5HZHA

Crystal structure of photoinhibitable rac1 containing c450a mutant lov2 domain
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
325
structure length
320
Chain Sequence
AIKCVVVGDGAVGKTCLLISYTTNAFPYIPTVFDNYSANVMVDGSTTLERIEKNFVITDPRLPDNPIIFASDSFLQLTEYSREEILGRNARFLQGPETDRATVRKIRDAIDNQTEVTVQLINYTKSGKKFWNLFHLQPMRDQKGDVQYFIGVQLDGTEHVRDAAEREGVMLIKKTAENIDEAAKELGSGGKPVNLGLWDTAGLEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related C3 botulinum toxin substrate 1,NPH1-1,Ras-relate
publication title Engineering extrinsic disorder to control protein activity in living cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 97
structure length 320
sequence length 325
ec nomenclature
pdb deposition date 2016-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5hzhA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5hzhA01
2F1RA 1JI0A 2A30A 3RSOA 4KHZA 2NZ8A 1LVGA 3TW4A 4HYYA 1KY3A 4LJ6A 1IAQA 3PCRB 3PEYA 3ADDA 5K8TA 3EIEA 4MN6A 2WICA 3NWJA 4UXJA 2B8TA 3RNLA 2GZDA 1KZGB 1TQ4A 3CX8A 4F4JA 2CCGA 4PFSA 1P9RA 1R10A 2CE7A 2E1RA 1JR3D 1P61B 3GJ4A 3N2EA 1E2HA 3B33A 1UKZA 4Z8XA 3K53A 2BKUA 3QKRA 2AD5A 2W58A 4PQYA 1M1YE 4URVR 4US1R 2RGBA 3GFTA 4OK3A 1F2UB 4LHXA 4PHTA 2Q3MA 1R8SA 3U3MA 3BRWD 2C95A 1S96A 1EGAA 4AKHA 1L8QA 4IOKA 5JLJA 4CEHB 2J3EA 4PC7A 2HEIA 3GLGA 4V0ME 3I61A 2P6NA 2YKHA 2VP0A 2MSCB 3EPJA 1VYVA 1H8EA 1KTVA 5TBMA 3DPUA 2PX3A 4MYUA 2R8RA 1YR7A 4YMSA 2O8FB 3NDBB 1N6IA 2D2FA 3TGPA 3AVYA 1NSFA 3U44A 3IPXA 4HZUB 3MG9A 1DTSA 2QU8A 5DI3B 4GBMA 5AJZA 2FPLA 3TQFA 3MRSA 4R2IA 1X1RA 1E9DA 1ZD1A 4OK6A 4DEXA 1DP8A 2CL0X 4M8NE 1FX0B 3LI8A 3HPQA 2XJ4A 2PCLA 3KJIA 5FTMA 4E04A 2L1MA 1G3UA 3LBIA 4KV9A 2VYFA 2JLZA 3DM5A 3IKJA 4ACBA 4QBFA 3IDQA 1CJKC 2GEDA 4F4IA 4BFZA 1OT3A 4UXIA 2CHVA 1Z28A 1CKEA 3GJ7A 2AD1A 1DAIA 4MRVA 2GZAA 5EUMA 4A1FA 4YXWD 4OI2A 2VHTA 5JMTA 1XTIA 5KSYA 4KAXA 4WVFA 2H18A 3GFOA 4IDOA 4K8OA 3G82C 4A2PA 1RYHA 3FTQA 1CULC 1G16A 5DLQC 1TPZA 5JSZA 4IVQA 2IYTA 1E1RD 1ZYUA 1GSWA 1D2EA 5FL3A 3LBNA 2O8CA 4EETB 4G5RA 4DLTA 1D5CA 1BMFD 1KNXA 3KFXA 4QJ4A 4I3IA 4I99A 3H82B 3I92A 4L15A 5JEDA 2C96A 4H6JB 2C04A 3RAPR 3BD9A 2F1JA 5P21A 5G4YA 3SQXA 5EXTA 3LLMA 3KXIA 4A4DA 1EESA 3JZMA 3C5CA 4Q9LA 3F1PB 5HZHA 1SVSA 2A5GA 4AYWA 2JCSA 3EIQA 5HDDA 3PG5A 1PV4A 1WF3A 3A8TA 4MDEA 1D7EA 1SULA 3VU9A 2R6GA 2RAPA 4RQ9A 4YC7A 2FMXA 5IRCD 3I5YA 1CBUA 5C4MA 4KXFB 1N6KA 1TUIA 3BFXA 1GRQA 3O8BA 5HE9A 2RHDA 4KO8A 1OW3B 4QNMA 1W36D 3JVUA 2RGDA 3KKPA 4D80A 1NY5A 2XITA 2FFQA 4CYMA 3U7FB 1XPUA 2ZSAA 1IQPA 4EIWA 2BV3A 4M1SA 3PQCA 4Q7JB 2JAQA 4LYFA 3DO6A 3PUXA 5G3YA 1EFRA 3T5DA 4R38A 2IEZA 4A36A 3WYAA 4EEUA 1GP2A 3QKSB 3RS3A 4QKQA 4PHHA 2VP4A 2LKDA 1JXOA 1J99A 3ADKA 3K1JA 2JLXA 4D4KA 2ZM5A 3AQ4A 2YINC 3QVUA 4BFSA 4KUKA 2PH1A 1O3YA 2WSSA 4NDZA 3R8FA 3FC7A 1E99A 1G3IA 1NIPA 1XX6A 2D7CA 1UEJA 3C14C 5CYOA 5H70A 2IT1A 3UG7A 1IY1A 2VHQA 3UWOA 2O5VA 4US2R 2XTZA 2CNWD 4YWZA 3OEED 3CPEA 3MXQA 2PEYA 1BYUA 1JQJC 2XZLA 3RHFA 1A7JA 1Z83A 1MR3F 5G41A 1XMIA 2GCPA 4TYPA 4R71A 3U5ZB 4R9UC 2NMVA 1CU1A 1Q1QA 3MQQA 1DAKA 4LOAA 4ZKDA 2ZS9A 3FMPB 4JL8A 3LH5A 4TQ9A 1OXSC 4TSFD 4LJ9A 2Q0HA 3IUYA 1JB1A 4ZCMA 1N6PA 2CLDX 3MWJA 4MKFA 2O8BB 1I2DA 3RS7A 5ANRB 3ADCA 1QVRA 5DIFA 1P0ZA 3GPLA 1X8JA 1TQDA 4LJ4A 2QP4A 4RJLA 4AC9A 1Y28A 3B60A 4D0LB 4KFSA 2GXQA 2NOAA 1AJEA 3ZS9A 3HPRA 1MKYA 3GCGA 4FMCB 3K70B 2ZRDA 3IEUA 5JRJA 4PKYG 1Q21A 2C2HA 3AVQA 4BZXA 3CBQA 1MABA 2H92A 4B3XA 1NVUQ 2IWRA 3EPLA 2GCOB 4GCZA 2QA5A 1YZNA 1NJFA 4GP7A 4TMXA 2G0TA 4QM6A 5DH9A 2ZI3A 2H28A 1KOFA 1XB2A 4XT2A 1XD2B 1ZUNB 2GESA 2NG1A 5SZIA 3W3AA 2OM2A 4GPTA 1G6HA 3BC1A 1MOZA 1OYYA 3W90A 3K0SA 4QOSA 1N25A 4O0MA 4J0QA 1E94E 2ZRMA 4QBHA 3WNCA 4B3GA 1G19A 2XTNA 1XJ2A 5JEEA 4U7DA 2HT1A 2BCGY 5K8UA 2D01A 3QVVA 4QXAA 4ZPXA 3U60B 1BYWA 2ONJA 1R4AA 3PFIA 1T4GA 4GHIA 3EA0A 4ZI2A 3WMGA 4QBIA 1LB1B 4PPQA 3FB4A 1TU4A 1C9KA 1UBGA 1L4UA 2B6HA 4ON9A 5EZ6B 4Z1MD 2OBLA 2MMGA 3LX5A 2H1LA 2F55A 3BS4A 2WWIA 2NPFA 4QJ3A 4O3MA 2EWVA 3U7EB 5JZVA 4YDHB 3P1JA 3D8BA 1JQLB 3Q72A 2R6CA 3SYLA 1ZW6A 2K7SA 3I8SA 3SBEA 1YR9A 2I1VB 4FMDB 4IFBA 2GJ8A 4MRPA 1FQJA 2A3RA 4AKEA 3OIYA 4BLSA 2BMDA 2RGAA 3V00A 4A0HA 5J4VA 5SZKB 1AA9A 1CRPA 1RYFA 2W0MA 1WXQA 3DMDA 4BBVA 4Q1EA 3DKPA 1SXJA 2EVWX 2FSHA 2ZUBA 4EESA 3IS2A 3RTYA 3AVVA 3BWLA 2FN4A 4M2LA 1XD9A 4TQAA 5DN6A 3OE7D 2ZUDA 3HJNA 1XTQA 4W5HA 4NBSA 4AK9A 1S4SA 1WMSA 3A36A 1KMHB 4JBWA 1ZC4A 2O0KA 2EYQA 1AKYA 2M1CA 1E2NA 1Z6GA 4NMMA 2P0EA 1EWRA 3GMTA 4AKIA 1LTQA 3P26A 2Z6DA 2JATA 2JIZD 1YQTA 2NO0A 2OAP1 3HU2A 4FIDA 1SVIA 3RRZA 1CTQA 2GEVA 1KIMA 3BH6A 3T61A 3EA5A 3BAFA 1Z22A 2INWA 3CRW1 2IUTA 3CX6A 3EZ9A 3H4MA 4JLJA 1JR3A 4QM7A 1QHIA 3CRQA 5EP1A 1NLYA 1DAFA 1RFLA 1W0JD 2F43A 1G4UR 1E69A 4XJXA 4CEIA 1S8FA 4URZR 3L0SA 1U2RA 2EYUA 4HOIA 1N0WA 2ZYVX 3LD9A 1I4LD 3K9GA 4Y0VA 1TS8A 5DYIA 3UK6A 3K70D 3K9LA 4C3ZA 5ELXA 4M4SA 1D6JA 2ZPTX 1SXJC 1KI2A 3PEVA 2OXCA 4NYIQ 3UXMA 4D2IA 2BWJA 1KJWA 3AUXA 3O8DA 4G3XA 3FYHA 3SHFA 3X1XA 2C9CA 2R9VA 5FL7D 2HCBA 3U44B 2P7JA 1Z5ZA 5KIZA 1DBSA 1KY2A 2VF8A 4FXPA 4NTZA 3WBJA 2XXAB 1KO4A 3ZJYA 2VQSA 3LRPA 4TN1A 2F1HA 4NPHA 2ERYA 