5HZHA

Crystal structure of photoinhibitable rac1 containing c450a mutant lov2 domain
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
325
structure length
320
Chain Sequence
b'AIKCVVVGDGAVGKTCLLISYTTNAFPYIPTVFDNYSANVMVDGSTTLERIEKNFVITDPRLPDNPIIFASDSFLQLTEYSREEILGRNARFLQGPETDRATVRKIRDAIDNQTEVTVQLINYTKSGKKFWNLFHLQPMRDQKGDVQYFIGVQLDGTEHVRDAAEREGVMLIKKTAENIDEAAKELGSGGKPVNLGLWDTAGLEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related C3 botulinum toxin substrate 1,NPH1-1,Ras-relate
publication title Engineering extrinsic disorder to control protein activity in living cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 97
structure length 320
sequence length 325
ec nomenclature
pdb deposition date 2016-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5hzhA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5hzhA01
2QORA 4B76A 2XOKA 1M1YE 3KJHA 2ZAOA 2XGJA 3GLIE 2ZJOA 4Y0AA 2XNDA 2YZ2A 2FFAA 2EWVA 1FL9A 3RRZA 4C7OB 3O8DA 5C18A 3UIEA 1G64A 1ZVQA 3DPUA 2GAAA 3EWKA 4KV9A 1NIPA 3K9LA 4GP6A 2H8KA 4Q48A 1Q12A 4Q47A 1ZMXA 3K53A 3KX0X 2W00A 4KBFA 1KDPA 2PMDA 4IVQA 1XU4A 3GLIB 2J0UA 4CW7A 3TMKA 2IUUA 3LW8A 3CAXA 1QDEA 1X1SA 1NLFA 4DKXA 5CDFA 2Q3FA 2OAQ1 1HQCA 3Q72A 3GEEA 3QG5A 3QIAA 4L8GA 4NXEA 2FFHA 3GFPA 4AD8A 1OYWA 5G3ZA 2ZTSA 4JLVA 1NMXA 2CVHA 4FCTA 5CJ2A 3PUVA 2L4RA 4TZ0A 1CR4A 5P21A 3HPRA 2ZR0A 3CRW1 2CK3A 1LS6A 2FGJA 4DWJA 2JJ2A 4A8JB 1KKLA 4IFBA 4GDFA 5FTMA 2AD1A 4DDWA 4M1WA 2V1AA 4Q5IA 1VG9B 3E4OA 1W1WA 2R6CA 4ZDIA 1GKIA 3P32A 2W0NA 1P9RA 1KHTA 2PX3A 3N5CA 1F5NA 4MGKR 1VHTA 4D4MA 2GZAA 1G3MA 2N42A 1G8HA 1J70A 2PR6A 4EFNA 2V6IA 2QRNA 2MSEB 4LRZE 1SHZA 4M1KA 3SW1A 3LW7A 4TN1A 1MO3A 1EESA 1ZM9A 2IYYA 4BGDA 2VHJA 1N0WA 4RFSA 3RLFA 4UXJA 2O8CA 5KU1A 2IEYA 1NIJA 1JAIA 2IXGA 4X8HA 2JLZA 2QA5A 4B3FX 5CDFE 4BFSA 4ASUA 2ZI7A 3DMNA 4RFVA 3KQKA 3B6EA 1COWA 2WV9A 3KFVA 4BASA 3BFKA 1JEEA 2OFOA 2UKDA 2QJ5A 1ESNA 3ZIAA 5C2JB 2VLGA 3A1UA 4FIDA 3KB2A 1KKMA 3HPQA 2J0UB 2WTUA 2YOGA 4R2IA 1W0JA 1U90A 4CT4B 4TTQA 2GETA 3I4LA 1T6NA 2A9KA 1LVGA 3Q7QA 4KVAA 3ZZTA 2VF8A 4PKYA 3FKSA 2R2AA 1ODFA 1ZC3A 3SHFA 4O3MA 2ZS7A 5JBQA 3GFTA 3GLHA 3U3MA 4HJ4A 1F2TA 3X1WA 3W5IA 4DSUA 1KMHB 5E7JA 3LXXA 4HOIA 3GDIA 1CS4C 2H16A 4OK5A 4ERNA 1RPZA 5FL7D 4CYMA 3CNLA 1EFUA 2O0JA 1GL6A 2ZE8A 5B2ZA 3P1JA 4V0LA 3SJBA 4IOLA 2Q9AA 4A9AA 2HXSA 2CEAA 1N0UA 421PA 1Z6YA 2WM9B 4IDOA 1OJGA 5AJYA 5EZ6B 1JXOA 4LYAA 1DS6A 4V0NA 1E9EA 3EZ6A 721PA 2X77A 4H1UA 5FUXA 5AWFC 4JL6A 4OI0A 4MGYR 3C5CA 5EFWA 4RFSB 4W9MC 1IOZA 1Z0AA 2IA5A 4U7DA 4TTPA 4LJ8A 3TBKA 1H8HD 1NN3A 1G28A 4MUBA 1F9IA 4URWR 1CJVC 1OH5A 2EVWX 4DLXA 1IJEA 3AKEA 4XD7A 3LRPA 1ZD8A 1NMYA 2YC4C 3NBFA 4WXRA 4F7WA 2PHYA 4YXWD 3GLHE 4ZPXA 1MABA 1Z8FA 3MWJA 3TSOA 1J8MF 2RGNA 4YDHB 3WBJA 5G4ZA 4BBTA 1IAQA 5KYKA 3NH6A 4UJ3A 3B5JA 4HY8A 4A0FA 2QE7D 5L3QA 5J4EA 2QWSA 1VYVA 4Q9HA 5AJVB 2YWGA 5EE1A 1S1YA 3SQXA 1E4YA 2VQSA 4F3LA 3VKHA 2FPKA 3U3JA 4DJ2A 2MSCB 2ZRHA 4WW0A 4CEJB 3AKDA 4Q7JB 2L0XA 2HT6A 1YZNA 3D3QA 1KAGA 1F2TB 3QY0A 1RYHA 2C8VA 1UWPX 4O2LA 4RZ3A 1X8JA 1XRJA 1CEEA 3A0VA 1CKEA 4JBXA 2FMXA 1K5GA 1EFCA 3JZAA 2JLVA 1QHYA 4NKRA 1XD2A 4DCSA 3OAAD 4JT2A 1LT0A 5F5YA 3H0KA 4HATA 2J5XA 4TYYA 3VR1A 1X8LA 2ZETA 3UMRA 3SFVA 4DC9A 3GCGA 1GWNA 5HR5A 5J40A 3BOSA 4A36A 1LS1A 1OFIA 2IYSA 1TAGA 3NEYA 1CBUA 1SKYB 1W46A 1N6IA 3DHWC 5HCIA 1Q1BA 4KUOA 1TQ6A 4US2R 4M4XA 3MUFA 4OQLA 2QSYA 2DR3A 1GILA 2PD8A 1RZ3A 1XTIA 3OEHD 3FOZA 4OKSA 2VP9A 1Q22A 4BRUA 2LKCA 3TAHA 5C1BA 1AS2A 1K5DA 1G3QA 3KJEA 1Z08A 2ZRFA 1YZTA 3TKLA 2AHOA 3KQLA 4C0BA 1MABB 2BJVA 2YYZA 3LD9A 1KSGA 5FOVA 1YQTA 3AVQA 4OHVA 3QSYA 1Q0UA 3R9XA 2HJGA 1JI0A 3KJGA 5KDLA 3AKCA 5L3QB 5DJTA 1P73A 5FPYA 2XNSA 3KXKA 5JHHB 2UVQA 2ATXA 4DLUA 1G5PA 4TSFD 4F3LB 5FTJA 2JASA 4MYCA 3SJAA 2R9VA 2AK3A 4G3XA 3FHTA 1TQ4A 2WICA 1SXJB 5CB8A 1W44A 1CU1A 2A3RA 1NJGA 1Y63A 2QGNA 4D4KA 4TMTA 2JLXA 4ZKDA 2F3RA 2J7KA 4NDZA 5F3WB 3IS2B 2BM0A 2WJYA 1ANKA 1U94A 2ZE7A 2ZRBA 4RD1A 4B2IA 1GSVA 3RH8B 2B8WA 1XD2B 4OHXA 2OWJA 2CDNA 4TLBA 2IYWA 3K8YA 2FWRA 3QPVA 1AS0A 2XZLA 3AEZA 1U99A 2G88A 2YC2C 3U2QA 2QTFA 3IEUA 3KDSE 4X8MA 3LA6A 3K70B 1DAIA 1MRSA 2P0EA 2VSFA 4PC2A 2ZOIA 3HU3A 1LSXA 2CMKA 4LYFA 3NJAA 1VPLA 3B78A 2FOLA 3MMPA 3U6KA 2QT0A 1PLKA 2DPXA 3TUJC 4GZLA 1W4AA 2PL3A 3TW4A 2CL6X 1P2SA 3VFDA 1WF3A 1P75A 2D4HA 4WVFA 1J90A 3AVUA 1SULA 1EG7A 2LCFA 1BIFA 1E0JA 2BCGY 4LI0A 4UNSA 2LKDA 2R65A 1IY0A 2IF2A 1XXHA 3D72A 1XTJA 1Z0FA 4DCTA 5AUOB 1E1RD 3RC8A 2IUSA 3SYKA 4US1R 2WIBA 2J7PA 3ND8A 5FOTA 4FMCF 4BQSA 4LX0A 5IU1A 2DWPA 2E87A 3T1OA 1F2UA 4RQ9A 4Q4AA 5CK4A 4JLDA 1IQPA 4LC1A 4HB2A 4M1OA 3IKJA 1XMJA 3DOFA 1Z63A 4PHGA 3LICA 1W36B 4AG5A 3AF4A 3AF0A 4DRZA 2O8EA 1BYWA 1W47A 3PG5A 4HB3A 5JECA 3H84A 2FF7A 3KKNA 1LSWA 5F6AA 2IYZA 4P4SA 2P67A 1KI3A 1G9XA 1U0LA 3AQ4A 3BIFA 3B85A 4I99A 3HYTA 3SE0A 1OH6A 2VEDA 3NC1C 1V9YA 2IXFA 1W48A 2KWIA 1NVUQ 3IDQA 2RGXA 5DI3A 1KO8A 3TRFA 3SDZA 1N6HA 1AS3A 1S9HA 4Q18A 5EP3A 3T61A 4ZCIA 4OI1A 5HZKA 2Q21A 3HJNA 1E79D 1Z28A 1XJ6A 1T3SA 2E1RA 1G18A 2G1KA 4C9BA 3GLGA 1XXHE 2QENA 5AVFA 1XPRA 1OHHD 1R10A 1R2QA 2ECKA 1AGPA 1II0A 2VRWA 