5HZHA

Crystal structure of photoinhibitable rac1 containing c450a mutant lov2 domain
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
325
structure length
320
Chain Sequence
AIKCVVVGDGAVGKTCLLISYTTNAFPYIPTVFDNYSANVMVDGSTTLERIEKNFVITDPRLPDNPIIFASDSFLQLTEYSREEILGRNARFLQGPETDRATVRKIRDAIDNQTEVTVQLINYTKSGKKFWNLFHLQPMRDQKGDVQYFIGVQLDGTEHVRDAAEREGVMLIKKTAENIDEAAKELGSGGKPVNLGLWDTAGLEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Engineering extrinsic disorder to control protein activity in living cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Ras-related C3 botulinum toxin substrate 1,NPH1-1,Ras-relate
total genus 97
structure length 320
sequence length 325
ec nomenclature
pdb deposition date 2016-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5hzhA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5hzhA01
2WKRA 1MKYA 4QM7A 1D9XA 2GTPA 3H2YA 1D2MA 3O8RA 4LK2A 4D0NA 1KI6A 4M8NE 1VYTA 3UB9A 2GXQA 3QXSA 1RRCA 4KBFA 3F8TA 3TK1A 1PUJA 2GCNA 3CR8A 4IXMA 1LS6A 3EC1A 4Q03A 1YZQA 4C0BA 3MJHA 2VRWA 2VO1A 1T4GA 3ZH9B 2ZSDA 1OXTA 2ZOHA 1QZXA 1H8ED 4LJ4A 4R71A 4OI1A 2CMKA 2QRNA 2IYZA 2ONKA 4FINA 4BGDA 2GWHA 1U0LA 3D6TB 4IDHA 1P3JA 4U00A 3HP1A 5G3ZA 1TU3A 2X77A 1LV7A 4HB3A 3GQBA 3QG1A 4TYPA 1MO6A 5F69A 3GJ0A 2CHQA 1WE2A 4LDJA 1E1RD 4IHQA 1XJ3A 1E4YA 2CCJA 5CM9C 2ZI4A 3EIHA 1MT0A 4JMPA 1YE8A 4TT3D 3V00A 4OL0A 4BFWA 1N6KA 2JDIA 4BBUA 4P3YA 3EIQA 1KJYA 2FPKA 5CK4A 1AS3A 2G3YA 5F98A 1SHZA 4JS0A 1NBMD 1HH4A 2AXPA 4JLDA 3VMFA 1XMVA 2EFCB 1D9ZA 4US1R 2HUPA 3H86A 1X8KA 3PCRB 4DLTA 2NO9A 3TR0A 2RH5A 1QHHB 2NGRA 4HP4A 4JSYA 4AKGA 5KDLA 4L9FA 1IN8A 4PSAA 3A0RA 4KLZA 4M53A 4WL9A 1OKKA 1P62B 1OSNA 1Q57A 2BC9A 2QE7A 4A6XA 4MDEA 2ZIAA 4A8JC 2WMNB 4R2IA 5AWFC 1DG1G 3IQXA 3OIWA 3WNBA 3EPLA 5F3WB 2F9MA 3CNLA 1E0AA 4I39A 4PZLA 2RGGA 3VHXA 4Z51A 1TF2A 5CK5A 2AHOA 1EWRA 1HEIA 4ASUD 1CTQA 1Z22A 1G5PA 1SVWA 4MGYR 3WHLA 2BKEA 1YRBA 1G64A 1GSVA 1T1BA 3L0IB 3W5IA 3AKEA 1IY1A 2Q9CA 4XWOA 2I1QA 4LJAA 4RKEA 4ZV4A 1H65A 3R7WB 4DCUA 1F5NA 2QBYA 5G40A 5FPTA 3NBZC 1N9OA 2A30A 4P4TA 4BUJA 5BW8A 5DI3B 1HURA 4Q1FA 4NXBA 1BMFA 2HV8A 3T5GA 3P1JA 1LY1A 5EXXA 3F1OA 1VTKA 4L15A 4HDCA 3UE6A 3PVSA 1R4AA 2XNDD 5JBQA 4FD2A 5AUPB 2ZUCA 1N9LA 3NBXX 1P9WA 5L3VA 3BIFA 3DZ8A 1XMIA 5FPYA 1OB5A 3TE6A 2GESA 3K0CA 4Q9HA 2WWHA 3NBYC 2AWOA 3U7EB 4E07A 2D3WA 4ZCLA 1ZU4A 3KKPA 2OFWA 4H1UA 4KSCA 3DEFA 4H6JB 4ACBA 2Y8EA 2GCPA 2WSSA 3JVUA 4R38A 2XSZA 5FTKA 3X1YA 2ZI3A 3GLIA 1NBMA 4A2WA 3ZZTA 1LVGA 4BRWA 1GP2A 4QBHA 5G41A 3F1NB 1YZUA 3SYNA 2HYDA 4V03A 3K70B 2WIAA 2REXB 3TAHA 3BFXA 1JEEA 3UMRA 1P9NA 2RCNA 3OEED 4GZMA 1NJGA 3QE0A 3UG6A 4JGQA 1VG9B 2XTNA 2ZE6A 3O47A 4LYFA 3W5JA 3BWLA 1ZW6A 2BJWA 2GRJA 1N5LA 4MKFA 1CRPA 1IY0A 1Z83A 1YZKA 4JL6A 4XVUA 1NMYA 3BS4A 3A6PC 3HYRA 4EQ1A 1VCOA 1CJMA 4B2PA 2WJYA 5JWRA 1XD2B 4FMCF 3V9PA 4DB2A 4UNSA 2XGJA 1U99A 3B82A 3IILA 4BFUA 1CIPA 5JJLA 3E4PA 5KDOA 3U44B 1KHTA 1KO7A 3VKHA 4DCSA 5JCZA 2B21A 4HQAA 4Q9KA 3JZAA 4E5UA 2WIBA 4Q4HA 5CB6A 2BEKA 5JJIA 1BYIA 4BE7B 3I5YA 1N5KA 3CRW1 4MRVA 1FPMA 5GJWC 1X0OA 1FZQA 4LPKA 4US0R 4V02A 2QTHA 3GFPA 1VG1A 1FUUA 2VLIA 3GLFB 3AVYA 4E04A 3CWFA 1OTAA 2C9OA 5HKKD 1P97A 5EJEA 3MRSA 2F43B 3EZ7A 4DLUA 1XJ2A 2Q0HA 3K0EA 4AG5A 5J4KA 1GNPA 4NCHA 4D0GA 1ODVA 2R8RA 4M9ZA 5TVKA 3U6KA 2AD1A 3BB4A 4QL3A 2A3RA 4B34A 1OTDA 4JVSB 3D3QA 3OE7A 3PITA 2F1IA 4ZCMA 4EEPA 4GSYA 3VNVA 4LJ6A 3SFZA 1GILA 2GJ8A 2VYFA 1J7KA 1XCPA 3VU9B 1KAGA 2ECKA 5JECA 1G17A 3K0AB 2WAXA 1VG8A 4LRYC 1QHIA 4MGKR 4PTLA 3W6PA 4DDTA 3GLGB 1IY2A 4NU0A 1KIMA 2BCJQ 3HR8A 4Q5IA 4LHVA 3DOEA 4BZXA 2KSQA 4RJLA 2FU5C 2QWSA 3H84A 3F1OB 1U0JA 4A2QA 5B2ZA 1UJ2A 2JLUA 1V9ZA 2JIZD 3AVWA 3N5CA 3E2IA 4Q4JB 2YNMA 3KKNA 2NO0A 3Q5DA 4XOIA 4GL2A 4MYCA 3I92A 4BZPA 1GNQA 2DWOA 4AC9A 3CRVA 2EQBA 1P2SA 1E32A 1E0KA 1C9KA 2ZRAA 2ZVQX 5HDCA 2OWJA 2EWWA 3ICQB 4AKHA 5F5YA 4BFVA 1E69A 1CU1A 3AUXA 1HY3A 4B3BA 2F9LA 1AGPA 1M2OB 2YOHA 3LDAA 4PHTA 4B73A 2OZEA 3PQCA 4DLRA 4EPWA 5FH9A 4M2LA 2HEIA 4KJZA 1XEXB 1KOUA 2GK7A 3U2QA 3W3ZB 1H8HD 3RC8A 3RNLA 4TLCA 3M1IA 3QKSB 2FFAA 4RZ3A 5LBIA 3FC7A 2MMCA 5J47A 3QPUA 2DPXA 1MO5A 3NTUA 2BMEA 3T15A 4II7A 3K9HA 1MO4A 2W00A 2BCGY 3T61A 1G18A 4WW0A 3AF1A 3BB1A 3FKSD 3BFVA 4F4JA 1LSWA 2HV1A 2GZDA 2ZE7A 3GFTA 4WBSA 2EFGA 1OPXA 1KGDA 1TX4B 3MG9A 2Z6VA 1T3SA 3WNDA 4D4LA 5SZJA 4HIAA 4CGZA 3VR6A 4M4SA 4OQNA 1S4RA 4Q1DA 2E1RA 4IOKA 2ORIA 5TBMB 2RGNC 1E98A 2ZTSA 3BRWD 1ZM9A 3UWKA 1P2UA 2H5EA 5GJBA 3GEEA 1F6BA 2R65A 1N5IA 4Q1AA 5KNCA 2QSZA 2QAGB 2R6DA 2ZE8A 2HT6A 2ZS8A 4JLBA 1FL9A 2DB3A 4F3LA 1XXHE 4IRUB 3C5CA 2VEDA 4XTCS 3K1JA 3AH8A 2ZJBA 4L4UA 5DHFA 1CF4A 2JLQA 4DB4A 4NCNA 4MDFA 1XZQA 1TUEA 3HJNA 4CEJA 1Z28A 4I99A 2PEZA 2ZBBA 2XB2A 2VSFA 4OK5A 5C18A 1Y28A 1KI1A 5HDDA 3B13B 1A2BA 1JBKA 2YC2C 1ESNA 4PO8A 3KQNA 1OHHA 2IXFA 2H17A 2PZGA 3C2WA 3C14C 3A36A 3FHOA 4URVR 4C2TA 1R6BX 2A5FA 2EWVA 2C03A 3RC3A 2GXAA 2R6AA 1V5WA 4EIWA 2WTUA 5A0FA 4Q00A 2GBLA 1KSHA 4HLCA 4D81A 5H8WA 2DFLA 3WRYC 1GTVA 3LVQE 4TLBA 4B3XA 3SBEA 1GDDA 5JMTA 2JIZA 2KE5A 2QPTA 1J90A 4HI4A 1TUIA 4BLSA 3EA5A 4PPGA 2BHRA 3X1WA 1IN5A 2GCOB 1YVDA 