4PKYA

Arnt/hif transcription factor/coactivator complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
104
structure length
101
Chain Sequence
TRFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNDEIEYIICTNTNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Coiled-coil Coactivators Play a Structural Role Mediating Interactions in Hypoxia-inducible Factor Heterodimerization.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/cell cycle
molecule keywords Aryl hydrocarbon receptor nuclear translocator
total genus 28
structure length 101
sequence length 104
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14598 PAS_11 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4pkyA00
1LSVA 3MR0A 3H9WA 4HJ6A 3CLOA 4I39A 5J3WA 5G4YA 2OWJA 4LLOB 4JGPA 4F3LA 1S1YA 4HNBA 1OTAA 3EWKA 4JGOA 4MN5A 3NOPC 1OT6A 4KUOA 2W27A 3T50A 1TS6A 1XJ2A 3LYXA 1LSWA 2VV7A 5HWTA 4BBUA 4EESA 4XT2B 3MXQA 2P7JA 4GS9A 4WL9A 4DJ2A 3MQOA 3BWLA 4EERA 2J80A 3PYPA 3LIFA 4I38A 3UB9A 5F69A 3MJQA 1DP8A 1OTEA 1JNUA 4I3IA 1NWZA 1D7EA 1F98A 4GCZA 4WLAA 4GHIA 4L9GA 5DJUA 4R38A 4YWZA 2WKQA 1DRMA 1OJGA 1GSWA 3B33A 1XJ4A 3ICYA 2M1CA 3LIAA 4HOIA 2VLGA 5HD3A 3LI8A 2PR5A 2CMNA 4M4XA 2KX6A 2YKHA 2A24B 3LI9A 3PHYA 3F1OB 4R3AA 4WUJA 3F1NB 3GDIA 4BBVA 4EW7A 1XJ6A 4HH2A 4LRXC 1S67L 1LSXA 3NOTC 3MQQA 2JN7A 2V0UA 2ZOHA 1BYWA 1TS0A 4LRYC 5F6AA 1OT9A 1T1BA 3H7WB 3RTYA 3SW1A 3NHQA 1D06A 1UWPX 2OOLA 3KX0X 4EETB 4EXOA 5J7EA 3LICA 4KQDA 5G4ZA 2PHYA 1T1AA 3A0SA 3F1NA 4XT2A 5TBMB 3CAXA 3UB6A 3UMEA 5IS1A 4PKYG 3EEHA 4WF0A 5F5YA 1UGUA 2BASA 2PR6A 4NXEA 3C8CA 2VEAA 2R78A 3NOUC 2PYPA 3VOLA 5IU1A 4E04A 3OLOA 2W0NA 1ODVA 1TS8A 2HV1A 1N9LA 2QJ7A 3CWFA 3FG8A 3K3DA 3NJAA 1OJ5A 4F3LB 3E4PA 4HI4A 5HSQA 3A0VA 1N9NA 3H7WA 5DJTA 4HP4A 5HDSA 3E4OA 4HQAA 4HH3A 2ZOIA 4R6LA 1XFQA 1P0ZA 5HWWA 2Z6DA 3LUQA 2A24A 3VE3A 2L4RA 1F9IA 1GSVA 1S4SA 2D02A 4DJ3A 2GJ3A 2PD7A 3A0RA 3D72A 3F1PA 4R70A 1EW0A 3C2WA 2OWHA 4L9EA 2INWA 2QWSA 1KOUA 2QHKA 3P7NA 3VE4A 3ZQ5A 1LL8A 4EQ1A 4HJ4A 2QKPA 3IBRA 4EEPA 1XFNA 1V9ZA 2KDKA 2V1AA 4HP9A 4I3AA 4LPZA 4MN6A 5HZHA 5HWVA 3LIBA 4GHIB 1TS7A 1WA9A 2H28A 5TBMA 1N9OA 4GS9B 1S66L 1V9YA 4H6JA 3K3CA 4I3JA 4KUKA 1Y28A 4NXBA 5F68A 3G6OA 2VV6A 3BY8A 3UB8A 1GSXA 4NXFA 3ULFA 5KIZA 3IS2B 1DP9A 4HHDA 1DP6A 2YKFA 3F1PB 1VB6A 2D01A 4K08A 1T1CA 2EA9A 5DKKA 4GW9A 5HDCA 3UE6A 3UMDA 3F1OA 1OTIA 1X0OA 2V1BA 3GECA 5I5LA 4I5SA 4WN5A 5AVEA 1OTDA 1S1ZA 4JGQA 3LIDA 1XJ3A 3E4QA 3IS2A 5HDDA 3FC7A 3LIEA 4BBTA 4NXGA 3UB7A 2QJ5A 4RQ9A 2I9VA 4HIAA 4HY8A 1T19A 2B02A 2PYRA 5HD5A 1OTBA 2WKRA 3H82B 2Z6CA 1P97A 5EFWA 4B9OA 1S4RA 2L1MA 4LRZE 2ZBBA 2JHEA 2K7SA 2V0WA 3HJIA 3MFXA 1UWNX 4PKYA 4JGRA 2WKPA 3RH8B 5A8BA 3HJKA 2V9AA 3H82A 5J4EA 4L9FA 1G28A 4H6JB 1T18A 1MZUA 2L0WA 2PDRA 1LT0A 2PD8A 5AVFA 4HJ3A 5DKLA 3BY9A 2VV8A 4EEUA
chains in the Genus database with same CATH superfamily
3CLOA 2Y4AA 4CPKA 2XFSA 4LV1A 2MJ6A 1K56A 3QNBA 1OT6A 3WS1A 4X25A 4ID4A 1XJ2A 4FSFA 3QHYA 4KZ7A 1HVBA 4KZ9A 1NWZA 3G34A 4Z9QA 2HGVA 4BD0A 4Y5FA 1GSWA 1XPBA 3LI8A 1JTDA 2WAEA 1ONGA 3T4KA 4EW7A 4E3KA 4R4SA 2XQZA 2PAVP 3CAXA 1FCMA 3P01A 4WF0A 3G31A 4ETXA 2ZQAA 4YNRA 4X53A 5L8MA 3VMAA 2W3DA 2E8IA 2M7UA 3PAGA 2LB9A 4R6LA 2Z6DA 1F9IA 4GDNA 3CUEA 2OWHA 3P7NA 3B3XA 4WEJA 2B18A 2WGIA 3Q7VA 2WZXA 1PI5A 2JKRI 1GSXA 3Q07A 2YKFA 4R3JA 1T1CA 4CLCE 2V1BA 3QP8A 3E2KA 1I2WA 4Y0OA 3ZVWA 4JKTA 2B95A 3BJNA 2X01A 3S7OA 2OLVA 4PKYA 4CJNA 1BLSA 1H8ZA 3T1RA 4EUVA 5FAOA 4IVIA 1IELA 3S7QA 2Y79A 3ZFZA 3ZNYA 3CITA 4KQQA 3HLFA 5AQAA 3LR3A 3W2ZA 5A91A 5CERA 4K91A 3IQAA 3ZYTA 4CQHA 3HLBA 3TE8A 2ZL1B 4MCWA 4WL9A 1ZKJA 2WZZA 3BECA 3FPVA 1IKGA 3T4LA 2ZL1A 5CHJA 4WBGA 5FQQA 2WKQA 1P9RA 4KG5A 3U4LP 5F82A 5HPFA 3S7NA 2OAQ1 3UNWA 1N9BA 2HDQA 2EWVA 2V0UA 4HEFA 4S2IA 1UWPX 1TDLA 5F5YA 5CGSA 4AFIA 3PBOA 4E6XA 2W0NA 1ZG4A 5GLBA 4Y15A 2HP5A 2XGNA 3HUOA 3S22A 3C4PA 2A3UA 1GA0A 3GVBA 1FCNA 2ZOIA 4G3KA 3HLDA 3MSHA 1SDEA 1ES3A 5HSQA 3A0RA 4HJ4A 4OH0A 3PBRA 5HX9A 1H5XA 4PM7A 1CQAA 1BLCA 5JYOA 5E2EA 3PR6A 1BULA 1E3UD 2GDNA 4EUZA 1G5UA 4YFMA 3UN7A 3W4PA 2P08A 1ZTUA 4ZRRA 4XXRA 1BUEA 1XJ3A 5HDDA 4IHQA 4ZTKA 5FDSA 2E8JA 4IVKA 1UWNX 1HTZA 1XGJA 3GQZA 1QMEA 5AVFA 1MZUA 1VETB 4KZBA 4GKUA 2P9VB 2VK3A 4HNBA 5L10A 5EE8A 3IH9A 1NXYA 1MWSA 3ITAA 2OAP1 4IBRA 4KENB 3LYXA 3FKWA 2P7JA 2A2LA 1TDGA 4DJ2A 3BWLA 1PYYA 1EI5A 1DP8A 2V8FA 1BLPA 3ICYA 2YKHA 4GB7A 3OPLA 4WUJA 3D3OA 4LCLA 3A3FA 3HUMA 5E2FA 2DRWA 4N9KA 1KE0A 4OPYA 4EETB 3KX0X 1VHMA 3DW0A 3SS4A 4MN7A 5CECA 1YLTA 2XA7M 1ODVA 3CWFA 3NJAA 1LHYA 2J3WA 4P6ZM 5DJTA 1CEFA 4MBKA 4C6YA 2JKGA 3OOVA 2IWDA 5EM1A 1Y54A 4QY6A 4EEPA 5FEFA 1WA9A 4GS9B 5F68A 1VEUA 4K0XA 2XK1A 3FZCA 2W3FA 4WM9A 2EFUA 4GW9A 1VEUB 1K0KA 3VSKA 5EM0A 1S1ZA 4OOMA 3LIEA 1M40A 2QJ5A 3V39A 3G2YA 3N8RA 1P97A 3B47A 5FATA 4JGRA 1GA9A 2HJ9C 3E98A 2Y2PA 3PBTA 1T18A 2WUQA 1Y4OA 1FQGA 5LBRA 5GLCA 4HJ6A 4QY5A 4GD6A 3EQVA 4PM9A 4EBPA 2Q9NA 2PU4A 2HJEA 3ZG7B 3OBFA 3UPPA 2J7VA 1LL5A 2EWWA 1TS6A 2VJWA 4XT2B 2O9AA 3MQOA 2J80A 3G30A 3LIFA 1ERMA 4RVAA 3V3RA 4I3IA 1D7EA 4GNUA 3NDEA 1NZUA 2VGLS 1XJ4A 3OCNA 4R23A 1Q2PA 