5HZHA

Crystal structure of photoinhibitable rac1 containing c450a mutant lov2 domain
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
325
structure length
320
Chain Sequence
AIKCVVVGDGAVGKTCLLISYTTNAFPYIPTVFDNYSANVMVDGSTTLERIEKNFVITDPRLPDNPIIFASDSFLQLTEYSREEILGRNARFLQGPETDRATVRKIRDAIDNQTEVTVQLINYTKSGKKFWNLFHLQPMRDQKGDVQYFIGVQLDGTEHVRDAAEREGVMLIKKTAENIDEAAKELGSGGKPVNLGLWDTAGLEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Engineering extrinsic disorder to control protein activity in living cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Ras-related C3 botulinum toxin substrate 1,NPH1-1,Ras-relate
total genus 97
structure length 320
sequence length 325
ec nomenclature
pdb deposition date 2016-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5hzhA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5hzhA01
3ICEA 2PT5A 3SR0A 4JLNA 3SYKA 3MGCA 3E4OA 3QG1A 2WSSD 4F4CA 4YMSA 4MQBA 1VB6A 2AL7A 3KJHA 4TL9A 1QHIA 3GMTA 5HD5A 1JECA 1Z83A 1AA9A 3CBQA 2ZRJA 2NGRA 1LT0A 1VHLA 2ONJA 5KOYA 3SU8A 4C4PA 4G5SA 4JLVA 5LBIA 2ZUBA 3GLFB 4KLZA 2L0WA 1Z3IX 4KODA 1L8QA 2JGNA 1KZGB 1FZQA 1Q44A 2J87A 2W83A 4KUKA 2QN6A 4RZ2A 4L9FA 3SZRA 4BFWA 2R6FA 3FMOB 2ZI9A 2FFBA 5BXQC 1K5GA 2W2XA 1W36C 2WV9A 1H8HD 4P31A 4C0HA 4H9GA 1NN3A 4YMWA 2E9SA 4URXR 3K70C 2WKQA 4WIAA 2V1UA 3U44A 2UZIR 4U5XA 3IDQA 3WRXC 5JEEA 5SZKB 4Q9IA 1IXSB 5BYJA 2O8EB 4NBSA 1WBBA 1WP9A 3B5JA 1W0KD 1IHUA 1OB5A 2QQEA 1XMSA 2A78A 5HDCA 2I1QA 1PLJA 3EAQA 421PA 4M1TA 4L9SA 1VYTA 1U0HC 2FPMA 4LBZA 4YXWD 4RD4A 4ZKEA 3B1VA 3FDIA 1KZ7B 3U7EB 1EFHA 2I3BA 2QG6A 1FP7A 3IEVA 3VE4A 2YWFA 2BBWA 2I1VB 3TVDA 2EQBA 5FPHA 2K7SA 2QZ4A 4YXWA 1TNDA 5L3QB 3EA0A 4CW7A 5DN6A 4BEJA 4HDQB 4RZXA 5IS1A 1MABA 4JKYA 4ZCLA 3WNBA 3MJRA 4ASUD 5H68A 2DFKB 5F9HA 621PA 2JAQA 5GJBA 2IYVA 1YR7A 3QXJA 2H28A 3CR8A 4W7SA 3T50A 1E6CA 4CDGA 4LHWA 2XAUA 5HWTA 3PYPA 1G64A 4ARZA 3SQXA 2ZI7A 1X86B 4HAWA 1IONA 1FQKA 3K3DA 2J3EA 1OFUX 2WMNB 3QEJA 3TUIC 5AJYA 4IDOA 4EPTA 2AWOA 1OHHD 2BVNA 1WDTA 1SULA 3L0OA 1XCPA 2CE2X 2PZEA 5GJWC 4A0RA 1HT2E 3A1SA 3BERA 4M1YA 4XWOA 2VSXA 2DWOA 3EG5A 4LRXC 1PJRA 2Z0MA 4IEIA 2G83A 2J7PA 1V9YA 1G19A 1TF5A 3CF2A 3CWZA 5M04A 1LS1A 3OE7D 4Q03A 4TTRA 4L4UA 4DRZA 4Q4HA 4EFMA 2RGDA 1ZYUA 3FFAA 3K8YA 1G18A 1CJTC 2IUUA 5J4YA 2G3YA 2CK3D 1KI8A 1FW6A 3CW2A 2REXB 2QWSA 5IDVA 4LRYC 1JR3D 1OTBA 5J5CA 4IOMA 2FJUA 4L9WA 4PQRA 4WA7A 1E4VA 3BGWA 2WOJA 3GLHE 2L4RA 1UEIA 1IBRA 2B8WA 3MWLA 5AJZA 1QZXA 3BE4A 1P2SA 2OXRA 5G3ZA 2YKFA 4QJ5A 1R7RA 2Z43A 3ECCA 3SJZA 2HCJB 4WVFA 1O87A 1VIYA 2WKPA 5HR5A 1TL7C 2V0UA 2AKYA 4MGZR 1EWRA 4ASUA 5JJLA 3TGPA 3LD9A 2VHQA 4GOKA 3MQOA 2Q3MA 4ON9A 5FL7D 3LXXA 1YRBA 2Q9BA 4PPQA 1N5KA 1FUUA 1PLKA 2BIFA 2OUKA 1KJYA 3EIQA 3FMIA 4CRWB 3AF3A 4IEEA 2NMVA 2BMDA 4US1R 5FPSA 1HYQA 1V43A 4LBWA 3LFUA 1TU3A 4DSNA 1U0JA 4JSTA 2BBSA 2PR5A 3RS7A 3ZYCA 4D6PA 3PCRB 5DI9A 3WNCA 1X8JA 5C4GB 3A4LA 1UKYA 2ZYVX 4EIWA 1W48A 2XJ4A 1W2HA 3H0KA 4QGGA 1KSFX 1S9HA 4ZCIA 5JJKA 1HQYE 1AS2A 1NG9A 2Q0HA 3LBHA 4Q1AA 1IQPA 3KTAA 2J45A 3SI7A 4M9SA 3VAAA 1P9RA 3F0TA 2CL6X 1FMJA 4PZLA 2RCNA 1F3OA 2QENA 3LUQA 2NO6A 1YJ5A 1XXHE 2O52A 1NVVQ 4US2R 3ETLA 1P2UA 1U8ZA 2BCGY 4AYTA 3GLIB 1GG2A 1ZAKA 4I81A 1E9AA 1QHYA 1R5BA 2CCGA 4AC9A 3AP2A 4EPXA 5KPDA 2AD1A 5J4KA 3LIFA 1XFAA 3IO3A 5FBQB 4KO8A 3PUZA 1ZM2A 1P5ZB 4A36A 1NLYA 3X1WA 3FE2A 4XD7A 1F60A 1E9SA 5HD3A 1XXHA 1LNZA 2JLSA 3U3OA 1RKBA 3AKCA 4IDNA 2XSZD 4GCZA 5BWMA 1XJ6A 5KDOA 1VIAA 3HJNA 1UPTA 2J7KA 4LK2A 3CF6R 3LWNA 4HDOB 4GRAA 3RS3A 2WWGA 521PA 2JLQA 2V6JA 3H82B 2KX6A 4MRNA 2ZM5A 3CF0A 3DVLA 2A5GA 2JA1A 1ZNXA 4EDHA 5FH9A 1N0WA 1OXTA 4GS9A 1GZSA 4KLNA 3WHKA 5CDFE 3HU1A 2OE2A 3ZZ0A 5AJWA 4BFXA 2FE4A 3CRQA 3MWJA 4CYMA 2W2VA 4B71A 1E32A 2Y8EA 1UBEA 1EGAA 3C7KA 4KFRA 1OH7A 2A5DA 5F69A 3OEHD 3TBKA 1SZPA 4BECA 5AUOB 5FBVB 3SNHA 2HDNB 3EWKA 2OT3B 5CYOA 5IT5A 1YR6A 4AY2A 1E2EA 3LW8A 3BIFA 3VR2A 2CE7A 3W3AA 3IBRA 1TQ6A 2YOHA 4O3MA 1OYWA 1VMAA 2N1BA 4BLPA 1Q3TA 4OK6A 2DWPA 1ZM7A 3A0RA 2ZJ2A 4RD3A 4DEXA 2BWJA 5JRZA 4EPRA 5FFMA 3R9XA 2CLDX 2Q9CA 2XXAA 1FUKA 1G8GA 1ELOA 3I72A 4A9AA 2R9VA 1NBME 5HDDA 2YV5A 3CIOA 1W44A 3CONA 4XOIA 5FTJA 4IVQA 1BYIA 1P9WA 4PKYA 4OK3A 3CLOA 1CRQA 4LJ5A 1L7VC 1COWD 4DUGA 4RFSA 5IF9A 2P2LA 2V7QA 2ASEA 3FC7A 2WKRA 2HF9A 2YC2C 3T15A 1F5NA 1TPZA 4OQFA 1DAGA 4IVPA 4QFMA 2J0UB 3JZAA 2R6AA 1D6JA 2REOA 3O8BA 4XSGA 1X8LA 1YE8A 4MRSA 5DYIA 2IWHA 5AUNB 2PCJA 1SHKA 3LO5A 3OESA 3ZD6A 2D62A 1GM5A 3FYHA 3UG6A 2BOVA 3TW8B 5DSZA 2V1BA 3S1AA 1EFTA 4RVCA 2WTUA 2NO1A 4Z54A 2YKHA 3QXCA 5I5LA 4GT1A 2IS4A 3H9WA 2H92A 3BWDD 1CJMA 3BRWD 3HYRA 4BZPA 3ZQ5A 4A15A 4OBEA 4MKFA 1VG9B 3OEHA 2H17A 3A6PC 1DTSA 1AS0A 4L8GA 4H6JA 4NTZA 1KI2A 3PFIA 2C98A 4UKDA 1CULC 1NG1A 2PT7A 1LSVA 1P72A 1NLZA 2XX3A 3BORA 4ZDIA 5G41A 1VPLA 3CPHA 3W5IA 4B44A 1KK1A 2ZYUX 5B64A 4TYYA 1ZNZA 2F55A 1II9A 1MKYA 4K46A 4ZKDA 1HA3A 3T06B 1W36B 2IYXA 1E1RD 2W6IA 2J41A 4GHIB 2F3TA 1KK0A 2GZAA 4ZO4A 4L9GA 1XD2B 2V1AA 1IN5A 4MRPA 2L1MA 5EFWA 4Q9KA 3QKUA 2YKGA 4D4MA 1EX6A 5EXPA 4M4XA 1KI6B 2GF9A 4QRHA 3HJKA 4B73A 1IY2A 4QBFA 4JL5A 3W6PA 2IA5A 2JEOA 5FBWB 