4PKYA

Arnt/hif transcription factor/coactivator complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
104
structure length
101
Chain Sequence
TRFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNDEIEYIICTNTNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Coiled-coil Coactivators Play a Structural Role Mediating Interactions in Hypoxia-inducible Factor Heterodimerization.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/cell cycle
molecule keywords Aryl hydrocarbon receptor nuclear translocator
total genus 28
structure length 101
sequence length 104
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14598 PAS_11 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4pkyA00
1S4RA 1S66L 3E4QA 3LUQA 2KDKA 2PR6A 4JGRA 3UE6A 3C2WA 2WKQA 2YKFA 4HP9A 1D7EA 3ULFA 1OJGA 3F1OB 5HWTA 2ZBBA 3F1OA 4EERA 4EW7A 1X0OA 2QJ5A 4HNBA 2Z6DA 4HY8A 1DRMA 1OTDA 2PR5A 5F6AA 4EEPA 2VV8A 4MN5A 2QHKA 1N9NA 3H7WB 4HJ4A 1G28A 3H7WA 4HOIA 2WKPA 4R3AA 4JGPA 2OWHA 3UB7A 3UB8A 4I39A 2WKRA 2D02A 4WUJA 1V9YA 1NWZA 3K3DA 4XT2A 1XJ3A 2KX6A 3UB6A 4YWZA 3B33A 5DJTA 1P0ZA 3E4OA 1T1CA 4GHIB 3SW1A 1XJ2A 3C8CA 3MR0A 2K7SA 3PYPA 4KQDA 4RQ9A 5DKKA 5J4EA 1F9IA 2VV7A 3F1NA 5KIZA 2Z6CA 4HJ6A 3UMDA 1LSVA 2VEAA 1JNUA 3MFXA 4I3JA 4M4XA 1GSWA 4PKYG 5F5YA 5J3WA 3GECA 4BBUA 1LT0A 3FG8A 5TBMA 4WL9A 2JHEA 2B02A 3F1PA 3LIBA 4HP4A 3PHYA 5HWWA 2INWA 4EETB 1TS6A 2QWSA 3ZQ5A 4DJ3A 3A0VA 3UB9A 1P97A 4HIAA 2PD8A 4HH2A 1T18A 1D06A 4LRZE 1OTIA 1BYWA 5HSQA 3H9WA 5G4YA 5TBMB 5HD5A 2PYRA 3H82B 3MJQA 1XFNA 2PYPA 2EA9A 2QKPA 4L9GA 4K08A 1UWNX 3EEHA 1OTAA 4HHDA 3LIEA 3LI8A 3VE4A 1LSXA 4EXOA 1DP6A 3E4PA 4F3LB 1DP9A 4KUKA 3D72A 2R78A 3K3CA 4F3LA 5HD3A 1XFQA 2L0WA 2BASA 2V1BA 4MN6A 3BY8A 2JN7A 2M1CA 2W27A 1MZUA 1WA9A 2L4RA 4HH3A 4R70A 3CAXA 2CMNA 3HJKA 5HDDA 2OWJA 2V9AA 3P7NA 1OTEA 3LICA 3MQQA 4GS9B 1XJ4A 5DKLA 4BBVA 4PKYA 2V0UA 3IBRA 3NOUC 5HDCA 3RH8B 5HZHA 4EESA 1OT6A 2A24A 4LLOB 2HV1A 2J80A 5A8BA 2A24B 3LIDA 1LSWA 1S4SA 2OOLA 1Y28A 4WF0A 4R38A 1OT9A 1S1ZA 2QJ7A 3ICYA 4HQAA 1EW0A 1DP8A 3FC7A 4LRXC 4WN5A 4XT2B 5F69A 4EQ1A 5EFWA 5HWVA 4E04A 3VE3A 3UMEA 3G6OA 3H82A 1TS7A 4I3AA 4NXEA 1ODVA 3OLOA 2GJ3A 4L9EA 4I38A 1F98A 1GSXA 5AVEA 5J7EA 2P7JA 4GHIA 3LI9A 5I5LA 3HJIA 2PHYA 3BWLA 1S67L 1XJ6A 1T1AA 4HI4A 1OTBA 2VV6A 3KX0X 4GCZA 4GW9A 4DJ2A 1N9OA 3NJAA 1V9ZA 4H6JA 4R6LA 1N9LA 1VB6A 2H28A 3MQOA 2ZOHA 3NOPC 3LIAA 4H6JB 2PD7A 2V1AA 4I3IA 3F1NB 4HJ3A 3IS2A 2PDRA 3NOTC 4GS9A 5F68A 4LPZA 5G4ZA 1S1YA 1UWPX 5IU1A 3CWFA 3T50A 1GSVA 4LRYC 3LYXA 1TS0A 1KOUA 1TS8A 2I9VA 3GDIA 4I5SA 4KUOA 3RTYA 2ZOIA 5DJUA 3A0RA 3VOLA 4NXGA 5HDSA 3F1PB 1OJ5A 2W0NA 4B9OA 1LL8A 1UGUA 3IS2B 3MXQA 1T1BA 4JGQA 2YKHA 3A0SA 1T19A 2VLGA 2V0WA 3BY9A 3EWKA 5AVFA 3LIFA 4NXFA 2L1MA 5IS1A 3CLOA 3NHQA 4BBTA 4JGOA 4EEUA 2D01A 4L9FA 4WLAA 4NXBA
chains in the Genus database with same CATH superfamily
1S66L 4JGRA 3C2WA 2XLNA 1XA1A 1DJAA 1DRMA 5F82A 5FASA 4LFUA 3T1RA 1ONGA 1XJ3A 2PBDP 2GX5A 1GHMA 3PYPA 1STZA 4EWFA 5A90A 2Z6CA 4LV0A 5EM1A 4I3JA 4E04A 3BEBA 3F1PA 2W1TA 3PHYA 2INWA 3W4QA 4DJ3A 1OTIA 4S2NA 3HLCA 4BJPA 5A92A 2O0YA 5CTNA 4N1HA 1SKOB 2V1BA 3UDXA 2CMNA 2R9XA 1JTGA 4JXSA 4GS9B 2B5RA 4IVKA 5E2GA 1SHVA 4ESPA 1S4SA 3KSFA 3B42A 3HLFA 2P74A 5HARA 4X1MA 3OPRA 4E3LA 2GJ3A 4QD4A 1IKGA 2QPNA 2XR0A 1NJ4A 2ZOHA 2EWWA 3Q82A 1S1YA 3IF5A 4GJ4A 5L8MA 3WS0A 2ZC6B 4NXFA 3MSHA 2UWXA 4OQHA 1MKMA 1AXBA 1K57A 3C5AA 5CX7A 4R1GA 2EXAA 4XXRA 4Y0OA 2XEPA 4CQHA 1K54C 3SW1A 1XJ2A 2AVXA 4GN2A 5KIZA 3P09A 3PAGA 3V3RA 3L7HA 3SH7A 1D06A 2LB5A 2I72A 2PYPA 1OTAA 4P6BA 1VEUB 4PPRA 3K3CA 3Q81A 2GZAA 4F3LA 4OQIA 5HD3A 1ES4A 2W27A 2VA0A 1EI5A 1YLZA 3VP0A 2QZ6A 2NUTC 5GLDA 3LIDA 1K55A 3KO6A 2HDUA 3ICYA 2QJ7A 1KE3A 2BLSA 3SH9A 4CLCE 5G18A 4JXGA 3OLOA 2WZXA 4NK3A 3A3IA 1IFQA 1FCNA 4CLCB 4DJ2A 2XD5A 3BM6A 3ITAA 2Y91A 2PU2A 3NJAA 4IVIA 5JYPA 1H0MA 4H6JB 3S7PA 3GSGA 3UB6A 5G4ZA 1HD8A 2GDNA 2Q9NA 3GDIA 4RVAA 3CZDA 2A2LA 2YKHA 4EBPA 3IX4A 3QP8A 3UB5P 3ZNYA 1MXOA 4BWIA 1BULA 2YKFA 3JPUA 4E6WA 5J7EA 1FCMA 2IWCA 3H7WA 5HAQA 4GOGA 4KZ3A 4XT2A 3B33A 1P0ZA 3M2JA 1YPRA 1YLJA 3CPTA 2VV7A 1LSVA 2WGWB 4CJNA 1JVJA 4LCMA 1W8YA 2OLVA 5HSQA 5G4YA 4EU0A 1MPLA 1WYCA 4DXBA 1YMSA 3T1SA 3RFBA 3M6BA 3IXHA 1BLCA 3D72A 4UA6A 5M18A 2L0WA 2LB9A 1GA9A 3UY6A 1MZUA 1WA9A 4DDSA 5HAIA 1NLYA 2EXBA 5FQMA 2A24A 1PZPA 4OPZA 2J3TD 1EW0A 2QMIA 1K0KA 3V5MA 5F69A 3OPPA 4OVDA 2O9AA 1TS7A 4X56A 1VHMA 1GA0A 3ZVWA 3A3EA 1XJ6A 3N8LA 4WMCA 3IF6B 4LRYC 3UB9A 1KOUA 1F5MA 4KUOA 3ZG0A 2ZOIA 1PI4A 2VGLM 3T12B 5U47A 2ZMAA 5EOOA 3LIFA 4NETA 4PMAA 1XA7A 3CLOA 3NHQA 2J8YA 5CGXA 1H8ZA 3HVFA 4EW7A 1OTDA 3MKEA 4R4RA 5J8XA 4YFMA 4Z1WA 1LL5A 3BFEA 1I5QA 2WKRA 3CUEA 3M2KA 4YWZA 2M7UA 4P0MA 5DKKA 1KVMA 4PKYG 4Y2FA 1G5UA 1AWIA 4H8RA 1NY0A 3LR4A 4KZ7A 1E4DA 5DF7A 5GL9A 3PBRA 2ZQCA 4U0XA 1UWNX 3S4XA 1LSXA 3U2AA 4OLGA 2R78A 3GVBA 3T4KA 4Y13A 1XFQA 5CECA 3L9KA 3CG5A 4HH3A 1Z09A 3CAXA 3HJKA 3P7NA 2HDQA 3LICA 1XXMA 5FAOA 3RH8B 3VFFA 1TEMA 3GR2A 2K2NA 1J9MA 4BLMA 2HP5A 4WEJA 3HREA 1DP8A 4BL3A 1WE4A 4X1LA 2K31A 3HUNA 4LENA 3EEAA 1ES5A 2V8CA 3NDEA 2W3GA 