A;  1XFN A;  2Z6D A;  3R7W A;  2MJ6 A;  3CAX A;  4MCW A;  5TJJ A;  3T4T A;  3B47 A;  4LRX C;  3IBJ A;  2VV7 A;  2OWJ A;  1UWP X;  2XA7 S;  2ZMF A;  3MMH A;  5HZH A;  4F3L B;  2ZOH A;  3SW1 A;  3LI8 A;  4BBT A;  4Q0I A;  1F5M A;  5I5L A;  1S4R A;  3MF0 A;  5AVE A;  3R4K A;  4G3K A;  4L9F A;  4HHD A;  4I3J A;  3H82 B;  2DMW A;  1H3Q A;  5IS1 A;  2VGL M;  4EQ1 A;  4HJ3 A;  4HJ4 A;  2GNX A;  4LRY C;  3UB9 A;  2XSS A;  3C2W A;  5C5K A;  4HJ6 A;  4HP9 A;  3MR0 A;  3TJZ C;  4O0P A;  5A8B A;  3UE3 A;  3PR6 A;  3BW6 A;  5HD5 A;  4QPR A;  4R70 A;  1T18 A;  2QKP A;  2QWS A;  2VZW A;  3F1O B;  2V1A A;  5F68 A;  1DP6 A;  3FC7 A;  4PKY G;  5K5B A;  1GSV A;  3E0Y A;  3S7O A;  4E04 A;  2JKT I;  2O9B A;  3EQU A;  5DJT A;  3NHQ A;  3OLO A;  4EES A;  3D3O A;  2WKP A;  4HI4 A;  5HWT A;  4EET B;  3S7Q A;  2P7J A;  3C30 A;  4WLA A;  4G3W A;  1WA9 A;  2B18 A;  2W1T A;  2CMN A;  2XA7 M;  1V9Z A;  2FH5 A;  1F98 A;  4BMW A;  4BWI A;  1DP9 A;  2GJ3 A;  3PBO A;  2A24 B;  4OOM A;  3EOI A;  3B42 A;  1ODV A;  2PDR A;  3EEA A;  3UB8 A;  3LR5 A;  3LI9 A;  5HDC A;  4MMN A;  2KDK A;  5DKK A;  1OPX A;  1GSW A;  4JGR A;  1D7E A;  4FSF A;  2KX6 A;  1D06 A;  3UMD A;  1S66 L;  2QJ7 A;  4PHT A;  3B33 A;  5DFY A;  3P01 A;  1IFQ A;  1T1A A;  3EWK A;  1OT9 A;  3KSG A;  5HL6 A;  4Q0H A;  5HD3 A;  2W1R A;  2J3T D;  3PXP A;  1TF1 A;  5J4E A;  2JKR M;  3C38 A;  3T50 A;  2M7V A;  4R6L A;  3ICY A;  1S1Z A;  2A24 A;  3MQ0 A;  3T4K A;  4EEU A;  3OCL A;  4EU0 A;  4GS9 B;  1ZTU A;  4HNB A;  1IOU A;  3VOL A;  4JGP A;  4UQI S;  3P7N A;  1MZU A;  4HP4 A;  2YKH A;  1ZHH B;  4GHI A;  1P97 A;  2M7U A;  2V1B A;  3MQO A;  3KYZ A;  1OTE A;  4L9G A;  4O8G A;  4IHQ A;  3CWF A;  1NLZ A;  1OTB A;  3F1P A;  4O01 A;  4KUO A;  1MC0 A;  5CX7 A;  3LIE A;  1NWZ A;  2PR6 A;  1P0Z A;  3PBN A;  4R3A A;  2KLI A;  3IS2 B;  5LBR A;  5FL3 A;  4GCZ A;  5HDD A;  4B93 A;  4MN7 A;  4KQO A;  5J3W A;  1KOU A;  3GEC A;  2HJ9 C;  2W3D A;  2W3E A;  2VJW A;  4GS9 A;  2O0Y A;  3MXQ A;  4NXF A;  5KSH A;  3EEH A;  3ZYT A;  4EEP A;  4IUH A;  3KSH A;  2JKR I;  3W2Z A;  1DP8 A;  2K7S A;  4XT2 B;  3PBT A;  1G28 A;  2EWW A;  3LYX A;  5AVF A;  4Z1W A;  3OBF A;  3A0R A;  5G4Z A;  4P6Z S;  3NOU C;  3FPW A;  3H7W B;  3PYP A;  3CI6 A;  2L1M A;  1Y28 A;  2WKR A;  4EXO A;  3FPV A;  4LPZ A;  1XJ6 A;  3LUQ A;  2VX8 A;  1NLY A;  3NJA A;  3GDI A;  5G4Y A;  5MC7 A;  3LIA A;  3C8C A;  4YOF A;  4HY8 A;  3RFB A;  2QYB A;  3PBR A;  1XJ3 A;  5HPF A;  1W63 M;  2KOI A;  4XT2 A;  2EA9 A;  4F3L A;  2VEA A;  3NOT C;  2W0N