1KOFA 1TQ6A 3SJZA 3SZRA 1Y3AA 1WB9A 1JQLB 5EXPA 2DWQA 5CLLA 1JNYA 5DKKA 2YWGA 4XSHA 3RS5A 1ZCBA 3SI7A 3V4RA 2ZS7A 5A8BA 5AUNB 3QUSA 4TL9A 1COWD 2C95A 2DYKA 3QJYA 4JVMA 1AA9A 2G0NA 2FH5B 5DN6D 1U98A 1HYQA 2ZAOA 3AVUA 2XJ4A 2XNSA 3GLIB 4Z8YA 4LJ9A 4C9BA 1AKYA 4DIDA 4MRSA 3AVVA 2PH1A 3FMOB 2WKQA 1FTNA 4CT5A 4JVNA 4N0DA 2V3CC 1T3HA 4US2R 2QP4A 2AK3A 3A1VA 1VYVA 3KKMA 1UAAA 1X8JA 2NG1A 1A4RA 1KNQA 4RCZA 2ZRNA 3A1UA 1AN0A 1SXJD 4PZZA 5CJ2A 1RRPA 2JLXA 2QTFA 1DAEA 1RRGA 1P60A 1DTSA 1TF7A 2J46A 2IL1A 1DP6A 5EE9A 4JYBA 2V0WA 2QN6A 5E3HA 4TL7A 2NMVA 4HLDA 1E2DA 5E7IA 3LIAA 1Z07A 1ZBDA 4ILEA 4W7SA 4WLAA 2O0KA 3ECCA 3LUQA 3I4LA 1PUIA 2FEOA 3L8YA 1RIFA 4IVPA 2QMUA 4QNMA 1AGRA 1GNRA 3HR7A 2WJJA 5FL7D 3WYGA 3B60A 3FVQA 3GJXC 4PKYA 2RGNA 3KJGA 4NKRA 1QHXA 3RS0A 3THXB 3V4FA 1KDRA 2VQSA 1PVOA 1XFNA 1FOEB 2CXXA 3LWNA 1E2EA 1OFUX 5KOYA 2V55B 3NXSA 3T34A 1KJZA 4B75A 3PHYA 5LDDC 2PJZA 2WWFA 3Q85A 3TH5A 3IEVA 1W0JA 2QNRA 3T12A 2GJSA 3E5HA 4NYJQ 1FUKA 2H8KA 4JGPA 2AK2A 3A4LA 4UNNA 4A1FA 5GVRA 2XXAB 2ZYTX 2OO7A 1LT0A 4DUGA 2ZUDA 2LKCA 3P27A 2QT0A 2OCBA 1Q1EA 2ZROA 2NTYC 2ZS9A 1DS6A 3PIRA 4B3FX 1XDBA 4Q4JA 3C5HA 4HI0E 1NIJA 2ASEA 3BY8A 3IUYA 1OT3A 2C04A 3IPXA 1UDXA 3OESA 3EX7C 1WDTA 2FFBA 4F92B 1IN6A 1RKBA 4TYWA 3SQXA 2N1BA 4JLKA 3IHLA 3RANA 4ASUA 3VE3A 2W0SA 3B8HA 3EIEA 4UNQA 2ZI7A 2KWIA 2WJHA 2CCKA 2HCJB 3DKPA 2J0UA 2D4HA 1CXZA 1LFDB 3ONWA 4TTPA 4E09A 3LYXA 2VLGA 4X8MA 4NE2A 4Q01A 4BRUA 3DM5A 1U81A 2QE7D 1W4RA 2JJ2D 1Z6AA 3QF4A 5BXQC 3QG5A 3K09C 1GKUB 2Z4RA 5IK2A 2ODWA 4LJYA 1GWNA 2PR6A 3A4NA 4WZBE 1KY3A 4NTZA 2CE7A 4OI0A 3P4XA 4M1SA 4GHIA 1FQKA 2YJTD 3GLFE 4XWAA 3UB8A 4YONB 4RQ9A 4P31A 1LTQA 3FMIA 3S1AA 1XWIA 3NJAA 2FPLA 1AS0A 4HAYA 4RD0A 1KO5A 1UBFA 5CYPA 3MWJA 1DAMA 3MQQA 2GDJA 2IC5A 3BE4A 4ZI2A 4DLXA 1EG7A 2H57A 2CEAA 5BQ5A 1NN5A 1XFQA 2CVHA 1OKKD 3LBIA 1TNDA 1UKVY 1YZNA 4BFZA 1NNEA 3ZQ6A 2GA8A 1NVUQ 4C7OA 3CLVA 2MMGA 5DI9A 3LIDA 3W90A 1Z6GA 3CZQA 4N3NA 5EZ5A 4DC9A 1Z63A 3FOZA 3EPHA 3SW1A 4RVCA 1JB1A 4GOXA 4D0LB 1Z6YA 1GIAA 2V54A 1MH1A 2BMDA 3O8BA 1UFQA 1U8ZA 2I1VB 2O8BA 2KX6A 4BECA 1FX0A 2W0NA 3WHKA 2D7DA 2J80A 3RLFA 1E1QA 1M1YE 2G9NA 3BERA 4BWYA 1LNZA 4I5SA 2ATXA 2J41A 3IHWA 4WIAA 5DISB 5SZKB 3U3JA 5L3QB 4LLOB 2ZJZA 1D06A 4GDFA 1N0VC 3DHWC 4KO8A 3QSYA 1KZGB 3U7HB 4XTRA 2NPFA 3ZS9A 2KJQA 1SZPA 4W9MC 4BEBA 4DJTA 2AR7A 1JECA 3P4YA 5F9HA 4BFYA 3I8SA 3PEVA 1XTIA 5AJWA 3AF2A 2QGZA 4OQFA 1BH2A 3Q3JB 2D02A 1RYFA 2V7QD 2ZVPX 2IWHA 3FKQA 2IS1A 3NKVA 2V9AA 5JWHA 2OLJA 3IIMA 2ZRJA 3U4QA 3X1ZA 4FMDF 3VFDA 4GOJA 4IDQA 3OIVA 4JKYA 5DH9A 3W6NA 3ZVRA 3ICYA 5AJYA 4M1WA 4TSFD 4TZ0A 4F7WA 3LD9A 3NVAA 3LX5A 1OFIA 2CLCX 2J0QA 4EW7A 1T1CA 1HUQA 4A15A 1ZJ6A 4PANA 5J5CA 1G9XA 1QVAA 2NPIA 1HT2E 1S0UA 4Q4HB 1D6JA 3R9IA 2FSIA 4NCJA 4I3IA 5AJXA 2QY9A 4M9QA 1F48A 1Z0DA 2G1KA 2GJAA 3IO3A 3QQ5A 2QBYB 2GF9A 4G5SA 4JBXA 4HLUA 1XXHA 2NZJA 4E03A 5IU1A 2GETA 3IGFA 5JRZA 1XEFA 3B78A 2ZOIA 4C0HA 5EXSA 3EPJA 2GCOA 4MN5A 2JN7A 3Q72A 4P4SB 4XIGS 2C5LA 2RGXA 4NL4H 5HZHA 3TSOA 4EDHA 1U8YA 2PYPA 2GAOA 3AUYA 5FOVA 4U5XA 1N6LA 3TLXA 1F98A 3KXLA 4QXAA 2HCBA 2QMHA 2VP0A 4Q47A 3ZQ5A 1I4LD 2ZJYA 5JFGA 3BOSA 4PQYA 4EERA 4JKIA 4NP6A 5HD5A 4YMTA 3AVTA 1VPLA 1EFRA 1NG1A 3FMPB 2C9CA 1ZVQA 2D2EA 1Z0JA 3K9NA 3ZD6A 4QJ3A 4ZIRA 5LPNA 1G19A 4JGRA 2BIFA 3AKYA 1D7EA 1E94E 4JT4A 2QP3A 1LF0A 1DPFA 3IKJA 4PPQA 1GAJA 1W36C 2IHYA 3C15C 1G291 3LQRA 1O3YA 1XCMA 1Z08A 2CNWD 2DWPA 3RDPA 3TSZA 4DUGD 1NVVR 1JAIA 2ANCA 2KBEA 3LXRA 4OHVA 2WBLC 3GLHE 4XD7A 2H16A 1OT6A 2F7SA 1NN1A 2R6CA 4G3XA 3CR7A 1HQYE 1A7JA 1W4AA 5JWOA 1E1RA 2B8TA 3NHBA 5GJVC 3OHMA 2GILA 1OIVA 2J87A 4BLPA 4MYHA 3TNFA 1ZU5A 3AP2A 1E2QA 1XJ4A 1GITA 1KSJA 3CKLA 2BBOA 3SNHA 3KX0X 1N6IA 2RAPA 1Q0UA 1Z06A 2HDNB 4QHTA 3TBKA 2VV7A 1HQCA 1ZP6A 3PV0A 1R0YA 3Q5EA 4G5QA 3E4OA 3IS2A 1S4SA 1FP7A 4GS9B 3CLOA 1W0KD 1NN3A 2C78A 6Q21A 1N6OA 2OBNA 4DBLC 5L3QA 1GG2A 1N0WA 3ASYA 1CJTC 1S2MA 4O25A 3LI9A 4B35A 4FWIB 4OYHA 1VB6A 4MRRA 5FOSA 2IBMA 4Q9LA 2A5GA 3K70C 4C0QC 3EW9A 2BBWA 1GSWA 4B43A 2A78A 3UATA 5IK2D 3QXXA 2PMKA 3K53A 2X1VA 3BY9A 1EX6A 5B58C 1Q1QA 1MRNA 4URZR 4EPRA 4ZDWA 1NSFA 3UMEA 1HE1C 1MO3A 3C16C 5DLQC 4DWJA 621PA 1A82A 4PO9A 2QMOA 4LV6A 4KUOA 5J4LA 2QHKA 1CR0A 2ZI9A 2PJRA 4BPBA 1TU4A 2QAJA 3K70D 4OK6A 2OFXA 4K81B 3VAAA 3VQTA 2CK3A 4JZKA 5JHHB 5DYGA 5K8TA 1G7RA 1QHHA 1EWQA 2XOKD 4DSNA 2BJVA 2VH5R 3D8BA 4LBWA 3F5FA 4HB0A 1II8A 2F6RA 2AFIE 2OBMA 1TPZA 2H28A 2GZHA 1WBBA 5H1YA 4GHIB 1FQJA 3Q8XB 4B3CA 3PEWA 1VDZA 1F3OA 4QBIA 4W5HA 3GLGA 821PA 4LYAA 1R0XA 4HH3A 1OXUA 2NO6A 4GFDA 4EFNA 3THWA 1GFIA 1T0HB 2WPDA 2CL7X 5EXTA 3KUDA 2YWEA 3I8XA 1RRFA 4LI0A 4R9UC 4N0EA 2ZYWX 1F2UA 3P7NA 2VA8A 1X1RA 3E70C 4I1UA 4R7ZA 1S1ZA 1T8UA 3FB4A 3TW8B 4FMBB 2QU8A 4HDOB 4EJSC 2PD7A 1OB2A 2REBA 4CEIB 2XB4A 5KHOC 4M1YA 3LW7A 3ZYCA 2ODBA 2VP9A 1L4UA 3K9GA 5LD2C 1X6VA 3ZS8A 4YMWA 2YKHA 2JLRA 5EE5B 5LB4A 2IK8A 2YV5A 1R8SA 1ZD9A 1KK1A 3HU1A 4P4UA 5GVSA 4HB4A 5ANRB 3S1AB 1EXMA 2X2EA 4UXHA 2ZPTX 4M1TA 2AXNA 2Z6CA 1TL7C 1Z2AA 4WZ6A 1II9A 2W6ID 3NDPA 2ZI5A 4GT1A 1NBME 2ZRGA 3PEUA 5BWMA 1VKJA 4HATA 1S9DA 1E96A 2A5DA 2VHTA 5AK0A 4BFXA 