4GW9A 3OCNA 4H6JA 2H28A 3NOPC 3FYZA 3UNWA 3AGFA 1GSVA 1SCWA 1LI9A 3A0RA 3NC8A 4E3JA 4GKUA 3S1YA 2V0WA 1LHYA 2XFSA 1W63M 1PI5A 4XUXA 4BBTA 3E4QA 3LR5A 2WKQA 3MF0A 3UE1A 3S22A 4HY8A 3PAEA 1OMEA 3H7WB 4CPKA 4JGPA 1LLBA 1CEFA 4X68A 3VP1A 3K3DA 2KX6A 3NI9A 4EBLA 3TE8A 4E3OA 4DN0A 4UHUA 2ZMVA 4ME4A 4YINA 3UDIA 2JHEA 3UPNA 1O07A 4MDZA 5FQJA 5C5KA 3DTMA 4GNUA 4LV1A 4ZAMA 2BTFP 3DTEA 4WMCD 5HD5A 2WUQA 2EX2A 4GLQA 2IWBA 5CTMA 4HHDA 5CGSA 2J9OA 4RYEA 4YOFA 2JN7A 3UE0A 3ZNTA 3UPPA 4OONA 3IHBA 2XA7M 3BFFA 2PAVP 4PKYA 3K2NA 1CJFA 4LLOB 2WGVA 3OCLA 5EVIB 3OBFA 3IH9A 4Y0UA 4WBGA 3FC7A 2UV0E 3U4LP 1KGEA 2JCHA 3VV4A 4FTXA 3IWOA 3MZEA 4RA7A 3HJIA 3BWLA 3MFDA 5EE8A 1V9ZA 5HWTA 3MQOA 1TF1A 4WYYA 1E3UD 2V1AA 4LPZA 4S2NC 3ZVTA 4MBKA 5HDSA 1QMFA 4DF6A 1T1BA 3IXDA 2A49A 1KE0A 3N7WA 1FSYA 1VETB 4P6ZM 1GHIA 1FOFA 4ID4A 2ZC7A 4JPMA 3JVVA 3G31A 1D7EA 5F6AA 3TG9A 5FQ9A 2PR5A 2QHKA 3C7UA 3CITA 5K5BA 3QP1A 4HJ4A 4E3IA 3BRMA 2D02A 3JVUA 1NWZA 4QJGA 5DJTA 3E2KA 1M6KA 3HLWA 2GNXA 1HTZA 3TOIA 3KSIA 1PFLA 2VEAA 4LGWA 5BOHA 2E8JA 3A0VA 2OAP1 1TD5A 3ITBA 1K56A 1YSPA 4Y7PA 2ZM8A 1G6AA 4KZ8A 1J3WA 4R4SA 1CEGA 2KLIA 4WZ5A 4DE0A 4B4ZA 3QNCA 4K0WA 3IBRA 2JKFA 1DJCA 3G4PA 3NOUC 5GLBA 2OV5A 1FQGA 4WN5A 3GV9A 4I3AA 2HZ5A 1JWVA 4ZRRA 4Q0JA 4L9EA 5A91A 1F98A 3LY3A 3IH8A 4OP8A 1OTBA 2ZM2A 4RX2A 5FI7A 4PM6A 3F1NB 4BQMA 3EQUA 1WYBA 5IU1A 3MS6A 1GHPA 3CWFA 4KENB 4JXVA 5FI2A 5FQQA 1L0DA 2RCXA 3NULA 3VP2A 3A0SA 3IWIA 2ZQ7A 4OKPA 1EWZA 2HP9A 5MC7A 4Q0IA 5HFOA 1DJBA 3V3SA 4WLAA 2WKEA 1GCEA 5TR7A 5FQIA 1N9NA 5EECA 5FATA 4S2LA 5D3OA 4ZJ1A 4NG2A 4UA7A 5DFXA 1XPBA 1C3BA 3E4OA 1ALQA 1XX2A 2ZL1B 4KG5A 2XD1A 3IHAA 4S2KA 4UQIM 3QNBA 4JF6A 4F94A 1H3QA 3I7JA 5DVAA 2WZZA 1P9RA 5TBMB 1VETA 2ZQAA 4DKIA 3FKVA 4K08A 1ESUA 3LIEA 1DP6A 4KUKA 4JBFA 3RJUA 2Z2LB 4KZ6A 1G68A 3C30A 2V9AA 1SKFA 2G7UA 3IWQA 2V0UA 1MBLA 5HZHA 2H0TA 5L09A 4FCFA 4GD8A 4KZ5A 3P98A 4IUHA 2FFYA 1GSXA 4QHCA 5I5LA 2PHYA 1T1AA 1MWSA 2JKTM 3IX3A 2FH5A 1VB6A 2Y2LA 3W2ZA 2PBYA 4CLCA 4IHQA 5DJUA 3SS5A 3VOLA 1LL8A 4JGQA 1MWRA 1KVLA 2XA7S 4PAUA 2HF6A 2G2UA 4JGOA 3VFHA 3LUQA 2KDKA 5GHXA 5M19A 1IEMA 5HL1A 1PWGA 2DMWA 4IBXA 3PBOA 3VP4A 1L2SA 3W4OA 2Y2GA 1YMXA 3C4OA 1K57C 2JE5A 1CI8A 3RXXA 1PIOA 5J4EA 1H8MA 3F1NA 5LBRA 3MQ0A 4UAAA 4HBUA 1BZAA 3GTCA 2PD8A 4OP5A 4EUZA 3EOIA 4ZDXA 3LY4A 2EA9A 5HX9A 2W1RA 2Y8HA 3HBRA 3WRZA 4MBFA 3KSHA 4C3QA 3WWXA 1CI9A 1MWUA 4X53A 4WM9A 1FR1A 5A93A 4IUKA 2HV1A 4NKPA 1FR6A 2OOLA 4WF0A 5TJJA 5IT5A 3LEQA 3EQVA 3FV7A 2EX6A 4RX3A 3EGXC 3LI9A 4FD8A 1S67L 4GCZA 2PT7A 1N9OA 1NRFA 4Q8IA 4HJ3A 1W5DA 5HPFA 1DY6A 4I5SA 3CI6A 3ZG7B 3MMHA 1OJ5A 4KG6A 3MBZA 5IS1A 4S2PA 4EV4A 5DTTA 1TDLA 2PR6A 4MBHA 1K25A 3ULFA 1ZG6A 3HCYA 4PM9A 5KSHA 3T4QA 3WS5A 3C8CA 2B95A 5GHYA 3MFXA 2X01A 3FG8A 3FZCA 3DTKA 2HDSA 5HWWA 3ZG9B 4N9KA 4HIAA 3B47A 5GLCA 4QY6A 2E8IA 1KDSA 2PYRA 2XRNA 3N4IA 2V20A 3UO9A 2H0YA 4R70A 5HDDA 5I94A 1OTEA 2P08A 3DWZA 4OPYA 1S0WA 3NY4A 2ZMFA 2XGNA 3Q1FA 3JYIA 1K55C 2A24B 2FFFB 1H8YA 1KE4A 4LRXC 4GD6A 1YLWA 3CHWP 3BFCA 3NBLA 4PHTA 4ZBEA 3DAVA 5EUAA 1ODVA 4Y17A 4ZJ2A 4O7DA 3WS2A 4X69A 3FWLA 2Y55A 3O88A 2VZWA 3V67A 4UEYA 2ZC5B 2V1ZA 3LYXA 4O8GA 2JKRI 4MN7A 3MXQA 5FDSA 1YQSA 2KOIA 3EWKA 1ES3A 2DCFA 3SS3A 4DDYA 1E25A 5KSCA 1S4RA 1L0GA 3OPLA 4WEKA 2VV8A 3GMWA 5FDHA 2WKPA 5JYOA 2EWVA 2ZQDA 3NCKA 2J7VA 4RQ9A 1BLPA 1ZTUA 3OOVA 3V50A 3MXRA 4B4XA 2OSUA 2ZQ8A 4HJ6A 1JNUA 5TBMA 2B02A 2VKSA 1VM1A 3GRJA 3A3DA 3ZQ5A 2HDRA 4LRZE 4N1XA 5DTSA 1IYOA 4CLCC 3H82B 3AGDA 2QKPA 3EEHA 3T1XA 3S7OA 5E2HA 4GDBA 2Y2HA 4U0TA 5L2FA 3EGDC 1Y54A 2H10A 3PBTA 4YNRA 4PM5A 4JF4A 5A8BA 4Y3IA 1IYQA 5F1FA 2DNSA 1S1ZA 4EQ1A 1KDWA 5EFWA 1Z6FA 3G6OA 4QB8A 2A3UA 1KGFA 2NUPC 5EVEA 1PWDA 5FA7A 4KZ9A 3TSGA 2P7JA 4G3WA 2FZ0A 3DTIA 1NZOA 4OLDA 1CF0A 2O99A 2JKGA 4LCLA 2PD7A 5GLAA 5E43A 1UWPX 5FAQA 1XKZA 1SKOA 1PYYA 3R4KA 4S2MA 3RTYA 3IQAA 1VEUA 1D1JA 5CHMA 3HLDA 2WYXA 3VMAA 2J3WA 1RGZA 2M7VA 4QWOA 3S7NA 1L3LA 3G30A 3MKFA 2Y2KA 2JKRM 4DE1A 1N4OA 4MN5A 4FH2A 4Y15A 2W3EA 3KYQA 4R3AA 4I39A 4WZ4A 4WUJA 3OZHA 5FEFA 3IXBA 1YT4A 1YLPA 1CQAA 5M1AA 4R23A 4BBUA 4WL9A 2VX8A 4HP4A 4II7A 3KYZA 1TS6A 2QWSA 3RXWA 3T1QB 3QP6A 3CJMA 3MJQA 2EFUA 1XFNA 2PRFA 5CHJA 1ERMA 3VE4A 3E2LA 3E4PA 3T4SA 1OPXA 3R7WA 4GDNA 4BMWA 2M1CA 3ZYTA 1KGGA 3NECA 3T4OA 3KYEA 2JKTI 4EESA 4ETZA 5DTKA 1RCJA 2ZC4B 3HLGA 4E3KA 3QP4A 4EXOA 4XT2B 3LEZA 5HWVA 5AQBA 1IYSA 4LV3A 3CPTB 3D9YA 2W3HA 3BQ8A 1MWTA 4E3NA 3C7VA 2XROA 2WKIA 2H5SA 4X6TA 1LL9A 4HI4A 3IF6C 3KX0X 4B88A 3G34A 5IHVA 4I3IA 4N92A 3LIAA 4E3MA 2C5WB 5CERA 1EROA 1TS0A 2BG1A 5CHUA 3F1PB 4DMZA 1HZOA 3A3JA 3BW6A 3FKWA 4OOYA 2VLGA 3BY9A 4UQIS 5AVFA 1JWZA 2ZJ9A 2WGWA 2W3DA 4OQGA 5AQ9A 4FOFA 1K38A 4KZAA 2QJ5A 4EEPA 2Z6DA 3DW0A 4NEED 1FILA 4LV2A 1L0EA 1G28A 4DE2A 1ZC2A 4OH0A 2V2FF 3S7QA 1HLUP 5EVIA 2K7SA 3MZDA 3IT9A 4M4XA 1GSWA 1LT0A 2ZL1A 4EETB 3HLEA 1NRJA 2VJWA 1K56D 3FPVA 4ETXA 5EV0A 3AGEA 1P97A 2JC7A 3T4LA 1LI0A 1NLZA 2Y2NA 1YLTA 5E2EA 4F3LB 4JLFA 3ZHHA 1PW8A 4MN6A 3BY8A 4BD0A 1VQQA 2WKHA 1F2KA 3MQQA 1XJ4A 3LGOA 5DKLA 1O7EA 5HDCA 1BT5A 2J80A 4IEDA 2Y2QA 1Y28A 1BLSA 4R38A 4Q0HA 