5HZHA

Crystal structure of photoinhibitable rac1 containing c450a mutant lov2 domain
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
325
structure length
320
Chain Sequence
AIKCVVVGDGAVGKTCLLISYTTNAFPYIPTVFDNYSANVMVDGSTTLERIEKNFVITDPRLPDNPIIFASDSFLQLTEYSREEILGRNARFLQGPETDRATVRKIRDAIDNQTEVTVQLINYTKSGKKFWNLFHLQPMRDQKGDVQYFIGVQLDGTEHVRDAAEREGVMLIKKTAENIDEAAKELGSGGKPVNLGLWDTAGLEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Ras-related C3 botulinum toxin substrate 1,NPH1-1,Ras-relate
publication title Engineering extrinsic disorder to control protein activity in living cells.
pubmed doi rcsb
source organism Homo sapiens
total genus 97
structure length 320
sequence length 325
ec nomenclature
pdb deposition date 2016-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5hzhA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5hzhA01
1OFHA 3KL4A 4J0QA 1GL9B 2C9OA 3OLOA 4WXPA 2QORA 2HT1A 3CO5A 3O8DA 1T1CA 5J47A 3IPYA 1R0WA 4R2IA 5DI9A 4XWOA 1N5KA 4NU0A 3B33A 4HHDA 2CNWA 4ERNA 1W2HA 1LF0A 4MRPA 2AK2A 1E79D 5EP2A 2D06A 1Z08A 2KJQA 4P4SA 2DFKB 1PV4A 1KGDA 2P0EA 4RD1A 2GVZC 4LHVA 4W9MC 3AVXA 1J2JA 4OL0A 2VA8A 5F98A 4P32A 1G3QA 4Q4HA 4CT5A 2QMEA 2VP2A 3BY9A 3KKQA 1XFAA 3LAWA 4ZCIA 1N6NA 2JDIA 1TQDA 1OKKA 2ZRNA 2Q6TA 5DLQC 4GS9A 4TL6A 2WJIA 1ZD8A 4L16A 1N9OA 4PHGA 2X8AA 4DWJA 2G1KA 2IWHA 4LSGA 4IDNA 1MRNA 5DE3A 3F1PB 1P97A 1GUAA 2FA9A 4L5BA 4CEHB 2ZU6A 3ZD6A 1KJWA 5JHHB 3P1JA 4AG5A 1FTNA 3TSOA 4MYTA 1U9IA 4BBTA 2NO0A 1E79A 2NO1A 4KHZA 4C0LA 1FX0A 1DG1G 1AN0A 1Q22A 2GTPA 5HR5A 2NQ2C 3WP0A 4N1AA 4ZDJA 4I1UA 5FTLA 3SS8A 1UKVY 1OH5A 3NBZC 1N5LA 2QG6A 5G41A 1G3MA 4LYJA 3BD9A 2ZANA 2YC2C 4OK5A 3UG6A 3KX2A 4L9EA 3RS3A 4DCTA 1II9A 2UVQA 3C41J 3E5HA 1PLKA 1IJEA 1X8JA 1G28A 3EZ9A 3K9GA 2QBYB 3LLMA 2ZYUX 2ZAMA 3GJ0A 2H8KA 4Z8XA 1G291 1S66L 1W48A 2I4IA 1RW4A 2HYIC 1GITA 1NSFA 2QAGB 2H17A 4KYIB 4BRUA 3H82A 3PV0A 2PYRA 4EXOA 1ODVA 2AFHE 3P4YA 3Q8XB 4D2IA 1YU9A 3TQFA 3O8CA 2XXAB 5FTJA 4O2LA 3SW1A 4DLXA 3KXIA 4CGZA 2HEIA 2JAQA 2QGNA 2GK6A 1GFIA 2FU5C 3KTAB 4URYR 1S67L 5FPHA 4XWKA 3BB4A 4HP4A 1F60A 2RAPA 3QPUA 1BH2A 2BWJA 4JLOA 4TMTA 2VYFA 3L0OA 2VSFA 2RB4A 4DSUA 4ZDIA 3QVUA 3C2WA 2OXCA 3MWLA 4HJ4A 3R8CA 5JECA 4ZCMA 5EZ5A 1SVLA 3KXLA 3WXMA 4Q7MB 2TMKA 3JVUA 3LWNA 1Z5ZA 1BIFA 2ZYTX 3A1TA 3NBXX 4DCUA 2BMJA 2AK3A 3R7WB 4LPSA 3QUSA 2IUTA 1P61B 3RSOA 3MWJA 5E3HA 2PLFA 4G1UC 4URUR 3QBTA 2DBYA 1ZNYA 2DFLA 2ZSEA 3OF5A 4NXBA 3X1XA 1Z0AA 4GCZA 4P3YA 2GJ3A 3MWYW 2ZI4A 2WAXA 1MRSA 2WJYA 1ANKA 1QVRA 3SC3A 2GK7A 3K70C 1JQJC 3F1NB 5HCNA 2VP6A 5EXTA 3FDIA 2LKDA 4FINA 5FOSA 2WWYA 2J0UA 5A8BA 1KNXA 2QUZA 3BFXA 4NONA 4AIIA 4O2RA 5B58C 1KYIA 4LJ6A 3AVTA 5E4FA 1ZCAA 2VPPA 3VTKA 2YKHA 2RCNA 1D9ZA 1RRPA 2YKFA 1VIAA 5FOTA 3EXAA 3B78A 1QHSA 3K0EA 2YVUA 1G20E 3SI7A 1JALA 2WIAA 2PT5A 1WCV1 4BFTA 1XTSA 2AD5A 4JBYA 2H5EA 2GJAA 4LK2A 1D2EA 3FTQA 5FBQB 1YQTA 2AKAB 2HCBA 4OQMA 3U44B 5KNDA 1X3SA 2OM2A 2ORIA 1MOZA 4GHIB 1KI6B 4TZ6A 3CF2A 1W5TA 3P27A 4LBVA 4AK9A 2UZIR 3U2QA 4RQ9A 3AKYA 4EETB 5FI0B 3PENA 4ZIRB 4TMKA 6Q21A 3K0AA 4HZUB 2G3YA 1G18A 1SVWA 2BBWA 1ZYUA 2VO1A 521PA 2KBFA 5BN5A 5JJIA 3IEVA 2QPTA 1G7CA 4EFMA 3LBNA 5L3VA 2Q9BA 1CULC 1ZIOA 2QJ7A 4LX0A 4AYWA 2ZRGA 1XJ2A 1E2JA 1TS0A 3CRQA 2ZJ8A 3NC1C 4RZ2A 3SHWA 4JT4A 1E9BA 1AKYA 3K1JA 1OT3A 3Q3JB 3ZLJA 3I1FA 1TADA 1AGPA 4I38A 1CTQA 2V9PA 4V0MA 4DIEA 4RSGA 1DELA 3BORA 1LSXA 3VR6A 2G6BA 3E4QA 1WQ1R 3K70D 1P75A 4TLAA 1NLFA 2IYXA 4A0RA 2FFBA 4NXFA 3AUXA 3EEHA 4HLQB 4QKQA 2ODWA 5J4LA 4MN5A 3NC0C 2H57A 1HUQA 3ZS8A 4XJXA 4IFEA 4BLSA 4AC9A 4IDOA 1NY5A 3DOEA 3NWJA 5E7MA 5F68A 4DBLC 2F3RA 2GHIA 1GL7A 4B71A 1KO8A 3LO5A 4BLTA 4IDPA 1ZJ6A 4BZXA 5HZKA 1OFIA 5SZKB 2I3BA 3KJEA 1TTTA 2A30A 4LZZA 3FMOB 3A1UA 1ZIPA 3ZQJA 3MFXA 5B30A 4DCNA 2OCYC 2AXNA 2ZJYA 2BEKA 1EESA 3CH5A 1ZC4A 3EASA 3N5CA 4YMSA 4YDSA 3QJYA 2V3CC 2ZJBA 3KB1A 2IYLD 4EFNA 1NKTA 1ZUIA 2N46A 1QRAA 4EAQA 4V0LA 4TTRA 3FVQA 3GLGE 5LD2C 3C5CA 1YZNA 1ETUA 3B1XA 4Q4AB 3R20A 2NG1A 4B3DA 3LBHA 1AKEA 5DJTA 1IN6A 4MKIA 4I3AA 1A1VA 4GBMA 5TVKA 1QHIA 1W49A 3OIWA 4Q1BA 1R0ZA 1IY1A 1E2NA 2Q3HA 2KWIA 1SHKA 4B2LA 4BLRA 2REXB 5FPKA 1EFCA 2CLCX 2GXSA 4K46A 2FOLA 5TB5A 1E2GA 2OEPA 2J5XA 4OYHA 4QOSA 1EG7A 4KI0A 2H18A 3U5ZB 1T8UA 3BFVA 1GKUB 3SJBA 3KKMA 3G5UA 4H6JA 2GKSA 4NMMA 5EUMA 4QJ3A 1H8HD 2ZROA 1KDRA 3PXGA 2QN6A 4CVNA 2Z5FA 4M9ZA 2CE7A 1UFQA 3GJ6A 3A1SA 3MFYA 5DISB 2R6GA 2EWVA 1G4UR 1G8PA 2AWNA 3H84A 3LVQE 4CEIB 4W5HA 3IGFA 1Z6TA 4EPVA 1EFRD 1FQJA 4O0MA 2DB3A 4CF7A 4F4CA 2YWFA 1ODFA 3ZVMA 1XMJA 2Q21A 2BVNA 2PEYA 2ZE8A 4TZ0A 4JKIA 4D81A 5GVSA 3AKEA 2LWIA 1E9SA 2HF8A 2VLIA 3CBQA 3KJIA 4B75A 4HH2A 2ZS7A 2ODBA 1FW6A 1Q0UA 4NXGA 1CF4A 2ASEA 4UXJA 1NSTA 1U98A 4XTRA 1KSGA 3T1TA 4DSNA 2VH5R 1WXQA 4YXWA 2BMFA 3LBIA 3SN6A 1U94A 1KZGB 4A9AA 3SJCA 4DIDA 1EFRA 1VB6A 4IEEA 2F1IA 4DLWA 5L3QA 3RYTC 2FEOA 3GLIA 4AKIA 4Q47A 4RJLA 3T35A 2VV8A 4A6XA 1QHHB 3HPQA 1XJ6A 1NP6A 2CL0X 2PX0A 1QHXA 3IIKA 3QPVA 4JLPA 2ZRJA 3GLGB 1P9WA 2DCUA 2PZEA 1S96A 5IT5A 4Y0AA 2E9SA 4DJTA 2O8EA 1NMXA 5FR1A 1KSHA 3U60B 2GXUA 1IJFA 1D2NA 2E87A 2AKYA 1G5RA 1GILA 3TRFA 5FBVB 