3CX7A 1VECA 2QI9C 2DFNA 2BVNA 2ERXA 4IOLA 4Q7KA 1N6NA 1OTBA 2GKSA 3MSXA 4LYHA 2C8VA 4B3DA 1G6OA 3TSWA 3L0SA 3U3MA 3T35A 1MABA 1OE0A 8OHMA 1BIFA 4WA7A 4XVQA 3QBTA 2PR5A 1DOAA 3VX4A 3F1NA 3C7KA 4YDHB 5CIQA 4ARZA 1GUAA 4HJ6A 3L0OA 3EWKA 4OHYA 4MA4A 3CF6R 5EE3A 3TUZC 1BO6A 3ADDA 2BDTA 1KKMA 1KI8A 4QRHA 1T9HA 5FL7A 4ZDJA 2MSDB 4TQ9A 1OH5A 1OH8A 2GBLC 2IYUA 1NVXQ 4KFSA 3LFUA 4D4KA 2PX3A 4RD6A 1DAGA 1JALA 2QRZA 3DMNA 2AKAB 1G1MA 1F60A 2JASA 4HJ3A 3CNOA 4RSGA 3BBPA 4TMZA 4B44A 2ZRCA 4TMXA 4A0GA 4IXNA 2FDCA 3A1SA 3AGQA 3BWDD 1KI4A 2ZRMA 4YMUA 2IXEA 4HJ4A 3MFYA 2ZXUA 3FPAA 3GEHA 1NRJB 2WAYA 4HUQA 2VF7A 2O8FB 2GEDA 1CJVC 1G4UR 3FWYA 3QENA 1W48A 3E4QA 1ZM4A 3B6EA 2XAUA 4RY2A 2QAGC 3O8DA 2ZR9A 3CRMA 3NOUC 5J7EA 1JJVA 3GMTA 3KTAA 4GMDA 4GMXA 3IIKA 1WMSA 5IT5A 1JXMA 2IYSA 1W44A 2BKUA 1LB1B 4EPVA 5TARA 3FYHA 3GJ8A 5AJZA 2OWHA 1E9RA 1I4TD 1W2GA 2IHBA 2F3TA 2HLDD 1IJEA 1A1VA 2V0UA 3KJIA 1AJEA 1RFLA 2YVUA 3DDCA 2X19A 3QIAA 3R8FA 3THWB 2FOLA 2OOLA 5DN6A 1ESMA 2VL7A 3A0VA 4LPZA 1U9IA 1TS7A 3KZ1E 2IS2A 4TMVA 5F2EA 4JT2A 3AKDA 4OQXA 4PR0A 1FTSA 2GHIA 2JCSA 2OV2A 5FUYA 3LIBA 1Z0AA 2K7SA 5BYJA 3T50A 3NIBA 1CR4A 3TGPA 2V4ZA 4ZDKA 2JEOA 4AWXA 2QROA 1JEDA 2VEAA 4A0FA 2Z83A 4TWZA 3TQCA 4EKDA 1IBRA 1O87A 4QHSA 1S1YA 4X8LA 2N46A 1KMHA 3QXHA 3KKOA 3I62A 1T5LA 2VHJA 3VR2A 1OT9A 5KIZA 1ZNZA 2YC4C 3J81k 1AQYA 4PSKA 4YXWA 1XBTA 3B9PA 3LQQA 4KYIB 4AYTA 3KXKA 1GZSA 1JPJA 3SYLA 4L16A 3G6OA 4LWZA 4TN1A 4D25A 4LC1A 4ZKEA 2Z43A 4NXGA 1G28A 2O0HA 5AVEA 1UEIA 4TMKA 4AURA 5CIWA 4DXAA 3HU3A 5HPYB 2O8CB 3QPWA 1E6CA 4EJSA 4C7OB 1BS1A 5DYIA 5DJUA 4QOSA 1W0JD 3RHFA 1RC8A 4XSGA 1T18A 2L0XA 3VTKA 1Q3HA 5AJVB 4NCIA 4JLJA 2A24A 5JHGB 2OEPA 1XZPA 1C4OA 4LHYA 2FJUA 2GK6A 2R62A 1OJGA 1R10A 3ZVNA 1EX7A 3FE2A 5JEDA 2GJKA 4BZQA 4ZI3A 5IF9A 3I73A 3O8CA 1E99A 5EUQB 3WNCA 4MN6A 2P5SA 1H8HA 2GNOA 2O52A 3TIFA 5CITA 3U5ZB 3FHTA 2W0MA 4HB2A 1NG9A 1SKYB 1Q20A 3QI2A 2PL3A 2Q21A 3DM9B 1D2EA 4KHZA 4JBWA 1XMSA 3CF0A 5C2JB 2BWJA 4AYWA 4C3ZA 1IN4A 4YDSA 2XSZD 1DELA 4L8GA 4GZLA 4FWTA 1P2TA 2O5VA 5FI1B 4DEXA 2P6NA 2FSGA 1XXHB 3CIOA 3UB7A 1J8YF 2ZYUX 3IO5A 5EE0A 4YMSA 2V6IA 5L3SA 3KUCA 2J0SA 4WF0A 3B1YA 4JLPA 1GRNA 4GCZA 1KI9A 1NLFA 3LICA 1G7TA 3NC0C 1E2KA 4FCTA 2CBZA 3SYKA 2BASA 3EZ9A 3ZQJA 2ZRPA 3FGNA 2YYZA 3BH7A 4B71A 2QQ0A 3LV8A 4C2UA 1ZAKA 4OQMA 4URUR 3UMDA 3OAAD 3FDIA 4U02A 2PZEA 3SE0A 1XF9A 1S3GA 4EQ6A 1KAOA 2OLKA 4LYJA 1RJ9A 1HE8B 4DCVA 4FW9A 2AX4A 4O2LA 1BOFA 2N42A 4S2EA 1E2NA 4KBGA 1S96A 3R9XA 2Z6DA 4XWKA 2PCJA 4I1VA 2F1HA 4FMCB 4D82A 1UF9A 2ANBA 2QTVB 1HTWA 2FF7A 5G53C 3CW2A 1XTKA 2J9RA 4BLOA 1ZYUA 4Q7MB 2IUSA 1RPZA 3DVLA 2AD5A 2SHKA 2WZQA 3MGCA 2JJ1D 3QVUA 5KSOA 3UPUA 4LV8B 2P0EA 3UXMA 4AD8A 4L9SA 4NHOA 2J59A 1KK0A 4EQ6B 1F2UB 1NI3A 1Q21A 1KO1A 4DLZA 3EZFA 2G6BA 2GEVA 3MWKA 4PO1A 3PR1A 2EYUA 1W2HA 1M74A 4ON9A 5FOWA 1TMKA 3ADBA 4B6FA 3SHFA 1NVWQ 2QT1A 2VP6A 5E7JA 5FUXA 3THYA 2QJ7A 4YC7A 1PJRA 1OH7A 4P4SA 4D26A 4B9OA 4TSFA 1P6XA 4TZ6A 2QSYA 1XJ0A 1XNJA 5AR1A 4P0TA 4TMTA 2OE2A 3EZ6A 4KFUA 1N3BA 3AB3A 4PHFA 4Q7LA 5HCIA 2DY1A 2EFHB 3B1XA 4PZYA 2WOOA 3REGA 3VKWA 2OCPA 1LSVA 3CPEA 4RD4A 1QVRA 2OAP1 4U7DA 3F1PB 3A1WA 1R0WA 4DSOA 1DP9A 3QKTA 2J7PD 2Q6TA 3TVDA 4URWR 3SDZA 2C99A 1JXOA 2GZAA 1E2GA 3GLGE 2PMDA 1E2IA 1NY5A 2BM1A 1IQPA 3AVQA 4IEEA 4TMWA 1UDWA 4OI2A 3VR3A 5KSYA 4RKFA 3C4JA 1TS6A 1CKEA 4RFSA 1CBUA 2OHFA 1G8PA 5CYOA 5C1BA 1QHNA 2X8AA 3W3AA 4BBVA 3GECA 1KKLA 3LBNA 4FXPA 1SXJA 2D2FA 2RGBA 4V0KA 5J3WA 2ZU6A 1WBDA 2Q3HA 4KODA 3I5XA 1E1QD 5UKDA 5J4YA 1NSTA 3ICEA 2IYYA 4MQBA 3KQUA 3RSOA 1AKEA 3H7WB 1A2KC 1JJ7A 2VHUA 1G16A 4GP6A 1F2TA 5FL3A 2C96A 2JJ8A 4M1KA 4YLGA 5FOXA 3U44A 1ZNXA 2HJGA 3AKCA 2VSXA 2AFHE 3U61B 2WV9A 2D74A 1R2QA 1UKYA 4ZCIA 4MRNA 5J40A 3M4YA 3UIEA 5KYKA 4A36A 5G4ZA 2QP9X 5KUTA 1XP8A 3EC2A 4HAZA 4LJ7A 4TL8A 5HTKA 1TQ2A 3CRRA 2OBLA 2ATVA 3KX2A 4JLAA 4PHGA 4DLWA 1EFTA 3LIEA 4JLMA 2VV8A 4KYUA 4QGGA 1TQDA 5FPHA 521PA 4HY8A 5I5LA 1NMZA 1NIPA 1Z3IX 2JLWA 4JL8A 3W9YA 1G6HA 4B74A 4TLAA 5DIFA 2HXSA 4UJ3A 1UBEA 1JR3D 4V0OA 4DJ2A 4LJ5A 2B92A 1Z47A 4M9XA 4FIDA 1TF5A 4DKXA 4M4XA 1QHYA 2OILA 5EP2A 3CH4B 4DIEA 5TV2A 4Q4AA 1EW0A 2A5JA 5FBWB 1T1AA 4GW9A 1ZCAA 4LY6A 2R78A 1SVOA 4FCVA 4QBGB 1SXJE 2PT5A 3LY5A 2FE4A 4UNPA 2CLDX 3NOTC 2XOKA 1CLUA 2ZE5A 4OI4A 4Q9IA 4JLOA 1G20E 1E2LA 1N9NA 1VIAA 4L5BA 2RHDA 1IM2A 4LBYA 5FBVB 4KXFB 4G01B 1P72A 4KVGA 5KTYA 5JLJA 3T5DA 1KDPA 3IBYA 1YRAA 2EA9A 3B2EA 1VHLA 3DPUA 3RWOA 1NF3A 2B7BA 3SJBA 1E3MA 2EU8A 2ZR7A 3EARA 1HA3A 1TQ4A 1ELOA 4MGIR 4RFVA 3H82B 1OIWA 3WBKA 1WA5A 3WP0A 5LB2A 3ZVMA 1NP6A 1TADA 3IIJA 3K8YA 4N1AA 3N2IA 4CIDA 3CO5A 3EEHA 3THOA 3DOFA 2GJ9A 3DKVA 4QBFA 3CM0A 221PA 3FMFA 1NJFA 4DEYA 4HP9A 4LOAA 4O2RA 1JR3E 5BN3A 3U3KA 3K0FB 2V7QA 4NH0A 3LLMA 2IEYA 2B6HA 4KFTA 4EESA 4H6JA 2DFTA 3RABA 1W5TA 2Q9AA 3CF2A 3BD9A 4RCYA 1N0UA 1DAKA 2WKPA 3ULFA 5FBRB 2R6GA 4RFSB 3L8ZA 3EWAA 3W8NA 1Z29A 4KQDA 1SKYE 5TMPA 1QHGA 3BB3A 1FNNA 2J7KA 2DHRA 3ETLA 5TB5A 3F0TA 2B02A 5K8LA 4LSGA 3SHWA 2VP4A 3RRMA 4BFSA 3AV0B 3K0FA 4BBTA 3CBQA 4RZUA 4ITRC 3KTAB 3TAUA 3IEUA 1QBKC 4PX9A 3KB1A 3REFA 5DNYB 2FFQA 3NHQA 2FV8A 3C8CA 