2GK7A 1OYYA 5BQ5A 5KSYA 4HDCA 1NN0A 3FB4A 5E7MA 4HLUC 2MMGA 2J0QA 1S1ZA 4PZZA 5HSQA 1T3SA 3Q8XB 1OH8A 3QVUA 4QJ3A 3AQ4A 3A1UA 3VHXA 3EWSA 5J40A 5J4HA 3IEUA 4HZUB 4J0QA 4QHTA 4B74A 1OTEA 3THXB 4RCZA 5C18A 4FCTA 2WPDD 4DCSA 4DIDA 3FKSD 2MMCA 3GLHA 1JR3E 5SZIA 4TLCA 1KAOA 2JDID 2ZE6A 4JYCA 3KQUA 3QXSA 2PX0A 1DAKA 3BWLA 2OBLA 3REFA 5J7EA 2YINC 1U98A 1OHHA 3CNNA 4FN5A 2QSZA 3G0HA 2XOKA 4MUBA 5DJUA 1M74A 4XTRA 1S4QA 3R8FA 1EX7A 4LV5B 1PLLA 1QVAA 5CK4A 4FCVA 4W5WA 3E2IA 1E79D 4RD0A 1CTQA 2GJ8A 1IAQA 2C9YA 3OIYA 4IDHA 3W3ZB 2IS6A 2W2TA 4NXGA 4M4SA 3FVQA 3EIEA 4PQFA 1RRGA 3LVRE 1N6HA 1OXXK 3FHOA 1Z63A 5DKLA 1G4AE 1XTKA 2ZJAA 2CJWB 4XSHA 5GJVC 4RFVA 1RJ9A 3K0FB 3F1OB 2NG1A 4JLBA 4AYWA 2ZRGA 4Q7KA 1JXOA 1Z22A 2ZREA 2WWXA 4AIIA 4NMMA 4YC7A 1AJEA 4LJ9A 4XJXA 3LIEA 3ZZUA 3VOLA 5FUXA 1OT6A 5HE9A 2OLKA 1G5TA 3RWOA 3U4QA 3RDPA 4Q9LA 4MUAA 4PAMA 3HR8A 1G7CA 3WY9A 4KFTA 4LRZE 3RTYA 3A4NA 1GSXA 4DBLC 1X0OA 4QNRA 4EEUA 2VSOA 2JLWA 4IDPA 2E1RA 3D8BA 1N25A 1CR2A 4YWZA 1Z2AA 4FCWA 4NYIR 4UJ3A 4B32A 2PMDA 4IXMA 3L0SA 2X2FA 2ZRKA 1GL7A 2ODBA 3L0IB 2V9AA 2WWHA 4LYHA 3TAUA 4JGQA 4PPFA 2GAAA 1G28A 2QBYB 3KJEA 4E03A 1GOTA 1W1WA 2XNDD 4C0BA 2HXYA 4GOJA 2JCSA 2NZJA 4HB2A 3L0PA 2IEZA 4I3JA 1NN5A 2XOKD 1K5DA 3EZFA 4RD6A 4NXFA 1F2TA 1WMSA 3TRFA 3UMSA 1U8AA 4OI1A 721PA 4I3AA 2DYKA 2KBFA 2NO0A 2QT1A 3ICYA 2ZI4A 4NYMR 4WLAA 2O8CA 2O8BA 5L3VA 1UBFA 2QGZA 4Q21A 3NDPA 1XJ0A 2ZR7A 1RE0A 4Q1FA 3KFXA 4X8MA 2QT0A 4BRUA 2HYIC 2XGJA 2I9VA 3NOUC 1XEWY 2FEMA 1X1SA 2W58A 4Q1BA 2QM7A 5CIQA 5HCNA 4E07A 2M1CA 2ANCA 3VNVA 3GLHB 5G40A 4OHYA 3SJCA 1P61B 5EP4A 1YR8A 2IL1A 1IN7A 1JB1A 2F6RA 2Z5FA 3EA5A 2GXQA 4TYPA 2O0HA 1S9DA 1G4UR 4G3XA 1D2EA 3SJBA 3CPEA 1DAFA 1G3QA 3B33A 1MO6A 1KI4A 5L8VA 3RRZA 1P9NA 4BZQA 2GXAA 1UJ2A 5HZKA 3EPJA 1KO5A 1VG8A 2J1LA 1US8B 4MN5A 3GDIA 4Q1EA 2CDNA 2CK3A 3CM0A 4V02A 1DG1G 2XB2A 4Z1MD 3F5FA 3BS4A 2DR3A 1AGRA 2XTMA 2JJ1D 2ZRMA 2OBNA 4XIGS 1Z0IA 1T91A 1U0LA 3KZ1E 4QHSA 2OSBA 1EFRD 4C7OB 1IM2A 1WF3A 2ZTSA 5LPNA 4Q9HA 3NWJA 5EZ5A 5E3HA 2V54A 5B2ZA 4CT4B 2PMKA 2FSGA 2BCJQ 3RRYA 1N9OA 1ZJ6A 4RD2A 1E4YA 4BRWA 2QSYA 2XNDA 1OV4A 3ICQB 5F98A 3BH0A 1EFCA 1N6LA 4CT5A 2HCBA 4DEYA 4BPBA 3B82A 1P75A 4TSFA 2B21A 3H82A 1QF9A 3DM5A 2OCAA 2IXGA 1P2VA 4JVLA 1XJ2A 2C8VA 1A5TA 3PJRA 1Z2CA 2YNMA 5LB2A 4TN1A 1TF2A 1J2JA 4HP4A 4JVNA 3TJZA 1QHHA 4KQDA 4D2IA 4PZYA 2IYWA 1Y28A 4JJKA 1KO4A 3QF4B 1A1VA 4OQNA 3VR3A 2FGKA 4OHWA 1UKZA 2X1VA 4LI0A 1U90A 2YC4C 4BFSA 4JLAA 3O47A 3UG7A 3KKOA 2CHGA 1RPZA 1WB9A 4LV8B 1T19A 3MRSA 4V0OA 2WJHA 1T3LA 3ZQ6A 3ZQJA 1KY3A 2LKDA 4JL6A 1HQCA 1E3MA 1T1AA 1T9HA 3IHLA 1AZTA 2Q6TA 1XPUA 5TARA 3AF4A 2Q3FA 1G5RA 1ZIPA 4BBVA 1YU9A 3IO5A 4KBFA 4XTCS 1ZC3A 3S1AB 5DE3A 4A0GA 1T5IA 4WUJA 2CHQA 2D3WA 4RJLA 3VQTA 2ZRPA 1NVWQ 2CL0X 3Q5DA 4IJMA 4JJZA 2ORVA 4G5RA 4WXPA 1K6MA 4PHHA 2ORIA 4WZAE 3CWQA 2RHMA 3G6OA 1E0SA 2CNWA 3GJ4A 4IOKA 4DCUA 1W5SA 2A5FA 4G5GA 1SVWA 3KXIA 5A8BA 3HP1A 4FMDB 3A0VA 3WBJA 4TLEA 1QG2A 2FGJA 2CL7X 1KSJA 1LSWA 2X2EA 4F3LB 2ZJYA 4URYR 4H1VA 4P32A 5TDHA 4LSGA 3P7NA 1E1QD 4MYHA 2OFWA 2WPDA 2ZQ5A 4ILEA 1JQLB 1TADA 3AKDA 4XWAA 3Q3JB 1XFNA 1G7SA 1LVGA 3LLMA 4NH0A 2GJSA 1ZP6A 3IS2B 2J0SA 2UVQA 1XWIA 4IHQA 3RC3A 3VR5A 1OFTA 1ZUHA 1NMXA 2QNRA 2VBCA 2ZJOA 1XZQA 2J9RA 2OHFA 3KB2A 3LRPA 2BM0A 4IW3B 3NEJA 4B3CA 5CB8A 2ZEJA 2CEAA 2ANBA 2OG2A 3EZ6A 1P0ZA 1U81A 4RCYA 2DFLA 3U7FB 3ADDA 3I73A 3UMEA 2IHBA 3K9HA 1H8HA 3GLIE 3RVBA 3ZH9B 5JMTA 2ZRLA 4US0R 1A7JA 1HTWA 1UDWA 4Y0VA 3HPRA 5TBMB 4HQAA 5TY0A 3Q5EA 3DOEA 3V4RA 3PUWA 4F4JA 4E22A 3RC8A 3H1TA 4QOSA 3B8HA 1N6RA 4MYUA 4ACBA 5KSOA 1EFRA 4JZKA 4JYBA 1NSFA 1E9BA 4QJ4A 121PA 4GS9B 4DZZA 5DI3B 3AUYA 2AHOA 2PD8A 2ZSAA 1IJFA 2P7JA 3GQBA 1E2KA 4Q4AA 3OEED 3DKVA 2FN4A 4RKFA 1G17A 3C14C 2HJVA 3FKSA 2AXNA 3NG1A 2Z6DA 1OJLA 3DZ8A 3RSLA 4F92B 1R10A 2H18A 2WIBA 3CLVA 1AQUA 5FUVA 1BS1A 4F38A 5B58C 3LDAA 3QNUA 1U9IA 1S2MA 4KSCA 4DCNA 1CP2A 5JHGB 1Z0DA 2W0MA 3EWAA 4M53A 5H1YA 4D4LA 5HKKA 2DHRA 3CNLA 3KB1A 1Z6YA 1KNQA 2W00A 3GEEA 4OYHA 3T12A 4JLJA 4LJYA 3TKLA 2H16A 4HUQB 2VEAA 4JVSB 4HB0A 3LX5A 3ZDQA 1NY5A 1ZC4A 2Z4SA 2WSMA 2A9KA 2B02A 1QHXA 2XTZA 5FL3A 5FOWA 2D7CA 3SHWA 2QJ5A 1E2LA 3OIWA 2IYRA 2JASA 3K3CA 1B0UA 3OFND 4KYUA 3VR1A 1VCNA 4CVNA 2QAGB 1E9CA 2B8TA 5C1BA 1N6PA 5P21A 1G6HA 1X3SA 4TTPA 4UNPA 1HUQA 4HYYA 3HU3A 3K0SA 1VG0B 3DDCA 4TL6A 1JAIA 1TS0A 4RSGA 1EESA 2D7DA 2OM2A 5JFGA 4Z8YA 3OFNA 1TF7A 4OK5A 3K1JA 2QP9X 3I32A 1WA9A 4KCGA 4QBIA 5FR1A 2ECKA 1OT9A 3W8RA 1DO0A 4HAXA 3QQ5A 5J47A 2OOLA 4N1AA 4GL2A 3Q7QA 1E94E 2GXSA 3TR0A 5KNDA 5JSZB 2OXCA 4F7WA 3UXMA 3E4PA 2FU5C 4PSVA 1HH4A 1Q12A 2RGNA 4MKIA 1YZTA 3C2WA 2HLDD 2VLGA 4M9ZA 5J4EA 2JHEA 1SKYE 2QQ0A 2QRNA 3KKNA 3RSOA 4CIDA 3MXQA 4DLVA 3QVVA 5CIWA 4DB4A 3K9GA 1RYFA 1OJ5A 2GRJA 4NXBA 3VE3A 2ZRHA 3VNUA 4LPZA 4ZI2A 2YOGA 5HWVA 1FTNA 1S0UA 1GL6A 1KDTA 1DAIA 1Q22A 5B30A 1GITA 1UBGA 1T8TA 5JCPA 3AF1A 1C9KA 4JGRA 3FMPB 1II8A 2H57A 3U3RA 2C9CA 4EETB 2EA9A 1ZBDA 2VPPA 1YR9A 2ZYTX 4DKXA 4XVUA 1TTTA 1XJ4A 5HCIA 2CLCX 1NWZA 2WWFA 3KKQA 1OFHA 1TQ4A 3UMRA 4XWKA 3OIVA 1MZUA 3GEIA 3QPWA 5FTLA 3GLGE 2YZ2A 4WN5A 4R71A 1KO1A 4PQYA 