2RHMA 2NZJA 1E0AA 1KMHA 4V02A 2GVDC 1YZGA 3ONWA 1BO6A 1MH1A 2P5TB 4N3NA 1P0ZA 5J3WA 4POAA 2ZSFA 2CK3D 2QROA 3DVLA 1VIYA 4XVRA 5AJVB 4LOAA 2DWPA 3QQ5A 2OESA 4QG7A 1S8FA 3DZDA 5HDCA 5KPDA 1GSXA 3REFA 1N25A 3NVAA 3RWMB 3WMGA 1KK2A 1GP2A 1AK2A 1E69A 2ERYA 3Q5EA 3FFAA 1KI8A 5C18A 1Q3HA 2CLSA 1OH7A 4BRWA 1KI4A 2WKRA 1N2CE 1YE8A 4RD4A 1LS6A 5AUNB 1XEWX 1P62B 1D6JA 1XPUA 1S1ZA 1VCIA 5JEDA 1ZUNB 1D5CA 1AS2A 2JASA 1F2UA 3WNCA 4JJKA 3C5HA 4RD2A 3CWZA 2XEXA 1OYYA 1KTVA 1W5SA 4R38A 2CK3A 3F1PA 2ONKA 3OIYA 4HB3A 3DZ8A 4DEXA 3EPJA 3QXCA 3U7GA 2P6RA 2O8CB 4DT1B 1JAIA 1RJ9B 3L2OB 3BB1A 3HU2A 1W4AA 1MKYA 4AD8A 4RD6A 4B3XA 4HOIA 1G3RA 3VE3A 5AR1A 2ZRDA 1W44A 2OUKA 1L8QA 2XZLA 3HDTA 4HY8A 5BW8A 1WBBA 4MN6A 2CCKA 4NYIR 4HB2A 3OE7D 4A1FA 4OHXA 1AGRA 4GNKA 1HY3A 2PEZA 2G88A 2VHTA 3B85A 2QBYA 1YRBA 4Q9IA 4A2WA 1R10A 2HYDA 2CL6X 3FB4A 2DYKA 4PZYA 3BAFA 2ZUCA 3B8HA 1XX6A 2GJ9A 4K81B 1D9XA 4C0KA 4AY2A 1M7BA 5JI3E 3V00A 3B13B 2ZR7A 5FI1B 4C30A 3CPHA 3PQCA 2DY1A 3VKGA 2XXAA 2IL1A 2XB4A 2VEAA 3W3AA 2QQEA 2WHXA 3E4OA 1KAGA 3NXSA 2ZVQX 2V7QD 1RYFA 3D7MA 3U6BA 3L8ZA 3KTAA 4DKXA 1S2MA 3ZVNA 3L82B 1I4DD 4LJAA 2VIIA 2B7CA 2O0HA 1JXMA 3AP3A 3PEYA 3UB9A 2WV9A 2QE7A 5HD3A 1U8ZA 4TYPA 2J0QA 2ANBA 3HJNA 3BFKA 3IQWA 5A5GA 1N6PA 1NRJB 5C46F 2R6DA 1Z07A 2IYQA 1EWQA 1Z0KA 2MSCB 2X2EA 4B44A 1EGAA 4MGKR 1JNUA 3TK1A 3DOFA 2YHSA 3EARA 4PO9A 4D6PA 2OSBA 2F55A 5DJUA 1YZKA 2PR6A 2WOOA 4JVNA 4GI7A 3R7WA 2ODNA 1E9FA 4PXAA 3AGQA 3SYNA 5BQ5A 3J81k 3RAPR 4PSKA 2V7QA 2B8WA 2HT6A 1GKYA 2A78A 3BJIC 5BYJA 3UB6A 2KB0A 1NIPA 2OWJA 3EPHA 4URZR 1FZQA 3RC8A 3IHWA 3MQOA 5DO9A 4UNQA 2ZRPA 2BIFA 2C8VA 4CT4B 1LT0A 4X8LA 1TF2A 1ZNXA 4WIAA 3KUDA 2W27A 1AZTA 2EFDB 3AVPA 3CPEA 5KU1A 1LTQA 1NJGA 4M1OA 4GPTA 4JYCA 2WSSA 4B47A 3IBYA 2IHYA 4ZDKA 1SVKA 3EW9A 4A8JB 2OOLA 2PD7A 1EFUA 1LW7A 1JR3D 2ZRKA 1XXHE 1J99A 2HLDD 2L0WA 3RHFA 1G6HA 2FEMA 2GZDA 2OILA 5GJBA 3EWAA 3I3SR 2Z4RA 2V1XA 3G82C 4BZQA 3U44A 2NOAA 1E2LA 2GJKA 2I1VB 1KI6A 4GZMA 4PC3A 2W2VA 1GSWA 2OXRA 4Q03A 1W0KD 2I9VA 5EFWA 1R8QA 4ZIRA 4HLUA 5I5LA 2YOFA 3MUFA 1UKZA 3AEZA 3I32A 2XITA 4ARZB 3GECA 3T1VA 2PMKA 4QM7A 2EFHB 4NYMQ 1NLYA 1ZM3A 4OI2A 2ZUDA 5FBWB 1DP8A 1DAKA 1MO4A 4PTLA 1UWNX 1OV4A 2WMOB 5CK4A 4LPZA 1XP8A 1JAHA 2PL3A 4KSCA 3C7KA 1E94E 4B34A 1CLUA 4FMCF 2REBA 4HATA 4F92B 5J7EA 1JR3A 1KKLA 3CX8A 5G4ZA 3CRVA 1IXSB 3ZH9B 2HLDA 2IYTA 3FOZA 3TVTA 5F9FA 1IOZA 4YC7A 1G5PA 1CU1A 4Q00A 4OJQA 2IS6A 1J70A 3KKPA 3RLFA 3I72A 3IPXA 2HUPA 3BWLA 2GXAA 4URVR 2QPOA 4ASUD 4RZXA 1UEIA 5JMTA 2CHGA 2RGAA 5EE5B 2FFQA 1S4RA 2GJSA 4BBUA 2ZIAA 4FCVA 1E9AA 2RGXA 4X8OA 2D3WA 1UBFA 3GD7A 4FCWA 4TLBA 2XSZA 1ZM4A 1E0KA 3PUVA 3ICEA 4AYXA 4HP9A 2VP0A 4QHSA 1CXZA 3Q5DA 5J40A 2CEAA 3TUIC 2IT1A 4NDZA 2O52A 5JWHA 1F3OA 1OXXK 1XBTA 4BLQA 4JGOA 4IFBA 1F6BA 1P2VA 3KQLA 3TAHA 4K8OA 1XEWY 3ASZA 4F4IA 4HB4A 2IEYA 1RPZA 3A0VA 3PEUA 4JVSB 1OHHD 2WWWA 5GJWC 3U3JA 2FSIA 3T5DA 2V4ZA 4PQYA 4ASUA 2FPMA 4ZDWA 5DYIA 3PYPA 2JJ8A 4MRVA 2XNDD 4Q4AA 4TL8A 3B9PA 4W5JA 2LKCA 3QKUA 4B33A 4DLYA 3OIVA 3Q85A 4G5GA 3MWKA 4B3FX 1Z0FA 2ZU0C 1SZPA 4ESHA 2DWOA 3K0FA 1XXHB 4KFRA 1ZMXA 2F9LA 1Z8FA 1OTIA 4L15A 2IK8A 3HR8A 3MRSA 5IDVA 1Z83A 1YVDA 5F6AA 5J4EA 4JJZA 4KODA 4DUGD 4C7OB 1U9IC 2RKOA 3MJRA 4PC6A 4B9OA 3HYTA 2ZRLA 4NL4H 2F1JA 1OT6A 3ZJYA 4B2IA 4XVUA 2C78A 3W6NA 4B6FA 1P7CA 1OF1A 2HV8A 3GDIA 4PPQA 4PPNA 1C4OA 3CRMA 2NTYC 3LICA 3QNUA 1MO6A 5SZHB 1OTAA 4D80A 2AHOA 2XJ4A 3LV8A 4EQ6B 5KHOC 1OLOA 2OHFA 4IXNA 2JLRA 4JVLA 4YMWA 2WJVA 5C1BA 3PITA 2CNWD 4G5OA 1FNNA 4CEIA 2BBOA 3AVYA 4OHYA 1OPXA 2FV8A 4MRRA 3TR5A 3JZAA 3A0SA 3CB4A 3U7EB 3FKSA 3FKQA 1E2EA 3B2EA 1E2QA 3WYFA 5F2EA 5EXSA 1G41A 5JLJA 2CDNA 3AB3A 1V43A 3FG8A 2R2AA 3IIMA 2R6AA 3K3CA 2NO9A 1CP2A 2JDID 2MSDB 4NP6A 1HE1C 1RKBA 2BEJA 3QF4A 5FOVA 2XZOA 1U0JA 2V0UA 1VCMA 1VHLA 1E2IA 2IYRA 2FE4A 1MABA 4WOPA 1TU4A 2YOHA 1YZLA 3B1VA 1IN8A 4EPXA 1GNRA 4ZPXA 3GPLA 3QKSB 2NIPA 3RRNA 3N70A 3UMSA 4XT2B 3DO6A 3M4YA 4A2PA 1WA9A 5C4MA 1E4VA 2EYUA 1CJKC 4GT1A 1IN7A 1UM8A 4OQNA 3UWOA 3OHMA 3KJHA 3TR0A 4Q4JA 2BM1A 3W3ZB 1Z0DA 4FIDA 3AKCA 5FOXA 1Z6GA 4EKDA 1T91A 2WZQA 3QVVA 3VOLA 4URXR 1KO1A 2GF9A 3RDPA 4UJ5A 3GLGA 3ND9A 3SJAA 4G5QA 1ZRHA 4HUQA 1UF9A 4HSEA 2QP9X 1F9IA 1ZCBA 4N0DA 2JGNA 3GFTA 5HCIA 2C96A 1Q1QA 3QY0A 3T15A 3DHWC 2K5UA 1CR0A 5HE8A 2GETA 1ZNWA 2P67A 1TAGA 1W1WA 3CAXA 1G21E 2FPLA 3CF0A 4Q18A 2J7PA 3D3QA 3GEHA 5LB2A 3L0IB 1GRRA 2KDKA 1FP6A 4RFVA 2BV3A 1R5NA 2QEQA 4Q7KA 5B2ZA 2JLSA 5IU1A 1U2RA 1X8LA 2IYUA 5HWVA 3KDSE 2GWHA 4OQFA 3LQRA 4TT3D 4YMUA 2FFAA 1DARA 4XIGS 3QF7A 3H86A 1XD9A 3ZYCA 4BFZA 3WMEA 2GXQA 3LYXA 3E1SA 1G3UA 4QHTA 2WKPA 1VKJA 3AV0B 3GJ7A 3TVDA 2GA8A 2OE2A 2P3SA 1C1YA 4DJ3A 3KZ1E 5EP4A 5HPYB 2XZPA 2GEUA 3GEIA 2F1RA 3R8FA 4R9UC 4WW0A 4CDGA 1FOEB 4Y0VA 2R65A 1FUKA 1DO2A 1ZW6A 2L0XA 4WZBE 1YRAA 4Q7JB 3C14C 1TUEA 2VBCA 4FMBB 4YWZA 1QHYA 1YR6A 1VPLA 3U3KA 4TT3A 4O25A 2DHRA 2GILA 2ZBBA 4BUJA 5JJLA 2OZEA 1DE0A 4DT1A 1KSJA 3QXJA 1UGUA 5EE1A 5AWFC 1RJ9A 5JCZA 5JI2E 1OFTA 3N2EA 4GMDA 4MKFA 1S1YA 4UXHA 3AVOA 3HJKA 1E9EA 2EQBA 2GRJA 2GZAA 2R6CA 2CBZA 5HTKA 1OJLA 4HQAA 3ZQ5A 1NVVQ 1S9HA 2PCLA 2EWWA 