3PUVA 3LX8A 2EYQA 3KKQA 2LWIA 2V1BA 2CL0X 2MSCB 3B1ZA 2QL6A 4QJ4A 2Q3FA 4HEJA 2ERYA 4HNBA 1TTTA 3D72A 2CHVA 2H1LA 4GRAA 4KVAA 1G3QA 3LA6A 3U7GA 2O8FA 5HDSA 1KMQA 4A8JB 5B57C 1W36B 1NKTA 3GD7A 5FPKA 1M6NA 3MFXA 1X8LA 3OEEA 4I3JA 1G8YA 1S66L 5KNDA 3ZGXA 3CPJB 2RGEA 2FZLA 5C4GB 5IS1A 2WWYA 1KI3A 2KDKA 2G83A 3IBRA 3W6OA 4RZ2A 1E0SA 3WYAA 4LV5B 4M22A 2IXGA 4B32A 4LRZE 5DGXA 1G7CA 1KDTA 3ZJYA 5JRJA 4TTQA 1OYYA 3BJIC 3QBVA 1A5TA 4HAXA 5F68A 3OZXA 1CJKC 3PJRA 2JAQA 3H1TA 1KJWA 2CE2X 4AG6A 2JJ2A 4MH0R 2EFEB 4X8OA 2WWIA 1C1YA 3ZIAA 1CR2A 4E22A 1GVNB 3H0KA 2CCGA 2QGNA 3PFIA 2CMNA 1J70A 5KO2A 2O8EA 2WJGA 4XT2A 5HKKA 4L9GA 1S9HA 1XEXA 4LHZA 3KQKA 1P9RA 4R2HA 1E79A 1DADA 4R70A 1P5ZB 2R9VA 3I3SR 2P7JA 1UBGA 1CRQA 4EJSB 4HDQB 2KBFA 1XJQA 4GNKA 2YZ2A 3IBGA 2XITA 3B9QA 4BLRA 2IYQA 3DZDA 4WOPA 4AY2A 3I72A 4QGAA 1IONA 1GSXA 4QGHA 5JSZA 3TUIC 4ZIRB 1OYWA 1NL3A 2ZRHA 1G7SA 3GLHA 3NWJA 2VIIA 4Z8XA 1LSXA 3P20A 2F55A 3WRXC 2V1UA 4LBZA 5E4FA 4PHHA 4L9EA 2P3SA 1BYWA 1W47A 4LC0A 1KSFX 1AQUA 2JLZA 1ZNWA 2IF0A 3RSLA 3TUJC 4Q18A 3QEJA 2NO1A 3GEIA 5B64A 4ARZB 1P75A 2H7VA 3NH6A 2QG6A 1YR6A 3PUXA 1RZ3A 3VE4A 4M9SA 3SU8A 4DZZA 5CDFA 1P2VA 3MR0A 2ODNA 4I1OA 4C0LA 1E9SA 4B33A 1YR7A 1DE0A 1JPNA 4EPTA 4NCKA 1ZRHA 3RH8B 2RMKA 3EAQA 2F1RA 5CM8B 1P0ZA 3CPHA 3KXIA 2OT3B 1IAQA 2L4RA 4WN5A 5E7MA 4LRXC 5EZ6B 4MGZR 1HV8A 1GOTA 1OXVA 2AWNA 3U4QB 3CX8A 2XTZA 1KI7A 1KDOA 2VHQA 4D4MA 5FUVA 1GM5A 1SQ5A 4PQFA 3T1OA 3CWZA 3QXJA 1YU9A 2VBCA 4B6EA 5KPDA 1S1MA 4R98A 4BASA 3R8CA 3BK7A 3B85A 3EPKA 4PC2A 1XTJA 4HHDA 1EK0A 4Y0AA 4Z54A 1H8EA 2JHEA 4HOIA 2JJ1A 4ZPXA 5FBQB 2OAQ1 4HUQB 4A0RA 1GKYA 1S1CA 3I32A 3GLIE 2WHXA 1GRRA 1HT1E 1TEVA 2PLRA 5FTMA 4GS9A 2LCFA 2VTKA 2JLYA 3G0HA 2YHSA 2ZSBA 4PAMA 3NC1C 1SVLA 3JVVA 2INWA 1RW4A 1NY6A 3AGPA 1ONBA 3ZD7A 3A0SA 4AI6A 1I2MA 1WXQA 3FTQA 2QQEA 2ONJA 3X2SA 2JLSA 4URXR 1E9BA 4Q1EA 5K8IA 5J4VA 1ZUIA 1EFHA 2RKOA 3B1WA 4PC7A 3UANA 3T1QA 1K5DA 1XPUA 1L7VC 4HZUA 4K8OA 3RRNA 2BBTA 4WUJA 3FFAA 3GCGA 4G5OA 1Z6XA 4A4DA 1CS4C 4KFRA 5IRCD 2IWRA 1Z8FA 4OBEA 3UKDA 3HU2A 2W6JD 3BAFA 4IKEA 5FTLA 4DJ3A 3HPQA 3A1TA 3MWLA 4QFMA 3TR5A 5F9FA 1BMFD 3RS7A 3AP3A 2W27A 3AVOA 3DMDA 4V0MA 4JLVA 1VCIA 1T8TA 1ZC4A 4I38A 2ZR0A 3EA0A 2W2TA 4PPFA 5TDHA 3MWYW 2WM9B 5HCNA 5G3YA 1XEWX 1YQTA 1ZINA 1N6PA 3QKUA 4KU4A 4QC2A 5IDVA 3ZVLA 2WJVA 3OAAA 4X8HA 1KTVA 3GLHB 1ZC3A 1JR3A 5JEEA 3OFNA 1SXJC 2VP2A 1E9CA 1QDEA 5IHPA 3PUYA 3MLEA 3SN6A 1DO0A 3KQLA 1UWNX 4M1OA 3LH5A 2HYIC 3QF7A 5FR1A 4EAQA 3OEHA 1LF5A 2RGDA 3ADKA 4MKHA 2TMKA 4B47A 3AVPA 1X1SA 2QPOA 3L43A 1ANKA 5ELXA 1F2TB 1UPTA 2LKDA 1N2CE 2VPPA 4QNRA 4F4IA 3BH6A 4R6LA 3AEZA 1N6HA 2FNAA 5KU1A 2G0TA 1RVDA 2UZIR 4AKIA 1T5IA 5G4YA 1SVMA 1GSIA 2OCYC 1US8B 2O8BB 1DAIA 1KI6B 1U0HC 4IDPA 4Q66C 3H7WA 2VHCA 2CHGA 2YINC 3G5UA 2A7QA 2IEZA 5JI3E 3CB4A 2RB4A 2REOA 4ZDIA 2GVZC 2ZUBA 1Z2CA 5L8VA 2ZAMA 3NHAA 1NMXA 2VSOA 3RWMB 3SOPA 1KY2A 4W5JA 4ACAA 2O8DA 2W58A 1WP9A 3BORA 2V9PA 4JLNA 3SJCA 3I61A 1K6MA 4D2IA 1M7HA 4O3MA 1XU4A 1YZLA 1SVSA 4C4PA 5J4EA 3GPLA 1E79D 1UKEA 2IX3A 3ND8A 1FW6A 1JR6A 4AK9A 4ZKDA 3WMFA 3KFVA 2G88A 5L3SB 2R2AA 3MXQA 4WAUA 4V0LA 3K09A 3PUZA 1IOZA 3KB2A 4NZYA 2J45A 2CL6X 3R20A 3M6AA 4A92A 4EFMA 1S8FA 4CZ2A 1E9DA 2FSFA 4P32A 1U94A 2ZRIA 3CWQA 3H82A 1E2PA 1CJUC 3GJ5A 1KO8A 2ZJOA 2GXSA 3TJZA 4IDOA 1K8RA 3QOFA 1EFRD 2EFDB 3E1SA 1NWZA 5DJTA 3WXMA 1XCGB 4B2LA 3VHLB 5JSZB 3QNUA 2ZRBA 2A5YB 4IW3B 3CONA 2YWHA 1PLJA 3QXCA 2CK3D 3SR0A 1FP6A 4EEUA 4B76A 2XJ9A 1NVVQ 4Q9JA 1ZD1A 5F6AA 3PENA 4L9WA 1EGAA 3VR4A 3A4MA 3AM1A 4DCNA 4FN5A 2ODEA 5FUWA 1W49A 2WICA 1EESA 3TQFA 3QPVA 3EZ2A 2Q3MA 3DL0A 4KITB 2KB0A 1FFHA 1DP8A 1FNMA 3THYB 1J8MF 3LW8A 4TYNA 4Z1MD 2ZRFA 2VF8A 4PSVA 1S67L 2W2XA 1T3LA 1G4AE 3ZZUA 2BM0A 1P4SA 1N5JA 1KMHB 2OSBA 3SS8A 5BN5A 4M21A 1XB2A 3RAPR 4C0KA 1GL9B 1JQJC 3SC3A 1MZUA 1P7CA 3UK6A 4BLQA 1G8HA 2P6UA 2QJ5A 4P33A 2QKPA 2VV6A 1WRBA 3RS2A 4QHYA 2GF0A 2F3RA 3GDIA 5P21A 2J0UB 4CT4B 1PLLA 4HLUC 3FFBA 1FX0B 4CYMA 5GJCA 1ZIPA 1G8FA 1GL7A 3OIYA 1IXSB 2XZLA 2OG2A 4Q1CA 3BGWA 2YKGA 4C0JA 4LRWA 2E87A 3K3DA 2O0JA 4AYXA 4ABYA 3KFXA 1IN7A 4K46A 1GL6A 1AZSC 1E9AA 1CR1A 1ETUA 4JIMA 4NYJR 1LL8A 3N70A 2ZITA 4TQAA 4DLSA 4CF7A 4BFTA 1WF3A 5HWVA 1QG4A 2V1XA 3MAAC 3WMGA 2DR3A 4A2PA 4TL6A 1ZMXA 4MRPA 3FG8A 1V9YA 4B2IA 2ZJ2A 2I4IA 1LS1A 1RYHA 2K5UA 1Q44A 1WQ1R 2FFHA 2QEQA 4UKDA 2A24B 3NH9A 3Q9LA 2W2VA 1XPOA 1G3IA 4Q4LA 2O8CA 5HWTA 2V6JA 1OIXA 5FFMA 1KO4A 3QVVA 1KZ7B 1VCMA 2IUTA 3T1TA 2QM7A 4V0NA 4HLQB 4UNRA 1W46A 3GJ6A 4HZUB 1U9IC 1J2JA 5SZIA 1IXZA 1ZM2A 2J7PA 4F3LB 2IYRA 4B48A 4M1MA 4NMMA 3TVTA 4LZZA 3RS4A 3LO5A 3HPRA 1SVKA 2BV3A 1M7GA 3PUWA 4OHZA 4F4CA 2NQ2C 4G0NA 2P5TB 4FMDB 4H9GA 1YZGA 4TYYA 3AF4A 3B7GA 3A37A 4JJZA 2A2ZA 5DE3A 4PQRA 4EPXA 2QORA 3BH0A 5FTNA 2ZQ5A 3LI8A 2GXUA 2QMEA 3R7WA 1AIPA 1XX6A 1G8GA 3ZLJA 3W34A 1DVRA 4ESHA 1CEEA 4G5RA 1YJ5A 2L0WA 4F91B 2QM8A 5KDDA 3OE7D 1II8B 3MJRA 2FZ4A 5A5GA 1DO2A 1YZTA 4TLEA 5DI3A 5E95A 1B0UA 1VG0B 5H70A 4PAQA 5EP3A 1LW7A 1F9IA 3LVRE 4HAWA 2CJWB 2ZSAA 4A9AA 1MRSA 4XT2B 1M8PA 3U3OA 1SULA 2J5XA 2XX3A 4GPTA 1P61B 5JZVA 2X2FA 2OM2A 4MYUA 2ZJ5A 3UB6A 1PZNA 