5HZHA

Crystal structure of photoinhibitable rac1 containing c450a mutant lov2 domain
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
325
structure length
320
Chain Sequence
AIKCVVVGDGAVGKTCLLISYTTNAFPYIPTVFDNYSANVMVDGSTTLERIEKNFVITDPRLPDNPIIFASDSFLQLTEYSREEILGRNARFLQGPETDRATVRKIRDAIDNQTEVTVQLINYTKSGKKFWNLFHLQPMRDQKGDVQYFIGVQLDGTEHVRDAAEREGVMLIKKTAENIDEAAKELGSGGKPVNLGLWDTAGLEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Engineering extrinsic disorder to control protein activity in living cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Ras-related C3 botulinum toxin substrate 1,NPH1-1,Ras-relate
total genus 97
structure length 320
sequence length 325
ec nomenclature
pdb deposition date 2016-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5hzhA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5hzhA01
2QL6A 4TSFA 3LFUA 1M74A 3SYLA 2IYQA 2QNRA 1LSXA 1CBUA 4NXBA 4PQYA 4UXIA 2PH1A 2YJTD 1R5NA 4AY2A 3TVDA 2JJ2D 2VSXA 1LSWA 3IBYA 4FMCB 1LS6A 1N3BA 4OHXA 4RCYA 4MYUA 3T15A 4EJSB 4BLRA 4RKFA 1W0KA 2FPLA 3LH5A 1ZINA 3UB7A 2GVZC 4BFXA 3ICYA 1N6NA 4NTZA 2ERXA 3AGQA 4WZBE 1MO3A 1QBKC 1XEWY 4QKQA 3VFDA 1NIJA 1S96A 3A36A 3I61A 4Q1AA 4QRHA 4EEPA 4XIGS 2DFLA 2Q3MA 4Q48A 3DL0A 3SBEA 3TMKA 1PUIA 3ICQB 1E2NA 2VL7A 5E4FA 1HV8A 4OHVA 2KI5A 1QHHA 3UB9A 1G3RA 1BKDR 1JB1A 1HA3A 2YC4C 3NVAA 4PAMA 1FTSA 4Q18A 721PA 3RWOA 2ZYUX 3LIBA 1W4RA 1NBMA 3U61B 3PQCA 2FPMA 2WJGA 1OV4A 1Z6AA 2OLJA 4LC0A 5AJXA 5FOUA 2NZ8A 3VR1A 1WA5A 2A5YB 1ZNYA 5L3VA 2R8RA 2BM0A 3PEWA 1LSVA 2VQSA 4EQ6A 3CZQA 2PHYA 3HR8A 4N1AA 5BYKA 2FMXA 2P6UA 2XGJA 5EXTA 3F8TA 3Q3JB 4MYCA 4PX9A 1VB6A 1CJTC 4TLEA 3W3AA 2J45A 3WYFA 4DJTA 3UG7A 5B2ZA 3MFXA 3NEJA 1IN4A 2BBOA 3P7NA 3DKVA 4BPBA 5J4YA 5EE9A 4LX0A 4ITRC 2G9NA 4BFWA 2OBLA 3PUZA 2NPIA 5G4ZA 1A1VA 3WP1B 3UMRA 1YQTA 3NOPC 4R70A 2HLDD 2NO0A 3GJXC 3TUZC 5FBVB 5KNCA 3H82A 1JEEA 3QPWA 3CIOA 2XXAB 2FFHA 4GOXA 4CEHA 4RCZA 4IEEA 1WBBA 5CDFE 1FP6A 3BD9A 2Y8EA 2XZOA 1Z28A 3MAAC 3F1PA 4E04A 3BERA 3TK1A 1CP2A 2YKHA 1UBFA 1WXQA 1ZVQA 4DHEA 4M9ZA 4UNNA 4O25A 3WMGA 4DUGA 3MCAA 1F48A 2W6IA 4A1FA 3GLGA 1DAHA 2DCUA 1E9BA 3KJGA 3UE6A 3HYTA 3KFXA 3SQXA 3B60A 4NXEA 1P5ZB 4JBYA 4PHGA 1J70A 2IYSA 4HLDA 2QAJA 2QM8A 5DE3A 2IUTA 3AUXA 1XZPA 5E7IA 2ASEA 2PZEA 1DADA 2GEVA 4HATA 3IDQA 1OXUA 2C9OA 3QXCA 3T61A 4Q19A 3KQUA 5J7EA 2AKAB 4H1UA 1R2QA 2YWHA 4QHTA 3GLIB 2CBZA 3LY5A 3EX7C 3FOZA 5EE3A 1WCV1 4UJ3A 1EFRD 4KCGA 2FF7A 5H8WA 2QAGB 2QT1A 5JI2E 1N5KA 2G3YA 1N5IA 4LHZA 4M1SA 4YDSA 2NPFA 5GJBA 1D2NA 1UDWA 4HB3A 2N46A 1UADA 3VHLB 2JDIA 2JEOA 4TMXA 3RS2A 