4B47A 3ASZA 1KHTA 2QBYA 3QEOA 4YQFA 3UPUA 4MDFA 4TSFD 5LD2C 2ODNA 3BK7A 2P65A 4M8NE 4BFZA 2QI9C 1G6OA 5F6AA 3DM9B 4PHGA 5IK2A 2SHKA 1CR1A 4LDJA 2J46A 3F8TA 2UKDA 3EW9A 3WXMA 2O8BB 4TLDA 1RVDA 4PO9A 1ZCBA 3DKPA 4URVR 4B6EA 4B75A 3U6BA 4AYXA 3K0AA 1KKLA 3DEFA 4FWTA 2ZI6A 3TAHA 3VHLB 1F2UB 2WVJA 4EJSB 1OXSC 1AQYA 1JNYA 4IDQA 5FR2A 2QPOA 1VYUA 2QE7D 1XF9A 4DLRA 1ZNYA 2Z4RA 1Q1QA 4B2LA 1DBSA 4P4TA 3K09C 1FP6A 2ZR9A 4TTQA 4CEJB 2NO9A 1NBMA 3UB7A 4HI4A 2RGBA 4TYQA 3QXHA 2IEYA 4UNNA 4AWXA 2JLXA 4O0MA 5DYGA 1CRPA 2PL3A 2VP5A 3FTQA 4Q7MB 3I62A 1Z0FA 2JATA 1D9ZA 1QHNA 2NPIA 3R7WA 2QGNA 3PITA 2QMOA 4A0FA 4Q18A 3KXKA 1ZM4A 3LA6A 1KDOA 2F1RA 3WRYC 3O8RA 1N0UA 4V03A 3T5GA 2JLVA 4TQAA 3MLEA 2IUTA 5AJVB 3N5CA 3PUYA 3I61A 5H8WA 4PSKA 3QJYA 4M1WA 1XCMA 4WL9A 2IYSA 3K0AB 1XMJA 4HZUA 4QGFA 5EQTA 3KDSE 3TNFA 2HV1A 1GNQA 3QG5A 1QHHB 4FWIB 4IVRA 1KO8A 4LCBA 1Z6TA 2R62A 2C5LA 1U99A 1S1MA 3K53A 2V4ZA 3NBFA 2F9MA 3T5DA 3F1OA 4D0LB 4ZDJA 3ADCA 3ND9A 4B9OA 2PHYA 1BYWA 3AKEA 2D06A 4AI6A 1TX4B 4JT4A 2JLRA 5KHOC 3SS8A 4EFLA 1WCV1 4DLSA 1OTAA 1DP9A 4HJ3A 4I39A 1RZ3A 2MSDB 2LWIA 3CRRA 5DH9A 3LI8A 1G7RA 5SZHB 4B35A 4B3GA 2O8FB 5F9FA 1NLFA 1JI0A 4NDZA 1I4DD 3VX4A 5KPJA 4TMXA 3WMFA 3NHBA 4MYCA 5TV2A 4KU4A 3RLFA 1J8MF 4BFVA 3BJIC 3GLFE 1SKYB 1OFIA 4HSEA 4KITB 1G3RA 1KI6A 1DARA 1XTSA 2PZGA 3D3QA 3QKSA 2F43B 4FXPA 4JLPA 4IFBA 5BN3A 1L4YA 1PUIA 1ZVQA 4B43A 1Z47A 1GNPA 2IX3A 5J4VA 4U7DA 1ZUNB 1D2NA 1NIPA 3NBZC 4FD2A 4JMPA 1GKIA 4PO8A 2DCUA 3B1YA 2BMFA 5E95A 4GP6A 3QBTA 3KQNA 1QDEA 4HLCA 1GKYA 4GMDA 4EUNA 1VHTA 1LW7A 5DGXA 4P4UA 4NZYA 4BLSA 2WIAA 5JLJA 2J0VA 3IS2A 2UZ3A 3THYA 4UNSA 2HF8A 5A0FA 2PEZA 4CZ2A 3I5YA 2A2ZA 3PIRA 4PPNA 1MRNA 3ZVLA 1JPNA 2VP2A 3U7GA 2C03A 3SBEA 2VEDA 3BBPA 1Z8FA 2XSZA 4Z8XA 1N5JA 5KYKA 4HAYA 5K8TA 4TMTA 4OI4A 3BY8A 4P4SA 2FZLA 2RGCA 1BMFA 2VO1A 3NVAA 5H70A 2P67A 3CX8A 3D31A 4EQ6B 1I2DA 5HKKD 2BEJA 3PEVA 4DCTA 2PX3A 2QMEA 3LW7A 2XZPA 4EJSC 4XT2A 1N9LA 2GILA 3R9IA 3FKQA 2RGNC 2WBLC 2FOLA 1NF3A 4R9UC 1N6NA 4FI3C 4Q47A 2RB4A 1VDZA 4U02A 2ZS9A 3UB8A 3OE7A 4Q02A 1KSGA 5J3WA 4I99A 5FOUA 1CEEA 2GZDA 4GP7A 5KNCA 4QKQA 1OSNA 4DT1A 4DHEA 1Z0JA 3IQXA 4C3ZA 3ZZTA 2GDJA 1T5LA 3DO6A 2NOAA 4PAOA 1YZGA 1OH6A 3AEZA 4DSTA 1SVLA 4ZDKA 1LFDB 1XEXB 3AVXA 1SXJC 4EXOA 2J7PD 3AUXA 2C78A 4GBMA 3OHMA 1KMHA 2GVDC 1R5NA 4FMDF 4OKSA 3K70D 1G8FA 2EFHB 5KSPA 1KOUA 3BB1A 1R0WA 3VU9B 3T1TA 4Q7JB 1I4TD 2BBOA 2PYPA 1NL3A 2WJIA 5ANRB 3SYLA 2QUZA 3LIAA 3LBIA 3A36A 4BGDA 3T1QA 2P6RA 1JJ7A 2Q3HA 8OHMA 1U9IC 4KBGA 3R20A 1UAAA 4BEBA 3EZ2A 4QC2A 4GFDA 4LPKA 1SVMA 2CCJA 3SN6A 4HUQA 4RFSB 2VH5R 2QPTA 4HP9A 3D6TB 2OAQ1 1SXJE 2HJGA 1KMQA 1EK0A 3A4MA 3MUFA 2DPXA 2VHUA 4M0LA 1DS6A 1JXMA 2BDTA 2G6BA 4NYJR 4URZR 4DJTA 1HE8B 3AGPA 4G5OA 3GJ0A 3ZVMA 2JJ2A 3AH8A 4NYIQ 2QPAA 2ZIAA 3I8XA 2RGAA 1OIXA 2RGGA 5DO9A 2X77A 1XP8A 2ZAMA 4G0NA 1LS6A 1PUJA 4PO1A 4EQ1A 3WP1B 1DP8A 3UMFA 4EPWA 2AWNA 3PUXA 5IK2D 4P3YA 4C30A 4A8JB 4PANA 3QKSB 4EPVA 3GJ5A 1XPOA 3TVTA 5L3QA 4M21A 1PVOA 2V3CC 4PAQA 4M9XA 1S4SA 2Z6CA 2EYUA 1DE0A 5CITA 5JJIA 2X8AA 4NYMQ 4HATA 1JR6A 4NKRA 4RZUA 4A1FA 5LD2B 4ITRC 2V55B 2C99A 1CR0A 3AF2A 1Q57A 3P26A 4A2QA 1XTIA 1G41A 2PLFA 3AVYA 3PXGA 1W49A 1QBKC 4I1VA 4LYAA 2OWJA 4ARZB 5BN5A 1A4RA 3A58B 5JSZA 3B7GA 1Z6AA 2V6IA 1G16A 3C5CA 1WQ1R 4Q4LA 3UK6A 2AK2A 2C96A 3IBYA 4BLTA 4BUJA 4LV6A 2MSEB 5JWHA 4QXAA 1E0AA 2FFHA 1RRFA 1IN6A 2ZI5A 3F1PA 2DFTA 5BN4A 2GCOA 1UDXA 3REGA 3EIHA 3QUSA 1M8PA 5G4YA 4D25A 4TWZA 3CRMA 4L5BA 4C0SA 1Q0UA 4NPHA 3X2SA 4DVGA 3SQWA 3CZQA 4JIMA 1E2PA 2AKAB 2ZITA 4G1UC 5FPTA 3L2OB 3GLFA 3P4XA 3EX7C 3MCAA 4PKYG 3MSXA 4JLMA 1GRQA 4KFSA 1DAEA 1KMHB 4DC9A 4KI0A 5ELXA 3NDBB 1W2GA 2FX3A 5LDDC 5L3SB 4HY8A 5AK0A 5GJCA 4C0LA 3EC2A 1P3JA 4Q1CA 4UJ5A 2D74A 2ZRFA 5KSZA 2P5SA 4WW0A 5JI2E 1M34E 4Y0AA 3SFZA 3WP0A 5EE1A 3U7HB 3IIKA 1X1RA 3A1VA 4S2EA 4C9BA 3NHQA 1N6OA 2MSCB 1N9NA 2ZRCA 3QIAA 2ZU0C 5DKKA 1Q1BA 3KX0X 3FMFA 2ZE8A 4LBVA 4B3DA 1ETUA 3MR0A 1W4CA 2W0SA 3OIUA 1CF4A 2G88A 5AVEA 3HYTA 5EXXA 3THWA 3T61A 4L9EA 1SQ5A 3LICA 2EFDB 3CZPA 4QNMA 5FBRB 1NJGA 4YONB 3X1DA 3PG5A 3GECA 1RC8A 2Z6VA 5G53C 1NBMD 3QKRA 2R44A 1H65A 5IHPA 1Q20A 5HDSA 2E87A 2GEUA 4CF7A 4KV9A 4DLXA 1WRBA 3LBNA 4YMTA 3QPUA 5TBMA 3X1YA 3GLGB 5HTKA 5EUMA 1TS7A 2HUPA 1T18A 3F1NB 4JGPA 2L0XA 4XD7D 2ODWA 4Q01A 4QM7A 2ORWA 2R78A 4ACAA 1FX0A 5TB5A 1N5LA 2ZOHA 3JVUA 1E2FA 2FFQA 2KWIA 3OAAD 1W5TA 3NEYA 4P0TA 4AK9A 2FH5B 3GP8A 1WBDA 2QTFA 1IN8A 1ZINA 3KFVA 2PJZA 4UXIA 5DI3A 2VP4A 3TSZA 1OXVA 1MH1A 3FOZA 2EFEB 4TL7A 3ASYA 3BD9A 4XVRA 1XTRA 2F1HA 4HAUA 1E9FA 1XFQA 4WZ6A 4EW7A 5EE0A 1FPMA 3LI9A 3GJXC 4X8LA 2VSFA 2IK8A 1CXZA 3RS5A 1BOFA 2FSHA 5EXTA 1W46A 1T1BA 1QG4A 3C41J 4V0MA 2WJGA 1J70A 2XZOA 1ANKA 3AV0B 3M0EA 3TIFA 3AVWA 4A2PA 3D7MA 1GRNA 2ZI3A 1AKEA 2KSQA 3BY9A 5JCZA 1W47A 1N6IA 2ZSBA 4V0KA 4X8OA 5AUPB 2QHKA 4G5QA 1F2TB 1JPJA 4BFTA 3GD7A 1LF5A 4KFUA 1E99A 1G291 1RYHA 4ZV4A 5EE9A 3ADKA 4CEIB 1AIPA 5E7JA 1SKQA 3NXSA 2AK3A 2OILA 1U8YA 3LLUA 1LTQA 1TS8A 1YZKA 1XTQA 1C4OA 4M1KA 4NCHA 2IWRA 2EVWX 3M6AA 2I4IA 2RMKA 2AFIE 2QTHA 4LRWA 3UKDA 1CJVC 1M7GA 2G1KA 3LAWA 2G0TA 2QY9A 2QE7A 