5HR5A 4GOKA 4MUBA 3WMEA 4OQLA 1E9EA 1W1WA 1ZNYA 4I4LA 3AF0A 4UQOA 5HSQA 2FGKA 2C9YA 1DRMA 3ZIAD 2Z4SA 3ND9A 1OF1A 5KSPA 4QGFA 1U90A 5KSZA 4F38A 2DBYA 1OFHA 2D06A 4C30A 2QA5A 2F1JA 4ERNA 1G5TA 3F1PA 1XTQA 4IOMA 3MQOA 1DEKA 2J1LA 1MOZA 3IDQA 4JSTA 4D4JA 4CEHB 1SKQA 2BEJA 1S3SA 4PPNA 4CEIA 5AVFA 3CZPA 1TEXA 4OJQA 1NLYA 2VP5A 2J3EA 3U60B 3VOLA 4I1SA 1G21E 3ZDQA 1G5RA 1ZD8A 2HJVA 4NPHA 3HDTA 3QEOA 4IEIA 3NG1A 1BKDR 3MCAA 3TMKA 4LPSA 5BYKA 1N25A 1FMJA 2KI5A 1SHKA 1XTSA 3MJQA 4WXRA 2PLFA 1L2TA 2IS6A 2R6FA 4EETB 5EFWA 2UKDA 4NYMQ 4ESVA 1W36D 1UBCA 4LUCA 5EP1A 5AUQA 4W5WA 5FR2A 1KNXA 3T1VA 3UMSA 4RD1A 4DDVA 1ZM7A 1OW3B 4JL5A 3OF5A 3BC1A 5CJPA 3WP1B 4AKEA 2HT1A 2IYLD 1XJ6A 5JCPA 3X1XA 2I3BA 1UKZA 1MABB 1R5BA 2P6RA 1OXSC 4NDZA 2E9SA 2JDID 3L0PA 3ADCA 2YOGA 2FN4A 2YOFA 4MITA 5TXGA 1TS8A 1X86B 721PA 3M0EA 1G41A 2PCLA 3PG5A 1VCNA 4LHWA 1N6RA 4OJKA 3U3RA 3U7FB 2Q9BA 1ZUHA 3AQ4A 2FSHA 1XJCA 3EASA 4Q1BA 2XZPA 1XTRA 3RVBA 3NDBB 2FWRA 3GLFA 1PLKA 3L82B 1COWA 4J0QA 3BXZA 4I3AA 4R3AA 2CLSA 2WWXA 3KDSE 1IXRC 1GKIA 3OEHD 4IOJA 3SJAA 4DHEA 2OUKA 3QY0A 2FGJA 2V8OA 3R9WA 3ASZA 4RZXA 1R0ZA 4DLVA 2QAGA 3AF3A 2FA9A 1D2NA 2XXAA 3H9WA 2RGAA 5TBMA 2IYWA 121PA 2V1AA 1QHSA 4HAUA 1U2RA 1Z0KA 3GJ3A 3QKRB 4CW7A 1XRJA 4M0LA 5K8UA 2G77B 1T6NA 1B23P 2AL7A 3NEYA 4DT1A 1I2DA 4HSEA 2DFKB 4KAXA 4LHXA 4PC1A 3I1FA 2ZETA 3CH5A 3HJKA 3IPYA 4PFSA 4B3GA 1RJ9B 3U6BA 1XMJA 4JGOA 4WVFA 2IYXA 5D3MB 2D01A 4QKQA 1T91A 4A82A 3OLOA 4KI0A 1SGWA 4FCWA 4IDNA 1VMAA 2ORVA 4OHWA 2CDNA 4UXJA 1RE0A 2UVQA 3A58B 421PA 2M1CA 1KYIA 3KJHA 4CDGA 4C0SA 2WMOB 3CNNA 3AVXA 3VNUA 3ZZ0A 2G1JA 3VR1A 4HAVA 4PC3A 4XVRA 2GJ3A 4G5GA 5H68A 3HYTA 3EWSA 4NXFA 4IFBA 2AKYA 3SBDA 2HLDA 1Q3TA 5EUMA 4CEHA 1XD2A 1D5CA 5LD2B 1XD9A 3JZMA 1KK3A 1V43A 2ZSFA 1OHHD 2PD8A 3MUFA 4QJ5A 1ODFA 1Z6TA 2EW1A 2RGCA 2ZI6A 2ZM5A 2BBSA 5HE8A 1G3UA 1Q22A 1OJLA 1M7BA 4PC6A 3D7MA 4PKYG 3CX6A 3QF4B 5HE9A 1E2MA 2HF8A 4EXOA 5DKLA 3PEYA 1S4QA 1D8TA 1VIYA 3WY9A 2XTMA 1MV5A 1IHUA 2J0VA 4EFLA 3CAXA 4Q48A 5JI2E 5AUOB 4NYMR 4LX0A 4DSUA 1XEWY 3FKSA 2AN9A 1WA9A 4JVLA 1GRQA 3RS3A 2QZ4A 2WJIA 2IW3A 5B30A 1G3MA 5EP4A 2P67A 1QRAA 4DDUA 1DARA 1DBSA 3W8RA 4DVGA 3SFVA 2Z0MA 2ZEJA 2ZRKA 3UWOA 2I9VA 1ZIOA 2OESA 2PBRA 2RHMA 2WOJA 5M04A 4NBSA 4A0HA 4Q7JB 3MMPA 4Q19A 3IS2B 2DCUA 2IUUA 2IS4A 4BEJA 2O8DB 2NOAA 4XJXA 5EQTA 5FBLB 4EUNA 3X1DA 2HF9A 2ZJAA 1Y63A 4Q21A 4TLDA 3PXGA 4NXEA 2D62A 1YHNA 3DO6A 1DG3A 3WYFA 1US8A 3A8TA 2PYRA 4RD3A 4S35A 5DO9A 2HXYA 1XD8A 3RYTC 3TRFA 2C77A 2JLVA 3K0CC 2PZFA 3AP1A 2CJWA 3C8UA 4YWZA 2IA5A 4MUAA 1II0A 4DDWA 3LAWA 5BN4A 5FTJA 5SZHB 1JNUA 2PDRA 1AM4D 1EFUA 1NLZA 2ZYVX 5HD3A 2IF2A 4GP7A 3T06B 1P73A 1KK2A 2OCAA 2P2LA 3EG5A 1OXXK 1VYUA 3Q7QA 1DAFA 4AIIA 4CEJB 3VR5A 4JBYA 1EFCA 1AS2A 1CULC 1OFTA 1R5NA 2Z5FA 3KL4A 4Q4AB 5L3RA 4UJ5A 1UADA 4TTRA 4KV9A 4BLTA 4YXWD 2B8WA 1PV4A 2ZJ8A 4V0ME 5CDFE 1L8QA 4Y0VA 4D80A 4KLNA 1YKSA 5C4MA 3K3CA 1CP2A 1KI2A 4K08A 2JA1A 3BFKA 4MYTA 4OHXA 3SEAA 2XZOA 4DT1B 4A8JA 5CB8A 2GAAA 3SQWA 2WVJA 2UZ3A 4HYYA 1OTIA 2WSMA 4NYIR 5J4HA 2C98A 3EXAA 2L1MA 5JS7A 1OTEA 1UEJA 2W6JA 1W4CA 5FOUA 5DHAA 2ZANA 4PXAA 1OLOA 1I4DD 2H18A 1Z0IA 3KQHA 1E4VA 2GVDC 3K9LA 1AK2A 3TW4A 2FMXA 2QENA 3UG7A 2BMJA 2IYTA 2PEYA 1MR3F 2YWFA 1TS0A 1UM8A 2FPMA 4OK3A 4LBVA 1ZUNB 1R8QA 4IVRA 1OJ5A 2YKFA 1XPRA 1E9FA 5KNBA 1AZTA 1Q1BA 4MKIA 1M34E 3N2EA 2C2HA 3VX3A 3PYPA 1YR8A 2ORWA 2XEXA 1TAGA 4HH2A 4MKGA 3WBJA 3K0SA 2MSEB 2ZU0C 1OH6A 1R5OA 1W0KA 4G1UC 1J99A 2IYVA 4JJKA 5FI0B 4DSTA 3H4MA 2WWGA 1E2HA 2OXRA 3GJ4A 2D7CA 4NONA 5C46F 4DCTA 1VHTA 2FX3A 1L4YA 3GJ7A 3MD0A 2B7CA 2FEMA 1IJFA 4WZAE 4CVNA 2PHYA 1X3SA 3P32A 1W7AA 2BMFA 2H92A 3NOPC 2P65A 3TKLA 2CVFA 2NIPA 1W5SA 2JGNA 3LIFA 4I81A 1SXJB 1R7RA 4PAOA 3VKGA 1ZM3A 3HJIA 3OIUA 4QM6A 2JATA 1Q12A 4XD7D 3GFOA 3B33A 1E0JA 1G3RA 2QUZA 3QKSA 3P26A 2BOVA 3THXA 3HWSA 4A6PA 2OXCA 4KSBA 4TQUS 3NEJA 3LLUA 3LBHA 2QPAA 4OKSA 4HUTA 4LGMA 1YR9A 4TT3A 5DSZA 4KCGA 4YQFA 5HZKA 2IT1A 3G82C 2NO7A 1UWPX 1BYUA 4GBMA 2FG5A 3UMFA 4D6PA 2ZRDA 3RRZA 3RRYA 4URYR 3LRPA 2WSSD 3B1VA 4O0MA 1KSGA 1K5GA 3NBFA 3FHCB 5JS8A 1NN0A 2OFOA 1UGUA 1E2JA 1QG2A 1T19A 4H1VA 4NYIQ 4POAA 4DRZA 1XFAA 3F3YA 4YMVA 2F43A 2WWWA 4KUKA 3LXXA 5EE1A 4IJMA 3Q7PA 3IQWA 4WXPA 4C0AC 3CRQA 5A4JA 2PT7A 2CNWA 4HZIA 4RD2A 2W6IA 1Z5ZA 5D3QA 1OV4A 1U8AA 2R44A 2XNDA 4TYQA 2ZRLA 4QG7A 3OFND 1JAHA 4Q02A 4GI7A 4ZO4A 2WPDD 4JYCA 2PX0A 1Q1ZA 4UXIA 5FPSA 5JJKA 1QF9A 3GP8A 4IFEA 2GEUA 1FMLA 4FI3C 3LNCA 5FOTA 3VU9A 1WCV1 1Z0FA 4XH9B 4EPYA 3K0AA 1JI0A 4Z1MA 3C41J 4BQSA 2EVWX 5GADl 3QKRA 4CRWB 3CUEF 5D3MA 2ZREA 5CLQA 1DAHA 5KPJA 2ZSEA 1T0JB 1W4BA 5TY0A 5HWWA 1NKSA 3KJEA 2NZ8A 1SVIA 3B5JA 3L2OB 3D31A 2W83A 4F93B 2O8EB 1E2FA 3RTYA 4LCBA 4DLYA 4LJ8A 4IVQA 2A9KA
chains in the Genus database with same CATH superfamily