4HQAA 5CEDA 3BLSA 3C38A 2HGVA 3B3XA 1YAXA 4C75A 1BLHA 1U60A 4R6LA 2XF3A 1ONHA 4P85A 4D2OA 4M3KA 2O9CA 5FSRA 4MNRA 4B9OA 4OPRA 3IS2B 5FI6A 1W63Q 1MC0A 2VGKA 4PM8A 4L9FA 4OPQA 4R3JA 4EBNA 2ZC3B 3MXSA 3F1OA 3HUOA 2EFXA 5E2FA 1N9BA 1W7FA 2W3FA 3UB7A 1FSWA 2VK3A 4KG2A 4DXCA 5TFQA 3LR3A 3O5YA 5AQAA 4OOLA 1I2SA 1XGJA 4KQDA 4ZJ3A 2Y4AA 4GB7A 4B93A 5DFYA 4JF5A 3ZG5A 2Y2MA 3ZDJA 5HPIA 1FIKA 1T18A 3G32A 5L07A 5CEBA 3T4TA 1P9WA 2ZLYA 5HAPA 5HL6A 1MY8A 1G6OA 4QY5A 5DF8A 1IKIA 3IXGA 4KZ4A 3SOIA 3VSLA 4O0PA 2XDMA 1SZVA 1I2WA 3TJZC 3V39A 1LSWA 3NIAA 1L0FA 1OT9A 4HBTA 4Y0TA 3QHYA 2Y2JA 3VE3A 5TGFA 2Y79A 5FQKA 1W8QA 4ARZB 1PZOA 3LR0A 3TRCA 4IBRA 3UE3A 1BUEA 3N8RA 1Y4OA 2QYBA 1PNEA 1NZUA 3GQZA 1UGUA 1K6SA 3P01A 4OQ0A 3VOZA 3UPOA 3NDGA 2J9PA 1RGYA 4KQQA 3IX8A 2IA2A 5DF9A 5EVIC 2XQZA 2WAEA 1W79A 1OJGA 2HPBA 2DRWA 2P04A 5KMWA 1E3UA 2CC1A 2WGIA 4N9LA 4OOMA 1YSQA 4E6XA 2HJEA 3Q7ZA 4FSFA 2JBFA 2X02A 4QU3A 1PRQA 3MR0A 4C6YA 1F9IA 3UMDA 4MEZA 3GECA 4KQRA 5F1GA 4Y5FA 3BECA 4HH2A 4MLLA 5FL3A 2C6WB 3PBQA 3LCEA 3PR6A 4XUZA 3ZG8B 3CMZA 3IF6A 1BTLA 5EOEA 1A0KA 2L4RA 2VGJA 5AQ7A 1QMEA 4X55A 2X71A 3D4FA 4L0LA 4K91A 5EPHA 4O01A 1S6RA 4S2IA 4R3BA 5EM0A 3ZFZA 1CK3A 2OAQ1 2V8FA 3WS4A 1ESIA 2Y2OA 1Q2PA 4G3KA 4I38A 1Q2QA 1YM1A 4BD1A 4EQIA 3Q07A 3DBAA 4KZBA 1TVFA 1IYPA 3BYDA 3DWKA 3PTEA 3QP2A 3NOTC 2P9VB 3LO7A 2WK0A 3OPHA 4CLCD 2W0NA 5AJGA 4DRTA 5GHZA 4A5RA 2PU4A 1YKDA 1IOUA 4NXGA 4NXBA 3HL9A 3UE6A 2IWDA 3F1OB 2HJ9C 2ZBBA 4K0XA 5F83A 2G2WA 4EERA 1X0OA 2RL3A 3PBNA 2ACGA 4X25A 2XK1A 4HOIA 2OWHA 4P6ZS 4JKTA 4QPRA 4ARZA 2O9BA 4JXWA 3VP3A 1PWCA 3LFVA 3UN7A 1T1CA 5L10A 5CXWA 5EVLA 4G3VA 2ZQ9A 3D3OA 1BSGA 4D60A 4HEFA 3E0YA 2ZM0A 1XP4A 4L9GA 1ERQA 3LI8A 2WADA 1DP9A 3BLMA 2XFTA 5HW3A 3PXPA 3Q7VA 2BASA 4AFIA 1ES2A 3SZTA 5FEGA 4R0QA 2OWJA 3IBJA 3UDFA 4WELA 3O86A 1ZG4A 1FCOA 2P9VA 4MCWA 2Q0OA 1SDNA 3BFGA 3ZCZA 3T4JA 4PM7A 2XH9A 3BJNA 1SDEA 3UMEA 1K4FA 1MKIA 1PW1A 5EVID 1HVBA 1NYYA 2HP6A 4GHIA 4DE3A 2EX8A 1K4EA 1ZHHB 1N9LA 1K6RA 1JTDA 3IS2A 2Y59A 2R9WA 4GS9A 3HLBA 3T50A 3W4PA 3ZGAB 1TS8A 4UA9A 2I9VA 4FH4A 4P87A 3MZFA 4FUWA 1XGIA 1RP5A 3QP5A 2D01A 4IJGA 1K54A 1YLYA 3PBSA 4HP9A 3CUEC 1H5XA 4HNBA 3M6HA 4BENA 4U3TA 4S2OA 4S2JA 3UB8A 1V9YA 4ZTKA 3E98A 2MJ6A 4GHIB 3G35A 1ACFA 4KQOA 5J3WA 5F5YA 3LIBA 2XSSA 2OLUA 2ZD8A 3SS4A 3N6IA 1BYWA 3H9WA 3A3FA 3KSGA 4HESA 2Y2IA 3G2YA 2VGLS 1NYMA 2Q9MA 3O87A 1ZKJA 2W1TB 3W8KA 3N8SA 4BL2A 4EUVA 2J3TC 3SH8A 1OT6A 3HUMA 3ISGA 1IELA 3G2ZA 3WRTA 1M40A 3C4PA 3H82A 1TDGA 4NXEA 4WZ5C 5AVEA 3OC2A 3FPWA 2WAFA 2VV6A 2B18A 5KZHA 4GZBA 3BFDA 3O3VA 3R7WB 3VSKA 4MMNA 1NXYA 5F68A 4BBVA 2EX9A 2PDRA 3Q7VB 5CRFA 2Z2MB 3BQAA 4Z9QA 3WS1A 2Y2PA 1T19A 5CGWA 1JWPA 3VOYA 2L1MA 5FAPA 4EEUA 3TW8A
chains in the Genus database with same CATH topology
1S66L 3E4QA 4JGRA 2PR6A 3LR5A 3ULFA 3C2WA 2WKQA 3MF0A 3F1OA 3HCYA 4HY8A 1DRMA 2W3FA 3H7WB 5KSHA 3T4QA 4JGPA 3UB7A 3K3DA 1XJ3A 2KX6A 3LR3A 3O5YA 3TE8A 2GX5A 4OOLA 4DN0A 4KQDA 3C8CA 3PYPA 1STZA 2Z6CA 2ZMVA 4I3JA 4ME4A 3MFXA 4E04A 4B93A 3FG8A 2JHEA 3F1PA 4MDZA 2W1TA 3PHYA 5DFYA 2INWA 5HWWA 5C5KA 4DJ3A 4HIAA 3B47A 1T18A 5HPIA 1OTIA 5HD5A 3T4TA 4BJPA 2PYRA 1P9WA 2XRNA 2O0YA 5HL6A 4GLQA 4HHDA 1G6OA 2V1BA 4YOFA 2JN7A 4R70A 2CMNA 5HDDA 1OTEA 4O0PA 2P08A 2XA7M 4GS9B 4PKYA 2ZMFA 3K2NA 3TJZC 4LLOB 2A24B 1LSWA 1S4SA 3OCLA 3OBFA 3KSFA 1OT9A 3B42A 4LRXC 3FC7A 3VE3A 4PHTA 3VV4A 2Y79A 1ODVA 2GJ3A 3HJIA 3BWLA 4ARZB 3LR0A 5HWTA 1V9ZA 3MQOA 3TRCA 1TF1A 2ZOHA 2EWWA 2V1AA 2VZWA 3V67A 4UEYA 4LPZA 3UE3A 1S1YA 3LYXA 4O8GA 4GJ4A 2QYBA 2JKRI 5HDSA 1UGUA 4MN7A 5L8MA 3MXQA 1T1BA 3P01A 4P6ZM 2KOIA 3EWKA 4NXFA 2IA2A 5DF9A 3JVVA 1S4RA 1MKMA 1D7EA 1OJGA 2P04A 5F6AA 4WEKA 2PR5A 2VV8A 2QHKA 5K5BA 3CITA 4HJ4A 5CX7A 4OOMA 2WKPA 1YSQA 2HJEA 2D02A 3JVUA 2EWVA 4FSFA 1NWZA 4CQHA 5DJTA 3SW1A 2GNXA 1XJ2A 3MR0A 4RQ9A 3OOVA 1ZTUA 3KSIA 1F9IA 4HJ6A 3UMDA 2VEAA 1JNUA 5KIZA 3GECA 5TBMA 2B02A 4Y5FA 2VKSA 3ZQ5A 3A0VA 4HH2A 4LRZE 1D06A 2OAP1 1TD5A 2LB5A 5FL3A 4CLCC 1YSPA 3H82B 3PBQA 2PYPA 3PR6A 2QKPA 3EEHA 1OTAA 3K3CA 4F3LA 2GZAA 5HD3A 3S7OA 2W27A 2KLIA 2L4RA 2VA0A 3IBRA 2NUTC 3NOUC 4L0LA 3EGDC 3PBTA 4YNRA 4O01A 5A8BA 3LIDA 4Y3IA 3KO6A 3ICYA 1S1ZA 2QJ7A 4EQ1A 4WN5A 2OAQ1 5EFWA 3G6OA 4CLCE 4I3AA 3OLOA 4ZRRA 4L9EA 4G3KA 4I38A 1F98A 4Q0JA 2NUPC 2P7JA 4G3WA 2FZ0A 1IFQA 3DBAA 4CLCB 4DJ2A 1OTBA 2O99A 3NJAA 4H6JB 2PD7A 3F1NB 3S7PA 3NOTC 3EQUA 5G4ZA 5IU1A 1UWPX 3UB6A 3CWFA 3R4KA 3GDIA 3RTYA 4CLCD 2W0NA 2A2LA 5AJGA 2YKHA 3A0SA 1YKDA 2J3WA 2M7VA 5MC7A 4Q0IA 4BWIA 1IOUA 4NXGA 3S7NA 4WLAA 4NXBA 2JKRM 3UE6A 2YKFA 3F1OB 2HJ9C 2ZBBA 4EERA 1X0OA 5J7EA 3PBNA 4MN5A 1N9NA 2W3EA 3H7WA 3KYQA 4HOIA 4R3AA 2OWHA 4P6ZS 4I39A 4QPRA 4WUJA 4ARZA 4XT2A 2O9BA 5DFXA 3B33A 3LFVA 1P0ZA 3E4OA 1T1CA 2VV7A 1LSVA 4UQIM 4BBUA 4G3VA 3D3OA 4WL9A 2VX8A 4HP4A 4II7A 3KYZA 1H3QA 1TS6A 2QWSA 1P9RA 5HSQA 3E0YA 5G4YA 5TBMB 4EU0A 3MJQA 1XFNA 4L9GA 4K08A 3VE4A 3LIEA 3LI8A 3RFBA 1DP6A 3E4PA 1DP9A 4KUKA 1OPXA 3R7WA 3D72A 3T4SA 3PXPA 2L0WA 2BASA 2LB9A 4BMWA 4AFIA 2M1CA 1MZUA 1WA9A 3ZYTA 3T4OA 3C30A 2OWJA 2V9AA 3IBJA 2G7UA 4WELA 2V0UA 2JKTI 5HZHA 1NLYA 