3PHYA 1N2CE 2OCPA 4KVGA 2DB3A 1Q3HA 1E1RA 2W6ID 5CJPA 3F1PB 1XMIA 2A7QA 1O3YA 1GP2A 2W6JA 3M4YA 1UKVY 2C95A 1KI3A 1JR3A 3FG8A 1MR3F 3THWB 4DLTA 1OH5A 2WWYA 1KNXA 1XJCA 3DMNA 3KXLA 3PVSA 2B92A 1HE1C 3GJ7A 4JLDA 4H6JB 1COWA 2FWRA 3NHAA 4NCKA 4DUGD 4D81A 1T1CA 4LOAA 5AJXA 3QE0A 4F4IA 2GTPA 4A92A 3WYAA 4QBGB 1US8A 3CWFA 4DIEA 4LYJA 3KTAB 1UM8A 3ZS9A 4DDWA 2FMXA 3BC1A 3C8UA 1WE2A 2GF0A 2P3SA 3K9NA 1HY3A 1F2UA 4EJSA 1FX0B 3KL4A 1A2KC 3WYFA 3MWYW 2QM8A 4V0ME 2GZHA 2QU8A 3FGNA 3LIDA 4M1SA 4BLOA 1DEKA 3T34A 1GDDA 1ZD9A 2AFHE 2ZSFA 1XDBA 2HEIA 4TMZA 1VKJA 1X8KA 3Q72A 4ZIRA 3TH5A 2KBEA 1QHGA 1RFLA 1SVSA 3FHTA 1FTSA 4NONA 4MKGA 3UIEA 4D0GA 1S3SA 5AR1A 1XZPA 1XD8A 3NC0C 4NYJQ 2PLRA 2G9NA 3AVPA 3H86A 3JVVA 1NY6A 1E79A 1R2QA 4OQXA 3RWMB 4AKIA 2VHTA 4FIDA 4PHFA 1SVIA 1W0JD 2OLJA 1ZUIA 2P5TB 5DHAA 5KO2A 1G3MA 4UNQA 3AM1A 3BH7A 3V00A 2R6DA 3CUEF 3RS2A 5CYPA 4NL4H 5JWOA 4S35A 1NSTA 1EG7A 3QENA 4FMCB 3AP3A 4IOLA 1GSWA 1FOEB 3E5HA 4M1MA 1XNJA 4WAUA 2ONKA 3WMGA 1D9XA 4K81B 1E2GA 4Q00A 3FWYA 2CLSA 1E2JA 1LSXA 4TMWA 1NP6A 4O25A 4R98A 2AX4A 5EE5B 5DISB 1P97A 1NRJB 1CKEA 4FMBB 5IU1A 2OAP1 4JLOA 4HLDA 3U60B 4I3IA 1CJKC 4KYIB 1ZIOA 4GHIA 2NQ2C 3UB6A 5KUTA 1M2OB 2CHVA 5FTMA 4DXAA 1D7EA 4BQSA 3SW1A 2BBTA 2VP9A 1Q1ZA 1II0A 2ZROA 3EZ7A 5FBLB 3GLIA 2QP3A 3AVUA 5DLQC 1TQDA 3ZIAA 3ZGXA 1JJVA 1P7CA 5EZ6B 1AS3A 1XEWX 3FFBA 1KYIA 2ZUCA 2INWA 2VA8A 2BEKA 1RJ9B 4HH3A 3BOSA 1MT0A 3K0FA 2QTVB 2KJQA 3G5UA 3PEWA 2ZE7A 1BKDR 5FOTA 1E1QA 3HWSA 2VF7A 4E5UA 1GSIA 1M6NA 4ESHA 3VKWA 2XTNA 2A24B 1M1YE 2XNSA 3U3JA 4MA4A 4PSAA 1KJZA 3GJ3A 4OQLA 1KGDA 3UWOA 5EP3A 2R6GA 1KIMA 4PC2A 1DO2A 2IYQA 4R2HA 3NBYC 4LZZA 4Q7LA 2ERYA 3G82C 1IXZA 2GAOA 1W0JA 1KK2A 1W36D 5EE3A 4D0NA 3VTKA 4BLRA 4XVQA 1W0KA 1G9XA 1BYUA 1KI9A 3KKMA 3QY0A 5GVRA 1W4RA 3D72A 3RABA 4AD8A 2GCNA 2XEXA 3NH6A 1G5PA 2WAXA 3TSWA 2V0WA 2VV8A 5F5YA 2QAGC 1E9RA 4B2IA 3A1WA 4HHDA 4Q1DA 3TK1A 1N6KA 3BXZA 3K09A 4QGHA 3LQQA 4W5HA 4A2WA 4V0LA 5LB4A 5SZJA 5K8UA 3GFTA 4LBYA 1VCIA 4HB3A 2O8EA 1H8ED 3UB9A 2OZEA 2ZR0A 3ZS8A 4CGZA 1ODFA 2D02A 2VRWA 2ZE5A 5CM8B 5A4JA 2W6JD 1W4BA 4Z1MA 2ZRIA 1FNMA 3MD0A 4OL0A 5FI1B 1DVRA 3IILA 5L3SA 2A30A 3DMDA 2JLYA 4PPGA 4Q4AB 3C5HA 3N70A 4JSYA 4WOPA 4RKEA 3QBVA 2PDRA 2O5VA 1ZM9A 3IIMA 4PFSA 4TMKA 4CEJA 2J5XA 4DCVA 1T3HA 4GPTA 2Q9AA 3GFOA 2VV7A 1J90A 1GRRA 3DHWC 3M1IA 5E7IA 2ZJ8A 4AKHA 1DELA 2X19A 4I1SA 4POAA 4LC0A 1RRPA 4TLBA 2D2FA 6Q21A 2NPFA 1E2MA 4PTLA 3GJ6A 4CEHA 3EPLA 1VCMA 3EC1A 3BFKA 1VG1A 2Z83A 1YRAA 3OF5A 3RAPR 1LF0A 1XEFA 5TMPA 3R8CA 4Q48A 3T1OA 3B9PA 3BB3A 2ZJ5A 3EZ9A 3SE0A 2GEVA 5GVSA 2BJWA 2GJ9A 3U61B 2GHIA 1G8PA 2QEQA 1JALA 1ZCAA 2ERXA 3NKVA 2VHCA 4JBXA 3JZMA 3CH4B 1UGUA 1IY0A 4QL3A 4MDEA 3A1TA 2OWHA 3A0SA 1TEXA 4DDUA 1VTKA 4NCIA 5HE8A 1KAGA 1T6NA 4AG6A 1YQTA 2FFAA 1SGWA 3GJ8A 4HAZA 1XPRA 2B7BA 4R38A 1EFUA 3V9PA 1JBKA 4MGYR 4TLAA 4Q4HB 1CIPA 2C04A 5C46F 2QL6A 2EFCB 4C2UA 3BAFA 1E96A 4GSYA 4LYFA 3VKGA 5K8LA 1T8UA 1II8B 3B85A 4MH0R 4RD1A 1KJWA 2GVZC 4LJ8A 3VR6A 5CM9C 1ZNWA 3CRVA 3NH9A 2GXUA 1BO6A 1AM4D 2JJ8A 2OCYC 3DZDA 3ZIAD 2LKCA 4KJZA 1UADA 1ZU4A 4P4SB 2IF2A 2V7QD 4O2RA 4YDHB 1DAHA 1OIVA 1VCOA 3A37A 1MO5A 2VYFA 2PZFA 2FV8A 4CEIA 2IF0A 3DL0A 1KDRA 4N3NA 4OHZA 1IXRC 1Z28A 2CVHA 2H1LA 4EKDA 2VV6A 4LC1A 1ESNA 3RYTC 5DN6D 2QORA 2BC9A 2WAYA 1CS4C 2ZVPX 4LPSA 3O8CA 1XJQA 1OTIA 4V0NA 3O8DA 4K8OA 2OV2A 1NIJA 2GBLA 1JEEA 3E70C 3LH5A 4KSBA 2CXXA 3MQQA 1XB2A 2Q21A 2VF8A 4NXEA 3SHFA 1KOFA 1P60A 1XEXA 2PEYA 4OJKA 5D3MA 3EPHA 4LX0A 4D26A 3B1WA 3IPYA 1Q1EA 1KY2A 1NKSA 3B2EA 3KQHA 3RS4A 3QI2A 5DHFA 4F3LA 2GESA 3A8TA 3TQCA 2ZANA 1IN4A 3ZVNA 2NO7A 1MO4A 1J99A 1XCGB 3AB3A 2YHSA 3IPXA 3T1VA 3LXRA 5B57C 4LJ4A 1UFQA 1G3UA 1XRJA 4OI0A 2P6UA 1CLUA 3MAAC 1Z5ZA 5BYKA 5HWWA 4JBYA 3W9YA 3AP1A 3IIJA 1N5IA 5C2JB 2V8OA 1GTVA 3THYB 4BFUA 5CJ2A 2BKEA 1OKKD 2ZU6A 4TMVA 1ZM3A 1KTVA 4R3AA 5E4FA 3P27A 4ZPXA 3W6OA 2PJRA 2IHYA 2VP6A 2FDCA 3CX7A 2O0JA 1PZNA 4OHVA 4AG5A 4ZIRB 4PHTA 3KX2A 4HZIA 2GBLC 2YOFA 1E9EA 4KHZA 1XBTA 2RH5A 4LHXA 4M1OA 4DSUA 3P32A 4YDSA 5G4ZA 2ZPTX 4HUTA 3RRMA 2D4HA 4Q5IA 5FL7A 5FTKA 3KJGA 2QA5A 2D2EA 5JS8A 2YVUA 1MV5A 2F1JA 2CMNA 1M7BA 3UATA 3GPLA 2REBA 5KDLA 4TYWA 2W0NA 3B6EA 1CR4A 1SXJA 1HV8A 1T4GA 2GETA 2C2HA 3I1FA 3GLGA 1JNUA 3QSYA 2BMEA 4OJQA 5JZVA 3ZLJA 3MJQA 3GEHA 1U2RA 4TT3A 4GZLA 2R65A 1AGPA 1GUAA 1FNNA 4GDFA 2B7CA 4DJ3A 2B6HA 1KI7A 4LHVA 2P0EA 3U4QB 1IOZA 3QPVA 3P1JA 1P73A 2OESA 4OHXA 2H5EA 2OBMA 1DOAA 1R0YA 2N42A 2GJAA 2YYZA 4NCJA 4WZBE 1R0XA 2FEOA 1GAJA 2QROA 5FPYA 1J8YF 2FPLA 4IXNA 2EWVA 4X8HA 4HJ6A 4I4LA 3WHLA 4JL8A 1F9IA 1MOZA 3I3SR 1AN0A 1OTDA 1R0ZA 5JS7A 1SHZA 2F9LA 1DADA 1FMLA 2R2AA 2ZXUA 4TZ6A 1D8TA 2JIZD 2OCBA 2QAJA 2WOOA 2GCPA 3CH5A 2QMUA 1R8SA 3X1XA 2WWIA 2W27A 3IKJA 4A6PA 3IUYA 5UKDA 1P6XA 3BH6A 2VIIA 4JGOA 1FQJA 3F3YA 3GFPA 1J7KA 2NIPA 3TMKA 3CR7A 2PCLA 4BASA 1LY1A 4HOIA 1BIFA 2VL7A 4XH9B 1MABB 2G77B 3H2YA 5IRCD 3Q7PA 4DLZA 4JBWA 3THOA 3LY5A 5K8IA 1P4SA 2G0NA 2V9PA 1G3IA 1D2MA 2CVFA 2O8DB 5A5GA 1NKTA 3VKHA 3C4JA 1XJ3A 1Z29A 2BKUA 1M7HA 3H7WB 1TAGA 1VECA 3L8ZA 3OLOA 4MYTA 2FSIA 1QRAA 2IYYA 4HAVA 4BBTA 2NZ8A 4EESA 4IOJA 