1GM5A 4URVR 1S2MA 3QPUA 5G53C 2OOLA 4AI6A 4B6FA 1KIMA 5FPSA 4F4JA 2YV5A 4KYIB 4MGZR 4GT1A 1DPFA 1SVWA 1XXHB 2REXB 3PUXA 4GI7A 1NVWQ 3MFYA 3KXIA 4YXWA 1Q1ZA 2A5GA 3EZ9A 4EESA 1OIWA 4JGPA 1QHHB 1QHSA 1W0KD 4MUAA 5FBQB 5DKKA 4NXGA 3MCAA 3U6BA 4E5UA 2VIIA 3VX3A 1F2UB 4Q4AB 3F1OA 4JYCA 1XFAA 3K0CA 3UKDA 3VR6A 3UB7A 5KDOA 2H28A 1LV7A 1P5ZB 4Q4JA 1NSTA 4H1VA 4PO1A 2AN9A 2O8EB 4AKIA 3WBKA 3L82B 3RSLA 1XTKA 1NVXQ 4AYXA 4P4SB 3HU2A 1E2FA 2D2EA 4PX9A 2BMDA 1S3GA 4YMSA 4CIDA 2PEZA 4QGAA 1OTBA 2IL1A 1GRQA 1Y28A 3ZH9B 3THYA 4EFMA 2QI9C 1LB1B 3SR0A 1QHNA 3CH4B 4XTRA 2W0MA 1E2LA 4LPZA 2PZGA 2GJSA 3WP0A 2FGKA 1AK2A 4TQ9A 5DI3B 2MMGA 1HE8B 5FOSA 3FMOB 2B92A 2ORIA 2C99A 4URUR 4WIAA 1GL7A 5KNBA 2NO0A 1G21E 3VE3A 4GMXA 1DP8A 4MKHA 3LWNA 1HE1C 5KSYA 4LWZA 4M1MA 1U98A 2W2TA 2W27A 1PLLA 2REOA 5JJLA 5KSPA 3QVVA 3FHOA 4P3YA 2QY9A 4JLPA 1S4QA 4PAOA 3OEHA 4HLUC 3X1YA 2P2LA 5FBRB 3SYLA 1DVRA 4FI3C 1OB2A 3W5JA 4DJ3A 3Q5DA 3TAUA 4P33A 3GLFA 3BWLA 5KPJA 1FUUA 1XTQA 2GILA 2YWFA 3VU9B 4M8NE 4NYJR 2C9OA 1RYFA 1NG1A 3NBXX 3LY5A 5E7IA 3F1OB 4RKFA 5JS7A 1S3SA 2EYQA 4IVRA 3I73A 5FTKA 3KB1A 5LDDC 1OTEA 4MRRA 3RS4A 4HAVA 1XWIA 4AY2A 1G8YA 5DLQC 1E2IA 1NKTA 5EXTA 4WUJA 4LJYA 2R6GA 3LI9A 5DKLA 1LSVA 3JVVA 3SU8A 4ACAA 3B2EA 5TVKA 5I5LA 1GAJA 1OXXK 4D0GA 3R8FA 3VR2A 5HD5A 4URXR 1P97A 3T1VA 2P3SA 4JBYA 3CWQA 1HT1E 3AB3A 1V9ZA 2ANBA 5HE8A 4RY2A 3UMDA 4POAA 1CF4A 2QMOA 2DFLA 3MJQA 1AKYA 2KSQA 2RGBA 3L0IB 1XJ4A 4HB0A 1UKYA 1E9SA 1QVAA 3AF2A 1JXMA 2NTYC 5CLLA 3DM9B 3EPKA 1E1QD 5FR2A 1P2UA 1Z2CA 3OFND 4US0R 3GLFE 1ZUHA 2F9MA 1EWQA 1DAMA 2ZI4A 1Z07A 4BFXA 1JJ7A 4M53A 1N9OA 2L1MA 1OXVA 5A4JA 3N2EA 3KQNA 5GJVC 2EFDB 4EEPA 1EWRA 4B3BA 1YR6A 4R7ZA 2SHKA 3IPXA 3GLFB 1DBSA 4N1AA 3G82C 4LBWA 1NN0A 4WZAE 4HJ6A 3QF4B 4X8LA 3VAAA 1E0KA 1Q1QA 2CK3D 4GSYA 2JJ2D 4Q7LA 1GITA 2ZJAA 1E1RA 1US8B 2Z83A 1UDXA 3AV0B 4K8OA 2JLYA 2P6NA 1VG0B 1GDDA 1BS1A 2PYRA 3O8RA 3H7WA 2Q0HA 1S4RA 4NH0A 4P0TA 3ZVMA 5IS1A 1T4GA 1Z0KA 3LYXA 1LL8A 1LTQA 1RRFA 1NVVR 2A5YB 2ZREA 2C78A 2GWHA 2ZRJA 3L8ZA 4D4LA 2BOVA 1CJKC 3Q8XB 4KU4A 4NZYA 1T5LA 2KBFA 3FVQA 4XT2B 2ZE6A 1Q3HA 2QP9X 1S1ZA 4I38A 2GCOB 1GKYA 3OHMA 1Q1EA 3CR8A 2IYTA 2CCGA 1COWD 3BXZA 2P65A 4OI2A 3U7FB 4NYMR 3QXXA 3ZIAD 5HWWA 3VHXA 1XEWY 2J59A 4IRUB 5TB5A 1W0JD 2FE4A 4LPKA 4PO9A 2DFNA 3EASA 4R6LA 3LXRA 3AUYA 3UB9A 3NXSA 1W4CA 2ODWA 3IO3A 2R44A 3QE0A 3I62A 1S4SA 3HJKA 3EX7C 3FKSD 4JL8A 3ADDA 3CLOA 2JDIA 2CLCX 4ZKEA 1ZBDA 1KJZA 4G0NA 2ZJBA 4WAUA 2O8DA 3CX7A 5B30A 1X0OA 2XZOA 2MMCA 4C3ZA 2AWOA 2HT1A 5LD2C 1GNQA 1TUEA 4HHDA 3TLXA 3QBTA 1AZSC 3DM5A 4RD4A 4RCYA 5AR1A 2W6IA 4HZUA 4B44A 4KODA 2C96A 3BBPA 5GJBA 3OZXA 2BVNA 4P4UA 4UXIA 1XJ3A 4NPHA 3H7WB 1JQJC 1OT3A 1G16A 3QXCA 3IEVA 4AKGA 1OFUX 1R4AA 3PVSA 5F68A 3FPAA 4NCHA 1C4OA 4LHXA 1TF2A 2R6DA 4Q1DA 4ARZA 1NN5A 5EXPA 4ESVA 1W2GA 3UMFA 3TGPA 3AF3A 1M7BA 2GKSA 5F9FA 4HI4A 1EFRD 4A82A 3A0RA 3AVYA 1KI8A 3QUSA 3AM1A 5CM9C 5L3RA 4AURA 1E9AA 1Z6XA 1IHUA 3MR0A 3ZQ6A 2HEIA 1VCOA 4TYPA 4I81A 4LYHA 2E9SA 1RJ9B 1RRPA 4L9EA 3C41J 4XD7D 5A5GA 4RVCA 3L0OA 1N6OA 1QBKC 1Q20A 3C5HA 3PEUA 2ONJA 1CJTC 4KFRA 1LF0A 2RGCA 2PZEA 4B3CA 4WF0A 1UBEA 4Q1AA 4E03A 1FZQA 2UZIR 2W2VA 3PENA 4Q00A 4AG6A 5HDCA 2GXQA 1XEFA 2QMHA 3OE7D 3VR3A 3QKUA 3GPLA 3B13B 4JS0A 3ZD6A 1TS7A 2HJVA 3R7WB 3GP8A 4DLSA 2ORVA 2V1BA 2O8DB 2W58A 1XZPA 3MSXA 1SXJD 4AYTA 3RABA 3L8YA 5DGXA 1QRAA 3I61A 3NVAA 2FSHA 1S0UA 3A0SA 1UM8A 3CPEA 3VR5A 2V55B 4R38A 2ZIAA 2GJ8A 1SZPA 5LB2A 1ZM2A 4MA4A 1P3JA 1NJFA 1II9A 4LK2A 1IONA 4KUKA 2BKEA 2WJGA 5H68A 2C98A 3OEEA 1P9NA 4HDOB 1ZD9A 4PANA 5D3QA 4A8JA 3GJ4A 5JJIA 2RGAA 4NE2A 1LNZA 3FMFA 1GNPA 4A0GA 4ARZB 2ERXA 5IF9A 1RRGA 2W83A 2AKAB 3K70D 5FOWA 2Z4SA 1TTTA 4GW9A 2OBNA 2PD7A 4DCVA 4G1UC 3UATA 4Q01A 1M7GA 2DY1A 3A4MA 3ICQB 2X1VA 2HXYA 4QGGA 1E6CA 2KJQA 4PC6A 1CJUC 3CZPA 3W6OA 4C0LA 2QJ7A 2PEYA 4DSOA 4QKQA 2AD5A 2CE7A 3SC3A 2J0VA 3V00A 2BASA 4O0MA 2WOJA 2W6JD 1BYIA 4BWYA 3H82A 1ZNWA 2QMEA 1KO4A 1SGWA 4I4LA 4JLNA 4IKEA 4JBWA 3A1SA 3PQCA 5B57C 2XJ9A 1M7HA 1G8GA 2RMKA 1CTQA 2V6JA 4Q9IA 1E1QA 1Y3AA 3WNCA 3OFNA 1UPTA 1XMSA 3LIAA 1L4YA 1AA9A 4NCNA 4MRPA 1A7JA 3BFVA 3VTKA 5EP2A 5B64A 3C8CA 1JAHA 4Q9KA 1KI9A 2ZBBA 2NG1A 4K08A 2FFQA 3FMPB 3W9YA 2GHIA 2WIAA 2EFEB 5GJCA 1W36D 5BN5A 1ZM4A 2PZFA 1IM2A 2ZANA 4D4JA 1XEWX 1ZYUA 3CNNA 4M9XA 2A5DA 4BFZA 1KMHA 1ZNZA 4M4SA 4J0QA 4NCKA 5TY0A 1E4VA 1XTRA 2Z5FA 5TBMB 1XTSA 2V1XA 3RNLA 3KUCA 3IILA 3GJ3A 2DBYA 3MWLA 2QMUA 1NP6A 4R3AA 1FFHA 2ZRDA 4G5SA 4C0QC 3KXLA 5HWTA 1HYQA 1R6BX 2X2FA 2XITA 3AH8A 5J47A 5K8IA 2GVZC 4IXNA 3IGFA 2QTVB 5BWMA 3VNUA 1D2EA 2GA8A 3CKLA 3P27A 2GJ3A 1G291 2M1CA 2F1RA 3F0TA 3TR5A 2WSSA 3H82B 1E9BA 4Q9LA 4CT5A 3P7NA 4HJ3A 3SFZA 4KXFB 2GBLC 2OFXA 3EZFA 4DLWA 2CLDX 4E09A 2FSFA 3GJ6A 3LX8A 3K3CA 2A5FA 2FEMA 3SJZA 3PUWA 4EJSC 3THXB 4P31A 2D62A 1OYYA 2J7PD 2O8FB 2Q9BA 5CITA 2QAGC 2ZITA 4WLAA 1FUKA 1UKZA 1OT6A 3U60B 3T50A 4CEIA 4MYUA 2PBRA 3BH0A 1TMKA 3TJZA 2IHYA 4B71A 1HUQA 2AFHE 2ZSDA 4CEJA 2VP5A 3S1AA 2D01A 1P2TA 2Z6VA 4GPTA 1GUAA 2C04A 4FMDF 4O25A 4XH9B 4ILEA 3TQCA 1XCGB 2J46A 1N9LA 3IIJA 4JJKA 4W5JA 4LC0A 1PUIA 2WBLC 5M04A 4EFLA 