4PKYA

Arnt/hif transcription factor/coactivator complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
104
structure length
101
Chain Sequence
TRFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNDEIEYIICTNTNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Aryl hydrocarbon receptor nuclear translocator
publication title Coiled-coil Coactivators Play a Structural Role Mediating Interactions in Hypoxia-inducible Factor Heterodimerization.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/cell cycle
total genus 28
structure length 101
sequence length 104
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14598 PAS_11 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4pkyA00
2K7SA 1XJ6A 1F9IA 2L4RA 4MN5A 4L9FA 5DKKA 3NOUC 2QHKA 4M4XA 4KUKA 4WLAA 1KOUA 2HV1A 3UB9A 4GS9B 4EQ1A 2PYRA 2GJ3A 3C2WA 1LT0A 3NHQA 4I3AA 3G6OA 2W27A 3C8CA 1N9NA 4HP9A 2QJ5A 4HI4A 3CLOA 2QWSA 1GSWA 4HP4A 3LUQA 3UB6A 3PYPA 2WKRA 4RQ9A 3A0RA 5KIZA 1OJGA 2A24A 3BY8A 1S4SA 3GECA 4I39A 4R38A 3BWLA 2PD7A 1LL8A 5AVFA 2WKPA 1DRMA 4XT2A 4EESA 5HSQA 1ODVA 2OWJA 4HY8A 1N9OA 2PR5A 5I5LA 1G28A 4HHDA 1XFQA 4LRYC 3LYXA 3H7WB 1OTDA 4KQDA 3MR0A 3E4PA 1S1ZA 1S66L 4MN6A 2PR6A 1OTEA 5HWTA 5A8BA 3NOPC 5TBMA 1V9YA 3RTYA 2EA9A 5J7EA 1OJ5A 2L0WA 2VV8A 3OLOA 3NOTC 3GDIA 3ZQ5A 4YWZA 4GS9A 4I3IA 4HNBA 1XJ3A 5J3WA 3IBRA 1T18A 2VV7A 2INWA 2H28A 2KX6A 2V1BA 1TS7A 5TBMB 3VE3A 3UMEA 2ZBBA 4L9GA 4R70A 2JHEA 3F1NB 1LSWA 3ULFA 2OOLA 5HZHA 3MJQA 5EFWA 2WKQA 4F3LB 3VE4A 4HJ3A 1S4RA 5F69A 1OT6A 5G4ZA 1DP6A 3HJIA 4I38A 5AVEA 3MQQA 3K3CA 1T19A 5F6AA 1P0ZA 2R78A 3F1OA 4LPZA 5HWWA 4DJ3A 2QKPA 1BYWA 1TS0A 1VB6A 1Y28A 3LIFA 1LSXA 4JGRA 2M1CA 3H7WA 2L1MA 2D01A 2CMNA 3UMDA 5F68A 1WA9A 2ZOHA 3UB8A 1LSVA 4E04A 3F1OB 4HH2A 5HWVA 4R3AA 2V0UA 2BASA 2YKFA 3LIEA 4H6JB 5IS1A 3H82B 4I3JA 4HH3A 1XFNA 3LIBA 2V0WA 5J4EA 4HIAA 1D06A 3KX0X 4GW9A 1TS6A 3ICYA 3EWKA 4HOIA 4EETB 5DJTA 3BY9A 4HQAA 3CAXA 1OTBA 4WN5A 1EW0A 5F5YA 3E4QA 4GHIB 3K3DA 3LIAA 1F98A 1XJ4A 4WL9A 3A0SA 2ZOIA 1X0OA 1JNUA 4R6LA 1P97A 3RH8B 2P7JA 3F1PB 3F1NA 3UB7A 4WUJA 4JGPA 3IS2B 4DJ2A 1V9ZA 4JGQA 3H9WA 4F3LA 1XJ2A 4JGOA 4KUOA 3NJAA 3PHYA 2I9VA 2JN7A 4EERA 1TS8A 4I5SA 1UWPX 5DJUA 4EW7A 2J80A 3FC7A 3A0VA 2YKHA 1T1CA 2QJ7A 3MXQA 1DP8A 4NXFA 5HD3A 5HDDA 2W0NA 1UWNX 2VLGA 5IU1A 2D02A 4H6JA 3E4OA 3H82A 3LI8A 3LICA 2PYPA 5DKLA 1GSVA 1GSXA 2VV6A 2Z6CA 1OTAA 1N9LA 4NXBA 4PKYG 2V9AA 1T1AA 1D7EA 4GHIA 2PDRA 1DP9A 3LI9A 3P7NA 4LRXC 2KDKA 4BBUA 4GCZA 1T1BA 4LRZE 3F1PA 4NXEA 3IS2A 4NXGA 2Z6DA 4BBTA 1S1YA 3VOLA 2A24B 3MFXA 3D72A 4B9OA 4K08A 2PHYA 4L9EA 2B02A 4PKYA 4XT2B 3UE6A 5HDSA 3B33A 5HDCA 4HJ6A 5HD5A 4EEPA 4EXOA 4HJ4A 1MZUA 3MQOA 2PD8A 3SW1A 3CWFA 1UGUA 4WF0A 2OWHA 3LIDA 4BBVA 4EEUA 1OTIA 2VEAA 3FG8A 1OT9A 3T50A 5G4YA 3EEHA 3HJKA 1S67L 1NWZA 2V1AA 4LLOB
chains in the Genus database with same CATH superfamily
2L4RA 2XLNA 5TFQA 3W4PA 5DKKA 1F5MA 5GL9A 2OLUA 3TJZC 3GRJA 2K31A 4M4XA 3GTCA 5DF8A 1KOUA 4QY6A 2XD1A 2VGJA 1N4OA 2WKEA 3N8RA 3NHQA 3ZG0A 2Y91A 1M40A 3G6OA 2XK1A 3T1XA 3C8CA 1RGYA 5C5KA 5L8MA 1H3QA 3N8SA 1ZKJA 4WBGA 4S2NC 1GSWA 4HP4A 4GKUA 4OPRA 2ZQ7A 3SH7A 2P04A 5KIZA 4II7A 1WYBA 4JLFA 3GECA 5EE8A 1W79A 3M2JA 4OONA 2PD7A 1MC0A 4M3KA 3U2AA 5AVFA 1PW8A 2WGWA 4XT2A 4Y17A 4ETXA 4YINA 1MXOA 1FR1A 2Y2QA 2ZC4B 3SS5A 3KSFA 1NZOA 2OWJA 2X02A 1YLPA 2Z2LB 4HHDA 1XFQA 2BTFP 3GQZA 4ID4A 4S2MA 3G2ZA 1BUEA 3V3RA 1CJFA 4KQDA 3MR0A 4DE1A 2QZ6A 2OAQ1 4MN6A 5AQ9A 4R0QA 5EV0A 1STZA 4BLMA 4B4ZA 4L0LA 1ZG6A 3T1QB 1YLWA 3NOPC 1J9MA 3VP2A 2ZQAA 3KYQA 3BFCA 3RTYA 2EA9A 3HUOA 5J7EA 1BULA 3HLDA 2HP5A 2O9AA 1I2WA 2G2WA 4CLCD 3KSIA 3FKVA 4RVAA 3NOTC 2Q0OA 4YWZA 4GS9A 1ES2A 1DY6A 4PM8A 5DF9A 1XJ3A 5J3WA 4ZAMA 3IBRA 4WMCA 4PM6A 2Y2MA 1NRJA 3OPPA 3S4XA 5CGXA 2H28A 4EBLA 2V1BA 1TS7A 1ACFA 5TGFA 3W4OA 3IH8A 3UMEA 1NLYA 4R70A 4DF6A 3MJQA 1XGIA 2WGVA 4JXVA 1GCEA 3IHBA 5FDHA 5A91A 4Y13A 4F3LB 5FAPA 3VE4A 4GB7A 1OT6A 1P9RA 5FAQA 3PBTA 5AVEA 3T4KA 5EOEA 1T19A 1KGEA 3WS0A 5DFXA 1P0ZA 4KQOA 4JF5A 3NI9A 1L0GA 1TS0A 3DWZA 1KDSA 3M6BA 3ZGAB 2KLIA 4JKTA 4R23A 1SDEA 3W2ZA 2M1CA 3H7WA 4P6BA 4DXCA 3N7WA 3UMDA 3WRZA 4OP5A 2GZAA 4N9LA 2HGVA 5FASA 4HH2A 1W63Q 4ESPA 5L07A 4C3QA 4R3AA 2BASA 4FUWA 5IS1A 2XA7S 1YM1A 1H8YA 2A49A 4GW9A 1SCWA 5I94A 4Q0HA 4HOIA 1EWZA 3BECA 5CGWA 1HTZA 3O88A 1W7FA 1MWRA 4GDNA 1ERMA 3CAXA 1OTBA 4BENA 2V8FA 1BLPA 1E25A 3E4QA 2M7VA 3G30A 3K3DA 4IEDA 5HX9A 4DXBA 1F98A 4K0XA 3A0SA 1JNUA 1Y4OA 1P97A 1TEMA 5A90A 3RH8B 1PRQA 2P7JA 3B3XA 2M7UA 3S7QA 1O07A 3PAEA 4JXWA 4EBPA 1BLSA 4DJ2A 1V9ZA 4JGQA 1BT5A 2J3WA 3BFEA 4N9KA 1OMEA 3Q7ZA 4JGOA 4H8RA 2DMWA 3OPHA 1OPXA 2ZM8A 3I7JA 3UN7A 5DTTA 4OPZA 3BRMA 3IF6A 3VOYA 4O01A 4EV4A 2QMIA 3WS1A 1FSYA 5HPIA 1CI9A 4CLCE 3WRTA 2YKHA 4KENB 3NDEA 3GMWA 3Q7VB 1RGZA 5JYOA 5HDDA 1LI9A 1IFQA 2QPNA 4XUZA 5HFOA 2XFTA 3MSHA 2W1TB 3E4OA 1FQGA 5EOOA 3ZYTA 4OKPA 3DTKA 2PYPA 1K57C 2W3HA 3IWIA 1GSXA 2VV6A 3RJUA 2OSUA 4MCWA 5CHMA 5IT5A 3CUEC 2VK3A 4NK3A 3WS5A 3LFVA 1RP5A 2PDRA 1IKGA 5FATA 2W3DA 3TRCA 2DCFA 1F2KA 5F1FA 3LR3A 4S2KA 4KQRA 3T4SA 4NXEA 2VGKA 3UPPA 2HJ9C 