4UNRA 3Q9LA 4TT3D 3SJAA 5JI3E 2WJYA 1WA5A 2IXFA 2QRZA 1RRCA 1QVRA 1TMKA 1HT1E 3B1ZA 4I38A 3C8CA 1SXJD 3KJIA 1F48A 4GMXA 4KAXA 5BW8A 5TXGA 4BLQA 4HH2A 4LUCA 4RY2A 5JEDA 4FMCF 2CMKA 1ZW6A 2F3RA 4GOXA 5F3WB 4JT2A 1YKSA 3H4MA 1I4LD 4A6XA 3AVQA 3LV8A 5F68A 1E98A 2IYUA 2C9OA 1G8HA 3F1NA 2DBYA 2GJKA 2VHJA 4LGMA 2C77A 4B2PA 1E2DA 3W6NA 1H8EA 1GSVA 2DWQA 2AXPA 4KXFB 5EP2A 1HURA 4C0KA 1B23P 1JEDA 4IFEA 2QKPA 4NP6A 3V4FA 2ZRDA 5GADl 4ESVA 2O8DA 2QAGA 5F2EA 2KDKA 1F6BA 4EPYA 1UBCA 3QF4A 3WNDA 5FUYA 3AGQA 1LL8A 1E2NA 1G8YA 4GNKA 4JLKA 4PC1A 3RNLA 1S1YA 4W9MC 2QMHA 1OB2A 2O0KA 3PR1A 1OW3B 2ZRAA 2J59A 5CDFA 1S1CA 4TL8A 4F93B 2JJ1A 1NJFA 4W5JA 1Z0AA 1EWQA 3KUDA 1YVDA 1XU4A 1E0JA 3NBXX 1S66L 2JDIA 3QF7A 1MO3A 1UWPX 2ZS7A 5DJTA 3IQWA 4QG7A 2ATXA 1OKKA 1E2QA 1G1MA 3ONWA 5FTNA 4Q4JB 5AVFA 1N3BA 1NVXQ 1X6VA 4NHOA 3EARA 2G1JA 1ZD1A 2QJ7A 1TQ2A 4G01B 2RHDA 3BB4A 2BM1A 2BASA 1OIWA 2WICA 4JVMA 4OI2A 2GEDA 4B48A 3HU2A 4QM6A 4B3BA 2V1XA 3SYNA 1R4AA 1Z06A 5FI0B 1YHNA 5CLQA 4A82A 3MFYA 1G21E 2NTYC 2ZVQX 4MN6A 3ULFA 3KKPA 1R8QA 1E9DA 3OZXA 3PENA 4YMUA 3X1ZA 1JAHA 4E09A 3K0EA 3AVVA 4N0EA 4Q9JA 3B1XA 5EUQB 2BV3A 3EPKA 1OE0A 4E04A 3SC3A 4ZCMA 2FF7A 2YWEA 1KKMA 2FG5A 4ZI3A 1KSHA 1R6BX 1DG3A 1Z0KA 4C0QC 2PD7A 1RIFA 1EXMA 3RANA 3IGFA 4BBUA 4DLYA 3H7WA 3HDTA 3LVQE 3QXXA 2H8KA 4BZXA 4B3FX 2ZBBA 2AR7A 4MGKR 3CX6A 2R6CA 5KTYA 2IC5A 2OEPA 3W34A 3CB4A 4UXHA 1L4UA 2AN9A 2JIZA 4ERNA 2OFXA 5HZHA 1E2IA 4KVAA 1XXHB 821PA 3OEEA 4A8JA 4TZ0A 2A5YB 1LV7A 2RKOA 2OFOA 3OAAA 3U44B 3BFXA 3TQFA 3PV0A 2ZS8A 4M22A 2KB0A 2VQSA 4H1UA 2EFGA 5HPYB 4AKGA 3NJAA 1EW0A 1MRSA 5CK5A 2F1IA 3K0CA 3HPQA 1Z6XA 2RAPA 4ZDWA 2A24A 4P33A 2GK6A 1OXUA 3CNOA 4ABYA 1KK3A 4HI0E 1BMFD 3UWKA 4PR0A 4EFNA 3U2QA 3LX8A 4D80A 2GCOB 3KQLA 2ZJBA 1AZSC 1NMZA 2LCFA 4LJAA 1UEJA 2WJVA 4WXRA 3TUJC 2O8FA 4L16A 4DSOA 4YLGA 2YWGA 2IYTA 4GZMA 3TUZC 1Z07A 1A2BA 4D4JA 3Q85A 3NOTC 4I1OA 4B34A 1ODVA 3HR7A 2FSFA 3P20A 3H84A 5AWFC 5DNYB 1W7AA 2IW3A 4C2TA 1UWNX 1Z08A 3I92A 3TLXA 4IRUB 2ZOIA 1YZLA 3B13B 2HV8A 3ZD7A 1BH2A 4LLOB 1D5CA 1ONBA 3UMDA 1DP6A 3E1SA 1XMVA 1OJGA 2EWWA 2F7SA 4XT2B 2K5UA 2WM9B 5JRJA 3T35A 4TQUS 4TQ9A 3N2IA 4LJ6A 2CCKA 3PQCA 1OPXA 2WHXA 3NTUA 4C7OA 2IBMA 2PR6A 3B60A 1GIAA 5JWRA 4RZ3A 1P2TA 3DPUA 2PH1A 3CRW1 1GFIA 1G20E 4HLUA 2RGXA 1L2TA 2BMJA 4PX9A 3ZVRA 2BJVA 4D82A 4DT1B 4QGAA 2XITA 1DRMA 3THXA 1XX6A 1GNRA 4WBSA 5FOVA 4LHZA 4F91B 5TVKA 5J4LA 3KUCA 4D4KA 4RQ9A 3FPAA 3W8NA 3MFXA 1IY1A 1VYVA 3IBGA 4PC7A 2HLDA 2ZRNA 1P62B 1V5WA 3NOPC 4GI7A 1TS6A 2FZ4A 2GKSA 4QHYA 4U00A 1WXQA 3U3MA 4URUR 2IYLD 4FW9A 4B6FA 3TE6A 3AVOA 4PC6A 2WWWA 1GL9B 4M9QA 2J0UA 4AKEA 1IJEA 1YZQA 2BHRA 2FA9A 4OQMA 3B9QA 3B78A 4CEHB 2ZJZA 2ZAOA 2TMKA 5CB6A 1ZU5A 5EP1A 2JN7A 2GNOA 3K70B 5KU1A 3ADBA 1QHSA 1FFHA 4I5SA 1V9ZA 1OT3A 3L8YA 4A0HA 2XB4A 3NC1C 4BE7B 3WBKA 2P6NA 5DIFA 1SXJB 4IKEA 2HT6A 4DDTA 1Y63A 3SFVA 4DWJA 1TU4A 4MKHA 3SBDA 1KO7A 5JBQA 5FOSA 5L3RA 4HEJA 5CLLA 4NE2A 2IS2A 4L15A 3I8SA 3VU9A 1NNEA 3CAXA 2IXEA 1Y3AA 4AURA 4LHYA 1OF1A 1AKYA 4EEPA 3U6KA 5EJEA 2IT1A 2ZYWX 4UQOA 3DOFA 3AVTA 1KI1A 1CU1A 5AUQA 1E2HA 4B76A 3UANA 3W90A 2D01A 2ATVA 3W5JA 4I1UA 1K8RA 2RGEA 3NIBA 2OO7A 4R6LA 3VX3A 3MJHA 4EERA 2YJTD 2A5JA 2IYZA 5KIZA 3LNCA 2IS1A 2DFNA 4HJ4A 1UKEA 1GVNB 1Z6GA 3P4YA 1F98A 3CKLA 4N0DA 2CNWD 1G7TA 1T0JB 3LIBA 3ND8A 2QP4A 5KDDA 5D3QA 1GKUB 1S3GA 2VLIA 3TSOA 3SEAA 1UF9A 1D06A 4M2LA 3EXAA 1S8FA 2AD5A 4HNBA 3RHFA 2O8CB 2WJJA 1NVUQ 1S67L 2IUSA 4TYNA 1T0HB 2HXSA 2ODEA 1SVKA 1XD2A 4NU0A 3K0CC 4B3XA 1U94A 221PA 1CBUA 3J81k 3L82B 4R70A 3UE6A 3TW4A 3U5ZB 4C0JA 2HT1A 4II7A 1N0VC 3PUVA 2EW1A 3CPJB 3VR4A 3IHWA 3WYGA 4A8JC 3MWKA 1TUEA 4MGIR 2F43A 4DLWA 1ZD8A 3PEYA 1NN1A 2JLZA 1R5OA 1TUIA 4HLQB 3KQKA 4LY6A 3RRNA 1S4RA 3AF0A 2J80A 2N46A 4MRVA 3K9LA 3R7WB 4YMVA 1C1YA 3QOFA 1JQJC 1NVVR 4C0AC 4QBHA 1E69A 2GWHA 3RS0A 4K08A 3I4LA 3ZJYA 3C16C 4PXAA 5JECA 1AK2A 2A3RA 5FUWA 3BFVA 2CJWA 1RW4A 2CBZA 1ZRHA 2XJ9A 5KNBA 3QKTA 1ESMA 1W4AA 3LQRA 4EAQA 2PYRA 3L43A 4NCNA 2KI5A 4Q19A 4URWR 4GW9A 2ZSDA 2EU8A 1NMYA 1PV4A 5G3YA 2HYDA 1YZNA 1XTJA 4HIAA 3RH8B 4BFYA 5FPKA 4WF0A 2EYQA 4HB4A 1GILA 3EASA 5D3MB 1XD9A 4B33A 5JHHB 1OLOA 1YZUA 2VTKA 1TEVA 3U3KA 4Q4JA 3AKYA 4LJ7A 3R9WA 3I5XA 3PEUA 3MG9A 4A4DA 4DDVA 4Z51A 2FPKA 3FHCB 3QKRB 2XZLA 4EQ6A 2ZETA 2R8RA 3SOPA 1I2MA 1NI3A 4KUOA 2ZSEA 1DPFA 2ZRBA 2VP0A 4R2IA 3VMFA 1GWNA 3TR5A 3VFDA 3E4QA 4JS0A 1A82A 4UXJA 1CJUC 2H7VA 4FINA 4O2LA 4DB2A 2ZUDA 2DY1A 3EEHA 5EXSA 1KDPA 2WZQA 1LB1B 1HEIA 2JLUA 1SVOA 1E0KA 2GJ3A 3LYXA 4MRRA 4BWYA 3C15C 5FOXA 1ZMXA 3SDZA 1Q21A 2PBRA 2FNAA 2WMOB 3GCGA 4Q66C 4DLUA 3MMPA 3N2EA 3HJIA 2GA8A 4DJ2A 1DAMA 2XXAB 2YWHA 4MITA 2JJ2D 3WMEA 5C4MA 2WSSA 4PC3A 2KE5A 4JKIA 1S96A 4LWZA 1FL9A 4R7ZA 3CO5A
chains in the Genus database with same CATH superfamily