4I3IA 2V1UA 4KVGA 3CWZA 3GFOA 1W4RA 1SVSA 3TE6A 5J4YA 1WA5A 4N0DA 5BYKA 2V8OA 1G8FA 1GFIA 3DKPA 4HQAA 5JRJA 3IUYA 1E2QA 2VV7A 5HWVA 5JZVA 3EW9A 4D2IA 1QVRA 3D31A 3OF5A 3UXMA 5DIFA 1KSFX 4TL7A 4DCUA 4JVMA 3FMIA 5CIWA 1EFRA 2WWIA 3U4QA 1QZXA 3C4JA 1D2NA 3KZ1E 4QGFA 3X1DA 5IHPA 1CXZA 5L3VA 4JLBA 2IYQA 1RRCA 2HF8A 2WAYA 3K0AA 5GADl 4IDNA 1FNNA 2IS2A 2IXEA 3CONA 2JIZA 4QBFA 1AN0A 1VB6A 2VA8A 4PQFA 1HA3A 3EG5A 3RS7A 1WA9A 3RTYA 4B3DA 2ZYVX 3KL4A 3FHCB 1AZTA 2IS4A 1P2VA 2KB0A 3FC7A 1R5BA 4DDUA 1R5OA 1U9IC 3VE4A 1KSJA 1T0HB 3WMFA 1ZUIA 1TL7C 2D74A 1GRNA 4QBHA 1R0YA 4D26A 1S1MA 1ZM7A 3OE7A 4YONB 4ZDJA 4CEIB 3A4LA 1J7KA 3A37A 5EXXA 3BWDD 2ZI3A 3NWJA 4XSGA 1UJ2A 1WXQA 2TMKA 3F3YA 1ZCAA 3S1AB 1FP7A 1OTAA 1SXJA 1T9HA 121PA 5CB6A 4TMZA 3THWA 2YHSA 3SQWA 1UKEA 4A1FA 1FNMA 3IS2A 1N5JA 3I8SA 1SKYE 4F91B 4JJZA 4NYIQ 3K9HA 2ZRPA 3F5FA 3GQBA 1Z6TA 1G41A 3PCRB 4GHIA 2ERYA 5JEDA 1UWNX 2OV2A 4HP9A 3CRQA 4PZYA 2GXUA 4V0OA 4XVUA 1A4RA 1W2HA 2X8AA 2ZQ5A 2ZSAA 4OI4A 3ZS8A 1DRMA 4RKEA 3NDPA 4MN5A 3EPLA 2A78A 4CVNA 3U4QB 4XSHA 1GOTA 5L8VA 1E9RA 2GJAA 4KFSA 4PSKA 4NP6A 3RS2A 2BJWA 2BKUA 3WYFA 2QM8A 3K0AB 4GOXA 1K8RA 1S67L 1VMAA 2UZ3A 4Z54A 3UPUA 1Z2AA 3NH9A 1P62B 1ZW6A 1OXSC 1XCPA 4BUJA 2W6JA 2ZI5A 1G7RA 4QNRA 1TEVA 2ZJYA 1IN6A 3F8TA 3ZS9A 1SXJE 4XWOA 4KQDA 1MO6A 4PHFA 2D2FA 4EQ1A 1IN4A 3RYTC 3ZVNA 1KY2A 3M6AA 3PR1A 1KTVA 3QG1A 4IFEA 5F69A 1AM4D 3OLOA 2G0TA 4RD2A 4EEUA 2RB4A 3FWYA 5SZJA 1VG8A 1WCV1 4AYWA 3KUDA 1EW0A 1B0UA 1II8B 2QSZA 1OF1A 2GJKA 3T5DA 5JSZB 3THWB 2JATA 1TQDA 5DHFA 5J3WA 3CPHA 1N5KA 5FPHA 1MKYA 2I9VA 4G5QA 3J81k 1QG2A 1J2JA 1PUJA 3EXAA 3A4NA 1UKVY 1VIYA 4A8JC 2WVJA 2IS1A 1E2PA 1VCMA 4A15A 3RVBA 1ZAKA 4GHIB 4NCJA 5FH9A 1AQUA 2QNRA 3IQXA 2I4IA 5LBIA 4GRAA 2BBSA 2OEPA 3WXMA 3KKPA 4C0KA 1MH1A 1QHIA 3BB1A 1YR7A 1SVKA 1YZLA 3GJXC 1FPMA 1JJVA 2V9PA 4BLRA 4V0KA 1NSFA 4Q7MB 2VSOA 2IWHA 1W5SA 1DE0A 4B35A 3CPJB 2I3BA 5BYJA 1UEIA 4BZPA 4TT3D 4R70A 1G20E 5GJWC 4R9UC 3U3KA 4EAQA 3HYRA 3FG8A 4IDQA 3VHLB 4MYHA 3I92A 1D6JA 1PLJA 1E9CA 4I3AA 2NGRA 5CLQA 3VX4A 2QPAA 1SHKA 4OQMA 4I1SA 1MO4A 3FDIA 5CIQA 3WNBA 3CF2A 3LO5A 1N0VC 2C77A 3L0SA 4OL0A 3SOPA 4B33A 3P4XA 5IRCD 4C30A 5JJKA 1QHHA 3PIRA 3RS5A 3DMDA 3GEIA 2F7SA 2G0NA 1JEDA 2D02A 1U0JA 3RDPA 2ZU0C 3ZYCA 4YMVA 1E94E 2ZM5A 3NKVA 3NG1A 2WMOB 1KZ7B 3C2WA 2PLRA 5FPTA 3UMEA 2HF9A 1SQ5A 2CLSA 1XP8A 5DJUA 1UGUA 1KK3A 3CWFA 2FZ4A 3EC2A 3D8BA 4MQBA 4LRYC 2FDCA 1U8ZA 4ZCLA 4LHWA 4JGOA 4JKYA 1ZIPA 2YNMA 1P9WA 1OTDA 1A2KC 3AGPA 1N9NA 2NIPA 4HYYA 5KDDA 3H9WA 3NOUC 2OCAA 3ZDQA 1KJYA 4Q21A 4PC3A 2JLRA 3MGCA 4EKDA 1VYUA 2QPOA 4JZKA 2IW3A 2F1HA 3AVPA 1H8EA 3KTAA 3U3RA 3K0FB 2JDID 1ZU5A 2HV8A 4MYTA 2J45A 4KBGA 2X19A 4Z51A 3FTQA 1Z6GA 2A7QA 2PH1A 4JLAA 2ORWA 3TNFA 3OIUA 1TPZA 4JLOA 3ZQJA 2JJ1A 2RGGA 4ON9A 2G77B 4HH2A 2XB4A 4FINA 1YJ5A 2EU8A 2W6ID 3W8NA 1OTIA 3EA5A 2QPTA 4MDFA 1NF3A 3VU9A 3PFIA 4B75A 3UK6A 4OYHA 3TSZA 1W49A 1NNEA 4Q02A 2PLFA 3GJ0A 2CNWD 1KI6B 3KJIA 2R6FA 4QXAA 3UMSA 2O8BA 2YINC 4HB4A 1D2MA 1DEKA 4EPYA 1ELOA 2XEXA 3U61B 1D8TA 5AJWA 3ASZA 4DBLC 2BWJA 2OWHA 3Q5EA 5IK2A 1NKSA 1XFNA 2K7SA 1Z0IA 2IT1A 2YWHA 4K81B 4PHHA 5TDHA 1G7TA 3U7HB 3LQQA 3PYPA 5D3MB 2WWYA 1SKQA 4ZDKA 1M8PA 4LY6A 1KK1A 3RS3A 5G4YA 2OG2A 1E2HA 1HV8A 4OHWA 2CXXA 4LUCA 4PR0A 4D80A 2ZVPX 5HE9A 2XX3A 4E04A 3EZ7A 3BORA 2CMNA 1RIFA 3AVXA 2VLIA 4TLDA 1XJ0A 3A36A 3SNHA 2L0WA 2ZRIA 1X3SA 3HR8A 1JALA 1T8TA 2OO7A 5FUVA 4KSCA 1MRNA 3KTAB 4HDCA 3WP1B 3X1ZA 1JB1A 1LW7A 2QG6A 4BRWA 3K09A 2VP6A 4LHZA 4ZIRB 1OFTA 4MRVA 2GEVA 3NBZC 4FW9A 5AVEA 2RGNC 1U2RA 2O5VA 1YR8A 3B9QA 3AUXA 1FX0B 1DOAA 4MRSA 4NXFA 2O0KA 5J7EA 4N3NA 1NRJB 1RE0A 3A8TA 1G3RA 5HZHA 3QF4A 1OW3B 3OEED 3ONWA 5JWRA 3W6PA 4WXPA 4F92B 2IYVA 3R9WA 2AK2A 1NBMD 1SXJC 3QOFA 1US8A 1BYUA 2H5EA 4NONA 2O8BB 3LNCA 2CBZA 1NN1A 3UWKA 4DXAA 4DLTA 1X8KA 3B1VA 4PSAA 4ITRC 5AUNB 1DAGA 1XBTA 3UB6A 4JLKA 2JN7A 2JLUA 1OIVA 1G19A 2R8RA 2FN4A 4JL5A 3LFUA 4DEYA 3NTUA 1CRPA 4EW7A 2GESA 3BH7A 3MJRA 3CUEF 2RGDA 4TL9A 221PA 4PPQA 4JSYA 4Q1EA 3WRYC 1VIAA 2WAXA 4TLEA 3BC1A 2NMVA 1R8QA 4UNRA 2ZSBA 4XT2A 2B8TA 3K70C 4BFWA 2IYRA 1EXMA 2CCKA 1PZNA 3ASYA 1JR6A 4GCZA 2GCOA 4M0LA 4ABYA 2G3YA 4C2TA 2VYFA 2IHBA 1L2TA 1YRBA 4BLQA 4L9GA 2IX3A 4YMUA 5KSZA 2NPFA 2H92A 2VP4A 2QUZA 2ZJ2A 5KNDA 4A2PA 4RD3A 4TMKA 4FXPA 1OLOA 4NTZA 1JBKA 4TT3A 4MRNA 3IO5A 5C46F 2REBA 1IXRC 2H18A 1DTSA 3PV0A 3LLMA 3NHBA 2J0QA 4YWZA 4BPBA 4BECA 2PJZA 1UAAA 4RZ2A 4X8OA 4QL3A 2OLKA 2OCYC 5EE0A 3AVOA 3NC0C 2DHRA 1F3OA 1JNYA 1IY2A 3P4YA 2C2HA 3WHLA 4Q4LA 3OESA 2AFIE 4OBEA 3EPJA 4ZO4A 1W36C 4PC1A 3RRNA 3ULFA 1TF5A 3EIEA 2Q6TA 4HUQA 3BJIC 4GMDA 1N6LA 2A24A 3DKVA 2D3WA 4LZZA 1Z47A 2GVDC 1FMJA 4L5BA 2G9NA 4LV8B 4PO8A 4CDGA 1KOUA 2IWRA 2ZR9A 4HAWA 4L16A 3UANA 5TMPA 3BB3A 1NY6A 2ZYWX 4QJ3A 2WSSD 1VYTA 5JI2E 4JSTA 2WZQA 5TV2A 1S96A 3THOA 4M9ZA 4WL9A 1QHGA 1RJ9A 4LJ9A 4LJ6A 4EPXA 2EW1A 3RAPR 1CIPA 1Z6AA 2VHCA 1E2GA 3E4PA 4KAXA 1KYIA 4TMXA 5BXQC 4CZ2A 4B2LA 5FBLB 2CVFA 2JLWA 2ZSFA 1U8YA 1Z06A 4B73A 5DNYB 5FTNA 4JGRA 3NOTC 3VR4A 1XMIA 2DFTA 4GOJA 2BBWA 4HUTA 4D25A 1M2OB 1VCIA 3GEHA 3LVRE 3LBNA 3HDTA 3FGNA 3CM0A 3R7WA 