3QP6A 3IS2A 5EVIB 4CLCC 3M2KA 3ZFZA 1YKDA 2V1ZA 4MBHA 4ZDXA 1NY0A 1HVBA 2A24B 2P08A 3K2NA 3PBRA 3NIAA 4Y0UA 2E8JA 3T4JA 4WZ5A 4PKYA 1AXBA 2ZQCA 3B33A 2WZZA 2ZL1A 1MZUA 5FA7A 2PD8A 4Q8IA 3SW1A 3E98A 1VEUB 3OPRA 2X71A 1CK3A 2VEAA 1OT9A 3T50A 4CJNA 3JVVA 2Q9NA 4FTXA 1NWZA 4MMNA 2V1AA 4S2PA 1XJ6A 4S2LA 1VQQA 1K56A 3CITA 3QP4A 5CHUA 4Q0JA 1ZC2A 5MC7A 1LI0A 5HARA 1FR6A 4R4RA 4PM7A 1FCNA 4G3WA 4I3AA 3UDIA 1H8ZA 4GDBA 2A2LA 3BLMA 4ARZA 3LO7A 1N9NA 1MKIA 4U3TA 3AGFA 4RX2A 2QJ5A 5FQIA 1KVMA 5EVLA 1EI5A 3PYPA 2WKRA 4RQ9A 2HP6A 3NY4A 3QHYA 3LR4A 2JKTM 1CF0A 1YLZA 1IYSA 1KE0A 5D3OA 4R38A 3BWLA 1TD5A 3P09A 5GHYA 2EWWA 5GLAA 3A3IA 2WKPA 3LY3A 3O86A 4X68A 2P9VB 3AGDA 3W8KA 3BEBA 1G68A 1ODVA 1N9OA 3DTMA 1L0EA 2V20A 2KOIA 3KYZA 4N92A 1K6SA 2R9XA 1OTDA 4HBUA 4R1GA 2WKHA 5FSRA 3UDFA 1E3UA 2J3TD 1S66L 5DVAA 3CPTA 3VP3A 1LL9A 5A8BA 2B95A 3LEZA 5E2GA 3HREA 1CEGA 2EX8A 4KZ3A 4OPYA 5TBMA 3VV4A 3ZNTA 5CX7A 1ONGA 3UO9A 3FPWA 3TSGA 1OJ5A 2L0WA 4P0MA 4JF4A 2EFUA 5LBRA 5E2HA 1ESUA 3GDIA 4I3IA 2B5RA 2HDUA 4O8GA 4FOFA 4K91A 3EQUA 3ZG7B 2KX6A 5TBMB 1JWZA 3VE3A 3SH9A 3DBAA 3BJNA 3MKFA 1FSWA 4OP8A 2ZBBA 3G34A 1H5XA 4NETA 4L9GA 1WYCA 4IHQA 3ULFA 2OOLA 4RX3A 1SZVA 4NEED 2H5SA 3IF5A 2JCHA 1SKOB 1L3LA 4HJ3A 5HL6A 4EBNA 4X69A 1IYPA 2IWCA 3WWXA 3M6HA 3GSGA 3K3CA 2XEPA 5F6AA 1CQAA 5AQAA 5IHVA 4O7DA 5CTMA 3F1OA 4DJ3A 4KZBA 1L0DA 1W8YA 1VB6A 3BFGA 2EX6A 3LIFA 1LSXA 2IA2A 2O0YA 1GA0A 2ZMFA 3PTEA 3ZG5A 4Y3IA 5TJJA 3T4LA 1G5UA 2CC1A 5F68A 2ZMVA 3BFDA 2PU2A 5KSHA 4WMCD 3F1OB 4B88A 2W3FA 3A3JA 1W8QA 4BMWA 3E2KA 3EOIA 2YKFA 4ZTKA 3Q1FA 4HIAA 3FWLA 3SZTA 3KX0X 5HL1A 1ALQA 3ICYA 3EWKA 5CERA 1NZUA 4MDZA 3S7PA 3BY9A 1Q2PA 1K6RA 3HVFA 3QP5A 1YLTA 1KVLA 1IOUA 2J9PA 4GHIB 3O87A 4WL9A 2ZOIA 5TR7A 1XXMA 3NC8A 1LLBA 1IELA 5L2FA 3DTEA 2DRWA 4IVKA 3F1PB 1IKIA 2HDRA 2Y55A 3OOVA 2PRFA 4LV1A 4PM9A 4WYYA 3H9WA 3ZG9B 1KE4A 4F3LA 3TW8A 4MNRA 1XJ2A 3VP4A 2JKFA 2I9VA 4EERA 4C75A 1Z09A 3QP1A 1NJ4A 1KGGA 4PPRA 3N4IA 2J8YA 1NRFA 2O9BA 4GOGA 2ZQDA 3JPUA 2VJWA 3V3SA 2QJ7A 2A3UA 2XA7M 5M19A 1DP8A 5G18A 4NXFA 5E2FA 2DNSA 1UWNX 3CUEA 4KZ4A 2JC7A 4WZ4A 2WYXA 3QP8A 2ZQ9A 3KO6A 4GN2A 2I72A 3LI8A 3OCLA 2K2NA 3T4OA 2EXAA 3T1SA 1GSVA 3ISGA 4CQHA 4R3JA 1N9LA 2J3TC 1PI4A 1HD8A 2V9AA 2R9WA 1BSGA 3LGOA 4D60A 5CRFA 2HDQA 3ITBA 2Z2MB 2EFXA 4LRXC 4E3JA 4E3NA 2XD5A 1W63M 4HESA 4LRZE 3IXDA 2V2FF 4KG5A 4S2IA 3MF0A 4P6ZM 4CLCB 3HBRA 2Z6DA 3IWQA 3UE3A 3MFXA 1GHMA 3UY6A 1YMSA 3MZEA 4UHUA 4DRTA 2VZWA 2PHYA 5CGSA 4OLGA 3MZFA 3LEQA 3QNBA 5HDSA 2LB5A 3HLEA 4X56A 2Y8HA 4EXOA 5BOHA 4WM9A 4WEKA 3TOIA 3MQOA 4BJPA 3Q7VA 2ZC3B 2Q9MA 4ME4A 1KE3A 3HLBA 1VETB 4P6ZS 3LIDA 3C38A 3UPNA 3IXHA 4EEUA 1OTIA 2XRNA 2W1TA 5G4YA 1AWIA 3HJKA 1XA1A 2VGLS 3MXSA 3TG9A 1BLHA 4IJGA 4OOLA 3ZCZA 2FFYA 3FZCA 4LLOB 4UA6A 1F9IA 3G31A 5DF7A 3HCYA 1ZG4A 4MN5A 4GD8A 4UQIM 1LL5A 2QHKA 4OQGA 2AVXA 2ZJ9A 4KUKA 4WLAA 3UB9A 3V67A 4EQ1A 2PYRA 3E0YA 3BYDA 2GJ3A 3UE1A 3HLGA 3D4FA 1PIOA 5AQ7A 3IXGA 2XH9A 4LENA 3KSGA 3PBNA 3RFBA 4PM5A 4IBXA 4OQHA 1JWVA 4Y2FA 2QWSA 3LUQA 1O7EA 5EVIA 3A0RA 5DTKA 4ZBEA 1OJGA 2A24A 3BY8A 5HPFA 1Z6FA 4G3KA 2BG1A 1SKFA 4GD6A 2W3EA 4P87A 3PR6A 4UQIS 1LL8A 1NYMA 4LV3A 4YNRA 1DRMA 4EESA 1QMFA 3IT9A 1EROA 1BTLA 4MLLA 2J9OA 4DMZA 4HY8A 2PR5A 2RL3A 1G28A 5EVEA 3CG5A 5GLBA 4A5RA 2P74A 3LYXA 1K54A 5HW3A 1ERQA 4E3MA 1VEUA 3S22A 3E4PA 1S1ZA 2JKRM 5HAQA 4Q0IA 3ZHHA 2EWVA 3DW0A 1OTEA 3MBZA 5HWTA 2QYBA 4JPMA 1E4DA 1BZAA 1V9YA 4N1XA 4HEFA 2HF6A 5FQJA 2EX9A 3BQAA 4XUXA 5E43A 3OLOA 5DFYA 4MBKA 4FD8A 1YSQA 4UEYA 3UDXA 4IVIA 3DWKA 2ZC7A 3VOZA 3MMHA 2VV7A 2INWA 2G7UA 2WAFA 3IX8A 4QPRA 1PWGA 3IXBA 4S2NA 3F1NB 4QU3A 1LSWA 4LCLA 4DKIA 4BD0A 5EFWA 5CECA 4QHCA 4ETZA 2EXBA 5CHJA 3AGEA 4KZ7A 5G4ZA 1DP6A 4BD1A 5A93A 3OPLA 3MQQA 2ZD8A 4MN7A 1FOFA 5KSCA 2Y2PA 3A3FA 2Y2JA 3IF6C 4OVDA 4PAUA 3N8LA 1MPLA 4LPZA 3RXXA 2P9VA 4WELA 2QKPA 3VMAA 1YT4A 4LFUA 4LCMA 2Y4AA 2NUTC 5A92A 3EQVA 4G3VA 1Q2QA 1PWDA 3UPOA 1GHIA 1WA9A 5AQBA 3OCNA 3VSKA 5HWVA 2WUQA 3S1YA 4ZJ2A 3LIEA 4H6JB 2Y2KA 3C5AA 3H82B 1K55C 1SDNA 4I3JA 4IUKA 3V50A 4HH3A 3LIBA 5E2EA 3C4OA 5HAIA 3VFHA 3IWOA 1U60A 2PT7A 1NXYA 4CPKA 4DE0A 4EETB 5DJTA 4HQAA 1YLJA 3CMZA 1XGJA 3Q81A 4S2OA 1EW0A 1YAXA 5F5YA 4WEJA 1GA9A 3LIAA 1XJ4A 2XQZA 5FDSA 2V8CA 4R6LA 2OAP1 3IQAA 3CI6A 4XXRA 3C7UA 4IUHA 4WUJA 3EGDC 1YPRA 3A3DA 4K0WA 4GLQA 1SKOA 2JKRI 3IHAA 2XROA 3GR2A 4E3LA 2O9CA 4KUOA 1ZTUA 1DJCA 2UV0E 1TS8A 3V5MA 2W1RA 2H10A 4I5SA 4LGWA 4JXGA 4YOFA 1DJBA 2HDSA 2ZM0A 1PW1A 5DJUA 5FQ9A 4E6XA 1ES4A 1D1JA 2Y2GA 3A0VA 3O5YA 5KMWA 5FQMA 1G6AA 1K4FA 2PU4A 4HBTA 1M6KA 3CZDA 1IYOA 4E3KA 3EEAA 2VLGA 1JWPA 4OH0A 2D02A 4MEZA 3NECA 4U0TA 2WKIA 5J8XA 5GHZA 3LICA 4FCFA 4UA9A 4NG2A 1MWTA 5DKLA 2ZQ8A 4Y0TA 4NXBA 1MKMA 4PKYG 4ZJ3A 1ONHA 1XX2A 4GHIA 3NBLA 1PWCA 4Z9QA 1DP9A 3T1RA 3LI9A 4QY5A 3P7NA 4ZRRA 5FL3A 3C4PA 4PHTA 3HL9A 4GCZA 4BWIA 3F1PA 4Y0OA 2OV5A 3MQ0A 2JKTI 1XKZA 5L09A 1BLCA 2XGNA 2BLSA 4NXGA 4BBTA 3DAVA 3G32A 3VOLA 3L9KA 4UAAA 3D72A 3GV9A 2C6WB 1QMEA 1N9BA 1IYQA 2PBDP 4B9OA 3G35A 4L9EA 3IX4A 1H0MA 4JBFA 5U47A 2WGWB 1P9WA 2WAEA 2Y79A 4KG6A 4N1HA 4XT2B 5M1AA 3UE6A 