4EESA 4ETZA 2A24A 4MCWA 3T4JA 4EXOA 4XT2B 2J3TD 1EW0A 5F69A 5HWVA 3BJNA 4IUHA 3UMEA 2O9AA 1TS7A 2W3HA 3BQ8A 1VHMA 1GSXA 2XROA 4GHIA 5I5LA 2PHYA 1XJ6A 1T1AA 4HI4A 3KX0X 2JKTM 1ZHHB 2FH5A 1N9LA 1VB6A 4I3IA 3W2ZA 3LIAA 3IS2A 4GS9A 3T50A 4CLCA 4LRYC 1TS0A 1KOUA 1F5MA 1TS8A 2I9VA 4KUOA 3UB9A 2ZOIA 4IHQA 5DJUA 3VOLA 3F1PB 2VGLM 4DMZA 1LL8A 3BW6A 4JGQA 2VLGA 3BY9A 4UQIS 2XA7S 4PAUA 5AVFA 3LIFA 3CLOA 3NHQA 2HF6A 4JGOA 2D01A 4IJGA 2W3DA 3LUQA 2KDKA 3PBSA 4HP9A 3CUEC 4FOFA 4EW7A 2DMWA 2QJ5A 4HNBA 2Z6DA 4EEPA 3PBOA 1OTDA 4NEED 4Z1WA 1G28A 3UB8A 2WKRA 1V9YA 3CUEA 3E98A 4YWZA 2MJ6A 3S7QA 2M7UA 4GHIB 5J4EA 1H8MA 2K7SA 5DKKA 3F1NA 4KQOA 4PKYG 4Y2FA 4M4XA 5F5YA 1GSWA 5J3WA 5LBRA 1LT0A 3MQ0A 3LR4A 3LIBA 2XSSA 4EETB 1NRJA 2VJWA 3FPVA 4ETXA 1P97A 2PD8A 3PBRA 1BYWA 3H9WA 3KSGA 3T4LA 1NLZA 3EOIA 2EA9A 1UWNX 2W1RA 2Y8HA 2VGLS 1LSXA 3U2AA 4F3LB 2R78A 3T4KA 1XFQA 3KSHA 4MN6A 3BY8A 4HH3A 3CAXA 3HJKA 3P7NA 2W1TB 3LICA 3MQQA 1XJ4A 5DKLA 5HDCA 3RH8B 4EUVA 2J3TC 4IUKA 1OT6A 2K2NA 2HV1A 2J80A 4NKPA 2OOLA 1Y28A 4WF0A 5TJJA 4WEJA 4R38A 4Q0HA 4HQAA 5IT5A 1DP8A 3C38A 3H82A 2K31A 3EQVA 2HGVA 4NXEA 5AVEA 1YAXA 3EEAA 3EGXC 3LI9A 3OC2A 1S67L 3FPWA 2VV6A 2W3GA 2B18A 4GCZA 2PT7A 4GW9A 1N9OA 3OCNA 4R6LA 4H6JA 2H28A 3R7WB 3NOPC 4MMNA 5F68A 4BBVA 4HJ3A 2PDRA 5HPFA 1GSVA 4I5SA 2O9CA 3CI6A 3BQAA 3A0RA 3MMHA 1OJ5A 4B9OA 3IS2B 1W63Q 1MC0A 1T19A 2V0WA 2L1MA 1W63M 5IS1A 4BBTA 4EEUA 3TW8A 4L9FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S4R A;  1S66 L;  3E4Q A;  3LUQ A;  2KDK A;  2PR6 A;  4JGR A;  3UE6 A;  3C2W A;  2WKQ A;  2YKF A;  4HP9 A;  1D7E A;  3ULF A;  1OJG A;  3F1O B;  5HWT A;  2ZBB A;  3F1O A;  4EER A;  4EW7 A;  1X0O A;  2QJ5 A;  4HNB A;  2Z6D A;  4HY8 A;  1DRM A;  1OTD A;  2PR5 A;  5F6A A;  4EEP A;  2VV8 A;  4MN5 A;  2QHK A;  1N9N A;  3H7W B;  4HJ4 A;  1G28 A;  3H7W A;  4HOI A;  2WKP A;  4R3A A;  4JGP A;  2OWH A;  3UB7 A;  3UB8 A;  4I39 A;  2WKR A;  2D02 A;  4WUJ A;  1V9Y A;  1NWZ A;  3K3D A;  4XT2 A;  1XJ3 A;  2KX6 A;  3UB6 A;  4YWZ A;  3B33 A;  5DJT A;  1P0Z A;  3E4O A;  1T1C A;  4GHI B;  3SW1 A;  1XJ2 A;  3C8C A;  3MR0 A;  2K7S A;  3PYP A;  4KQD A;  4RQ9 A;  5DKK A;  5J4E A;  1F9I A;  2VV7 A;  3F1N A;  5KIZ A;  2Z6C A;  4HJ6 A;  3UMD A;  1LSV A;  2VEA A;  1JNU A;  3MFX A;  4I3J A;  4M4X A;  1GSW A;  4PKY G;  5F5Y A;  5J3W A;  3GEC A;  4BBU A;  1LT0 A;  3FG8 A;  5TBM A;  4WL9 A;  2JHE A;  2B02 A;  3F1P A;  3LIB A;  4HP4 A;  3PHY A;  5HWW A;  2INW A;  4EET B;  1TS6 A;  2QWS A;  3ZQ5 A;  4DJ3 A;  3A0V A;  3UB9 A;  1P97 A;  4HIA A;  2PD8 A;  4HH2 A;  1T18 A;  1D06 A;  4LRZ E;  1OTI A;  1BYW A;  5HSQ A;  3H9W A;  5G4Y A;  5TBM B;  5HD5 A;  2PYR A;  3H82 B;  3MJQ A;  1XFN A;  2PYP A;  2EA9 A;  2QKP A;  4L9G A;  4K08 A;  1UWN X;  3EEH A;  1OTA A;  4HHD A;  3LIE A;  3LI8 A;  3VE4 A;  1LSX A;  4EXO A;  1DP6 A;  3E4P A;  4F3L B;  1DP9 A;  4KUK A;  3D72 A;  2R78 A;  3K3C A;  4F3L A;  5HD3 A;  1XFQ A;  2L0W A;  2BAS A;  2V1B A;  4MN6 A;  3BY8 A;  2JN7 A;  2M1C A;  2W27 A;  1MZU A;  1WA9 A;  2L4R A;  4HH3 A;  4R70 A;  3CAX A;  2CMN A;  3HJK A;  5HDD A;  2OWJ A;  2V9A A;  3P7N A;  1OTE A;  3LIC A;  3MQQ A;  4GS9 B;  1XJ4 A;  5DKL A;  4BBV A;  4PKY A;  2V0U A;  3IBR A;  3NOU C;  5HDC A;  3RH8 B;  5HZH A;  4EES A;  1OT6 A;  2A24 A;  4LLO B;  2HV1 A;  2J80 A;  5A8B A;  2A24 B;  3LID A;  1LSW A;  1S4S A;  2OOL A;  1Y28 A;  4WF0 A;  4R38 A;  1OT9 A;  1S1Z A;  2QJ7 A;  3ICY A;  4HQA A;  1EW0 A;  1DP8 A;  3FC7 A;  4LRX C;  4WN5 A;  4XT2 B;  5F69 A;  4EQ1 A;  5EFW A;  5HWV A;  4E04 A;  3VE3 A;  3UME A;  3G6O A;  3H82 A;  1TS7 A;  4I3A A;  4NXE A;  1ODV A;  3OLO A;  2GJ3 A;  4L9E A;  4I38 A;  1F98 A;  1GSX A;  5AVE A;  5J7E A;  2P7J A;  4GHI A;  3LI9 A;  5I5L A;  3HJI A;  2PHY A;  3BWL A;  1S67 L;  1XJ6 A;  1T1A A;  4HI4 A;  1OTB A;  2VV6 A;  3KX0 X;  4GCZ A;  4GW9 A;  4DJ2 A;  1N9O A;  3NJA A;  1V9Z A;  4H6J A;  4R6L A;  1N9L A;  1VB6 A;  2H28 A;  3MQO A;  2ZOH A;  3NOP C;  3LIA A;  4H6J B;  2PD7 A;  2V1A A;  4I3I A;  3F1N B;  4HJ3 A;  3IS2 A;  2PDR A;  3NOT C;  4GS9 A;  5F68 A;  4LPZ A;  5G4Z A;  1S1Y A;  1UWP X;  5IU1 A;  3CWF A;  3T50 A;  1GSV A;  4LRY C;  3LYX A;  1TS0 A;  1KOU A;  1TS8 A;  2I9V A;  3GDI A;  4I5S A;  4KUO A;  3RTY A;  2ZOI A;  5DJU A;  3A0R A;  3VOL A;  4NXG A;  5HDS A;  3F1P B;  1OJ5 A;  2W0N A;  4B9O A;  1LL8 A;  1UGU A;  3IS2 B;  3MXQ A;  1T1B A;  4JGQ A;  2YKH A;  3A0S A;  1T19 A;  2VLG A;  2V0W A;  3BY9 A;  3EWK A;  5AVF A;  3LIF A;  4NXF A;  2L1M A;  5IS1 A;  3CLO A;  3NHQ A;  4BBT A;  4JGO A;  4EEU A;  2D01 A;  4L9F A;  4WLA A;  4NXB A; 
#chains in the Genus database with same CATH topology