1ZHFA 3HVUA 4MQ4A 2V7EA 1GCGA 5BN5B 3PC8A 4AO8A 4ARCA 4KQXA 3M8KA 3ZV3A 2GTPA 1CY1A 5KOJB 1ZI9A 3ESAA 1XRLA 4AMGA 3GUCA 5FEGA 4LMRA 1L7MA 2D6FA 1KI6A 1VYTA 3UB9A 3ZNYA 2JCXA 1YJQA 3H8WA 1KZ4A 4EWFA 4KQGA 4RKRA 4AJJA 1JFVA 3F8TA 5D5HA 4YRNA 2BG1A 2C57A 2JKGA 3DL2A 2OB2A 3JYIA 1MD9A 4IXMA 4Q03A 1KVQA 5EWLA 4WCVA 2VRWA 4AZ3A 4W82A 1OXTA 3HP4A 4OQZA 1NHGA 1VEUA 4Y98A 2AOVA 3FUVA 1F0YA 1WMDA 1YULA 2QRNA 4N5MA 1M83A 1BFUA 1E59A 1RP1A 2R97A 4JU9A 3SX2A 3D6TB 2JH9A 3UXHA 1ZG4A 3WV5A 4CMCA 3A3FA 4L27A 1DCTA 3GVIA 3GQBA 3NWPA 3NBMA 3QG1A 1T34A 3WOVA 5CGWA 1PZXA 1WSAA 3WMXA 2QK4A 1NWHA 1WE2A 4IHQA 1QQ7A 3WYAA 2XDWA 3IRUA 2CCJA 5AKXA 2V7WA 3L1KA 5KYGA 2PBLA 3DDUA 4JHXA 1KEKA 1JBQA 3LO8A 5TQ2A 1MT0A 2NSYA 1A4IA 3NVMB 3N76A 1AHIA 4GR9A 1I5EA 1EFLA 5M3BA 2I7DA 3VZRA 3BTVA 5H5JA 2CLEB 4JQSA 4ZMSA 4GOGA 4BBUA 3G5AA 3KVVA 2RARA 3H9BA 1R0KA 2OZVA 4G4IA 1UMKA 4LFAB 2GN9A 5JNWA 1SHZA 1NBMD 1TEMA 2Q41A 3VMFA 1WCYA 2FPGA 3D4BA 4US1R 3N7TA 5CA0B 2L17A 2FUG6 2QOEA 3NBUA 1EUCB 3S2UA 1BLPA 1PE0A 2AF3C 3TR0A 2RH5A 1N2OA 1R0LA 2E82A 1H94A 4HP4A 1T9GS 4L5AA 3ZG9B 2I22A 3B2QA 3I1YA 3GARA 3NNDA 4LKRA 2VPZA 1NW8A 1OKKA 2GFHA 3LFTA 1Q57A 4YRJA 1O6BA 5TMDA 4QYMA 2ZUVA 3NHYA 1U5AA 3D4NA 1HFJA 5K0NA 2YRXA 4FSDA 4MR9B 1YQUA 5FJIA 4EY3A 3Q7EA 1JT2A 1DINA 3CLRC 1SCAA 4WEJA 3T1QB 4FIZA 1CUCA 3CNLA 1ES2A 1KDZA 3KB6A 4PZLA 3QLJA 3DE4X 5FATA 4YFMA 2AHOA 1OU4A 3P2EA 4GMKA 4ROSA 4X94A 3GUYA 4ZT4A 4C7XA 4WJKB 1G5PA 3N2YA 4MGYR 4K26A 5MN5A 5JU6A 1YRBA 2OC9A 2JH3A 2VOEA 4ZYTA 3DH0A 3V80A 1SUPA 2VF4X 5EJ7A 1G64A 2KX7A 2FFYA 2QD3A 3AKEA 1IY1A 1Z2EA 2Q9CA 3AHEA 1RU3A 4LJAA 3AB7A 4RKEA 1NZFA 1H65A 1E1DA 1XO1A 1O8CA 2A0WA 2OR3A 3JPYA 4ZV4A 1S2OA 3OHPA 3N87A 4MUYA 2DPLA 1N9OA 2A30A 5BW8A 5DI3B 1HURA 4X6YA 4NXBA 3GV0A 2HV8A 2XH9A 1V8FA 3P1JA 1WUIS 3F1OA 1X80B 2VYNA 3H2ZA 3O75A 4L15A 3PVSA 1R4AA 2GSDA 4MVJH 1OROA 4KO4S 4ZOEA 3HJCA 3JQEA 3DVSX 4L73A 4FD2A 1TC2A 4L74A 3T9BA 2ZUCA 1N9LA 3NBXX 5AUPB 8LDHA 4ZTBA 2D0DA 3K96A 2BD0A 5L3VA 5FPYA 5I7EA 1RCTE 3KR2A 3V42A 4Q9HA 3KO8A 1QFYA 1RM4A 4RTMA 2FPUA 3RJZA 3U7EB 4RFLA 2KM1A 1IHXA 2Q0SA 3IDOA 3UOWA 4X91A 1NYLA 4ZCLA 1ZU4A 3KKPA 2GD0A 4H1UA 3WC4A 2WGVA 1FVOA 1H6BA 2H4XA 5LZ8A 4GB7A 2Y8EA 3UA3A 3PBTA 3VPCA 3IAM6 3JVUA 5AQ9A 1HYGA 2XSZA 2N1MA 1NVFA 4CODB 4F5DA 5AVRA 1VKZA 4YBZA 3DQPA 4FFWA 2ZM8A 4HYQA 1NOJA 1S6YA 1UC4B 1XDZA 1QYRA 4BDSA 3N2KB 3LHIA 4MINA 3THRA 3ZK7A 3MTBA 3STYA 3JQ6A 1N2ZA 2OP1A 4JXWA 1TIKA 3C3EA 3VOZA 1JLLB 4A0SA 3BFXA 4Y15A 1XK6A 3E7PA 1TTPB 2VH2A 3PQ2A 2Q5JA 5G4KB 5TPWB 4JGQA 4ZAFA 4AMUA 2QQGA 1SQGA 3W5JA 2FSUA 5EZYF 1Q6ZA 4EA8A 4BKUA 2J0QA 3FZQA 3ANNA 1YVEI 2VTVA 1FRNA 2RC6A 3NPAA 3C7AA 1YZKA 3U7QB 3A6PC 1O5TA 2W5UA 4EQ1A 3HYRA 1I51A 4WNYA 2WSBA 2OD7A 3L8MA 4N5IX 4H0FA 4PS0A 4Q1AA 3PI6A 3IT3A 2VRCD 3R7DA 4CKXA 3GVPA 5JWRA 5BW4A 4JP8A 3DCJA 4ZJ2A 4FMCF 5E2GA 4DB2A 5AM2A 3ORFA 1Q83A 3B82A 3QE9Y 1CIPA 3DVAB 3QWAA 1EHYA 4NARA 1KHTA 1KO7A 4C7VA 4DCSA 1L5OA 3OMXA 4E3ZA 3E6AA 8ADHA 2AHRA 5JQWA 1QTNA 3OJWA 1A4UA 3EVFA 1Q6YA 1ISGA 2FUCA 4RVOA 2ZK7A 4BHTA 1FK8A 2WIBA 1KGSA 4PXSA 1R8JA 1T6XA 2C1ZA 2VNHA 5IJ0A 5JJIA 2O2IA 3GRPA 3CXUA 4BE7B 2D8MA 2K2WA 3I5YA 1DAOA 1O0BA 1IBSA 2P75A 5BV1A 4JB0A 1FPMA 1U0SY 3SFTA 1X0OA 1WYBA 4LENA 1V6CA 3HU5A 4LPKA 1YI1A 4R1TA 3G5MA 1MX5A 3AVYA 4WM9A 4Z9QA 4G84A 3Q1KA 5FBZA 2C9OA 2WMYA 3NECA 1P97A 5WRFA 5FLKA 2AOTB 2PQ0A 4YAWA 2W3EA 1XJ2A 1CEXA 3ABOB 3HMQA 3SF8B 5J4KA 4FDTA 1H9CA 3A3JA 4K1XA 1MFPA 2R8RA 5TJ9A 2A35A 5TVKA 4MHOA 3U6KA 1NSYA 3NOQA 3IA2A 4L75A 4A03A 2EQAA 2FQQA 2OY0A 2I3GA 3FVTA 4L95C 4BP1A 1S2DA 3W5AA 4EEPA 3F1LA 4GSYA 3VNVA 4LJ6A 2WNHA 1Z16A 1R0CA 2Z4TA 2ZR8A 4OVDA 1P18A 2E4YA 3KEQA 4BLVA 2PT6A 3O5YA 3L6RA 1KAGA 1XL1A 1K7XB 1N75A 2DWCA 1G17A 1TUGA 5EGSA 4G63A 1VG8A 1QHIA 4PTLA 3W6PA 2QR5A 4NLLA 4UC0A 3OT1B 4NU0A 4WY8A 5A9SB 1O8BA 3L7OA 5EJAA 4QXPA 4BZXA 5TS2A 1CE8B 1IB6A 2QM3A 4FOOA 3VZCA 4WFKA 4BKRA 3KKKA 2PU5A 1UJ2A 2JLUA 1V3UA 4QTZA 1SU8A 3N8GA 1F2DA 4OSPA 3AVWA 5DPMA 4KN8A 3HNOA 3QI7A 1UMBA 4XOIA 3RXWA 3Q7ZA 1W30A 4ZVMA 3I92A 4HS9A 4JB2A 1GGKA 1ECJA 3F78A 1I1QB 3S7NA 3JQFA 5KWSA 3F73A 1E32A 4PQGA 4ED9A 4F3NA 3FCUB 3RF7A 5JFOA 5EPOA 1P5HA 4FPXA 5HDCA 2OWJA 2EWWA 4YK7A 4AKHA 3ZV6A 1R9GA 4GPEA 1CU1A 3ZCXA 5IJXA 3VDMA 4AJOA 2Q4DA 1AQ6A 3DEKA 4B3BA 1TO6A 4KR3A 5IM5A 3O03A 3A7EA 3LDAA 3PQCA 2HDSA 5FH9A 2CNLA 1QAOA 1DIGA 2HEIA 3GVHA 4MLDA 3RC8A 1U28A 4KNWA 3IKLA 1LRKA 2VK1A 1PJBA 2FFAA 4S04A 5DBOA 2IUFA 3C3XA 1QE3A 1YQSA 5KINB 4JX8A 3VR5H 4II7A 1E9VA 4FH2A 1SUCA 3EQ6A 3PUJA 2J5BA 1T5SA 2EX4A 2E8IA 4ID3A 4K9LA 2GYVA 1SBCA 3EQ2A 4HDRB 2YUIA 4UM7A 1H93A 3AF1A 3BB1A 3FKSD 1W7FA 4DSAA 5BMVB 3IDAA 2PUEA 5D7BA 4ZAZA 4N76A 3GFTA 1N2CA 4ITVA 2XWSA 3CYFA 3CX3A 1D03A 4WBSA 4DR4B 2IDZA 1WE4A 1OPXA 3H19A 4FJ0A 3STUA 2HLHA 1Z9BA 2IVZA 4ZVSA 3GFQA 3WHIA 3OJXA 1QOZA 4CTKA 2XPCA 5PGMA 3WNDA 4D4LA 3GRAA 4AQYB 1HE3A 1S4RA 2IHNA 1UANA 1UKCA 2E1RA 3RHSA 2ORIA 1RM0A 3VKVA 5TBMB 4F1WA 5FUMA 1R64A 3DTMA 5IEBA 3CG5A 4D44A 1FRZA 2VPQA 4M38A 2IZZA 3CUYA 3BFJA 5KNBD 2R6DA 4NESA 5E4YA 4NZMA 3H05A 4ZTKA 3NT4A 4NNOA 2HMVA 4JLBA 3UT5B 1COZA 1FL9A 3GW8A 4F3LA 1GJRA 2H0TA 2Y2LA 1CVLA 4IRMA 4EK9A 5CDYA 4IRUB 4WCFB 4XTCS 3N5KA 4JDPA 5JBIA 1N9GB 3MVEA 3KZNA 4L4UA 5DHFA 5JARA 4MDZA 3BVPA 4NOJA 2WIGA 3JARB 2JLQA 2AYZA 3D6HA 4NCNA 5FYDA 3U3XA 4MDFA 1H5UA 2XUPA 3T12B 2VHWA 4D41A 3I2YX 4JBNA 4TLLB 2Z9DA 1J0DA 4H6PA 3IAUA 4ZAYA 2ZBBA 2PU2A 4X3OA 2CXOA 4U6QA 2O5EA 1QG0A 1TMOA 