1IQPA 1J99A 3LV8A 2RGNC 1ZC4A 2OFOA 2ZSAA 5FPHA 5C2JB 2NTYC 3LXXA 3DHWC 2ZI4A 1T5IA 5DO9A 4ZI2A 2ZSEA 4HDOB 1Q12A 4KVGA 4OK6A 3LLMA 4RKEA 5CJ2A 4CEIB 4FW9A 4BFSA 5C18A 1CJUC 3ADKA 2NIPA 1ZU4A 5F9FA 1FP7A 2FFBA 5EQTA 4K46A 2QKPA 4GHIB 4B3XA 3SR0A 2GJ3A 2ZRNA 4PSKA 5KOYA 1XXHB 1JEDA 4XTCS 1AJEA 3K0SA 4PC1A 3OIWA 3ADCA 4NH0A 1ZIOA 5EUMA 1KI3A 2IHBA 1SKYB 3I4LA 3LNCA 3P27A 2JJ1D 4W5WA 4EPYA 2QORA 2XB4A 2O5VA 2OCAA 1VCMA 4XTRA 3ZQJA 4CF7A 3EPHA 3NTUA 1KO8A 3NH6A 3K3CA 3DDCA 3SOPA 2FH5B 2IC5A 3GFOA 5JEDA 1KK2A 4BGDA 2ATXA 5EXPA 2W83A 1ZM3A 4GZLA 5FOWA 4NXGA 3GFPA 4OQMA 5L3RA 3QXSA 1XD9A 1SQ5A 1ZRHA 3HPQA 5FOSA 4F38A 3ULFA 3KB2A 3WRXC 1FZQA 4MGIR 1V5WA 5E7MA 1II8A 1G6OA 4M1MA 4LCBA 1KKMA 2G83A 3L0IB 3LW7A 1MABA 4Q9JA 1VCNA 4TWZA 4XJXA 5BQ5A 2EVWX 4KV9A 4C2TA 2HXYA 4IHQA 2RGBA 1C1YA 4ZCIA 3PHYA 2F43A 3F1PB 2BIFA 4D2IA 2J7KA 3U5ZB 4LJYA 5LB2A 1RYFA 4US0R 3GDIA 5HWTA 1U9IA 4PXAA 3RRMA 4U5XA 2F7SA 2C77A 4KYIB 1G9XA 3K0CC 1W46A 4JLOA 5L3SB 2R9VA 4GFDA 3GLIA 1TU4A 1LL8A 2X8AA 3BIFA 3GD7A 4ZI3A 1OTDA 1R0YA 2O8BA 1LY1A 1NF3A 3AVUA 2IUSA 1S8FA 2QM7A 2OFXA 4D25A 1E9DA 1VECA 2JDID 4JVSB 1G18A 2UKDA 4B48A 1NVVR 4W7SA 3B1WA 2QJ7A 2ZVPX 3HU2A 3U3KA 1XFQA 2C9CA 1TMKA 3KFVA 3HJIA 2QY9A 5FTNA 3ND9A 3FKQA 2ODNA 4UNQA 5EP1A 5GVRA 4NXFA 4PPNA 4B3DA 3EPJA 4GZMA 1OIVA 3IHLA 1NIPA 1IY1A 1NSTA 4I1VA 3FHOA 2I4IA 4EFLA 1Z0DA 5AUPB 1DPFA 2CCGA 1KSHA 3OZXA 4H1VA 4URUR 4ZO4A 1W7AA 2GA8A 4PANA 1KJYA 3EA5A 4ESHA 3CWZA 1G6HA 1R8SA 5AVFA 2MSCB 4J0QA 4C30A 2RGGA 1TQ4A 3CBQA 1LF0A 5LD2B 1P3JA 3PEYA 4LBVA 1KK1A 2BMJA 3R8CA 2O8DB 3G0HA 2O0KA 3IGFA 2OWHA 1DELA 1T8UA 3DZ8A 1DARA 1GSVA 1QF9A 2QRNA 1G4UR 1KI2A 3TLXA 4EW7A 1G7RA 3V9PA 1US8B 3JZAA 3KL4A 2JIZD 5FPSA 4H6JA 1G28A 3K0AB 3WP0A 2GTPA 5A8BA 2FU5C 1N0UA 1QG4A 2VO1A 4V0LA 5SZJA 3TQFA 3U4QB 3VNUA 1W48A 1N6IA 4HJ3A 3PITA 1M7GA 1TX4B 2GJAA 4Q1DA 4NE2A 4ESVA 3FHCB 3PUXA 4V0KA 1N5JA 1TQ2A 3BAFA 1COWA 2A3RA 2D4HA 2CDNA 2V4ZA 4LRYC 2W2VA 1KY2A 5F2EA 5UKDA 4A36A 2VHTA 2BJWA 4DEXA 4GCZA 1CULC 2OO7A 1JBKA 2IYWA 4B76A 1E0JA 4G0NA 4EFNA 1EXMA 2JLWA 2MSEB 2R44A 2PEZA 4RFSB 2GXAA 3NHBA 1W4BA 1MRSA 3A37A 4EKDA 3MGCA 1KDOA 4OJKA 3P4XA 1OB2A 3AKYA 4QOSA 4B71A 5TARA 3BH0A 3THWA 3QVUA 5KDDA 4M9XA 5DI3A 3MD0A 4OI4A 5F9HA 3AVXA 1TQDA 1W2GA 1XFNA 3F5FA 3DPUA 3LX8A 4I1SA 4IVRA 3QG5A 5CLLA 2R2AA 2F1RA 3NEYA 4CT4B 1MT0A 1EFCA 3U44A 1PZNA 1OTAA 4TZ6A 1KO4A 1SVWA 2W2TA 4N0DA 3TGPA 3CF0A 2GXUA 1IAQA 4YMVA 3CUEF 2QSYA 2IEYA 2WM9B 3DOEA 4Z1MD 5KPJA 4Z8XA 1NP6A 5AVEA 3THXB 4XT2B 1RRFA 2HXSA 4K08A 2Q9CA 4AKHA 1NLZA 5M04A 1KK0A 2ZS8A 4WXPA 1DTSA 3T34A 