1I4DD 4TTRA 1XMVA 2YKFA 3B9PA 4Q9JA 2ZI9A 3M1IA 1CJMA 1QHXA 4FN5A 1JR3D 1N5LA 2CL0X 3AP1A 3MD0A 3Q85A 3QEOA 4GNKA 3WRXC 2IBMA 5SZKB 3LIFA 3N2IA 1S66L 1OJLA 1ZUNB 4WZBE 3ZVLA 4CEHB 1LFDB 2PMKA 4NBSA 5EE9A 1XPOA 2JAQA 3WY9A 1WMSA 2YWEA 2F9LA 2F55A 2XAUA 3E1SA 5H8WA 5DN6D 2CNWA 4F4CA 4HUQB 3W3ZB 3IHWA 3ICEA 1NWZA 1W5TA 2A24B 1XDBA 4BFUA 2QAGB 5BQ5A 4DLRA 3BERA 2XXAB 2ZYTX 2FJUA 3I5YA 1UBFA 1VKJA 2XTMA 1DP6A 1M6NA 1VDZA 2G6BA 3QPWA 4EXOA 2IC5A 3BB4A 4WA7A 4MGIR 4HIAA 2BIFA 1RFLA 3CR7A 1F60A 4HEJA 1N6RA 1O87A 4EIWA 2XJ4A 2JIZD 2YOFA 3B1WA 4WOPA 5KUTA 3B1YA 4AKHA 2XTZA 2EA9A 2INWA 4C0SA 1HURA 2B21A 1OSNA 2AWNA 3IQWA 3QKSB 4AKEA 1J99A 5JEEA 2ZR7A 4IOMA 3EIQA 3A1VA 3X2SA 1TS0A 2WKPA 3IBRA 4LJAA 2D06A 3DOEA 5HKKA 1AIPA 2QL6A 5JWOA 2R78A 1W7AA 3MJHA 3TVDA 1RC8A 4P4TA 1NLZA 3R9IA 1Z0JA 1KGDA 1YZGA 4PTLA 1F48A 2OM2A 4HSEA 1FP6A 2WWXA 3Q7PA 2K5UA 2OT3B 1S8FA 5BN4A 1ONBA 2QP4A 3E70C 1G3IA 4Z1MA 1YHNA 1OE0A 2JJ8A 3VMFA 4H6JA 2ZS8A 1JPNA 3UB8A 4Q1FA 4KI0A 1KO1A 2QROA 5G3YA 3NBYC 2ZRKA 3CIOA 1E2JA 1B23P 3B33A 3DZ8A 3K0CC 4B47A 2J9RA 2JLQA 1P7CA 3LDAA 2NZ8A 1A1VA 5TBMA 4OQNA 4NMMA 1NBMA 2EYUA 1OV4A 5DSZA 4JKIA 2Z6CA 2OCPA 5G41A 2KBEA 1G3UA 1I4TD 3LIEA 1YU9A 1XFQA 1G8PA 3Q3JB 4EPTA 4GP7A 4LJ7A 3FFAA 5EUMA 2QBYB 2N1BA 4TYWA 2CHQA 3X1XA 2JA1A 1JECA 1Z0DA 3I32A 2ZROA 4G5OA 4LPSA 4ZDWA 3MQQA 4MN6A 1EK0A 5EJEA 1G1MA 2OXRA 4D0LB 1TQ2A 4M22A 5KIZA 4YMWA 2BV3A 4S35A 1UFQA 3ZVRA 4DUGD 4R2HA 3V4RA 3KKOA 4B48A 1ZCBA 2DWQA 3K09C 4UXHA 4LLOB 4G5RA 4B2PA 4HI0E 2P5TB 3GD7A 1E2MA 3THXA 2DWOA 2ATVA 1ZM3A 3IIMA 1XD9A 2O8FA 3KKMA 3K3DA 2QQEA 1NBME 3ZLJA 3QKTA 3MAAC 4H6JB 2RCNA 1HY3A 4F93B 3G5UA 4TQAA 5GVRA 3QENA 2Y8EA 2FG5A 2FEOA 1HH4A 1IJFA 5F98A 1N3BA 3NHAA 3U3OA 5JMTA 4BFTA 3LIDA 5EXSA 4E07A 2J80A 3B60A 3BH6A 2HCBA 1S9DA 1V5WA 1H65A 2ZUCA 2OE2A 2WOOA 2YVUA 3DDCA 4FWTA 4E22A 2HYIC 2QTHA 4NYJQ 1AKEA 1DG3A 1Z83A 1ZIOA 3T5GA 4YLGA 3LVQE 2P6RA 1A2BA 4M1TA 1RVDA 2GEUA 3FB4A 3ADBA 4DT1A 2VPPA 1ESMA 4QG7A 4F4IA 2ZPTX 1E0AA 4XWKA 2AL7A 5EE5B 2Z6DA 1EX6A 1N6PA 4YQFA 1W4BA 3MRSA 2ZRNA 4TLCA 4EQ6A 2WMNB 3DEFA 2YKGA 3UG7A 4A2QA 1KDRA 2I1QA 4FCWA 1MOZA 2GJ9A 4PQRA 4FCVA 1ZC4A 2XZPA 1G5TA 3QEJA 4I1OA 2VP2A 2FZLA 3OIWA 3O8CA 1M34E 3UG6A 5DISB 3T1QA 3R20A 1Q44A 5DYIA 1AJEA 1U0HC 5AK0A 1YZUA 4BEBA 3CW2A 1E3MA 2QHKA 2VTKA 4AC9A 4TZ6A 2GCPA 5C4MA 1XJCA 2JEOA 1K6MA 4RZUA 3CX6A 4B32A 3PHYA 1JR3A 3CF0A 2VL7A 4QNMA 3E2IA 1ETUA 1SVMA 1NL3A 3H4MA 2V3CC 4PZZA 3E5HA 3RRYA 3JZMA 1J8YF 2H7VA 1KK0A 1KNQA 2NO6A 4QBIA 4BLTA 2VEAA 6Q21A 2ZRGA 4UNQA 3DO6A 3WMGA 5FUYA 1PV4A 3AF1A 4TL8A 3EEHA 3PUZA 5DN6A 3IPYA 1CP2A 3C14C 2GZHA 4HAXA 4O2RA 3TUZC 2ZRAA 2XSZA 4IDPA 2V0WA 1BMFD 4KLZA 2WSMA 4GZMA 1GVNB 1XZQA 2RKOA 4RD6A 5SZIA 3RS0A 4L9WA 1OIXA 4BFYA 3I5XA 1H8ED 1FOEB 2ODBA 4DT1B 4IVPA 3CO5A 1NI3A 1TS8A 1IXSB 3IBYA 2QP3A 1KI1A 4I3JA 4Q03A 2VV6A 2ODNA 3EAQA 4DIDA 1WBBA 2R62A 1OH7A 4BZQA 1G5RA 1IN5A 1R0XA 2FSIA 3GJ5A 4EQ6B 4LRWA 3R8CA 2JJ1D 2X2EA 2W0SA 4HAYA 1NVVQ 2ANCA 5FPKA 3P26A 5IT5A 2QEQA 1TS6A 4KFTA 2V54A 3TR0A 2R6AA 1I4LD 1KJWA 2N46A 4KYUA 1JR3E 2QQ0A 4GFDA 2ZE5A 4OHYA 3F1PA 3UE6A 2VBCA 4EERA 2GF0A 3B82A 1KI4A 1DAEA 2HLDA 3EZ2A 2FV8A 2GCNA 3QF7A 2O8CB 2OBLA 4Q1BA 4Q4HA 4JYBA 4H9GA 3UWOA 4GS9A 5E95A 3ZQ5A 2RAPA 1II8A 4NYMQ 5AJXA 3W3AA 5IK2D 5IDVA 5JSZA 5L3SA 1KI7A 2GXSA 2Q3MA 4KLNA 3C15C 2NZJA 2DCUA 1L4UA 4IHQA 4LOAA 4WN5A 4HLUA 1YR9A 2DB3A 1GP2A 4L4UA 3SYNA 4OQXA 4BE7B 2GNOA 4DCNA 2WKQA 1OH8A 2B02A 2J41A 2WWWA 5E4FA 3RANA 4BBVA 1E2EA 3SHWA 2GF9A 1CR0A 1ZU4A 4QJ5A 1XB2A 1N25A 1MO5A 2C95A 2QN6A 3LUQA 1RW4A 3PXGA 3AVTA 3DL0A 4I1VA 2ZS9A 4C0HA 3AGQA 3CBQA 3GLHB 4ZCMA 2HV1A 1MR3F 4PPGA 1P6XA 4LRXC 3EC1A 4FMCB 2OESA 3GJ7A 3PEWA 2JLSA 4KJZA 4WBSA 1VG1A 3B1ZA 3TIFA 1NLYA 3V9PA 1UF9A 1AGRA 2GXAA 1WP9A 3EPHA 2J0SA 3VOLA 2QZ4A 1P61B 4PHTA 2VHTA 1GSXA 1DARA 1E99A 1YKSA 1R7RA 4M9QA 1TU3A 3ICYA 5G40A 3PUYA 5AUQA 2CHVA 3QXJA 2HYDA 2BHRA 4XVQA 4JLJA 3A1TA 2NPIA 5FR1A 4A4DA 2CHGA 2H17A 3T34A 1KSHA 3F1PB 1F98A 3C8UA 4DUGA 5TXGA 4OJKA 3PEYA 5DI9A 3EARA 4DB4A 3HR7A 3G0HA 2WWFA 2OFWA 3D7MA 4LBVA 4HDQB 4Q4HB 2FU5C 4XTCS 2IEZA 4GS9B 2J3EA 5H1YA 3T06B 3O8BA 2OILA 1ZRHA 2CCJA 2OLJA 4IEEA 5L3SB 2GTPA 2RH5A 3MLEA 2ONKA 1EGAA 5K8LA 1IBRA 3CRVA 2QM7A 3QJYA 1D06A 4OQFA 4ZI3A 1YE8A 2WJVA 3QQ5A 3T12A 5KNCA 2FFBA 2ASEA 4D82A 3SS8A 1GSIA 1X6VA 2AXNA 2A30A 3AP2A 3DZDA 5KTYA 2VV8A 1IN8A 1E98A 4JT4A 2H1LA 2KX6A 2WJJA 3AP3A 3CF6R 3K9NA 4ZV4A 2GK7A 2ZAMA 4GOKA 5FTLA 4DDTA 2GAOA 2FH5B 4XJXA 1ZNYA 2VH5R 1DAKA 1XCMA 3NIBA 4MKGA 3GMTA 2ZRCA 1DP9A 5HSQA 2XTNA 5DE3A 4XWAA 5CJPA 4CF7A 5FFMA 1T91A 1O3YA 1YVDA 1MT0A 4DLZA 2QKPA 4A6XA 4W7SA 4BLSA 4I5SA 5A8BA 2FNAA 3DVLA 521PA 3NHQA 1KK2A 4HAUA 1HT2E 1WDTA 4CRWB 3K0FA 1T1CA 3MXQA 1TEXA 2F3TA 2F6RA 2B6HA 3SEAA 1T8UA 2WJIA 1R8SA 2DFKB 3U7GA 2KE5A 3L2OB 2AKYA 2BEKA 2CJWA 3LX5A 2NO9A 4PAQA 5KOYA 3A58B 3QNUA 3LV8A 4JMPA 4DLYA 1WQ1R 3U44A 4D81A 2BCJQ 4LV5B 4TL6A 4B3XA 3RWMB 2Q3HA 1XEXA 1A82A 5HCNA 2JHEA 3C16C 2GZDA 1KO5A 2EFCB 2ZJ8A 1XD8A 3I3SR 4EETB 4HH3A 5FL3A 2F1JA 4W5HA 4LCBA 1RKBA 4K46A 1KI6A 1KY3A 3QVUA 4FMBB 1MV5A 4HLCA 1KO7A 3EWAA 