2EDCA 5E0OA 2PWYA 1O95C 5IHXA 4IGIA 1OHHA 4BNUA 3HXMA 2ZSUA 1OREA 4B5LA 3JQBA 3T3EA 3S4XA 3T7IA 1V95A 5ALWA 3R6LA 3C2WA 5FAOA 3G5LA 3GZ4A 1NLMA 3H65A 3QVWA 4XKJA 3TLMA 4CKEA 1C41A 3VV3A 2R6AA 3F6CA 4J43A 1U80A 5AW1A 3Q3GE 3TI9A 1EWKA 1FMFA 3OPYB 2GBLA 3H6HA 4HLCA 4IFIA 4L8FA 5DMXA 1PRQA 1VMKA 4M7RA 4ADSG 4D81A 2ABWA 5CXXA 4HUJA 2J9FB 1PS9A 4MCHA 1J90A 4HI4A 2E55A 1PJ3A 1SBZA 1TUIA 3G31A 1Y8CA 1YQXA 2VHXA 5ED4A 2ZTMA 1D4ZA 2BHRA 1PZGA 4RCVA 3UT6A 4LF9B 2O6LA 3MXTA 2GCOB 1EU1A 4LCLA 1KOFA 3OPQA 3SZRA 3W2GA 4RNDB 2UDPA 1V5FA 2Y27A 1NZUA 4R9NA 1JNYA 3RS5A 5J43A 3SI7A 2H8GA 4HPWA 2C2KA 2I6QA 1DTWA 4DQXA 4EVRA 1U7ZA 1MEJA 1UJCA 1AA9A 2G0NA 2FH5B 4F5ZA 1XHLA 5EJ4A 3FYTA 3HP7A 1H8ZA 2VWPA 1OFGA 1SUWA 2OTCA 1HE2A 4B46A 1PCXA 1SKAA 2Q3BA 2I9PA 3N2ZB 1TD5A 2BI8A 4IRXA 2ROQA 1YB6A 4CLOB 1RR6A 1WB5A 2XT6A 3GEMA 2PH1A 4YT5A 2VDLB 2QL9A 3S55A 3HUTA 4BQNA 3P2KA 1J0AA 1K8QA 2QP4A 3K6RA 3A1VA 1VYVA 3KKMA 3IQIX 3RUEA 5C7LO 1MTZA 3SS9X 1YVPA 1LDNA 3BTSA 3ZJTA 1A4RA 3OT4A 4RSRA 5IMBA 1KNQA 3IV6A 3GDOA 3EDRA 3A1UA 2AEJA 3DBHB 3H9UA 4F3CA 3C87A 3PUIA 3NS7A 3H3JA 3W6UA 2VXBA 3D4OA 1DAEA 2WF8A 1JHRA 5EERA 2J46A 4WBNB 1UPCA 3X1MA 1XFDA 2IX9A 2QN6A 1NRJA 4ZMRA 2JANA 4F4HA 3O1JC 1NE7A 2GK3A 2MCFA 1E2DA 3ZK9A 4D98A 1KJ9A 4UTRA 1GV1A 3ONNA 4GI3A 5CB4F 1JH9A 4WLAA 2O0KA 3ECCA 3LUQA 1JFRA 1LQUA 1MWTA 1M5UA 1U4NA 1WCWA 1TI7A 2BFEA 2FEOA 3I4LA 2PZLA 3L8YA 1CZRA 2Y2MA 1DDGA 4IVPA 3WICA 1GNRA 3OU7A 5MHTA 2WJJA 4OXNA 5KYUA 3WYGA 4NKRA 3KJGA 2P9TA 2RHWA 3V4FA 3C3KA 3MUNA 4CU5A 4F2WA 1XFNA 2CXXA 2D5AA 2Q29A 5DM1A 1PVOA 1B1AA 1TCUA 2Q0XA 4BTLA 3P9YA 5KVAA 2V55B 5LA6B 2HO5A 2HCTA 3DUWA 3T34A 2EEZA 3F3SA 4BNDB 1KJZA 2GYWA 4FNOA 5IUNC 3IAM1 1ORRA 1X94A 4P2GA 3T7CA 1ID8A 3OQHA 3MLBA 3UUFA 2HHLA 5CEFA 3IEVA 4UD2A 2Q3LA 2QNRA 1E6KA 3QEKA 2X4GA 3Q3CA 3COSA 3G8DA 1HT0A 1QR6A 2MWMA 4GIBA 5IDXA 5K8JB 3PJGA 2WZDA 3T3DA 1ADGA 1PJCA 2F8MA 2BSAA 4A1FA 1HFEL 2ZYTX 2XXAB 4FXOA 1KQ3A 4DUGA 2IZ5A 3VKGA 1A5SB 2ZROA 2OCBA 4LMBA 2NTYC 4PX2A 4OP8A 1XTPA 2FRVA 2ZS9A 1VHMA 3IP5A 3PIRA 2MSLA 4X7MA 4ZT6A 3VOSA 1I7QB 4AY6A 3ODGA 1GCOA 4FE7A 3ES9A 5D87A 4GYJA 3WLMA 3ZNQA 3BY8A 2V7UA 1UBHS 1OT3A 2XYGA 1ES9A 1UP6A 3IPXA 5EWJB 4YJGB 3WAGA 3OQMA 2HHHB 3OJOA 3VP0A 1UXGA 3HUOA 3S68A 1WDTA 3EX7C 2WT4A 5EY5B 2RHGB 1XQXA 5CVVA 1T15A 5CM2Z 3ZHZA 3U1VA 1BJRE 1RKBA 1RC0A 5C5CA 1I6KA 1Z26A 3A26A 2JC3A 5HHTA 5I45A 5L53A 2I9KA 3SQXA 3IXHA 1CUJA 4W5OA 1U2TA 3IHLA 3RANA 5EC8A 2V7BA 1NX6A 1DX4A 4KWTA 1VIDA 4MVJA 4R01A 4E08A 3P4UA 1VJCA 4Y2RA 2MSWA 3AG6A 2XT9A 3SX0A 2DLNA 3H11A 4UNQA 5MFZA 1VGQA 4HJXA 5DOZA 5A5EA 5THKA 5JNVA 2DKFA 2HCJB 1R50A 2J0UA 5JSFA 5L7WA 4R1GA 2D4HA 2P77A 4ZO7A 5LYJF 2FWBA 1LFDB 3ONWA 1FFDA 2H2IA 3QFRA 4XLTA 4NE2A 3P0JA 5T4HA 4DR6B 4EYSA 1PG2A 3PNLA 2QE7D 4UUBA 3DLTA 3FNIA 2G0AA 1N8KA 5K0JA 3QG5A 4EQZA 4OOLA 1AVTA 5DKFA 1E3LA 1OXBB 5CLFA 1GWNA 2VKQA 3A4NA 2H54A 2DTDA 3IBSA 3FSJX 4X56A 4OP3A 2CE7A 2H9AA 1QTRA 2HSEA 4EF5A 2J5QA 4M1SA 4YP9A 4GHIA 1K7CA 3GLFE 4XWAA 4DV4B 1JAZA 3UB8A 2E4WA 3B48A 4YONB 5LZ7A 1Q1GA 4P31A 1QDLB 5JYCA 4HAYA 4RMNA 5AHRA 5DHTA 4JYZA 1ZOIA 1KO5A 4BWIA 1QIMA 2GN2A 3GRYA 4RBNA 3AL0C 4C4PA 1QJCA 5BW5A 2C61A 2GDJA 2EW2A 2IC5A 4ZVOA 4CKWA 2MOKA 5JDIA 5BWOA 1TJPB 2C82A 4ZD6A 2EKBA 5JATA 5K0CA 2H57A 1OX6A 2CEAA 5HA5A 2VA9A 3D2BA 3NV9A 4E46A 3MFQA 1UKVY 1H8YA 4P4LA 4BFZA 1NNEA 4JC4A 4CETA 4UQIS 4C87A 1GZVA 2PKQP 3TLYA 5KBYA 2RONA 5DI9A 3LIDA 1DBRA 2PRFA 2B4QA 1ERMA 4IDGA 5EVIC 3FUTA 4NJOA 4PXYA 1AGYA 3EEYA 3GH1A 4NDAA 3IVAA 5CH3A 4GOXA 5ICFA 4HLNA 3WLEA 1H2BA 1B7GO 1ICIA 1J5EB 1ST2A 2H48A 4Q3BA 2WIDA 5JO9A 3PNOA 5EVCA 2AQIA 5IANA 3TNDA 1PGNA 1E1QA 1C0IA 1M1YE 1BEZA 1VIMA 3QVGB 4BWYA 2Y79A 4ALJA 4BNJA 2ATXA 3SQDA 2QPLA 4MR8B 4WIAA 5DISB 1AQLA 3QU5A 2PXHA 3E8XA 4XXHA 4RAOA 1Y5IA 1N0VC 4KO8A 2Y76A 4MB6A 5EMLA 3IVMA 1J39A 2DHEA 5E2AA 2NPFA 2FTKE 2KJQA 3LPAA 3T7RA 4JH0A 2AR7A 1JECA 1SO8A 3P4YA 2HJ9A 3N59A 5HG0A 3PEVA 1FF9A 2J9FA 2DULA 3SXUA 3AF2A 2QGZA 3I6ZA 1KEUA 2WF5A 3QFTA 3ON5A 4GE0A 1RSZA 2V7QD 5EKTA 4A16A 2IWHA 1FOFA 4O29A 3L6EA 1NV8A 4FGLA 5JWHA 1GQYA 2ZRJA 4ESEA 2PX4A 1CUSA 4ZJZA 1QK4A 2WNIA 1BWQA 3G1UA 4MK4A 3VFDA 5JTUA 3OIVA 1NRWA 4X20A 3HL9A 4Z4FA 5AJYA 1L7OA 4HWOA 4CL8A 4MX8A 4B6JA 2Q5LA 3IQEA 4C6SA 5K8CA 3AIKA 2P2ZA 3Q7RA 1U6JA 4KHPB 2BEUA 1G9XA 3CMZA 5GHZA 2NPIA 3MIZA 2EZ8A 1JHOA 1RVV1 2YS7A 2IYFA 3FPKA 3OLWA 4LRUA 4GVPA 4Y6RA 5D3KA 3H5TA 4CL3A 1F48A 5DULA 5E3HA 3MTDA 2GPJA 4ZU1X 5ER6A 1XP5A 4HLUA 2VJAA 5IU1A 4AWBA 3IE1A 1TZJA 1Q14A 4X69A 3RV3A 4HBTA 2IRWA 2GEFA 1WR8A 3NM5A 5JRZA 2V20A 2ZOIA 1Y9AA 2VPYA 3UICA 2GCOA 1OBVA 3VAYA 4R3WA 3Q72A 2H2AA 2HXGA 4JBGA 1Q2UA 2WZXA 2R1TA 4LISA 2NW6A 2VTEA 2C5LA 2EXXA 4N9QA 4IP0A 4XIGS 3WFJA 3N6XA 3BXOA 4EDHA 2GAOA 4C3UA 4MMNA 2QUIA 3R5JA 1MG0A 2V3WA 3P94A 4RS3A 1F98A 5JCJA 4FZ3A 4DDKA 1WHSB 2VP0A 3A31A 2ZJYA 3DBRA 5JFGA 3AO0B 3BOSA 4V24A 3LUDA 5B7NA 2XUJA 4J6EA 2HPVA 2IHKA 2YFHA 5B2EA 1P7YA 3FYCA 3LUCA 5D1NA 4R9RA 4RZQA 5LPNA 5AHXA 1G19A 1UMCA 3BCSA 3I9OA 1H66A 3AKYA 3GAAA 5BWNA 1Y81A 5DGIA 5GP1A 1UL1X 1DPFA 4FFMA 3TOCA 4BO3A 4CIYA 4PPQA 1KFKB 3ZV5A 1OVMA 2IHYA 3C15C 