3UANA 4WF0A 4EIWA 2K7SA 2PZFA 4DT1A 3U60B 3FGNA 2L0XA 4RD3A 2HYIC 4NP6A 2EYQA 2D7DA 2DHRA 2HV1A 4HOIA 3KJEA 4JLPA 5TV2A 2JGNA 4GP6A 3SNHA 1TQ6A 4OI2A 3KKOA 4DDVA 1DAEA 2RGAA 3ECCA 4LV5B 4YXWD 3CLVA 4U02A 2J9RA 1AS0A 1WMSA 5DNYB 2DR3A 5JJIA 1G7TA 4LBYA 4F3LB 2FDCA 2QU8A 1NVXQ 3BFVA 3NHAA 2QPOA 1GKIA 4DVGA 1G8YA 2WWHA 3QY0A 1YZTA 4CZ2A 4RSGA 1IJEA 3AH8A 2GESA 4KI0A 1IN7A 1Z6XA 2YKGA 4C7OA 1OHHA 2PD8A 3U3MA 3A58B 4B3CA 3IO5A 2NGRA 5SZHB 3ZS8A 3H7WB 4BBTA 1A2BA 2XZLA 2OEPA 4EPXA 4LHWA 3GLHA 3EIEA 2EFCB 3ZQ6A 4DLRA 1PLKA 2PT7A 2PT5A 2PYRA 1D5CA 3AVVA 3VMFA 1XD2B 1XFAA 3RABA 2VP0A 2BMEA 5DHFA 2WAYA 2GCOA 1G3MA 2C78A 5FOTA 2YOFA 1AN0A 1KO5A 3A4NA 4KQDA 3W5IA 2O8EB 4PC7A 1SHZA 3Q72A 5P21A 3GP8A 1G19A 2BHRA 2OAQ1 2B6HA 1YZKA 3I3SR 3QJYA 3AV0B 3CX7A 5FOXA 3W34A 1XJ2A 3SJZA 1FMLA 2R62A 1UKVY 2WMNB 1HT2E 3BJIC 4PHTA 1OT9A 4DT1B 1IOZA 1XD2A 3B78A 1A5TA 2A5FA 3J81k 5KSZA 1WQ1R 3EASA 1TS6A 4M0LA 1KK3A 5DKKA 1KY3A 3FVQA 5HD3A 1H8HA 3B5JA 3H7WA 1H8EA 2GCPA 4Q03A 3N5CA 1D9ZA 3RHFA 6Q21A 2YVUA 4DCSA 2GK7A 2ZROA 2V3CC 1E1QA 4DB2A 1G21E 3K9HA 4MYHA 5L8VA 1PUJA 5CK5A 4C7OB 2IEZA 3IIKA 4TTPA 2WV9A 3OHMA 3O8DA 3SYKA 1GM5A 4O0MA 1GSIA 4HSEA 4PTLA 4LHYA 1IM2A 2RHMA 3FFBA 1JPNA 4E22A 1NG9A 4F3LA 3FKSD 2V55B 2G1JA 2OFWA 4ARZB 4D81A 1CR4A 2C2HA 2AD5A 3KXIA 4IRUB 3CW2A 5KNBA 4V0OA 4A8JB 1R7RA 5IU1A 2WKRA 2ZSFA 1NG1A 3KKNA 3U2QA 2JIZA 3I32A 2G0NA 3TAHA 3X1WA 4JJZA 2BCJQ 3DMNA 1SXJC 1MH1A 1P4SA 4JGQA 2JCSA 5BN3A 1W2HA 5HWVA 1OKKA 1T9HA 2CE2X 2JLRA 3LVRE 4B32A 4BLSA 1W4AA 1VYUA 1R0XA 1OT3A 4IDHA 4QM7A 2GETA 1AM4D 4YC7A 1G7SA 2QAGC 1ZU5A 4DLUA 1W36B 3QOFA 2OHFA 1XPOA 5K8TA 5KSYA 2XEXA 3CKLA 4LJ7A 1QHXA 4EESA 1NBME 1P2TA 1VG1A 2PX0A 3WYGA 1G64A 4B33A 4IXNA 3V00A 2XX3A 3WY9A 1I2DA 2H5EA 2ZR0A 2CK3A 3ASZA 3U6BA 2PDRA 4HB2A 3P20A 1XJCA 3MJHA 4HP9A 4MYTA 1BYIA 1Z63A 3G6OA 1X8JA 4DLZA 3VU9B 3RS0A 4QJ5A 1J8YF 5J4EA 2GZHA 5CK4A 4H6JB 3NWJA 4KBFA 2JASA 4IOKA 3L2OB 2VSFA 2CHQA 3CNLA 4NONA 3RANA 2ZM5A 2ZAMA 2AD1A 1CTQA 2CMKA 5JECA 5HCIA 2EFGA 1KOUA 4UJ5A 3PFIA 2F6RA 1XCGB 1DP6A 2PYPA 2OCPA 3O8RA 5HDCA 1NNEA 4Q4AA 3ZS9A 4KSBA 4NCIA 1E2MA 4GL2A 2Q21A 5EE0A 3K0CA 3SEAA 3IBRA 4BLTA 3L82B 3VKHA 4GW9A 2Z43A 3QXHA 4LJ6A 3WYAA 1Z83A 1XMSA 2J46A 2KB0A 2CMNA 1S1CA 2WIAA 1TF7A 1GITA 4Z1MA 5IF9A 3NKVA 1P9RA 2W6JA 1ZNXA 5F69A 4I1OA 1X8KA 1I4TD 4QNMA 4FCVA 2ZXUA 1JR3E 4GMXA 5KIZA 3B9QA 1OT6A 4BFZA 1VKJA 1RRGA 4IOJA 2OESA 4R3AA 1NMZA 2BC9A 3CONA 4TQ9A 2PJZA 5AUQA 1K8RA 2FEMA 2IYZA 5EP2A 4G5GA 2QG6A 5HCNA 2JLUA 1S3SA 2J0UA 4F93B 3RAPR 2FGKA 2WAXA 2LKDA 2AL7A 2EYUA 3OE7A 4YXWA 3RC3A 2X77A 