1UBGA 4I39A 3H86A 3ZD7A 5HDSA 4UNPA 2GRJA 4Z8XA 3FE2A 5EP4A 1GL9B 4MITA 5LPNA 3PJRA 2RHMA 3SBDA 4M9SA 5FI0B 2ZXUA 1FMLA 4IOKA 5J5CA 2ZJ5A 4RJLA 1E2DA 3VQTA 3BRWD 4DVGA 5D3MA 3VKWA 3C7KA 1ZINA 3PEVA 3RSOA 2BEJA 1G7SA 3LAWA 4QFMA 3W90A 3VNVA 3CNOA 3KX2A 4F38A 2I1VB 1NY5A 2Z43A 1N2CE 1WE2A 4M1YA 4JVSB 2V0UA 3EWSA 4NU0A 1G7CA 3AVVA 3U5ZB 1YZQA 3WMEA 2EQBA 1BMFA 5JLJA 3ECCA 1BOFA 4AK9A 4DSTA 4QC2A 4II7A 1IN7A 3LIBA 4PC7A 5EQTA 5FI1B 1E69A 1X1RA 2RGEA 3CB4A 5FL7A 3BY8A 3Q9LA 4IXMA 3LQRA 3W34A 5HPYB 4ZIRA 2CJWB 4JVLA 4OK3A 1P72A 5ELXA 2WPDD 1T1BA 3BY9A 3G6OA 2FPLA 4L9FA 2BMEA 4YC7A 1TNDA 5HD3A 4M2LA 3U44B 1R0WA 1DO2A 1FX0A 3AVWA 5EP1A 4PPFA 1YRAA 1DO0A 3T1TA 1XEXB 2PR5A 5JHGB 5KO2A 4IJMA 4V03A 3I1FA 1KNXA 1TX4B 3U7EB 3TSWA 1OJ5A 3MQOA 4TLAA 4KHZA 2QRZA 4A2WA 1UEJA 3CRMA 4NXBA 1D5CA 4Q19A 5FBWB 4IW3B 1OXUA 1AQYA 2FSGA 2FPMA 1S1CA 3IIKA 1H8HA 4PFSA 1DAHA 2A5JA 5DH9A 4A0HA 5CM8B 4CGZA 3ZZ0A 1EFHA 2YJTD 5TARA 1EX7A 2WHXA 4LDJA 1X86B 4U02A 2IS6A 1JPJA 1FTNA 4NL4H 5JCPA 4A0RA 4G5GA 2AX4A 1ODVA 5A0FA 1OT9A 5K8UA 1DG1G 5LD2B 1GTVA 4LHYA 1JNUA 4NCIA 4YMTA 3QI2A 1XX6A 3RHFA 2V7QD 4QHSA 2V9AA 2P7JA 2PJRA 2QE7A 2G83A 3ETLA 3E4QA 1G4AE 2ZEJA 4A92A 5FUWA 1T5IA 2JGNA 5J4HA 2ZVQX 1I2DA 4EPRA 3A1WA 4JLMA 3QKRA 3NEJA 3SZRA 2OHFA 2F1IA 3SJCA 2PT7A 4BEJA 1D7EA 4ZI2A 1CR2A 2B7CA 5HKKD 1E2NA 4PKYG 3H2YA 3MWKA 3T15A 4DLVA 5JCZA 4XIGS 4JVNA 3ZGXA 1T19A 4PXAA 5JI3E 4XVRA 3GLGE 4QM6A 1I2MA 2QU8A 4XOIA 5KHOC 3BFXA 3OAAA 1BO6A 1DELA 1TU4A 3SN6A 4LJ5A 1UADA 4Z1MD 1DAFA 4UNNA 2KI5A 1PJRA 3ZJYA 3ADKA 2OCBA 1M74A 3TH5A 2Q9CA 3GLGB 4LGMA 1GZSA 3K9GA 2GDJA 2MSDB 2OBMA 1FW6A 3VKGA 4DJTA 3I8XA 1YZKA 1ZNXA 1KMQA 1SVIA 4HZIA 1XNJA 2PDRA 4Y0VA 4UKDA 4V0MA 5HDDA 2PCJA 5E3HA 1OXTA 2WWGA 4MH0R 5DO9A 5HTKA 4DSNA 3REGA 3M4YA 3FFBA 1E0SA 3MG9A 4IEIA 3B8HA 2AXPA 1Q57A 1R5NA 3BD9A 4KCGA 3QBVA 4QHYA 5ANRB 1OB5A 4TYNA 4BZXA 4R98A 2DYKA 1GG2A 1G6HA 2GK6A 2IYXA 4TQUS 4OHZA 4MKIA 5UKDA 3GECA 4TSFA 1OKKD 4QHTA 4WZ6A 3K0SA 3KQHA 1E96A 1IXZA 4Q4JB 4HLQB 3B7GA 4M21A 1E9FA 1LF5A 3EA0A 3LBIA 1ZD1A 3QKRB 1FTSA 3FKQA 1T3LA 4M1SA 2YOHA 1HTWA 2NO7A 1L8QA 3EIHA 1NG9A 5JRZA 4C0AC 1C9KA 3K1JA 3ZZUA 2PT5A 1DADA 4GL2A 2XOKD 4LBYA 3THYB 2RHDA 2F43A 1VECA 2VP0A 2YKHA 4HP4A 1KDTA 2XNDD 2WJHA 4QOSA 4DDVA 4V0ME 2Z4RA 1T0JB 2ZRMA 3N70A 4IDHA 2XB2A 2QGZA 4YDSA 1P4SA 1V43A 4DZZA 2QT1A 4QBGB 5EE3A 2GBLA 4EPWA 5GVSA 4MKFA 4CEHA 3NDBB 1HQYE 1TF7A 4OJQA 4RZXA 3CRRA 2ZRLA 2B7BA 3HJIA 1KDOA 4EJSA 2O0HA 4PPNA 2H57A 2HCJB 3MWYW 5FOXA 2GEDA 4TWZA 4KSBA 2QAGA 2VSXA 4W5WA 2XXAA 5CYOA 4RD0A 2P6UA 1VTKA 2FX3A 4LSGA 5LB4A 1U8AA 2J1LA 2HDNB 3OIYA 1CLUA 4LJ4A 3BS4A 1GKUB 3CH5A 1G17A 1LY1A 3KKQA 4G01B 821PA 2Z0MA 5J4KA 3CLVA 1Z22A 3BE4A 1Q21A 4URYR 2OSBA 3QXHA 5J4VA 4Q1CA 1SVOA 2ZOHA 5E7MA 4URZR 1GIAA 2ODEA 4EDHA 3NOPC 1P0ZA 1Q3TA 3QKSA 2C9CA 1HEIA 1Z3IX 3AKYA 1IY1A 3P20A 5AJZA 2LWIA 2ZUBA 5FOUA 2F43B 4LYJA 4JGQA 1A5TA 4IOJA 2AR7A 1CRQA 2IUTA 3W8RA 4EPVA 3F1NA 2ZYUX 1ZJ6A 4PQYA 2ZUDA 2WKRA 1KI2A 4ASUD 3SI7A 2WPDA 3TK1A 2QAJA 4BLPA 3BGWA 4LHVA 5DHAA 1KAOA 3HU1A 4KITB 3MFXA 1E2KA 2C5LA 1E79A 2IF0A 3BK7A 3I72A 4I1UA 1QF9A 4OK6A 4U00A 5CYPA 4TYQA 5EUQB 2C03A 4NYIR 5BW8A 2VHUA 2EFGA 4EJSB 4HAZA 4B6EA 4MDEA 1OHHA 2C9YA 3JVUA 2EFHB 4B43A 5K8TA 1U9IA 5JFGA 4BFVA 2XSZD 3L43A 4QRHA 2FA9A 2D7DA 2ZJZA 3IHLA 4NHOA 1XF9A 3M0EA 2OUKA 4PSVA 4UJ5A 5F2EA 4Q7KA 2ZSEA 2BM1A 3FYHA 2W2XA 4QM7A 4ESHA 3TQFA 2QBYA 2D7CA 2HUPA 1GNRA 4TMWA 3TUIC 1GSWA 2BMFA 2IYUA 4KO8A 3K0EA 1T18A 1N5IA 5AUPB 2V7QA 2BMJA 5B58C 1MZUA 1XPUA 5F9HA 1W0KA 1KZGB 5BN3A 4B9OA 4P32A 4FWIB 1P60A 2KDKA 2NO1A 3V4FA 4S2EA 2VF7A 4HLDA 1PVOA 3BAFA 3H1TA 4LBZA 1C1YA 4PZLA 3RRMA 5EZ5A 1D9XA 3HP1A 3PITA 5KPDA 5DYGA 1OPXA 4D0NA 3HWSA 2CL7X 2HLDD 4U5XA 1T3HA 4D6PA 5KSOA 3LH5A 1TUIA 5C4GB 4EUNA 1SVLA 2V4ZA 4PAMA 1N6KA 3LLUA 3W6NA 4BBUA 4JIMA 3F1NB 1OFHA 2NQ2C 4UQOA 1D9ZA 3RWOA 2EWWA 3LI8A 3TW8B 5H70A 1BKDR 1QG4A 2G1JA 2JCSA 5J4LA 2VHQA 3REFA 4DEXA 1WBDA 2OZEA 1UDWA 2IYLD 3RC3A 4A6PA 4AWXA 3ADCA 4DIEA 5FBVB 2P5SA 2BC9A 1E32A 1EFTA 4C7OA 1G4UR 4R71A 3KFXA 3GJ8A 2VO1A 2PYPA 4RCZA 4RSGA 1Z5ZA 4B3GA 4AIIA 8OHMA 2J87A 2ZU6A 5SZHB 2NOAA 2OXCA 3QXSA 2A2ZA 1KOFA 1XJ2A 1F6BA 4KFUA 1R0ZA 2CE2X 1G6OA 3GLIA 1CR1A 3B1XA 2IK8A 4ACBA 3A6PC 4DHEA 1L7VC 1NMZA 4LV6A 1JQLB 3CX8A 4L15A 1ZP6A 1U81A 4N0EA 4QJ4A 1FQKA 2ZI6A 4HNBA 4C4PA 1FQJA 4L9SA 3CZQA 3TVTA 4BLOA 5JS8A 4HZUB 2OAP1 4QGHA 4C2UA 2O52A 621PA 3L0PA 3KQUA 1N6NA 2BDTA 2WWHA 1E9DA 3WYGA 1XJQA 4FMDB 4Q66C 3OIVA 1UBCA 2PX0A 5JWHA 3D6TB 3LBHA 4GBMA 2PCLA 4Z8YA 3O47A 3T35A 3WHKA 3WYAA 1OKKA 2BBTA 1GRRA 1WRBA 4B74A 4V02A 1WB9A 3SBEA 1VCNA 4FD2A 1CULC 4C0JA 5CK5A 3WNDA 1TADA 4B34A 4TMVA 3ND9A 1BH2A 4DB2A 3IBGA 1T1AA 2BBOA 1Z29A 1VHLA
chains in the Genus database with same CATH superfamily