2PR5A 3BQ8A 3F1NB 1M6KA 3CUEC 2W3HA 3FWLA 3BEBA 2ACGA 3E2LA 1T1AA 3F1NA 1FOFA 3NDGA 5FEGA 2R78A 2H0YA 2PYPA 4P6BA 2Y2KA 4IUHA 1NRFA 5FQJA 3IWIA 2IA2A 5GHZA 2UV0E 3F1PA 1KOUA 2QHKA 4LGWA 1W63Q 3PXPA 1U60A 2G7UA 1S66L 1V9YA 1NZOA 3OPHA 4NXFA 2J3TC 3ULFA 4BD1A 5EPHA 3LY3A 2JBFA 3PBNA 1OTIA 5EOEA 2V2FF 4WN5A 1SKOA 1YLYA 4OQ0A 4RQ9A 3VOZA 3EGDC 4PPRA 4H6JB 3A3JA 4PM8A 4ZJ1A 3LGOA 3BFFA 4UQIM 5J8XA 2W27A 3GV9A 2Y2JA 1L0GA 1W5DA 5EVIB 5F69A 3WS5A 3L7HA 4DDSA 1OTEA 5EVEA 3KYEA 5HW3A 1W8YA 2V1ZA 4HOIA 4FD8A 3M2KA 3IXBA 2J9OA 1SCWA 1ESIA 3NBLA 2ZC6B 4LRYC 4R3BA 5FASA 2OOLA 1K55A 4EXOA 3NC8A 2RCXA 3M2JA 5DF9A 1UGUA 2VEAA 2IWBA 4RA7A 1YLWA 2B5RA 4F3LB 3W4QA 3IF5A 1ZHHB 2V8CA 2C5WB 3JPUA 1XA7A 2BLSA 4KZ6A 5HWWA 4IEDA 4DJ3A 3C2WA 5L2FA 5U47A 1V9ZA 2KDKA 5HWVA 4OPZA 3PBQA 2H28A 3A3DA 4O0PA 1ACFA 1WYCA 2FFYA 3MXRA 3F1PB 2WADA 4DE1A 4G3WA 4I5SA 5AVEA 1N4OA 3LIDA 3FC7A 4LFUA 2I9VA 3CPTB 5FQIA 5KZHA 1PFLA 3DBAA 1S4RA 3HJIA 4N1XA 4C3QA 4II7A 4LV0A 2P04A 4O7DA 3MR0A 1KDSA 3Q1FA 3DWZA 3FPWA 5GLDA 4JGOA 3T12B 3N8LA 3ZNTA 3G4PA 3MKFA 2ZD8A 1MKIA 1MBLA 4OPQA 1FCOA 2JCHA 2VV7A 3NIAA 3BFDA 4UA7A 3BFCA 3C4OA 3ZG9B 5DJUA 2XROA 1E3UA 4G3VA 1CF0A 3O88A 2Y91A 4KZAA 1JTGA 4QD4A 5DTTA 2HF6A 3QP1A 1KGEA 1WYBA 3NHQA 1KGFA 5A92A 3A0SA 3TJZC 2BASA 3NCKA 5FAQA 1C3BA 3MZFA 3A0VA 1W79A 3C7VA 4NG2A 2PD7A 4HP9A 4B88A 3NULA 1GHIA 1BTLA 3G6OA 1MPLA 3HLWA 3EGXC 3KSHA 3IXGA 4YINA 5L07A 1D1JA 3C7UA 4JXGA 4GOGA 3E0YA 3E4QA 4E6WA 3MFDA 3QP5A 4IUKA 1K4FA 5DFXA 3BYDA 1FR1A 3QP2A 4S2NA 2Y2MA 5EVLA 3H82B 3IH8A 1NLYA 3N8SA 1BLHA 4KZ5A 1LI9A 2V9AA 5CEDA 5IT5A 4BL3A 3BFGA 3K2NA 2VKSA 2ZC3B 4LV2A 4FOFA 4B93A 1VM1A 3V67A 5G4YA 1Z6FA 2HP9A 1RGZA 3CI6A 4S2MA 3T50A 2HZ5A 3MZDA 3UO9A 3L9KA 2XFTA 3Q82A 1XA1A 1JNUA 4YWZA 1YLJA 4DF6A 4EBNA 3OC2A 2Y2NA 5FI2A 4FTXA 2ZM0A 2XF3A 3EQUA 4L0LA 2BG1A 3BRMA 1RCJA 1YAXA 3RJUA 4Y0UA 3C8CA 4E3NA 3FYZA 1ZG6A 3VP3A 2O9CA 3MMHA 3IWOA 1PZOA 5EOOA 4OP8A 4HQAA 4X69A 5F1GA 4D2OA 1VQQA 1HLUP 4UHUA 2D02A 3O5YA 1EW0A 3VE4A 1PWCA 4ZBEA 2IWCA 5FI7A 4OVDA 3LEQA 3LIBA 5F83A 3ZG0A 1N9OA 4NXBA 3AGDA 4PM6A 5EVID 4S2LA 4Z1WA 1O07A 3D4FA 2EX9A 3G35A 1Q2QA 5KSHA 5FQKA 1H0MA 1J9MA 1GHMA 4JGQA 2HDUA 1ES4A 3OZHA 3PAEA 1OTBA 4WEKA 5EFWA 3IF6A 2VX8A 2W3EA 2ZBBA 4BENA 3BFEA 3HJKA 5DTKA 3LEZA 2Y2LA 3SS3A 3NECA 2OWJA 4RX3A 2W3GA 1E4DA 4E3IA 1CEGA 4Y7PA 1KVMA 3ZVTA 4JXWA 4U0XA 1FILA 1I2SA 3UDFA 1CI9A 1JWPA 1STZA 1DRMA 1KGGA 1S6RA 1PW1A 3VOYA 1S67L 4JXVA 1PWGA 1YKDA 4U0TA 1K6RA 3UB6A 3DTKA 3KSIA 4QWOA 3JYIA 5GHYA 3FV7A 3H7WA 5FAPA 1XX2A 1P0ZA 3LUQA 4Q0JA 2R9XA 2GJ3A 2VGLM 4R70A 5E2GA 4RYEA 1YSQA 5HZHA 2Y2GA 4LENA 5HL1A 4GHIB 3VV4A 2M7VA 1A0KA 1BZAA 1E25A 2EX8A 2G2WA 5HDCA 5HAQA 3IF6C 3GECA 1OTDA 1ONHA 1FIKA 4R1GA 4Y17A 2FZ0A 4HIAA 4LRZE 2O0YA 4OONA 4C75A 4OLGA 3GTCA 5J4EA 1AXBA 4K0WA 3GR2A 2AVXA 1K25A 3H9WA 4BWIA 5HFOA 4F3LA 3ZG5A 4S2PA 3T4TA 4ARZA 3IBJA 3JVUA 3LY4A 4BBUA 1FSWA 3MXQA 3WS0A 1H8YA 3FKVA 3PBSA 3UE0A 3UB9A 3P09A 3MJQA 4EU0A 2XR0A 2ZC4B 4R0QA 2WGWA 4NKPA 1XKZA 3TG9A 2XEPA 2XD5A 1J3WA 4RX2A 3B33A 3CG5A 3MQ0A 2P74A 3LIAA 4EBLA 3AGEA 3VFFA 2FFFB 1Z09A 2KOIA 3PHYA 4R3AA 4LRXC 1MY8A 5KSCA 4GJ4A 4WZ5A 1T1BA 3UB5P 1PI4A 3ZGAB 5TBMB 4UQIS 3EEHA 4E3LA 2PR6A 5MC7A 4ESPA 4B4XA 2HV1A 1N9LA 4WZ4A 3BM6A 5M19A 3VP4A 3LFVA 4HI4A 2A24A 1HZOA 1DJBA 4LCMA 4CLCB 1H3QA 1LL8A 2V1AA 1NY0A 3M6BA 4I3AA 2ZM8A 4DE2A 3P98A 1I5QA 4S2KA 2PRFA 4CLCD 3KSFA 1Y28A 4DE3A 3WRZA 3IHAA 3C5AA 3VP0A 5CRFA 5DVAA 2V20A 2EX6A 2NUPC 2K2NA 4EQIA 5DF7A 4BBTA 4MLLA 1VETA 3BQAA 1PRQA 1XP4A 4Q0IA 4DN0A 3EEAA 2L1MA 4OQIA 2P9VA 4O8GA 1K57C 2JHEA 3RH8B 2WKPA 2C6WB 2O9BA 3HBRA 3N7WA 1LT0A 3BY9A 5IHVA 3SH7A 1OTAA 3UE3A 3RFBA 4WMCA 1PWDA 4GN2A 4DMZA 1ES2A 2Y2OA 3OPPA 4MMNA 2Z2LB 4XUZA 2JKTI 1BSGA 2VLGA 5M18A 1LSXA 3NOTC 4Y3IA 2WGWB 5F6AA 4M3KA 1IFQA 3A3IA 5J7EA 4KQDA 4XT2A 2DNSA 5CEBA 3UPOA 4UEYA 1KE4A 2EXBA 2HP6A 1TVFA 4ARZB 2Q0OA 2ZQ7A 3VE3A 1GSVA 5M1AA 1L2SA 5F1FA 5CX7A 3JVVA 5EUAA 4LPZA 4UAAA 3O87A 4QU3A 1TEMA 4DE0A 2Y2HA 3ZG8B 5HAIA 3IS2B 4CLCA 2GNXA 2EA9A 3IWQA 1W7FA 3IS2A 3ZHHA 2ZJ9A 2PYRA 4OQGA 2Y55A 2Z6CA 4OOYA 5KMWA 2K7SA 2V0WA 3LR5A 4NEED 5A8BA 1MKMA 4ME4A 2PDRA 3A3EA 2X02A 3B42A 4I39A 4U3TA 3R7WA 4X6TA 2HDSA 3T4JA 2WKHA 1DJAA 5HAPA 4E3MA 1K57A 3DWKA 1K38A 2WKEA 4JXSA 4F94A 5E43A 2CC1A 2A24B 2Y8HA 2LB5A 3GDIA 5JYPA 4HH2A 3MQQA 4Y0TA 2Y59A 3LICA 3MBZA 4HESA 5IS1A 4E04A 3R4KA 1LLBA 3FG8A 4GD8A 4X55A 1N9NA 2XDMA 4WYYA 2ZC5B 3C30A 2HPBA 3D9YA 2QZ6A 2EX2A 1G6OA 3HCYA 4E3OA 1GHPA 1EROA 3T1SA 1K54A 4I3JA 3ZDJA 3VSLA 5KIZA 5CXWA 3SOIA 5EVIA 1TF1A 2W1RA 2Y2QA 1VB6A 1K4EA 5CHUA 4IBXA 3QP4A 4JF4A 5G18A 3SH8A 3LO7A 3RXWA 3V3SA 4HY8A 1T19A 5HD5A 1K6SA 4HBUA 3GRJA 2JKTM 4FCFA 1JWZA 4PM5A 5AJGA 1YM1A 5CGWA 4HJ3A 1ES5A 4OLDA 4EEUA 3TSGA 4X56A 1YMXA 1OPXA 4JGPA 4MN5A 1NYYA 3NI9A 4ZJ3A 4EWFA 3LR0A 2VA0A 2HDRA 4LV3A 3UPNA 4I38A 2W1TA 3SZTA 3VP2A 1NYMA 4E3JA 5EV0A 3M6HA 4GHIA 4L9GA 5DF8A 3VP1A 3TRCA 2W1TB 4Q0HA 1G68A 2M1CA 4BL2A 4BBVA 1PNEA 2GZAA 2WKIA 2XRNA 1XJ6A 2R9WA 3MXSA 5DFYA 2ZOHA 1OMEA 1GCEA 1YT4A 2PHYA 5CHMA 2H10A 3R7WB 3OLOA 1W8QA 1TS8A 