1K25A 5CXWA 2O99A 2H0TA 4HJ6A 3VP0A 3ZDJA 4EEPA 2FFFB 2GNXA 2ZMAA 4HJ4A 4X25A 4OQIA 5EM0A 4E6WA 2WK0A 1UGUA 4Y7PA 2IWBA 3JVUA 2OWHA 2WGIA 3FG8A 4KZAA 2VKSA 1FIKA 1K0KA 4E3OA 2ACGA 2XSSA 1WE4A 1S6RA 1XP4A 2K7SA 3LR0A 3MXRA 2JKGA 4L9FA 3R7WA 1K57A 3LCEA 3NOUC 1MY8A 1PYYA 4LV0A 4ZJ1A 3NULA 2HV1A 4GS9B 4B4XA 1HLUP 2XR0A 2PBYA 3C2WA 1LT0A 3D3OA 4X1LA 3LY4A 2W27A 3T12B 4Z1WA 2JBFA 3MZDA 2XF3A 1TDGA 4HP9A 3R7WB 4HI4A 3CLOA 3UB6A 4CLCA 4EWFA 1Y54A 1DJAA 1S4SA 3FPVA 4I39A 5CTNA 4R3BA 1ESIA 4MBFA 2H0YA 1TDLA 3ZVWA 3G2YA 5HSQA 1H8MA 1PZPA 3B47A 4QB8A 5CEBA 2Y2LA 2C5WB 4OOMA 5I5LA 4LRYC 2VGLM 4GZBA 3H7WB 1VM1A 3IX3A 3FKWA 1YMXA 1VETA 4EUZA 4U0XA 4Y15A 2UWXA 2PR6A 2X01A 3BFFA 4QJGA 3HLFA 5FAOA 3SOIA 2FH5A 4PMAA 1PNEA 4GNUA 4JXSA 2VV8A 1XA7A 2WADA 5EVID 3HUNA 2G2UA 2GDNA 3ZQ5A 4HNBA 1T18A 5EUAA 3NCKA 1IEMA 5DTSA 4BQMA 3RXWA 4KZ5A 2WZXA 3ITAA 2W3GA 3SS4A 1PFLA 5CEDA 3QP2A 4DE2A 1TF1A 4X53A 2JHEA 5GHXA 1VHMA 3OBFA 4BL2A 5EM1A 5HZHA 3KYEA 4C6YA 1FCOA 2WKQA 4RYEA 1S4RA 2VA0A 5F69A 4OQ0A 3N6IA 3HJIA 4X1MA 2EX2A 4I38A 3S7NA 4R4SA 3BM6A 1JVJA 3MFDA 2R78A 3IF6B 4P85A 5HWWA 4EQIA 3BQ8A 1XPBA 5FI2A 1BYWA 3W4QA 2Y2NA 1K55A 1Y28A 4BL3A 5GLCA 4NKPA 5EECA 5FI6A 5F83A 4JGRA 1NYYA 1HZOA 2L1MA 2D01A 3HLCA 2B18A 3SS3A 4Y5FA 2CMNA 3ZG8B 1ES5A 1JTDA 2ZOHA 3UB8A 3T4TA 1LSVA 4E04A 3BLSA 1ES3A 2V0UA 1K4EA 4KZ8A 4KQQA 3UB5P 1XFNA 2HP9A 2V0WA 5J4EA 1K56D 1D06A 3MS6A 1A0KA 1TS6A 1JTGA 1PZOA 1I2SA 3L7HA 3D9YA 1NLZA 4WN5A 4X55A 3V39A 3WS4A 3A3EA 3EGXC 3O3VA 3HLWA 3PBOA 3S7OA 1X0OA 4DE3A 2VX8A 3R4KA 2Y2IA 1FILA 2Y59A 2XFSA 3OC2A 2Y2HA 1I5QA 4EU0A 3F1NA 3UB7A 3CJMA 3U4LP 4JGPA 3IS2B 3TE8A 4OOYA 3C30A 4OPQA 3E2LA 1RCJA 5FEGA 4JF6A 5JYPA 3NJAA 3PHYA 5EPHA 2FZ0A 2XDMA 1MBLA 2JN7A 1MWUA 3ZVTA 2ZLYA 4IBRA 2NUPC 3G4PA 3NDGA 3PBQA 1UWPX 2ZC5B 3BW6A 3OZHA 1KDWA 2RCXA 1PI5A 3DTIA 4FSFA 2ZL1B 5FQQA 3HUMA 4EW7A 2J80A 1W5DA 3FC7A 1T1CA 3MXQA 4KZ9A 4AFIA 1E3UD 4FH2A 2ZM2A 5HD3A 2W0NA 5KZHA 1L2SA 5IU1A 4O0PA 5K5BA 4KZ6A 1G6OA 4H6JA 1MWSA 4LV2A 3H82A 2IWDA 4RA7A 1J3WA 2MJ6A 2Z6CA 1YQSA 1CEFA 2HZ5A 1OTAA 4DDYA 1T1AA 3CHWP 5L10A 3QNCA 2PAVP 3JYIA 1D7EA 3GVBA 1S0WA 3PBSA 4GJ4A 1CI8A 5AJGA 1C3BA 1YLYA 4OLDA 3LR5A 3ZNYA 3WS2A 5HAPA 4UA7A 4DDSA 2KDKA 4BBUA 3SH8A 4D2OA 4ARZB 2GX5A 1T1BA 4YFMA 3P98A 3FYZA 4S2JA 4QD4A 4FH4A 3MKEA 5EVIC 4E3IA 1ZHHB 5F1GA 2LB9A 1S1YA 1L0FA 1SHVA 2ZC6B 4QWOA 3Q07A 2E8IA 5M18A 4K08A 5FQKA 2B02A 3FV7A 3VSLA 3C7VA 2J7VA 3UE0A 4DN0A 3P01A 4KG2A 5HDCA 3UNWA 1TVFA 2HJEA 5FEFA 4X6TA 3Q82A 5HD5A 3VFFA 2OLVA 1LHYA 4EUVA 2Y2OA 5GLDA 4B93A 3IH9A 3B42A 3VP1A 1GHPA 1K54C 3CWFA 4WZ5C 3IBJA 4WF0A 2HPBA 3KSHA 5F82A 4BBVA 3CPTB 1FCMA 3T4QA 2JE5A 3PXPA 3EEHA 4F94A 1YSPA 3PAGA 1K38A 1S67L 5FI7A 1KGFA
chains in the Genus database with same CATH topology
2K7SA 3LR0A 1XJ6A 1F9IA 2L4RA 3HCYA 4MN5A 4L9FA 3R7WA 5DKKA 1F5MA 3NOUC 4UQIM 3TJZC 2K31A 2QHKA 3CITA 4M4XA 4KUKA 4Q0JA 4WLAA 1KOUA 2HV1A 3UB9A 3V67A 4GS9B 4EQ1A 5MC7A 2PYRA 3E0YA 2GJ3A 3C2WA 1LT0A 3NHQA 4G3WA 4I3AA 3D3OA 3G6OA 2A2LA 2W27A 3C8CA 4Z1WA 3KSGA 3PBNA 3RFBA 4ARZA 1N9NA 4HP9A 3R7WB 2QJ5A 4HI4A 5C5KA 5L8MA 1H3QA 3CLOA 4Y2FA 2QWSA 1GSWA 4HP4A 3LUQA 3UB6A 3PYPA 4CLCA 2WKRA 4RQ9A 2P04A 3A0RA 5KIZA 1OJGA 2A24A 3LR4A 4II7A 2JKTM 3BY8A 5HPFA 1S4SA 3FPVA 4G3KA 3GECA 4I39A 4R38A 2W3EA 3BWLA 1TD5A 3PR6A 2PD7A 1MC0A 4UQIS 1LL8A 2EWWA 3U2AA 5AVFA 4YNRA 2WKPA 1DRMA 4XT2A 4EESA 4ETXA 5HSQA 1H8MA 3KSFA 3B47A 4DMZA 1ODVA 2OWJA 4HY8A 1N9OA 2PR5A 4OOMA 5I5LA 1G28A 4HHDA 1XFQA 4LRYC 2KOIA 2VGLM 3KYZA 3LYXA 3H7WB 1OTDA 4KQDA 3MR0A 3E4PA 1S1ZA 2JKRM 2J3TD 1S66L 2OAQ1 4MN6A 4Q0IA 1STZA 2PR6A 2EWVA 1OTEA 5HWTA 2QYBA 5A8BA 4L0LA 3NOPC 3KYQA 5TBMA 1V9YA 3VV4A 2HF6A 5CX7A 3RTYA 2FH5A 2EA9A 3FPWA 3BQAA 5J7EA 1OJ5A 2L0WA 2VV8A 3OLOA 2O9AA 5DFYA 5LBRA 4CLCD 1YSQA 4UEYA 3KSIA 3NOTC 3GDIA 4YWZA 3ZQ5A 4GS9A 4I3IA 4HNBA 5DF9A 1XJ3A 4O8GA 5J3WA 4FOFA 3IBRA 1T18A 2VV7A 3EQUA 3MMHA 1NRJA 2INWA 2H28A 2KX6A 2V1BA 1TS7A 5TBMB 3VE3A 2W3GA 3DBAA 3BJNA 2G7UA 3UMEA 1NLYA 2ZBBA 4QPRA 1TF1A 4L9GA 4R70A 2JHEA 3F1NB 4IHQA 1LSWA 1VHMA 3ULFA 3OBFA 2OOLA 5HZHA 3MJQA 5EFWA 4NEED 4ETZA 2WKQA 4F3LB 3VE4A 4HJ3A 1S4RA 5HL6A 2VA0A 5F69A 1P9RA 1OT6A 5G4ZA 1DP6A 3HJIA 4I38A 3S7NA 3PBTA 5AVEA 3T4KA 3MQQA 3K3CA 4MN7A 1T19A 5F6AA 5DFXA 1P0ZA 2R78A 4KQOA 4PAUA 3F1OA 4LPZA 5HWWA 4DJ3A 3BQ8A 4WELA 2QKPA 1BYWA 1TS0A 1VB6A 1Y28A 2KLIA 4NKPA 3LIFA 1LSXA 4JGRA 2NUTC 3W2ZA 2M1CA 3H7WA 2IA2A 2O0YA 2ZMFA 2L1MA 2D01A 3EQVA 2B18A 4G3VA 4Y5FA 2CMNA 4Y3IA 5TJJA 3UMDA 3T4LA 2GZAA 5F68A 2ZMVA 1WA9A 2ZOHA 3OCNA 3T4TA 3UB8A 2HGVA 5KSHA 1LSVA 4E04A 3F1OB 4HH2A 1W63Q 2W3FA 5HWVA 4BMWA 4R3AA 2V0UA 2BASA 3EOIA 2YKFA 3LIEA 4H6JB 5IS1A 3H82B 4I3JA 4IUKA 4HH3A 1XFNA 2XA7S 3LIBA 2V0WA 5J4EA 4HIAA 1D06A 3KX0X 4GW9A 1TS6A 2PT7A 3ICYA 3EWKA 4Q0HA 4HOIA 4MDZA 4EETB 3S7PA 5DJTA 3BY9A 4HQAA 3CAXA 1OTBA 1NLZA 4WN5A 1EW0A 1IOUA 1YAXA 5F5YA 4WEJA 3E4QA 2M7VA 4GHIB 3K3DA 3LIAA 1F98A 1XJ4A 4WL9A 3A0SA 3EGXC 2ZOIA 3PBOA 3S7OA 1X0OA 1JNUA 2VX8A 3R4KA 2OAP1 4R6LA 1P97A 3RH8B 2P7JA 3CI6A 3F1PB 3OC2A 4IUHA 4EU0A 3F1NA 2M7UA 4WUJA 3S7QA 3UB7A 