4B8ZA 4CM3A 1IM5A 3L49A 2BZGA 3KJHA 2UUPA 2XNDA 2YZ2A 1FL9A 2GAAA 3ZE9A 2UXCB 1EDDA 3E0XA 2UZAA 3BCRA 1SKMA 4NESA 1YOVB 4JLVA 4ND7A 2GM9A 1DHTA 4H17A 1KS9A 4G0PA 4DWJA 2O5EA 4JR0A 2QYTA 3WNZA 2R1ZA 3KB8A 2MSEB 1C7IA 4IUCS 2HDSA 1MO3A 3GRVA 2PFKA 3GRRA 5JDCC 2Y93A 2OHOA 4E5MA 4L0LA 3BFKA 2O8NA 1EI9A 5A3VA 4AX8A 4JBLA 3I4LA 4XYLA 1PQ4A 4OONA 1M6YA 3GFTA 3U3MA 3BSSA 3EVZA 2GJ4A 1EFUA 1T9GS 3ENVA 5A2QA 3V4ZA 2W7TA 4I8DA 4HNGA 2HXSA 5IDWA 1OJGA 5AJYA 5JYBA 3RVOA 1Y1TA 4PBTA 4QA9A 1TO2E 4YP9A 2DT5A 4LJRA 4PM6A 4URWR 3LRPA 3NBFA 1J8MF 3KUUA 3SZMA 1L7PA 2WG1A 5J4EA 1YQ9A 3SQXA 1FRZA 4I5FA 1EA5A 3GY0A 4QBKA 3MYYA 3U4LP 1CKEA 4JBXA 5LA6F 3WLSA 2FLWA 3VR1A 1FSPA 3BOSA 3AIIA 3V8QA 1W88B 1OFIA 2I6GA 3G1UA 3G17A 4F2GA 3MUFA 5SICE 1T8PA 2JI9A 5JS1A 3CINA 1JSLA 1XZCA 1AS2A 1ULAA 1Z08A 5FA5A 1MABB 5B58T 3V8PA 4PCVA 2ZYSA 1DCKA 4MEJA 1L7EA 5HW3A 1USVA 4U7WA 4EI2A 5E1MA 1A5SB 3MMXA 2I7TA 1ORDA 1GHPA 2FEPA 1ACMA 4J76A 2Z2ZA 5HUQA 2B8EA 4DPKA 5DDIP 4X8MA 1NHGA 4G9BA 2Q5HA 3KZNA 2V5VA 1GTMA 1EP9A 3RO7A 2B99A 1VHMA 4FSXA 5LMZA 1SC1A 2CVOA 1YB5A 1XTJA 2Q1YA 3TF5A 3T7DA 2H07A 1YRLA 3MUEA 4IPTA 5CHYA 3NRBA 3W2TA 4Q3OA 1IBSA 5A0TA 3ZI7A 2C54A 3HYTA 3K2QA 3MZEA 2NADA 3GYGA 1ZVMA 3AU9A 3FPKA 4MLCA 5HSGA 4M3KA 3L7JA 5JAUA 3Q7ZA 4DIUA 3IAM6 4F3CA 4GI7A 1XQ1A 1G5QA 2V8BA 2CNDA 4NXGA 1C7RA 4KJXA 1AB6A 1NAHA 3UKDA 5I48A 4Q9DA 3FGZA 4H1VA 4FQ8A 2PN1A 3HVJA 3HU5A 4CR7A 4EB3A 5AHWA 5BMVF 1YUNA 3CH4B 4UVEA 1E2LA 1CVIA 2EZUA 1AGYA 1YAXA 1IB0A 2Q2QA 4GMXA 2FEWB 2EZ8A 1X19A 5HBRA 3WRZA 1XZDA 3O9VA 3VZPA 2QF7A 4JQCA 3GJSA 1RZUA 4S04A 3BWLA 1XTQA 5J2TB 4DE1A 2C9OA 1S3SA 4IVRA 2HRQA 1DXQA 3LC7O 4HAVA 4QUAA 1XX2A 3DQZA 2XNKA 1BGVA 1RRMA 3FNIA 1JHUA 4E5YA 2R6GA 5I5LA 5HD5A 1P97A 3T1VA 1QYRA 5CAEA 4DV4B 1R64A 4HB0A 5GM1A 3GLFE 3UV7A 2F9MA 1S8NA 1F9AA 1XN1A 3DJFA 4TROA 4M53A 4L2IA 1MAUA 3O2JA 5EVEA 5GMOA 5JLAA 5FAKA 2V98A 3IPXA 1IZZA 1X1EA 4BVAA 3L4EA 4PRKA 4YRSA 1ISRA 1NGSA 4WLOA 1JJIA 3RR2A 3L8DA 5C52B 2Q0HA 1NVKA 2A0UA 2PUGA 1T4GA 1LL9A 3UFBA 1NVVR 1ZJZA 3OPPA 5JV5A 4M0EA 3L8ZA 4YS6A 3T0GA 3K15A 4CV1A 1Y3HA 3CIFA 4GR4A 3FUWA 3ZG5A 1DC3A 2IYTA 1COWD 2P65A 2PKRA 1Q1GA 4YV7A 2G1UA 3N1UA 2FZGA 4W5QA 2LGJA 1ZBDA 1BDHA 2GFHA 3TEFA 2OGZA 2NAFA 3QBTA 4RD4A 3Q15C 1F38A 5I7SA 1RI4A 1G16A 3VAZA 4NCHA 3A6KA 3Q7SA 5A03A 2ZWVA 4UU0A 3G8CA 5BWNA 5L3RA 4AMVA 4HY3A 5ENZA 3K05A 1KYYA 4AUKA 2WKWA 1RJ9B 3ZBUA 2VUIB 4N1HA 5ERYA 1ESUA 3SKVA 4MRAA 2G17A 3PICA 4YASA 3L93A 2W2VA 2I76A 5CFNA 3ZD6A 3HBMA 3R7WB 2ORVA 5IBPA 1XZPA 4UPEA 5BUZA 2Q5QA 4OFXA 4BE4A 2ILTA 1P9NA 2GRAA 2O06A 2DFDA 2II6A 2QG4A 2AKAB 2A1TR 2ACGA 1M7GA 2HXYA 1L0GA 1GFZA 5JALA 1A0KA 3MWEB 4Y3IA 1QRDA 3RS8A 2BASA 4YAWA 5G0VA 3F9CA 1KJQA 1OZ0A 3RAJA 2V6JA 3NNDA 2VUTA 3CVYA 2EKPA 3BFVA 4M0PA 4RK6A 1R50A 2VWGA 4ZQGA 3E9EA 3IOBA 4HGOA 1FEZA 5IVIA 1P1HA 2IPOA 4LXGA 3OKAA 2PU2A 3ZG9B 4C0QC 3KXLA 1Z36A 1HYQA 5J47A 4S12A 2QLLA 3SSNA 1XCLA 1NWCA 2Y1GA 2HKIA 4XLLA 5EJGA 2A5FA 2FEMA 1Z6ZA 4JCCA 1SD2A 2ZSDA 2AIRA 1JSXA 2F90A 4TSRA 4H7KA 4GN2A 3OJFA 4G0OA 1PIOA 2XCRB 1JIVA 1GFIA 1KORA 3OU2A 3SXUB 3DAVA 2QLMA 1LQUA 4WFKA 1Z17A 3C4JA 3CEAA 1FNNA 3RFUA 1K6IA 3WRWA 2VA8A 2M1ZA 1NBHA 3HA7A 1QH8A 2ZAIA 4A1OA 4A27A 5AI5A 1S1MA 2JKFA 1EGHA 2EGGA 2FPIA 4FEEA 1SXJA 1T9HA 5JCOA 4G4JA 3E9YA 1FIUA 4BV9A 5KTOA 2GXUA 4UZEA 4RKEA 2OBBA 5BSTA 3V1MA 4MN5A 2OQVA 1MVOA 5JE8A 3H5OA 2VYNA 2HPHA 3WYFA 3NHJA 2QM8A 3MOGA 2AVXA 4O2BB 4DIFA 2PANA 4FKBA 3ZS9A 5HOQA 4ZYVA 4D3FA 4CQMB 4IFEA 4N82A 4RD2A 1KZ1A 1A2OA 5CCEA 1TQDA 3ONDA 4G0VA 1VCMA 2O59A 4NCJA 3V33A 1KJNA 2BBSA 2JIMA 3C6BA 3DVAB 1LU9A 3SBOA 3PD1A 3VHLB 2O1XA 3AINA 4MARA 4P81A 4DRYA 3AJDA 5ITZB 4NENA 3E2PA 3CEJA 1VFPA 4OOEA 3U1VA 5AHOA 3ZYCA 3R3VA 3R5KA 5LQSA 4N6GA 3DWEX 1SEPA 1P1IA 2EKDA 3X1JA 1GL3A 2PKWA 4UVDA 4IILA 3E0QA 2IZOA 2HV8A 4KBGA 2X19A 5K3SA 4OOFA 4JLAA 3HR4A 2DTXA 3HZRA 3ZQJA 2RGGA 3QGMA 3VO1A 3OECA 3W8NA 4MJ7A 4QDXA 1N8TA 3C5EA 4QXAA 3UMSA 1ADFA 5HIKA 1RHJA 1K6RA 4GYWA 2IT1A 4JA0A 1ISSA 1AVTA 1EVJA 2ONZA 3U7HB 4ODIA 4RANA 2E4YA 4TTSA 5MN4A 4LUCA 3V7NA 2WSLA 1HRKA 1NNI1 4O33A 4HWKA 2FK7A 4GX1A 4Y2YA 4RH0A 2Q5JA 1O7EA 3SHTA 3SEZA 2Q0QA 2J09A 3X1ZA 1H2EA 3F67A 3MD9A 2CV1A 2B2NA 3PPWA 5DNAA 5KTMA 1PN3A 2ZDQA 4YGXB 3OJOA 4HVTA 2Q1UA 5K0JA 4DXAA 1X8KA 3EBPA 3G02A 3KQQA 2HJ9A 5DP1A 2JLUA 1EU1A 3BH7A 2RGDA 5FEUA 1VIAA 1SZVA 2WAXA 2NMVA 4XT2A 3E98A 4GCZA 1E5XA 3COPA 1GDHA 4X7PA 2NPFA 4QARA 2XIJA 1SWVA 1JLHA 2H18A 3Q2IA 3O8OA 3PV0A 2D5BA 1P5HA 3O9MA 3IRVA 2Y1XA 3U4GA 5JNTA 3NC0C 5HX9A 1W36C 2V20A 4WZBA 4JN6B 3AUTA 3R6LA 3HJFA 4UE2A 2W8BA 3K6JA 3THOA 2BR4A 3ZCPA 2C82A 3RUPA 2BFOA 2XHZA 1PG5A 4K9PA 1DZ3A 2G5PA 5DP2A 5E2HA 2H31A 2IHKA 4B4WA 1H6AA 3D8TA 4LCMA 1JR3D 2QK4A 4TN5A 3WY9A 3FCSB 3BFJA 5JO0A 2ECPA 3OU6A 2H54A 1W25A 3L8HA 4WTOA 4RTSA 1I7NA 2H5JA 4G5HA 1XDUA 1HE2A 3EH2A 4MGIR 2FMKA 2FN3A 2JAOA 2H1SA 5H80A 3VI4B 4J7UA 2GN2A 2AG5A 4ESOA 4CIWA 1GSHA 1TS0A 3PYMA 3W2FA 4ID4A 1M5TA 2J3JA 3COZA 3BT7A 4D8TA 1QF6A 3KYBA 1RP1A 1KO1A 2QROA 3CUKA 2ZRKA 1UKBA 1I2CA 2J9RA 4QQRA 1P7CA 2ZGVA 1A1VA 1FSWA 5EHXA 4URFA 4Q3NA 1GQSA 2JW5A 4U6SA 1MMFB 3Q3JB 1G8PA 4EPTA 1GSOA 1P1KA 3G2ZA 1VBFA 2VDVE 5K0LA 4IIEA 4D0LB 2PXHA 3RFTA 3E3OA 4ZZ0A 4B48A 1HKUA 1NXVA 2A0WA 4GD3Q 4B2PA 1FP4A 3IIMA 2H1RA 2IKSA 4S2UA 2VKSA 3ZLJA 1EIWA 3RIMA 3DULA 4R3NA 3W5SA 1PJBA 1I9CA 4OXNA 1QKJA 3I6BA 5CG2A 4BNKA 1L4KA 2GAJA 4KQFA 4CIBA 3S2ZA 5FAPA 2OE2A 1F4PA 1LZKA 4RK7A 3DP7A 5KJ1A 1AKEA 1M8KA 