5EE9A 2ZRKA 4UJ5A 4HP4A 1BIFA 1T8UA 3GFPA 3LICA 4Q1CA 3T5GA 4C0QC 4MQBA 3U4QA 2Q9AA 3QEJA 4DBLC 4Q1BA 1SKQA 1YRBA 3SJZA 4JGOA 2J46A 3F3YA 3PUYA 2UVQA 5FOWA 3MFYA 1A2KC 2GBLA 4JJKA 1BOFA 3UMEA 2W27A 2V54A 3VNVA 1KO8A 5GJWC 1DADA 3VR2A 3NEYA 3WNBA 4QHSA 4JBYA 1XCPA 3ZQ6A 4DSUA 1CR0A 2BEJA 5EE0A 5CJPA 3U3JA 3E2IA 4KJZA 3UMDA 4G1UC 2JHEA 2ZR9A 3S1AB 3VAAA 5LDDC 4AURA 2B7CA 3U7GA 2ZU6A 1XMSA 3Q7PA 1IXZA 5JWHA 4I81A 1P7CA 4R7ZA 2O0JA 1VCOA 3Q9LA 4F38A 5F3WB 4M1WA 3SI7A 2AWNA 3U3OA 2JLVA 2PDRA 3CO5A 2ZRJA 2QMHA 3W3ZB 1VYTA 5GVSA 2RHMA 3L82B 1PUIA 2W00A 3DM9B 1TS0A 2L4RA 1NRJB 3LVQE 4KODA 2TMKA 5JWRA 3Q3JB 4KFTA 1AN0A 4C0BA 4H9GA 2QTVB 3PEUA 2B21A 3JZAA 3U7HB 4EPVA 4DKXA 3THWA 1E32A 1QZXA 1VYUA 4MA4A 1G28A 2EFDB 5GJBA 1W4BA 2ZS7A 3B1WA 5L3QA 3NJAA 1E9CA 2HJVA 3AF0A 3LXRA 3TIFA 4DCSA 1BO6A 4BEBA 1ZM4A 2I1QA 4CVNA 4U5XA 1KI8A 2RMKA 2YNMA 4FCWA 4LX0A 1WBBA 1KDPA 3QSYA 1U99A 4POAA 5KUTA 3EARA 2OEPA 4A2WA 3LI9A 2D02A 1COWD 1T8TA 1WE2A 3X1WA 3DZ8A 4BFUA 2OSBA 3IEVA 3LWNA 4LJ8A 4E22A 2J7KA 3OFND 5CM9C 1AS0A 2YKFA 3W6PA 1VHTA 2F3TA 3GEHA 4AYTA 1IN4A 2WWWA 1KI9A 4LK2A 5FFMA 3A1TA 2V1AA 4BFWA 2ZRIA 4N3NA 2OT3B 1Z3IX 4W5JA 2ZOIA 2QP3A 5FR2A 4NYIR 1RRFA 2AXNA 2OV2A 3GEIA 2VHUA 4MITA 4BQSA 3DZDA 2B02A 3W6OA 1Q3HA 1X86B 1WP9A 4ZIRB 3HR8A 1RRGA 4RKFA 3FDIA 4UNNA 3VR6A 1PLKA 2XSZD 3QG1A 1Z6TA 4DIEA 3LV8A 2QMOA 4RD1A 1EW0A 3MMPA 2HLDD 4NKRA 1ZJ6A 1HEIA 1E9FA 2RH5A 1S2MA 5CB6A 5EE1A 2BBWA 2FX3A 2OILA 3RC3A 1OYWA 5AVFA 5L3SA 5DJTA 1OTAA 3SJBA 4EPRA 1KKMA 4JL5A 1P72A 1W2GA 1Z2CA 4JYBA 4DT1B 1Q1BA 1XJ3A 1P9WA 3UMFA 4BBUA 1IM2A 4M9ZA 1IJEA 1WCV1 4ZKEA 3VFDA 4RFSB 1NI3A 3K8YA 1Z63A 1TQ2A 5LD2B 1HY3A 4JLAA 4B76A 2W6JA 3K3DA 5JHGB 1DAMA 2FE4A 3FFBA 4PO9A 5K8LA 1W36C 4RD3A 4TSFA 1DARA 5HCIA 4GZLA 5JS7A 1V9YA 3I62A 3L8ZA 2WWXA 1DAEA 1EX6A 1YRAA 4Q21A 3TMKA 2WWYA 4MUBA 5C46F 4I3AA 2Y8EA 2V9PA 1KNQA 5BWMA 2DB3A 1UBCA 2CJWB 3GLHE 3D72A 3K3CA 4DLUA 4IOJA 4Q48A 1XU4A 3BY8A 4EW7A 3TW8B 2V9AA 3ZIAA 4A6XA 1J7KA 4WOPA 1ANKA 2W6ID 3MJRA 1CJTC 1FQKA 4L9GA 1R0ZA 4QBGB 3UMSA 4DVGA 3EPKA 1T0JB 4NZYA 2XOKA 4RCYA 1OJLA 1XZQA 3B6EA 4CT5A 1MO4A 4DUGA 4F92B 4BZPA 2WWFA 3SR0A 1DOAA 4BBTA 3B82A 2BIFA 3NHQA 1G1MA 1RZ3A 1BKDR 4KSCA 2ORVA 3GJ6A 3ZYCA 3RS2A 1YVDA 3BORA 3TNFA 5EE5B 3THYB 3CWZA 3DVLA 1XPOA 3SJCA 3QXSA 1Q3TA 3FKSA 3C15C 1ESMA 1XMVA 3R9WA 1WDTA 4XSGA 2H17A 2YKGA 2XB4A 4EUNA 4PSKA 1KDRA 2Q6TA 4B3BA 1E6CA 2ZSFA 4MRRA 5F5YA 2ZITA 4DJTA 3CPHA 3IPYA 2FH5B 3KB1A 4HLUA 4PPFA 3QIAA 2J45A 3UIEA 1SVLA 1A82A 2IW3A 4M1YA 4NCKA 721PA 5AWFC 1ZUIA 4B71A 2HV8A 2XEXA 1KSJA 3T1VA 1T3SA 4DDWA 1N3BA 2V7QD 1NMZA 3I4LA 2QPTA 4PO1A 3RSLA 3LLUA 4F91B 1GL9B 4CEJB 4HNBA 1T9HA 4OI4A 5FOXA 1E0JA 3BB1A 4JLBA 2BDTA 2QAGA 5AUNB 4Q4HA 3TKLA 2GAAA 2QGZA 2KJQA 4IRUB 5FTLA 2OCBA 3TVTA 1FPMA 4LHZA 1FMJA 1XEWX 4GOJA 1P9NA 4ZDIA 2ZI4A 3V4RA 2WWGA 1EXMA 4DLWA 2ZRAA 2H57A 1GILA 3SOPA 2JIZA 3GLFE 1W4AA 2XAUA 3QF4B 4OQMA 2WMNB 2WJGA 4LWZA 3SFVA 1NLFA 2FGJA 3IHWA 2ZETA 2VSXA 2DY1A 1ZVQA 5C1BA 5BYJA 1NSTA 1EFTA 1T91A 2FZ4A 3B1XA 3THXA 1KI3A 2CK3D 4Q5IA 3NG1A 4BASA 2F9MA 4URUR 3HU3A 4HLUC 1JXMA 5JI3E 3AVUA 5FPKA 5KNCA 1I2MA 1VG0B 1B0UA 1YJ5A 5LBIA 1ZM7A 3QOFA 2WV9A 1DEKA 3EG5A 4OHZA 2W0NA 1E0KA 5FOUA 2OUKA 3BJIC 4NXBA 2GWHA 1MT0A 1FUKA 4UQOA 1G3MA 1GNPA 4V03A 2PCJA 1CJMA 5DHAA 2FWRA 4BRWA 4HH3A 3NHBA 2QAGC 1OH5A 1KGDA 1R7RA 1G7SA 1HTWA 2V55B 1N5IA 3VX4A 3GQBA 2YWGA 2ZJ8A 2X19A 3TH5A 1T18A 1ZM9A 1FZQA 1JJ7A 4S2EA 2IK8A 3GLGE 4PTLA 4JLKA 3QXCA 2EFHB 3B2EA 4KFUA 4LRWA 5E4FA 1NVVQ 4C0LA 1OTEA 3Q8XB 5L3RA 1CJUC 5TV2A 1KHTA 3CIOA 4C30A 2VL7A 3AEZA 5DSZA 1OH6A 1XWIA 3AVOA 3QXXA 1VCIA 4Q4JA 3GJ8A 3K0FA 5E3HA 2OWJA 3LW7A 1VPLA 3EEHA 1GTVA 2VIIA 4IKEA 4Q66C 5KU1A 5HD3A 2ZREA 3FHCB 5AR1A 5A4JA 4JGPA 1IY0A 4HATA 5SZJA 3CRVA 3EXAA 1NBMD 3E4OA 1T6NA 3K70C 1KSGA 2QENA 2FJUA 2QPAA 1L2TA 2A7QA 4C2TA 1E2LA 1HQYE 1J70A 1NIJA 1P73A 2FFHA 5HCNA 2HJGA 5FBQB 2Q9CA 3C5HA 4B73A 4EPWA 3RC8A 1YR6A 2ATXA 1T0HB 3SJAA 1SVOA 3AKDA 5HR5A 1Q22A 1CRQA 1OIWA 3PUWA 4FMCF 1G5TA 4O25A 2Z43A 4OBEA 3ICQB 5FUVA 2V0UA 2VV7A 1LW7A 4EJSA 1NKSA 2FFAA 3QNUA 5AUOB 5L3QB 2VSFA 3OAAD 3CZQA 3O8RA 2FPKA 1WA5A 2QWSA 4TTPA 1TEVA 1M6NA 1OFIA 5IT5A 3F5FA 2XNDA 1VCMA 2I4IA 2A24B 1COWA 3NBZC 2OOLA 5SZHB 1UGUA 4HP9A 1EFCA 2WJYA 4XD7A 1TF2A 1KAGA 1OF1A 3GJXC 5IK2A 1KSHA 4Q18A 4US0R 3TK1A 3QENA 4TLDA 4YMVA 4BFVA 3R20A 1FP6A 2IXEA 4LV6A 2JDID 4ESVA 2W2TA 2ZSDA 4KI0A 3SC3A 1E2GA 1RJ9A 5JFGA 2LCFA 4GT1A 1P97A 1N6OA 1D8TA 3MLEA 4UNQA 4HUQA 4HB4A 3G5UA 4M4XA 1T3HA 1PLLA 2ZJAA 3RWMB 3PUVA 1W0KD 5J4KA 1K5DA 2ZJBA 1EG7A 4MKGA 3HYRA 3QQ5A 4B33A 4BLQA 4BLTA 2DBYA 4B34A 1SHKA 4AKGA 3H7WA 4EPXA 2PL3A 1KI4A 5DI9A 3HJIA 1XCMA 4UXHA 2N46A 1YZTA 1Z2AA 1NVVR 1N0UA 2OHFA 1D9ZA 4JVMA 4GOKA 1HA3A 3KJEA 4OYHA 4JBXA 4LI0A 4EJSC 4ARZA 1E2IA 1E9AA 3QKTA 2YOHA 3TR5A 2IBMA 2GKSA 4IOLA 5J5CA 3WY9A 1W4CA 4D4MA 1G6OA 5EP4A 5KOYA 2FA9A 3IO3A 2Q3HA 2JJ2D 2OLKA 2QQEA 2PX0A 3AKEA 3GEEA 3KTAA 5HE8A 2ZRCA 4F93B 2OCAA 1A1VA 1QHNA 5HKKD 1KYIA 2ZSBA 1KAOA 2HYIC 1NY6A 1GSVA 1XJ6A 5FBVB 2A2ZA 2IYLD 1TADA 4URYR 2AX4A 5AJVB 2J9RA 521PA 3T15A 4IEIA 1E9RA 