4GZLA 3TUZC 3MSXA 1G5TA 3CNNA 1EWRA 2D2FA 2FGKA 1XPRA 2F7SA 3EC1A 3ZVRA 1CIPA 4MGYR 3EAQA 2JA1A 3AH8A 2FFHA 2JLQA 2V9AA 1NG9A 1GSVA 3CX6A 3B1ZA 1S1CA 1XTRA 3MCAA 4ZO4A 2X1VA 1N9LA 5DN6D 2RGGA 4RD3A 1AS0A 1Q1EA 5CM9C 4E03A 4C0SA 4M9SA 3ZZTA 1Z06A 3LW7A 4BE7B 1T0HB 5FBRB 2B92A 4MYCA 2OCAA 2WTUA 4A0FA 4KFUA 621PA 1ZP6A 1DP6A 3AGPA 4EDHA 2GEDA 1TEVA 4S2EA 2VLGA 5HKKA 4D4KA 3LH5A 3IHLA 5A4JA 4JT2A 1C9KA 3IUYA 5HDSA 2VSXA 3KQHA 4Q1EA 3JZMA 3OIUA 5AUPB 2YWEA 2V1UA 1KI3A 2C9YA 4B76A 4WN5A 1OJ5A 2W0NA 3ICYA 5DN6A 3ADDA 4DSOA 2E1RA 3T12A 5HWWA 2Q9AA 1ESMA 5KDDA 4YONB 1AM4D 3R9WA 3NBYC 4B73A 2QENA 1L4UA 5EQTA 3TKLA 3E70C 1K8RA 5JCPA 4JBXA 4JLNA 1NBME 1T9HA 2ZITA 1TPZA 3Q7QA 4M1WA 2JLUA 4F91B 3EZ6A 4LRYC 5DI3B 1TMKA 3W8RA 4C9BA 3THYA 2GAOA 1Z6XA 3EZ7A 3UMEA 3X1YA 1TEXA 2WWXA 4HYYA 4TL9A 4P31A 1N6IA 3HYRA 1YJ5A 1P60A 4NE2A 4B6EA 1U81A 5A0FA 1L4YA 5B64A 3OEEA 4JKYA 2OG2A 5FTNA 5J4VA 4NCIA 3KX0X 4GL2A 4TYYA 3SEAA 1B23P 1HURA 1JR6A 2HXSA 4JZKA 2Z6CA 3F0TA 4A8JA 3VNUA 4UJ3A 3QXSA 3RTYA 4IOLA 4LRXC 3H0KA 4KU4A 5FL3A 3GLFE 3TW4A 1XEFA 2CL7X 3IEUA 4RZUA 3TNFA 1BYIA 1Z2AA 3B6EA 3LX8A 1RZ3A 5JHGB 1OH8A 4WZ6A 3U7FB 3LI9A 2V8OA 2WAYA 3AKDA 1GNQA 4LYHA 4B32A 4KV9A 1US8B 3CR7A 5J4HA 2JLXA 1UKYA 2JJ2A 3BH7A 3B1YA 4R3AA 2H92A 4ON9A 4ARZA 2G9NA 3TIFA 4QL3A 5KNCA 1COWD 1GSIA 4KVGA 4BQSA 4ZKDA 1AZSC 2VV7A 3M0EA 1EXMA 3MG9A 2Z43A 3RSLA 5FH9A 1IQPA 2QRZA 1NMZA 2YZ2A 3CONA 3IS2B 2FSFA 1HQCA 3FC7A 4AI6A 2JIZA 2ZYWX 1N3BA 2Z0MA 1PUIA 3K09C 3LUQA 1FNMA 1TF5A 4Q02A 4QBFA 4AKEA 3CZQA 3AVWA 1JBKA 1TS8A 4LHXA 1KJZA 1N5JA 3B1WA 3EIHA 3H4MA 4DHEA 4OKSA 3RRMA 4CYMA 3E2IA 1LSVA 3FHCB 2X77A 3LD9A 3CPJB 4KUKA 1W36B 1R8SA 5H70A 1COWA 1NY6A 2D4HA 4MKHA 2VL7A 2D02A 3ZD7A 1N6LA 2ANCA 4H1VA 1N6HA 5FOWA 4FCTA 4JMPA 3TE6A 3PCRB 1WP9A 4HAXA 2IXGA 4BGDA 4EEPA 4RFSB 1SHZA 2GCOB 1UPTA 4EPWA 4M1YA 1K5GA 2IUSA 3SJZA 5CJPA 1CEEA 3VU9B 2ZRHA 4US1R 1E32A 2W2XA 1Q21A 3EWKA 1NF3A 4KVAA 3PJRA 2HDNB 1D7EA 3KKOA 5CDFE 1U99A 3A4MA 4JBWA 4TWZA 5J5CA 4YXWD 2FSHA 2HJGA 1DAEA 2FH5B 4I3IA 1RRCA 4LRZE 4I4LA 4M21A 1J8YF 1Y3AA 4F93B 1A5TA 2UKDA 2QU8A 3FFBA 3VMFA 2ZUBA 1TS7A 1F5NA 1KY3A 4PQFA 1S4SA 1XXHA 1VG0B 3E4PA 4RCYA 3RANA 1CR1A 2M1CA 1HT2E 2OLJA 2H16A 1F2TB 1CBUA 3RS7A 3GLFB 721PA 1DTSA 1KOFA 1ZM2A 4DEYA 4FMCB 5AUOB 3NOUC 1NVXQ 4C7OA 2OAP1 2IYVA 2ZS8A 3UMFA 5J4YA 1F98A 2A24B 2VP9A 4YDHB 4DCVA 2QY9A 2ZAOA 3QEJA 2AWOA 2VEDA 2PYPA 2IXFA 1QDEA 2EW1A 3IQXA 1XF9A 3ADKA 5CB6A 3ZS9A 1P4SA 4JS0A 1VCOA 2GNOA 2W6JD 5SZJA 4C0QC 2WOJA 1TQ6A 4IVQA 4LC1A 4V0KA 5TXGA 1KDOA 3X1DA 4EQ6A 1K6MA 4M4SA 4Q1FA 2QAGC 2YC4C 3CWFA 1XJ3A 4PKYA 1VCNA 4MGIR 2JATA 4W5WA 4BFUA 3K09A 4G3XA 1PLJA 3K0CA 4WAUA 5FTKA 3TQCA 5LPNA 1KAOA 1L7VC 1S0UA 3DM9B 1ZU5A 2WPDA 1QBKC 3NTUA 2D74A 4QGHA 1XZPA 4R2HA 4GP6A 4TQAA 4UXIA 4AKHA 3LNCA 4PPGA 2BBTA 1FMLA 1XTKA 4RKEA 1SVIA 2ZPTX 3R9XA 3VX4A 221PA 1AA9A 4L8GA 4P4SB 3DL0A 4KUOA 5IS1A 3GJXC 3VKHA 1OH6A 2W6JA 4WLAA 1OXSC 1Z28A 5EUQB 3VR2A 1G1MA 1N5IA 2AN9A 4ACAA 1J90A 1MO3A 4MYUA 2QP4A 4XT2A 4CEJB 1U0HC 3AVVA 5DKLA 3PEVA 2WJGA 5DSZA 4FWIB 2GJ8A 1I4LD 4B3GA 1Q57A 1ZBDA 2D7CA 4LCBA 1UAAA 3K9HA 4DLTA 1DVRA 1GTVA 3UMDA 4JL6A 4KFSA 4QBHA 5DHAA 3NH6A 3AM1A 1OIVA 1X1SA 2NO6A 2CMNA 3KJGA 4ZKEA 1SULA 1XMVA 1G19A 3U4QB 4C3ZA 2D2EA 4DLVA 1A82A 4LWZA 3W6OA 4EEUA 5C4GB 3A0RA 1FFHA 1BYUA 3LRPA 4LJYA 1D2MA 3MXQA 4CEHA 4US2R 1V9YA 2RGDA 3KKNA 3QI2A 4JGPA 121PA 4TMXA 2O0JA 4HAVA 1BYWA 2EFCB 1QZXA 3BH0A 3FPAA 4AYTA 1VHTA 5BWMA 2PMDA 3LY5A 3ZGXA 3AP2A 1G8YA 1OT9A 4PPFA 4XH9B 2ZI7A 1D8TA 4HJ6A 4V0NA 1U8YA 3H82B 4IHQA 2QE7D 5KYKA 3AF2A 2CVFA 1CJTC 2B6HA 3BRWD 3OEHD 5EP3A 2ZJ5A 3R9IA 3W5IA 1JEEA 2BCJQ 4HLUC 4JLMA 4PO1A 2EFGA 2QHKA 5JRZA 5D3MB 3FMFA 4NKRA 4HDOB 4TMZA 5F9HA 5KNBA 1II8B 2QAGA 1ZVQA 1LF5A 2ZI3A 2JJ1D 4MUAA 5E7IA 2F3TA 2OFXA 1G6OA 1E1QD 1Q12A 2QM8A 3CX7A 2V1BA 3MJHA 1M7GA 1YR9A 4M9XA 5DIFA 2W00A 4D4JA 2BDTA 1A2KC 4JLKA 4MGZR 4QXAA 1P9RA 1W7AA 1XTJA 3CNLA 4OQXA 1JPJA 1O87A 4A4DA 4B2PA 4KLNA 3EWSA 1FUUA 1CKEA 4LHWA 2P5SA 4QJ5A 2ZRBA 2CJWB 3TMKA 4B3CA 3OEHA 4JLVA 2L4RA 3SYLA 2QRNA 4BFVA 2IS2A 1JI0A 3O47A 4L4UA 4L9SA 3H7WB 1UKEA 2KX6A 4JSYA 3GCGA 1NIJA 3VQTA 1NKSA 2J59A 1SGWA 2PBRA 2JJ1A 2WSSD 2Z83A 4KQDA 1E1QA 5UKDA 3B7GA 2YV5A 4BECA 1KDTA 2ZJAA 4QGAA 1TS6A 3CW2A 1T3HA 3RS5A 4MITA 1U8AA 1TF7A 2VP5A 3PUWA 3DPUA 1CR2A 1QHGA 2BKEA 4KFTA 4B74A 1GL6A 4QNMA 5DKKA 4C4PA 3CM0A 4XWAA 2YOGA 2QJ5A 5FUYA 4QFMA 1SKYE 3P26A 2J87A 3BWDD 4I99A 3D72A 4WA7A 2FPKA 4IOJA 5JS8A 3EIQA 2QTVB 3F1NA 2A9KA 2O0KA 1E9CA 4E5UA 3BS4A 2GBLC 3VE4A 1HA3A 4C0JA 5F69A 1KK3A 2YWGA 1XJ0A 3A4LA 3T5GA 2D01A 1JJ7A 1I2DA 2ATXA 3TSZA 2F43B 1XCMA 3WY9A 3ZIAD 4R98A 2BKUA 4AG6A 3F1OB 4X8HA 1CR4A 2JEOA 1BS1A 1R5OA 5KO2A 1N0VC 3CRW1 3GJ8A 4YMTA 4WL9A 5AVEA 3A1VA 3LDAA 1JPNA 4HH3A 5DGXA 1LFDB 2BMDA 4ZI3A 2HF9A 4HUTA 3D6TB 4GHIA 1DG3A 1T0JB 2G77B 4B3BA 1RFLA 1UEJA 4M22A 4NPHA 3WNDA 3TGPA 3I5XA 1OE0A 4KSBA 1WRBA 4HZUA 2WMNB 821PA 2XOKA 4HIAA 4NYJQ 1Z3IX 3U61B 2XSZD 1UBEA 5EE0A 3LQQA 3RS4A 5CIQA 2WJJA 1G8FA 2C77A 3ZIAA 4WF0A 5ANRB 3Q7PA 3QKTA 1JQLB 5CLQA 2ZSDA 5SZIA 1E2MA 3VHLB 1OB2A 1V5WA 3BE4A 4Q9HA 