 1S66 L;  4JGR A;  3C2W A;  2XLN A;  1XA1 A;  1DJA A;  1DRM A;  5F82 A;  5FAS A;  4LFU A;  3T1R A;  1ONG A;  1XJ3 A;  2PBD P;  2GX5 A;  1GHM A;  3PYP A;  1STZ A;  4EWF A;  5A90 A;  2Z6C A;  4LV0 A;  5EM1 A;  4I3J A;  4E04 A;  3BEB A;  3F1P A;  2W1T A;  3PHY A;  2INW A;  3W4Q A;  4DJ3 A;  1OTI A;  4S2N A;  3HLC A;  4BJP A;  5A92 A;  2O0Y A;  5CTN A;  4N1H A;  1SKO B;  2V1B A;  3UDX A;  2CMN A;  2R9X A;  1JTG A;  4JXS A;  4GS9 B;  2B5R A;  4IVK A;  5E2G A;  1SHV A;  4ESP A;  1S4S A;  3KSF A;  3B42 A;  3HLF A;  2P74 A;  5HAR A;  4X1M A;  3OPR A;  4E3L A;  2GJ3 A;  4QD4 A;  1IKG A;  2QPN A;  2XR0 A;  1NJ4 A;  2ZOH A;  2EWW A;  3Q82 A;  1S1Y A;  3IF5 A;  4GJ4 A;  5L8M A;  3WS0 A;  2ZC6 B;  4NXF A;  3MSH A;  2UWX A;  4OQH A;  1MKM A;  1AXB A;  1K57 A;  3C5A A;  5CX7 A;  4R1G A;  2EXA A;  4XXR A;  4Y0O A;  2XEP A;  4CQH A;  1K54 C;  3SW1 A;  1XJ2 A;  2AVX A;  4GN2 A;  5KIZ A;  3P09 A;  3PAG A;  3V3R A;  3L7H A;  3SH7 A;  1D06 A;  2LB5 A;  2I72 A;  2PYP A;  1OTA A;  4P6B A;  1VEU B;  4PPR A;  3K3C A;  3Q81 A;  2GZA A;  4F3L A;  4OQI A;  5HD3 A;  1ES4 A;  2W27 A;  2VA0 A;  1EI5 A;  1YLZ A;  3VP0 A;  2QZ6 A;  2NUT C;  5GLD A;  3LID A;  1K55 A;  3KO6 A;  2HDU A;  3ICY A;  2QJ7 A;  1KE3 A;  2BLS A;  3SH9 A;  4CLC E;  5G18 A;  4JXG A;  3OLO A;  2WZX A;  4NK3 A;  3A3I A;  1IFQ A;  1FCN A;  4CLC B;  4DJ2 A;  2XD5 A;  3BM6 A;  3ITA A;  2Y91 A;  2PU2 A;  3NJA A;  4IVI A;  5JYP A;  1H0M A;  4H6J B;  3S7P A;  3GSG A;  3UB6 A;  5G4Z A;  1HD8 A;  2GDN A;  2Q9N A;  3GDI A;  4RVA A;  3CZD A;  2A2L A;  2YKH A;  4EBP A;  3IX4 A;  3QP8 A;  3UB5 P;  3ZNY A;  1MXO A;  4BWI A;  1BUL A;  2YKF A;  3JPU A;  4E6W A;  5J7E A;  1FCM A;  2IWC A;  3H7W A;  5HAQ A;  4GOG A;  4KZ3 A;  4XT2 A;  3B33 A;  1P0Z A;  3M2J A;  1YPR A;  1YLJ A;  3CPT A;  2VV7 A;  1LSV A;  2WGW B;  4CJN A;  1JVJ A;  4LCM A;  1W8Y A;  2OLV A;  5HSQ A;  5G4Y A;  4EU0 A;  1MPL A;  1WYC A;  4DXB A;  1YMS A;  3T1S A;  3RFB A;  3M6B A;  3IXH A;  1BLC A;  3D72 A;  4UA6 A;  5M18 A;  2L0W A;  2LB9 A;  1GA9 A;  3UY6 A;  1MZU A;  1WA9 A;  4DDS A;  5HAI A;  1NLY A;  2EXB A;  5FQM A;  2A24 A;  1PZP A;  4OPZ A;  2J3T D;  1EW0 A;  2QMI A;  1K0K A;  3V5M A;  5F69 A;  3OPP A;  4OVD A;  2O9A A;  1TS7 A;  4X56 A;  1VHM A;  1GA0 A;  3ZVW A;  3A3E A;  1XJ6 A;  3N8L A;  4WMC A;  3IF6 B;  4LRY C;  3UB9 A;  1KOU A;  1F5M A;  4KUO A;  3ZG0 A;  2ZOI A;  1PI4 A;  2VGL M;  3T12 B;  5U47 A;  2ZMA A;  5EOO A;  3LIF A;  4NET A;  4PMA A;  1XA7 A;  3CLO A;  3NHQ A;  2J8Y A;  5CGX A;  1H8Z A;  3HVF A;  4EW7 A;  1OTD A;  3MKE A;  4R4R A;  5J8X A;  4YFM A;  4Z1W A;  1LL5 A;  3BFE A;  1I5Q A;  2WKR A;  3CUE A;  3M2K A;  4YWZ A;  2M7U A;  4P0M A;  5DKK A;  1KVM A;  4PKY G;  4Y2F A;  1G5U A;  1AWI A;  4H8R A;  1NY0 A;  3LR4 A;  4KZ7 A;  1E4D A;  5DF7 A;  5GL9 A;  3PBR A;  2ZQC A;  4U0X A;  1UWN X;  3S4X A;  1LSX A;  3U2A A;  4OLG A;  2R78 A;  3GVB A;  3T4K A;  4Y13 A;  1XFQ A;  5CEC A;  3L9K A;  3CG5 A;  4HH3 A;  1Z09 A;  3CAX A;  3HJK A;  3P7N A;  2HDQ A;  3LIC A;  1XXM A;  5FAO A;  3RH8 B;  3VFF A;  1TEM A;  3GR2 A;  2K2N A;  1J9M A;  4BLM A;  2HP5 A;  4WEJ A;  3HRE A;  1DP8 A;  4BL3 A;  1WE4 A;  4X1L A;  2K31 A;  3HUN A;  4LEN A;  3EEA A;  1ES5 A;  2V8C A;  3NDE A;  2W3G A;  4GW9 A;  3OCN A;  4H6J A;  2H28 A;  3NOP C;  3FYZ A;  3UNW A;  3AGF A;  1GSV A;  1SCW A;  1LI9 A;  3A0R A;  3NC8 A;  4E3J A;  4GKU A;  3S1Y A;  2V0W A;  1LHY A;  2XFS A;  1W63 M;  1PI5 A;  4XUX A;  4BBT A;  3E4Q A;  3LR5 A;  2WKQ A;  3MF0 A;  3UE1 A;  3S22 A;  4HY8 A;  3PAE A;  1OME A;  3H7W B;  4CPK A;  4JGP A;  1LLB A;  1CEF A;  4X68 A;  3VP1 A;  3K3D A;  2KX6 A;  3NI9 A;  4EBL A;  3TE8 A;  4E3O A;  4DN0 A;  4UHU A;  2ZMV A;  4ME4 A;  4YIN A;  3UDI A;  2JHE A;  3UPN A;  1O07 A;  4MDZ A;  5FQJ A;  5C5K A;  3DTM A;  4GNU A;  4LV1 A;  4ZAM A;  2BTF P;  3DTE A;  4WMC D;  5HD5 A;  2WUQ A;  2EX2 A;  4GLQ A;  2IWB A;  5CTM A;  4HHD A;  5CGS A;  2J9O A;  4RYE A;  4YOF A;  2JN7 A;  3UE0 A;  3ZNT A;  3UPP A;  4OON A;  3IHB A;  2XA7 M;  3BFF A;  2PAV P;  4PKY A;  3K2N A;  1CJF A;  4LLO B;  2WGV A;  3OCL A;  5EVI B;  3OBF A;  3IH9 A;  4Y0U A;  4WBG A;  3FC7 A;  2UV0 E;  3U4L P;  1KGE A;  2JCH A;  3VV4 A;  4FTX A;  3IWO A;  3MZE A;  4RA7 A;  3HJI A;  3BWL A;  3MFD A;  5EE8 A;  1V9Z A;  5HWT A;  3MQO A;  1TF1 A;  4WYY A;  1E3U D;  2V1A A;  4LPZ A;  4S2N C;  3ZVT A;  4MBK A;  5HDS A;  1QMF A;  4DF6 A;  1T1B A;  3IXD A;  2A49 A;  1KE0 A;  3N7W A;  1FSY A;  1VET B;  4P6Z M;  1GHI A;  1FOF A;  4ID4 A;  2ZC7 A;  4JPM A;  3JVV A;  3G31 A;  1D7E A;  5F6A A;  3TG9 A;  5FQ9 A;  2PR5 A;  2QHK A;  3C7U A;  3CIT A;  5K5B A;  3QP1 A;  4HJ4 A;  4E3I A;  3BRM A;  2D02 A;  3JVU A;  1NWZ A;  4QJG A;  5DJT A;  3E2K A;  1M6K A;  3HLW A;  2GNX A;  1HTZ A;  3TOI A;  3KSI A;  1PFL A;  2VEA A;  4LGW A;  5BOH A;  2E8J A;  3A0V A;  2OAP 1;  1TD5 A;  3ITB A;  1K56 A;  1YSP A;  4Y7P A;  2ZM8 A;  1G6A A;  4KZ8 A;  1J3W A;  4R4S A;  1CEG A;  2KLI A;  4WZ5 A;  4DE0 A;  4B4Z A;  3QNC A;  4K0W A;  3IBR A;  2JKF A;  1DJC A;  3G4P A;  3NOU C;  5GLB A;  2OV5 A;  1FQG A;  4WN5 A;  3GV9 A;  4I3A A;  2HZ5 A;  1JWV A;  4ZRR A;  4Q0J A;  4L9E A;  5A91 A;  1F98 A;  3LY3 A;  3IH8 A;  4OP8 A;  1OTB A;  2ZM2 A;  4RX2 A;  5FI7 A;  4PM6 A;  3F1N B;  4BQM A;  3EQU A;  1WYB A;  5IU1 A;  3MS6 A;  1GHP A;  3CWF A;  4KEN B;  4JXV A;  5FI2 A;  5FQQ A;  1L0D A;  2RCX A;  3NUL A;  3VP2 A;  3A0S A;  3IWI A;  