1GFIA 3PVSA 1II8B 4M22A 4Q4AB 3E4PA 1E79D 4NXEA 1U98A 2XNSA 4C9BA 2ZJOA 3NC0C 3IO5A 2NQ2C 1IHUA 2FOLA 2FSFA 4Q1FA 4TL7A 5BN4A 3MJQA 3F1NA 4LPZA 4MH0R 2PZFA 4RZUA 1S67L 2G0NA 2PBRA 4IDHA 1XRJA 4OHXA 4A0FA 4DZZA 2F9LA 2VBCA 1V43A 1R8QA 2R65A 3ZZ0A 5HD5A 4Y0AA 1R2QA 2WZQA 2ZJYA 1FW6A 5HDSA 1AGRA 1M74A 5D3QA 1VTKA 4I5SA 1ZIOA 4HDCA 1U0LA 1UDXA 1E3MA 2C5LA 3R8CA 3KJHA 2J0UB 4PPNA 2AKYA 3UB7A 3CR8A 2QBYA 3HJKA 3UANA 4NCJA 4B74A 1G291 5FUYA 3RRMA 1M7HA 2AHOA 1Q20A 3IQWA 5FTKA 2GCNA 4KUOA 1SVWA 2O8EB 1E9BA 4ASUA 3LIDA 2WKQA 2VH5R 2ZRLA 1H8HD 1E1QD 4GRAA 2ODNA 2A5YB 1YZKA 1X8KA 1B23P 3NBXX 2C99A 3VX3A 1AIPA 3AH8A 2ZVPX 4KSBA 4C2UA 3MWYW 3PXGA 2PHYA 3LUQA 1ZD8A 3PYPA 3MD0A 1RKBA 2XTMA 3P4YA 4XWAA 5GJVC 3RRYA 3QJYA 1JAIA 2AKAB 4GS9A 1SVKA 2DFKB 4JIMA 4DCNA 3EAQA 4RSGA 4EFNA 4LLOB 4OJQA 4L9WA 1KK1A 3THOA 1XJQA 8OHMA 3QUSA 2X2FA 4B35A 4KFRA 3CNOA 4JSYA 1AZSC 5FPYA 1QHHA 3E70C 3A58B 1GUAA 1KK0A 1P3JA 1LFDB 1OFUX 2J87A 5DKKA 4GOXA 1E2QA 3GLHB 4P3YA 1AS2A 4KVGA 4MYHA 3F8TA 2E87A 1Z6YA 2KWIA 4DSTA 2FG5A 4HLQB 1U0HC 3E1SA 3K0AA 3NXSA 4XH9B 4XSHA 1OXVA 1A2BA 5KDOA 1XXHB 2BBSA 3LO5A 1SXJE 4DXAA 2IXGA 4A8JA 2ODWA 4R2HA 3KX0X 3LIBA 4TT3A 3WRYC 2FV8A 3AM1A 4Q00A 4D81A 3VR3A 4LBWA 3M1IA 1UKVY 2NO1A 3ADBA 3BERA 1Y3AA 2Q3FA 4EPTA 5BN5A 4D0NA 2XJ9A 3OLOA 3NOUC 3C41J 4KBGA 4URWR 1XNJA 2OFWA 1GZSA 5CK4A 1VIAA 1G20E 2RKOA 4DSOA 1KK2A 4ZCLA 3AVWA 5D3MA 4PHFA 3BXZA 4RCZA 4IDPA 5EQTA 2O8DA 1PJRA 1N6NA 5CM8B 2JJ1A 1SGWA 2P67A 3RVBA 1N5KA 2GK7A 4LJ5A 1E9SA 3IIJA 1JR3E 5KSZA 2XGJA 3FGNA 4C4PA 1G5RA 4LBZA 1G8PA 1G7TA 4C0AC 3B5JA 1HE8B 2AL7A 2IEYA 1XF9A 2V4ZA 4TMTA 4BRUA 2PD7A 4D4LA 1FNNA 3AUYA 3CLVA 2BKEA 2QJ5A 1XTSA 2OCPA 2VHCA 1OHHA 2G3YA 3EIHA 1OJ5A 5G40A 5L8VA 1E9EA 2IYRA 3RS4A 3UG6A 3W8NA 3WRXC 3IIKA 4EFLA 3JVVA 1NMXA 3LA6A 4G5SA 4V0OA 3EZFA 2HT6A 3TE6A 4E5UA 2X1VA 2L0WA 3CZPA 3FKQA 3LXXA 1OFTA 3TAUA 2V1BA 4Q9KA 2ZIAA 3V9PA 4A8JC 1E2DA 2GVZC 5C2JB 4R3AA 4XVRA 3L0IB 1BYIA 4NE2A 3GECA 5CLLA 5LD2C 2XZPA 1F2TA 4KYUA 3QI2A 2R6AA 2DWQA 1KI6B 1ODFA 1Z06A 2P5SA 4Q4JB 4RFVA 1JEDA 1G5PA 1XEXA 4JLOA 1R0WA 2RGGA 3CKLA 2GXSA 3GLFB 4HJ3A 1KJZA 2A9KA 2IYZA 2BEKA 1ZC3A 2IXFA 2VA8A 1J90A 3BFKA 3GJ0A 3A4NA 3I72A 1FMLA 4FW9A 3ASYA 4OL0A 4DDUA 3T1TA 3PHYA 3HDTA 2WAXA 3EZ6A 4URXR 3CWFA 4LZZA 1VCNA 3OEHD 1RW4A 2OWHA 3P4XA 4DLSA 2PR5A 1MO5A 1NJGA 3CRMA 2QORA 4GMDA 5TVKA 2PJRA 2BMFA 1Q0UA 2IUSA 4JT4A 2IYQA 2NGRA 4DLXA 2KBFA 1W44A 5EFWA 3H86A 3UKDA 2ZTSA 3H0KA 1GL7A 1II9A 2D62A 2FNAA 4TYYA 3KL4A 3UWKA 4IDNA 3ONWA 5JS8A 1IXRC 1Z0KA 2EU8A 5IS1A 4ZV4A 3ZLJA 3A4LA 3QKRB 4LHYA 4L9SA 4TLBA 5IDVA 3TRFA 1J2JA 3AKCA 3I8XA 4LJAA 1Z0AA 4JGQA 1LF5A 1OV4A 2CXXA 3EW9A 4HAXA 1AKEA 4P4TA 3C8CA 4NXGA 5EP2A 2QT0A 1XJ4A 4Q7LA 4S35A 3GLGB 5EP3A 2JLUA 4IJMA 1TMKA 5KTYA 1QHSA 3D31A 3LVRE 5FTNA 2LKCA 4ITRC 5TBMB 2A5DA 4KITB 1S3SA 4MKHA 1Z8FA 3CH5A 3T1OA 2WKRA 5K8IA 2REOA 2ANBA 4AY2A 3A1SA 1JPNA 2OG2A 4PZYA 1E0AA 4F3LA 2CHQA 2JDIA 1OKKD 2RGNC 3RLFA 4CRWB 1RJ9B 5KNDA 1UAAA 1T1BA 3W8RA 3SZRA 1CS4C 4X8OA 1F6BA 2FDCA 3OZXA 3GLIE 4ZO4A 4KVAA 5J3WA 1G21E 4MGZR 4WXRA 5F69A 5FPHA 3U3KA 4C7OA 2ZE5A 3P20A 1QHYA 3EWKA 4P4SA 2AK2A 2ATVA 3B8HA 1N5LA 4LJ7A 1PLJA 4JLMA 3N2IA 1MV5A 3R7WA 1CR4A 3FOZA 3CNLA 1DP6A 4K08A 3ZVNA 5F68A 2IF0A 2VV8A 1KZ7B 2AK3A 5CIWA 1IJFA 4YMUA 3M6AA 4YXWA 5JJIA 4XWKA 4JGRA 3PITA 1KO1A 3W9YA 1L7VC 3ASZA 2Z4RA 3UATA 4IEEA 1UWPX 4B6EA 3VHXA 3R9XA 2RGEA 2BC9A 5JSZB 3B1YA 1OB2A 3OF5A 3L8YA 2UZIR 4EQ6A 4OKSA 4MN5A 1E1RA 4YQFA 1E2FA 2VP5A 2O8CB 5I5LA 1BH2A 1BMFA 1EK0A 3BGWA 2WJVA 3N70A 4HI4A 2AR7A 3I1FA 3FHTA 1M2OB 2W2VA 2V1XA 4RVCA 4L16A 1N2CE 3IBRA 4TZ0A 1E0SA 2W83A 3VQTA 1TAGA 1QVAA 1ZNZA 2ZI7A 2BJVA 1E2KA 3SHWA 2DFTA 3EZ2A 1VIYA 1GVNB 5BXQC 4TLEA 1YZLA 2P6RA 3VU9B 2ZR0A 3PIRA 2ZOHA 3SW1A 3EX7C 2F1IA 1DS6A 4TMWA 1G17A 2OXRA 4HDOB 1KSFX 1UM8A 2Z5FA 4R6LA 1ZINA 3BBPA 1F3OA 4QL3A 2WPDD 3GLIA 1UKEA 4LJYA 5GVRA 4HB3A 5F2EA 1W1WA 1XFNA 2PEZA 4TL8A 1C4OA 2G83A 4NCHA 3ZVLA 2JGNA 5DO9A 4NONA 4DCVA 1F2UA 2MMCA 4HAVA 3A4MA 4TMZA 5B58C 4GMXA 4Q02A 2JJ8A 1S4QA 1NN3A 2EQBA 2PT5A 5C4GB 1Z0IA 2PLFA 5BN3A 4WZAE 1G7RA 4OQLA 4CEHA 4XTRA 2HDNB 3N5CA 2VP2A 3PV0A 4PAOA 1I4DD 1ZM3A 1H8HA 5LPNA 1H8ED 2KI5A 2ODEA 1FL9A 4QNRA 3FHOA 4U00A 2RGXA 2GA8A 3B13B 2O8FA 1TS7A 3UB6A 3IBGA 5HSQA 4HZUA 3EC1A 4JLNA 2QY9A 1GKYA 1NMYA 2QE7D 5DI3A 1MRNA 1N0VC 3KXLA 2QZ4A 5F6AA 1T3LA 1ZD9A 2CNWA 2ZJZA 3BH0A 3OEEA 3WYGA 2QTHA 5CK5A 1TUEA 4V0NA 2H16A 1Y63A 1J8YF 2J59A 1NG1A 2J0VA 1UEIA 1ZU5A 3DOFA 5G53C 4TL6A 3VE3A 2V6IA 2ZEJA 4DC9A 5JJKA 1C1YA 1QHHB 4DJ2A 3NKVA 4Q7KA 2H7VA 4A9AA 4IVPA 1PUJA 5FH9A 1Z0JA 2NPIA 1IN5A 4Z54A 3NTUA 3FPAA 4CF7A 3C2WA 1QRAA 2JEOA 2FPMA 4BFXA 4LV8B 4IXNA 1QG4A 3F1OA 2OAQ1 4PPGA 3SBDA 4FWTA 2PR6A 1GNQA 3UE6A 1YZQA 3OIWA 4W9MC 1GDDA 2CLSA 1OH8A 3Q7QA 4DJ3A 4I3JA 3E5HA 5CLQA 3QF7A 1MRSA 1OT6A 4MYCA 4QRHA 1OFHA 1FP7A 3NHAA 3MR0A 4ZDJA 1X6VA 4IDQA 3W5JA 4ERNA 1MABB 5FBRB 4Q03A 3KQUA 4HI0E 3H82A 2C9YA 4IXMA 4LHWA 1P5ZB 1SKYE 2DCUA 4N0EA 4H6JA 4YDSA 5HPYB 1OTBA 5G4ZA 4NH0A 4M1MA 2J5XA 1ZUHA 3KXKA 1F60A 4QFMA 4XT2B 4LHVA 4UKDA 1DO2A 1EX7A 4I1UA 1D2MA 2EWWA 4ESHA 