2VT2A 4OFBA 4RF4A 3ICEA 4C5AA 4JLNA 4AJPA 4O1HA 1KXJA 3ZJTA 2WSSD 2Z98A 5BOSA 2LP4Y 2O4UX 2YY6A 1PR2A 1VB6A 3KE8A 2AL7A 3RGGA 2PLWA 4RH1A 1GUDA 4P2GA 3CH7A 4K0XA 2JF0A 4I4TB 1M0WA 4V0SA 3ZWXA 1Z63A 4MEBA 4MWBA 1NFQA 2VHXA 3SSOA 3DO5A 3JVIA 1LEHA 1VHLA 3DD1A 1V1MB 1Z35A 3I5MA 5LBIA 3GLFB 2IDMA 2PSJA 5TT0A 4V0QA 1C8BA 3UA4A 4HDNA 1Z3IX 5CH3A 3UF0A 2QLBA 1O9HA 2JGNA 4QSMA 4YT2A 1AVTA 1E6KA 3SLGA 4BX3A 3DBHB 5EZSA 4CPDA 3SZRA 1VM6A 4BFWA 4RUKA 4L9FA 2EBWA 1RQPA 1Z4LA 2R6FA 4PW0A 2HHHB 1VSVA 3DBAA 3V50A 2ZI9A 4Y15A 3MCUA 4YJFB 2XWBF 3GBVA 3P2KA 2WV9A 5DBHX 3CLTD 4GG1A 3BWEA 3T4JA 4H9GA 4URXR 2NW6A 3WDMA 2JBAA 4AROA 2WKQA 4ZMBA 4DIBA 2EJWA 5JFTA 4RF5A 2PUEA 2V1UA 1CCWA 3O4HA 3PE6A 1A7AA 3I3OA 4R8VA 4Q9IA 1GQSA 4YVFA 2CT8A 1WP9A 3D8UA 2DKFA 3B5JA 5FI2A 1JHOA 5FEUA 1UMBA 4WLOA 3H05A 1OB5A 3M4XA 3U40A 3K30A 4Y1RB 5AHKA 3DTIA 1TFUA 2GM4A 1U6JA 4O01A 1EBFA 2L17A 5D7BA 1D4OA 1PLJA 1S3IA 3WK7A 3HSYA 1LI9A 1UZMA 2B3TA 4DIOA 3B6IA 1GGKA 3E9CA 1ZG4A 3WLOA 1P7ZA 3NYWA 3UDIA 2JGDB 3B1VA 2B5OA 4TXJA 1I1OA 1R0RE 2I3BA 1OTYA 3GMSA 3D8SA 3L6CA 4LRXA 4UEQA 4RVAA 3VE4A 1U3DA 2Q6VA 1HKHA 1L1EA 2OZLB 2R11A 4U0TA 1ENOA 1EYZA 4GX1A 4KIWA 5FPHA 2K7SA 1ONOA 3HZOA 2OBBA 3KU1A 4RJJA 4AO8A 1XXMA 3MXSA 2P4EA 3FPKA 5L3QB 3UE1A 1DIAA 1DAOA 1TM1E 2GEJA 1DX6A 2X40A 3MOGA 1RBYA 4HDQB 4HDSB 4YWHA 5KWSA 4F85A 3VH4A 4RKQA 3MJRA 3WWOA 4JI4B 3GG2A 2ZTUA 5F9HA 621PA 1TDGA 5GJBA 2JFQA 1NKVA 1ZOLA 4DIFA 4W7SA 3T50A 1V4BA 1MEJA 1E6CA 3BMXA 3AL0C 3ACCA 4ARZA 2JJYA 1C0EA 1X86B 2ZI7A 4HAWA 1K38A 1U28A 3ACBA 1FQKA 2J3EA 5A4AA 1LDBA 3QEJA 5JSFA 4IDOA 2AWOA 3RU7A 1WDTA 1FP2A 3FVTA 1GTG1 1RKVA 2PZEA 2PM8A 3BWXA 3HHEA 3BERA 4AW9A 5GLAA 1Z73A 2VSXA 2DWOA 1YTLA 1PJRA 1IZ8A 4MVJP 2FW7A 4OXIA 5HL6A 3CF2A 2ZWVA 3CWZA 4KQ9A 5M04A 1LS1A 2Z2JA 3OE7D 1QOPB 4AJOA 3N39C 1QO9A 4ZYVA 2V1ZA 2WC1A 3CKYA 3KKKA 3QLUC 4M3NA 5CT6A 4R7GA 5DV9A 2H1RA 3DH0A 3G2KA 2OR3A 4Q4HA 4KQIA 5KHAA 4DRZA 1V5IA 4PSCA 3TOSA 2RGDA 2OZLA 3ZCSA 1T1SA 1CJTC 3OE5A 5J4YA 3EVTA 2G3YA 1QVVA 2RCYA 4HTFB 5LYJA 3T7DA 5DTKA 2Z5LA 1AJEA 1QIGA 1GGMA 2QWSA 1QONA 3QPDA 4IGKA 5J5CA 1YVUA 2FJUA 2IOYA 3NAQA 2Y2IA 4QTZA 4WA7A 4Z2AA 3JWEA 1JU3A 2BGNA 3D7SA 3UZUA 4UARA 1UEIA 1OZAA 1IBRA 1M1NA 4FGSA 4XLLA 4X3CA 4OLDA 2CLHB 1F8FA 2P9VB 1M3SA 1QZXA 2WAAA 3QRWA 2OXRA 2WWVD 4BTVA 4JDUA 1CUVA 3DF7A 4QJ5A 2P9JA 3LA8A 3TTUA 2HMVA 1K3UB 3S7PA 1TIBA 2Z43A 3TPZA 3NM4A 3QVGB 4WLFA 1A8SA 2ETVA 1O87A 2FPGA 1QORA 2YYAA 3GH1A 2WKPA 3HO6A 3O4GA 4LEIA 2QQGA 2X13A 3FIUA 3JSXA 4K03A 1K8QA 4K6FA 4MGZR 1EWRA 1RZVA 3KQTA 1ML4A 1JDSA 4OMDA 5FL7D 3QKIA 1PS0A 3LXXA 4BL3A 1JAZA 4IJQA 5HX7A 1FUUA 2OUKA 1KJYA 1MMFB 3FMIA 3UJ8A 4CRWB 3N9IA 1VE7A 2GBGA 3X1MA 2Y67A 3R7FA 2BMDA 1SNYA 4US1R 2RAFA 3IP9A 4LBWA 2CYCA 2OOSA 4TTAA 1PJ4A 4DSNA 2BBSA 2PR5A 3OU7A 5TGTA 4V3CA 4I4NA 2VDPB 4JLFA 3WNCA 2V7BA 4K40A 3A4LA 1DC5A 3IWQA 1UKYA 2PG3A 4FSFA 3ETNA 1VE9A 5C8YA 1KWKA 4CTMA 5HF9A 1KSFX 3M3HA 4BE9A 3STTA 3COWA 3V3RA 4KK4A 3IJEB 3MGKA 4KNWA 4EF4A 1D5WA 4LDZA 1EUZA 1X1CA 3OO0A 3QWIA 2VTVA 4Q1AA 5F1OA 2O2JA 3KTAA 2C2WA 5GPBA 4YH1A 3UGTA 3IULA 4RETA 3ZVTA 1U0RA 2H1FA 1K6XA 1FMJA 1JS1X 2EZTA 2RCNA 1RYMA 2IQIA 3BKXA 3PRJA 1WW2A 4JCCA 2QUIA 3HCAA 4LNAA 2O52A 1E3TA 1KFCB 1R8JA 3QWHA 1XZDA 4S1WA 1A96A 1U8ZA 1IBCA 1RWBA 3VUEA 4I81A 4E31A 1AMOA 3B6JA 4EPXA 2OQVA 3W2EA 2RD2A 1XFAA 3HVRA 3I2YX 4MPDA 1L4HA 1NXTA 1P5ZB 1XVUA 2QLFA 4E30A 2O5RA 2ZAGA 3X1WA 1B0AA 2CXRA 4MR7B 5TIIA 5I9NA 3IUPA 3T3MB 4F97A 1AXRA 4FE4A 2JBWA 4Z7QB 3I9MA 5FATA 2QTLA 2XSZD 3BRQA 3LRXA 1H2AS 2XBUA 5BWMA 5JYEA 1JFLA 2PZ8A 4LZLA 2X0KA 3SJ7A 3HZHA 3ZDXB 2NT4A 1K0FA 2BGTA 2IZZA 5HS6A 3VO2A 5IEJA 2VUSA 3CF6R 5E2GA 3L7JA 1BDMA 3LWNA 3ZX5A 4GRAA 4ND1A 1DU4A 2IXDA 3QBJA 4M0CA 3H82B 2F9FA 1M0EA 1S3FA 3UGKA 4EYEA 2ZM5A 3OT4A 9MHTA 5K05A 2J4FA 2XZTA 3DGFC 3E9DA 4R3NA 5FH9A 4LE1A 2IXAA 3OPLA 1U3WA 2PUTA 2KYRA 4MVJA 3WHKA 5CDFE 4NX2A 2QVGA 4IG9A 2H59A 2OE2A 3GP3A 1Y8RB 4JEIA 3G49A 4OQ4A 4BO2A 4MV4A 4ZBEA 2B3DA 2GN6A 1K4YA 5KNBH 2FE4A 4ZAWA 3W8FA 1NGSA 3V8EA 1C29B 3D3JA 4JXGA 1CLEA 4FKBA 4EHAA 1B93A 4HRAA 1UBEA 4X68A 1EGAA 1HE4A 1RRKA 2ZYRA 2Y0CA 4L76A 3W1VA 5KNBD 4LOLA 2CGEA 4KFRA 1HBJA 2LVBA 4FONA 4LFBB 1HTBA 3TBKA 1SZPA 5KC9A 3NJ4A 2HDNB 3EWKA 1DC3A 4MXDA 1YR6A 2AXQA 2OHXA 3AL3A 2EX8A 1DXOA 3ZHSA 1RWQA 2IDZA 3NHSA 4AMGA 4J94A 5HFNA 3BIFA 1FQGA 1Z9BA 1RPNA 3W3AA 3EY4A 2BGMA 2WK0A 5ARCA 3G1UA 1VMAA 3ZLTA 3O3NB 4BLPA 4E88A 1E7SA 2W1TB 4Q24A 1K9SA 3DV2A 3ER9A 4DE1A 3O92A 4J7UA 4DEXA 2I62A 1CEQA 3QLVA 4DQ0A 1D0IA 1K7YA 3HXTA 4IDFA 5FFMA 1JI3A 2FWIA 3C3BA 3EFOB 2CLDX 4NQZA 2ENUA 1CZHA 2WEKA 3AOEA 4R41A 4UBKA 3JRWA 4UFPA 5CA1B 1DQNA 2IHKA 3EWIA 2FQYA 3OIGA 3UFXB 3RUHA 4A9AA 1DDGA 4NCBA 1V35A 2YV5A 2AOVA 1IPHA 3AUSA 2HPZA 4CLHA 4KPUB 1YV9A 4BVFA 4OK3A 4ZEOA 1BU5A 5DRTA 5T8KA 2AQIA 1M76A 3N76A 4FFVA 2JH9A 1U1IA 5DN9A 1PX0A 2ASEA 4IQ8A 5JQGF 4OQFA 4GAEA 4ISCA 4R05A 3HB5X 4YRDA 1YBAA 2C4HA 2J0UB 1D6JA 4ITVA 5DSTA 4XSGA 1RWKA 2XA7M 1ZMBA 4F2WA 3D3WA 4YUWA 2XQZA 3OESA 3LO5A 1A8HA 3OHPA 1NYRA 1GSOA 2D62A 1T4BA 4DR3B 3LWDA 3FYHA 2RC5A 3ZE8A 2V1BA 1Z4NA 4L85A 1XYGA 4RVCA 1RWXA 2QN8A 4UBMA 2YKHA 2FK7A 3B3AA 3QXCA 3RG8A 4CF4A 2IS4A 3TTTA 3K8OE 4JA2A 4F6LA 4HSGA 3M2PA 4H0CA 4A15A 3ZQ5A 2B6NA 1IZ7A 4OBEA 4QDKA 3C74A 1VG9B 5CFRA 2CUKA 1N9KA 4EG8A 4K9PA 5JZOA 2Y77A 4CIXA 2A0UA 3K73O 3P2MA 4ZQEA 4WUVA 2C98A 3AEUB 1SUIA 4UKDA 1CULC 1NG1A 3ET4A 4IH4A 3WG9A 1P72A 1S2IA 1V95A 3T1HB 4AUMA 1PBTA 4X1OA 