3EGDC 4JGPA 3IS2B 3TE8A 4DJ2A 3OOVA 1V9ZA 4JGQA 3C30A 3H9WA 4GLQA 2J3WA 4F3LA 2JKRI 3TW8A 1XJ2A 2XROA 4JGOA 2O9CA 4KUOA 2DMWA 3NJAA 3PHYA 2FZ0A 1OPXA 1ZTUA 2I9VA 2JN7A 4EERA 1TS8A 2NUPC 2W1RA 4I5SA 4O01A 3PBQA 1UWPX 4YOFA 3BW6A 5DJUA 5HPIA 4FSFA 2O9BA 2VJWA 4EW7A 2J80A 4CLCE 3FC7A 3A0VA 2YKHA 1T1CA 2QJ7A 3MXQA 4AFIA 3O5YA 2XA7M 1DP8A 4NXFA 5HD3A 5HDDA 2W0NA 1UWNX 3CUEA 3EEAA 1IFQA 2VLGA 5IU1A 4O0PA 5K5BA 2D02A 2W1TB 1G6OA 4H6JA 3E4OA 3KO6A 3H82A 3LI8A 3LICA 3ZYTA 3OCLA 2K2NA 3T4OA 2PYPA 5DKLA 2MJ6A 2W3HA 1GSVA 1GSXA 2VV6A 4CQHA 4MCWA 2Z6CA 5IT5A 1OTAA 1N9LA 2J3TC 3CUEC 4NXBA 1MKMA 4PKYG 2V9AA 1T1AA 3LFVA 1D7EA 4GHIA 2PDRA 4GJ4A 3PBSA 1DP9A 5AJGA 3LI9A 3LR5A 3P7NA 2W3DA 4LRXC 3TRCA 4ZRRA 5FL3A 4PHTA 1W63M 2KDKA 4BBUA 3LR3A 4ARZB 4GCZA 2GX5A 4BWIA 1T1BA 4LRZE 3F1PA 3MQ0A 2JKTI 3T4SA 4NXEA 2HJ9C 3MF0A 4P6ZM 3IS2A 4CLCB 4CLCC 4NXGA 1YKDA 2Z6DA 4BBTA 1ZHHB 2LB9A 1S1YA 3VOLA 2A24B 3UE3A 3MFXA 2P08A 3D72A 3K2NA 3PBRA 2VZWA 3T4JA 4K08A 2PHYA 4B9OA 4L9EA 2B02A 4PKYA 1P9WA 2Y79A 4XT2B 4DN0A 3P01A 3UE6A 5HDSA 3B33A 2O99A 5HDCA 2LB5A 2HJEA 4HJ6A 5HD5A 4EUVA 4EEPA 4B93A 2Y8HA 4EXOA 2GNXA 3B42A 4HJ4A 4WEKA 1MZUA 3MQOA 2PD8A 4BJPA 3SW1A 3E98A 3CWFA 1UGUA 3IBJA 4ME4A 4WF0A 3JVUA 2OWHA 4P6ZS 3KSHA 3LIDA 4BBVA 3C38A 3T4QA 4EEUA 1OTIA 2VEAA 2XRNA 3FG8A 1OT9A 2VKSA 3PXPA 2W1TA 5G4YA 3T50A 3JVVA 3EEHA 1YSPA 3HJKA 1S67L 2VGLS 2XSSA 4IJGA 4OOLA 1NWZA 4MMNA 2V1AA 4LLOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K7S A;  1XJ6 A;  1F9I A;  2L4R A;  4MN5 A;  4L9F A;  5DKK A;  3NOU C;  2QHK A;  4M4X A;  4KUK A;  4WLA A;  1KOU A;  2HV1 A;  3UB9 A;  4GS9 B;  4EQ1 A;  2PYR A;  2GJ3 A;  3C2W A;  1LT0 A;  3NHQ A;  4I3A A;  3G6O A;  2W27 A;  3C8C A;  1N9N A;  4HP9 A;  2QJ5 A;  4HI4 A;  3CLO A;  2QWS A;  1GSW A;  4HP4 A;  3LUQ A;  3UB6 A;  3PYP A;  2WKR A;  4RQ9 A;  3A0R A;  5KIZ A;  1OJG A;  2A24 A;  3BY8 A;  1S4S A;  3GEC A;  4I39 A;  4R38 A;  3BWL A;  2PD7 A;  1LL8 A;  5AVF A;  2WKP A;  1DRM A;  4XT2 A;  4EES A;  5HSQ A;  1ODV A;  2OWJ A;  4HY8 A;  1N9O A;  2PR5 A;  5I5L A;  1G28 A;  4HHD A;  1XFQ A;  4LRY C;  3LYX A;  3H7W B;  1OTD A;  4KQD A;  3MR0 A;  3E4P A;  1S1Z A;  1S66 L;  4MN6 A;  2PR6 A;  1OTE A;  5HWT A;  5A8B A;  3NOP C;  5TBM A;  1V9Y A;  3RTY A;  2EA9 A;  5J7E A;  1OJ5 A;  2L0W A;  2VV8 A;  3OLO A;  3NOT C;  3GDI A;  3ZQ5 A;  4YWZ A;  4GS9 A;  4I3I A;  4HNB A;  1XJ3 A;  5J3W A;  3IBR A;  1T18 A;  2VV7 A;  2INW A;  2H28 A;  2KX6 A;  2V1B A;  1TS7 A;  5TBM B;  3VE3 A;  3UME A;  2ZBB A;  4L9G A;  4R70 A;  2JHE A;  3F1N B;  1LSW A;  3ULF A;  2OOL A;  5HZH A;  3MJQ A;  5EFW A;  2WKQ A;  4F3L B;  3VE4 A;  4HJ3 A;  1S4R A;  5F69 A;  1OT6 A;  5G4Z A;  1DP6 A;  3HJI A;  4I38 A;  5AVE A;  3MQQ A;  3K3C A;  1T19 A;  5F6A A;  1P0Z A;  2R78 A;  3F1O A;  4LPZ A;  5HWW A;  4DJ3 A;  2QKP A;  1BYW A;  1TS0 A;  1VB6 A;  1Y28 A;  3LIF A;  1LSX A;  4JGR A;  2M1C A;  3H7W A;  2L1M A;  2D01 A;  2CMN A;  3UMD A;  5F68 A;  1WA9 A;  2ZOH A;  3UB8 A;  1LSV A;  4E04 A;  3F1O B;  4HH2 A;  5HWV A;  4R3A A;  2V0U A;  2BAS A;  2YKF A;  3LIE A;  4H6J B;  5IS1 A;  3H82 B;  4I3J A;  4HH3 A;  1XFN A;  3LIB A;  2V0W A;  5J4E A;  4HIA A;  1D06 A;  3KX0 X;  4GW9 A;  1TS6 A;  3ICY A;  3EWK A;  4HOI A;  4EET B;  5DJT A;  3BY9 A;  4HQA A;  3CAX A;  1OTB A;  4WN5 A;  1EW0 A;  5F5Y A;  3E4Q A;  4GHI B;  3K3D A;  3LIA A;  1F98 A;  1XJ4 A;  4WL9 A;  3A0S A;  2ZOI A;  1X0O A;  1JNU A;  4R6L A;  1P97 A;  3RH8 B;  2P7J A;  3F1P B;  3F1N A;  3UB7 A;  4WUJ A;  4JGP A;  3IS2 B;  4DJ2 A;  1V9Z A;  4JGQ A;  3H9W A;  4F3L A;  1XJ2 A;  4JGO A;  4KUO A;  3NJA A;  3PHY A;  2I9V A;  2JN7 A;  4EER A;  1TS8 A;  4I5S A;  1UWP X;  5DJU A;  4EW7 A;  2J80 A;  3FC7 A;  3A0V A;  2YKH A;  1T1C A;  2QJ7 A;  3MXQ A;  1DP8 A;  4NXF A;  5HD3 A;  5HDD A;  2W0N A;  1UWN X;  2VLG A;  5IU1 A;  2D02 A;  4H6J A;  3E4O A;  3H82 A;  3LI8 A;  3LIC A;  2PYP A;  5DKL A;  1GSV A;  1GSX A;  2VV6 A;  2Z6C A;  1OTA A;  1N9L A;  4NXB A;  4PKY G;  2V9A A;  1T1A A;  1D7E A;  4GHI A;  2PDR A;  1DP9 A;  3LI9 A;  3P7N A;  4LRX C;  2KDK A;  4BBU A;  4GCZ A;  1T1B A;  4LRZ E;  3F1P A;  4NXE A;  3IS2 A;  4NXG A;  2Z6D A;  4BBT A;  1S1Y A;  3VOL A;  2A24 B;  3MFX A;  3D72 A;  4B9O A;  4K08 A;  2PHY A;  4L9E A;  2B02 A;  4PKY A;  4XT2 B;  3UE6 A;  5HDS A;  3B33 A;  5HDC A;  4HJ6 A;  5HD5 A;  4EEP A;  4EXO A;  4HJ4 A;  1MZU A;  3MQO A;  2PD8 A;  3SW1 A;  3CWF A;  1UGU A;  4WF0 A;  2OWH A;  3LID A;  4BBV A;  4EEU A;  1OTI A;  2VEA A;  3FG8 A;  1OT9 A;  3T50 A;  5G4Y A;  3EEH A;  3HJK A;  1S67 L;  1NWZ A;  2V1A A;  4LLO B; 
#chains in the Genus database with same CATH topology