4KG2A 4MBFA 5HDSA 4UA9A 4HH3A 1XFQA 2L4RA 1S4SA 4KQRA 1JWVA 3ZQ5A 4BJPA 2ZMFA 2QKPA 4OP5A 4EV4A 4DDYA 3K3CA 3CPTA 2ZC7A 3BY8A 1L3LA 4ETZA 4KG6A 2J8YA 3UE6A 3F1OA 1K54C 4BMWA 2DMWA 3IXHA 1PW8A 2VZWA 1S0WA 3MFXA 2WYXA 2OSUA 1NLZA 5FL3A 5DTSA 1G28A 1P9WA 3ITBA 3S1YA 5C5KA 1S1YA 3W4OA 1G6AA 1PIOA 4HBTA 5FSRA 4KUOA 3DAVA 4DXBA 3DTIA 1ALQA 4EERA 4DRTA 1AWIA 1F98A 1YMSA 4GCZA 3S7PA 5HPIA 5TGFA 4QHCA 4QB8A 4OPRA 1LL9A 3O3VA 3NY4A 3BLSA 4JPMA 2QPNA 4WMCD 1TS0A 3UMEA 4PKYG 5HL6A 3EOIA 5IU1A 3DTEA 5FDHA 3T1QB 3IX4A 1SKFA 4N9LA 2H5SA 1XXMA 3D72A 4ZDXA 1W63M 2QWSA 1L0FA 3HVFA 1DY6A 4P6ZS 4MBHA 1FSYA 4BQMA 4KUKA 4EQ1A 5DKKA 1IYSA 3ISGA 3C38A 1RP5A 1YLZA 1KDWA 3UB7A 2PU2A 4YOFA 1KVLA 2XSSA 5CGXA 5A93A 1WE4A 3KSGA 2EXAA 2K31A 3MZEA 3T4QA 4N92A 4NK3A 2OV5A 1IYQA 1F2KA 1LSVA 3EWKA 3IT9A 4Y13A 3UDXA 1MC0A 1LSWA 5HWTA 3IF6B 5A90A 3O86A 1DJCA 5AQ9A 5TFQA 2KLIA 1FR6A 1L0EA 2UWXA 2ZM2A 3AGFA 3UE1A 4QJGA 3LCEA 3N4IA 1ESUA 3GMWA 5FQ9A 2KX6A 4ZAMA 4JBFA 1BYWA 1D06A 4GLQA 3T4OA 1RGYA 5G4ZA 5TR7A 2I72A 1YPRA 2PBYA 3MF0A 3HLCA 3NOUC 2J3TD 4S2NC 3E4PA 2ZQ9A 4HP4A 3E4OA 1NRJA 2ZMVA 4P87A 3S4XA 4UA6A 4L9EA 2PBDP 2INWA 5FA7A 4S2JA 5K5BA 1H8MA 3IBRA 3N6IA 5CTMA 4X1LA 3U2AA 4JLFA 4H6JA 3UB8A 2QMIA 3WRTA 4QPRA 3UMDA 4B4ZA 3HLGA 1X0OA 3IX8A 4GDBA 4KQOA 2GX5A 1F5MA 2B02A 3BW6A 4X68A 4A5RA 4NETA 4JF6A 3RXXA 3H82A 4PHTA 2L0WA 2QYBA 2X71A 2DCFA 5E2HA 1SHVA 1IOUA 3LR4A 2VV8A 3G2ZA 4R4RA 4LLOB 4OKPA 5GL9A 4DXCA 2J9PA 2ZMAA 1CK3A 2JKFA 1CI8A 2G2UA 3NOPC 5AQ7A 5BOHA 4BLMA 1YLPA 3QNCA 3HREA 2PT7A 2ZQ8A 3PYPA 3Q7ZA 1QMFA 4N1HA 4P0MA 5HD3A 2CMNA 4PMAA 4P85A 2BTFP 3LI9A 2FH5A 2JN7A 4WZ5C 2H0TA 1OT9A 3H7WB 2JKRM 3IX3A 1CJFA 3KYQA 3GSGA 2RL3A 1MWTA 4NXEA 5EECA 3W8KA 2ZQCA 4KZ4A 2QJ7A 4CLCC 1ERQA 3MS6A 1LI0A 1KE3A 4MEZA 1IYPA 3TW8A 4KZ3A 3VFHA 4MN6A 3WS4A 5TBMA 3CMZA 1SZVA 1DP9A 4HHDA 5EVIC 4D60A 3SS5A 3TOIA 4H8RA 2O99A 2XA7S 1TD5A 3ZCZA 1HD8A 1O7EA 2WAFA 4B9OA 2A49A 2JC7A 4WELA 3HL9A 1PZPA 3SH9A 1EWZA 4MNRA 3V50A 3UDIA 3HLEA 3HUNA 3T1XA 4X1MA 1IKIA 1JVJA 5L09A 4FH4A 5J3WA 4ZJ2A 4MDZA 2VGKA 1L0DA 1BT5A 4EESA 4GS9A 1MWRA 1MXOA 3CHWP 5AQBA 3WWXA 3IHBA 5FQMA 2XH9A 4WLAA 4R38A 2WGVA 2OLUA 5I94A 1OJGA 1IEMA 4M4XA 4Y2FA 4DKIA 3F1OB 3WS2A 2XLNA 4JF5A 1K56D 1SKOB 3RTYA 3SW1A 3UY6A 4FUWA 1XGIA 3VOLA 3KYZA 4OOLA 2VGJA 5GLAA 3OPRA 2Q9MA 2NUTC 3DTMA 3K3DA 1K55C 1OJ5A 5D3OA 3Q7VB 2XD1A 4PAUA 3IXDA 4KZ8A 5TJJA 3QP6A 4OQHA 2EFXA 5FI6A 4IJGA 1ZC2A 1IYOA 3V5MA 1NJ4A 3OCLA 4GZBA 4Q8IA 1YQSA 2ZQDA 1XFNA 5GHXA 1TS7A 3G32A 2JE5A 2VV6A 3BLMA 4S2OA 1DP6A 3T4SA 2D01A 3MKEA 4K08A 2WK0A 3I7JA 5CTNA 2ZLYA 5I5LA 1SDNA 4NXGA 1YSPA 3KO6A 2WKRA 3CJMA 2Z2MB 1MWUA 5HARA 2Y2IA 3PTEA 4FH2A 4XUXA 4L9FA 2PD8A 3CZDA 5DKLA 3Q81A 4O01A
chains in the Genus database with same CATH topology
3H9WA 3CLOA 4BWIA 4F3LA 5C5KA 1S1YA 2MJ6A 3T4TA 4UQIM 4ARZA 1OT6A 4KUOA 2W27A 3IBJA 3JVUA 4BBUA 1XJ2A 4FSFA 3MXQA 4EERA 3PBSA 3UB9A 5F69A 3MJQA 1OTEA 4EU0A 1NWZA 4GCZA 1F98A 4NKPA 3S7PA 5HPIA 2HGVA 4Y5FA 1GSWA 3B33A 3MQ0A 3LIAA 4HOIA 3LI8A 2KOIA 3PHYA 4R3AA 3T4KA 4EW7A 4LRXC 4GJ4A 1TS0A 4LRYC 1T1BA 2OOLA 4EXOA 5DF9A 5TBMB 3CAXA 3UMEA 4UQIS 4PKYG 3EEHA 3EOIA 3P01A 1UGUA 4WF0A 2PR6A 5HL6A 5MC7A 2VEAA 4ETXA 5IU1A 4YNRA 2HV1A 1N9LA 5L8MA 2W3DA 4F3LB 3LFVA 4HI4A 2M7UA 1ZHHB 2LB9A 4R6LA 5HWWA 2Z6DA 2A24A 1F9IA 3CUEA 4DJ3A 3D72A 4CLCB 1W63M 3C2WA 1H3QA 2OWHA 2QWSA 3P7NA 4WEJA 2B18A 1LL8A 1V9ZA 2KDKA 2V1AA 4I3AA 5HWVA 4P6ZS 3PBQA 2H28A 4CLCD 4KUKA 3KSFA 4O0PA 1Y28A 2JKRI 1GSXA 2YKFA 3F1PB 4EQ1A 1T1CA 5DKKA 4CLCE 2V1BA 3C38A 2NUPC 4G3WA 2K2NA 4I5SA 5AVEA 3LIDA 4BBTA 3FC7A 3UB7A 3BQAA 2I9VA 4YOFA 2XSSA 3BJNA 4Q0IA 4DN0A 3S7OA 3EEAA 3DBAA 1S4RA 3KSGA 2L1MA 4O8GA 2JHEA 3HJIA 3RH8B 2K31A 3T4QA 4PKYA 4II7A 2WKPA 2O9BA 4EUVA 2P04A 1LT0A 3BY9A 3S7QA 2Y79A 1LSVA 3MR0A 3CITA 3FPWA 1OTAA 3EWKA 3LR3A 4JGOA 3UE3A 3W2ZA 3RFBA 3ZYTA 4CQHA 4DMZA 3TE8A 1MC0A 1LSWA 2VV7A 5HWTA 4MCWA 4WL9A 3FPVA 2KLIA 3T4LA 4MMNA 5DJUA 2XROA 4G3VA 2WKQA 1P9RA 2JKTI 2VLGA 2KX6A 5HPFA 3S7NA 2OAQ1 1LSXA 2HF6A 3NOTC 2EWVA 4Y3IA 2V0UA 1BYWA 5F6AA 1IFQA 3NHQA 1D06A 1UWPX 4GLQA 3T4OA 5J7EA 4KQDA 5G4ZA 3A0SA 4XT2A 3TJZC 5F5YA 2BASA 3MF0A 4AFIA 3NOUC 4UEYA 3PBOA 2W0NA 2J3TD 4ARZB 3E4PA 3A0VA 4HP4A 3E4OA 2ZOIA 4G3KA 1NRJA 2ZMVA 3VE3A 1GSVA 2PD7A 5HSQA 3A0RA 4L9EA 2INWA 5CX7A 5K5BA 1H8MA 3JVVA 3IBRA 4HJ4A 4HP9A 4LPZA 3PBRA 3U2AA 4H6JA 3G6OA 3PR6A 3UB8A 3IS2B 3KSHA 3EGXC 4CLCA 2P08A 4QPRA 2GNXA 2EA9A 3UMDA 1ZTUA 1X0OA 4ZRRA 4KQOA 2GX5A 3E0YA 1XJ3A 3E4QA 3IS2A 4IUKA 1F5MA 4IHQA 5HDDA 5DFXA 2B02A 2PYRA 3BW6A 3H82B 2Z6CA 1NLYA 2K7SA 2V0WA 3LR5A 4NEED 1UWNX 5A8BA 1MKMA 2V9AA 3H82A 5IT5A 4PHTA 3K2NA 1MZUA 2L0WA 2PDRA 2QYBA 4ME4A 5AVFA 2VKSA 1IOUA 3LR4A 2VV8A 4FOFA 4B93A 3V67A 3B42A 4I39A 5G4YA 4LLOB 3R7WA 4HNBA 3CI6A 3NOPC 3T4JA 3T50A 2OAP1 3LYXA 2PT7A 2P7JA 2A2LA 4DJ2A 3BWLA 3PYPA 1DP8A 1JNUA 4YWZA 3ICYA 5HD3A 2CMNA 3OC2A 2YKHA 2A24B 3EQUA 2FH5A 3LI9A 2Y8HA 3D3OA 4WUJA 2LB5A 3GDIA 4L0LA 4HH2A 3MQQA 2JN7A 1OT9A 3H7WB 1YAXA 2JKRM 4EETB 3KX0X 1VHMA 3LICA 3KYQA 5IS1A 4NXEA 3C8CA 4MN7A 4E04A 2XA7M 1ODVA 3R4KA 4CLCC 