4N0EA 4ASUA 3VR4A 1N25A 4V02A 3KXKA 2L1MA 3E5HA 3MLEA 4L9WA 5AJVB 2CXXA 4B6EA 1NN1A 1BMFD 3IIJA 3SW1A 4DSUA 1R4AA 2GHIA 3QBVA 3QF4B 1MABB 1R5OA 1Q1QA 4RZ3A 1UWPX 4FIDA 4HJ4A 4G1UC 1G5RA 2ZJ5A 3QKRA 1RIFA 2QGZA 3VR2A 3BB1A 2M1CA 4Q21A 2RGCA 3AB3A 4X8MA 1E2IA 2XTNA 3MRSA 2BOVA 4YDHB 4CGZA 1R6BX 3LQRA 1XX6A 5CYOA 1CJMA 1OXVA 5HWWA 3E4PA 3BORA 4CW7A 1LB1B 2GZAA 3CX8A 3KDSE 1YZNA 4DCUA 4KO8A 2O8BB 4LYHA 2MSDB 1ZUIA 5TBMB 1U0LA 4FMCF 1E0KA 1EG7A 2WPDA 2XNDA 3B6EA 4R2HA 4Z8YA 5FI1B 1E9AA 4BEBA 4JL8A 5JJKA 2H17A 4PO9A 3N70A 3TR0A 3W6NA 4BRWA 1BOFA 2UZ3A 1EFTA 4I4LA 5J4VA 2J87A 4PC2A 3EPLA 3CM0A 2YC2C 3NBZC 2IXEA 4JLAA 1F2TB 2V1UA 4I38A 2KBFA 5DYGA 1YZGA 3TJZA 1VYTA 1N9OA 2PR5A 3I62A 1ZCBA 2QROA 2ZBBA 1BH2A 3VE4A 2QBYB 1S2MA 2BASA 1RW4A 1SGWA 3EZFA 4XD7A 1UGUA 4OK3A 1IBRA 4XSHA 2OUKA 1TNDA 4MGYR 5D3MA 3GLFB 3EZ7A 2W2XA 4QGFA 5HDSA 1D2EA 2P6RA 2OM2A 2W6JD 3GCGA 3LAWA 5GJVC 2W0SA 1UWNX 1G41A 2WKQA 4PAOA 1XPRA 3AM1A 3AF4A 4HI4A 3PIRA 3UATA 3RSOA 3H0KA 2WJJA 2EW1A 1DRMA 2GZDA 4HLQB 1ZM2A 2IYTA 2I3BA 2XSZD 2JLVA 4N3NA 4JT4A 2YNMA 1GDDA 3P4YA 3E4OA 1UPTA 1U2RA 3QNUA 4TLBA 1ZUNB 3QG1A 5JS8A 3FFAA 2YWFA 2OOLA 2PCJA 4ZIRB 3FMPB 2HV8A 5G40A 2GEUA 2IK8A 1S9DA 3NBFA 3IO3A 5TBMA 1IN6A 5E7JA 2DWQA 1CIPA 4NYMQ 4TLAA 1JQJC 1KI8A 4AKGA 3MFYA 1HH4A 4URYR 4UKDA 2FPKA 2ZE7A 5K8LA 1P2VA 4AKIA 2QENA 2WKPA 5AWFC 5BW8A 4FN5A 4GT1A 5D3MB 1KMQA 2Q9BA 4P32A 4Q47A 4D4JA 3EZ2A 4I3JA 1E2HA 1UFQA 3CPEA 1JNUA 3LIEA 2FV8A 2CK3D 3TBKA 5JRZA 1KSGA 4PKYG 1XTKA 4DZZA 4M1WA 5ELXA 4UNPA 1U98A 4JL6A 1AKEA 2OE2A 4DLTA 1KZ7B 2G1KA 2P5SA 1DP8A 3THYA 1U94A 1KDRA 4JLKA 4A0GA 1OYYA 4CEHB 1ZBDA 4MRRA 3O47A 4GDFA 2IUUA 2ORVA 3K09A 3CRVA 2ORIA 3FE2A 2X1VA 2DB3A 4RZXA 5H68A 3DO6A 2A5JA 1G17A 2JA1A 1LT0A 2H7VA 3FDIA 3U6KA 1OTEA 4JJKA 1MKYA 4PR0A 2O8FA 1WE2A 4Q4LA 3D7MA 3ZD6A 1Z22A 1T8TA 3W8RA 4Q1FA 4C4PA 1NN0A 4LZZA 4W9MC 1XMJA 1DE0A 3EXAA 1AGRA 4RD1A 3B2EA 4TLDA 1SVSA 2AXPA 1S4SA 5DJUA 5GJCA 4C0HA 5K8UA 1B23P 2Z4SA 3BY8A 1Z0FA 3GEHA 3GLGB 5JEEA 2V0UA 4PHHA 3BBPA 3MUFA 3MJRA 4LWZA 3HYRA 1FOEB 3IS2B 3TRFA 1PLJA 1IXSB 1JXOA 3B1ZA 4RZUA 1YRAA 3LWNA 3B33A 3JZMA 3NXSA 1XB2A 2AXNA 2WOJA 2X2FA 4G01B 3SZRA 4DCTA 1G4AE 1V43A 2D74A 1DAKA 3KB1A 4JYBA 3BFXA 1YE8A 4A0RA 1DS6A 1M6NA 2CJWA 1Q1ZA 2W58A 2ZTSA 1MO5A 1TU3A 2ZRMA 4FWIB 3SJAA 1T0HB 2JLQA 2CLCX 2IW3A 1XEXB 3RS5A 2O0HA 1Z8FA 3U7HB 4QL3A 2JHEA 2RKOA 2ZRGA 1FQJA 2VEDA 4GPTA 4LDJA 1BMFA 2RHDA 3QKTA 2QRZA 4ABYA 1G3UA 5FBWB 2GXQA 3IHWA 5JHGB 4NYMR 5CB8A 1CJKC 4G5QA 5IS1A 1GOTA 1FNNA 2Z83A 1T1AA 1QRAA 3EC1A 3AUYA 3CF6R 4OHYA 5J40A 1G5PA 5G3ZA 4K8OA 