1VPLA 2Z5VA 1DHTA 1QMGA 4N76A 2ZYUX 3FCUB 5LC1A 2GKGA 1ESEA 1DP4A 2HA3A 3V46A 1XAIA 4K6CA 3K5IA 4BXOB 3UAXA 2IYXA 3JQAB 3T5AA 1K3FA 1A50B 1E1RD 2W6IA 1GYPA 4ZZIA 1CEYA 2XUKA 2WWRA 3IUNA 3OM0A 1KK0A 1V26A 1KVTA 2SKCA 4GYKA 1QLWA 3T4TA 3BXFA 4MRPA 2L1MA 1TCUA 5EFWA 3OLQA 3QKUA 1GHPA 5JBNA 5GHZA 1BGXT 1UFVA 2IZOA 4NS4A 3BA6A 5EXPA 2ZB2A 5EG5A 3QX3A 3HGMA 3TLBA 4DMFA 1SC9A 1Y7HA 4QRHA 3TJRA 4B73A 1K86A 1EA5A 1IY2A 4A16A 3LKDA 3CUKA 4DQUA 2NADA 2JEOA 3HCDA 2WFAA 2GK7A 4YASA 1QO0A 3BFPA 3R40A 2OP1A 4LJKA 1YS7A 3T54A 1GYQA 1SC1A 3FB4A 2VWQA 4OLBA 4A7PA 3WA6A 4HLUC 2MMGA 5H3HA 2DBQA 4PZZA 1LRJA 5JADA 4D9BA 2FKAA 3DOIA 3QVUA 1CJFA 1Y37A 2DECA 2XVZA 3BXXA 3C5WP 4TRNA 2O9CA 4MCWA 3DB2A 3EWSA 5EHGA 4JY7A 5J40A 3IEUA 2Y2MA 1L0BA 2E8JA 3CN7A 4RM3A 4QHTA 2IZ0A 2JPDA 3T94A 3PHJA 1JIVA 2ZKLA 2G0AA 3HJFA 3E7PA 2VT7A 1P81A 4DIDA 3M6LA 1PWZA 2VPZA 1JR3E 1B73A 2P77A 3S29A 1E7MA 4TLCA 1CK3A 2HJSA 1LV8A 3D0RA 3DTTA 4JYCA 3VU3A 2JEYA 4G8JA 2R9WA 2NO4A 2Z3WA 3AW9A 2BD0A 3TLAA 1DAKA 4EATA 3REFA 5I9TA 2QV7A 4BAUA 1DRVA 2YINC 4PLYA 4KQQA 1H69A 1XR3A 2IEBA 1QBGA 1DV2A 1JQEA 3CNNA 4PG6A 3OLZA 1VPVA 4MBKA 1NWCA 2C7VA 2I3AA 3CE9A 1NUTA 2QPLA 1EROA 2XWSA 3M8KA 2R87A 5DJUA 2ZBRA 4XTRA 1S4QA 3R8FA 1EX7A 1PLLA 1QVAA 4F71A 1OWOA 3Q12A 3ELBA 4ZI5A 4RTQA 4W82A 1L6RA 1JJFA 1H6CA 3GUUA 2A88A 2PRJA 5KSHA 2GJ8A 4FE3A 4IDHA 4MVJG 4PCVA 3M1YA 2IS6A 4XEHA 2W2TA 4NXGA 3M4ZA 2PZBA 2Y2PA 4FVTA 1NI4B 4MW9A 1QV7A 5EESA 3OZGA 1QQ5A 2LE0A 3GA7A 1OXXK 4B87A 5B1YA 1FDIA 4LJSA 5K3AA 2CJWB 1XO1A 4RFVA 3QVXA 2XPCA 2X8LA 3DSRA 4N7RA 1I7QB 1E2BA 4QO7A 5G0VA 4G3VA 4JC8A 2VEOA 3UPOA 4AIIA 1IEXA 2OZVA 2QTTA 2Y2VA 2Z1MA 2UV8A 2NYRA 1OLXA 4IXDA 4J0HA 3DC2A 4OVKA 5HE9A 2HW8A 3D81A 2B94A 2QN3A 1NJ5A 2R66A 5BWCA 2EDCA 3SF8A 3WY9A 1KARA 4E14A 3C3WA 4RTSA 5J2UA 3O3VA 4OQEA 3RTYA 1IUPA 1GSXA 2J9XB 3GN1A 2XDYA 3H9QA 1DWOA 2OYSA 3HTXA 2FI1A 1A69A 3FDJA 3ETHA 4YECA 1A9OA 5L45A 3CLUC 1FC0A 4FCWA 4R8RA 3WSWA 2P27A 4DTIA 3GQZA 3MQ2A 3U7JA 2X2FA 2ZRKA 3TJMA 2CJYA 3O75A 3RVOA 3OQJA 5C35A 2IV3A 1E3WA 3G2HA 1L5OA 1V8OA 1CFJA 1X7YA 2CXUA 3KT0A 4UBNA 4MW5A 3PQEA 5TR9A 1GOTA 5DTQA 4UBOA 4HNVA 1XA1A 1RVV1 1OY1A 1RS0A 2Y1OA 1DBVO 2Y0BA 2JCSA 3PXAA 4C0BA 1NHWA 2NZJA 4IHKA 3SLKA 3RUFA 2PQ0A 4YS6A 1I5EA 4KQ6A 2RHHA 1JSRA 5A5DA 4WQMA 1JLRA 3VM6A 1LX7A 4NJMB 3UMSA 4F3NA 3FSGA 2UZ1A 1KEKA 5LQAA 3EGDA 2DYKA 2H1HA 2QT1A 1YJXA 3VXKA 2P2YA 5L3VA 3BICA 2IU6A 1FBNA 4GRDA 4BNGA 1QQBA 2QGZA 3VPHA 1LQ2A 3ZGZA 5GHYA 4REMA 1TD1A 2ZR7A 4Q1FA 5CTNA 2JVIA 1PJZA 2NACA 3KFXA 2PT9A 3V2UA 2HYIC 3B6MA 2IVZA 2B37A 4MJLA 2W58A 3KEFA 4Q1BA 3ZWMA 3CZRA 2M1CA 4OHYA 1MTOA 4MBHA 4OAOA 4QVIA 2VKTA 2J3QA 4LY3A 1AXBA 3RU2A 4DQDA 1U7TA 4O1IA 3AZQA 5LUBA 4X64B 5CFLA 1M2EA 1S9DA 1PQUA 4G3XA 3SJBA 5KIAA 1DTWA 1K06A 2VF4X 3DMYA 4Y9RA 1DAFA 1JDNA 3B33A 5TPWA 1VLHA 3VSDA 3ZWDA 4XZ3A 2HB6A 1P9NA 1KEUA 2NPOA 2XDWA 3BMCB 5F52A 4KMRA 3ER6A 4WJLA 1CUEA 3EQUA 1GR0A 1YQQA 5EZYB 3NB0A 1PJBA 3Q8LA 1WVIA 1ILEA 2ZTVA 4Z9BA 1J07A 3L0DA 4KGXA 4Q1EA 2D1FA 1DG1G 3KQYA 1ZHHA 1KYTA 1AGRA 2GXAA 1P0FA 1DT3A 2P2CA 5H83A 1T91A 4OLHA 2HZ7A 4MAMA 4Q39A 4JR2A 3ZH2A 4FDTA 3R9WA 4FQ5A 1UK7A 3I05A 4U9UA 3CH6A 4LV0A 3STYA 3MUOA 4DQVA 4MHSA 4D5EA 4LG1A 1L0DA 2FSGA 5GLDA 4NENB 3I45A 1EWKA 1QH8A 3KT6A 1OASA 2ECQA 1ZJ6A 2FUG1 3NUZA 4RD2A 2QD4A 4WLVA 1SKAA 4JXXA 4PWYA 2HFKA 4BDSA 4PIMA 3VR5H 2AH5A 3HXOA 4UMFA 4RK4A 4JJ6A 1Y0BA 2KLIA 4GXQA 2YBDA 4G5FA 5D8DA 5F33A 4F12A 4FHCA 8AT1A 5KZMB 4YPOA 4WZ5C 3B6KA 2MHCA 3ISJA 4CLCC 4L9RA 2B21A 3BFFA 1G2OA 1U4NA 4ZO6A 5E9AA 5DCWA 4HGNA 1PR1A 4AXBA 3HJRA 1WNFA 4KZ5A 3G3EA 5LB2A 4O4LB 4J4HA 4IUCS 2B18A 1UOQA 3TJZA 1QHHA 4FEEA 1R3DA 3C1OA 2PFKA 4MVJF 4PZYA 4YP5A 4BMDA 4JQZA 1FCNA 1Z88A 2Q5LA 2IYWA 3OOHA 1Z13A 3Q1LA 3WS7A 1Y28A 3Q7TA 2VRCD 4L73A 4ZC1A 4C4SA 3EXHB 1NQAO 1PT6A 4ROTA 3FOEC 1EK2A 2DR0A 2ZIWB 1A1VA 3GGSA 2WKEA 1GGHA 1M10A 2XF2A 5I7AA 5D01A 4AFIA 1TYAE 3N53A 4F6CA 2GO7A 1YE5A 2AMVA 4H0FA 3ZWCA 2XT6A 4QHYA 4YCMA 5CLJA 1UPFA 2HRDA 3QUTA 4KR3A 4YRJA 4BFSA 2IDJA 4JLAA 3RYCB 4H6WA 3KKOA 5FO1A 3WL8A 4J16C 5IG2A 4EMTA 2Q9UA 3JQGA 2HV9A 16PKA 3MRSA 5DWVA 4CL2A 1DC4A 3S1SA 2R6JA 3CQ9A 4IG4A 3ZQJA 5FV4A 2ZWIA 5F78A 1DEHA 1T1AA 2Q6TA 1MB9A 4ZPJA 3S7TA 1OC4A 4BBVA 1B16A 1BXGB 3TB4A 4A0GA 2ONZA 4HY3A 2Q4OA 3ROEA 1D6NA 3VKFA 3T5BA 5ADUS 1SMKA 4RJLA 4C6TB 4JX8A 3Q5DA 1NVWQ 3VQTA 5HYVA 3WJAA 2P8JA 5F4ZA 3EG9A 1H2BA 4B9AA 4QO8A 4IOKA 1MPLA 3GJ4A 4KWIA 4NZOA 3VJKA 4DCUA 4XYLA 3KXIA 1ULSA 3A0VA 3I42A 4MLCA 1D0VA 4F3LB 3M89A 4URYR 3ROPA 3SSAA 3TIGA 3PRKE 2G70A 4H1VA 4P32A 2ZT5A 4F2PA 4G5HA 2HSEA 4NBVA 2W6OA 4LSGA 3P7NA 1V48A 3BMOA 2OFWA 3H1EA 3NHMA 3W2GA 2WPDA 2MINB 3C7UA 5HSGA 4YCNA 1UJ6A 3SEFA 1NQ5A 5CMLA 5IM5A 3P9SA 1FRQA 4KXMA 3PWZA 3L7AA 3QITA 3Q3JB 5M19A 4NATA 3IMKA 3WGOA 1TMYA 1RYYA 2UVQA 3C8HA 4K05A 2MYTA 2BZ1A 2NU6B 4CG0A 4N1HA 1GKKA 5NULA 3T7AA 1P0QA 2QNRA 1JE0A 5F2EA 1U0BB 3KB2A 3LLCA 1JQDA 1XZQA 3VZRA 2BM0A 2VTBA 5SYAA 3NEJA 1Z33A 2R5WA 3PT9A 1XP5A 4MS1A 3ZCXA 2ZEJA 3DZGA 3MWFA 3LC2O 1KRHA 3HLCA 2H63A 2HMUA 2OHVA 4AUKA 3BM6A 4P6ZM 5F1GA 4HFMA 1N78A 2HPBA 1LBIA 2EQAA 2J09A 2NU7A 2J7VA 