2ZQ7 A;  4OKP A;  1EWZ A;  2HP9 A;  5MC7 A;  4Q0I A;  5HFO A;  1DJB A;  3V3S A;  4WLA A;  2WKE A;  1GCE A;  5TR7 A;  5FQI A;  1N9N A;  5EEC A;  5FAT A;  4S2L A;  5D3O A;  4ZJ1 A;  4NG2 A;  4UA7 A;  5DFX A;  1XPB A;  1C3B A;  3E4O A;  1ALQ A;  1XX2 A;  2ZL1 B;  4KG5 A;  2XD1 A;  3IHA A;  4S2K A;  4UQI M;  3QNB A;  4JF6 A;  4F94 A;  1H3Q A;  3I7J A;  5DVA A;  2WZZ A;  1P9R A;  5TBM B;  1VET A;  2ZQA A;  4DKI A;  3FKV A;  4K08 A;  1ESU A;  3LIE A;  1DP6 A;  4KUK A;  4JBF A;  3RJU A;  2Z2L B;  4KZ6 A;  1G68 A;  3C30 A;  2V9A A;  1SKF A;  2G7U A;  3IWQ A;  2V0U A;  1MBL A;  5HZH A;  2H0T A;  5L09 A;  4FCF A;  4GD8 A;  4KZ5 A;  3P98 A;  4IUH A;  2FFY A;  1GSX A;  4QHC A;  5I5L A;  2PHY A;  1T1A A;  1MWS A;  2JKT M;  3IX3 A;  2FH5 A;  1VB6 A;  2Y2L A;  3W2Z A;  2PBY A;  4CLC A;  4IHQ A;  5DJU A;  3SS5 A;  3VOL A;  1LL8 A;  4JGQ A;  1MWR A;  1KVL A;  2XA7 S;  4PAU A;  2HF6 A;  2G2U A;  4JGO A;  3VFH A;  3LUQ A;  2KDK A;  5GHX A;  5M19 A;  1IEM A;  5HL1 A;  1PWG A;  2DMW A;  4IBX A;  3PBO A;  3VP4 A;  1L2S A;  3W4O A;  2Y2G A;  1YMX A;  3C4O A;  1K57 C;  2JE5 A;  1CI8 A;  3RXX A;  1PIO A;  5J4E A;  1H8M A;  3F1N A;  5LBR A;  3MQ0 A;  4UAA A;  4HBU A;  1BZA A;  3GTC A;  2PD8 A;  4OP5 A;  4EUZ A;  3EOI A;  4ZDX A;  3LY4 A;  2EA9 A;  5HX9 A;  2W1R A;  2Y8H A;  3HBR A;  3WRZ A;  4MBF A;  3KSH A;  4C3Q A;  3WWX A;  1CI9 A;  1MWU A;  4X53 A;  4WM9 A;  1FR1 A;  5A93 A;  4IUK A;  2HV1 A;  4NKP A;  1FR6 A;  2OOL A;  4WF0 A;  5TJJ A;  5IT5 A;  3LEQ A;  3EQV A;  3FV7 A;  2EX6 A;  4RX3 A;  3EGX C;  3LI9 A;  4FD8 A;  1S67 L;  4GCZ A;  2PT7 A;  1N9O A;  1NRF A;  4Q8I A;  4HJ3 A;  1W5D A;  5HPF A;  1DY6 A;  4I5S A;  3CI6 A;  3ZG7 B;  3MMH A;  1OJ5 A;  4KG6 A;  3MBZ A;  5IS1 A;  4S2P A;  4EV4 A;  5DTT A;  1TDL A;  2PR6 A;  4MBH A;  1K25 A;  3ULF A;  1ZG6 A;  3HCY A;  4PM9 A;  5KSH A;  3T4Q A;  3WS5 A;  3C8C A;  2B95 A;  5GHY A;  3MFX A;  2X01 A;  3FG8 A;  3FZC A;  3DTK A;  2HDS A;  5HWW A;  3ZG9 B;  4N9K A;  4HIA A;  3B47 A;  5GLC A;  4QY6 A;  2E8I A;  1KDS A;  2PYR A;  2XRN A;  3N4I A;  2V20 A;  3UO9 A;  2H0Y A;  4R70 A;  5HDD A;  5I94 A;  1OTE A;  2P08 A;  3DWZ A;  4OPY A;  1S0W A;  3NY4 A;  2ZMF A;  2XGN A;  3Q1F A;  3JYI A;  1K55 C;  2A24 B;  2FFF B;  1H8Y A;  1KE4 A;  4LRX C;  4GD6 A;  1YLW A;  3CHW P;  3BFC A;  3NBL A;  4PHT A;  4ZBE A;  3DAV A;  5EUA A;  1ODV A;  4Y17 A;  4ZJ2 A;  4O7D A;  3WS2 A;  4X69 A;  3FWL A;  2Y55 A;  3O88 A;  2VZW A;  3V67 A;  4UEY A;  2ZC5 B;  2V1Z A;  3LYX A;  4O8G A;  2JKR I;  4MN7 A;  3MXQ A;  5FDS A;  1YQS A;  2KOI A;  3EWK A;  1ES3 A;  2DCF A;  3SS3 A;  4DDY A;  1E25 A;  5KSC A;  1S4R A;  1L0G A;  3OPL A;  4WEK A;  2VV8 A;  3GMW A;  5FDH A;  2WKP A;  5JYO A;  2EWV A;  2ZQD A;  3NCK A;  2J7V A;  4RQ9 A;  1BLP A;  1ZTU A;  3OOV A;  3V50 A;  3MXR A;  4B4X A;  2OSU A;  2ZQ8 A;  4HJ6 A;  1JNU A;  5TBM A;  2B02 A;  2VKS A;  1VM1 A;  3GRJ A;  3A3D A;  3ZQ5 A;  2HDR A;  4LRZ E;  4N1X A;  5DTS A;  1IYO A;  4CLC C;  3H82 B;  3AGD A;  2QKP A;  3EEH A;  3T1X A;  3S7O A;  5E2H A;  4GDB A;  2Y2H A;  4U0T A;  5L2F A;  3EGD C;  1Y54 A;  2H10 A;  3PBT A;  4YNR A;  4PM5 A;  4JF4 A;  5A8B A;  4Y3I A;  1IYQ A;  5F1F A;  2DNS A;  1S1Z A;  4EQ1 A;  1KDW A;  5EFW A;  1Z6F A;  3G6O A;  4QB8 A;  2A3U A;  1KGF A;  2NUP C;  5EVE A;  1PWD A;  5FA7 A;  4KZ9 A;  3TSG A;  2P7J A;  4G3W A;  2FZ0 A;  3DTI A;  1NZO A;  4OLD A;  1CF0 A;  2O99 A;  2JKG A;  4LCL A;  2PD7 A;  5GLA A;  5E43 A;  1UWP X;  5FAQ A;  1XKZ A;  1SKO A;  1PYY A;  3R4K A;  4S2M A;  3RTY A;  3IQA A;  1VEU A;  1D1J A;  5CHM A;  3HLD A;  2WYX A;  3VMA A;  2J3W A;  1RGZ A;  2M7V A;  4QWO A;  3S7N A;  1L3L A;  3G30 A;  3MKF A;  2Y2K A;  2JKR M;  4DE1 A;  1N4O A;  4MN5 A;  4FH2 A;  4Y15 A;  2W3E A;  3KYQ A;  4R3A A;  4I39 A;  4WZ4 A;  4WUJ A;  3OZH A;  5FEF A;  3IXB A;  1YT4 A;  1YLP A;  1CQA A;  5M1A A;  4R23 A;  4BBU A;  4WL9 A;  2VX8 A;  4HP4 A;  4II7 A;  3KYZ A;  1TS6 A;  2QWS A;  3RXW A;  3T1Q B;  3QP6 A;  3CJM A;  3MJQ A;  2EFU A;  1XFN A;  2PRF A;  5CHJ A;  1ERM A;  3VE4 A;  3E2L A;  3E4P A;  3T4S A;  1OPX A;  3R7W A;  4GDN A;  4BMW A;  2M1C A;  3ZYT A;  1KGG A;  3NEC A;  3T4O A;  3KYE A;  2JKT I;  4EES A;  4ETZ A;  5DTK A;  1RCJ A;  2ZC4 B;  3HLG A;  4E3K A;  3QP4 A;  4EXO A;  4XT2 B;  3LEZ A;  5HWV A;  5AQB A;  1IYS A;  4LV3 A;  3CPT B;  3D9Y A;  2W3H A;  3BQ8 A;  1MWT A;  4E3N A;  3C7V A;  2XRO A;  2WKI A;  2H5S A;  4X6T A;  1LL9 A;  4HI4 A;  3IF6 C;  3KX0 X;  4B88 A;  3G34 A;  5IHV A;  4I3I A;  4N92 A;  3LIA A;  4E3M A;  2C5W B;  5CER A;  1ERO A;  1TS0 A;  2BG1 A;  5CHU A;  3F1P B;  4DMZ A;  1HZO A;  3A3J A;  3BW6 A;  3FKW A;  4OOY A;  2VLG A;  3BY9 A;  4UQI S;  5AVF A;  1JWZ A;  2ZJ9 A;  2WGW A;  2W3D A;  4OQG A;  5AQ9 A;  4FOF A;  1K38 A;  4KZA A;  2QJ5 A;  4EEP A;  2Z6D A;  3DW0 A;  4NEE D;  1FIL A;  4LV2 A;  1L0E A;  1G28 A;  4DE2 A;  1ZC2 A;  4OH0 A;  2V2F F;  3S7Q A;  1HLU P;  5EVI A;  2K7S A;  3MZD A;  3IT9 A;  4M4X A;  1GSW A;  1LT0 A;  2ZL1 A;  4EET B;  3HLE A;  1NRJ A;  2VJW A;  