3F1PA 4PC2A 4CDGA 2WBLC 4B47A 3QKUA 3T12A 2QHKA 1CLUA 1EFHA 2UZ3A 4JL6A 4YONB 1D2NA 1OTIA 4B9OA 1UFQA 1G3QA 2YOFA 2VEDA 4RD6A 1AM4D 2V0WA 1WQ1R 2ASEA 2ZE6A 2QTFA 4JKYA 5DISB 5LB4A 3VTKA 2IL1A 4PR0A 2FEMA 4W7SA 2OBNA 2ZI6A 4BLOA 5JJLA 4OQFA 4GHIB 4QJ5A 1OB5A 1YZGA 3QEOA 5CB8A 3D7MA 3K9NA 4BLPA 4HJ6A 2HCJB 4NCIA 4KCGA 4Z1MA 5IHPA 3R9IA 2BHRA 2QSZA 2KX6A 2FSIA 2GDJA 121PA 2ZYUX 4NHOA 3WHLA 3BB4A 1DP9A 2IHBA 5EXXA 5KHOC 1TQ6A 2VLGA 3LIEA 1M8PA 3NOTC 1E4VA 1EFRD 2CDNA 2IS2A 1UDWA 3KKOA 3AF4A 4UNPA 4DIDA 2YJTD 3P32A 3QKSA 1W2HA 2REXB 4HAWA 1QF9A 1HYQA 3RS0A 3H9WA 5HWVA 2AFHE 1HH4A 2ZRGA 4LYJA 4RD4A 4HIAA 1LSXA 4BFYA 1D06A 1IY2A 3QPWA 1SXJB 1S1CA 4L5BA 2QGNA 2QMEA 3IS2B 1ESNA 2WSSD 2P2LA 4RY2A 1TNDA 3UPUA 1XD8A 3CNNA 3O47A 4H1VA 1SZPA 3OE7A 4D6PA 2WVJA 2ZI5A 3NH6A 1Z07A 1UBEA 3GJ3A 2J41A 3NBFA 1IN6A 4M9QA 2ORWA 3CLOA 3ECCA 1N9OA 3EWSA 3GD7A 4AYXA 2QM7A 1N6LA 4TMKA 2C77A 4HAYA 1Z0DA 5DYGA 2OFXA 2VTKA 3LQQA 4CIDA 4JVSB 3VKGA 2CLCX 4Q9HA 1W47A 4WW0A 5J7EA 3KJGA 1E4YA 4HLCA 3PJRA 4LUCA 3CH4B 2BBTA 2QT1A 5FOSA 2GRJA 1JNUA 1HUQA 1W0JA 2F43B 1UADA 1XEFA 3TSZA 4CEIB 5JHHB 1YZUA 2QP9X 1S1MA 1QHGA 3U2QA 4C0HA 2GF0A 2Z0MA 1K8RA 2V6JA 3CONA 4DWJA 1TTTA 3TSWA 3KKNA 4DDVA 3KX2A 1CJVC 421PA 2F7SA 3IGFA 4C0KA 4M21A 1UBFA 2R78A 1XZPA 4PX9A 4JLDA 4DCTA 5EXPA 1FNMA 1F9IA 3DOEA 2JASA 2YWEA 3P27A 4L8GA 5BYKA 3T50A 3GJ5A 3A37A 3B1ZA 4LGMA 4ZDWA 4OHYA 1P2SA 4JYCA 4JKIA 1RPZA 3RRNA 3VKWA 1Q44A 4B48A 2GCOA 1F48A 2J0QA 2PT7A 5FL7A 2ZI9A 1V9ZA 4WAUA 1P2UA 2W0SA 1OKKA 1NKTA 4LBYA 2J0SA 1ZCBA 4LRZE 1UPTA 1F98A 4M1KA 1E98A 3SFZA 2DFNA 3TUIC 3U4QB 3FWYA 1XTRA 3CX7A 3L43A 3MWKA 4A0GA 4Q19A 2FU5C 2D06A 3MJHA 2PMKA 4IVRA 1JJVA 4G0NA 4IOMA 3A1WA 5JI2E 3G6OA 4NL4H 2GAOA 2GJ9A 4LDJA 2QRZA 4N1AA 3BY9A 4FCVA 2GNOA 3IHLA 4B2LA 1G8FA 5HTKA 1FTNA 2SHKA 1OT9A 2OE2A 3X1DA 4B32A 4PHGA 2V1UA 2HUPA 2CCJA 2ZANA 2GJSA 3DEFA 3Q5EA 3FE2A 4PXAA 2V8OA 1R5BA 4MDFA 1AS3A 1CXZA 3L0OA 2X8AA 2LWIA 4HY8A 4HHDA 5JECA 3B7GA 4LYHA 1RIFA 4GNKA 5DNYB 3ICEA 5F98A 3NIBA 1SXJD 3H1TA 4P0TA 3THWB 1GRRA 1OXTA 2KE5A 4Z8YA 3KQLA 1Q12A 3F0TA 5KPDA 2ZXUA 3RYTC 3U6BA 4MGYR 5DN6D 5FOTA 3MAAC 1W7AA 4FI3C 1Z6AA 4FN5A 2YC2C 1KMHA 2ZUCA 4GW9A 4QGFA 1NN1A 4PZLA 1XFQA 5F9HA 4WL9A 1JBKA 4EEPA 3WYFA 1HQCA 4GFDA 2CHGA 4EQ1A 2XB2A 4JMPA 4V0LA 2B8WA 2D4HA 1OIXA 4K46A 4NP6A 5FUXA 3BOSA 1VHLA 4DCUA 3GLIB 3OFNA 2WPDA 4B2IA 3KQKA 4D26A 4D0GA 4NYJQ 4O2LA 5CJ2A 1W36B 3ZS8A 4PO8A 5JCPA 2H5EA 5FOVA 1GSIA 2P65A 4WXPA 4A0RA 2ZYWX 2J7PD 1ELOA 1LNZA 4LBVA 4BLRA 4HDQB 1SVMA 2XSZA 1M7GA 2BOVA 2OLJA 2IC5A 2N1BA 3KB2A 4AWXA 3ZD7A 1R5OA 2HLDA 1KO5A 1W49A 1X3SA 1YKSA 4FMDF 5H1YA 4OQNA 5A8BA 3NEJA 4NXFA 2BBOA 1DPFA 1TEXA 3KUDA 2Q21A 3LQRA 2HV1A 5L3SB 4CGZA 2PYRA 2XXAA 1AK2A 3TQCA 2RCNA 4MUAA 4WA7A 4ZCIA 1TL7C 2QE7A 3CF0A 1WRBA 4RZXA 1GKIA 5HWWA 1NN0A 2W2XA 3QXJA 5DE3A 5LB2A 2PLRA 3KUCA 1US8A 3GDIA 3AF3A 3CF6R 2I3BA 5KPJA 1QBKC 4G5QA 4M9XA 1RC8A 3I5XA 2JLYA 3SYKA 4AD8A 4DRZA 2YYZA 3REFA 4K81B 1GWNA 4AIIA 3AV0B 4JSTA 3CR7A 2C98A 2YVUA 2N42A 2NZJA 2VO1A 3LNCA 1G8YA 3UB8A 1ZNXA 2YV5A 1JNYA 2IYSA 1CIPA 1G4AE 1GSXA 2V3CC 3SQWA 1CR2A 3TR0A 3B85A 1T5LA 5M04A 4G5OA 3S1AA 2ZRBA 2WJHA 5AJYA 4PZZA 4LPSA 3U3RA 1G64A 1TX4B 3F1OB 5IU1A 4HQAA 4WUJA 2HF9A 3T1QA 2BJWA 3TUZC 2B92A 3SE0A 4YMWA 4A92A 5AJXA 4M53A 5TY0A 4M1TA 4DB4A 2WSMA 4Q9JA 2Z6VA 1S1YA 3SDZA 2MSDB 1Q57A 4LY6A 3AGQA 2DFLA 4BUJA 3FMOB 2VLIA 4QG7A 1V5WA 2PD8A 4JVNA 4V02A 5A0FA 2W6IA 3IIMA 1LT0A 3KDSE 2DR3A 4BECA 2GEUA 5JCZA 4V0MA 2QL6A 3DL0A 1R5NA 1G41A 4E09A 3PENA 5AUPB 1S0UA 3DMNA 1VKJA 2XX3A 2OZEA 2IF2A 3LW8A 1KI1A 1NVXQ 3VHLB 2D7DA 1W46A 4PQRA 4NYJR 2BMJA 1PVOA 4F7WA 2H8KA 1ZNWA 3FG8A 1ZP6A 1TU3A 1YR8A 1JR6A 1K6MA 2VF7A 3NVAA 1T5IA 3ZQ5A 2C8VA 5J47A 5H8WA 4JZKA 2CEAA 1BS1A 3LBHA 4OHWA 4BPBA 2YHSA 1ZAKA 2HXYA 2J1LA 2REBA 3BWDD 4LCBA 5FI0B 1KKLA 4HLDA 1TS6A 1YU9A 2KBEA 3RDPA 1N9LA 4ZIRA 2ECKA 2PZGA 5B30A 3AVTA 2WMOB 1K5GA 1N5JA 2CVHA 2RB4A 3ZZUA 3CW2A 3LYXA 5CYPA 2R44A 2V7QA 3I32A 4HB0A 3T35A 4WN5A 2VHJA 4FMBB 1WB9A 2G6BA 2GZHA 1OIVA 1NLZA 5KSPA 3CAXA 1R0YA 4CW7A 3CWQA 3VE4A 3BK7A 3RWOA 2QAGB 3H84A 3TAHA 4Q4HB 4HUTA 3MQOA 2ZU0C 1T1AA 4LPKA 4NYMQ 4Q1AA 4DLVA 1DVRA 3D3QA 4DT1A 4JT2A 5G3ZA 1KMQA 2QM8A 1G7CA 1SKYB 4JLPA 2P5TB 2X77A 2EFEB 2J80A 2ZYTX 2EW1A 4RD0A 2EFGA 3TVDA 2BM0A 4RFSA 1X0OA 4QC2A 1FOEB 3SEAA 1IN7A 3MWLA 5E7MA 1W5SA 4M0LA 3ZDQA 4DSNA 2W6JD 1RVDA 1M7BA 4Q1DA 3RANA 3TJZA 5KDDA 1S66L 1IOZA 3IQXA 5J4LA 1TF7A 3T06B 1KO7A 3THXB 2GXUA 3X2SA 1LSWA 1NBME 2CK3A 1OXXK 5E7IA 5HZKA 1XP8A 2ERXA 4B44A 4TWZA 4QGHA 4OI0A 2IYXA 1CP2A 4EAQA 2Z4SA 4GP6A 4Z51A 2IYYA 2GHIA 1XDBA 3WBKA 2DWPA 1JPJA 4V0KA 1FTSA 1VG1A 2CJWA 4WF0A 1XTKA 2GXAA 1S9DA 1XCGB 2ZRNA 1Z0FA 4A6PA 4G5GA 2P6UA 1S1ZA 4L9EA 4PAMA 3SNHA 1XJ0A 3ZIAD 1IONA 3ZD6A 1N6RA 2QG6A 2ONKA 4TTQA 4MKIA 4TMVA 4D25A 1HT1E 1VG8A 1G8HA 1AGPA 3UB9A 2G1KA 5EZ5A 2YWHA 3WNDA 1QDEA 2XOKD 5FPTA 4FINA 3MUFA 1ZM2A 4DUGD 2WWHA 4TYWA 2GJKA 3DDCA 1WBDA 2NO6A 3QBTA 3K9HA 1FUUA 3BIFA 4RD2A 4GZMA 3ZVMA 2AXPA 3TLXA 4OI1A 5BW8A 1GKUB 3SYNA 2DHRA 3THYA 1U94A 3A0RA 3U61B 3UMRA 3FKSD 3OIUA 4DLZA 2QPOA 3K0FB 