5ALYA 3N1UA 4PWZA 3NUGA 4YALA 3FG9A 3ILHA 4BX8A 4W5QA 2QTNA 2DQ4A 4CR6A 4DUGD 3V8RA 3OQBA 1E1KA 1MJ5A 4IXDA 4KDEA 4LYYA 1XRQA 3ESCA 4YNBA 1N4AA 2VGLM 1C7ZA 4TKVA 1JFLA 2H16A 3DB2A 4OXRA 1NC1A 4YJDA 1CVIA 1PD1A 1R18A 3HLFA 5CJJA 3F71A 1HQYE 4RJIA 5JO0A 5GJVC 1A8QA 2C6WB 4OHRA 3BXXA 2CBGA 4MYHA 3VJRA 4RE6A 3OH8A 1A95A 3LY8A 3FJYA 4P58A 4XYMA 4D46A 1HYHA 3AP2A 4Y2UA 3RU2A 4N7JA 4FDLA 1GITA 1YV9A 4IH1A 5DSXA 1N6IA 1X0XA 3OY7A 4BX2A 1YLJA 3MWDA 4C3OB 4UULA 1VA4A 4JN6B 3WR5A 1HQCA 1LA2A 1ZP6A 4F3KA 1R0YA 1XTZA 3H42B 3V4VB 5AT1A 4GS9B 1M67A 2Z3WA 4IM7A 4CLEA 3BGOS 3MTAA 3TFWA 3EXEA 4RGBA 1CPYA 3N07A 5E8RA 1MG5A 2IXAA 4HPXB 4NC9A 1GG2A 1N0WA 2CEKA 1TM5E 3ASYA 1RQPA 4G5XA 4U8GA 2BKLA 4HGPA 2JVIA 4QPNA 2FZGA 4GPD1 1MKMA 1VB6A 3EPPA 4MRRA 5J2UF 1PD0A 2IBMA 4W5RA 4Q15A 5JR3A 3K70C 5I94A 2HL6A 2XQGA 3QXXA 3VHQA 2J3IA 2QQFA 4HQ6A 3ZWYA 3NRJA 4DR1B 4BAUA 3ZVKA 3ENQA 4TM7A 1JQ3A 4RNCA 4UUAA 5TNXA 2MYNA 2BISA 4EPRA 1NSFA 2BUBA 3C16C 4FHZA 1LD3A 1J9GA 621PA 5CB4A 4X1LA 4PO9A 1TVFA 4KUOA 1C50A 4DV7B 1WXWA 2ZI9A 4BV8A 1JJAA 2QAJA 2Q5QA 2X8BA 5KQSA 3F3MA 2VZ8A 1GZ3A 2YHAA 3DD1A 4RMJA 2R60A 2H11A 3SKYA 3RC1A 2CK3A 3S6JA 3OZEA 1ZVVA 2DXIA 1J8DA 3V97A 2BJVA 2VH5R 5EQFA 3KR1A 3BW6A 1II8A 1IM5A 4H35A 2F6RA 1FSPA 1DCMA 1HI9A 2AFIE 2E4AA 2W4IA 2OOKA 5IM4F 3K8ZA 2GZHA 3I2GA 2ZAYA 4KRGA 3PX7A 1FMTA 1QDUA 1W1UA 1F3OA 3SIWA 3GWZA 1KZ9A 4L4ZA 4NCXA 4UVDA 3HBRA 2YMQA 1OXUA 2NO6A 3AHCA 3B12A 3MMXA 4PICA 1GFIA 3TDKA 4PE5B 2BFFB 4UTVA 1A98A 2J6IA 3KUDA 2YWEA 1L0GA 1B8OA 5EXTA 5A1JA 5FA7A 2P9CA 5DHUA 4YT2A 2QAIA 1E6EA 4DIBA 4YP5A 5A9SA 3P7NA 2G25A 3K2EA 1ZN7A 3KZKA 1MQAA 1TMGE 1S1ZA 3HYNA 4N65A 3RBAA 1YBHA 4CDNA 1GLVA 4HDOB 5GONF 3QRWA 1U31A 4EJSC 2O1XA 4EO4A 2PD7A 4BJPA 3ZKWA 1OB2A 1EB9A 2REBA 4PCLA 5D51S 3C3PA 1ZUWA 2P5YA 2XB4A 3GLSA 3LW7A 4PGAA 3NAMA 1A9RA 1EUQA 1ZGBA 1IPEA 3UVEA 3T4TA 2CLHB 2XVYA 1EGVB 3DDHA 2JLRA 3JWGA 1Z5GA 4YMWA 3TLCA 4DUPA 5BSHA 5LB4A 3EAFA 2JD1A 4EBNA 1GGHA 1NW3A 1KK1A 4P4UA 2QD5A 5GVSA 2Z1MA 3S1AB 5TIIA 4FFSA 5FWAA 1AKUA 4AZWA 3HXTA 1EXMA 1WOYA 5C7YA 2IHUA 4OXYA 2VYVD 4FFBA 1II9A 3TIXB 2GPAA 5HF8A 1Z6PA 3H9CA 4LNHA 4EHDA 2R8PA 3PEUA 3FLBA 1DMRA 4BATA 4HATA 1S9DA 5LBUA 4EYKA 4OREX 4CEIA 1DSSG 3CX7A 1VECA 4HRYA 3DOIA 2DFNA 4DE0A 2HU8A 3B6MA 1D0SA 4P22A 4V3BA 2W43A 2GKSA 1NQUA 3L01A 4XRGA 5KZMB 4GR4A 3LUJA 2J0EA 5C7OO 2PJDA 4O4JA 4B93A 3DE0X 3T35A 4J16C 4W1PA 2AN5A 4E2YA 1R4NB 4F71A 1K7YA 1OBHA 5K7SA 4WA7A 4XVQA 1O7EA 1MPLA 4OL9A 3KJQA 3O95A 1QVWA 1DOAA 3C7KA 3LDUA 5DHRA 1ZRMA 4D9FA 3L0OA 2AOXA 1REQA 4AO7A 1IQRA 1DU4A 3HCWA 4MA4A 2OHXA 4OHYA 2ZJ1A 4Z9AA 3WDLA 2XRZA 2HNBA 2R25B 5JDCA 1JX6A 1KKMA 2R8XA 4PZUA 4QRHA 4TQ9A 2BDUA 1OH5A 1UBLS 2R1VA 1UIMA 1XEAA 2IYUA 2W7TA 2ACGA 2QI9F 2YWJA 1B14A 3BQ8A 3G49A 1U8TA 4HAIA 1JDPA 4KFSA 5EPEA 4FHFA 4D4KA 4K86A 3EMKA 4RD6A 4PYIA 2SICE 1W5DA 4AMVA 2AKAB 2B2XA 5LMZA 1F60A 3CNOA 3OQ1A 5BNIA 1CUFA 1MB9A 4IXNA 3K92A 3A1SA 1RQRA 4ARIA 4RLQA 4O59O 3UMJA 2XHEA 3PSHA 3WQHA 2BE7A 2ZRMA 4ND4A 3RSFA 4TTJA 2I33A 3RC9A 1PDOA 2NXNA 5ALDA 4M9UA 4HQNA 4ZJ1A 1ESIA 4R3BA 2O8FB 2GEDA 3LX4A 2HK7A 4LSWA 3TSGA 2YZ7A 3FWYA 2KMLA 3DS8A 2X5NA 2VPTA 5K6TA 1AXGA 1KFBB 1PU2A 2GN8A 2R8OA 3NXKA 2V8FA 3QSYA 4JKOA 3O8DA 2GZRA 2ZR9A 3CRMA 3KTAA 4QDTA 5EHZA 3PPXA 1PG0A 3C2QA 1FR6A 2J67A 4EPVA 5TARA 3FYHA 5L4NA 3H8VA 3AGFA 1I4TD 1W2GA 4MB2A 3ANMA 5EVJA 2HLDD 1IJEA 2J9GA 2Z04A 3GRZA 3QE4A 4E14A 4AWAA 5C5DA 2QZPA 3NORA 3HTXA 4LNUB 1XJ5A 3PE3A 1IYPA 3Q6IA 1TS7A 2GFIA 2ZYSA 3LT4A 2L19A 2CNNA 4P93A 1E4EA 1MB0A 4IIJF 4S1PA 5E1BA 2JKYA 2Z58A 4JT2A 1IBLB 1HQKA 1E7SA 2A9PA 4PR0A 2VR1A 3OIDA 3U26A 4BP3A 3C4VA 4QQ8A 1Z0AA 1K7SN 1WQ4A 3T50A 1O5OA 3O3OB 1T9DA 1VRVA 3VSBA 3EB9A 2VSYA 4AWXA 2QROA 1W35A 1BFKA 2O9CA 4A0FA 4ZYVA 3G9TA 4OO3A 4LQLA 1KR2A 4DYHA 1UCFA 4UCXA 1HDXA 2HN9A 4NIMA 3GJQA 2WM3A 5KIZA 2EF1A 3E9EA 3LMKA 1UMCB 1CS0B 2EZ9A 1F2VA 3R6TA 5CCXA 2B8EA 3WV4A 4OLAA 1XBTA 1K54C 3N8NA 1OI3A 3LQQA 5BR7A 1RE1A 2O48X 5GIPE 5FI2A 5D3ZA 4QYIB 1GZSA 5AW0A 1IHDA 4MEZA 1POWA 2UVPA 4EF4A 4L16A 1T2EA 4F9FA 3BWXA 1ONPA 1NXXA 3GGSA 3MS4A 2OXIA 5C52B 4D25A 1LPPA 2Z43A 2H51A 5TPWA 4TMFA 3U9TA 1PL6A 4E3IA 4BQOA 5F7XA 1U0RA 1R27A 1J49A 3HU3A 4DXAA 4OX9B 3P2YA 2XSSA 1SCJA 5DJUA 4Q34A 2Q3CA 4QOIA 1XZDA 1BAPA 1FDUA 3D3NA 3FMVA 4XSGA 1T18A 4KSYA 3VTKA 4ER3A 5AJVB 3QMWA 3FTDA 1R4NA 2A5LA 2R7KA 2SCUB 3Q6NA 2A24A 4EQIA 4JLJA 4MQFB 4NCIA 5JHGB 2C1XA 3WWXA 1H2FA 1JDNA 2HGSA 1XZPA 4LF7B 4LHYA 1J8QA 1AKWA 4DGSA 1I1OA 1OJGA 1R10A 3FE2A 4OB6A 4ZI3A 2EFJA 2GN4A 2VT6A 4LZOA 3I73A 3O3VA 4XYGA 4BZQA 1E99A 2D2IA 1DIOB 2OHIA 1XGKA 1ZGGA 5I7WA 2P5SA 4DEVA 1EFAA 3HSSA 3TIFA 5KWVA 2W0MA 4HB2A 2C7VA 4RY8A 1F8YA 2HDQA 1GSOA 1SKYB 1XAGA 5AI9A 1VSUA 1FEZA 1MC8A 2PL3A 3FCCA 2CD9A 2PKCA 3DM9B 4KUGA 5ALTA 3IPCA 2BGGA 1HDEA 1XELA 2BWJA 1IN4A 3TKAA 4J3FA 3JQ7A 2VDNB 1JTGA 4M1ZA 2XSZD 4LZLA 4L8GA 4X9XA 4A0QA 4DL9A 4ZGGA 3DBLB 4MI6A 4KQMA 1OT5A 1U3GA 2FSGA 5ALRA 3T3NA 5EE0A 4YMSA 3CZMA 3WB1A 1INLA 4YDQA 2J0SA 3WGLA 1CQXA 4WSOA 2R87A 1R0RE 3CKMA 3QHPA 4JLPA 3RM3A 1GRNA 4ENWA 2O5CA 2OBYA 3LICA 4DF3A 3K5WA 4I50F 1M34A 2BASA 3Q7VA 3SYKA