 2L4R A;  2XLN A;  5TFQ A;  3W4P A;  5DKK A;  1F5M A;  5GL9 A;  2OLU A;  3TJZ C;  3GRJ A;  2K31 A;  4M4X A;  3GTC A;  5DF8 A;  1KOU A;  4QY6 A;  2XD1 A;  2VGJ A;  1N4O A;  2WKE A;  3N8R A;  3NHQ A;  3ZG0 A;  2Y91 A;  1M40 A;  3G6O A;  2XK1 A;  3T1X A;  3C8C A;  1RGY A;  5C5K A;  5L8M A;  1H3Q A;  3N8S A;  1ZKJ A;  4WBG A;  4S2N C;  1GSW A;  4HP4 A;  4GKU A;  4OPR A;  2ZQ7 A;  3SH7 A;  2P04 A;  5KIZ A;  4II7 A;  1WYB A;  4JLF A;  3GEC A;  5EE8 A;  1W79 A;  3M2J A;  4OON A;  2PD7 A;  1MC0 A;  4M3K A;  3U2A A;  5AVF A;  1PW8 A;  2WGW A;  4XT2 A;  4Y17 A;  4ETX A;  4YIN A;  1MXO A;  1FR1 A;  2Y2Q A;  2ZC4 B;  3SS5 A;  3KSF A;  1NZO A;  2OWJ A;  2X02 A;  1YLP A;  2Z2L B;  4HHD A;  1XFQ A;  2BTF P;  3GQZ A;  4ID4 A;  4S2M A;  3G2Z A;  1BUE A;  3V3R A;  1CJF A;  4KQD A;  3MR0 A;  4DE1 A;  2QZ6 A;  2OAQ 1;  4MN6 A;  5AQ9 A;  4R0Q A;  5EV0 A;  1STZ A;  4BLM A;  4B4Z A;  4L0L A;  1ZG6 A;  3T1Q B;  1YLW A;  3NOP C;  1J9M A;  3VP2 A;  2ZQA A;  3KYQ A;  3BFC A;  3RTY A;  2EA9 A;  3HUO A;  5J7E A;  1BUL A;  3HLD A;  2HP5 A;  2O9A A;  1I2W A;  2G2W A;  4CLC D;  3KSI A;  3FKV A;  4RVA A;  3NOT C;  2Q0O A;  4YWZ A;  4GS9 A;  1ES2 A;  1DY6 A;  4PM8 A;  5DF9 A;  1XJ3 A;  5J3W A;  4ZAM A;  3IBR A;  4WMC A;  4PM6 A;  2Y2M A;  1NRJ A;  3OPP A;  3S4X A;  5CGX A;  2H28 A;  4EBL A;  2V1B A;  1TS7 A;  1ACF A;  5TGF A;  3W4O A;  3IH8 A;  3UME A;  1NLY A;  4R70 A;  4DF6 A;  3MJQ A;  1XGI A;  2WGV A;  4JXV A;  1GCE A;  3IHB A;  5FDH A;  5A91 A;  4Y13 A;  4F3L B;  5FAP A;  3VE4 A;  4GB7 A;  1OT6 A;  1P9R A;  5FAQ A;  3PBT A;  5AVE A;  3T4K A;  5EOE A;  1T19 A;  1KGE A;  3WS0 A;  5DFX A;  1P0Z A;  4KQO A;  4JF5 A;  3NI9 A;  1L0G A;  1TS0 A;  3DWZ A;  1KDS A;  3M6B A;  3ZGA B;  2KLI A;  4JKT A;  4R23 A;  1SDE A;  3W2Z A;  2M1C A;  3H7W A;  4P6B A;  4DXC A;  3N7W A;  3UMD A;  3WRZ A;  4OP5 A;  2GZA A;  4N9L A;  2HGV A;  5FAS A;  4HH2 A;  1W63 Q;  4ESP A;  5L07 A;  4C3Q A;  4R3A A;  2BAS A;  4FUW A;  5IS1 A;  2XA7 S;  1YM1 A;  1H8Y A;  2A49 A;  4GW9 A;  1SCW A;  5I94 A;  4Q0H A;  4HOI A;  1EWZ A;  3BEC A;  5CGW A;  1HTZ A;  3O88 A;  1W7F A;  1MWR A;  4GDN A;  1ERM A;  3CAX A;  1OTB A;  4BEN A;  2V8F A;  1BLP A;  1E25 A;  3E4Q A;  2M7V A;  3G30 A;  3K3D A;  4IED A;  5HX9 A;  4DXB A;  1F98 A;  4K0X A;  3A0S A;  1JNU A;  1Y4O A;  1P97 A;  1TEM A;  5A90 A;  3RH8 B;  1PRQ A;  2P7J A;  3B3X A;  2M7U A;  3S7Q A;  1O07 A;  3PAE A;  4JXW A;  4EBP A;  1BLS A;  4DJ2 A;  1V9Z A;  4JGQ A;  1BT5 A;  2J3W A;  3BFE A;  4N9K A;  1OME A;  3Q7Z A;  4JGO A;  4H8R A;  2DMW A;  3OPH A;  1OPX A;  2ZM8 A;  3I7J A;  3UN7 A;  5DTT A;  4OPZ A;  3BRM A;  3IF6 A;  3VOY A;  4O01 A;  4EV4 A;  2QMI A;  3WS1 A;  1FSY A;  5HPI A;  1CI9 A;  4CLC E;  3WRT A;  2YKH A;  4KEN B;  3NDE A;  3GMW A;  3Q7V B;  1RGZ A;  5JYO A;  5HDD A;  1LI9 A;  1IFQ A;  2QPN A;  4XUZ A;  5HFO A;  2XFT A;  3MSH A;  2W1T B;  3E4O A;  1FQG A;  5EOO A;  3ZYT A;  4OKP A;  3DTK A;  2PYP A;  1K57 C;  2W3H A;  3IWI A;  1GSX A;  2VV6 A;  3RJU A;  2OSU A;  4MCW A;  5CHM A;  5IT5 A;  3CUE C;  2VK3 A;  4NK3 A;  3WS5 A;  3LFV A;  1RP5 A;  2PDR A;  1IKG A;  5FAT A;  2W3D A;  3TRC A;  2DCF A;  1F2K A;  5F1F A;  3LR3 A;  4S2K A;  4KQR A;  3T4S A;  4NXE A;  2VGK A;  3UPP A;  2HJ9 C;  3QP6 A;  3IS2 A;  5EVI B;  4CLC C;  3M2K A;  3ZFZ A;  1YKD A;  2V1Z A;  4MBH A;  4ZDX A;  1NY0 A;  1HVB A;  2A24 B;  2P08 A;  3K2N A;  3PBR A;  3NIA A;  4Y0U A;  2E8J A;  3T4J A;  4WZ5 A;  4PKY A;  1AXB A;  2ZQC A;  3B33 A;  2WZZ A;  2ZL1 A;  1MZU A;  5FA7 A;  2PD8 A;  4Q8I A;  3SW1 A;  3E98 A;  1VEU B;  3OPR A;  2X71 A;  1CK3 A;  2VEA A;  1OT9 A;  3T50 A;  4CJN A;  3JVV A;  2Q9N A;  4FTX A;  1NWZ A;  4MMN A;  2V1A A;  4S2P A;  1XJ6 A;  4S2L A;  1VQQ A;  1K56 A;  3CIT A;  3QP4 A;  5CHU A;  4Q0J A;  1ZC2 A;  5MC7 A;  1LI0 A;  5HAR A;  1FR6 A;  4R4R A;  4PM7 A;  1FCN A;  4G3W A;  4I3A A;  3UDI A;  1H8Z A;  4GDB A;  2A2L A;  3BLM A;  4ARZ A;  3LO7 A;  1N9N A;  1MKI A;  4U3T A;  3AGF A;  4RX2 A;  2QJ5 A;  5FQI A;  1KVM A;  5EVL A;  1EI5 A;  3PYP A;  2WKR A;  4RQ9 A;  2HP6 A;  3NY4 A;  3QHY A;  3LR4 A;  2JKT M;  1CF0 A;  1YLZ A;  1IYS A;  1KE0 A;  5D3O A;  4R38 A;  3BWL A;  1TD5 A;  3P09 A;  5GHY A;  2EWW A;  5GLA A;  3A3I A;  2WKP A;  3LY3 A;  3O86 A;  4X68 A;  2P9V B;  3AGD A;  3W8K A;  3BEB A;  1G68 A;  1ODV A;  1N9O A;  3DTM A;  1L0E A;  2V20 A;  2KOI A;  3KYZ A;  4N92 A;  1K6S A;  2R9X A;  1OTD A;  4HBU A;  4R1G A;  2WKH A;  5FSR A;  3UDF A;  1E3U A;  2J3T D;  1S66 L;  5DVA A;  3CPT A;  3VP3 A;  1LL9 A;  5A8B A;  2B95 A;  3LEZ A;  5E2G A;  3HRE A;  1CEG A;  2EX8 A;  4KZ3 A;  4OPY A;  5TBM A;  3VV4 A;  3ZNT A;  5CX7 A;  1ONG A;  3UO9 A;  3FPW A;  3TSG A;  1OJ5 A;  2L0W A;  4P0M A;  4JF4 A;  2EFU A;  5LBR A;  5E2H A;  1ESU A;  3GDI A;  4I3I A;  2B5R A;  2HDU A;  4O8G A;  4FOF A;  4K91 A;  3EQU A;  3ZG7 B;  2KX6 A;  5TBM B;  1JWZ A;  3VE3 A;  3SH9 A;  3DBA A;  3BJN A;  3MKF A;  1FSW A;  4OP8 A;  2ZBB A;  3G34 A;  1H5X A;  4NET A;  4L9G A;  1WYC A;  4IHQ A;  3ULF A;  2OOL A;  4RX3 A;  1SZV A;  4NEE D;  2H5S A;  3IF5 A;  2JCH A;  1SKO B;  1L3L A;  4HJ3 A;  5HL6 A;  4EBN A;  4X69 A;  1IYP A;  2IWC A;  3WWX A;  3M6H A;  3GSG A;  3K3C A;  2XEP A;  5F6A A;  1CQA A;  5AQA A;  5IHV A;  4O7D A;  5CTM A;  3F1O A;  4DJ3 A;  4KZB A;  1L0D A;  1W8Y A;  1VB6 A;  3BFG A;  2EX6 A;  3LIF A;  1LSX A;  2IA2 A;  2O0Y A;  1GA0 A;  2ZMF A;  3PTE A;  3ZG5 A;  4Y3I A;  