3SQWA 3AVTA 3GJ3A 1QHGA 4D82A 3KUCA 1JAHA 2DPXA 1Z0KA 1T3HA 2B8TA 1PVOA 3LX5A 3SHFA 5J3WA 4TYYA 2LWIA 3VKGA 3MQQA 5DKLA 3OESA 1G8FA 3AGPA 2JJ8A 2VP4A 4TL8A 4DDTA 4FD2A 1XJQA 2BV3A 4R2IA 3BFKA 1U8AA 2L4RA 5A5GA 5DN6D 4KHZA 2NG1A 4A6PA 1GP2A 1W47A 5B57C 1XU4A 1IHUA 4HQAA 3FG8A 3IKJA 4A8JA 4FMDB 4FINA 1CRQA 4BECA 5LDDC 2OZEA 2DWOA 3VX3A 2GJ9A 2VP5A 4ARZA 4LPKA 2BBTA 1KAGA 1VYVA 1ZC3A 2ZSBA 4IVQA 3C8CA 4C0KA 3L0OA 1DOAA 1N9NA 1GNPA 2AR7A 2CL6X 3A0VA 2P5TB 4HB4A 4IDPA 1XPUA 2W27A 4P4TA 4LBZA 4BZPA 2BJVA 2FZLA 1XMVA 1XWIA 1DAMA 3GJ5A 3TVTA 3FC7A 5CB6A 2RGXA 2P0EA 1XTIA 2VLGA 4OHWA 2AK3A 2IYLD 1G3IA 3LLUA 3F1NB 5HE8A 2GAOA 4C2UA 3BRWD 4KUOA 4LHVA 4EERA 2NQ2C 4NZYA 1JR3A 3WXMA 3W3ZB 4DLWA 1TADA 3W6PA 2BMFA 1L2TA 3WBKA 4MH0R 3IILA 5HSQA 1M1YE 3LI8A 2QTVB 4R38A 1E79D 2XSZA 3ZZ0A 4OI1A 4Q1BA 4AKEA 4BLOA 3K09C 1NMXA 2BWJA 3LQQA 1BO6A 3GECA 3QQ5A 3WMEA 4E07A 3TW8B 2FFAA 4I39A 2VLIA 2CHVA 1YZLA 1MR3F 3K8YA 5EZ5A 1S66L 2R6FA 5HZKA 4E03A 1ZCAA 2AFIE 4RD6A 4JGRA 1F2UA 5EXXA 4A92A 2ZJ2A 2GCOB 4H9GA 1T1CA 1KMHB 1SHKA 3OIVA 3OFNA 4NMMA 2WJIA 2IS4A 4KSCA 3K9NA 3ZGXA 2FGJA 2ANCA 2YZ2A 3LDAA 4HUQA 2V9AA 1K5DA 4HAWA 4P4UA 4ERNA 3KTAA 2ZSDA 4Y0AA 1KNXA 1W44A 4LYAA 3ZQ5A 1TEXA 4C0AC 3PCRB 4WBSA 2F55A 1SVKA 1QHIA 3ZIAD 4AURA 1X0OA 3IIMA 1E2JA 1VPLA 4US2R 3ZVNA 2E9SA 5AK0A 2H16A 4ACBA 2ONKA 1IY0A 1Z6TA 1P7CA 1W1WA 4TZ0A 4XWKA 1W5SA 3NBXX 2Q6TA 1PLLA 4TMKA 1ANKA 4GNKA 2VV7A 4TQAA 3K0FB 3AVOA 4Q1EA 1FW6A 3LICA 3CPJB 1F2UB 5EFWA 3DZDA 2FSFA 2AX4A 3ZVMA 1SULA 1E3MA 2C8VA 3W90A 2G0TA 1D06A 5JWRA 5KUTA 1IONA 1DBSA 3THOA 1HUQA 3AEZA 2CVFA 5B58C 1E9FA 2RCNA 4MRSA 2WWWA 1JJVA 2B7BA 1QVAA 1XEWX 4QBIA 521PA 5BXQC 1E2KA 3LD9A 4IFBA 3A4MA 3E70C 2DFKB 3R7WA 2ZUCA 3KZ1E 4NYJR 2CEAA 4Q5IA 3ZDQA 2EA9A 4A6XA 2A2ZA 2V6IA 3LVQE 4HAUA 2CLSA 2ZRPA 4DC9A 3T1TA 2ZRDA 3BC1A 4S2EA 1OB5A 1G7CA 2UZIR 2ZQ5A 1GUAA 2VBCA 2ZRCA 3THXA 4KYUA 5JWHA 4MA4A 2QMEA 2J7PD 4IKEA 4JT2A 4Q02A 1P6XA 4JBXA 1UBCA 3JVUA 4FWTA 1GVNB 1A2KC 2WJHA 2BDTA 4G5OA 5J4KA 5B64A 3CZPA 5TDHA 4KXFB 1KO7A 4OYHA 2YKFA 1FMJA 4HIAA 4DBLC 3FMOB 1EESA 4LYJA 4NHOA 3EPKA 4PPQA 2CCKA 3GEEA 1JPJA 1XBTA 4WZAE 1IN8A 4DDUA 4JGPA 1XTQA 3DOFA 3IEVA 4G5RA 1GTVA 1NVUQ 1RC8A 1O87A 5HKKD 3FTQA 2WMOB 1SXJD 1SKYE 1HYQA 2ZS7A 4HAYA 4AWXA 4DUGD 3A4LA 3SE0A 2QTFA 5CITA 4KAXA 4DRZA 4M9SA 3K1JA 2D06A 1BS1A 4NCHA 4EJSC 5JZVA 2GWHA 1V9YA 2ZI9A 3CRW1 4TYNA 1HE8B 1NVWQ 4RFSA 5DGXA 2NO7A 2VSOA 2D3WA 4KJZA 3TUIC 3OFND 1U81A 4OK5A 2A24B 2JAQA 4LJ5A 3TUJC 5D3QA 3AKDA 2HCBA 3UKDA 1ZM7A 1DO0A 1RKBA 1JECA 2ZI6A 2QP3A 3WBJA 3C14C 2FWRA 4XVRA 4AYXA 2IWHA 