1K56 D;  3FPV A;  4ETX A;  5EV0 A;  3AGE A;  1P97 A;  2JC7 A;  3T4L A;  1LI0 A;  1NLZ A;  2Y2N A;  1YLT A;  5E2E A;  4F3L B;  4JLF A;  3ZHH A;  1PW8 A;  4MN6 A;  3BY8 A;  4BD0 A;  1VQQ A;  2WKH A;  1F2K A;  3MQQ A;  1XJ4 A;  3LGO A;  5DKL A;  1O7E A;  5HDC A;  1BT5 A;  2J80 A;  4IED A;  2Y2Q A;  1Y28 A;  1BLS A;  4R38 A;  4Q0H A;  4HQA A;  5CED A;  3BLS A;  3C38 A;  2HGV A;  3B3X A;  1YAX A;  4C75 A;  1BLH A;  1U60 A;  4R6L A;  2XF3 A;  1ONH A;  4P85 A;  4D2O A;  4M3K A;  2O9C A;  5FSR A;  4MNR A;  4B9O A;  4OPR A;  3IS2 B;  5FI6 A;  1W63 Q;  1MC0 A;  2VGK A;  4PM8 A;  4L9F A;  4OPQ A;  4R3J A;  4EBN A;  2ZC3 B;  3MXS A;  3F1O A;  3HUO A;  2EFX A;  5E2F A;  1N9B A;  1W7F A;  2W3F A;  3UB7 A;  1FSW A;  2VK3 A;  4KG2 A;  4DXC A;  5TFQ A;  3LR3 A;  3O5Y A;  5AQA A;  4OOL A;  1I2S A;  1XGJ A;  4KQD A;  4ZJ3 A;  2Y4A A;  4GB7 A;  4B93 A;  5DFY A;  4JF5 A;  3ZG5 A;  2Y2M A;  3ZDJ A;  5HPI A;  1FIK A;  1T18 A;  3G32 A;  5L07 A;  5CEB A;  3T4T A;  1P9W A;  2ZLY A;  5HAP A;  5HL6 A;  1MY8 A;  1G6O A;  4QY5 A;  5DF8 A;  1IKI A;  3IXG A;  4KZ4 A;  3SOI A;  3VSL A;  4O0P A;  2XDM A;  1SZV A;  1I2W A;  3TJZ C;  3V39 A;  1LSW A;  3NIA A;  1L0F A;  1OT9 A;  4HBT A;  4Y0T A;  3QHY A;  2Y2J A;  3VE3 A;  5TGF A;  2Y79 A;  5FQK A;  1W8Q A;  4ARZ B;  1PZO A;  3LR0 A;  3TRC A;  4IBR A;  3UE3 A;  1BUE A;  3N8R A;  1Y4O A;  2QYB A;  1PNE A;  1NZU A;  3GQZ A;  1UGU A;  1K6S A;  3P01 A;  4OQ0 A;  3VOZ A;  3UPO A;  3NDG A;  2J9P A;  1RGY A;  4KQQ A;  3IX8 A;  2IA2 A;  5DF9 A;  5EVI C;  2XQZ A;  2WAE A;  1W79 A;  1OJG A;  2HPB A;  2DRW A;  2P04 A;  5KMW A;  1E3U A;  2CC1 A;  2WGI A;  4N9L A;  4OOM A;  1YSQ A;  4E6X A;  2HJE A;  3Q7Z A;  4FSF A;  2JBF A;  2X02 A;  4QU3 A;  1PRQ A;  3MR0 A;  4C6Y A;  1F9I A;  3UMD A;  4MEZ A;  3GEC A;  4KQR A;  5F1G A;  4Y5F A;  3BEC A;  4HH2 A;  4MLL A;  5FL3 A;  2C6W B;  3PBQ A;  3LCE A;  3PR6 A;  4XUZ A;  3ZG8 B;  3CMZ A;  3IF6 A;  1BTL A;  5EOE A;  1A0K A;  2L4R A;  2VGJ A;  5AQ7 A;  1QME A;  4X55 A;  2X71 A;  3D4F A;  4L0L A;  4K91 A;  5EPH A;  4O01 A;  1S6R A;  4S2I A;  4R3B A;  5EM0 A;  3ZFZ A;  1CK3 A;  2OAQ 1;  2V8F A;  3WS4 A;  1ESI A;  2Y2O A;  1Q2P A;  4G3K A;  4I38 A;  1Q2Q A;  1YM1 A;  4BD1 A;  4EQI A;  3Q07 A;  3DBA A;  4KZB A;  1TVF A;  1IYP A;  3BYD A;  3DWK A;  3PTE A;  3QP2 A;  3NOT C;  2P9V B;  3LO7 A;  2WK0 A;  3OPH A;  4CLC D;  2W0N A;  5AJG A;  4DRT A;  5GHZ A;  4A5R A;  2PU4 A;  1YKD A;  1IOU A;  4NXG A;  4NXB A;  3HL9 A;  3UE6 A;  2IWD A;  3F1O B;  2HJ9 C;  2ZBB A;  4K0X A;  5F83 A;  2G2W A;  4EER A;  1X0O A;  2RL3 A;  3PBN A;  2ACG A;  4X25 A;  2XK1 A;  4HOI A;  2OWH A;  4P6Z S;  4JKT A;  4QPR A;  4ARZ A;  2O9B A;  4JXW A;  3VP3 A;  1PWC A;  3LFV A;  3UN7 A;  1T1C A;  5L10 A;  5CXW A;  5EVL A;  4G3V A;  2ZQ9 A;  3D3O A;  1BSG A;  4D60 A;  4HEF A;  3E0Y A;  2ZM0 A;  1XP4 A;  4L9G A;  1ERQ A;  3LI8 A;  2WAD A;  1DP9 A;  3BLM A;  2XFT A;  5HW3 A;  3PXP A;  3Q7V A;  2BAS A;  4AFI A;  1ES2 A;  3SZT A;  5FEG A;  4R0Q A;  2OWJ A;  3IBJ A;  3UDF A;  4WEL A;  3O86 A;  1ZG4 A;  1FCO A;  2P9V A;  4MCW A;  2Q0O A;  1SDN A;  3BFG A;  3ZCZ A;  3T4J A;  4PM7 A;  2XH9 A;  3BJN A;  1SDE A;  3UME A;  1K4F A;  1MKI A;  1PW1 A;  5EVI D;  1HVB A;  1NYY A;  2HP6 A;  4GHI A;  4DE3 A;  2EX8 A;  1K4E A;  1ZHH B;  1N9L A;  1K6R A;  1JTD A;  3IS2 A;  2Y59 A;  2R9W A;  4GS9 A;  3HLB A;  3T50 A;  3W4P A;  3ZGA B;  1TS8 A;  4UA9 A;  2I9V A;  4FH4 A;  4P87 A;  3MZF A;  4FUW A;  1XGI A;  1RP5 A;  3QP5 A;  2D01 A;  4IJG A;  1K54 A;  1YLY A;  3PBS A;  4HP9 A;  3CUE C;  1H5X A;  4HNB A;  3M6H A;  4BEN A;  4U3T A;  4S2O A;  4S2J A;  3UB8 A;  1V9Y A;  4ZTK A;  3E98 A;  2MJ6 A;  4GHI B;  3G35 A;  1ACF A;  4KQO A;  5J3W A;  5F5Y A;  3LIB A;  2XSS A;  2OLU A;  2ZD8 A;  3SS4 A;  3N6I A;  1BYW A;  3H9W A;  3A3F A;  3KSG A;  4HES A;  2Y2I A;  3G2Y A;  2VGL S;  1NYM A;  2Q9M A;  3O87 A;  1ZKJ A;  2W1T B;  3W8K A;  3N8S A;  4BL2 A;  4EUV A;  2J3T C;  3SH8 A;  1OT6 A;  3HUM A;  3ISG A;  1IEL A;  3G2Z A;  3WRT A;  1M40 A;  3C4P A;  3H82 A;  1TDG A;  4NXE A;  4WZ5 C;  5AVE A;  3OC2 A;  3FPW A;  2WAF A;  2VV6 A;  2B18 A;  5KZH A;  4GZB A;  3BFD A;  3O3V A;  3R7W B;  3VSK A;  4MMN A;  1NXY A;  5F68 A;  4BBV A;  2EX9 A;  2PDR A;  3Q7V B;  5CRF A;  2Z2M B;  3BQA A;  4Z9Q A;  3WS1 A;  2Y2P A;  1T19 A;  5CGW A;  1JWP A;  3VOY A;  2L1M A;  5FAP A;  4EEU A;  3TW8 A; 
#chains in the Genus database with same CATH homology