4A6PA 4GOXA 4I1SA 3V4RA 3BH6A 5CJ2A 1X8KA 3PG5A 4F3LB 3T06B 1ZU4A 4M9QA 1QF9A 8OHMA 2PJRA 1GRQA 2ZQ5A 3W90A 1OB5A 5GJVC 1O3YA 4TQUS 1T4GA 4MH0R 3PHYA 4EFLA 4V03A 4F4JA 1T1BA 1IY2A 2ZS9A 3K53A 4R7ZA 2X2FA 2ZR0A 3KUCA 4KITB 1US8A 5CLLA 1G7TA 2FX3A 3OESA 1LNZA 4IVPA 4U02A 3HU3A 3A58B 3L0SA 3K70B 3NG1A 4PQRA 1F48A 2QTFA 4TYNA 4A36A 1UDXA 2A7QA 3S1AB 2NO7A 2RGCA 3FE2A 2BJWA 2QPAA 3A36A 4JVMA 1DAHA 1SKYB 2V6IA 4XD7D 4W7SA 1E0SA 3TBKA 3IS2A 4CW7A 1VTKA 4EPRA 4LGMA 3I61A 3PFIA 5L3SB 2C98A 2OFWA 4PAMA 2OV2A 4KLZA 4D25A 2BCGY 4U5XA 5L8VA 3WP1B 5IHPA 2GBLA 3BBPA 2OBMA 2QA5A 4BZPA 4EESA 4TMWA 1E9RA 3EX7C 1W0JA 3UXMA 3U3OA 4DRZA 2QWSA 1IBRA 1LS1A 3ULFA 2W6IA 4Q9KA 4K08A 2VHCA 3FMIA 1H8EA 2O5VA 2P2LA 4IW3B 1DRMA 2QTHA 2XTZA 1OFUX 3OAAD 2R62A 1T5LA 5G40A 5BN3A 2KI5A 4IDQA 4DDVA 2FF7A 2HJVA 2CLDX 2IBMA 1MO5A 1NBMA 1GM5A 5TBMB 3C16C 4XD7A 5DYGA 3FKSD 4HLDA 4D0NA 1J8MF 4RFSA 1MZUA 4DDTA 3GLHE 2BBSA 3EPKA 4AKGA 3SFZA 4YLGA 2ZXUA 3K9NA 4EPTA 3VU9A 4JLDA 1Z6YA 4ESVA 1NVWQ 3I4LA 2PX3A 2EA9A 1OYWA 4JLBA 4HAZA 4RCZA 3T61A 5KDLA 5HE9A 3KQUA 2RH5A 1XD8A 1Q3TA 1X1RA 2N1BA 4NYIQ 1AQUA 1GOTA 1OSNA 2WIBA 3SBEA 4LC0A 3H1TA 2C5LA 3OAAA 4BFWA 2AL7A 1DAFA 2EFEB 4HJ3A 1KK0A 3CIOA 2Q3FA 4BEBA 4A15A 4QJ4A 2VRWA 2O8FB 2XNSA 2BHRA 2PR5A 5HSQA 3IILA 2ORVA 1ESNA 4FMDF 1F2TA 3GLFA 1E1RA 4DSTA 2XTMA 4DB2A 3MQQA 3AVUA 3SHFA 4LBYA 1XB2A 4G0NA 2V54A 1KO5A 1R6BX 2ZE5A 3AF1A 4CZ2A 4OK3A 1V9ZA 5JEEA 2INWA 3UE6A 5L3QB 2FGJA 2QM7A 4GFDA 4KJZA 1YZTA 3THXB 5KSZA 3LIDA 4BASA 3K0SA 3HJIA 2A2ZA 2J7PD 5JFGA 5FTMA 4ACBA 4OHWA 4GOKA 4D82A 2XB2A 3MR0A 5LD2B 1M7HA 3DMDA 4D4MA 2C04A 1LVGA 2FJUA 1KO4A 3UATA 1R4AA 4D26A 1R0XA 5BYKA 3RH8B 1GIAA 2CE2X 3NH9A 4P0TA 4BPBA 1QHHA 1KMHB 4LI0A 3SQXA 3UG7A 4CIDA 4Z54A 3F5FA 4C0AC 2A5YB 3X1WA 1E3MA 1WDTA 5EE9A 3B60A 4JGRA 5FL7D 1NN5A 3SU8A 5ELXA 2O8DB 3CZPA 3VNVA 1VYVA 1VYUA 3GMTA 3BB3A 3QKRB 3T50A 3VR3A 2FDCA 4PO8A 3IO5A 4GP7A 2XTNA 5G53C 3F3YA 3Q9LA 2A5GA 3FYHA 3WNBA 2NPIA 4G5RA 4UNPA 4Z1MD 5IK2D 3A1WA 3QE0A 2G0TA 4KCGA 4HDCA 1IY0A 2N42A 2YWHA 1N0UA 2ERXA 2V55B 3NEYA 4CEJA 3GLHB 1ELOA 1ZM9A 5EXPA 1EFHA 2PCJA 4DLSA 5L3RA 3ADCA 2FN4A 3QPWA 4UKDA 1MR3F 4WVFA 1NMYA 4HI0E 1KOUA 1P2TA 1F2UB 1Z29A 1XEXB 3IDQA 4OI1A 4C0HA 1U90A 4EW7A 2OBLA 5CDFA 3RRZA 4BFXA 3U6KA 3HP1A 5FL7A 4QGFA 1ZD1A 4JL8A 2PD8A 4Q21A 3IIJA 3EA0A 2ZOIA 2PLRA 3ECCA 4NXEA 1N6KA 2CHVA 2OAQ1 5KSYA 3ZZ0A 3EC2A 2P6UA 3U4QA 2ZJ2A 3BY8A 5FR2A 4EIWA 4F38A 5IK2A 1PJRA 4Z1MA 4EJSB 5KUTA 3DDCA 4IJMA 1HE8B 2QQ0A 1DPFA 1TQ4A 2R6FA 1QG2A 2VHJA 2Z4SA 3VKWA 3WMFA 2O8CA 5M04A 2BMEA 4M53A 2PZFA 3NDBB 4A8JC 2IWRA 2FMXA 2D62A 4GMXA 1KHTA 4QHYA 1PZNA 2ZE6A 3W34A 1XJQA 5JWRA 1OJGA 3QBVA 3M1IA 5FUWA 4NCKA 5AUQA 4II7A 4MDFA 4H1UA 1NN3A 3KFXA 3QOFA 1P6XA 1W46A 2ATVA 4OHVA 5HKKD 1E98A 2JLYA 2ECKA 5H1YA 1SQ5A 2QMUA 2PDRA 2IUUA 5KPJA 1VG8A 2DWQA 1WF3A 4JGQA 3UMRA 1M74A 5HDDA 1HTWA 1JR3E 2CCGA 1Z63A 1BOFA 5D3MA 5GADl 1CRQA 3B9QA 1OTDA 5LB4A 3N2IA 1II8A 3T1OA 2B02A 4HAUA 4DLUA 4PSVA 5JSZB 4TTQA 2C9CA 1OTBA 1BMFD 4PZLA 1S4QA 4BFYA 2ZRAA 1IN5A 4JIMA 1E2HA 4X8MA 1GZSA 3LVRE 1CRPA 5DH9A 3A8TA 4IXMA 1R5BA 2C2HA 3TLXA 2Y8EA 2ZSBA 1TUIA 4RKFA 4Q7LA 5G3YA 1XPOA 2JLVA 4KAXA 2IS4A 2EU8A 3HR7A 4QBGB 1P5ZB 2G83A 4KBFA 4C0BA 2IC5A 2CJWA 1JJVA 4OQLA 2CVHA 1CS4C 3D8BA 1TL7C 5FUVA 2IA5A 3U7HB 3OEED 2BM0A 5G4YA 1KY2A 4LYAA 4DDUA 3NHBA 2GF0A 3H7WA 3CR8A 2ZJZA 4IDHA 5E95A 1NN0A 3QXHA 1YHNA 4N0EA 1Y28A 2ODEA 1XTIA 4DLRA 1BMFA 3G0HA 1WMSA 1FP7A 2W2TA 4R70A 1QG4A 3U3MA 3A4NA 2O8BB 1NL3A 4RD0A 2PHYA 5FOUA 2HXYA 3TW8B 1E2KA 4TLEA 4MRSA 1VG9B 4YQFA 1R0YA 1XCGB 5F5YA 3AP1A 4E04A 4GRAA 4V0OA 1KSFX 2JJ2D 1JEDA 4PAOA 4C2UA 2G1JA 4DDWA 2W83A 2F1HA 5TARA 5KIZA 2H28A 5AVFA 1U0LA 2ZVPX 2PH1A 4PR0A 1GG2A 2WICA 2F43A 3AF3A 3F1OA 5HD5A 3M6AA 4GOJA 2W58A 2QGZA 1KDPA 2HV1A 3P7NA 2JIZD 5JZVA 4JSTA 4WBSA 4A0HA 1XMIA 3P4XA 1JB1A 1RVDA 2R44A 4BLOA 1A2BA 1OW3B 1VG1A 4LYFA 4G01B 2IF2A 1KNQA 1RE0A 1DOAA 2A3RA 3UB7A 2WWIA 3CRRA 5K8TA 4MDEA 4B43A 1UADA 3WYGA 3V4FA 2G0NA 1XJ4A 1GNPA 3QXXA 2ZR9A 4S35A 2IEZA 4P33A 5EP1A 1KO7A 4LJ8A 1HEIA 1OXUA 3G6OA 1IHUA 5LDDC 2FZLA 3I5YA 3WRYC 3W8NA 1AS3A 1GRNA 3DKPA 3BIFA 1XD2B 1X6VA 3P32A 3ICQB 3WHLA 1G7RA 1A4RA 3CWQA 1Z6AA 4OBEA 1SXJE 3QG5A 2GCNA 3MGCA 3K0CC 4OHZA 5DHFA 2RMKA 4F3LA 1P3JA 5K8UA 2L1MA 2W0MA 3FGNA 5JBQA 1BKDR 2KE5A 2BC9A 1T19A 3H2YA 2Q0HA 1OIWA 5IRCD 1Z0JA 1IXZA 5D3QA 1PVOA 1S3SA 4PC2A 4PC1A 3W9YA 1JXOA 1XNJA 4LPKA 4QNRA 1NNEA 1YR8A 2K7SA 4L9GA 2SHKA 4RZ3A 3DKVA 2MMGA 1IM2A 1PLLA 3K9LA 2YINC 3REGA 1T6NA 2MMCA 2NZ8A 3JVVA 4OI0A 3S1AA 1GKIA 3MAAC 1TX4B 1HT1E 1NLZA 3SOPA 3WBJA 4IEIA 4U00A 4M1TA 5JS7A 1ZAKA 1VMAA 4Q1DA 3LIBA 2WSMA 4UQOA 5L3SA 2OCPA 3F8TA 3K0FB 1DAIA 2A5JA 1GAJA 1NI3A 3THWB 3UK6A 4PKYG 1YZQA 4FN5A 3PVSA 1DADA 4LUCA 1H65A 4E07A 4M1KA 1EW0A 3EIEA 1DP9A 1SKQA 3SZRA 3DM5A 2LCFA 4XSHA 3T1QA 4DXAA 4LLOB 3AF4A 3SQWA 1K5DA 1OTEA 1AJEA 2CXXA 4EQ1A 3ZVLA 2Z6VA 1S1MA 1LY1A 3WHKA 1AQYA 4Q1AA 1ZD9A 3GJ4A 1G4AE 5KOYA 1P72A 3TSWA 3RABA 2V1AA 5DNYB 2H1LA 2RHDA 4PANA 4HEJA 3ZQ6A 3GEEA 3VFDA 5TBMA 2B21A 4LHZA 3FWYA 2WPDD 2AXPA 1MT0A 1KMQA 2C99A 2GAAA 2VHUA 