3UEOA 1P4JA 3AETB 1P19A 1Y1QA 3DAOA 3FPSA 2IHBA 4UTVA 2Z1NA 4OUDB 1EFPA 1BJRE 3H6KA 2ZRLA 4US0R 3O8QB 1NFRA 1A7JA 2QL7A 1NW8A 1SBNE 3V6LA 3OZFA 3MYYA 5B2FA 4L78A 2VUUA 3QP1A 2A59A 2V97A 2W8ZA 3I2GA 3Q5EA 3PUWA 4QATA 5A9RA 4CCSA 2WHEA 1HQKA 3OICA 3RC8A 3H1TA 1EUDB 5CIYA 1TI7A 3PFKA 3VTZA 4FBMA 2WR8A 3SWWA 1HEYA 2NYAA 3VGPA 1E9BA 4DZZA 3C4QA 1YLWA 1U7OA 5DI3B 4MIOA 1ZH0A 1IJFA 2P7JA 3FHLA 1E2KA 2JHAA 3KM0A 2FRDC 4FT4A 3DKVA 3QP2A 2FN4A 5A4IS 4J9VA 4IGEA 3FKSA 3VFHA 3OM9A 3NG1A 1BG6A 2JJQA 4U3JA 3RSLA 3DEIA 4AMVA 4XPZA 5K8VA 2KX7A 1L4MA 1R10A 3HCNA 2ZT6A 3NX4A 4F92B 1PD0A 5FUVA 5A7GA 3RK0A 3QNUA 5E2FA 3TPCA 5B53A 3V1KA 1V4VA 2W0MA 4M53A 4D4LA 1QPBA 4JXSA 4V24A 1KNQA 2W00A 3T12A 2Y0PA 1XTTA 4JLJA 4LJYA 3W2TA 4GI5A 5KZHA 4CQJA 5IFKA 2J9FA 1VM1A 4JVSB 3LX5A 1NY5A 5JQWA 4MTCA 2LR0A 5FNZA 4PXSA 5LP6B 2R7LA 4QDJA 4QG3A 2A9KA 4YT5A 1U65A 1W581 2H07A 4CLDA 4R8LA 5FL3A 3AHHA 3LP6A 4DCOA 3SHWA 1JEJA 2XYPA 3ENZA 1YPRA 2ZBVA 1XV5A 2BMWA 2XQFA 2PGAA 3EOZA 1B2RA 2BZSA 2QAGB 2VPXA 4HWPA 2B8TA 3ZN2A 2DJ5A 4EY8A 4B6OA 4TWIA 3WK9A 1H3NA 1NYLA 1G6HA 1JQ3A 4XEUA 1HUQA 3LR3A 3DDCA 5K4AA 1NJ4A 4TL6A 5D6OA 1ODLA 5TQVA 4G0WA 2RBEA 1ADCA 2OM2A 3F7OA 5J2UB 3S5UA 4DNPA 4OAQA 5AM4A 1EQUA 2QP9X 3I32A 3WRWA 1I4OA 3IF6C 4KH0A 2ECKA 5AICA 3PSAA 3WVNA 4AS3A 4FHDA 4MGEA 5FCDA 4HAXA 2IBSA 5KNDA 4LRQA 5DK6A 4UOQA 5IUJC 1VHDA 4AT1A 1BXGA 4J7AA 5I4BA 2HY7A 2RGNA 1YZTA 4JWKA 4TMYA 2QQ0A 4EVQA 1SKYE 3KKNA 3O93A 3VU8A 2VX8A 4DLVA 1QTNA 2QE6A 5EYPA 1WUJS 1XWFA 3SF0A 2FVYA 3VE3A 2QJOA 4YRMA 2ZDHA 3GMDA 4LF7B 3OU2A 1U9CA 1LLCA 3EQ9A 5DNDA 4QZVA 4O59O 4ZI2A 3I01A 2BLLA 2AOUB 3OF3A 4CIYA 1GL6A 5F64A 2HSDA 3TZBA 1JJIA 3BJNA 1R50A 1Y81A 1DAIA 3EUWA 2YQ5A 4NCAA 2JCVA 5KX5B 1GITA 2GAIA 3R9KA 4R3BA 3RYHA 3UTCA 4BQFA 1P1FA 3FMPB 1II8A 2LD4A 2H57A 5IYZF 3IMEA 4N5MA 4EW1A 4F8YA 4EL5A 3SZOA 1XMQB 4B3RB 4GUDA 3O2SB 4DKXA 3DXFA 3VZDA 3RARA 1PKXA 4L5YA 5HW0A 2QN7A 1FP4A 1XQVA 2LUOA 3KBOA 4NESA 2VK4A 4RAQA 4XWKA 2R25B 3UMRA 2C9ZA 2CUNA 3OIVA 3VI4B 3KOOA 2EXBA 2WFMA 4WWHA 3HDVA 2A9PA 4HWSA 2VCYA 2YZ2A 2ZC4B 1DBIA 1MB3A 4PQYA 4W99A 4YO7A 4Z9YA 5HGJA 4CR7A 4GP9A 4WK4B 2Q5QA 4QWMA 1A8QA 3PPIA 3HKCB 4TSFD 3JQEA 2ZYSA 5ITVA 2VTBB 2PAVP 3TOVA 4NMHA 2JC7A 1WHTA 4JROA 4MARA 3V7NA 4BRSA 3G30A 5A1TA 1Z5PA 4QWOA 4IQGA 2Q5JA 4LDJA 2J46A 1T9CA 3F8TA 3BF8A 1PZEA 1IYPA 3Q9SA 1KYQA 3AHCA 5CGXA 5FD8A 3L92A 2ZTMA 1MJNA 1XK6A 3LUCA 3LFVA 5EN4A 4PO9A 5CXQA 2AOUA 2Y2LA 3O8OB 4E3LA 3BFEA 2GF2A 1CJBA 1E2UA 1GSHA 2QYOA 1L1FA 1KKLA 1L7DA 1MW9X 4BV2A 4D9HA 2EL7A 1MNQA 4RACA 1QMEA 3CPSA 1V37A 3AILA 5BSFA 4EJSB 4MDZA 1BEUB 3GJQA 4ALLA 1AQYA 3DDWA 3I52A 1KGSA 4G23A 5FR2A 2QPOA 2QE7D 5MF6A 2A0WA 1XF9A 2IIVA 4HX9A 1ZH4A 4QOEA 2PIAA 1DBSA 5AM5A 1YMUA 5HIKA 4G1CA 2GK4A 2ZR9A 5CEFA 4CEJB 3R4VA 2FSVC 4OHOA 4Q9NA 1IZ9A 2QY6A 4R40A 2YMPA 2RGBA 5A04A 2DMWA 3GU3A 5CX1B 4O0MA 2CKDA 3HEMA 1CRPA 5EJ9A 3KT3A 4XB6B 1Y7IA 4M0UA 4YCAA 5KAMA 3D4FA 2JATA 3SC6A 2G63A 5ALQA 2NPIA 3N7AA 1UK9A 4EVSA 3HVFA 5AVSA 3KXKA 4TVKA 3LA6A 1KDOA 3D8NA 4MO2A 3T5GA 4MDHA 4QUAA 3ROGA 3AUUA 2JLVA 2ISQA 3U7QB 5AJVB 1VXOA 3UV6A 4P4NA 1UPAA 3PUYA 4ZANA 3UYLA 3WLTA 4CQMD 3CZ9A 3B89A 2P30A 4WL9A 4RQBA 4EYQA 3DTYA 3WRTA 2INGX 1XMJA 2EJBA 4QGFA 2XRZA 2V98A 2REQB 2B61A 3NTOA 3TBHA 3TNFA 4FWIB 1V7ZA 1KO8A 3D3NA 2WW8A 4GPBA 4GR9A 4PLFA 4RGYA 1U99A 3L6EA 4OYYA 1CJSA 4ZGWA 4ZDJA 1KYXA 1QQ7A 3G6KA 1GA0A 3A14A 3ND9A 3PFFA 4FLEA 4L4YA 4RAOA 3TLMA 1H05A 3E35A 1HT0A 1TX4B 4ZAMA 1PW7A 3UK2A 2IOHA 2NZYA 4G9EA 3N4IA 3SS8A 4F5WA 1OTAA 3LECA 2FZKA 5CX1A 3AEQB 2MSDB 2BHTA 5KREA 1Y9AA 4WUTA 2HIHA 4B3GA 1FSGA 2JRLA 1RC0A 5FB3A 4NDZA 3HRKA 3VZBA 4MYCA 1CB7A 3IESA 1ALQA 4EBLA 5TV2A 5L4SA 1JDJA 1HDYA 3PBSA 4WLUA 3RLFA 3PXCX 4D9JA 3BJIC 3HKBA 1T9GS 4UMEA 3GLFE 3NFYA 5ES3A 4KITB 4EG1A 1UJNA 1PFVA 2R7MA 1NRFA 2F43B 3H0EA 4LXUA 2NP6A 4IFBA 2G08A 3OPYA 2HJ9C 1ODSA 1L4NA 1Z47A 3NALA 4MQFA 2IX3A 1MY8A 4CETA 2JZCA 5ELMA 1D2NA 1NIPA 3V4PB 4E1AA 3NBZC 1N3IA 5CH5A 1P2BA 4PO8A 3AV3A 5E95A 4CFZA 2H4ZA 4GP6A 4JEMA 4RK5A 3VYTB 1ORDA 1ZGZA 2PBLA 3FDXA 5F7OA 1QDEA 1QYCA 1DKUA 5GGXA 4AM8A 3VHXB 3GA5A 4MS4B 1B1CA 4GBJA 5JLJA 1BZYA 2QD1A 2ZIEA 3D2BA 4OHMA 4CM7A 4UNSA 4GWGA 3OF2A 3GDOA 1HR0B 4ZJ2A 1YZHA 1EEXB 2VF5X 1YRHA 3FNGA 2C03A 2D1RA 3D9QX 1LLDA 1U0OC 2OENG 4E33A 5EE8A 1SUWA 2C9BA 4Z8XA 2C8LA 3TI9A 4M8IA 3ZWQA 4Z1OA 4HAYA 2YRFA 3LPDA 4ZO9A 5BVHA 3IH5A 5K8TA 1SIUA 1XAJA 4WOKA 2IVFA 2PTGA 4E5MA 2Q8NA 2BP7A 2P67A 2FQQA 3D31A 3K05A 5AVXA 2PMBA 1A2QA 2QDXA 3PEVA 1ACLA 1XLTC 4KN5A 2HWYA 5CEJA 1QCDA 4W1QA 1T4DA 2W8BA 2N9UA 3H3FA 3QUQA 2MWMA 4YRRA 3T7RA 2QR2A 4U8GA 2DKNA 2J07A 4U5QA 2WBLC 3KWLA 4BBJA 3JQBC 2AVDA 4R9UC 5HJ5A 2ECFA 4MB2A 1KE4A 3GYBA 3DW0A 5C8ZA 1KTIA 1A1SA 1E92A 4UA7A 1FU7A 5CTAA 5BV2P 1FW8A 3OE7A 4IFTA 2PR7A 1UT8A 2ZQZA 4C1BA 2WHPA 3BLSA 4L72A 4WJZA 4QLBA 2HIMA 2EWMA 2JKZA 1RWVA 4ME6A 4Q1VA 1GSAA 2WVGA 4C3ZA 3DO6A 1DIHA 3W4QA 3PYXA 4DE0A 2I4TA 4PAOA 3QEMA 1RLUA 3H4VA 3OEYA 1WQ4A 3STVA 2O99A 4OH0A 1LPBB 4ZDKA 1N5OX 1LFDB 3OTGA 4KKVA 2J7PD 1BVYF 3PQ4A 1GTRA 4TXLA 4EFDA 1JQ5A 5A06A 3CLTC 1R0WA 3KK0A 5E9JA 3VU9B 1KBOA 3TQRA 3T1TA