2QJ7A 2O9CA 3CWFA 3FG8A 3NJAA 2J3WA 4P6ZM 5DJTA 1N9NA 3MMHA 4HQAA 3C30A 3OOVA 2D02A 3O5YA 3TW8A 1EW0A 1G6OA 3VE4A 3HCYA 4EEPA 4MN6A 3LIBA 1WA9A 5TBMA 1N9OA 4GS9B 4NXBA 5F68A 4I3JA 4Z1WA 2W3FA 5KIZA 1DP9A 4HHDA 1TF1A 2W1RA 1VB6A 5KSHA 4GW9A 2O99A 1S1ZA 4JGQA 4OOMA 2XA7S 3LIEA 2QJ5A 1TD5A 4HY8A 1T19A 5HD5A 1OTBA 4WEKA 1P97A 5EFWA 3B47A 2VX8A 2W3EA 4WELA 4B9OA 2ZBBA 4JGRA 2JKTM 2HJ9C 3HJKA 3E98A 3PBTA 5AJGA 1T18A 5LBRA 4HJ3A 4EEUA 4HJ6A 5J3WA 3EQVA 2OWJA 4MDZA 1OPXA 4JGPA 2W3GA 2HJEA 4MN5A 3OBFA 3LR0A 2VA0A 2EWWA 1TS6A 2VJWA 4EESA 4XT2B 4GS9A 2O9AA 3MQOA 2J80A 4I38A 3LIFA 2W1TA 4I3IA 1D7EA 4WLAA 4GHIA 4L9GA 4R38A 1STZA 1DRMA 1OJGA 3TRCA 2VGLS 2W1TB 4Q0HA 1XJ4A 3OCNA 2M1CA 2PR5A 4M4XA 4Y2FA 3BQ8A 3F1OB 2XRNA 2GZAA 3F1NB 4BBVA 3CUEC 2W3HA 1XJ6A 1S67L 1YKDA 5DFYA 2ZOHA 3SW1A 3RTYA 3VOLA 2PHYA 1T1AA 3F1NA 3KYZA 4OOLA 3UB6A 3R7WB 2R78A 2PYPA 3KSIA 3OLOA 2NUTC 1TS8A 3K3DA 1OJ5A 3H7WA 5HDSA 4PAUA 4IUHA 5TJJA 2IA2A 4HH3A 1XFQA 4IJGA 1P0ZA 3LUQA 4Q0JA 2L4RA 1S4SA 2GJ3A 3F1PA 2VGLM 3OCLA 4R70A 1KOUA 2QHKA 3ZQ5A 4BJPA 2ZMFA 1YSQA 2QKPA 1W63Q 1XFNA 3PXPA 5HZHA 2G7UA 4GHIB 1TS7A 3VV4A 2M7VA 1S66L 1V9YA 3K3CA 2VV6A 3BY8A 4NXFA 2J3TC 3ULFA 4ETZA 1DP6A 3T4SA 2D01A 4K08A 5HDCA 3UE6A 3PBNA 3F1OA 1OTIA 3GECA 5I5LA 4WN5A 1OTDA 4BMWA 4NXGA 4RQ9A 1YSPA 2FZ0A 3KO6A 4HIAA 2DMWA 2WKRA 3EGDC 2VZWA 4LRZE 2O0YA 3MFXA 1NLZA 5FL3A 5J4EA 4L9FA 1G28A 4H6JB 2PD8A 5DKLA 4O01A 1P9WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LSV A;  3MR0 A;  3H9W A;  4HJ6 A;  3CLO A;  4I39 A;  5J3W A;  5G4Y A;  2OWJ A;  4LLO B;  4JGP A;  4F3L A;  1S1Y A;  4HNB A;  1OTA A;  3EWK A;  4JGO A;  4MN5 A;  3NOP C;  1OT6 A;  4KUO A;  2W27 A;  3T50 A;  1TS6 A;  1XJ2 A;  3LYX A;  1LSW A;  2VV7 A;  5HWT A;  4BBU A;  4EES A;  4XT2 B;  3MXQ A;  2P7J A;  4GS9 A;  4WL9 A;  4DJ2 A;  3MQO A;  3BWL A;  4EER A;  2J80 A;  3PYP A;  3LIF A;  4I38 A;  3UB9 A;  5F69 A;  3MJQ A;  1DP8 A;  1OTE A;  1JNU A;  4I3I A;  1NWZ A;  1D7E A;  1F98 A;  4GCZ A;  4WLA A;  4GHI A;  4L9G A;  5DJU A;  4R38 A;  4YWZ A;  2WKQ A;  1DRM A;  1OJG A;  1GSW A;  3B33 A;  1XJ4 A;  3ICY A;  2M1C A;  3LIA A;  4HOI A;  2VLG A;  5HD3 A;  3LI8 A;  2PR5 A;  2CMN A;  4M4X A;  2KX6 A;  2YKH A;  2A24 B;  3LI9 A;  3PHY A;  3F1O B;  4R3A A;  4WUJ A;  3F1N B;  3GDI A;  4BBV A;  4EW7 A;  1XJ6 A;  4HH2 A;  4LRX C;  1S67 L;  1LSX A;  3NOT C;  3MQQ A;  2JN7 A;  2V0U A;  2ZOH A;  1BYW A;  1TS0 A;  4LRY C;  5F6A A;  1OT9 A;  1T1B A;  3H7W B;  3RTY A;  3SW1 A;  3NHQ A;  1D06 A;  1UWP X;  2OOL A;  3KX0 X;  4EET B;  4EXO A;  5J7E A;  3LIC A;  4KQD A;  5G4Z A;  2PHY A;  1T1A A;  3A0S A;  3F1N A;  4XT2 A;  5TBM B;  3CAX A;  3UB6 A;  3UME A;  5IS1 A;  4PKY G;  3EEH A;  4WF0 A;  5F5Y A;  1UGU A;  2BAS A;  2PR6 A;  4NXE A;  3C8C A;  2VEA A;  2R78 A;  3NOU C;  2PYP A;  3VOL A;  5IU1 A;  4E04 A;  3OLO A;  2W0N A;  1ODV A;  1TS8 A;  2HV1 A;  1N9L A;  2QJ7 A;  3CWF A;  3FG8 A;  3K3D A;  3NJA A;  1OJ5 A;  4F3L B;  3E4P A;  4HI4 A;  5HSQ A;  3A0V A;  1N9N A;  3H7W A;  5DJT A;  4HP4 A;  5HDS A;  3E4O A;  4HQA A;  4HH3 A;  2ZOI A;  4R6L A;  1XFQ A;  1P0Z A;  5HWW A;  2Z6D A;  3LUQ A;  2A24 A;  3VE3 A;  2L4R A;  1F9I A;  1GSV A;  1S4S A;  2D02 A;  4DJ3 A;  2GJ3 A;  2PD7 A;  3A0R A;  3D72 A;  3F1P A;  4R70 A;  1EW0 A;  3C2W A;  2OWH A;  4L9E A;  2INW A;  2QWS A;  1KOU A;  2QHK A;  3P7N A;  3VE4 A;  3ZQ5 A;  1LL8 A;  4EQ1 A;  4HJ4 A;  2QKP A;  3IBR A;  4EEP A;  1XFN A;  1V9Z A;  2KDK A;  2V1A A;  4HP9 A;  4I3A A;  4LPZ A;  4MN6 A;  5HZH A;  5HWV A;  3LIB A;  4GHI B;  1TS7 A;  1WA9 A;  2H28 A;  5TBM A;  1N9O A;  4GS9 B;  1S66 L;  1V9Y A;  4H6J A;  3K3C A;  4I3J A;  4KUK A;  1Y28 A;  4NXB A;  5F68 A;  3G6O A;  2VV6 A;  3BY8 A;  3UB8 A;  1GSX A;  4NXF A;  3ULF A;  5KIZ A;  3IS2 B;  1DP9 A;  4HHD A;  1DP6 A;  2YKF A;  3F1P B;  1VB6 A;  2D01 A;  4K08 A;  1T1C A;  2EA9 A;  5DKK A;  4GW9 A;  5HDC A;  3UE6 A;  3UMD A;  3F1O A;  1OTI A;  1X0O A;  2V1B A;  3GEC A;  5I5L A;  4I5S A;  4WN5 A;  5AVE A;  1OTD A;  1S1Z A;  4JGQ A;  3LID A;  1XJ3 A;  3E4Q A;  3IS2 A;  5HDD A;  3FC7 A;  3LIE A;  4BBT A;  4NXG A;  3UB7 A;  2QJ5 A;  4RQ9 A;  2I9V A;  4HIA A;  4HY8 A;  1T19 A;  2B02 A;  2PYR A;  5HD5 A;  1OTB A;  2WKR A;  3H82 B;  2Z6C A;  1P97 A;  5EFW A;  4B9O A;  1S4R A;  2L1M A;  4LRZ E;  2ZBB A;  2JHE A;  2K7S A;  2V0W A;  3HJI A;  3MFX A;  1UWN X;  4PKY A;  4JGR A;  2WKP A;  3RH8 B;  5A8B A;  3HJK A;  2V9A A;  3H82 A;  5J4E A;  4L9F A;  1G28 A;  4H6J B;  1T18 A;  1MZU A;  2L0W A;  2PDR A;  1LT0 A;  2PD8 A;  5AVF A;  4HJ3 A;  5DKL A;  3BY9 A;  2VV8 A;  4EEU A; 
#chains in the Genus database with same CATH topology