5TJJ A;  3T4L A;  1G5U A;  2CC1 A;  5F68 A;  2ZMV A;  3BFD A;  2PU2 A;  5KSH A;  4WMC D;  3F1O B;  4B88 A;  2W3F A;  3A3J A;  1W8Q A;  4BMW A;  3E2K A;  3EOI A;  2YKF A;  4ZTK A;  3Q1F A;  4HIA A;  3FWL A;  3SZT A;  3KX0 X;  5HL1 A;  1ALQ A;  3ICY A;  3EWK A;  5CER A;  1NZU A;  4MDZ A;  3S7P A;  3BY9 A;  1Q2P A;  1K6R A;  3HVF A;  3QP5 A;  1YLT A;  1KVL A;  1IOU A;  2J9P A;  4GHI B;  3O87 A;  4WL9 A;  2ZOI A;  5TR7 A;  1XXM A;  3NC8 A;  1LLB A;  1IEL A;  5L2F A;  3DTE A;  2DRW A;  4IVK A;  3F1P B;  1IKI A;  2HDR A;  2Y55 A;  3OOV A;  2PRF A;  4LV1 A;  4PM9 A;  4WYY A;  3H9W A;  3ZG9 B;  1KE4 A;  4F3L A;  3TW8 A;  4MNR A;  1XJ2 A;  3VP4 A;  2JKF A;  2I9V A;  4EER A;  4C75 A;  1Z09 A;  3QP1 A;  1NJ4 A;  1KGG A;  4PPR A;  3N4I A;  2J8Y A;  1NRF A;  2O9B A;  4GOG A;  2ZQD A;  3JPU A;  2VJW A;  3V3S A;  2QJ7 A;  2A3U A;  2XA7 M;  5M19 A;  1DP8 A;  5G18 A;  4NXF A;  5E2F A;  2DNS A;  1UWN X;  3CUE A;  4KZ4 A;  2JC7 A;  4WZ4 A;  2WYX A;  3QP8 A;  2ZQ9 A;  3KO6 A;  4GN2 A;  2I72 A;  3LI8 A;  3OCL A;  2K2N A;  3T4O A;  2EXA A;  3T1S A;  1GSV A;  3ISG A;  4CQH A;  4R3J A;  1N9L A;  2J3T C;  1PI4 A;  1HD8 A;  2V9A A;  2R9W A;  1BSG A;  3LGO A;  4D60 A;  5CRF A;  2HDQ A;  3ITB A;  2Z2M B;  2EFX A;  4LRX C;  4E3J A;  4E3N A;  2XD5 A;  1W63 M;  4HES A;  4LRZ E;  3IXD A;  2V2F F;  4KG5 A;  4S2I A;  3MF0 A;  4P6Z M;  4CLC B;  3HBR A;  2Z6D A;  3IWQ A;  3UE3 A;  3MFX A;  1GHM A;  3UY6 A;  1YMS A;  3MZE A;  4UHU A;  4DRT A;  2VZW A;  2PHY A;  5CGS A;  4OLG A;  3MZF A;  3LEQ A;  3QNB A;  5HDS A;  2LB5 A;  3HLE A;  4X56 A;  2Y8H A;  4EXO A;  5BOH A;  4WM9 A;  4WEK A;  3TOI A;  3MQO A;  4BJP A;  3Q7V A;  2ZC3 B;  2Q9M A;  4ME4 A;  1KE3 A;  3HLB A;  1VET B;  4P6Z S;  3LID A;  3C38 A;  3UPN A;  3IXH A;  4EEU A;  1OTI A;  2XRN A;  2W1T A;  5G4Y A;  1AWI A;  3HJK A;  1XA1 A;  2VGL S;  3MXS A;  3TG9 A;  1BLH A;  4IJG A;  4OOL A;  3ZCZ A;  2FFY A;  3FZC A;  4LLO B;  4UA6 A;  1F9I A;  3G31 A;  5DF7 A;  3HCY A;  1ZG4 A;  4MN5 A;  4GD8 A;  4UQI M;  1LL5 A;  2QHK A;  4OQG A;  2AVX A;  2ZJ9 A;  4KUK A;  4WLA A;  3UB9 A;  3V67 A;  4EQ1 A;  2PYR A;  3E0Y A;  3BYD A;  2GJ3 A;  3UE1 A;  3HLG A;  3D4F A;  1PIO A;  5AQ7 A;  3IXG A;  2XH9 A;  4LEN A;  3KSG A;  3PBN A;  3RFB A;  4PM5 A;  4IBX A;  4OQH A;  1JWV A;  4Y2F A;  2QWS A;  3LUQ A;  1O7E A;  5EVI A;  3A0R A;  5DTK A;  4ZBE A;  1OJG A;  2A24 A;  3BY8 A;  5HPF A;  1Z6F A;  4G3K A;  2BG1 A;  1SKF A;  4GD6 A;  2W3E A;  4P87 A;  3PR6 A;  4UQI S;  1LL8 A;  1NYM A;  4LV3 A;  4YNR A;  1DRM A;  4EES A;  1QMF A;  3IT9 A;  1ERO A;  1BTL A;  4MLL A;  2J9O A;  4DMZ A;  4HY8 A;  2PR5 A;  2RL3 A;  1G28 A;  5EVE A;  3CG5 A;  5GLB A;  4A5R A;  2P74 A;  3LYX A;  1K54 A;  5HW3 A;  1ERQ A;  4E3M A;  1VEU A;  3S22 A;  3E4P A;  1S1Z A;  2JKR M;  5HAQ A;  4Q0I A;  3ZHH A;  2EWV A;  3DW0 A;  1OTE A;  3MBZ A;  5HWT A;  2QYB A;  4JPM A;  1E4D A;  1BZA A;  1V9Y A;  4N1X A;  4HEF A;  2HF6 A;  5FQJ A;  2EX9 A;  3BQA A;  4XUX A;  5E43 A;  3OLO A;  5DFY A;  4MBK A;  4FD8 A;  1YSQ A;  4UEY A;  3UDX A;  4IVI A;  3DWK A;  2ZC7 A;  3VOZ A;  3MMH A;  2VV7 A;  2INW A;  2G7U A;  2WAF A;  3IX8 A;  4QPR A;  1PWG A;  3IXB A;  4S2N A;  3F1N B;  4QU3 A;  1LSW A;  4LCL A;  4DKI A;  4BD0 A;  5EFW A;  5CEC A;  4QHC A;  4ETZ A;  2EXB A;  5CHJ A;  3AGE A;  4KZ7 A;  5G4Z A;  1DP6 A;  4BD1 A;  5A93 A;  3OPL A;  3MQQ A;  2ZD8 A;  4MN7 A;  1FOF A;  5KSC A;  2Y2P A;  3A3F A;  2Y2J A;  3IF6 C;  4OVD A;  4PAU A;  3N8L A;  1MPL A;  4LPZ A;  3RXX A;  2P9V A;  4WEL A;  2QKP A;  3VMA A;  1YT4 A;  4LFU A;  4LCM A;  2Y4A A;  2NUT C;  5A92 A;  3EQV A;  4G3V A;  1Q2Q A;  1PWD A;  3UPO A;  1GHI A;  1WA9 A;  5AQB A;  3OCN A;  3VSK A;  5HWV A;  2WUQ A;  3S1Y A;  4ZJ2 A;  3LIE A;  4H6J B;  2Y2K A;  3C5A A;  3H82 B;  1K55 C;  1SDN A;  4I3J A;  4IUK A;  3V50 A;  4HH3 A;  3LIB A;  5E2E A;  3C4O A;  5HAI A;  3VFH A;  3IWO A;  1U60 A;  2PT7 A;  1NXY A;  4CPK A;  4DE0 A;  4EET B;  5DJT A;  4HQA A;  1YLJ A;  3CMZ A;  1XGJ A;  3Q81 A;  4S2O A;  1EW0 A;  1YAX A;  5F5Y A;  4WEJ A;  1GA9 A;  3LIA A;  1XJ4 A;  2XQZ A;  5FDS A;  2V8C A;  4R6L A;  2OAP 1;  3IQA A;  3CI6 A;  4XXR A;  3C7U A;  4IUH A;  4WUJ A;  3EGD C;  1YPR A;  3A3D A;  4K0W A;  4GLQ A;  1SKO A;  2JKR I;  3IHA A;  2XRO A;  3GR2 A;  4E3L A;  2O9C A;  4KUO A;  1ZTU A;  1DJC A;  2UV0 E;  1TS8 A;  3V5M A;  2W1R A;  2H10 A;  4I5S A;  4LGW A;  4JXG A;  4YOF A;  1DJB A;  2HDS A;  2ZM0 A;  1PW1 A;  5DJU A;  5FQ9 A;  4E6X A;  1ES4 A;  1D1J A;  2Y2G A;  3A0V A;  3O5Y A;  5KMW A;  5FQM A;  1G6A A;  1K4F A;  2PU4 A;  4HBT A;  1M6K A;  3CZD A;  1IYO A;  4E3K A;  3EEA A;  2VLG A;  1JWP A;  4OH0 A;  2D02 A;  4MEZ A;  3NEC A;  4U0T A;  2WKI A;  5J8X A;  5GHZ A;  3LIC A;  4FCF A;  4UA9 A;  4NG2 A;  1MWT A;  5DKL A;  2ZQ8 A;  4Y0T A;  4NXB A;  1MKM A;  4PKY G;  4ZJ3 A;  1ONH A;  1XX2 A;  4GHI A;  3NBL A;  1PWC A;  4Z9Q A;  1DP9 A;  3T1R A;  3LI9 A;  4QY5 A;  3P7N A;  4ZRR A;  5FL3 A;  3C4P A;  4PHT A;  3HL9 A;  4GCZ A;  4BWI A;  3F1P A;  4Y0O A;  2OV5 A;  