4A92A 1VECA 1J7KA 3I8SA 4QRHA 3LIEA 2NPFA 1DO0A 2WVJA 3RNLA 1M8PA 4BLPA 4QC2A 1T5IA 1UBGA 5AJZA 3NHAA 3RRYA 3EZFA 4P4UA 4Z8YA 4Z51A 2J46A 1ZM7A 3LLUA 3K8YA 4UNNA 4R6LA 1NN1A 1SXJB 4LJ4A 2VHQA 1G3IA 3CNOA 1X0OA 4EJSC 1XWIA 3QF4B 1HV8A 1IAQA 1H8HA 4Q19A 2O8FA 2WWFA 3SE0A 3HPRA 4A2QA 4NYJR 3SYKA 4NYMR 1MABB 1G7SA 3LIAA 3IBRA 2JLWA 4HAYA 4URWR 4LJ9A 4OK6A 4PSAA 4OJKA 2QL6A 3D31A 2PZGA 4PHHA 4A0GA 4M8NE 3QIAA 1XJCA 4PC7A 1A7JA 4M0LA 4Q4JB 1N6OA 2I1QA 4HZIA 4PHFA 1W47A 2GESA 3THXA 1Z0IA 1RRGA 2FSGA 3FMPB 3QKSA 2IYZA 2V0WA 4LV6A 4TTPA 2P7JA 4Q4HB 2BJVA 3O8RA 4HUQB 4Q9JA 4A82A 3MD0A 2ZRIA 3DMNA 2QP3A 2WJHA 5EE3A 3GJ5A 5BXQC 4DZZA 2QZ4A 3NBFA 4GS9B 3TAUA 4L9FA 2Z6DA 1FQKA 2WKQA 1SVMA 2C95A 2J0VA 4LY6A 3OZXA 5K8LA 3QSYA 3V9PA 2V6JA 1EK0A 1T3SA 2W0SA 3B82A 4PFSA 2FZ4A 3UIEA 2B8TA 2VQSA 3C15C 4P4TA 1L2TA 2VP4A 2WWGA 5JRJA 2O8DA 1FX0B 2OLKA 3QKRA 1XFNA 2OO7A 3B5JA 2ZSAA 2YKGA 3L43A 1N6RA 1DAMA 2YYZA 2R78A 3IO3A 1SVOA 1LB1B 4Q01A 4LV5B 4TSFD 1M34E 2HCJB 2ZI6A 3FHOA 4XSGA 3QENA 4Q48A 2XX3A 2QSYA 2J45A 4R71A 1M6NA 5HZHA 1E99A 3NIBA 3QG1A 1VDZA 1G17A 3I8XA 3GLHA 3CLOA 4ABYA 1UWPX 5FBLB 3I92A 3AQ4A 1FMJA 1DS6A 3SR0A 4FMDB 1G8GA 1Q1ZA 2REOA 2IYWA 2VSOA 4D4LA 4IRUB 1XEXA 4Q4LA 4TL7A 5FPYA 4D0GA 1R7RA 2F6RA 3VHXA 2GEVA 4ZCLA 4PAQA 5TDHA 1Q44A 5TV2A 3KB2A 4HNBA 2ONJA 1N9NA 5CIWA 5KTYA 1NJFA 5JWOA 2J80A 2KSQA 3A37A 2ZRCA 4E09A 3GP8A 2MSEB 2EYQA 1T18A 3A6PC 3UB8A 2ZRFA 1TNDA 1CJUC 3C8UA 4TSFA 4V0ME 5AJYA 1Z22A 4XVQA 4Q66C 5AJXA 4EJSA 2KBEA 2BOVA 3WBKA 3TUJC 3LIFA 4I39A 4IOKA 1VYTA 1G16A 1TQ2A 4QM6A 1M2OB 2Q9CA 3ASYA 1M1YE 2OBNA 2J9RA 2QI9C 2RGEA 1DAGA 3UPUA 1YZUA 4TLCA 4XTCS 2F9MA 4LV8B 5TMPA 4GW9A 5E7JA 1R2QA 4M1SA 3RWOA 1EX7A 3IBGA 5TY0A 1UJ2A 1RYHA 1P2UA 3PIRA 5KSPA 1KI1A 1E2FA 2QNRA 3C4JA 3GFPA 2YNMA 1KJYA 2Q3MA 1IN4A 1E0JA 1XMSA 2RGNC 1HYQA 1KI2A 3LXRA 1CJVC 5JSZA 2ZETA 2J0UB 4TQ9A 4TLDA 2YJTD 2A5FA 1PUJA 3GJ3A 3OE7A 3SFVA 2QT0A 2ZTSA 4FXPA 2NMVA 4KBGA 2GZHA 2ZM5A 3MMPA 4BFSA 3VX3A 3ZDQA 2PJZA 3FHTA 5EJEA 4ITRC 2P6NA 4LHYA 3NOPC 1WA5A 2QSZA 4WZAE 3BK7A 5GVRA 1S3GA 2XOKD 1GWNA 2IHBA 4PX9A 4C2TA 4IKEA 2AR7A 4I3JA 4M4XA 3AUYA 4DLZA 2OCBA 3SNHA 4AWXA 2D7DA 1ZUHA 2PT7A 5AJWA 5B57C 4JLAA 2B7BA 3BOSA 2IX3A 4ZI2A 3THYB 2C03A 4E22A 1W2GA 4EPYA 1W36C 3EG5A 3NDPA 4MRNA 4KO8A 4LJ5A 5JJKA 1E96A 2ZOHA 1Q20A 3NKVA 4G5SA 5BN4A 1KKMA 3K0AB 2EVWX 4NHOA 4US0R 5CYOA 2R9VA 3L8YA 1ZC3A 3NHQA 2QT1A 2ZEJA 3K3DA 2DPXA 3Q72A 1QHNA 5DI3A 2ZREA 2JLZA 2O8BA 4NH0A 1AIPA 4HLCA 5CITA 4QGGA 3RS0A 4D0LB 1KZ7B 3BXZA 2ZYVX 4AURA 2J1LA 3HU1A 1JNYA 3X2SA 1E2PA 4FWTA 3AF0A 4RY2A 2VTKA 5LBIA 1W4CA 2FG5A 1DBSA 4GSYA 5AK0A 4BBVA 4WUJA 1IONA 3L0PA 3RC3A 2X19A 1Z47A 1JECA 1LL8A 1HQYE 5CYPA 5FPSA 4I81A 2WBLC 3MLEA 4NZYA 5HWTA 2XJ9A 1E2DA 2JHEA 1I2MA 1RRFA 4WXRA 1NWZA 1XCPA 1WBDA 2A5DA 1WB9A 1EFTA 2IW3A 1KK1A 3SDZA 3PUYA 1E4YA 3TH5A 1NVUQ 1II0A 3NEJA 3PUXA 3C8CA 5K8IA 3UKDA 2DFNA 1OXVA 3BERA 1ZNZA 1X86B 4UNSA 1G64A 2CCJA 4JL5A 4BWYA 4TYWA 1WE2A 3NJAA 3OFND 2VF8A 1W0JD 2W6ID 4Q1CA 2DFTA 5CK5A 1P73A 421PA 1DEKA 1H8ED 1QVAA 2H7VA 3H9WA 2IS1A 3I73A 4KYUA 4ZV4A 3DEFA 3GLIE 1NVVR 1OIXA 3EZ2A 3BC1A 2P65A 4B48A 2RGNA 5J4KA 1XFQA 1W36D 1UBCA 1FTSA 4KXFB 2IYYA 1KI7A 3W5JA 4OI4A 1T3LA 4FD2A 4RVCA 1G9XA 1NBMD 1Q1BA 4NCJA 4TYQA 3T34A 5H8WA 2JN7A 1XD2A 5GJCA 5FFMA 1W0KA 1IXRC 4IVRA 3UWKA 2QKPA 1SXJC 4MYHA 3W6PA 2VV6A 3NOTC 5EZ6B 4LBZA 4DCSA 3ZZUA 4GDFA 4LDJA 3WYAA 2CHQA 3EPLA 4HI4A 2ZI5A 2JCSA 2VF7A 1XRJA 2WM9B 3LXXA 1TU3A 3OFNA 4O3MA 1CJMA 3GFOA 1XU4A 1LSWA 2QMHA 2QMOA 5CM8B 3TJZA 3U3RA 2AD1A 1FPMA 5H68A 2OT3B 3VAAA 4LRWA 5C2JB 1I4TD 3CLVA 5FPTA 4QBIA 3LI8A 4MQBA 3MJQA 5P21A 3LA6A 3VR4A 1B0UA 2AFIE 2RGBA 1Z2CA 4M1MA 2J41A 4H6JB 1YR7A 5KDOA 5F3WB 1KIMA 1OXTA 1XTQA 5IF9A 1W4BA 3SBDA 4CRWB 3PUZA 2ORWA 4NCNA 1Y63A 4H9GA 2ZI9A 3WRXC 2IXEA 3LW8A 1P2SA 4NBSA 4LJ7A 1E1RD 4IOMA 4Q5IA 3THOA 5G3ZA 2GCOA 4PHTA 2GDJA 3KQKA 3LFUA 4TMVA 2ZJOA 4I1VA 2J0SA 1YKSA 2J7KA 1KI9A 1S9DA 1T1AA 3CF6R 2XAUA 4HAWA 3RS2A 3RVBA 4UNRA 3BGWA 2WWHA 4F7WA 3ND8A 5CB8A 3THWA 1GDDA 4MUBA 5KSOA 2NGRA 3I62A 1SVSA 2OWHA 1D06A 3AVQA 3VR1A 4HB0A 2R8RA 4JLJA 1RC8A 4FW9A 2XGJA 3CKLA 2ZRMA 1OHHA 3GQBA 2DR3A 3QEOA 3ADBA 3LX5A 2FNAA 3X1ZA 1SXJD 4ILEA 2UZ3A 4I5SA 1P9NA 3CUEF 3KXKA 4NCHA 2OFOA 2ZE7A 1N0WA 2XNDA 4DC9A 1ZINA 3IKJA 2A24A 1E6CA 1FL9A 2BASA 4DVGA 4EUNA 3VR5A 1EX6A 2IYSA 4DJ2A 5FUXA 2IF0A 4EERA 3UANA 3GLIB 4L9WA 3HWSA 4NTZA 1T8TA 3KFVA 3PEWA 2FWRA 2J3EA 4DUGA 4DB4A 1GVNB 3O8BA 2AX4A 4M2LA 1E9DA 3PR1A 3CH4B 4FI3C 1XZQA 1UDWA 1RIFA 2QAJA 2O8EB 1G8HA 4MA4A 4HDQB 4U7DA 1W4RA 1XDBA 4Q9LA 3P20A 4JYBA 4BEJA 3EA5A 4PZZA 2CMKA 4LBWA 1ONBA 4TN1A 1LV7A 5EXXA 1SXJA 4YMVA 2GCPA 1NG1A 1HH4A 3ETLA 4MKGA 1OKKD 4XOIA 1MV5A 4B35A 3KQNA 4I1OA
chains in the Genus database with same CATH superfamily