3KQNA 3CUEF 3AP2A 1P62B 4WLAA 4GSYA 4NU0A 5BQ5A 2CMNA 5DJUA 1RRPA 2L0XA 1KDTA 4E03A 1R6BX 2GJ3A 5CIQA 4A82A 2GJAA 3ND9A 4B3DA 2RGNA 3A1UA 5E7JA 1OJGA 1NBMA 3A1VA 3BH7A 4M1OA 3J81k 5E95A 2QQ0A 2WIBA 2RGCA 4NYMR 1SHZA 1VG9B 3VKHA 2ZBBA 3K0CA 4X8HA 5FUWA 4HJ4A 2JA1A 4CEJA 4XVUA 4TLCA 2G9NA 2FF7A 1WA9A 5J4YA 1YHNA 1E2EA 1Q1ZA 1U8AA 2F3RA 2OESA 1PZNA 4Q4LA 4DHEA 5IF9A 4EJSB 2IS1A 1II0A 5C18A 1VDZA 4BFTA 3MSXA 3OAAA 2WOOA 4PC1A 2WJIA 1XFAA 3FVQA 1YE8A 5B2ZA 4QHTA 3QF4A 5F9FA 2ZE7A 4FD2A 3EWAA 2QEQA 2AFIE 4H1UA 5KYKA 2KDKA 1G18A 1ONBA 4XTCS 3MGCA 2VPPA 5AUQA 1E2PA 4LSGA 2PMDA 6Q21A 4DDTA 1P60A 5EE3A 2YWFA 4B6FA 2VP9A 1EWQA 3ICYA 4TYQA 4EERA 1OXUA 2J7PA 1P2TA 4HUQB 4B75A 4IW3B 4PSVA 1HV8A 5KDLA 3PR1A 4IFEA 1OPXA 2ZE8A 4MRSA 5L3VA 2ZRHA 1W0KA 2A78A 3QXHA 2C9OA 3K0CC 3WP1B 1XMJA 1KJYA 2VRWA 3M4YA 5EXSA 4RZ3A 3E4QA 1TF5A 3H7WB 1ZCAA 4HEJA 4Q7MB 3CM0A 1GRNA 3K09A 2QN6A 4HAZA 1P75A 1U81A 1G3RA 3RS5A 4A15A 3C7KA 1GL6A 1LY1A 3HP1A 1G8GA 3KZ1E 3SS8A 2CL7X 4ARZB 1CEEA 4I1SA 1HT2E 3AF1A 1OLOA 4EFMA 3I73A 2IA5A 2GVDC 4L4UA 2QJ7A 1A4RA 3AP1A 4WZBE 3ETLA 3O8CA 2UKDA 1US8B 2VV6A 2P3SA 3KTAB 2JJ2A 4P31A 1E96A 5TB5A 1D9XA 1R0XA 5HKKA 1ZU4A 2QAJA 4OK5A 1S3GA 3WXMA 2BCJQ 4PC3A 1Z6XA 4KU4A 1AZTA 5TXGA 3FMIA 2MSEB 3FFAA 2CL6X 5KO2A 1OSNA 1X1SA 3SN6A 1NVWQ 4JJZA 1W4RA 2VEAA 2O0HA 1KOUA 1T19A 2CCKA 2FSGA 1OE0A 4LRYC 2HF8A 2R62A 1E79A 3B1VA 1XJCA 1AQUA 4O2RA 5FBWB 4KQDA 2XZOA 1QG2A 3ND8A 3HWSA 5HWTA 3A6PC 1VECA 5JBQA 4E07A 2X2EA 3WMEA 2IS4A 1VB6A 2BVNA 3EPHA 3F1NB 2AWOA 3L0PA 2FZLA 3K09C 2IS6A 1NN5A 2QRNA 2ZROA 1N6HA 1S4RA 4EDHA 1AQYA 1UF9A 5EJEA 2ZQ5A 4I1VA 3W6NA 4LYAA 1MO3A 1W5TA 3KQHA 1VMAA 1LS6A 2WJJA 3QPUA 2QBYB 3KFVA 1MZUA 4OQXA 4XIGS 1GM5A 4R98A 2XNDD 1DG3A 4DB2A 2GBLC 1KK3A 2GTPA 3C8UA 3C16C 4LRXC 2A24A 1HURA 2JLQA 2ZSEA 2HYDA 2ANCA 1EFUA 1A5TA 3CB4A 1JEEA 4AG5A 1X8LA 3B9PA 4ACAA 4B3FX 4PKYA 2Z6CA 4ZI3A 3MCAA 1E1QA 4TL9A 621PA 1E2JA 3QY0A 1DAGA 4XD7D 2D2EA 4BEJA 1S9HA 3FMFA 4LV5B 2C03A 5H68A 5IK2D 4GI7A 2BM1A 3K0EA 1DG1G 2WAYA 4WBSA 4FWIB 2ZS8A 3RABA 2G1JA 3ULFA 2CBZA 2R6DA 3AP3A 5JRZA 1GNRA 1Z47A 2ORIA 3AKYA 2ZAMA 4RKEA 2KSQA 2R2AA 4II7A 1DE0A 4L9FA 4I39A 4GS9B 3ZH9B 4I1OA 1P6XA 2A5FA 1MO6A 3TBKA 5TMPA 2A5JA 1MH1A 1FX0A 3V4FA 2GETA 3PEWA 4MYTA 4ZDKA 4BWYA 1LV7A 3LFUA 1P2VA 2BMEA 5AK0A 2BASA 4P32A 1OH7A 1GG2A 2CMKA 5TDHA 2VSOA 5B57C 1U0JA 3LDAA 4TTRA 1NL3A 1W48A 3K0AB 2QNRA 4X8LA 4AG6A 2EFCB 2Z83A 2ZJ5A 1CF4A 2IHYA 5AJWA 3M0EA 2B7BA 3WP0A 3DHWC 4MRNA 2DWOA 2OCYC 4QHYA 4A8JB 4PC6A 4U02A 4Q9IA 2QROA 3IBYA 2YZ2A 2O52A 3EC2A 3L2OB 2PYPA 3NOPC 3W5IA 3C4JA 2D74A 2HXSA 4TLAA 3AVXA 3NDPA 1JECA 4BE7B 1U8YA 2JLSA 1II8A 3LAWA 1Q1EA 3CF2A 4RZ2A 4XOIA 3B78A 2JN7A 4Q4AA 3WHKA 5CDFE 3NH9A 4IHQA 5D3MB 4XWOA 2O8DB 3W34A 2QSYA 2IYWA 4KYIB 2ZRPA 2OO7A 4UNRA 4JLVA 4PQFA 5FPSA 5FBLB 4CZ2A 2IYVA 2ODBA 1XBTA 1LL8A 4EPYA 3QE0A 4PAQA 3BFVA 3D6TB 3B9QA 2IYUA 3AVPA 1XTJA 3REGA 2DPXA 2AN9A 3NC1C 3IILA 2GK6A 4QGGA 221PA 1SQ5A 1IBRA 1I4TD 1XXHE 2ZJ2A 2YC4C 4I4LA 3VR4A 1IXSB 3LIFA 1HE1C 2KB0A 5FR1A 3X1ZA 5JWOA 1ZRHA 4HH2A 1RE0A 2CE2X 1DO0A 2J0UA 3HR7A 3HYTA 4W5WA 3A0VA 1NG9A 2JLRA 3PUZA 2PZEA 4HZIA 4WIAA 3T34A 2QI9C 3Q5DA 4OHVA 4WZ6A 2CVFA 3OIVA 4C0JA 2IWHA 2NO7A 4KLZA 4MGIR 5J4HA 1F2TB 4TYNA 5FTJA 2FFBA 4ASUD 2O8EA 1H65A 4HSEA 5B64A 4HAUA 1CR1A 2I9VA 1LF0A 2G88A 2K5UA 3VR1A 4OJKA 2WTUA 4C0SA 4GDFA 3HU1A 3AGPA 4KLNA 2WKPA 1XEXB 3ZQJA 1LSVA 1KDOA 4N0DA 4DEYA 2WHXA 1Z29A 4JS0A 4YMTA 3OHMA 1IN8A 1DAHA 1JAHA 5UKDA 3QBVA 2NTYC 4Q01A 4A2QA 4BZQA 4TQUS 4BGDA 3OEHA 2YOGA 2FGKA 5DHFA 2WOJA 1GAJA 2PJZA 4YLGA 5CDFA 2ZR7A 3BE4A 5J40A 4I38A 3BB3A 4B3CA 3I3SR 2D3WA 821PA 4KBFA 4DLRA 3ZVRA 4ILEA 3GLHA 4LC0A 4FCTA 3KKMA 4P33A 2Q9BA 1G9XA 1KI7A 5CITA 1OTDA 2O8BA 3QG5A 2GILA 1GIAA 3LY5A 4UJ3A 4X8MA 4UNSA 3U6KA 2E9SA 2QMUA 1U9IA 2WM9B 2OFOA 3OESA 1RRCA 1XXHA 1ZIPA 1UWNX 1DRMA 4TT3D 1Z08A 2NIPA 2IUUA 2R6FA 3CRRA 3LX8A 1O87A 3CPJB 3AF2A 3H2YA 3LIAA 3VR5A 1NWZA 4F4CA 1T1CA 2NO9A 1JALA 4JVLA 1N9NA 5GADl 4EXOA 1UJ2A 5KSOA 4F3LB 1M34E 5J4EA 1XD2A 4D82A 5DKLA 2G77B 3EASA 1XPRA 2JJ1D 4P4UA 1U90A 3G0HA 5FI1B 1E2MA 1ODVA 1P4SA 4PSAA 4QGAA 3EZ7A 3ZGXA 4AI6A 1DELA 5HDCA 3P7NA 4G01B 1NP6A 3GP8A 4D4JA 4C7OB 4NCNA 5KNBA 3VMFA 3Q85A 4B43A 3RH8B 1ZNYA 4P4SB 3SU8A 4B2PA 4MGKR 2FEOA 5EUQB 5A5GA 2EA9A 1OHHD 4LC1A 5DGXA 3R7WB 1ZBDA 2ZVQX 4M9SA 4R70A 1GOTA 1ETUA 4HB2A 5AVEA 5GJCA 1FFHA 1L4YA 1XEWY 2ZAOA 4GL2A 3KKQA 1J8MF 4EKDA 3TUJC 1U9IC 2WIAA 3VOLA 5TARA 2F6RA 2JLWA 1QHXA 1F5NA 2GF9A 1NF3A 3MFXA 1GITA 3DKVA 4CT4B 4Q47A 2VP6A 3AB3A 1U8ZA 4DLYA 4XVQA 4EQ6B 3A0SA 2C78A 3QPVA 2DYKA 1KI6A 3VNUA 3X1YA 2QUZA 2ZRFA 4PANA 3TSOA 4TZ6A 2IX3A 3NBYC 3ZZTA 2QKPA 1LS1A 1UKYA 2OBMA 1ZMXA 3WMFA 1NNEA 4ABYA 3GLFA
chains in the Genus database with same CATH superfamily