 3CLO A;  2Y4A A;  4CPK A;  2XFS A;  4LV1 A;  2MJ6 A;  1K56 A;  3QNB A;  1OT6 A;  3WS1 A;  4X25 A;  4ID4 A;  1XJ2 A;  4FSF A;  3QHY A;  4KZ7 A;  1HVB A;  4KZ9 A;  1NWZ A;  3G34 A;  4Z9Q A;  2HGV A;  4BD0 A;  4Y5F A;  1GSW A;  1XPB A;  3LI8 A;  1JTD A;  2WAE A;  1ONG A;  3T4K A;  4EW7 A;  4E3K A;  4R4S A;  2XQZ A;  2PAV P;  3CAX A;  1FCM A;  3P01 A;  4WF0 A;  3G31 A;  4ETX A;  2ZQA A;  4YNR A;  4X53 A;  5L8M A;  3VMA A;  2W3D A;  2E8I A;  2M7U A;  3PAG A;  2LB9 A;  4R6L A;  2Z6D A;  1F9I A;  4GDN A;  3CUE A;  2OWH A;  3P7N A;  3B3X A;  4WEJ A;  2B18 A;  2WGI A;  3Q7V A;  2WZX A;  1PI5 A;  2JKR I;  1GSX A;  3Q07 A;  2YKF A;  4R3J A;  1T1C A;  4CLC E;  2V1B A;  3QP8 A;  3E2K A;  1I2W A;  4Y0O A;  3ZVW A;  4JKT A;  2B95 A;  3BJN A;  2X01 A;  3S7O A;  2OLV A;  4PKY A;  4CJN A;  1BLS A;  1H8Z A;  3T1R A;  4EUV A;  5FAO A;  4IVI A;  1IEL A;  3S7Q A;  2Y79 A;  3ZFZ A;  3ZNY A;  3CIT A;  4KQQ A;  3HLF A;  5AQA A;  3LR3 A;  3W2Z A;  5A91 A;  5CER A;  4K91 A;  3IQA A;  3ZYT A;  4CQH A;  3HLB A;  3TE8 A;  2ZL1 B;  4MCW A;  4WL9 A;  1ZKJ A;  2WZZ A;  3BEC A;  3FPV A;  1IKG A;  3T4L A;  2ZL1 A;  5CHJ A;  4WBG A;  5FQQ A;  2WKQ A;  1P9R A;  4KG5 A;  3U4L P;  5F82 A;  5HPF A;  3S7N A;  2OAQ 1;  3UNW A;  1N9B A;  2HDQ A;  2EWV A;  2V0U A;  4HEF A;  4S2I A;  1UWP X;  1TDL A;  5F5Y A;  5CGS A;  4AFI A;  3PBO A;  4E6X A;  2W0N A;  1ZG4 A;  5GLB A;  4Y15 A;  2HP5 A;  2XGN A;  3HUO A;  3S22 A;  3C4P A;  2A3U A;  1GA0 A;  3GVB A;  1FCN A;  2ZOI A;  4G3K A;  3HLD A;  3MSH A;  1SDE A;  1ES3 A;  5HSQ A;  3A0R A;  4HJ4 A;  4OH0 A;  3PBR A;  5HX9 A;  1H5X A;  4PM7 A;  1CQA A;  1BLC A;  5JYO A;  5E2E A;  3PR6 A;  1BUL A;  1E3U D;  2GDN A;  4EUZ A;  1G5U A;  4YFM A;  3UN7 A;  3W4P A;  2P08 A;  1ZTU A;  4ZRR A;  4XXR A;  1BUE A;  1XJ3 A;  5HDD A;  4IHQ A;  4ZTK A;  5FDS A;  2E8J A;  4IVK A;  1UWN X;  1HTZ A;  1XGJ A;  3GQZ A;  1QME A;  5AVF A;  1MZU A;  1VET B;  4KZB A;  4GKU A;  2P9V B;  2VK3 A;  4HNB A;  5L10 A;  5EE8 A;  3IH9 A;  1NXY A;  1MWS A;  3ITA A;  2OAP 1;  4IBR A;  4KEN B;  3LYX A;  3FKW A;  2P7J A;  2A2L A;  1TDG A;  4DJ2 A;  3BWL A;  1PYY A;  1EI5 A;  1DP8 A;  2V8F A;  1BLP A;  3ICY A;  2YKH A;  4GB7 A;  3OPL A;  4WUJ A;  3D3O A;  4LCL A;  3A3F A;  3HUM A;  5E2F A;  2DRW A;  4N9K A;  1KE0 A;  4OPY A;  4EET B;  3KX0 X;  1VHM A;  3DW0 A;  3SS4 A;  4MN7 A;  5CEC A;  1YLT A;  2XA7 M;  1ODV A;  3CWF A;  3NJA A;  1LHY A;  2J3W A;  4P6Z M;  5DJT A;  1CEF A;  4MBK A;  4C6Y A;  2JKG A;  3OOV A;  2IWD A;  5EM1 A;  1Y54 A;  4QY6 A;  4EEP A;  5FEF A;  1WA9 A;  4GS9 B;  5F68 A;  1VEU A;  4K0X A;  2XK1 A;  3FZC A;  2W3F A;  4WM9 A;  2EFU A;  4GW9 A;  1VEU B;  1K0K A;  3VSK A;  5EM0 A;  1S1Z A;  4OOM A;  3LIE A;  1M40 A;  2QJ5 A;  3V39 A;  3G2Y A;  3N8R A;  1P97 A;  3B47 A;  5FAT A;  4JGR A;  1GA9 A;  2HJ9 C;  3E98 A;  2Y2P A;  3PBT A;  1T18 A;  2WUQ A;  1Y4O A;  1FQG A;  5LBR A;  5GLC A;  4HJ6 A;  4QY5 A;  4GD6 A;  3EQV A;  4PM9 A;  4EBP A;  2Q9N A;  2PU4 A;  2HJE A;  3ZG7 B;  3OBF A;  3UPP A;  2J7V A;  1LL5 A;  2EWW A;  1TS6 A;  2VJW A;  4XT2 B;  2O9A A;  3MQO A;  2J80 A;  3G30 A;  3LIF A;  1ERM A;  4RVA A;  3V3R A;  4I3I A;  1D7E A;  4GNU A;  3NDE A;  1NZU A;  2VGL S;  1XJ4 A;  3OCN A;  4R23 A;  1Q2P A;  2PR5 A;  3BQ8 A;  3F1N B;  1M6K A;  3CUE C;  2W3H A;  3FWL A;  3BEB A;  2ACG A;  3E2L A;  1T1A A;  3F1N A;  1FOF A;  3NDG A;  5FEG A;  2R78 A;  2H0Y A;  2PYP A;  4P6B A;  2Y2K A;  4IUH A;  1NRF A;  5FQJ A;  3IWI A;  2IA2 A;  5GHZ A;  2UV0 E;  3F1P A;  1KOU A;  2QHK A;  4LGW A;  1W63 Q;  3PXP A;  1U60 A;  2G7U A;  1S66 L;  1V9Y A;  1NZO A;  3OPH A;  4NXF A;  2J3T C;  3ULF A;  4BD1 A;  5EPH A;  3LY3 A;  2JBF A;  3PBN A;  1OTI A;  5EOE A;  2V2F F;  4WN5 A;  1SKO A;  1YLY A;  4OQ0 A;  4RQ9 A;  3VOZ A;  3EGD C;  4PPR A;  4H6J B;  3A3J A;  4PM8 A;  4ZJ1 A;  3LGO A;  3BFF A;  4UQI M;  5J8X A;  2W27 A;  3GV9 A;  2Y2J A;  1L0G A;  1W5D A;  5EVI B;  5F69 A;  3WS5 A;  3L7H A;  4DDS A;  1OTE A;  5EVE A;  3KYE A;  5HW3 A;  1W8Y A;  2V1Z A;  4HOI A;  4FD8 A;  3M2K A;  3IXB A;  2J9O A;  1SCW A;  1ESI A;  3NBL A;  2ZC6 B;  4LRY C;  4R3B A;  5FAS A;  2OOL A;  1K55 A;  4EXO A;  3NC8 A;  2RCX A;  3M2J A;  5DF9 A;  1UGU A;  2VEA A;  2IWB A;  4RA7 A;  1YLW A;  2B5R A;  4F3L B;  3W4Q A;  3IF5 A;  1ZHH B;  2V8C A;  2C5W B;  3JPU A;  1XA7 A;  2BLS A;  4KZ6 A;  5HWW A;  4IED A;  4DJ3 A;  3C2W A;  5L2F A;  5U47 A;  1V9Z A;  2KDK A;  5HWV A;  4OPZ A;  3PBQ A;  2H28 A;  3A3D A;  4O0P A;  1ACF A;  1WYC A;  2FFY A;  3MXR A;  3F1P B;  2WAD A;  4DE1 A;  4G3W A;  4I5S A;  5AVE A;  1N4O A;  3LID A;  3FC7 A;  4LFU A;  2I9V A;  3CPT B;  5FQI A;  5KZH A;  1PFL A;  3DBA A;  1S4R A;  3HJI A;  4N1X A;  4C3Q A;  4II7 A;  4LV0 A;  2P04 A;  4O7D A;  3MR0 A;  1KDS A;  3Q1F A;  3DWZ A;  3FPW A;  5GLD A;  4JGO A;  3T12 B;  3N8L A;  3ZNT A;  3G4P A;  3MKF A;  2ZD8 A;  1MKI A;  1MBL A;  4OPQ A;  1FCO A;  2JCH A;  2VV7 A;  3NIA A;  3BFD A;  4UA7 A;  3BFC A;  3C4O A;  3ZG9 B;  5DJU A;  2XRO A;  1E3U A;  4G3V A;  1CF0 A;  3O88 A;  2Y91 A;  4KZA A;  1JTG A;  4QD4 A;  5DTT A;  2HF6 A;  3QP1 A;  1KGE A;  1WYB A;  3NHQ A;  1KGF A;  5A92 A;  3A0S A;  3TJZ C;  2BAS A;  3NCK A;  5FAQ A;  1C3B A;  3MZF A;  3A0V A;  1W79 A;  3C7V A;  4NG2 A;  2PD7 A;  4HP9 A;  4B88 A;  3NUL A;  1GHI A;  1BTL A;  3G6O A;  1MPL A;  3HLW A;  3EGX C;  3KSH A;  3IXG A;  4YIN A;  5L07 A;  1D1J A;  3C7U A;  4JXG A;  4GOG A;  