2D1RA 3O2SB 2C9OA 1IU9A 5DI9A 2AFIB 4J1TC 1TZMA 2FQYA 1PDWA 4B7XA 5JXGA 2VA8A 3GYBA 1G3QA 3KKQA 4JF4A 4KLCA 3OQNA 5DLQC 2HDUA 1ZD8A 2FN3A 4FFMA 4BNJA 2B18A 1P97A 3G89A 1TYAE 4DREA 2FEAA 1JSCA 3BRCA 5BQOA 3SS8A 4KO3S 4KXQA 5F1GA 4ME4A 3QELB 2YC2C 3HVKA 3KX2A 2IYFA 5L4LA 2IHUA 3UYLA 1IZZA 4HBUA 3W4JA 1GLGA 4UARA 3TO5A 3OMXA 2CLKB 3TQFA 2JKTM 1CVRA 3GFVA 3IRUA 4EBBA 2YZMA 3W2ZA 5G0SA 3DB2A 2Z8XA 1GAWA 5LZ9A 3R8CA 4I8DA 10MHA 5EZ5A 3KXLA 4LY3A 3QUSA 5YASA 3WOVA 4PE5B 4CQLA 1Z0AA 4J8PA 2ZI4A 5TJ9A 2Q5LA 5HM8A 5C8VA 3AVTA 3F97A 4O2RA 5K3DA 3VTKA 2YKHA 1G20E 1CLEA 2V7EA 1U9JA 2H5EA 4R1QA 5HGXA 5KNDA 2OM2A 4HO1X 3R0JA 4EMUA 5EMLA 3ROTA 3MHTA 1AGXA 2VK3A 4R1GA 1G18A 1UH5A 3BM5A 4U0KA 3AMVA 2Q9BA 2QD2A 4RQBA 1UDRA 1YR2A 2WSYB 2VUSA 4H7KA 3E4QA 1DBIA 3ECSA 3L9WA 4V3CA 4HLQB 5IT9A 5HYVA 1M1YA 2H57A 5A5VA 2F3RA 5LQNA 4IUHA 1LCIA 2CDAA 3QJYA 1P0CA 1ZUIA 3AFNA 5FWYA 2V74B 4WKGA 1N7GA 4GECA 3D6FA 3ONVA 1IBKB 4I3AA 3EVBA 1QHIA 4Q1BA 2VRNA 1ERMA 2KWIA 1X7ZA 4BLRA 2CUKA 2BMVA 2HJ9A 2ID4A 1EG7A 3BFVA 4O4JB 5EUMA 2ZM6B 3RB8A 3DE0X 1KFBB 2CE7A 5T4FA 4QY5A 5EQFA 1NFRA 1DJPA 3TPCA 1IJBA 1Z6TA 5IAGA 1JTEA 1NKVA 4CLRB 1VSVA 3Q7ZA 2IZZA 5JRDS 2J67A 1Q0UA 2FAXA 4NXGA 4J1SA 1L5SA 3MCVA 4DSNA 3K4PA 3SVLA 3O84A 3ZWNA 5LLSA 1RI2A 3C6QA 4MW7A 1NW3A 2QMZA 1YT5A 2C9ZA 2RBEA 1FNBA 5EIOA 1ORTA 5KWSA 4RF3A 1F14A 1NJ8A 1GILA 4IVKA 3M4ZA 1XXLA 2P5TB 4EHNA 3S8EA 2ZVJA 5BQXA 2GRAA 1KI8A 2FHPA 3GLTA 4NJEB 2RK3A 3JR3A 5AUNB 2C7PA 1D5CA 4K0XA 1IATA 5KYXA 3C5HA 3FNRA 1XDUA 3QUCA 4DEXA 1TT5B 1K5PA 2H52A 1FJ2A 2PU2A 3IAEA 4LAFA 4EG6A 4OUDA 4DTCA 2JJMA 4NYIR 4R1OA 4HB2A 4A1FA 4GPZA 3SJUA 2VZ9A 2YIVX 1PR2A 1D9XA 5F5XA 5FI1B 2LIVA 2XB4A 1DIBA 2ISQA 1PW7A 5BOVA 2WABA 3ETNA 1NRFA 2QN9A 2W6ZA 5HD3A 2V6GA 1OFGA 1W75A 4D8YA 4KZ6A 5CGWA 1TA4A 1I94B 4CM4A 5A9SA 3IUBA 3QPCA 4URZR 3UN7A 4UNQA 3RIXA 3ESXA 4WIAA 1CS0B 4N7MA 4ZHSA 3GMDA 2YCLA 1SU7A 2YXBA 3GVXA 2V1XA 4C4RA 5B2FA 1P4GA 4QIHA 4ZANA 4KAFA 2JIBA 1UKZA 2RH8A 3KQSA 4ZK6A 1NLYA 2AFHA 2WQ6A 1MO4A 4AP5A 4OPMA 1QPBA 1U1GA 1RP1A 3TW6A 4MIYA 1VMIA 2AT1A 3UH1A 4Q00A 1MX3A 3OQVA 3D3KA 1XRNA 3B6KA 5JMTA 4BBUA 4KXUA 3PUHA 1EX9A 1U3UA 3G9UA 5J40A 3UDIA 4JDUA 3I6YA 1XBTA 1P2VA 4K8OA 1JEYB 1SWVA 1CY4A 1RPZA 3AO0B 3PEUA 3T5DA 2V4ZA 3IJRA 3VC1A 1XR3A 4Q3DA 3PYPA 1WEHA 3BJNA 2ZTUA 4L2IA 1FP4A 1XXHB 1ZMXA 3GR6A 3HN7A 4DUGD 3ITNA 3MJRA 2EAUA 4G0YA 1GR1A 2KLIA 1Q0PA 4LY9A 1EFPA 4ZRMA 4II3A 3B20A 4QLBA 4MROA 2DHEA 2ARKA 2DSTA 2X9QA 5CD9A 2I8LA 3ZCSA 1PK8A 4YRQA 4MRRA 5CVJA 4EY7A 3U4AA 2MYUA 3WYFA 4OA8A 3VYTB 2QRMA 5JH7F 2R6AA 5CP8A 2C6WB 1VHLA 2MYNA 2IYRA 2B4AA 4WOPA 1ZXBA 5AI5A 1GSHA 1WVIA 4D8TA 4CMKA 3V2GA 4DIMA 2YY5A 3TR0A 1T91A 3W3AH 3NX4A 4MI6A 5CCBA 4GVLA 2BPOA 4EK9A 4HSEA 3QITA 1TGYA 8ATCA 4G25A 3NV7A 1URPA 3ZW9A 2UXCB 2R8BA 2NXJA 3GEHA 3V34A 2YFKA 4QRDA 5HWVA 2NU8B 3LQRA 4Y6LA 1YB6A 3V7WA 2QN7A 3LYXA 3P4UA 5JAHA 1G3UA 1JHZA 1JHXA 4MRMB 1WVGA 3I9FA 1C30A 2R65A 1HKHA 4ZTZB 5CGQB 4FMBB 3HQ4O 3AEUB 1ZICA 2IV3A 2PBDP 2FEWB 1NZUA 2GZAA 3OUTA 5C5CA 2QRHA 3WYDA 4LZWA 3SZMA 1M2OA 5HEKA 1IZYA 5FBRB 4FTXA 4XWGA 2X2PA 2PX2A 3ZZMA 5IVIA 4HBTA 2QS9A 4D4KA 3LH5A 4KPGA 1HL7A 5EHXA 2GCGA 3II6X 2XQGA 3NYIA 3A9WA 2NVUA 4I6GA 1ENYA 3T38A 3ST7A 3I2YX 2O07A 2I4RA 3ZI0A 1TVEA 2P8SA 3RTDA 2CF6A 4HNHA 4B6EA 5A0FA 5K1ZA 4R5HA 3DZKA 1RZUA 5E3JA 1R37A 2YBEA 1Y34E 2GN9A 4NMHA 3RTYA 4IH9A 3GOQA 1ZGZA 3B6EA 3LX8A 5I8PA 4BQFA 4LYHA 4RQTA 3JWJA 3MG9A 4HGYA 2Z43A 4LQ4A 5J8XA 3MS4A 3LY9A 3O3VA 3U37A 1QPZA 2VDWB 1PFKA 2R8PA 3MVEA 2YFYA 3AVWA 3F6CA 1LSVA 4KUKA 2W8BA 4RNDB 3VZSA 3EAFA 4L6AA 1UPTA 4FK8A 3A6GA 4ETXA 3MRVA 2G8NA 2WHPA 2HJGA 4H18A 4R51A 3DKRA 9ABPA 4RCYA 4DNXA 3EXHA 5FAKA 4EENA 2EF0A 2NUAA 4ZVUA 4OX9B 5J2UB 2A24B 2NU7B 1I7DA 5IT4A 3IUQA 3SE7A 1Y4UA 3VV4A 7MHTA 1YMXA 5FAXA 1QV9A 4JD5A 4BFUA 2XT6A 1LDEA 3RT7A 3NTUA 2O9CA 3DVAB 4X1YB 3A10A 2ZWPA 4P5DA 1H4VB 3ICWA 1OH6A 1NU8A 4DV3B 1OXSC 1N5IA 1BVYF 2RG7A 1ZGAA 4CMJA 4RK0A 3LUKA 5DSZA 1EZZA 3T4TA 5CX1B 1YCFA 4Y9TA 2TSYB 5J5VA 3D3OA 3ITAA 1BKSB 4DQVA 3H5AA 4EUSA 5TIIA 1FU4A 1H8MA 2A9FA 4DSAA 4LJYA 4O3FA 1VZ2A 4PWZA 3D64A 4KZKA 5D00A 2WU8A 2EZ9A 3FPAA 1D0VA 2XB9A 5LP1A 1SB9A 5FWNA 3PD1A 4Y0UA 1GFZA 1A50B 3A6DA 3DBOB 5KYKA 5T8KC 4LZLA 2HSZA 4JZYA 2BCJQ 3WSWA 1JFTA 5JYEA 1EGVB 1BGWA 2QM8A 4EGJA 3QBEA 3LCVB 3BXXA 4JLKA 3CNLA 3D7LA 2VDLB 3AGFA 2CJWB 1XZAA 3TMKA 3UY6A 3MK31 1ZFNA 2ZIXB 1NIJA 2J59A 5D1HA 1M33A 4QGAA 5C7YA 4DR3B 1QFZA 4BJ1A 3PUWA 1GL6A 2VJCA 4DV6B 4C4PA 1Z8DA 3HJAA 1QVWA 4EX6A 1ECGA 2JFNA 1HA3A 3IWOA 5FI2A 1XWWA 1JJ7A 2GK4A 1CI9A 2CVQA 3WDSA 4TV8A 1DKOA 4JR1A 3HABA 5FLKA 2I03A 1TJNA 2BMDA 4S1PA 3NRBA 1CVIA 3QRWA 2RC6A 3WNDA 2Y68A 2ZB2A 3IKLA 2XSZD 4HQ6A 4ZAMA 4J16C 1UWVA 1HKUA 3B6IA 3UHFA 1IUOA 3T4XA 3MS6A 2B98A 3NDJA 3ORSA 1Y48E 4EJ6A 1IUNA 4EP1A 1T1BA 3SIXA 2X2FA 5F52A 2XTAA 1K08A 2FX3A 2QKYA 1M72A 3RYFB 2IE8A 3H8VA 4D3XA 2A7QA 5JAMA 4FDMA 5AVZA 5LNK6 4FFVA 3ANTA 1DV2A 1UXIA 2XA2A 4CR6A 4OPRA 2EV9A 1HZZC 4REMA 2VHCA 4DOMA 2BHSA 2NWQA 1EGQA 1E66A 3GRCA 1Z15A 3IT3A 1TCUA 2ZG6A 2IBMA 3V7NA 1NBMA 2B5OA 5DYGA 2VDQB 1MG5A 2DUWA 5DRYA 4PCUA 5KHAA 2DXIA 3LG2A 4KH0A 3FRJA 1NVWQ 1M8GA 3L8DA 1FJXA 3I0MA 5BSUA 3SBEA 5LMZA 4P7JA 2O6LA 3AX6A 2OP0A 6ADHA 3S68A 1J42A 2L17A 4DSTA 9GPBA 2XTMA 3FTEA 4R8LA 5EVCA 4ENVA 2E48A 4ZEVA 5IZCA 5ALYA 2QM7A 1MB3A 1YZTA 3THXB 1FA9A 1P9LA 1XF1A 4B88A 3KEFA 3R3JA 5D85A 3VOAA 4XVHA 5KNBH 1LVGA 4K40A 1LKZA 3GNQA 2O54A 5EJ2A 1E5DA 