4YT4A 2NZ8A 3RG8A 4KGZA 3VSKA 1X13A 1PK8A 1IM8A 3F5MA 2BH9A 3F6SA 2GUGA 1ORWA 2GO7A 3T5AA 1D1TA 3GJ4A 3HUOA 4U3TA 1XCOA 4ATNA 4URVR 4TVBA 3X2EA 2WYIA 5AM3A 1XGJA 4NV0A 4IOKA 3LO7A 3C3BA 1KTVA 4R8SA 1YR7A 3O21A 5IAKA 3KEFA 1ZRSA 4YUZA 1QDUA 4R2IA 3LUPA 2V65A 4HEHA 4E04A 4PFQA 3GFBA 5DASA 1ZOIA 4BMXA 5KSYA 1G16A 1OC4A 3E9YA 3SS5A 2DX7A 3NBUA 3LEZA 1PT8A 5DM1A 2B4TO 4H6JB 1J2RA 2C04A 1T4CB 1VLLA 2XUKA 2MSNA 2WFZA 2FPIB 2GK3A 1HRKA 1A9XB 1V71A 4XQ0A 2WKIA 5AP9A 1SULA 1FTWA 3I5YA 5IAJA 4U2KA 3R3ZA 5JYBA 3NKFA 3SOZA 4ZEOA 3LF1A 4O5OA 3K1AB 4Q7JB 3O5AA 1SQ6A 4INPA 5TF4A 3JYIA 4C21A 4FNMA 1QYIA 2OD7A 3D2AA 3ADKA 3K1JA 3OC2A 3HL0A 3QVUA 5AW4A 1MV8A 2PH1A 4JKOA 1XX6A 5IVKA 1JZTA 5AQ1A 4FE3A 1PRQA 3UOAB 4AX4A 5PGMA 4TYPA 4LOAA 3MQQA 1TJPB 1DEXA 4LCJA 4C1BA 4JUIA 4DDKA 3G02A 2DLCX 3ADCA 2XTJA 1TC2A 3FA2A 4GNRA 4KIGA 2QUBA 1Z35A 1XZLA 3KELA 1L7AA 2WT9A 4U8HA 2HSWA 5AOVA 5EZYA 1TK9A 3H04A 2WU8A 3EMBA 3W90A 3HMQA 3DLPX 4D9MA 3EYWA 2DM6A 4ZPXA 3NVKI 3PFIA 1PR0A 2GEKA 3AEKA 4NNJA 3EWNA 5EZ6B 4JENA 4WNAA 2XXBA 2JS7A 2HF7A 4UTRA 5F7OA 3P1JA 3W2IA 1E3UD 1M6VB 4GQAA 4FHCA 3C3AA 3Q98A 2HK8A 2Y1EA 2PBYA 4F60A 2ZC7A 2WT8A 3E2MA 4NJMB 1KAHA 1ZC4A 5TNXA 1YQUA 2PRZA 1ZPDA 1Z6GA 3TD9A 3TDKA 1G2OA 2RJ3A 1KIMA 1YE3A 3OTIA 3R7FA 1X1DA 3JZIA 1DAFA 4J43A 4H1HA 3NC8A 3BSWA 1UZLA 1LRLA 4W9RA 1JSRA 3KP1A 4ZARA 2JAUA 1I4LD 1V1JA 3K9GA 4FZJA 4EGQA 1WEKA 5KIAA 4UU7A 3WLHA 3EJWA 2ZBVA 3S2EA 4YCAA 1G8AA 2R9VA 1ADYA 4NTZA 5KIZA 3BFGA 3V4LA 2KPOA 1NQUA 4OHUA 2R6HA 1ONGA 4MQBA 2B35A 4FDUA 3TFQA 4JGOA 3DS8A 4N8SA 4OHMA 3PEFA 2P1RA 3VNVA 2QVCA 1HVBA 4DSUA 1ISSA 3C85A 3QU7A 2EEPA 3U3JA 3VJLA 4B83A 2B7CA 4YV1A 1ZD3A 1PWDA 5JS2A 3U1BA 4ZVSA 4PCUA 4PG7A 4QT0A 1XWWA 1TM5E 5JWRA 2DG2A 4D9KA 1HEYA 1AKUA 2B21A 3EBPA 1QZXA 5ER6A 3TEMA 5BWOA 3NJAA 3AF0A 2Y2HA 4K9SA 1QO7A 5DGDA 2ENWA 1Q17A 3LWNA 4LJ8A 3OBFA 3ELWA 5DNVA 5JNTA 2F3TA 1GGKA 1EP9A 4JT9A 2QX6A 1Z3IX 4RAOA 3VSEA 3K9CA 4W5JA 3NIFB 3GEIA 3SDSA 2WSLA 4RKFA 2O2ZA 4MS4A 3DUFB 4RD1A 3RPEA 3L1KA 2FX3A 4HXFB 4BLUA 4XM2A 5TQ2A 3THRA 1HQDA 5EJ2A 3JARB 4IEFB 4M1QA 1Q1BA 4ZVPA 3V8RA 3I30X 3ADOA 5K8LA 3MBZA 5HCIA 3FSGD 1T1EA 3CLUD 2O19A 4UM7A 3QEMB 2Y92A 2GM3A 5HSGA 4C7KA 2CJWB 2XBUA 4LRTB 2QZPA 2K7ZA 4X84A 2JFZA 4DLUA 2R87A 3EJ6A 1Y8ZA 2W6ID 1OMEA 2DFVA 3SLGA 1U2GC 4BZPA 4KBYA 2P2DA 4BBTA 4JXJA 5L51A 3EHDA 4Q3BA 3QXSA 3AEXA 4RS3A 4XSGA 3P19A 1MTZA 1RZVA 4F86A 2V7XA 4A26A 1A82A 721PA 1H8YA 2XEXA 3VVLA 2FXIA 2B7LA 2FEKA 4ZU1X 1FB5A 1W63M 1T8PA 1BLSA 1E0JA 4J0GA 5AUNB 2ATCA 3IBCA 2VF4X 3BGDA 5LP6C 3G5LA 1QYXA 4EY3A 2JIZA 4OQMA 2WJGA 4EKNB 4NJEB 4W7HA 3D2CA 1T91A 3CJMA 4Q5IA 4N5DA 5IZCA 4HDSA 2G7ZA 1PTKA 4IV8A 1R15A 3UY6A 4WT7A 5K0SA 5LSAA 3T9CA 4RTJA 3RLIA 4V03A 4RADA 4Z4FA 1CJMA 1JHXA 1RJFA 2V55B 1ZCJA 3VX4A 2RSLA 4RTOA 3PSHA 4FFRA 1UPXA 4PTLA 4JLKA 1ZKMA 1OTEA 1MTOA 5A2QA 2HKIA 3AVOA 2W2KB 4ZQHA 5C52B 4Q66C 2P6OA 2REQA 1MZPA 4NICA 2G08A 4HATA 3WSVA 3S2UA 1PW1A 4CMEC 2DTEA 4EBPA 4W5OA 1WYCA 3ZX5A 2OC4A 5F1FA 3DWGA 2VSFA 4D97A 4RDHA 1FYVA 3ETEA 5EJ4A 5HKLA 4BN0A 1RHKA 2P0AA 1V48A 1MA0A 1D2RA 5IDQA 5I3ZA 4QTZA 4W63A 2VDPB 3SC2A 1PQUA 3ORQA 2WJYA 3T4OA 4UUPA 1FP6A 2BLNA 3IX3A 2W2TA 2R4QA 3DBIA 2PZJA 4S2MA 1L5MA 2ID4A 3VKFA 2HSJA 4MKGA 3QQ5A 4YJ3B 2AC2A 1S6YA 1E4EB 3CKMA 1VE1A 1Z2AA 1NVVR 2QUIA 1MC0A 2XFTA 3TR5A 5KOYA 1AOXA 1RM5A 1VP3A 1FFWA 2OCAA 1A1VA 4BQIA 1EUCB 2RCYA 2ZSBA 1DT3A 4ECEA 4EKYA 2RJOA 2FDXA 4HVLA 2NQ2C 5JVDA 3UHJA 1Q7TA 2G76A 2PBRA 4BNUA 1R8QA 4Y0AA 5I45A 2V7VA 3H1FA 3GT7A 2J0UB 1D7AA 1SKBA 3OQMA 1M83A 2WHQA 2RHBA 2PFKA 3GFRA 4HNAA 1X8KA 2EX2A 2J5BA 2C99A 5BSWA 2Q5CA 1YONA 2OSUA 3OPRA 3HKBB 4NQRA 2X6RA 3EAQA 1ULBA 2ECOA 1C0EA 5B55A 3UA4A 4UTOA 3KBOA 3GLHB 2YQ4A 1DL5A 2FG5A 1OXVA 1N9ZA 3UK2A 2QW0X 3IYLW 4HVTA 1XXHB 2BBSA 4TT3A 3LHDA 1Y80A 3T9EA 1GFSA 3OLOA 4IF6A 2RKOA 1NM5A 3ZJUA 3W06A 4KZPA 1JS1X 5LOVA 2IEYA 4TMTA 2ESRA 4DCMA 2X3YA 4LJSA 4BY9E 5AQ9A 4WINA 3TE6A 4E5UA 3LXXA 4M1EA 4IG4A 4R3AA 5IKOA 2DWQA 3V4VB 4IM7A 3RODA 5FAPA 1WPGA 4HNQA 3E5RA 2IYQA 3M2TA 2ON6A 5LDHA 5DP2A 5IBQA 2E4VA 1R8JA 3ZLJA 4AJNA 1J2JA 3BA6A 3BRWA 2FZKA 1O0CA 4ZO8A 4FVTA 4KITB 3TSCA 2XGMA 2VGJA 3HUMA 4GUDA 1Z38A 3LZCA 3U48A 4DY4A 4KVAA 4E3IA 3P20A 4TV9F 4P93A 3I05A 3DMYA 5CU7A 1N5LA 1SHTX 4KZ3A 4CUZA 2ID8A 1ZI9A 2Q1UA 4YMUA 2C42A 1L7VC 1B2LA 1YR2A 1Y33E 4C89A 1Z7WA 2WU0A 2EIHA 2M1XA 2HP9A 3IAFA 2DERA 2V1XA 1N2CE 1PTJA 4AZWA 1E2KA 4R2XA 3VU9B 1BLHA 3BRQA 2RBGA 2GHRA 3BQMB 1L7RA 1N3LA 1JE1A 4OX9Y 2TMDA 3O9MA 4Z3KA 4Y15A 2OKGA 5LWHA 1PZEA 4GMXA 3V4SA 4I9FA 5C4GB 4OKNA 1NUPA 1J0EA 2I6TA 3HN7A 4CKYA 1ZM3A 3LHFA 1JWPA 1TS7A 1B73A 3MEQA 2QZ4A 2TS1A 1ZK3A 5GTDA 4Y9RA 3GD5A 5DTIA 4D02A 5FH9A 3NTUA 1RHMA 3FKWA 4R41A 4X6XA 5K3FA 1MRSA 4JR2A 5IMBA 5FAKA 3JAWB 5G4ZA 4MP8A 3G7UA 1F60A 1HNZB 1DO2A 1XAIA 3WGLA 2X58A 5GONB 1MFZA 1P0QA 4JKYA 4YO8A 1LVUA 4RPIA 2NZWA 3VPSA 4Z1MA 2Q2NA 4NF2A 2GWRA 2QSZA 3ZHQA 1AA6A 3TEFA 5BQFA 4E13A 1K4FA 3FCEA 1UDWA 3VR4H 3RS0A 3DFMA 4FSDA 3ZDXB 3NHFA 2FWNA 4NSNA 1G60A 1VHMA 1VPTA 2F3SA 5AW3A 2CLCX 4Q9HA 3DL7A 3A04A 4BNMA 2F43B 1NVMB 2GF0A 3GPBA 1MY8A 3AO0B 1TTTA 3TSWA 1O4WA 3ZGVA 1F9EA 4QWWA 5AVKA 4B81A 2JCBA 5EIBD 1UK9A 4JKIA 3B20A 5FL7A 1H2XA 6PFKA 2XB8A 4FYIA 1OKKA 1ZCBA 1K6EA 2YHBA 1CDEA 3BEDA 3GAAA 4N1AA 4GDBA 1J8DA 2J3DA 3OCXA 3DEFA 1VP9A 2OZVA 4ZAFA 3KG2A 4Z0NA 1RIFA 2VK2A 2K6GA 3W5CA 1SDEA 3CHYA 4COKA 3U6BA 3A2KA 1ZK2A 4IJKA 1OVMA 4QYIA 1MP0A 4KIUA 1V6SA 1ZG4A 2BZ1A 2XB2A 