2VPPA 3T4LA 2ZT6A 3GOHA 5ALPA 2X9GA 4R1LA 4CCWA 3UJ7A 3GQVA 4TZ6A 3UPPA 4OOMA 4CLCE 1DO8A 5I9NA 1J8YF 2ZJ3A 4BLTA 3NRJA 3P97A 3R9KA 2ZRGA 1Z4MA 1CP2A 2RIRA 1Q77A 3B3JA 4D44A 1L3IA 4IINA 4FGLA 2HHCA 1NI3A 1NDUA 5FNVB 4BZQA 4EQ6B 4IYJA 1Y7TA 2V6GA 2J7VA 4OREX 1FSFA 3B5IA 4QODA 2E48A 2O1SA 4MB2A 4E5SA 2XH9A 5L3SA 1GPLA 3QSGA 4JOSA 4KLNA 4WXHA 4DR3B 4GLFA 4JV5B 1OH8A 3RANA 1CR0A 3SOIA 1XB2A 1N25A 3W2IA 3KT3A 2HWWA 3NOOA 1RQGA 1GU1A 1CF0A 3CX4A 3C6QA 3ZXXA 2XUAA 2BFMA 4TXLA 2LNDA 2E82A 5FR1A 3CPTA 5DHUA 2F67A 3C8UA 4OJKA 2Q9UA 2J9YB 1H4TA 1QTIA 3L7HA 2EBWA 3T06B 3OT4A 1JHMA 3UFXB 4YK7A 3MLEA 3GFRA 1PEAA 3BJNA 3RJTA 4F11A 5M2QA 4GUDA 5AK5A 5KTYA 3FRJA 3TECE 1DEOA 1XCMA 3GMTA 3G2NA 5HSQA 2XTNA 2FWMX 1VLLA 4S1OA 3E5NA 2QXTA 5CD9A 6REQA 1T1CA 3MXQA 2WNIA 2B6HA 3LX5A 1VE5A 2BEKA 5KC8A 1OQAA 4PYLA 4NZMA 4B3XA 1JHRA 3RWMB 4PY2A 1V0JA 3CHWP 1EFPA 5C3UA 4EETB 2NZWA 1CQIA 3PNLA 1MV5A 1SBTA 4FB4A 3QNWA 4RK1A 4C6YA 3GWGA 4KTVE 2ZXUA 2AI3A 3EXIB 1LL5A 3WJ7A 5A4DA 3LAWA 2I72A 2XCUA 4N3AA 2NTEA 4RF2A 3F7OA 2V8CA 3UJ6A 1C30A 3PHBE 4RSHA 4RTNA 4DSTA 4AK9A 2OSUA 3UA3A 3SIXA 3BY8A 1SUSA 3Q9LA 3LQRA 3A3NA 3QVGB 2NVBA 2QUAA 1RYNA 4G4GA 3VJLA 2C4VA 4HP8A 5KJFA 4L9FA 4KPYA 1PWCA 4F2PA 4PPFA 1AKWA 1UOOA 1NRJA 4QRDA 3E7FA 3VU0A 4CDNA 1GQQA 1UEJA 5IAGA 2ZDHA 4IW3B 4AKTA 1PE0A 2FSGA 4CGZA 1PZPA 3DQPA 3FUVA 3W4QA 1EX7A 1HTTA 4OD0A 1X86B 1JPJA 2MU1A 4WNYA 4NCIA 1M2VB 1STOA 5JQWA 4E5DA 4X61A 4MI3A 3I9V6 3BKWA 1K6EA 3MAGA 3I34X 3PDIA 1QQAA 5LYJA 5J63A 3FTFA 2Z8YA 3BTUA 1D7EA 3T15A 1F4LA 1E25A 4PYQA 4C4ZA 3RXWA 1C7ZA 3SN6A 4MXDA 3GLUA 3U0VA 3PGXA 2QYBA 2B1GA 3ZJYA 2Q9CA 1PX0A 4LGMA 5KMGB 1ZNXA 1ECGA 1ORTA 1YMUA 1SVIA 4KN8A 3Q11A 1NATA 4DSNA 1W2WB 4S2OA 3ZK7A 1AV6A 5UKDA 3RC2A 4JKTA 1L9KA 5E43A 4JP3A 4WE3A 2YH2A 3VA7A 3QKRB 2Q4EA 3H3FA 4RJIA 4C0AC 3KPUA 3HH8A 1A9XA 1VECA 1YJAA 4ZI7A 4E31A 2C4KA 2VP0A 2YKHA 1RQPA 2OK8A 2P62A 3G31A 1KDTA 2V7XA 4AULA 3EZGA 3UC5A 2J3TD 3QHQA 4CGYA 2X01A 2Z4RA 2DM6A 4U5QA 2X0IA 2XXBA 6LDHA 3PQ6A 1W8QA 1ZUNA 4CEHA 3QFRA 2AVDA 4M9RA 4OJQA 1MGOA 4RTPA 2PGLA 1Q7RA 3HUNA 4RYDA 4W5WA 2PGOA 2HU2A 4X41A 4LSGA 3TOXA 1QBGA 1LLDA 4JUCA 3NLLA 4OLFA 4A5RA 4AN4A 1OWMA 1WMAA 2FMFA 4UREA 5DN9A 4DJ5X 3SSOA 2J9FA 2PRFA 3OTWA 4UHCA 1V16B 4MWTA 2Z04A 4WY5A 3STUA 1XAHA 4YCNA 3P2YA 4D74A 3MB5A 3H8WA 1N7GA 4XDZA 4HX5A 4JHLA 4HTFB 2WK0A 1GA6A 3OQJA 1K92A 4NHOA 3Q40A 5THKA 4C3UA 4U9IS 4KO8A 3W5DA 3AGEA 3TCNA 5FHQA 3NWOA 4YO7A 4CG0A 4GPZA 4QIHA 1ZAYA 5KPDA 1UR5A 3VR0A 4LV0A 4GX0A 1QCCA 3HZHA 3II6X 2ZSIA 1QG4A 3REFA 2I29A 3C1AA 5C35A 8OHMA 4Y98A 2IXBA 4YRLA 5HQTA 1ZN2A 3BMOB 4D3DA 4KFUA 2ZOSA 3H1AA 3FYCA 2TSYB 2ROQA 4MO9A 3CZQA 3TVTA 5IH7A 3BFDA 1OC2A 3A6HA 1JB9A 5JWHA 3VV2A 1WRBA 4WGFA 5EJ5A 4V39A 4DR6B 5JG7A 2IBTA 3K4PA 4KZ6A 1BH2A 4PAUA 2BBOA 1Z29A 4WV3A 4XQ9A 5I3CA 2WTXA 1WOMA 2OQ2A 4B7CA 1IMOA 2E21A 3O8DA 2HU5A 2AEEA 1ZVQA 2QIPA 2FP3A 4DPLA 1PZGA 5KYXA 1TK9A 2HJ9C 3E3AA 4CW7A 2IU6A 5CIYA 1JWBB 4B9EA 1CB7A 2TMDA 2C97A 1ZIXA 3GFPA 2DCMA 1MW8X 3CKKA 2IHVA 2HM7A 4FCTA 1UQRA 1VSBA 4YYZA 1ZZEA 1MB9A 5JO9A 4R2WA 1Q0RA 4RO0A 3F6EX 1SELA 2PRZA 1U2GA 3RLFA 1H93A 3DAHA 3S28A 3GVHA 4YHBA 5BR1A 2WT8A 4QOEA 1UM9B 5COBA 4WINA 2AN4A 2ESRA 1U0FA 1B6GA 4LWPA 3CW8X 2PUFA 2A9OA 4ZMSA 1QK4A 3L77A 4FD3A 4HFJA 4CV3A 1OTHA 4DQLA 2VZ0A 4IDOA 2G4LA 4V0NA 3OPYI 1I7QB 1TCCA 2PL1A 2NUTB 1X42A 4UULA 4BKUA 5KSCA 5CMLA 3K9CA 2P78A 1OH5A 2SKDA 4XWTA 1LSSA 3WDMA 3O4JA 2CC1A 1N2ZA 4D3YA 1RAFA 4W8GA 3AIKA 1U7PA 4Q0IA 4WUTA 4WW0A 2E49A 1L5HA 3W4OA 2HT6A 1V8FA 1UWPX 1Y34E 1EFCA 3RIEA 5F5YA 4B09A 3LKZA 1BS9A 1CUBA 2LTAA 5E0KB 3KLOA 3BTVA 3BJMA 4W9RA 3N0VA 4M4XA 1WEKA 3VR6H 2FPWA 1ULZA 3QMPA 2DR3A 3NT2A 1U63A 1T15A 4NEQA 3TKLA 3UE0A 4B6QA 4K3VA 4U2EA 3AB8A 1HF3A 2C2BA 1TQ4A 1XVUA 3EY4A 3JAWB 4UVGA 2QGNA 2JLXA 3E7PA 2CFOA 1D0VA 1J5PA 3OBFA 3IALA 3GQBB 1G5IA 4YWHA 4H6PA 4EX6A 1Y4SA 3GZNA 4RDIA 2AX3A 2DPLA 5I9MA 5TR7A 4JASB 5A93A 2I4OA 1E7MA 3I6ZA 1VPLA 2QT0A 3RS9A 1JEAA 2CL6X 2RHRA 1J90A 1WE4A 2J6CA 3N6RA 4YRDA 4UNSA 2VDKB 4C0WA 2LKDA 3IT3A 3SZUA 1LRKA 3LQYA 1E1RD 4FQ5A 3SYKA 1EUQA 2UYGA 4KOAA 3TMYA 4ZJYA 2E87A 1Y9DA 2G28A 2PRKA 7ADHA 3DOFA 2OVFA 2JKVA 1LSWA 3M5PA 1VLVA 4LIPD 3TBHA 4MHTA 4QU0A 4L6IA 2Y9MB 3DOUA 1AQ6A 5DHRA 3NEPX 4JI6B 4MRMA 3NULA 2CNLA 1TYZA 3HY4A 1A7UA 1XPRA 1MFPA 3NGLA 1II0A 4XIFA 1RR6A 2Z5LA 4WJLA 4AZ3B 3G4PA 1QJCA 4BV3A 2FZVA 2REXB 2QX6A 3KXIA 3QZUA 1NTRA 1Q1ZA 3A31A 1OIWA 1W0KD 5HJEA 4TV8F 3ZBQA 2OKCA 3F1OA 2J48A 3VR6A 4PO1A 2C31A 2D0IA 1RDFA 1E2FA 2VF5X 4TVKA 3BK2A 4GH5A 4CIDA 1MLDA 1I7PA 2OZPA 1LB1B 4GKBA 2WHEA 1AV7A 3R0ZA 1YMVA 3Q3IA 2ZTUA 3FWNA 4L5CA 1DVRA 4FI3C 1VBNA 4FBGA 4S1WA 2IOHA 2AYZA 4LOHA 1PR5A 3RUHA 1AMUA 3BMXA 1M6WA 3ZU2A 3GI1A 2X0DA 2Q07A 2VPWA 4WUJA 5TVKA 3BX1A 1M5RA 4U7JA 1LJLA 3QU7A 5I45A 3MJQA 3DHEA 1QLHA 2DHQA 2M7VA 4CL2A 3QUBA 4US0R 1BLCA 2PGNA 1P0CA 3SICE 3TG9A 4Q93A 1N9OA 3I01M 3K16A 3W04A 2EFDB 3AJAA 5CFPA 2J6BA 3TZHA 4WZAE 2XR0A 1M2FA 2I8AA 1GITA 2QS9A 4RVAA 3G23A 1L0EA 2A1TS 3HKEA 2JGEA 2H6EA 4OSOA 2D2VA 2V97A 1IWOA 1RRVA 4MGEA 4HQRA 1GPDG 1K7FB 1GKYA 2B95A 4LFBB 4OI2A 5L95A 1JJAA 3T3GA 