4JVLA 1Z2AA 3RLFA 1W5TA 4L9FA 3ZIAA 3S1AB 2XB2A 3F1OA 4JSTA 2BCGY 2IS6A 2OILA 5EP3A 2ODBA 2ZRAA 2GBLA 2VA8A 3IPXA 5KSPA 1MOZA 3SJBA 1NLYA 1KIMA 2ZAOA 5KPDA 4YMUA 3U4QA 1P73A 4B2LA 1ZNZA 1XNJA 2DFTA 4TMZA 1SXJB 1WA9A 4PC6A 1US8A 2TMKA 2WICA 4EPTA 5GVSA 1GZSA 1E2EA 4NCKA 1N9LA 1OTBA 1LVGA 3HU3A 4HDCA 2PR6A 2G88A 4B6FA 5F6AA 4MGZR 1I4DD 3I5YA 3B85A 2DYKA 4BASA 2IT1A 1S1ZA 4B9OA 3B8HA 2O8CB 4TYQA 3Q7PA 1OH6A 1DAGA 5G3YA 1ESNA 5J5CA 2GK6A 2F1JA 4C0BA 1Q1EA 5ANRB 4M21A 4PZYA 1TS8A 4URWR 3NHQA 2SHKA 5KU1A 2A7QA 3QENA 3R8FA 1PJRA 2V7QA 4ZCMA 3VR3A 2ODWA 2IYVA 1DAFA 1F6BA 2P67A 1IXZA 4NU0A 2IF0A 3WHKA 3WNBA 4P4SB 1HE1C 2HT6A 4CEJB 1Z06A 3C4JA 1OJLA 1SZPA 5DLQC 1KHTA 1XEFA 2REXB 1L8QA 1KJWA 4TT3D 3KQKA 1TF2A 2O52A 2IYXA 1MZUA 1JR6A 4FMDF 4BLPA 1Q44A 5FBQB 1M2OB 3UPUA 3GJ0A 1TAGA 1E2LA 4WN5A 1ZP6A 2JJ1A 4PZZA 5IDVA 5HE9A 4WVFA 2DY1A 5EE1A 2IA5A 5JS7A 1JQLB 3E1SA 4BRUA 1E2GA 1OPXA 4GSYA 3CH4B 1ZAKA 1GWNA 1U8YA 4CRWB 1Z29A 2X19A 1VDZA 4KFTA 5JWOA 2FX3A 1PV4A 8OHMA 4JYCA 4QM6A 3BH7A 1N6PA 5LPNA 1TEVA 4I5SA 2HUPA 2C04A 1LF5A 3R9WA 1X3SA 4HDQB 1J2JA 2PCLA 4NCJA 2ZR7A 3UWKA 4OQLA 1LFDB 4B3BA 3LYXA 2ZUBA 4QJ4A 3M1IA 5JBQA 1NKTA 3U7EB 1VIAA 2LKCA 5CM8B 2ZANA 1II0A 2VIIA 3CO5A 2JJ2A 1A82A 3QVVA 2O8FB 3A1TA 4Q00A 3QXJA 4MGKR 4XH9B 2VP9A 4JVNA 1OH5A 1O3YA 2EWVA 3HU1A 1Z0AA 1W4CA 3AVWA 5AJZA 2EFEB 4P0TA 3T06B 5DISB 4ZIRA 2AHOA 5AUOB 4LLOB 5A0FA 1Z08A 3FMFA 4JLDA 4PC3A 4B3FX 3Q9LA 4KLNA 4RY2A 1VG8A 1VTKA 5EP4A 4I81A 1ETUA 4HJ6A 1GL7A 1HQCA 3LXRA 4G5SA 4LV6A 4X8OA 5CIQA 5FR2A 1T3LA 3U3JA 3OIUA 1XXHA 3W8NA 1T19A 2BVNA 2W00A 3HJKA 2RH5A 4V0ME 1Q57A 4MUAA 1EW0A 2ZRFA 1BIFA 1JAIA 2FOLA 2VTKA 4A4DA 2J7PA 1FTNA 3A1WA 3GJ8A 3NG1A 3ASYA 3H84A 5CYPA 4XVUA 1RPZA 1ESMA 2ZUDA 2VHJA 3PG5A 4E09A 2QBYA 3PUWA 4RVCA 1Q21A 4AD8A 4JKIA 1OXTA 4DEYA 1E98A 2QT0A 3RVBA 2D01A 3KUDA 3IPYA 2P7JA 1F2TA 1WB9A 1M34E 4U00A 4QGGA 3KQHA 2Z0MA 3UMFA 2IWRA 3BOSA 4QFMA 2YHSA 3U3RA 1GNQA 4ZDIA 3HDTA 3ZZUA 1HTWA 2VHQA 3IBGA 2Q9AA 2IXGA 2KE5A 2QAGA 2ZJYA 1CLUA 3GLGE 4Q9HA 4D6PA 4D4LA 4Q7LA 3PV0A 1GILA 4X8LA 1AQYA 1HQYE 3C7KA 4JLJA 1L4YA 3B13B 4KFRA 4MN5A 4RJLA 4YMWA 2J59A 5BN4A 1TTTA 4EEUA 3U7GA 1W49A 3D6TB 4EAQA 2C9YA 4URVR 5H1YA 4QHYA 1OHHD 1ZMXA 4Q4HB 4FMBB 2FJUA 4TSFD 4YONB 3QPVA 3UXMA 3EEHA 3ZYCA 3F3YA 2VH5R 5B30A 3C16C 4NYJQ 5LBIA 3B1YA 221PA 4TL7A 3SC3A 2R78A 1T4GA 2A78A 1W0KD 4TQUS 3VQTA 1D7EA 4MKHA 1J8MF 2PLRA 2WJYA 2IHYA 4IDOA 4TYWA 2CLDX 1P75A 5CM9C 1RRCA 3CAXA 1UKZA 1XMIA 3LBHA 4B44A 2NZJA 1GG2A 4L8GA 5TXGA 5JJLA 2V1BA 1JALA 2N1BA 4KFUA 3PEUA 2EU8A 2QQ0A 3BY9A 4M53A 2FE4A 1ZYUA 