4HQOA 4KZ9A 3OCLA 1QHEA 1XRQA 2PUJA 1NBWB 5EE9A 4RVOA 2I8CA 2P9JA 1I4EB 2FZCA 1QE5A 1QIEA 5B7PA 4W6ZA 4EVSA 4Q3CA 1VA5A 4KCGA 2N42A 2O20A 5KTNA 1O08A 2YJGA 3QP4A 5HF8A 1W73A 2R96A 3DEJA 1Z29A 4EW7A 3L6BA 1A76A 4AMBA 5LMUB 3LGAA 3VGPA 1MQ9A 3LPLA 2XCIA 5ISMA 2I87A 2P6UA 2J3TD 4EIWA 3H1FA 3DDCA 3WMFA 2QVBA 1JU4A 1Q91A 1JSLA 2WT9A 4QOGA 5JWRA 1OJGA 2PR2A 4JCCA 4JLWA 3AUFA 2VGLS 5CLFA 1I36A 2D54A 3UMRA 3G8BA 1V6SA 3G34A 5LXTA 2AG1A 3F7NA 3L1VA 3KQMA 3R4VA 3UKOA 1GZSA 3K6SB 2C2HA 4YRFA 4CTJA 5JCOA 5G3YA 2JLVA 2BHTA 3D6VA 3QJ5A 4PIMA 3USCS 6AT1A 4YAUA 2OC4A 4BYMA 1Y7IA 3VVBA 5BN4B 3UN1A 5KTRA 2H1IA 1QRTA 4ONEA 4NS4A 2EDAA 3TW8B 2HHHB 1JDVA 3GT0A 1FSGA 2M9MA 5I94A 2JKRM 2G1JA 5KJ1A 1UBJS 1Y1QA 4PR0A 2V7UA 4PZ9A 1CYEA 2QGZA 5COAA 4BWVA 2XI4A 4A0HA 4FC7A 3BMXA 5BSRA 2HO4A 3NWBA 1VG1A 3EFHA 4DHWA 1T4BA 1R27A 3AW8A 3R6GA 2WE8A 1RC1A 4IWNA 4LCEA 1KO7A 4XUCA 3PI6A 2XGMA 3JZDA 1AS3A 4GOND 3CWQA 4GOOD 1ZMBA 1OU4A 3MGCA 3FGNA 1Z0JA 7REQB 2MJ6A 1HYGA 3GCWA 3WGKA 4ER0A 4HNQA 1A69A 3C1OA 2MMGA 4IHKA 1HT1E 1MFZA 1X19A 2PUGA 1JEYA 2QV7A 2FN9A 3NKFA 5K0LA 2D1TA 3DMGA 4LF4B 5CLHA 3THWB 5CVUA 1NWCA 1NA5A 4LUCA 1MJGA 4CMEC 3OLVA 2CXXA 2P90A 3UTDA 4EABA 3U7IA 3S2EA 3RABA 4WM9A 2YTZA 1PBTA 3V1MA 4ZOCA 4H3VA 2OWEA 4P93A 4HNTA 3E7FA 3RC2A 4CODB 2NUPA 4BLPA 3PX7A 5AJZA 6CHYA 5DOVA 1IZ0A 1KR5A 3L4BA 4KQOA 1NN1A 3G8DA 2VHQA 4QULA 1HV8A 3IS3A 3T52A 2JGRA 4K9RA 2HA6A 4QA9A 4LQDA 3PTZA 1PR3A 4PC7A 2Q5CA 2ADOA 4JXGA 1VEUB 4H1HA 4A8TA 3DMNA 4M0UA 4D92A 2V96A 3ZHHA 3T3PB 5IKXA 1DBQA 4E3LA 1XGJA 2FR1A 4FR2A 2Z1NA 3V9PA 1EK0A 1BMQA 4ZN6A 2QUJA 5G4LA 1T1IA 5LQKA 2HA4A 3KT3A 2HCJB 1PKEA 5KOHB 4XM0A 3L7IA 1GHMA 1XQWA 4BGVA 1G8GA 3A3DA 3RU9A 1J5EB 2GH1A 1SQ0A 2F6RA 4L3VA 4LVUA 2LVBA 4I3FA 3B5IA 2NN3C 3PI7A 1XAGA 2VUHB 3C48A 4HUJA 1NTRA 1HF3A 1BRMA 3L46A 3WBKA 4QQFA 3ESYA 3D3JA 4IOKA 4EYGA 5KSWB 3ASYA 1AQNA 1NW5A 4FUTA 1JG7A 2OZPA 1NFQA 4ZBEA 1JIJA 2R9WA 4KQHA 1Z6QA 4BV8A 4EB6B 1LLDA 4RXTA 1L3LA 3C4JA 4HHEA 5BV8A 4WADA 2RH4A 2CLMB 3PX3A 2NSYA 4M6WB 2Z2KA 3K9WA 2R3SA 4HAIA 2E4XA 2QSZA 3MB5A 4WZAE 5F73A 3C24A 1VSQA 5CXUA 2D7DA 3QWFA 1A72A 4E22A 2O5RA 5HFAA 3L5OA 1FDTA 4JDPA 3U62A 1RAAA 1B3RA 2DPXA 4V0QA 1MVLA 1KZ7B 1QM5A 2ZYVX 3BXZA 1JNYA 3FPCA 2ZAGA 4F5EA 2VTKA 1PZOA 5DLDA 1Z35A 5FPSA 4I81A 3MLEA 4NZYA 3WSVA 1SQGA 4ETNA 1BLHA 3LP6A 5GPBA 1UBNA 1EFTA 1N1GA 4RKWA 1MOPA 4DPKA 4ZT4A 3RVMA 2YDYA 1MIOA 3RJTA 3OFND 4DC1A 4CN8A 3CJQA 2I65A 3CVVA 3EZ2A 2GKGA 4NCJA 4GKKB 2J4FA 3EZLA 5BMVF 1W0KA 4C7MA 2F3SA 4LVNA 1Q77A 3KSIA 2HSWA 2WM9B 1LSWA 3D2LA 3AHIA 1FPMA 1LDYA 3PPWA 4E15A 1LPSA 4JUAA 2AFIE 2RGBA 4L28A 5HS4A 1E1RD 3QX3A 4EBPA 1KMMA 3VXKA 5E43A 4P5EA 1RVV1 2GDJA 2PRYA 4KRYA 3VR0A 2BGJA 2A0FA 1UXHA 1JQAA 4LI3X 1PVVA 3VOZA 3COZA 4I5SA 3B48A 2WR8A 4E1VA 3RAJA 4ND8A 1AQJA 3IKJA 2A24A 3OE1A 1K3UB 2NU7A 3HWSA 3DAHA 1X77A 1UOOA 3GQZA 1W4RA 1N2HA 2CMKA 4DN6A 1PT9A 3GRVA 3R41A 4J0QA 2SCUB 4D9GA 2HT1A 2VZWA 3FSGD 5JZOA 1QPGA 1WDMA 4I7EA 1UQRA 4X1YA 4Q12A 1NXWA 3RF6A 1ATIA 5EHQA 4RD1A 1OLUB 1TVFA 2QVZX 2WFAA 1Q2QA 4D9IA 1USVA 4RKYA 4HQFA 4P85A 2ODQA 3GRKA 2ZU6A 3ZD6A 1V41E 1E79A 1G0OA 4BGIA 1FX0A 1DG1G 3FPGA 5FTLA 1EM8B 1Y3BE 3B2NA 3K30A 4AAYA 3MQFA 2ZAMA 3PL5A 4KQGA 1Y7HA 3DYVA 4QXQA 3L7LA 3GUZA 3L7DA 3R7SA 4IMPA 3JYPA 2J6HA 1O9BA 1XN4A 2XK1A 4MQEA 3W2TA 1O96B 1ZSYA 3C2WA 4MUHA 4EB0A 2JRLA 2GD2A 5JY6A 3JVUA 2AYZA 3NBXX 2FMIA 4J29A 4HEFA 3QBTA 4BPRA 3M9LA 2DFLA 3L6EA 3BSSA 2JKFA 5C8XA 2WAXA 3PL1A 1ANKA 1FIKA 3M89A 3SSAA 1M6HA 3LQ4A 5EXTA 1QWSA 4LJ6A 2VPPA 4L4XA 3I2HA 2Y2KA 5REQB 1WCV1 3DMTC 3BGOS 2HCBA 1DBRA 4E31A 1C0EA 1RYDA 1WSBA 5I7VA 2F67A 3OC6A 1DWPA 4OP3A 1SELA 3PD0A 1QLHA 3M83A 5TQ2A 3UT5B 2JFUA 2V3VA 3KYJB 5BT8A 3MJDA 1P75A 4I55A 1FFDA 2OMEA 4K3VA 5H82A 1XZGA 2PNJA 1NLMA 2Z1DA 3UGJA 5HZKA 7ABPA 5SZKB 2RJNA 5IC5A 2GUGA 5B30A 4S2IA 1Z26A 1QQTA 5LYJA 4KPYA 4YDSA 3AERA 4JH0A 5TVGA 1JS1X 3D6AA 2IYLD 3LPAA 2BKXA 3AEKA 3D4IA 5GZ3A 1A1VA 3RSHA 5LQMA 4MV7A 2VBFA 3T3NA 4JITA 3MJVA 4H6JA 2K31A 4CXMA 2FSVA 4D6XA 4FFNA 5HFOA 1FXUA 2XXJA 1TVKB 1O6CA 3LYLA 4XKJA 3VPHA 2DB3A 3DF9A 3ZVMA 2Q21A 1KGEA 2N1MA 3HXTA 5BR8B 4TS4A 3QX7A 3JD4A 3LDFA 5FXMA 5LUAA 4DLWA 4D74A 4JQCA 1XJ6A 2PSDA 4HN9A 3VI3B 4L9AA 3NTQA 1SU4A 3MOGA 2AKYA 1JFRA 1E0AA 4EVIA 2MWMA 2XUQA 4RZSA 1LEHA 1SDNA 3MWFA 2A9JA 2ILVA 2YXEA 3LCCA 1ONGA 4MARA 4L3WA 2WKRA 1LS6A 1YZ3A 2BSQA 2ORYA 5G0TA 4LIPD 2JIOA 1Z7BA 4Y13A 3OQIB 2B30A 1L5KA 4BNNA 5H59A 1OWOA 4TWBA 2O8CB 1B16A 1NZOA 1CF0A 4B6RA 1ONSA 3IA7A 4KL8S 4IJUA 2TRSB 1QUFA 2OUKA 5ALLA 4YUVA 1Y1TA 4LX8A 4PRKA 3ZIUA 4D2OA 1ST2A 1KEZA 5TGFA 2GCEA 5IVKA 1XVTA 3CPHA 3GXBA 3R77A 3HJGA 1MEOA 2A88A 3DXXA 2NUTB 1AXRA 2VIIA 3DW0A 5KKAA 3RREA 3K6SA 1Z07A 2FPRA 2OSBA 2DTDA 1GO2A 1E9FA 1MDBA 1N2CB 2Y2GA 2P1RA 1FFSA 1QKIA 3ZGNA 2X3FA 4CLXA 2PU4A 3AFMA 1NRIA 3TCXB 5DT2A 2XOEA 3KWLA 4YT8A 3E0YA 2IOQA 3IBYA 3S7TA 1EFUA 3BCHA 1XXHE 3HVFA 4Y6RA 1V1MB 4JXXA 5GJBA 4LXUA 1GLVA 2B3TA 4MCWA 4B2YA 2W2VA 1GSWA 3MUFA 1BEEA 4OAQA 4KQ2A 2PMKA 1PT6A 4M8LA 3FG9A 1DP8A 4JJ7A 5A0TA 1E94E 5B3JA 2W6QA 1GN9A 3GPIA 4KR0A 1RR6A 1QV7A 4KB5A 5CURA 3VR4D 5L7TA 4KIGA 3OP4A 