3MQ0 A;  2JKT I;  1XKZ A;  5L09 A;  1BLC A;  2XGN A;  2BLS A;  4NXG A;  4BBT A;  3DAV A;  3G32 A;  3VOL A;  3L9K A;  4UAA A;  3D72 A;  3GV9 A;  2C6W B;  1QME A;  1N9B A;  1IYQ A;  2PBD P;  4B9O A;  3G35 A;  4L9E A;  3IX4 A;  1H0M A;  4JBF A;  5U47 A;  2WGW B;  1P9W A;  2WAE A;  2Y79 A;  4KG6 A;  4N1H A;  4XT2 B;  5M1A A;  3UE6 A;  1K25 A;  5CXW A;  2O99 A;  2H0T A;  4HJ6 A;  3VP0 A;  3ZDJ A;  4EEP A;  2FFF B;  2GNX A;  2ZMA A;  4HJ4 A;  4X25 A;  4OQI A;  5EM0 A;  4E6W A;  2WK0 A;  1UGU A;  4Y7P A;  2IWB A;  3JVU A;  2OWH A;  2WGI A;  3FG8 A;  4KZA A;  2VKS A;  1FIK A;  1K0K A;  4E3O A;  2ACG A;  2XSS A;  1WE4 A;  1S6R A;  1XP4 A;  2K7S A;  3LR0 A;  3MXR A;  2JKG A;  4L9F A;  3R7W A;  1K57 A;  3LCE A;  3NOU C;  1MY8 A;  1PYY A;  4LV0 A;  4ZJ1 A;  3NUL A;  2HV1 A;  4GS9 B;  4B4X A;  1HLU P;  2XR0 A;  2PBY A;  3C2W A;  1LT0 A;  3D3O A;  4X1L A;  3LY4 A;  2W27 A;  3T12 B;  4Z1W A;  2JBF A;  3MZD A;  2XF3 A;  1TDG A;  4HP9 A;  3R7W B;  4HI4 A;  3CLO A;  3UB6 A;  4CLC A;  4EWF A;  1Y54 A;  1DJA A;  1S4S A;  3FPV A;  4I39 A;  5CTN A;  4R3B A;  1ESI A;  4MBF A;  2H0Y A;  1TDL A;  3ZVW A;  3G2Y A;  5HSQ A;  1H8M A;  1PZP A;  3B47 A;  4QB8 A;  5CEB A;  2Y2L A;  2C5W B;  4OOM A;  5I5L A;  4LRY C;  2VGL M;  4GZB A;  3H7W B;  1VM1 A;  3IX3 A;  3FKW A;  1YMX A;  1VET A;  4EUZ A;  4U0X A;  4Y15 A;  2UWX A;  2PR6 A;  2X01 A;  3BFF A;  4QJG A;  3HLF A;  5FAO A;  3SOI A;  2FH5 A;  4PMA A;  1PNE A;  4GNU A;  4JXS A;  2VV8 A;  1XA7 A;  2WAD A;  5EVI D;  3HUN A;  2G2U A;  2GDN A;  3ZQ5 A;  4HNB A;  1T18 A;  5EUA A;  3NCK A;  1IEM A;  5DTS A;  4BQM A;  3RXW A;  4KZ5 A;  2WZX A;  3ITA A;  2W3G A;  3SS4 A;  1PFL A;  5CED A;  3QP2 A;  4DE2 A;  1TF1 A;  4X53 A;  2JHE A;  5GHX A;  1VHM A;  3OBF A;  4BL2 A;  5EM1 A;  5HZH A;  3KYE A;  4C6Y A;  1FCO A;  2WKQ A;  4RYE A;  1S4R A;  2VA0 A;  5F69 A;  4OQ0 A;  3N6I A;  3HJI A;  4X1M A;  2EX2 A;  4I38 A;  3S7N A;  4R4S A;  3BM6 A;  1JVJ A;  3MFD A;  2R78 A;  3IF6 B;  4P85 A;  5HWW A;  4EQI A;  3BQ8 A;  1XPB A;  5FI2 A;  1BYW A;  3W4Q A;  2Y2N A;  1K55 A;  1Y28 A;  4BL3 A;  5GLC A;  4NKP A;  5EEC A;  5FI6 A;  5F83 A;  4JGR A;  1NYY A;  1HZO A;  2L1M A;  2D01 A;  3HLC A;  2B18 A;  3SS3 A;  4Y5F A;  2CMN A;  3ZG8 B;  1ES5 A;  1JTD A;  2ZOH A;  3UB8 A;  3T4T A;  1LSV A;  4E04 A;  3BLS A;  1ES3 A;  2V0U A;  1K4E A;  4KZ8 A;  4KQQ A;  3UB5 P;  1XFN A;  2HP9 A;  2V0W A;  5J4E A;  1K56 D;  1D06 A;  3MS6 A;  1A0K A;  1TS6 A;  1JTG A;  1PZO A;  1I2S A;  3L7H A;  3D9Y A;  1NLZ A;  4WN5 A;  4X55 A;  3V39 A;  3WS4 A;  3A3E A;  3EGX C;  3O3V A;  3HLW A;  3PBO A;  3S7O A;  1X0O A;  4DE3 A;  2VX8 A;  3R4K A;  2Y2I A;  1FIL A;  2Y59 A;  2XFS A;  3OC2 A;  2Y2H A;  1I5Q A;  4EU0 A;  3F1N A;  3UB7 A;  3CJM A;  3U4L P;  4JGP A;  3IS2 B;  3TE8 A;  4OOY A;  3C30 A;  4OPQ A;  3E2L A;  1RCJ A;  5FEG A;  4JF6 A;  5JYP A;  3NJA A;  3PHY A;  5EPH A;  2FZ0 A;  2XDM A;  1MBL A;  2JN7 A;  1MWU A;  3ZVT A;  2ZLY A;  4IBR A;  2NUP C;  3G4P A;  3NDG A;  3PBQ A;  1UWP X;  2ZC5 B;  3BW6 A;  3OZH A;  1KDW A;  2RCX A;  1PI5 A;  3DTI A;  4FSF A;  2ZL1 B;  5FQQ A;  3HUM A;  4EW7 A;  2J80 A;  1W5D A;  3FC7 A;  1T1C A;  3MXQ A;  4KZ9 A;  4AFI A;  1E3U D;  4FH2 A;  2ZM2 A;  5HD3 A;  2W0N A;  5KZH A;  1L2S A;  5IU1 A;  4O0P A;  5K5B A;  4KZ6 A;  1G6O A;  4H6J A;  1MWS A;  4LV2 A;  3H82 A;  2IWD A;  4RA7 A;  1J3W A;  2MJ6 A;  2Z6C A;  1YQS A;  1CEF A;  2HZ5 A;  1OTA A;  4DDY A;  1T1A A;  3CHW P;  5L10 A;  3QNC A;  2PAV P;  3JYI A;  1D7E A;  3GVB A;  1S0W A;  3PBS A;  4GJ4 A;  1CI8 A;  5AJG A;  1C3B A;  1YLY A;  4OLD A;  3LR5 A;  3ZNY A;  3WS2 A;  5HAP A;  4UA7 A;  4DDS A;  2KDK A;  4BBU A;  3SH8 A;  4D2O A;  4ARZ B;  2GX5 A;  1T1B A;  4YFM A;  3P98 A;  3FYZ A;  4S2J A;  4QD4 A;  4FH4 A;  3MKE A;  5EVI C;  4E3I A;  1ZHH B;  5F1G A;  2LB9 A;  1S1Y A;  1L0F A;  1SHV A;  2ZC6 B;  4QWO A;  3Q07 A;  2E8I A;  5M18 A;  4K08 A;  5FQK A;  2B02 A;  3FV7 A;  3VSL A;  3C7V A;  2J7V A;  3UE0 A;  4DN0 A;  3P01 A;  4KG2 A;  5HDC A;  3UNW A;  1TVF A;  2HJE A;  5FEF A;  4X6T A;  3Q82 A;  5HD5 A;  3VFF A;  2OLV A;  1LHY A;  4EUV A;  2Y2O A;  5GLD A;  4B93 A;  3IH9 A;  3B42 A;  3VP1 A;  1GHP A;  1K54 C;  3CWF A;  4WZ5 C;  3IBJ A;  4WF0 A;  2HPB A;  3KSH A;  5F82 A;  4BBV A;  3CPT B;  1FCM A;  3T4Q A;  2JE5 A;  3PXP A;  3EEH A;  4F94 A;  1YSP A;  3PAG A;  1K38 A;  1S67 L;  5FI7 A;  1KGF A; 
#chains in the Genus database with same CATH homology