1EFRA 4MQBA 3H82B 3GJ7A 3OAAD 2H18A 4RZ2A 5JSZB 3ICEA 1S9HA 3NIBA 4I1UA 2BEKA 3LRPA 4JL5A 4PPFA 5G41A 1AK2A 5FTMA 4EPVA 3VHXA 4CYMA 5CLQA 2GJKA 1QG2A 1N0VC 3GMTA 2GBLC 3K70B 3R9IA 3MSXA 1ZD1A 1GRQA 3TSZA 2V7QD 4ZPXA 1AZTA 2OAP1 2PLFA 4RQ9A 2GRJA 4QBGB 4YLGA 5JMTA 4IW3B 1ZW6A 3SU8A 1QZXA 1KI6A 2ZS9A 4EQ6B 2ORWA 1Z5ZA 1E2DA 4PKYA 1SVOA 1E9RA 3CRMA 3K70D 5IK2D 2RGDA 5F3WB 3I8XA 1EX6A 1G8PA 1ZM9A 3R9XA 1R0WA 3EWKA 2B8WA 1EGAA 1E1RD 1GKUB 4JS0A 2WTUA 2GF9A 1YR7A 1QHHB 1TL7C 4B35A 1OW3B 4DSTA 2GCNA 4LK2A 4X8HA 2ZU0C 1VG0B 4S35A 2IYYA 1P2SA 2ECKA 4NYIR 3TAUA 1CJVC 1FL9A 2OCBA 3G82C 2HF8A 1WBDA 3GLFE 3CNNA 3T1VA 3P26A 5FBLB 4I3IA 3EIHA 4M22A 3VU9A 3W5JA 1UM8A 4C3ZA 1OH8A 1OKKD 4GS9A 3UWOA 4TLCA 1F98A 3H1TA 5E3HA 1F5NA 1U9IC 4EJSA 5FPTA 2E87A 2QE7D 3PR1A 1GAJA 3X1ZA 1LW7A 1IN5A 821PA 4KITB 3RRZA 1ZUHA 1DG3A 3PEVA 3VR5A 3KJHA 3MG9A 4FXPA 2VYFA 1Z2CA 3A1SA 4UXJA 2C96A 1U8ZA 4R98A 4D0LB 3TE6A 3C5HA 2ZYTX 5FPYA 4IDNA 4QXAA 2D7CA 4F4IA 4L9GA 1L7VC 1Q22A 3BK7A 2WWYA 2JN7A 1J7KA 1OYWA 1E6CA 2RGEA 3SHWA 5KHOC 1NMYA 2H8KA 1VCOA 3HJNA 1MV5A 2WWXA 3EZ9A 3U7FB 2NO6A 1LS1A 1E4YA 2ZJ8A 5FR1A 1R5BA 5JLJA 1OXSC 4ACAA 2CHGA 3NC1C 4L4UA 3E2IA 2ZYVX 1VCIA 3AKCA 4OHZA 4D4MA 5FTLA 3RS3A 1ELOA 3SDZA 1FX0A 1P2UA 3QPUA 2A5DA 5BWMA 1S3GA 1NY5A 2VP2A 2WWIA 3AQ4A 3KXLA 4HZUB 2E1RA 2BBWA 4LJ8A 4LSGA 1XRJA 4HB0A 2C99A 3GPLA 1RE0A 4V03A 1MO6A 4JLVA 4JMPA 2J41A 4Q4JB 5FTKA 2W0MA 2Z6VA 1D9XA 4BZXA 3L8ZA 1KGDA 2HJGA 1OE0A 4BQSA 1CXZA 2I1VB 1OFTA 1CR0A 4UXHA 4DIDA 4D26A 2VHCA 1P72A 5IK2A 4LRZE 4URZR 2CCJA 4JVMA 4DJ3A 2HDNB 2N42A 2PEYA 3NH9A 3W6OA 3LIDA 5HD5A 2A30A 4WOPA 4A2QA 2VPPA 1E1RA 3MWJA 4R7ZA 1AS2A 1ODFA 1S4QA 1Z6YA 4PO8A 5TB5A 4RD2A 3MQOA 3H86A 1XCPA 2RB4A 1FFHA 3DM5A 1Y28A 3QXXA 4MKFA 1VMAA 2P3SA 1NI3A 3CH5A 4HLUA 4NBSA 2V54A 4BBVA 2VV6A 5FL3A 4A0FA 3ADBA 2JLXA 1BYUA 121PA 2KBEA 1JI0A 1TUIA 1WDTA 1XJ3A 2J1LA 3IEUA 3L8YA 2C5LA 4R9UC 1Y63A 2F3RA 2Q3HA 1P61B 3M4YA 1N2CE 2WSSD 4OKSA 2D2FA 3F0TA 5AJYA 4NL4H 1KI4A 3ND8A 4RFVA 1L4UA 1COWD 1ZNWA 1NSFA 1G8GA 1N6RA 1P60A 1FUKA 4CDGA 2VEAA 3VX4A 2H28A 4JGOA 5DJTA 2AK2A 2GJSA 2ZI5A 1RJ9A 3T12A 4EFMA 4JSYA 1T18A 2ZI3A 2XZPA 4FCTA 5C4GB 2ONJA 1Q3HA 4I3AA 1G5TA 4LJ9A 1DVRA 3ZLJA 1XD8A 4B3GA 2W0NA 2QP9X 4ILEA 4M2LA 4B43A 1NLFA 3FHTA 2B02A 1FNMA 3GJ4A 1S1MA 3OAAA 3LBIA 4GOKA 3Q8XB 4WUJA 4MDEA 3BWDD 1NJFA 1F9IA 1FPMA 4M4SA 3AF3A 1B0UA 3QIAA 4TN1A 1E94E 5EUQB 5J4HA 2C98A 4IOLA 3CR8A 4ZKEA 1IJFA 3B7GA 2PBRA 5G4YA 1AZSC 1HT1E 4KU4A 5L3QA 1ZD9A 2A5GA 4U7DA 2GVDC 4WXRA 4XT2A 3K9LA 3GLHB 2CE7A 4LJAA 3QKSB 2I1QA 3GLIE 4L9EA 5CDFA 2RGNA 2V6JA 