3E0Y A;  3E4Q A;  4E6W A;  3MFD A;  3QP5 A;  4IUK A;  1K4F A;  5DFX A;  3BYD A;  1FR1 A;  3QP2 A;  4S2N A;  2Y2M A;  5EVL A;  3H82 B;  3IH8 A;  1NLY A;  3N8S A;  1BLH A;  4KZ5 A;  1LI9 A;  2V9A A;  5CED A;  5IT5 A;  4BL3 A;  3BFG A;  3K2N A;  2VKS A;  2ZC3 B;  4LV2 A;  4FOF A;  4B93 A;  1VM1 A;  3V67 A;  5G4Y A;  1Z6F A;  2HP9 A;  1RGZ A;  3CI6 A;  4S2M A;  3T50 A;  2HZ5 A;  3MZD A;  3UO9 A;  3L9K A;  2XFT A;  3Q82 A;  1XA1 A;  1JNU A;  4YWZ A;  1YLJ A;  4DF6 A;  4EBN A;  3OC2 A;  2Y2N A;  5FI2 A;  4FTX A;  2ZM0 A;  2XF3 A;  3EQU A;  4L0L A;  2BG1 A;  3BRM A;  1RCJ A;  1YAX A;  3RJU A;  4Y0U A;  3C8C A;  4E3N A;  3FYZ A;  1ZG6 A;  3VP3 A;  2O9C A;  3MMH A;  3IWO A;  1PZO A;  5EOO A;  4OP8 A;  4HQA A;  4X69 A;  5F1G A;  4D2O A;  1VQQ A;  1HLU P;  4UHU A;  2D02 A;  3O5Y A;  1EW0 A;  3VE4 A;  1PWC A;  4ZBE A;  2IWC A;  5FI7 A;  4OVD A;  3LEQ A;  3LIB A;  5F83 A;  3ZG0 A;  1N9O A;  4NXB A;  3AGD A;  4PM6 A;  5EVI D;  4S2L A;  4Z1W A;  1O07 A;  3D4F A;  2EX9 A;  3G35 A;  1Q2Q A;  5KSH A;  5FQK A;  1H0M A;  1J9M A;  1GHM A;  4JGQ A;  2HDU A;  1ES4 A;  3OZH A;  3PAE A;  1OTB A;  4WEK A;  5EFW A;  3IF6 A;  2VX8 A;  2W3E A;  2ZBB A;  4BEN A;  3BFE A;  3HJK A;  5DTK A;  3LEZ A;  2Y2L A;  3SS3 A;  3NEC A;  2OWJ A;  4RX3 A;  2W3G A;  1E4D A;  4E3I A;  1CEG A;  4Y7P A;  1KVM A;  3ZVT A;  4JXW A;  4U0X A;  1FIL A;  1I2S A;  3UDF A;  1CI9 A;  1JWP A;  1STZ A;  1DRM A;  1KGG A;  1S6R A;  1PW1 A;  3VOY A;  1S67 L;  4JXV A;  1PWG A;  1YKD A;  4U0T A;  1K6R A;  3UB6 A;  3DTK A;  3KSI A;  4QWO A;  3JYI A;  5GHY A;  3FV7 A;  3H7W A;  5FAP A;  1XX2 A;  1P0Z A;  3LUQ A;  4Q0J A;  2R9X A;  2GJ3 A;  2VGL M;  4R70 A;  5E2G A;  4RYE A;  1YSQ A;  5HZH A;  2Y2G A;  4LEN A;  5HL1 A;  4GHI B;  3VV4 A;  2M7V A;  1A0K A;  1BZA A;  1E25 A;  2EX8 A;  2G2W A;  5HDC A;  5HAQ A;  3IF6 C;  3GEC A;  1OTD A;  1ONH A;  1FIK A;  4R1G A;  4Y17 A;  2FZ0 A;  4HIA A;  4LRZ E;  2O0Y A;  4OON A;  4C75 A;  4OLG A;  3GTC A;  5J4E A;  1AXB A;  4K0W A;  3GR2 A;  2AVX A;  1K25 A;  3H9W A;  4BWI A;  5HFO A;  4F3L A;  3ZG5 A;  4S2P A;  3T4T A;  4ARZ A;  3IBJ A;  3JVU A;  3LY4 A;  4BBU A;  1FSW A;  3MXQ A;  3WS0 A;  1H8Y A;  3FKV A;  3PBS A;  3UE0 A;  3UB9 A;  3P09 A;  3MJQ A;  4EU0 A;  2XR0 A;  2ZC4 B;  4R0Q A;  2WGW A;  4NKP A;  1XKZ A;  3TG9 A;  2XEP A;  2XD5 A;  1J3W A;  4RX2 A;  3B33 A;  3CG5 A;  3MQ0 A;  2P74 A;  3LIA A;  4EBL A;  3AGE A;  3VFF A;  2FFF B;  1Z09 A;  2KOI A;  3PHY A;  4R3A A;  4LRX C;  1MY8 A;  5KSC A;  4GJ4 A;  4WZ5 A;  1T1B A;  3UB5 P;  1PI4 A;  3ZGA B;  5TBM B;  4UQI S;  3EEH A;  4E3L A;  2PR6 A;  5MC7 A;  4ESP A;  4B4X A;  2HV1 A;  1N9L A;  4WZ4 A;  3BM6 A;  5M19 A;  3VP4 A;  3LFV A;  4HI4 A;  2A24 A;  1HZO A;  1DJB A;  4LCM A;  4CLC B;  1H3Q A;  1LL8 A;  2V1A A;  1NY0 A;  3M6B A;  4I3A A;  2ZM8 A;  4DE2 A;  3P98 A;  1I5Q A;  4S2K A;  2PRF A;  4CLC D;  3KSF A;  1Y28 A;  4DE3 A;  3WRZ A;  3IHA A;  3C5A A;  3VP0 A;  5CRF A;  5DVA A;  2V20 A;  2EX6 A;  2NUP C;  2K2N A;  4EQI A;  5DF7 A;  4BBT A;  4MLL A;  1VET A;  3BQA A;  1PRQ A;  1XP4 A;  4Q0I A;  4DN0 A;  3EEA A;  2L1M A;  4OQI A;  2P9V A;  4O8G A;  1K57 C;  2JHE A;  3RH8 B;  2WKP A;  2C6W B;  2O9B A;  3HBR A;  3N7W A;  1LT0 A;  3BY9 A;  5IHV A;  3SH7 A;  1OTA A;  3UE3 A;  3RFB A;  4WMC A;  1PWD A;  4GN2 A;  4DMZ A;  1ES2 A;  2Y2O A;  3OPP A;  4MMN A;  2Z2L B;  4XUZ A;  2JKT I;  1BSG A;  2VLG A;  5M18 A;  1LSX A;  3NOT C;  4Y3I A;  2WGW B;  5F6A A;  4M3K A;  1IFQ A;  3A3I A;  5J7E A;  4KQD A;  4XT2 A;  2DNS A;  5CEB A;  3UPO A;  4UEY A;  1KE4 A;  2EXB A;  2HP6 A;  1TVF A;  4ARZ B;  2Q0O A;  2ZQ7 A;  3VE3 A;  1GSV A;  5M1A A;  1L2S A;  5F1F A;  5CX7 A;  3JVV A;  5EUA A;  4LPZ A;  4UAA A;  3O87 A;  4QU3 A;  1TEM A;  4DE0 A;  2Y2H A;  3ZG8 B;  5HAI A;  3IS2 B;  4CLC A;  2GNX A;  2EA9 A;  3IWQ A;  1W7F A;  3IS2 A;  3ZHH A;  2ZJ9 A;  2PYR A;  4OQG A;  2Y55 A;  2Z6C A;  4OOY A;  5KMW A;  2K7S A;  2V0W A;  3LR5 A;  4NEE D;  5A8B A;  1MKM A;  4ME4 A;  2PDR A;  3A3E A;  2X02 A;  3B42 A;  4I39 A;  4U3T A;  3R7W A;  4X6T A;  2HDS A;  3T4J A;  2WKH A;  1DJA A;  5HAP A;  4E3M A;  1K57 A;  3DWK A;  1K38 A;  2WKE A;  4JXS A;  4F94 A;  5E43 A;  2CC1 A;  2A24 B;  2Y8H A;  2LB5 A;  3GDI A;  5JYP A;  4HH2 A;  3MQQ A;  4Y0T A;  2Y59 A;  3LIC A;  3MBZ A;  4HES A;  5IS1 A;  4E04 A;  3R4K A;  1LLB A;  3FG8 A;  4GD8 A;  4X55 A;  1N9N A;  2XDM A;  4WYY A;  2ZC5 B;  3C30 A;  2HPB A;  3D9Y A;  2QZ6 A;  2EX2 A;  1G6O A;  3HCY A;  4E3O A;  1GHP A;  1ERO A;  3T1S A;  1K54 A;  4I3J A;  3ZDJ A;  3VSL A;  5KIZ A;  5CXW A;  3SOI A;  5EVI A;  1TF1 A;  2W1R A;  2Y2Q A;  1VB6 A;  1K4E A;  5CHU A;  4IBX A;  3QP4 A;  4JF4 A;  5G18 A;  3SH8 A;  3LO7 A;  3RXW A;  3V3S A;  4HY8 A;  1T19 A;  5HD5 A;  1K6S A;  4HBU A;  3GRJ A;  2JKT M;  4FCF A;  1JWZ A;  4PM5 A;  5AJG A;  1YM1 A;  5CGW A;  4HJ3 A;  1ES5 A;  4OLD A;  4EEU A;  3TSG A;  4X56 A;  1YMX A;  1OPX A;  4JGP A;  4MN5 A;  1NYY A;  3NI9 A;  4ZJ3 A;  4EWF A;  3LR0 A;  2VA0 A;  2HDR A;  4LV3 A;  3UPN A;  4I38 A;  