 2K7S A;  3LR0 A;  1XJ6 A;  1F9I A;  2L4R A;  3HCY A;  4MN5 A;  4L9F A;  3R7W A;  5DKK A;  1F5M A;  3NOU C;  4UQI M;  3TJZ C;  2K31 A;  2QHK A;  3CIT A;  4M4X A;  4KUK A;  4Q0J A;  4WLA A;  1KOU A;  2HV1 A;  3UB9 A;  3V67 A;  4GS9 B;  4EQ1 A;  5MC7 A;  2PYR A;  3E0Y A;  2GJ3 A;  3C2W A;  1LT0 A;  3NHQ A;  4G3W A;  4I3A A;  3D3O A;  3G6O A;  2A2L A;  2W27 A;  3C8C A;  4Z1W A;  3KSG A;  3PBN A;  3RFB A;  4ARZ A;  1N9N A;  4HP9 A;  3R7W B;  2QJ5 A;  4HI4 A;  5C5K A;  5L8M A;  1H3Q A;  3CLO A;  4Y2F A;  2QWS A;  1GSW A;  4HP4 A;  3LUQ A;  3UB6 A;  3PYP A;  4CLC A;  2WKR A;  4RQ9 A;  2P04 A;  3A0R A;  5KIZ A;  1OJG A;  2A24 A;  3LR4 A;  4II7 A;  2JKT M;  3BY8 A;  5HPF A;  1S4S A;  3FPV A;  4G3K A;  3GEC A;  4I39 A;  4R38 A;  2W3E A;  3BWL A;  1TD5 A;  3PR6 A;  2PD7 A;  1MC0 A;  4UQI S;  1LL8 A;  2EWW A;  3U2A A;  5AVF A;  4YNR A;  2WKP A;  1DRM A;  4XT2 A;  4EES A;  4ETX A;  5HSQ A;  1H8M A;  3KSF A;  3B47 A;  4DMZ A;  1ODV A;  2OWJ A;  4HY8 A;  1N9O A;  2PR5 A;  4OOM A;  5I5L A;  1G28 A;  4HHD A;  1XFQ A;  4LRY C;  2KOI A;  2VGL M;  3KYZ A;  3LYX A;  3H7W B;  1OTD A;  4KQD A;  3MR0 A;  3E4P A;  1S1Z A;  2JKR M;  2J3T D;  1S66 L;  2OAQ 1;  4MN6 A;  4Q0I A;  1STZ A;  2PR6 A;  2EWV A;  1OTE A;  5HWT A;  2QYB A;  5A8B A;  4L0L A;  3NOP C;  3KYQ A;  5TBM A;  1V9Y A;  3VV4 A;  2HF6 A;  5CX7 A;  3RTY A;  2FH5 A;  2EA9 A;  3FPW A;  3BQA A;  5J7E A;  1OJ5 A;  2L0W A;  2VV8 A;  3OLO A;  2O9A A;  5DFY A;  5LBR A;  4CLC D;  1YSQ A;  4UEY A;  3KSI A;  3NOT C;  3GDI A;  4YWZ A;  3ZQ5 A;  4GS9 A;  4I3I A;  4HNB A;  5DF9 A;  1XJ3 A;  4O8G A;  5J3W A;  4FOF A;  3IBR A;  1T18 A;  2VV7 A;  3EQU A;  3MMH A;  1NRJ A;  2INW A;  2H28 A;  2KX6 A;  2V1B A;  1TS7 A;  5TBM B;  3VE3 A;  2W3G A;  3DBA A;  3BJN A;  2G7U A;  3UME A;  1NLY A;  2ZBB A;  4QPR A;  1TF1 A;  4L9G A;  4R70 A;  2JHE A;  3F1N B;  4IHQ A;  1LSW A;  1VHM A;  3ULF A;  3OBF A;  2OOL A;  5HZH A;  3MJQ A;  5EFW A;  4NEE D;  4ETZ A;  2WKQ A;  4F3L B;  3VE4 A;  4HJ3 A;  1S4R A;  5HL6 A;  2VA0 A;  5F69 A;  1P9R A;  1OT6 A;  5G4Z A;  1DP6 A;  3HJI A;  4I38 A;  3S7N A;  3PBT A;  5AVE A;  3T4K A;  3MQQ A;  3K3C A;  4MN7 A;  1T19 A;  5F6A A;  5DFX A;  1P0Z A;  2R78 A;  4KQO A;  4PAU A;  3F1O A;  4LPZ A;  5HWW A;  4DJ3 A;  3BQ8 A;  4WEL A;  2QKP A;  1BYW A;  1TS0 A;  1VB6 A;  1Y28 A;  2KLI A;  4NKP A;  3LIF A;  1LSX A;  4JGR A;  2NUT C;  3W2Z A;  2M1C A;  3H7W A;  2IA2 A;  2O0Y A;  2ZMF A;  2L1M A;  2D01 A;  3EQV A;  2B18 A;  4G3V A;  4Y5F A;  2CMN A;  4Y3I A;  5TJJ A;  3UMD A;  3T4L A;  2GZA A;  5F68 A;  2ZMV A;  1WA9 A;  2ZOH A;  3OCN A;  3T4T A;  3UB8 A;  2HGV A;  5KSH A;  1LSV A;  4E04 A;  3F1O B;  4HH2 A;  1W63 Q;  2W3F A;  5HWV A;  4BMW A;  4R3A A;  2V0U A;  2BAS A;  3EOI A;  2YKF A;  3LIE A;  4H6J B;  5IS1 A;  3H82 B;  4I3J A;  4IUK A;  4HH3 A;  1XFN A;  2XA7 S;  3LIB A;  2V0W A;  5J4E A;  4HIA A;  1D06 A;  3KX0 X;  4GW9 A;  1TS6 A;  2PT7 A;  3ICY A;  3EWK A;  4Q0H A;  4HOI A;  4MDZ A;  4EET B;  3S7P A;  5DJT A;  3BY9 A;  4HQA A;  3CAX A;  1OTB A;  1NLZ A;  4WN5 A;  1EW0 A;  1IOU A;  1YAX A;  5F5Y A;  4WEJ A;  3E4Q A;  2M7V A;  4GHI B;  3K3D A;  3LIA A;  1F98 A;  1XJ4 A;  4WL9 A;  3A0S A;  3EGX C;  2ZOI A;  3PBO A;  3S7O A;  1X0O A;  1JNU A;  2VX8 A;  3R4K A;  2OAP 1;  4R6L A;  1P97 A;  3RH8 B;  2P7J A;  3CI6 A;  3F1P B;  3OC2 A;  4IUH A;  4EU0 A;  3F1N A;  2M7U A;  4WUJ A;  3S7Q A;  3UB7 A;  3EGD C;  4JGP A;  3IS2 B;  3TE8 A;  4DJ2 A;  3OOV A;  1V9Z A;  4JGQ A;  3C30 A;  3H9W A;  4GLQ A;  2J3W A;  4F3L A;  2JKR I;  3TW8 A;  1XJ2 A;  2XRO A;  4JGO A;  2O9C A;  4KUO A;  2DMW A;  3NJA A;  3PHY A;  2FZ0 A;  1OPX A;  1ZTU A;  2I9V A;  2JN7 A;  4EER A;  1TS8 A;  2NUP C;  2W1R A;  4I5S A;  4O01 A;  3PBQ A;  1UWP X;  4YOF A;  3BW6 A;  5DJU A;  5HPI A;  4FSF A;  2O9B A;  2VJW A;  4EW7 A;  2J80 A;  4CLC E;  3FC7 A;  3A0V A;  2YKH A;  1T1C A;  2QJ7 A;  3MXQ A;  4AFI A;  3O5Y A;  2XA7 M;  1DP8 A;  4NXF A;  5HD3 A;  5HDD A;  2W0N A;  1UWN X;  3CUE A;  3EEA A;  1IFQ A;  2VLG A;  5IU1 A;  4O0P A;  5K5B A;  2D02 A;  2W1T B;  1G6O A;  4H6J A;  3E4O A;  3KO6 A;  3H82 A;  3LI8 A;  3LIC A;  3ZYT A;  3OCL A;  2K2N A;  3T4O A;  2PYP A;  5DKL A;  2MJ6 A;  2W3H A;  1GSV A;  1GSX A;  2VV6 A;  4CQH A;  4MCW A;  2Z6C A;  5IT5 A;  1OTA A;  1N9L A;  2J3T C;  3CUE C;  4NXB A;  1MKM A;  4PKY G;  2V9A A;  1T1A A;  3LFV A;  1D7E A;  4GHI A;  2PDR A;  4GJ4 A;  3PBS A;  1DP9 A;  5AJG A;  3LI9 A;  3LR5 A;  3P7N A;  2W3D A;  4LRX C;  3TRC A;  4ZRR A;  5FL3 A;  4PHT A;  1W63 M;  2KDK A;  4BBU A;  3LR3 A;  4ARZ B;  4GCZ A;  2GX5 A;  4BWI A;  1T1B A;  4LRZ E;  3F1P A;  3MQ0 A;  2JKT I;  3T4S A;  4NXE A;  2HJ9 C;  3MF0 A;  4P6Z M;  3IS2 A;  4CLC B;  4CLC C;  4NXG A;  1YKD A;  2Z6D A;  4BBT A;  1ZHH B;  2LB9 A;  1S1Y A;  3VOL A;  2A24 B;  3UE3 A;  3MFX A;  2P08 A;  3D72 A;  3K2N A;  3PBR A;  2VZW A;  3T4J A;  4K08 A;  2PHY A;  4B9O A;  4L9E A;  2B02 A;  4PKY A;  1P9W A;  2Y79 A;  4XT2 B;  4DN0 A;  3P01 A;  3UE6 A;  5HDS A;  3B33 A;  2O99 A;  5HDC A;  2LB5 A;  2HJE A;  4HJ6 A;  5HD5 A;  4EUV A;  4EEP A;  4B93 A;  2Y8H A;  4EXO A;  2GNX A;  3B42 A;  4HJ4 A;  4WEK A;  1MZU A;  3MQO A;  2PD8 A;  4BJP A;  3SW1 A;  3E98 A;  3CWF A;  1UGU A;  3IBJ A;  4ME4 A;  4WF0 A;  3JVU A;  2OWH A;  4P6Z S;  3KSH A;  3LID A;  4BBV A;  3C38 A;  3T4Q A;  4EEU A;  1OTI A;  2VEA A;  2XRN A;  3FG8 A;  1OT9 A;  2VKS A;  3PXP A;  2W1T A;  5G4Y A;  3T50 A;  3JVV A;  3EEH A;  1YSP A;  3HJK A;  1S67 L;  2VGL S;  2XSS A;  4IJG A;  4OOL A;  1NWZ A;  4MMN A;  2V1A A;  4LLO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...