A;  1TD5 A;  2XRN A;  2GZA A;  3TW8 A;  3VE3 A;  2ZBB A;  2JHE A;  3H82 A;  3FG8 A;  2P08 A;  2VV8 A;  2J3T C;  4KUK A;  4HOI A;  1MKM A;  2NUT C;  2HV1 A;  4ARZ B;  4NXE A;  1V9Y A;  3OOV A;  4H6J B;  2B02 A;  1LSW A;  2IA2 A;  4ETX A;  3CUE C;  2L0W A;  3F1O A;  4II7 A;  1YAX A;  2PD7 A;  3TE8 A;  3K3D A;  1TS6 A;  1X0O A;  2D02 A;  2VA0 A;  1P9R A;  4BJP A;  2M1C A;  3UB7 A;  5DKL A;  1UWN X;  5F5Y A;  4EER A;  5F69 A;  1EW0 A;  3E4P A;  1XFQ A;  4I38 A;  4I39 A;  4WN5 A;  2BAS A;  3UME A;  3LIC A;  3TRC A;  2O9C A;  3KYQ A;  3MJQ A;  3H9W A;  2W3G A;  4L9E A;  4ARZ A;  2HF6 A;  2ZOI A;  2VLG A;  3LID A;  4CLC B;  4BBU A;  3CLO A;  2Y8H A;  2V0U A;  4Y2F A;  1N9L A;  3E4Q A;  3JVU A;  4AFI A;  5IU1 A;  3G6O A;  3ZQ5 A;  1F9I A;  3T4J A;  3DBA A;  4Y5F A;  2INW A;  2K31 A;  4B9O A;  2PYR A;  5HSQ A;  2PR5 A;  2VV6 A;  5DF9 A;  2EWV A;  4IUK A;  2HGV A;  4IJG A;  3PHY A;  4YNR A;  3KSI A;  2VGL S;  2LB9 A;  3O5Y A;  3S7N A;  2HJE A;  4DMZ A;  2W3H A;  2QHK A;  3CIT A;  2V0W A;  4WEL A;  3UE6 A;  4CLC A;  4JGQ A;  4WUJ A;  4I3I A;  1LT0 A;  2PYP A;  3HJI A;  3EGD C;  5HWW A;  3LR0 A;  3V67 A;  4NXB A;  3F1N B;  1T19 A;  3ULF A;  1STZ A;  1LSV A;  1VB6 A;  3LR3 A;  5J7E A;  4HH2 A;  3K3C A;  3K2N A;  2OWH A;  4GJ4 A;  4WEJ A;  2Z6C A;  5HPI A;  2O99 A;  2W3F A;  4K08 A;  1W63 Q;  3BQ8 A;  2JKT M;  1VHM A;  4PAU A;  3BQA A;  3OCN A;  4NXG A;  3S7P A;  1H8M A;  3PBQ A;  3IS2 A;  3LR4 A;  4PKY A;  4DJ3 A;  1OTD A;  4UQI M;  4CLC C;  2YKF A;  3U2A A;  4NKP A;  3MQQ A;  2G7U A;  2JN7 A;  1TS7 A;  2GX5 A;  3VV4 A;  5AJG A;  3F1N A;  4DN0 A;  2FZ0 A;  3CUE A;  3OC2 A;  2VKS A;  2J80 A;  2D01 A;  3BY8 A;  5KIZ A;  1YSP A;  4MN6 A;  5L8M A;  2W1T B;  2H28 A;  4MN5 A;  4GLQ A;  2W27 A;  2NUP C;  1T1B A;  1OTI A;  4CLC E;  3BWL A;  3HCY A;  3H7W A;  2WKQ A;  1YSQ A;  2J3W A;  3KO6 A;  3LIB A;  4DJ2 A;  4CLC D;  3RH8 B;  3KSF A;  2O9A A;  2P04 A;  3RTY A;  1OJ5 A;  2L4R A;  5HWV A;  3E4O A;  1UGU A;  4OOL A;  4P6Z M;  2Y79 A;  5DFX A;  3E98 A;  2K2N A;  4Q0J A;  3D72 A;  2PT7 A;  4HIA A;  3MFX A;  2I9V A;  3NOP C;  1S1Y A;  2V9A A;  3EGX C;  3BJN A;  4HH3 A;  3JVV A;  3T4S A;  4EW7 A;  1N9O A;  4GW9 A;  2OAQ 1;  4RQ9 A;  4I3A A;  4WF0 A;  1N9N A;  4HQA A;  1G6O A;  2OAP 1;  1TS8 A;  4H6J A;  4L0L A;  3T4O A;  2XRO A;  2QJ5 A;  2PHY A;  4GHI B;  3UB6 A;  4FOF A;  3A0S A;  3PBS A;  4I5S A;  4M4X A;  5EFW A;  3T4L A;  4ME4 A;  2OOL A;  3T4Q A;  4EUV A;  1OT6 A;  5IT5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...