2W1T A;  3SZT A;  3VP2 A;  1NYM A;  4E3J A;  5EV0 A;  3M6H A;  4GHI A;  4L9G A;  5DF8 A;  3VP1 A;  3TRC A;  2W1T B;  4Q0H A;  1G68 A;  2M1C A;  4BL2 A;  4BBV A;  1PNE A;  2GZA A;  2WKI A;  2XRN A;  1XJ6 A;  2R9W A;  3MXS A;  5DFY A;  2ZOH A;  1OME A;  1GCE A;  1YT4 A;  2PHY A;  5CHM A;  2H10 A;  3R7W B;  3OLO A;  1W8Q A;  1TS8 A;  4KG2 A;  4MBF A;  5HDS A;  4UA9 A;  4HH3 A;  1XFQ A;  2L4R A;  1S4S A;  4KQR A;  1JWV A;  3ZQ5 A;  4BJP A;  2ZMF A;  2QKP A;  4OP5 A;  4EV4 A;  4DDY A;  3K3C A;  3CPT A;  2ZC7 A;  3BY8 A;  1L3L A;  4ETZ A;  4KG6 A;  2J8Y A;  3UE6 A;  3F1O A;  1K54 C;  4BMW A;  2DMW A;  3IXH A;  1PW8 A;  2VZW A;  1S0W A;  3MFX A;  2WYX A;  2OSU A;  1NLZ A;  5FL3 A;  5DTS A;  1G28 A;  1P9W A;  3ITB A;  3S1Y A;  5C5K A;  1S1Y A;  3W4O A;  1G6A A;  1PIO A;  4HBT A;  5FSR A;  4KUO A;  3DAV A;  4DXB A;  3DTI A;  1ALQ A;  4EER A;  4DRT A;  1AWI A;  1F98 A;  1YMS A;  4GCZ A;  3S7P A;  5HPI A;  5TGF A;  4QHC A;  4QB8 A;  4OPR A;  1LL9 A;  3O3V A;  3NY4 A;  3BLS A;  4JPM A;  2QPN A;  4WMC D;  1TS0 A;  3UME A;  4PKY G;  5HL6 A;  3EOI A;  5IU1 A;  3DTE A;  5FDH A;  3T1Q B;  3IX4 A;  1SKF A;  4N9L A;  2H5S A;  1XXM A;  3D72 A;  4ZDX A;  1W63 M;  2QWS A;  1L0F A;  3HVF A;  1DY6 A;  4P6Z S;  4MBH A;  1FSY A;  4BQM A;  4KUK A;  4EQ1 A;  5DKK A;  1IYS A;  3ISG A;  3C38 A;  1RP5 A;  1YLZ A;  1KDW A;  3UB7 A;  2PU2 A;  4YOF A;  1KVL A;  2XSS A;  5CGX A;  5A93 A;  1WE4 A;  3KSG A;  2EXA A;  2K31 A;  3MZE A;  3T4Q A;  4N92 A;  4NK3 A;  2OV5 A;  1IYQ A;  1F2K A;  1LSV A;  3EWK A;  3IT9 A;  4Y13 A;  3UDX A;  1MC0 A;  1LSW A;  5HWT A;  3IF6 B;  5A90 A;  3O86 A;  1DJC A;  5AQ9 A;  5TFQ A;  2KLI A;  1FR6 A;  1L0E A;  2UWX A;  2ZM2 A;  3AGF A;  3UE1 A;  4QJG A;  3LCE A;  3N4I A;  1ESU A;  3GMW A;  5FQ9 A;  2KX6 A;  4ZAM A;  4JBF A;  1BYW A;  1D06 A;  4GLQ A;  3T4O A;  1RGY A;  5G4Z A;  5TR7 A;  2I72 A;  1YPR A;  2PBY A;  3MF0 A;  3HLC A;  3NOU C;  2J3T D;  4S2N C;  3E4P A;  2ZQ9 A;  4HP4 A;  3E4O A;  1NRJ A;  2ZMV A;  4P87 A;  3S4X A;  4UA6 A;  4L9E A;  2PBD P;  2INW A;  5FA7 A;  4S2J A;  5K5B A;  1H8M A;  3IBR A;  3N6I A;  5CTM A;  4X1L A;  3U2A A;  4JLF A;  4H6J A;  3UB8 A;  2QMI A;  3WRT A;  4QPR A;  3UMD A;  4B4Z A;  3HLG A;  1X0O A;  3IX8 A;  4GDB A;  4KQO A;  2GX5 A;  1F5M A;  2B02 A;  3BW6 A;  4X68 A;  4A5R A;  4NET A;  4JF6 A;  3RXX A;  3H82 A;  4PHT A;  2L0W A;  2QYB A;  2X71 A;  2DCF A;  5E2H A;  1SHV A;  1IOU A;  3LR4 A;  2VV8 A;  3G2Z A;  4R4R A;  4LLO B;  4OKP A;  5GL9 A;  4DXC A;  2J9P A;  2ZMA A;  1CK3 A;  2JKF A;  1CI8 A;  2G2U A;  3NOP C;  5AQ7 A;  5BOH A;  4BLM A;  1YLP A;  3QNC A;  3HRE A;  2PT7 A;  2ZQ8 A;  3PYP A;  3Q7Z A;  1QMF A;  4N1H A;  4P0M A;  5HD3 A;  2CMN A;  4PMA A;  4P85 A;  2BTF P;  3LI9 A;  2FH5 A;  2JN7 A;  4WZ5 C;  2H0T A;  1OT9 A;  3H7W B;  2JKR M;  3IX3 A;  1CJF A;  3KYQ A;  3GSG A;  2RL3 A;  1MWT A;  4NXE A;  5EEC A;  3W8K A;  2ZQC A;  4KZ4 A;  2QJ7 A;  4CLC C;  1ERQ A;  3MS6 A;  1LI0 A;  1KE3 A;  4MEZ A;  1IYP A;  3TW8 A;  4KZ3 A;  3VFH A;  4MN6 A;  3WS4 A;  5TBM A;  3CMZ A;  1SZV A;  1DP9 A;  4HHD A;  5EVI C;  4D60 A;  3SS5 A;  3TOI A;  4H8R A;  2O99 A;  2XA7 S;  1TD5 A;  3ZCZ A;  1HD8 A;  1O7E A;  2WAF A;  4B9O A;  2A49 A;  2JC7 A;  4WEL A;  3HL9 A;  1PZP A;  3SH9 A;  1EWZ A;  4MNR A;  3V50 A;  3UDI A;  3HLE A;  3HUN A;  3T1X A;  4X1M A;  1IKI A;  1JVJ A;  5L09 A;  4FH4 A;  5J3W A;  4ZJ2 A;  4MDZ A;  2VGK A;  1L0D A;  1BT5 A;  4EES A;  4GS9 A;  1MWR A;  1MXO A;  3CHW P;  5AQB A;  3WWX A;  3IHB A;  5FQM A;  2XH9 A;  4WLA A;  4R38 A;  2WGV A;  2OLU A;  5I94 A;  1OJG A;  1IEM A;  4M4X A;  4Y2F A;  4DKI A;  3F1O B;  3WS2 A;  2XLN A;  4JF5 A;  1K56 D;  1SKO B;  3RTY A;  3SW1 A;  3UY6 A;  4FUW A;  1XGI A;  3VOL A;  3KYZ A;  4OOL A;  2VGJ A;  5GLA A;  3OPR A;  2Q9M A;  2NUT C;  3DTM A;  3K3D A;  1K55 C;  1OJ5 A;  5D3O A;  3Q7V B;  2XD1 A;  4PAU A;  3IXD A;  4KZ8 A;  5TJJ A;  3QP6 A;  4OQH A;  2EFX A;  5FI6 A;  4IJG A;  1ZC2 A;  1IYO A;  3V5M A;  1NJ4 A;  3OCL A;  4GZB A;  4Q8I A;  1YQS A;  2ZQD A;  1XFN A;  5GHX A;  1TS7 A;  3G32 A;  2JE5 A;  2VV6 A;  3BLM A;  4S2O A;  1DP6 A;  3T4S A;  2D01 A;  3MKE A;  4K08 A;  2WK0 A;  3I7J A;  5CTN A;  2ZLY A;  5I5L A;  1SDN A;  4NXG A;  1YSP A;  3KO6 A;  2WKR A;  3CJM A;  2Z2M B;  1MWU A;  5HAR A;  2Y2I A;  3PTE A;  4FH2 A;  4XUX A;  4L9F A;  2PD8 A;  3CZD A;  5DKL A;  3Q81 A;  4O01 A; 
#chains in the Genus database with same CATH homology