1FXSA 4YREA 5JCJD 2ZJBA 1XYGA 2O8DA 4MVWA 1FU7A 3RFVA 3A1NA 1RYMA 4NE9A 4F71A 4OFZA 3OZXA 1R9JA 4GUAA 1XMPA 5C7IO 5AYVA 4RW0A 4LHXA 4ARZA 1QIEA 2HRRA 1UXJA 4NICA 1EFRD 1KI8A 5A02A 2ZTVA 9GPBA 5CM9C 2RCXA 1E9AA 1MB2A 3A25A 5FQKA 4I81A 2G2WA 4H1HA 1Y7HA 1Q20A 3VHXB 2CSXA 2RGCA 3AF6A 3N2GB 3NANA 3VR3A 4PGMA 5M7EA 4NU5A 1WHSA 1TVFA 4Q4CA 1UM8A 1U65A 4R38A 4YUXA 2ZJ0A 4B0PA 1II9A 2SKCA 1HG0A 1QC5B 1N9KA 1GV1A 4QZVA 4OYLA 5IF9A 1Z12A 2Y91A 1TTTA 2QT9A 4GP9A 1B0AA 2X1VA 4O2AB 2GAFA 5BRJA 4ND5A 4M38A 2HV9A 3QE4A 5KVAA 3HCBA 1DC8A 3PQCA 2NYAA 1XL1A 2N3ZA 2RMKA 4CPDA 1SCBA 2VQDA 5SYMA 3DDNA 5ES3A 1XZAA 2HIHA 4V38A 4JC0A 5SY9A 2IUEA 1KQ3A 2XF3A 3MCUA 4B85A 2CDAA 2QZ6A 3CXUA 4CLRB 2YHBA 3C8DA 4J0QA 4JVOA 3GT7A 1XTRA 1XTSA 3TNLA 1NXWA 5IJWA 1O95D 3PNVA 4G4IA 5JNLA 2V7EA 2O9JA 1EGQA 3GAFA 2P79A 2XA7S 1WABA 2GA9A 3VP1A 3IE0A 3E3NA 5IJ9B 3U60B 3RIXA 1RM5A 1GHMA 3GAZA 3TQCA 4N0PA 1XKXA 2P2SA 3GFOA 1SVSA 4N0DA 3BXGA 3EPRA 1N5DA 3VUFA 1GTSA 3EW9A 4ITVA 5CHEA 2W3GA 3ABSB 3A7DA 1O8CA 4PU0A 3KZ1E 1U9CA 4PQEA 3A2KA 3EDRA 4NZZA 2OHVA 4OFWA 3D0RA 2ZYVX 5FB3A 1OXMA 1MOQA 2O1EA 5CGWA 3OTQA 1J7KA 4ZEOA 3BWDD 3Q6NA 5L53A 4RF5A 1VLQA 3QA9A 4QPNA 2PX5A 3D6FA 2ZIGA 3SZOA 2CXNA 2QN3A 3WGNA 4DR2B 3T9BA 4LV2A 4KFSA 3VTZA 3M6MD 3HKDA 2GGSA 4LOLA 5AKIA 4FM9A 3COJA 4K1LA 4ZOBA 4KUHA 3PC6A 4DSAA 3NTXA 1Y8CA 1TEVA 3FVTA 4H7IA 1GPAA 3W1VA 3DFUA 1BN7A 1II8B 1ODCA 3AZOA 2HO4A 1ZDMA 3ZEIA 2QMYA 2Y4NA 5EIXA 4AJEA 3A4NA 2I9PA 2DWCA 1PYGA 5LBIA 4C0KA 3HO1A 3ASVA 1JE1A 4YBRA 2O9AA 3GJXC 1GR0A 1MC4A 4P7BA 2IQ5A 1KFKB 4BJ1A 2I3BA 4R9UC 5BP7A 3L9KA 4P08A 4Y6LA 2OCGA 3KP1A 4KXNA 4EZEA 1E9CA 1SHKA 2CBGA 2BJHA 2QL7A 3CF2A 1N0VC 4XVHA 2JCHA 3HSKA 2EIHA 5FAQA 4EO4A 1IZ9A 4YMVA 3GJRA 2H9YA 1UZMA 1UWLA 5BOSB 2IYOA 4P34A 2DNSA 4FW8A 4GJ4A 3TL2A 2C5WB 4KMRA 3FFWA 4GQBA 1U2GC 4F4HA 1H69A 4OHRA 3NYRA 5ALWA 3ABZA 2JDID 2YRXA 5AM0A 3T4QA 4FINA 1YJ5A 3H9CA 2C07A 1MXFA 4B75A 3UK6A 4YMGA 4OYHA 1NNEA 3ORRA 1H8MA 3TOZA 3S2FA 1JP7A 4R7TA 3GFGA 2AT1A 2XUZA 4EB6A 4GLQA 4FNMA 3RFCA 4WM9A 3WB2A 4F2DA 3AYXB 4CTMA 4JJEA 2G1PA 2ID7A 4JJ8A 1N7JA 5EWLA 3CUTA 2EKBA 5FUVA 1MRNA 4JYZA 2XGMA 2G08A 3HGTA 3VU1A 1Q7CA 4DWVA 4MRSA 4ZT3A 1B76A 5B2FA 2VH2A 4E2YA 4TSKA 2FQXA 1BYUA 4TQGA 1OIVA 3VBCA 4EW7A 3RPEA 5JS6A 2NV0A 4EECA 4TLEA 2V74B 1RAHA 1R8QA 2ODPA 2GCOA 2G3YA 3V34A 3TQHA 2AEMA 1YO6A 2X0FA 1W35A 1YZVA 4E32A 5FWXB 1CY4A 1XKTA 1GA0A 1JBKA 2XUFA 3DZKA 1ZFNA 2C2OA 2CXOA 3MLAA 4HUJA 1EJ0A 4BPBA 3R3SA 6CHYA 1BSGA 4RZ2A 3GBVA 4XW2A 4F72A 4U2DA 4XFKA 3B1FA 3CBGA 1T4CA 4TLMB 3RRNA 3EIEA 3OLZA 3HCEA 3RVMA 2AXQA 4PCAA 4B6OA 4YHHB 4CDGA 4DG5A 1PNTA 2BR5A 2PLAA 3JY6A 4YRNA 1SBQA 1KYIA 4DC0A 3LE8A 4UQLA 4TV9F 4OX9B 1O9GA 4GOJA 2HHAA 2V7UA 3LBNA 4OUDA 4FYJA 1EP1B 4FN5A 4KRXA 2C88A 4FYHA 1OJLA 4NBSA 2XAUA 4ZAWA 2A24B 3BERA 3LDFA 5FOQA 1T1IA 5JAIA 4HEHA 1VRCA 3KR2A 1OSNA 2W1TA 1R0LA 2BSXA 1X0VA 3H2HA 2WTBA 3MJHA 1KFJB 5FUMA 3KDAA 1NQUA 3V8BA 3V4SA 3D5TA 3RSFA 3VMFA 2VF2A 4H6JA 1K0KA 3LF1A 3LPMA 2IH5A 4GXRA 3ONFA 1B16A 3LDAA 2H1WA 4O8ZA 4H6VA 3H4IA 5A1TA 5G41A 2KBEA 1I4TD 4CF3A 2QPLA 2AGVA 5JQGB 1MIOB 3OHSX 3SF0A 2QTVA 5ALMA 3MQQA 4ISBA 2OXRA 4URHA 3JYLA 2WAOA 3KSUA 4LLOB 2ZIXA 3F9IA 4QO7A 4WLFA 3KZMA 4YVFA 5J2UA 3EZXA 3OUZA 4MWSA 2R00A 3UC9A 3RSSA 3W2HA 2RSLA 5GVRA 3QENA 4UTXA 3WKDA 3T1RA 4ROSA 1JDPA 3LIDA 3P4UA 1DXHA 2HCBA 1AKUA 1WU7A 1H65A 2ZUCA 2YVUA 2EGHA 1YL5A 3OSUA 4XUGB 3H5WA 5FF9A 1RVDA 1I2BA 2Q0SA 1FYEA 1ABEA 1W4BA 2P6PA 3FJYA 1TXGA 4LVUA 3IJEB 3L8MA 3QITA 4RSMA 1EFLA 2YY6A 3QEJA 1L5LA 2FZLA 2WSIA 4B4OA 4FSHA 3SFTA 3K4HA 2X7HA 1IC6A 3DEHA 1JR3A 2QVCA 1RABA 4GE0A 1UODA 3UK7A 3QX9A 2FUKA 1Z39A 4GR5A 5FUYA 3GDFA 3VKVA 4KLZA 1KYVA 1GVNB 4FT4A 1ZLYA 4FEGA 3IUPA 4BAZA 2Z6QA 2MR6A 4DIDA 4B9AA 4FMPA 1J24A 1RM0A 2P2CA 2FWNA 4UEJA 4HAYA 2QEQA 2XGNA 1VI6A 3FMVA 3NW9A 2JFBA 1VMKA 2HBZA 4Z0PA 2OBLA 1VCHA 2A9VA 3V7FA 5JSZA 5I4BA 3SNKA 3C4VA 3AM5A 3WLPA 4CNBA 2TECE 3AZPA 3FF1A 2UXDB 1MO5A 2UYOA 1RW4A 4I1VA 3VXKA 1CQAA 2V9CA 1WP9A 4X69A 2J0SA 4PHTA 1V6CA 4AZ0A 1VETB 3RRFA 3ZXUB 3GFQA 2NPIA 2MYNA 1PR4A 1EUZA 2IQIA 3HR7A 1WXXA 5KYYB 3SX2A 3IAS1 3RYIB 2A2LA 2RAUA 4E3IA 1SCKA 3CCFA 5F21A 1RFGE 4DG8A 4KQ1A 4XRGA 1GPH1 3OQVA 5K05A 1X6VA 2A30A 1NP7A 1YVDA 5KKNB 5KNDD 5A8BA 3AY0A 5B3JA 4CRWB 1FFCA 1TVKB 5KOYA 4YRBA 3NHMA 1XRNA 1FRNA 1C9JA 4D9IA 2R96A 4MCWA 1MX3A 3WXBA 1K56D 3EWAA 4UNPA 1R1DA 2CMFA 5EP4A 5H3CA 1V7PC 1K5PA 3IP6A 4RJLA 2ZMFA 1E2DA 1PJ4A 1DSSG 1AKMA 1L8AA 3S22A 4WL0A 3CNOA 3ADPA 3R3ZA 4ETMA 3JARB 4Y9DA 1MPXA 4P87A 1NW7A 4A3SA 4AB1A 1MJHA 3IELA 5F1FA 4YUYA 5MN6A 4HX9A 5JT1A 2W4IA 3ELYA 2PR5A 2J8ZA 4X25A 2W11A 4A2WA 2I3GA 5FBWB 1OXUA 2VAMA 2BUAA 1N78A 5CM8B 1OR8A 2WTAA 4MPJA 5IH3A 3IT2A 3SVTA 1OT9A 1DG1G 4IDAA 4F4FA 3L05A 2A4KA 4NOMA 4OJMX 2XK1A 3N6IA 3K9BA 3SMVA 3ZU6A 1S2IA 4RE6A 4EYKA 1X7WB 1W5EA 3SZRA 3MINA 1DOZA 3AFOA 4REOA 4DKIA 1RKQA 1DELA 4U7TB 4HJXA 5CRFA 3GLTA 3HLGA 4WBNF 2KI5A 2D1TA 2O3SA 2XMCA 3QH4A 4EO7A 2QTGA 3BFFA 3JAMA 2PCJA 4F6RA 4YQYA 2I91A 5A91A 5TJJA 2AXPA 4P1ZA 4I0WB 3IX3A 3GECA 2L2QA 1NA5A 4QHTA 3N8NA 3P71T 4EJ0A 3LBIA 3G1WA 3BMQB 1YIDA 2YOHA