 1S66 L;  3E4Q A;  4JGR A;  2PR6 A;  3LR5 A;  3ULF A;  3C2W A;  2WKQ A;  3MF0 A;  3F1O A;  3HCY A;  4HY8 A;  1DRM A;  2W3F A;  3H7W B;  5KSH A;  3T4Q A;  4JGP A;  3UB7 A;  3K3D A;  1XJ3 A;  2KX6 A;  3LR3 A;  3O5Y A;  3TE8 A;  2GX5 A;  4OOL A;  4DN0 A;  4KQD A;  3C8C A;  3PYP A;  1STZ A;  2Z6C A;  2ZMV A;  4I3J A;  4ME4 A;  3MFX A;  4E04 A;  4B93 A;  3FG8 A;  2JHE A;  3F1P A;  4MDZ A;  2W1T A;  3PHY A;  5DFY A;  2INW A;  5HWW A;  5C5K A;  4DJ3 A;  4HIA A;  3B47 A;  1T18 A;  5HPI A;  1OTI A;  5HD5 A;  3T4T A;  4BJP A;  2PYR A;  1P9W A;  2XRN A;  2O0Y A;  5HL6 A;  4GLQ A;  4HHD A;  1G6O A;  2V1B A;  4YOF A;  2JN7 A;  4R70 A;  2CMN A;  5HDD A;  1OTE A;  4O0P A;  2P08 A;  2XA7 M;  4GS9 B;  4PKY A;  2ZMF A;  3K2N A;  3TJZ C;  4LLO B;  2A24 B;  1LSW A;  1S4S A;  3OCL A;  3OBF A;  3KSF A;  1OT9 A;  3B42 A;  4LRX C;  3FC7 A;  3VE3 A;  4PHT A;  3VV4 A;  2Y79 A;  1ODV A;  2GJ3 A;  3HJI A;  3BWL A;  4ARZ B;  3LR0 A;  5HWT A;  1V9Z A;  3MQO A;  3TRC A;  1TF1 A;  2ZOH A;  2EWW A;  2V1A A;  2VZW A;  3V67 A;  4UEY A;  4LPZ A;  3UE3 A;  1S1Y A;  3LYX A;  4O8G A;  4GJ4 A;  2QYB A;  2JKR I;  5HDS A;  1UGU A;  4MN7 A;  5L8M A;  3MXQ A;  1T1B A;  3P01 A;  4P6Z M;  2KOI A;  3EWK A;  4NXF A;  2IA2 A;  5DF9 A;  3JVV A;  1S4R A;  1MKM A;  1D7E A;  1OJG A;  2P04 A;  5F6A A;  4WEK A;  2PR5 A;  2VV8 A;  2QHK A;  5K5B A;  3CIT A;  4HJ4 A;  5CX7 A;  4OOM A;  2WKP A;  1YSQ A;  2HJE A;  2D02 A;  3JVU A;  2EWV A;  4FSF A;  1NWZ A;  4CQH A;  5DJT A;  3SW1 A;  2GNX A;  1XJ2 A;  3MR0 A;  4RQ9 A;  3OOV A;  1ZTU A;  3KSI A;  1F9I A;  4HJ6 A;  3UMD A;  2VEA A;  1JNU A;  5KIZ A;  3GEC A;  5TBM A;  2B02 A;  4Y5F A;  2VKS A;  3ZQ5 A;  3A0V A;  4HH2 A;  4LRZ E;  1D06 A;  2OAP 1;  1TD5 A;  2LB5 A;  5FL3 A;  4CLC C;  1YSP A;  3H82 B;  3PBQ A;  2PYP A;  3PR6 A;  2QKP A;  3EEH A;  1OTA A;  3K3C A;  4F3L A;  2GZA A;  5HD3 A;  3S7O A;  2W27 A;  2KLI A;  2L4R A;  2VA0 A;  3IBR A;  2NUT C;  3NOU C;  4L0L A;  3EGD C;  3PBT A;  4YNR A;  4O01 A;  5A8B A;  3LID A;  4Y3I A;  3KO6 A;  3ICY A;  1S1Z A;  2QJ7 A;  4EQ1 A;  4WN5 A;  2OAQ 1;  5EFW A;  3G6O A;  4CLC E;  4I3A A;  3OLO A;  4ZRR A;  4L9E A;  4G3K A;  4I38 A;  1F98 A;  4Q0J A;  2NUP C;  2P7J A;  4G3W A;  2FZ0 A;  1IFQ A;  3DBA A;  4CLC B;  4DJ2 A;  1OTB A;  2O99 A;  3NJA A;  4H6J B;  2PD7 A;  3F1N B;  3S7P A;  3NOT C;  3EQU A;  5G4Z A;  5IU1 A;  1UWP X;  3UB6 A;  3CWF A;  3R4K A;  3GDI A;  3RTY A;  4CLC D;  2W0N A;  2A2L A;  5AJG A;  2YKH A;  3A0S A;  1YKD A;  2J3W A;  2M7V A;  5MC7 A;  4Q0I A;  4BWI A;  1IOU A;  4NXG A;  3S7N A;  4WLA A;  4NXB A;  2JKR M;  3UE6 A;  2YKF A;  3F1O B;  2HJ9 C;  2ZBB A;  4EER A;  1X0O A;  5J7E A;  3PBN A;  4MN5 A;  1N9N A;  2W3E A;  3H7W A;  3KYQ A;  4HOI A;  4R3A A;  2OWH A;  4P6Z S;  4I39 A;  4QPR A;  4WUJ A;  4ARZ A;  4XT2 A;  2O9B A;  5DFX A;  3B33 A;  3LFV A;  1P0Z A;  3E4O A;  1T1C A;  2VV7 A;  1LSV A;  4UQI M;  4BBU A;  4G3V A;  3D3O A;  4WL9 A;  2VX8 A;  4HP4 A;  4II7 A;  3KYZ A;  1H3Q A;  1TS6 A;  2QWS A;  1P9R A;  5HSQ A;  3E0Y A;  5G4Y A;  5TBM B;  4EU0 A;  3MJQ A;  1XFN A;  4L9G A;  4K08 A;  3VE4 A;  3LIE A;  3LI8 A;  3RFB A;  1DP6 A;  3E4P A;  1DP9 A;  4KUK A;  1OPX A;  3R7W A;  3D72 A;  3T4S A;  3PXP A;  2L0W A;  2BAS A;  2LB9 A;  4BMW A;  4AFI A;  2M1C A;  1MZU A;  1WA9 A;  3ZYT A;  3T4O A;  3C30 A;  2OWJ A;  2V9A A;  3IBJ A;  2G7U A;  4WEL A;  2V0U A;  2JKT I;  5HZH A;  1NLY A;  4EES A;  4ETZ A;  2A24 A;  4MCW A;  3T4J A;  4EXO A;  4XT2 B;  2J3T D;  1EW0 A;  5F69 A;  5HWV A;  3BJN A;  4IUH A;  3UME A;  2O9A A;  1TS7 A;  2W3H A;  3BQ8 A;  1VHM A;  1GSX A;  2XRO A;  4GHI A;  5I5L A;  2PHY A;  1XJ6 A;  1T1A A;  4HI4 A;  3KX0 X;  2JKT M;  1ZHH B;  2FH5 A;  1N9L A;  1VB6 A;  4I3I A;  3W2Z A;  3LIA A;  3IS2 A;  4GS9 A;  3T50 A;  4CLC A;  4LRY C;  1TS0 A;  1KOU A;  1F5M A;  1TS8 A;  2I9V A;  4KUO A;  3UB9 A;  2ZOI A;  4IHQ A;  5DJU A;  3VOL A;  3F1P B;  2VGL M;  4DMZ A;  1LL8 A;  3BW6 A;  4JGQ A;  2VLG A;  3BY9 A;  4UQI S;  2XA7 S;  4PAU A;  5AVF A;  3LIF A;  3CLO A;  3NHQ A;  2HF6 A;  4JGO A;  2D01 A;  4IJG A;  2W3D A;  3LUQ A;  2KDK A;  3PBS A;  4HP9 A;  3CUE C;  4FOF A;  4EW7 A;  2DMW A;  2QJ5 A;  4HNB A;  2Z6D A;  4EEP A;  3PBO A;  1OTD A;  4NEE D;  4Z1W A;  1G28 A;  3UB8 A;  2WKR A;  1V9Y A;  3CUE A;  3E98 A;  4YWZ A;  2MJ6 A;  3S7Q A;  2M7U A;  4GHI B;  5J4E A;  1H8M A;  2K7S A;  5DKK A;  3F1N A;  4KQO A;  4PKY G;  4Y2F A;  4M4X A;  5F5Y A;  1GSW A;  5J3W A;  5LBR A;  1LT0 A;  3MQ0 A;  3LR4 A;  3LIB A;  2XSS A;  4EET B;  1NRJ A;  2VJW A;  3FPV A;  4ETX A;  1P97 A;  2PD8 A;  3PBR A;  1BYW A;  3H9W A;  3KSG A;  3T4L A;  1NLZ A;  3EOI A;  2EA9 A;  1UWN X;  2W1R A;  2Y8H A;  2VGL S;  1LSX A;  3U2A A;  4F3L B;  2R78 A;  3T4K A;  1XFQ A;  3KSH A;  4MN6 A;  3BY8 A;  4HH3 A;  3CAX A;  3HJK A;  3P7N A;  2W1T B;  3LIC A;  3MQQ A;  1XJ4 A;  5DKL A;  5HDC A;  3RH8 B;  4EUV A;  2J3T C;  4IUK A;  1OT6 A;  2K2N A;  2HV1 A;  2J80 A;  4NKP A;  2OOL A;  1Y28 A;  4WF0 A;  5TJJ A;  4WEJ A;  4R38 A;  4Q0H A;  4HQA A;  5IT5 A;  1DP8 A;  3C38 A;  3H82 A;  2K31 A;  3EQV A;  2HGV A;  4NXE A;  5AVE A;  1YAX A;  3EEA A;  3EGX C;  3LI9 A;  3OC2 A;  1S67 L;  3FPW A;  2VV6 A;  2W3G A;  2B18 A;  4GCZ A;  2PT7 A;  4GW9 A;  1N9O A;  3OCN A;  4R6L A;  4H6J A;  2H28 A;  3R7W B;  3NOP C;  4MMN A;  5F68 A;  4BBV A;  4HJ3 A;  2PDR A;  5HPF A;  1GSV A;  4I5S A;  2O9C A;  3CI6 A;  3BQA A;  3A0R A;  3MMH A;  1OJ5 A;  4B9O A;  3IS2 B;  1W63 Q;  1MC0 A;  1T19 A;  2V0W A;  2L1M A;  1W63 M;  5IS1 A;  4BBT A;  4EEU A;  3TW8 A;  4L9F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...