 3H9W A;  3CLO A;  4BWI A;  4F3L A;  5C5K A;  1S1Y A;  2MJ6 A;  3T4T A;  4UQI M;  4ARZ A;  1OT6 A;  4KUO A;  2W27 A;  3IBJ A;  3JVU A;  4BBU A;  1XJ2 A;  4FSF A;  3MXQ A;  4EER A;  3PBS A;  3UB9 A;  5F69 A;  3MJQ A;  1OTE A;  4EU0 A;  1NWZ A;  4GCZ A;  1F98 A;  4NKP A;  3S7P A;  5HPI A;  2HGV A;  4Y5F A;  1GSW A;  3B33 A;  3MQ0 A;  3LIA A;  4HOI A;  3LI8 A;  2KOI A;  3PHY A;  4R3A A;  3T4K A;  4EW7 A;  4LRX C;  4GJ4 A;  1TS0 A;  4LRY C;  1T1B A;  2OOL A;  4EXO A;  5DF9 A;  5TBM B;  3CAX A;  3UME A;  4UQI S;  4PKY G;  3EEH A;  3EOI A;  3P01 A;  1UGU A;  4WF0 A;  2PR6 A;  5HL6 A;  5MC7 A;  2VEA A;  4ETX A;  5IU1 A;  4YNR A;  2HV1 A;  1N9L A;  5L8M A;  2W3D A;  4F3L B;  3LFV A;  4HI4 A;  2M7U A;  1ZHH B;  2LB9 A;  4R6L A;  5HWW A;  2Z6D A;  2A24 A;  1F9I A;  3CUE A;  4DJ3 A;  3D72 A;  4CLC B;  1W63 M;  3C2W A;  1H3Q A;  2OWH A;  2QWS A;  3P7N A;  4WEJ A;  2B18 A;  1LL8 A;  1V9Z A;  2KDK A;  2V1A A;  4I3A A;  5HWV A;  4P6Z S;  3PBQ A;  2H28 A;  4CLC D;  4KUK A;  3KSF A;  4O0P A;  1Y28 A;  2JKR I;  1GSX A;  2YKF A;  3F1P B;  4EQ1 A;  1T1C A;  5DKK A;  4CLC E;  2V1B A;  3C38 A;  2NUP C;  4G3W A;  2K2N A;  4I5S A;  5AVE A;  3LID A;  4BBT A;  3FC7 A;  3UB7 A;  3BQA A;  2I9V A;  4YOF A;  2XSS A;  3BJN A;  4Q0I A;  4DN0 A;  3S7O A;  3EEA A;  3DBA A;  1S4R A;  3KSG A;  2L1M A;  4O8G A;  2JHE A;  3HJI A;  3RH8 B;  2K31 A;  3T4Q A;  4PKY A;  4II7 A;  2WKP A;  2O9B A;  4EUV A;  2P04 A;  1LT0 A;  3BY9 A;  3S7Q A;  2Y79 A;  1LSV A;  3MR0 A;  3CIT A;  3FPW A;  1OTA A;  3EWK A;  3LR3 A;  4JGO A;  3UE3 A;  3W2Z A;  3RFB A;  3ZYT A;  4CQH A;  4DMZ A;  3TE8 A;  1MC0 A;  1LSW A;  2VV7 A;  5HWT A;  4MCW A;  4WL9 A;  3FPV A;  2KLI A;  3T4L A;  4MMN A;  5DJU A;  2XRO A;  4G3V A;  2WKQ A;  1P9R A;  2JKT I;  2VLG A;  2KX6 A;  5HPF A;  3S7N A;  2OAQ 1;  1LSX A;  2HF6 A;  3NOT C;  2EWV A;  4Y3I A;  2V0U A;  1BYW A;  5F6A A;  1IFQ A;  3NHQ A;  1D06 A;  1UWP X;  4GLQ A;  3T4O A;  5J7E A;  4KQD A;  5G4Z A;  3A0S A;  4XT2 A;  3TJZ C;  5F5Y A;  2BAS A;  3MF0 A;  4AFI A;  3NOU C;  4UEY A;  3PBO A;  2W0N A;  2J3T D;  4ARZ B;  3E4P A;  3A0V A;  4HP4 A;  3E4O A;  2ZOI A;  4G3K A;  1NRJ A;  2ZMV A;  3VE3 A;  1GSV A;  2PD7 A;  5HSQ A;  3A0R A;  4L9E A;  2INW A;  5CX7 A;  5K5B A;  1H8M A;  3JVV A;  3IBR A;  4HJ4 A;  4HP9 A;  4LPZ A;  3PBR A;  3U2A A;  4H6J A;  3G6O A;  3PR6 A;  3UB8 A;  3IS2 B;  3KSH A;  3EGX C;  4CLC A;  2P08 A;  4QPR A;  2GNX A;  2EA9 A;  3UMD A;  1ZTU A;  1X0O A;  4ZRR A;  4KQO A;  2GX5 A;  3E0Y A;  1XJ3 A;  3E4Q A;  3IS2 A;  4IUK A;  1F5M A;  4IHQ A;  5HDD A;  5DFX A;  2B02 A;  2PYR A;  3BW6 A;  3H82 B;  2Z6C A;  1NLY A;  2K7S A;  2V0W A;  3LR5 A;  4NEE D;  1UWN X;  5A8B A;  1MKM A;  2V9A A;  3H82 A;  5IT5 A;  4PHT A;  3K2N A;  1MZU A;  2L0W A;  2PDR A;  2QYB A;  4ME4 A;  5AVF A;  2VKS A;  1IOU A;  3LR4 A;  2VV8 A;  4FOF A;  4B93 A;  3V67 A;  3B42 A;  4I39 A;  5G4Y A;  4LLO B;  3R7W A;  4HNB A;  3CI6 A;  3NOP C;  3T4J A;  3T50 A;  2OAP 1;  3LYX A;  2PT7 A;  2P7J A;  2A2L A;  4DJ2 A;  3BWL A;  3PYP A;  1DP8 A;  1JNU A;  4YWZ A;  3ICY A;  5HD3 A;  2CMN A;  3OC2 A;  2YKH A;  2A24 B;  3EQU A;  2FH5 A;  3LI9 A;  2Y8H A;  3D3O A;  4WUJ A;  2LB5 A;  3GDI A;  4L0L A;  4HH2 A;  3MQQ A;  2JN7 A;  1OT9 A;  3H7W B;  1YAX A;  2JKR M;  4EET B;  3KX0 X;  1VHM A;  3LIC A;  3KYQ A;  5IS1 A;  4NXE A;  3C8C A;  4MN7 A;  4E04 A;  2XA7 M;  1ODV A;  3R4K A;  4CLC C;  2QJ7 A;  2O9C A;  3CWF A;  3FG8 A;  3NJA A;  2J3W A;  4P6Z M;  5DJT A;  1N9N A;  3MMH A;  4HQA A;  3C30 A;  3OOV A;  2D02 A;  3O5Y A;  3TW8 A;  1EW0 A;  1G6O A;  3VE4 A;  3HCY A;  4EEP A;  4MN6 A;  3LIB A;  1WA9 A;  5TBM A;  1N9O A;  4GS9 B;  4NXB A;  5F68 A;  4I3J A;  4Z1W A;  2W3F A;  5KIZ A;  1DP9 A;  4HHD A;  1TF1 A;  2W1R A;  1VB6 A;  5KSH A;  4GW9 A;  2O99 A;  1S1Z A;  4JGQ A;  4OOM A;  2XA7 S;  3LIE A;  2QJ5 A;  1TD5 A;  4HY8 A;  1T19 A;  5HD5 A;  1OTB A;  4WEK A;  1P97 A;  5EFW A;  3B47 A;  2VX8 A;  2W3E A;  4WEL A;  4B9O A;  2ZBB A;  4JGR A;  2JKT M;  2HJ9 C;  3HJK A;  3E98 A;  3PBT A;  5AJG A;  1T18 A;  5LBR A;  4HJ3 A;  4EEU A;  4HJ6 A;  5J3W A;  3EQV A;  2OWJ A;  4MDZ A;  1OPX A;  4JGP A;  2W3G A;  2HJE A;  4MN5 A;  3OBF A;  3LR0 A;  2VA0 A;  2EWW A;  1TS6 A;  2VJW A;  4EES A;  4XT2 B;  4GS9 A;  2O9A A;  3MQO A;  2J80 A;  4I38 A;  3LIF A;  2W1T A;  4I3I A;  1D7E A;  4WLA A;  4GHI A;  4L9G A;  4R38 A;  1STZ A;  1DRM A;  1OJG A;  3TRC A;  2VGL S;  2W1T B;  4Q0H A;  1XJ4 A;  3OCN A;  2M1C A;  2PR5 A;  4M4X A;  4Y2F A;  3BQ8 A;  3F1O B;  2XRN A;  2GZA A;  3F1N B;  4BBV A;  3CUE C;  2W3H A;  1XJ6 A;  1S67 L;  1YKD A;  5DFY A;  2ZOH A;  3SW1 A;  3RTY A;  3VOL A;  2PHY A;  1T1A A;  3F1N A;  3KYZ A;  4OOL A;  3UB6 A;  3R7W B;  2R78 A;  2PYP A;  3KSI A;  3OLO A;  2NUT C;  1TS8 A;  3K3D A;  1OJ5 A;  3H7W A;  5HDS A;  4PAU A;  4IUH A;  5TJJ A;  2IA2 A;  4HH3 A;  1XFQ A;  4IJG A;  1P0Z A;  3LUQ A;  4Q0J A;  2L4R A;  1S4S A;  2GJ3 A;  3F1P A;  2VGL M;  3OCL A;  4R70 A;  1KOU A;  2QHK A;  3ZQ5 A;  4BJP A;  2ZMF A;  1YSQ A;  2QKP A;  1W63 Q;  1XFN A;  3PXP A;  5HZH A;  2G7U A;  4GHI B;  1TS7 A;  3VV4 A;  2M7V A;  1S66 L;  1V9Y A;  3K3C A;  2VV6 A;  3BY8 A;  4NXF A;  2J3T C;  3ULF A;  4ETZ A;  1DP6 A;  3T4S A;  2D01 A;  4K08 A;  5HDC A;  3UE6 A;  3PBN A;  3F1O A;  1OTI A;  3GEC A;  5I5L A;  4WN5 A;  1OTD A;  4BMW A;  4NXG A;  4RQ9 A;  1YSP A;  2FZ0 A;  3KO6 A;  4HIA A;  2DMW A;  2WKR A;  3EGD C;  2VZW A;  4LRZ E;  2O0Y A;  3MFX A;  1NLZ A;  5FL3 A;  5J4E A;  4L9F A;  1G28 A;  4H6J B;  2PD8 A;  5DKL A;  4O01 A;  1P9W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...