3S27A 3ABIA 1XNRB 1R00A 1DMRA 4JV5B 4D56A 2WADA 3KSGA 1GLNA 4TLBA 4HP9A 1M2FA 2IT1A 1Z7GA 1JT2A 5C37A 1ZK4A 3IBSA 1G6KA 5FLXA 2FXIA 1Y5MA 3NWOA 2G8LA 4B33A 3T1QB 1G20A 3MWKA 3MTGA 4Y2FA 3KOXA 2RKOA 4XI9A 5LMCA 4B6FA 3PYLA 4NXNB 2V9CA 3QNUA 2PR7A 3HJCA 5FAPA 4ER5A 5FP0A 5CBPB 4AWAA 3CLTC 4F45A 2Q49A 5HIJA 4QUKA 1RTTA 2PWBA 3SKXA 3VOTA 1U0JA 1VCMA 3K1AA 1E2IA 4CM3A 1QYDA 1PYGA 1TU4A 4DMFA 1Q0LA 2BI7A 3UMSA 1MGPA 1JH9A 3PXEA 4FOPA 3UWOA 4OQPA 4WVLA 3IQAA 3KV1A 1CHNA 4NH4A 3K05A 3GYGA 4GNRA 2AG5A 4JWKA 5L8MA 2JGFA 4G3VA 1TOAA 1O5OA 4BMOB 3GDOA 3L0IB 5B2ZA 2IYUA 4TT3D 5IUKC 1OVMA 4KQQA 4L3OA 4P38A 5KOHA 5SYAA 3M2KA 4WUTA 3EDRA 4QHTA 4PSDA 1YOVB 2DR2A 4QQ8A 2L0XA 4MS3A 2CHUA 2FR8A 4N48A 3HCFA 3M1YA 3ZQ5A 3RJZA 5L2FA 2EWWA 4CLOB 5IYZF 4EG4A 3GAZA 1P6QA 3MMSA 3KV3O 5CDSA 4NMWA 3KTOA 3FPVA 4F86A 2YIDA 4AZTA 4F94A 2GSDA 4A0FA 1U2EA 2H65A 3LDGA 2NT4A 4FE7A 2GEDA 2RH9B 1GDTA 1H05A 4KO4S 4CV0A 3OIUA 4M6WA 3A3PA 1HE5A 2QNBA 4JBIA 2GAFA 5A3VA 4Q9DA 4NDAA 3DJFA 4YOFA 3V67A 4DJEC 2JLUA 1CG6A 3SF8B 4ZP1A 4DCPA 3P09A 2HRZA 5L7WA 1PZMA 2TMGA 1LX7A 3D4BA 3KJFA 4GSLA 2VZ0A 1THGA 4LF6B 2BF4A 4XLLA 4D3YA 2CL7X 1BYIA 2J0EA 2REQB 2H9YA 3B6MA 4MLPA 3RT9A 3ASVA 4PNHA 4WKOA 2HK6A 3RSLA 5GL9A 1KAMA 2FSFA 2VJWA 3ISVA 3KNZA 3E2IA 3G5LA 3L6CA 3DEKA 1HZJA 4MLCA 1EINA 1QB7A 5F78A 5E6RA 3MQ4A 1DXOA 1RABA 5JG7A 3KKOA 4UEWA 1SIOA 4I3IA 4JXVA 3AOGA 2O2CA 4O2AF 1LI5A 2Q07A 2XMRA 5DULA 2OAP1 5HX7A 1P0PA 3STXA 4LC1A 2R7LA 5IBRA 2W2NA 1ZL2A 3PNLA 4DA6A 3N53A 4DQXA 3K0CA 2XGNA 4FS8A 2WFMA 2H2FA 3ZK9A 4KP7A 1RXEA 4H1WA 2SCUA 3GEDA 3GJXC 5EZQA 1R9GA 3H5LA 5MDHA 1G1MA 1EKXA 2AN9A 4XT2A 1WTAA 5I9LA 3BHNA 4FWIB 2ISCA 4XUGB 3CMZA 1UFRA 4BNTA 1GTVA 2VZLA 1KARA 5HILA 3ZCXA 3QA9A 1MZVA 4FDLA 1R0LA 4DARA 4FEGA 3RRFA 2E49A 4G23A 5C4GB 1BYUA 3QI2A 3M6LA 5L07A 5AVOA 1EM8A 5FCDA 5K5BA 2V8FA 3UDFA 1D8TA 3SR4A 3EIFA 1K4MA 1VYHA 3R5JA 1Y9EA 4R4RA 2O2JA 2QZZA 2QV0A 1ZG4A 1I13A 3OT5A 4IKPA 3RYIB 1L4HA 1P0MA 2P77A 5BURA 3MJHA 3SHTA 2W00A 3WQHA 1P44A 3UDXA 2HQOA 1OR8A 3W1VA 4I4TB 4LHWA 1CKEA 4Q16A 3OEHA 1O96A 4CL2A 1Z4MA 3IKTA 4IEDA 1HNXB 2ZMFA 1ERQA 4QOHA 1Z18A 2Y2IA 3UE3A 2H8GA 1GUFA 3E15A 3JVIA 1K92A 1FR6A 3A1DA 4ROSA 5DKKA 2YOGA 4QFMA 4AT1A 1U6JA 4O4LB 3TQOA 3QWHA 1RXUA 3OF3A 5JJ5A 3JQFC 4MW1A 4LOKA 2JEOA 5REQA 5I9NA 1R5OA 4OOYA 5B1SA 2X22A 3SMQA 1DHRA 4IMJB 1E6UA 4YGXB 3UYKA 3D6TB 1ACJA 1PJAA 4HFJA 4B3BA 4XAQA 1RFLA 4XQGA 1BN6A 1GA9A 4HEHA 4JJFA 5TRTA 1UBEA 4KEAA 3LUDA 3QUQA 4XVCA 3SOZA 1SHTX 4HYTA 1E2MA 1T0IA 1ZR4A 5CJ2A 2HSDA 3EMBA 2Q6VA 2Y77A 2VXYA 1WF6A 4MH0R 1D2CA 2QJWA 4KITB 1E3TA 4RTMA 1DP4A 1F48A 2G28A 4CNQA 1AC5A 1UDXA 3I6MA 1CVLA 1SKYB 4XD7D 4B40A 4DR6B 2ZL1B 3BX1A 4RADA 2QA5A 4GLBA 4K08A 2CKDA 2GPWA 1T4CB 2XTZA 5HPFA 2DCFA 2W48A 1KEKA 4PONA 3I1IA 5JV5A 3DHVA 3UAOA 1ZI8A 4RFSA 1MZUA 4DDTA 4AKGA 2PX3A 3SS5A 3K71B 1BNCA 2RH5A 4JBHA 2JFHA 3RHTA 3IERA 4HK4A 2Q3FA 3D7NA 2Y71A 4ZAYA 1G9SA 2VPTA 1WZIA 1YZFA 5LQJA 3H7AA 5B4UA 3MQQA 1IM5A 4RIIA 2Q3JA 4TVKA 4K3UA 3F3MA 2XWPA 4YT4A 4XUEA 3GZNA 4DMRA 2GVNA 2HGSA 3C3EA 4LI0A 2K87A 2JC7A 2OCIA 4KN9S 1JKJA 5CHUA 4GP9A 4MO2A 4YUYA 5KJ6A 4WVFA 4KDCA 1RADA 4OI1A 3DTIA 1U90A 3UOAB 4FLFA 1VMDA 5IKOA 4HMQA 2NU6A 4MVJH 2DE0X 3ZU4A 1N6KA 2JZOA 3EXEA 2B1JA 2W8ZA 2DFVA 4R1MA 2O19A 4NY1A 4C7XA 2VHJA 2Z4SA 3I6ZA 2O8CA 3A05A 3VO8A 2FMXA 1KHTA 4MDFA 2YHAA 2ZP1A 2MSKA 1QFXA 2PDRA 4QD4A 3WLJA 2XHZA 4RTOA 4XX0B 5D3MA 3B9QA 3EGOA 3DE2X 1L0BA 1BMFD 1CRPA 2NUTA 4JBNA 5CLJA 5CB0A 2G83A 3HZHA 4KBFA 2IC5A 1KVLA 4P84A 4E4YA 5FUVA 2V58A 2X6RA 3HMKA 1P17A 1L4NA 3M4NA 2ODEA 2C8JA 4MR9B 1FP7A 5ES4B 3LLSA 3V2HA 3EQ9A 4V0OA 4DDWA 2Y1XA 1P7WA 3AF3A 2J7VA 1IDOA 4H7PA 5JZVA 1V1MA 4ZAXA 1ZJYA 3P4XA 4RLSA 2R44A 1A2BA 1Y4DE 2IHZA 1GQSA 1ECPA 1ML3A 1U9ZA 4GRDA 4WDQA 1F9EA 3TAXA 3PJDA 3JQAB 3I5YA 1GRNA 1YRWA 4XUZA 1GN8A 2CNKA 3N5KA 4OH0A 1YQUA 2RMKA 1KERA 1KIFA 1P3JA 4JYAB 2FKNA 3QEBZ 5KEIA 2X0DA 5IRCD 2JKVA 4PC2A 1USWA 3W9YA 1XNJA 3BA6A 3H5NA 1YR8A 1KE2A 2YJ5A 3DKVA 3FTFA 3DTNA 2WNHA 1W30A 4OI0A 1RYYA 2ZIFA 1TX4B 2WQZA 2XMGA 5I7AA 3NQ41 4AG3A 2FMTA 3CG0A 4F9FA 1NX6A 2QUIA 4WCFB 3K1TA 1ICIA 4LDRA 1DADA 1JZSA 4E07A 2FLKA 3IDOA 2ZIUB 3T1QA 1F38A 4RHEA 1I1OA 3IEKA 4K05A 2V1AA 4YRZA 2WKHA 1NQUA 1E4EA 1VE1A 2WUQA 4LMRA 1ZA2A 1ZQ9A 3AG5A 2QN2A 3DTYA 2OV6A 4YCNA 4OCZA 1N3YA 1VLLA 3RRYA 1NUQA 1Y7TA 3V4VB 3A2KA 2FRDC 4DLKA 5CBPA 5KQLA 3UKJA 1GJRA 5BYBA 1A4IA 1P3Y1 1I14A 3AK4A 4KGDA 4PHHA 2BFCB 2O8VA 3IXDA 1RAGA 5KWVA 3VO1A 2BJVA 2PUBA 4EUHA 4ZZ2A 3OOYA 5T67A 2P6OA 2OORC 2H08A 1PW5A 4YV0A 2VP4A 3LXUX 2OO7A 3IYLW 1LB1B 2J48A 4JROA 1AA6A 4DDSA 2WUDA 1A98A 3CNEA 4GDBA 2ACEA 4FMDB 4FYIA 4AJ9A 1LNSA 1IYSA 1YOVA 1UWLA 1VHJA 3GP8A 3A6PC 5EXEA 5EJ9A 1FBTA 3ILSA 4BJHB 4DJJA 4L02A 4CLOA 3JPWA 1V3UA 4D7AA 2EKZA 5CA0F 4KIWA 1Z12A 3PDUA 1H2EA 1M10A 1S5PA 4KUGA 1E6EA 1LSJA 4KR3A 3GJ3A 3V8NA 1T15A 2JKZA 4B3TB 3OKPA 2WSBA 4BFSA 2H1VA 2VDRB 1PV1A 2RHJA 1XZHA 3SNHA 2PT7A 1PWEA 3LZCA 1HLUP 1GPYA 2PTGA 1QHNA 3C45A 5A3QA 1EAMA 1B3BA 3E9RA 1IONA 2ICAA 4RK4A 1T29A 1J4AA 2OO5A 3T5PA 3QVXA 3NHYA 1HG0A 1NWZA 3NHLA 1NVUQ 4FE4A 1YMQA 2X4IA 3NJAA 1M75A