4KN9S 4FFBA 3V7YA 2B82A 3KALA 4NYJQ 1HKHA 4R2LA 4YROA 3F7TA 1RI5A 1IEXA 4R2WA 4MZDA 3DDZX 3R3VA 3ONNA 3DZFA 3E35A 2EKBA 1RQXA 3K0KA 1XXMA 2BFWA 3KAKA 2A0YA 1BGVA 4ZYWA 1YL6A 2WGWB 3C3DA 3URMA 3LUFA 3QP6A 1X3SA 2Y1GA 3OZFA 1J23A 2HV1A 4L0DA 1A0OA 1H2ZA 2JFNA 4UE3S 3CF6R 4G5QA 3BXXA 4PXYA 2LDXA 4UA6A 2WU1A 3REFA 1ONHA 4WBXC 3JYHA 2ZBEA 3GRCA 2DCFA 4TRRA 4ZT6A 3J81A 3U4AA 2ZRBA 1P1RA 2Q99A 4WUJA 4N6OA 2O1XA 1HBJA 3LY4A 4Q9JA 4MUEA 2N0SA 4JVNA 4O29A 5A0FA 3PXEA 3JATB 1J0BA 1G41A 1WHSB 4XGKA 3FYUA 1LSOA 4QDZA 1U60A 4X20A 3WL7A 4UVIA 1E6MA 1WXWA 4M60A 4PQEA 1OV6A 2YHSA 3REQB 4X5OA 2WAAA 1XNGA 4LCBA 3PTZA 5J63A 1CNMA 4FP9A 3AVTA 1F8FA 1AKRA 2WMOB 4ZP1A 4RX1A 2V7QA 1KARA 4HB0A 4JB0A 5C8XA 4WCFB 2MYNA 1IMOA 4Q4HB 2V7BA 3CS3A 3SSNA 2GNXA 3D3QA 5T64A 4DT1A 2QM8A 1T2EA 1P7WA 3CUEA 3PPXA 3D6UA 5GLBA 3T06B 3HDYA 3LOUA 4FLEA 2RH4A 1C9NA 1M10A 2BYTA 1TKCA 3VISA 3TW8A 1N6RA 3MFQA 4DCGA 1T2CA 2PBLA 4DLKA 4OLGA 1RLTA 2OXIA 1IBMB 3O92A 1ZVMA 4JC8A 1M2NA 3V39A 3GIWA 3VYRB 3ZE7A 2DBZA 3LCUA 4U6QA 3GZJA 1LXCA 4HGRA 4YRAA 2CMNA 3R1IA 5CIQA 3FPLA 2EW2A 3A1VA 3J81k 4MW9A 5I6DA 2R1TA 4CM5A 1JQKA 4CM8A 1SOVA 3K0CA 4HJ4A 1BDBA 2AOUA 1WA9A 3TTWA 3PS9A 3IIIA 2Q5HA 4D6XA 3MSXA 4RK0A 3WGIA 2WJIA 3I9MA 1P39A 3QK7A 3CF4G 5KYKA 2E55A 4MQEB 3MGCA 4XTCS 4IWNA 4RXUA 6Q21A 3NGXA 1TF1A 2VP9A 3SYRA 1C1DB 2GD0A 4GM1A 3UDFA 7REQB 4JUAA 1KJYA 2VATA 3PUIA 3W6UA 3SXUB 3ZHCA 4O4LA 3TGWA 2ODAA 1L4LA 1M72A 4EFMA 2YDXA 3H9GA 3ER9A 3O8CA 4P31A 3FNIA 3Q4GA 2BR4A 3AESA 4HG2A 4RDIA 3PWKA 5IDXA 1Z6XA 3INYA 4WKCA 4RVGA 4O2RA 4PFKA 4LFBB 3KLBA 1PJCA 3ND8A 3UV3A 1VB6A 1ZD2P 1E7QA 4MCJA 4NHEA 4GYKA 2H48A 2QRNA 1SCIA 4IXWA 1ISHA 3VA7A 4J3NA 3HXOA 3AZOA 2C5EA 2X41A 2HBQA 4KUGA 4DNOA 1XMQB 2HYDA 4ACAA 1ND5A 4ZOCA 5LQAA 1W5DA 5L4NA 2LIVA 5H68A 1DG1G 4RSMA 1NUUA 2JCXA 4Z1OA 4L9FA 5TMPA 3UGQA 5HRUA 3ORYA 4XR4A 3AIIA 2BASA 3TG8A 4OQIA 4KLAA 1KJQA 4DCCA 3I2FA 5HG0A 4Q9IA 4BRZA 1QLHA 5DLPA 3AZPA 3SJ7A 4ZZ3A 3OETA 2QSYA 1CUWA 2ZRPA 3UXEA 2IYVA 4GR9A 3B9QA 4UPDA 3CZDA 2XRMA 4DDSA 3AL0C 3ZOKA 2DPXA 4IKOA 4CXMA 2OFFA 3X1ZA 2ONCA 1CY1A 1CJFA 4AMUA 1RGZA 3N9IA 3PNVA 4TYNA 1JQDA 5D3OA 1GG8A 1XRNA 4QYWA 1BE0A 3WNQA 2B5RA 1K5HA 2YOGA 3T7KA 1FNDA 3ZDRA 2E8IA 3OCYA 1KZYC 4B3CA 1SWVA 1FXSA 5D5HA 4L95C 2CDRA 4L78A 3VUEA 1XP5A 1R6XA 3UJ7A 4UDXX 1XG5A 1BJRE 3M3DA 1XDUA 1TGYA 1QTIA 3ZXSA 3AF2A 1BEEA 4F4CA 1EIWA 2YS7A 3MOIA 1XI2A 3H11A 3KV1A 3FW1A 4PAUA 4FWBA 2G77B 3GGOA 3ZGXA 4C7OB 2Z56A 3RJ5A 2XEPA 3Q85A 3D9QX 3ZK7A 1E5DA 1YXMA 4M9CA 1QP7A 3ER6A 1CI9A 4JEUA 1EFVA 3HJAA 3G9QA 1YA6A 1FFHA 2X0KA 2NV2B 1FRFS 4XFKA 5G1PA 4Q47A 4U3JB 2VP6A 3H87A 5BT8A 5HOQA 3A06A 1CF9A 3HA5A 4LXQA 4KHZA 1T2NA 1NW6A 4I1RA 3T7IA 2OPBA 1YQ9A 4BS9A 2HSEA 4RK7A 2NYRA 3PI7A 3N2EA 1E2HA 2AXQA 3BD6A 3DR5A 2LR0A 1KMNA 2Y3IA 5BWCA 2Z3VA 1TYDE 1S96A 1NXPA 4AKHA 4KDCA 2HEIA 2NWQA 1H4VB 2QU8A 5DI3B 5DFXA 2BLSA 3MT0A 5LXTB 5JW6A 4CKBA 5J2TF 1G3UA 2D3TA 3OLVA 1T9DA 1JA9A 1DAIA 1XTIA 4MOWA 2MJLA 3K8OE 3G82C 5JSZA 3STYA 3ZE6A 2O8CA 4DLTA 4FLMA 4TWIA 3H82B 3VYSB 5IVIA 4A91A 5GP1A 3HMKA 4BQEA 4IMJB 4IGAA 4NBNA 4D0RA 3NI2A 3VU3A 2Q0XA 2RAPA 3NCTA 2H85A 3NNNA 1ZD4A 2PIDA 1XPUA 2PS3A 4S2NA 4KGVA 1DT5A 4EEUA 2VP4A 3AIKA 4KG6A 4N92A 3WGZA 5A7FA 4NOLA 4IBXA 2I22A 5KQGA 2VHQA 1XLWA 3M3PA 3T5MA 4UTVA 2XZLA 1Z83A 2JIOA 2GCPA 1ODLA 4H3VA 1FILA 3BWYA 1DAKA 1GPMA 1SHLA 4TQ9A 4KTVE 4ZCMA 1CDZA 3RS7A 2WJWA 1CUCA 1RYMA 3EVCA 5EUBA 3V42A 1PZGA 5FWAA 5CDGA 1PJ2A 1RCFA 1Q21A 5KCZA 4GCZA 4GP7A 4H7EA 1NJFA 4QM6A 4K6HA 1OY1A 2YIVX 1YS4A 4XDZA 4U63A 5AHKA 2R6ZA 2HT1A 3TZCA 1SXIA 2C4HA 4YCSA 4ZI2A 4TWRA 4ON9A 1QZ3A 2H1LA 1SPXA 4R8MA 5IEBA 1DLIA 4GWKA 5LYJA 4RE6A 2EVWX 1JIQA 1DRWA 4M2LA 1KMHB 4TKMA 4BNJA 4NMMA 4UMFA 1LTQA 5BSUA 3K7EA 5C51B 2A58A 5CAEB 3RAFC 4B3HA 2Q7DA 1E69A 4KPGA 1O95D 2ZG6A 4KRXA 2AOXA 2CZQA 3GDHA 1RWXA 1RWNA 1DKUA 4P0MA 2WGVA 5JYCA 3WR5A 2HCBA 3U44B 1U7OA 2WF8A 4R2KA 3TQOA 3TIVA 4UE6A 4JHXA 3MPOA 4NXNB 4MI3A 1XTVA 1WMAA 2WD9A 2XWSA 3LKVA 4RF4A 1U2ZA 1K8ZB 2AQHA 2ZR9A 1JEQA 4FOLA 3VAAA 1AMNA 1AHPA 4P4NA 3D8NA 4WZ4A 4JITA 3P2JA 4GXTA 4JI2B 3USES 5DNUA 5GVSA 4NNOA 1GUDA 2NP7A 3TRHA 3JZAA 4MWBA 4ZMRA 3JVIA 5DULA 1KDPA 2OZLB 5CGZA 4G9GA 2D02A 3KVYA 4LX8A 3JYQA 2PH5A 4D9NA 2W71A 2ZRIA 5IJ0A 2FZ5A 4A5OA 3BFCA 4IMPA 1XTTA 4MITA 3OTWA 1M73E 5FI3A 5B4VA 4J0FA 1XCBA 1FLVA 2ROQA 4UTZA 1AUPA 3ANYB 2DFDA 2VYVD 2D1RA 4W5TA 1YLPA 5L3SA 2YL2A 4JR1A 1QQAA 1OAOC 1TOAA 5KQRA 1WDMA 1IJEA 2P9VA 2VUSA 5K0GA 1TQ2A 4MS1B 4ES6A 4DA4A 4G5XA 3RV3A 4KMMA 2Q5IA 4TSFA 1T3ZA 5DB4A 1NQOA 2J08A 3F8SA 4I1IA 4QPNA 3C8DA 4PZUA 2FPUA 4Q48A 1AQNA 3ZIAA 1J7KA 1X8XA 3SY8A 1YCDA 1WCIA 3L77A 4DA6A 5KYWA 3H1AA 3DV2A 3F2IA 3HLBA 4NIMA 3WGQA 3L6UA 1HWYA 3QUBA 1KWGA 5L4LA 5AD1A 1WQ3A 4QPJC 3QVGB 4EUNA 4EYQA 4FUQA 4TV9B 2GAIA 1ZZEA 1FRNA 1QYWA 3I4LA 1IQ0A 1TA0A 3B6JA 4ZQIA 5FCDA 4U7WA 3RAGA 4DLWA 5LQUA 1GVHA 4KHPB 4BO4A 3WSTA 1ZC2A 5BSKA 1EFTA 2JFPA 2W6OA 4D44A 4CLRB 4ID4A 3PPYA 2QRVB 3EG5A 3B7PA 2W0NA 3F1KA 5EMKA 3BIOA 4IS3A 2WLSA 4NVRA 4GMKA 3UBTA 1G3MA 2FWRA 4R8KA 3BMXA 4KG7A 4OQGA 4K8RB 1MAHA 4KFCA 2I72A 1C8VB 3R4CA 5E4FA 2ACWA 1E6UA 3HWRA 1EIZA 3DV9A 1CWUA 3V46A 1OH6A 3BM5A 5GM1A 4TZKA 3VZDA 5BOVA 4B5KA 1DZIA 1S6RA 5KNBH 1JP7A 4OHFA 3CRVA 3OG9A 3E4OA 3U4IA 1Q7GA 1A8IA 1MJNA 1G5QA 3CEAA 2A14A 2GA9A 2CD9A 3RT7A 1ECJA 3SJAA 3QUAA 1IXKA 1I2AA 3OAAD 2CV2A 2HA7A 3O8RA 3L0ZA 2R1ZA 4TTPA 4ZVVA 1AK1A 1XEAA 1T29A 1Y8RB 2C2MA 3LR3A 4F45A 4D56A 3R0XA 3E2KA 5ALWA 1QNFA 4XD7A 1KEZA 2ADOA 4Q3LA 4P7BA 4MWZA 4DDMA 4YFYA 2ORYA 4FS8A 3RKUA 4NARA 4HUQA 5J4KA 5FRDA 1VQQA 2I7XA 2PH7A 4EPXA 1XCMA 2NN3C 3AGDA 1YRYE 2XMRA 2BKAA 1RADA 1U0EA 1W4CA 1BTLA 1K6XA 1DHTA 1WNFA 4HQ0A 1NY6A 1XJ6A 3DGEC 3T1XA 2V4MA 2FW0A 4GM4A 3IUEA 2NYVA 1M6WA 2AX4A 2VH2A 1T2UA 3UMMA 1GFIA 4TUYF 4JGBA 1JTEA 4JJ6A 1ZJ4A 3LC7O 3DZIA 1S7CA 3VPHA 2XY4A 3P9IA 3KYCB 1FFXB 1W85B 2X40A 1RQPA 2FEWB 1M3SA 2I7VA 3PJGA 3DL2A 2ZYSA 1Z82A 5M29A 5KYVA 3LKZA 4F3NA 2HL6A 3QX7A 4BDTA 2VCHA 4BXOB 4ASUA 1WYBA 1DPGA 3Q2KA 1QE5A 3M8KA 3KLOA 1NZDA 4DA7A 3IL2A 3H4IA 3ZW7A 3LUQA 1R8XA 2ZTMA 3RRYA 5GHYA 4D4HA 3SHQA 4TKVA 4CCYA 1SVKA 1U5BA 4DCNA 3D3WB 3THOA 5KJ1A 3AONB 3IDFA 3RO7A 1ZGJA 2J87A 1SU6A 1RWQA 3F8TA 3MF4A 1JTDA 4K40A 2WRZA 4X1KA 1IPEA 2PSHA 4GDMA 3C43A 3HUEA 4R2HA 1UKVY 3BERA 1V3TA 1Y3AA 1LPNA 4AZTA 4URWR 4UZEA 1XNJA 3ZDAA 1W5BA 1I13A 3AQIA 4O2BB 1Z6QA 1GA9A 1JR3E 2XGJA 1HE8B 2PD7A 1KTIA 4KWTA 4MCWA 4CM4B 4Q9AA 3W7VA 5FX2A 3HCAA 4M7RA 5DIZA 4L76A 3V9PA 2A9VA 4A8JC 3P71T 1CQJB 4KYUA 2X0JA 2ECPA 1NW4A 2R8BA 5LZ8A 3U7IA 3DEAA 4UBLA 4KQ1A 3GLFB 3D8RA 4DC1A 3UANA 1CZNA 3IX7A 1J90A 5EMMA 1V95A 4BNKA 3OEHD 2OWHA 1FDUA 2SBTA 4OIFA 2DQ4A 2I4LA 3R0VA 2KBFA 3VRHA 4Q3EA 2ZTSA 2COKA 4P38A 3RSZA 4W8GA 3O6VA 4AN0A 4XIJA 4L3WA 2QVBA 4EG1A 4OFWA 4B8YA 1OBHA 4Y1FA 4EDFA 1ZMBA 1M2JA 3A1SA 4IMIB 1TO1E 2P69A 3KVOA 4EHNA 1GZDA 2IFTA 3QEKA 3C8HA 4YCNA 4DPMA 3OOEA 1SAYA 3D0QA 4K08A 1RD4A 5CIWA 2GM5A 1LBTA 5HL6A 4KR7A 3EGIA 3GRZA 2ZIEA 2CMDA 4ZALA 1C9MA 3L8YA 4JELA 1E2FA 1W6RA 3NCHA 3IOMA 4UTNA 1IOLA 2W83A 3R6DA 4X65B 3NYIA 1JIJA 4IX1A 5EE8A 2DOKA 4O8ZA 4PNHA 3EX7C 1N78A 3RBAA 3BBPA 4QL3A 3HUUA 5KJEA 1CFJA 3LYUA 2MMCA 4JBIA 4Q02A 4IHJA 1G7RA 4KAFA 2FUG6 4MUNA 4PZPA 1XKZA 1FS5A 4DR6B 1KHHA 1FL9A 1QG0A 4WEJA 3FHOA 3HJUA 3WK7A 4K2AA 1XA4A 3ZTWA 3EC1A 1BFUA 2QE7D 4JCOA 3PYLA 5DMHA 2X8JA 2ZJZA 4LJKA 1PNVA 2QTHA 2FR8C 2H6EA 2P2GA 5I8PA 4Q7KA 2QRKA 3V80A 4F72A 4MI1A 4Z54A 4G26A 5DSXA 5A6SB 2OAQ1 2JFHA 4FBLA 3KYDB 5E4TA 4W7IA 3C3YA 4PYOA 3AW8A 4M1MA 4LJRA 2NU7A 3C7AA 2H0YA 4LHVA 3I23A 3WK8A 2EWWA 5K3EA 3BQNB 5A9RA 4F6RB 2Z08A 3M2JA 5AO9A 1WXDA 2IL1A 2I2FA 1YZGA 5CB8A 3RFUA 1EE1A 3K9NA 2GD6A 1D1SA 2KX6A 4NHOA 2CXQA 5KHOC 4JJ8A 3NOTC 1JU3A 4J1TC 4AJEA 3K5IA 2FW9A 4B3RB 9LDBA 1U04A 3DYIA 1D06A 4QGSA 2OVBA 4TXNA 3WYEA 3G8CA 3GYGA 3GJ3A 2J41A 4JWKA 4M9QA 2ORWA 1AKVA 2V7GA 3EWSA 5AIBA 4HAYA 4NPAA 1FDVA 2KLBA 2I55A 4DMGA 5J7EA 1VE9A 2BTQB 4YP0A 4NZMA 2QP9X 4AKTA 3OQBA 4QXMA 3KKNA 2F7SA 1UBFA 4FIZA 3ABQB 4L8GA 4B4VA 1DJMA 4UW9A 1O9GA 2GCOA 1OLSA 4QEDA 5LMUB 3GDGA 4I4NA 1NKTA 4G1BA 2DH6A 2VDWA 4JH0A 2XT6A 3SS3A 3RKRA 1T2DA 1CNFA 3MJHA 3QVWA 4RZIA 1LPAB 2EX8A 2GJ9A 1RYDA 1E3LA 4GXNA 2GJSA 1AS3A 5BOHA 3HCNA 4MCAA 5F52A 4G5FA 5JNSA 1PUXA 2Z9BA 4B82A 4AN4A 3ZCTA 4BL3A 4MPJA 1ENZA 4P0TA 1OXTA 5DK4A 3F0TA 3GNLA 4BL2A 5FOTA 1W7AA 4Y9DA 4TS4A 3KR2A 3V4OA 4EEPA 2I2BA 2JGAA 5EWLA 4EQ1A 3TLYA 1A5AB 4RX2A 3GLIB 1SQFA 4WL0A 5IP5A 1EVLA 5ALVA 2WYXA 2VRBA 5JCPA 2RC6A 4WXPA 5T3YA 1DJCA 1A9OA 5BV0A 1ISRA 5LQSA 4U7JA 3BXFA 1W49A 1K89A 1Q6YA 4B4WA 3QIVA 2VK1A 4NXFA 4CV1A 2XXAA 2WYUA 1K7SN 1WRBA 2RD2A 3FWPA 1Y81A 4BX9A 3U9TA 2H1VA 2OB1A 3SYKA 4DRZA 3VAYA 3HC7A 5CLGA 1EHCA 3PHGA 2V3CC 2HF9A 3PUHA 3H1PA 4L4RA 3ND7A 3HKEB 1ES9A 3IQEA 3G2LA 2PR7A 4DJEC 2HR1A 5C1IA 3S7QA 3IIMA 5JCZA 3RAJA 4ZK2A 3COSA 4WM9A 5LP6B 5U9CA 5HJEA 1NPTO 3LY7A 3OX4A 4ZT5A 3QHQA 1JPVA 3ETCA 1YUMA 2C8VA 4JZKA 2CEAA 5EUAA 1F0PA 4J4BA 4HLDA 5FQNA 4PRLA 3VR6D 3ZZUA 4MHSA 4E2FA 1IU9A 4WN5A 2EFYA 2VEOA 3WK5A 4CW7A 5AK3A 3KPVA 4DLVA 1FDWA 1TKBA 2BM0A 1M6HA 2DULA 1QPGA 3BCUA 2BD0A 3G5TA 4AJIA 1OVGA 5KJCA 3D4NA 5DGHA 3HCPA 1VG1A 3R74A 4JI5B 4WF0A 4LG1A 1S9DA 1U0TA 2BFCA 4YPFA 4TTAA 3HSKA 3MGGA 1GUYA 3GVIA 3OQJA 4Q3AA 1A5ZA 3EVEA 1FUUA 4F4FA 1VIDA 4XIFA 1M1UA 3ZVMA 1O5IA 5BW8A 1WB6A 5FATA 2ZB2A 3UMRA 4CIWA 4DLZA 4KJXA 4K9RA 2BE9A 1Y5RA 5KTOA 1PWGA 2HJHA 4WLAA 4GSYA 4QFBA 4GOGA 5J2TB 2BFAA 3BCHA 4IHAA 4IFIA 5DHTA 4LGVA 2Z6UA 2I33A 1RXWA 3DLBA 5EIBC 3VKHA 3TZQA 2I2CA 2COUA 2FF7A 1J2TA 1BG6A 2O20A 2IS1A 1M2VB 2QDKA 2F3QA 5TPWB 3TM4A 1R6VA 1AF4A 4QUDA 2GD1O 1ORRA 1JSLA 1KORA 1ONBA 2RHOA 3UTDA 2CFRA 3OY2A 4B6GA 4WJLA 3CYFA 2E18A 3TTYA 3O5YA 1ZLYA 2ZKIA 2PFGA 1ZIXA 3N8IA 3LFHA 4HEJA 1IG0A 5CD9A 1G3RA 1G8GA 2HK6A 1U6JA 3Q7RA 3RNOA 3KTAB 4DV6B 2JJ2A 2Y59A 1ZHFA 3Q8LA 5EVIA 3ABIA 4OK5A 1NXVA 4FZ3A 3WLFA 4AQYB 4HQNA 2VEAA 5FNVA 3B1VA 1XAHA 1OE0A 5J5AA 3OOWA 2R62A 2VYNA 4FNOA 2EZ9A 4X3CA 3AR3A 4AT1A 2H1WA 1A9PA 2YZMA 2CB0A 4FUWA 4FGKA 2QPLA 4K91A 4ZZIA 5EEGA 1UBKS 4EDHA 5EJEA 1QKIA 3V7NA 1MZUA 1GM5A 4GOND 1BFKA 2MR5A 1L5WA 1QAOA 4O0LA 1TDLA 5CERA 1RYEA 4AP5A 4KDFA 1IEVA 2PWPA 2FFRA 4GYYA 3AY7A 3EOIA 2PIAA 2O3SA 5HM8A 3LC0A 3B48A 4YJ2F 1HFEL 4BWYA 4WKGA 3BULA 4P32A 3R7DA