4LRXC 3FMIA 4G3XA 2QPTA 4PFSA 4IOMA 4L16A 4MN6A 2CL0X 3BGWA 4LGMA 5IRCD 1K5GA 2BMDA 3OEEA 4GMDA 4HZUA 2H57A 4US1R 3MJQA 1KMHA 1ONBA 1Z6GA 2ZR9A 3SYNA 2XOKD 4HAXA 1V9ZA 3LBNA 4EETB 2ZE8A 2FSIA 2ZETA 4ZKDA 5KDLA 3OE7D 1G291 1MO4A 2GILA 2PZGA 2QEQA 4PAQA 1Q1BA 2QQEA 1ZD8A 4ASUD 5TVKA 2IX3A 4JIMA 2QI9C 1U90A 3D72A 1GFIA 2NO1A 4PQFA 5DI3B 2PL3A 1Q20A 3MR0A 3THWB 4AC9A 2QSZA 4QGHA 1N0WA 4HY8A 2DFNA 1D2MA 3EARA 5J47A 2J80A 1GIAA 3TNFA 3RC8A 1XJ0A 1P9WA 5SZIA 1OJGA 3DM9B 4HH3A 4LC1A 4CIDA 2V1AA 3MWYW 1S67L 4YMSA 1YHNA 3REFA 1AKYA 1RYHA 3QEOA 2XTZA 1I4LD 3OLOA 2ZE5A 1UEJA 2FNAA 1W36C 2GXSA 3PUYA 2GF0A 2QE7A 2WJVA 2ZJAA 4IVPA 3C41J 2D2EA 4OJQA 2WSSA 4JLMA 3AP2A 2GKSA 3OF5A 4ZV4A 1A7JA 3TQCA 3DEFA 2BEJA 1N5LA 1D6JA 4Q7MB 1UJ2A 1YVDA 5KTYA 1CEEA 2WHXA 5CIWA 1FX0B 4LJ4A 4A9AA 1X6VA 3OIYA 3VOLA 1N6LA 4C9BA 2RMKA 4NYIQ 4DLSA 2JATA 1E69A 5HZHA 1KTVA 4HZIA 4IJMA 4WZ6A 4E5UA 3U44B 1II9A 3K0AA 2L0WA 2KWIA 1QVRA 4DSNA 2VHUA 4KVAA 2JLSA 1Z3IX 4WL9A 2R6GA 2X2EA 4R71A 1X1SA 2IYRA 2EQBA 3DMDA 1X86B 3P32A 2B92A 2Z6DA 4TL9A 4V0NA 2PMKA 5DH9A 1XDBA 2DWPA 1P97A 1JJ7A 5GJWC 2IXFA 3SBDA 3ZH9B 2P2LA 4YQFA 3SS8A 4TYPA 5AUNB 3PJRA 1AQUA 2WZQA 3H9WA 3LUQA 1KYIA 2CNWD 3CPHA 4II7A 3ADDA 4XD7D 4M1KA 5FUVA 1Q0UA 3UMDA 1P9NA 2MMCA 5FH9A 4EXOA 4HH2A 1GKYA 2YOGA 1XJ4A 2QUZA 5DIFA 5G53C 1OXXK 1E9EA 1KI6B 3K53A 1KKLA 1NVVQ 3MMPA 4GOJA 5DSZA 5KYKA 1KDTA 1H8HD 4Q66C 3ONWA 1YR9A 3CWQA 4YWZA 3CLOA 3QF7A 4Q01A 1E1QD 4GS9B 1F60A 2F9LA 2ZRBA 2FN4A 1T91A 2K5UA 2Q3FA 5FTJA 5FPKA 2EFDB 3K3DA 1YRBA 3FWYA 4DWJA 2AKYA 4TTRA 4F92B 1XEXA 4A15A 4LHXA 5EXSA 3BE4A 5J4LA 2HT1A 4DJ2A 1XTJA 5L3SA 2CJWB 2IBMA 3RH8B 2HYDA 3FKSA 4Z51A 2JLYA 1Z0JA 2O8DA 4BFYA 2FFQA 4URXR 1X8LA 2OV2A 4D4KA 2Z4RA 3KX2A 2VRWA 2ZI7A 3THYB 1VIYA 3Q85A 3KKMA 3KKPA 4XOIA 1ODVA 1CKEA 1X1RA 2ODEA 4TMWA 2F43B 1OTIA 1E32A 3L0PA 1G1MA 2QWSA 3T5DA 3IS2A 2ZPTX 2I9VA 1LV7A 2KX6A 3EAQA 3I1FA 3NOUC 1D8TA 4BFTA 4M9QA 4L9SA 3OEHD 4HAVA 1R8QA 2ZREA 1H65A 1II8B 3NDBB 4YMTA 4MITA 4Q9KA 3QSYA 1A4RA 2UVQA 4Q4HA 4I99A 4MRNA 4DLYA 3AVPA 5JFGA 2ZITA 3GQBA 2YWGA 3CRQA 3M0EA 3Q5DA 3RS4A 3P1JA 3U3OA 2J5XA 4PO1A 1GRNA 4TMTA 1QHSA 5JSZA 1BYWA 4P31A 5FFMA 3X1DA 4ZDJA 5EZ6B 4D0NA 4DXAA 1T6NA 3EW9A 5HDDA 4EPWA 1UBEA 2V8OA 1EK0A 2D62A 2WSMA 2VV8A 4LBWA 2F9MA 2OBMA 2ZJOA 1M8PA 1T1BA 5DI9A 4MRPA 4PHFA 2OG2A 4F4CA 4AI6A 3JVVA 4IEIA 3TSOA 4OI0A 4ZDKA 1OIWA 1SXJE 3BH6A 4HI0E 4M4XA 4OQFA 2QGNA 3NJAA 2ZE6A 4C0SA 4EUNA 2RAPA 2J0VA 2ZJZA 1XJ6A 3HPRA 1KI1A 2KDKA 4GHIA 3IQXA 1H8ED 1GL9B 1YZUA 4M8NE 3HR7A 3GLFA 4DCVA 1QDEA 4CEIA 2V0WA 1DO2A 3A6PC 3I8SA 3N2IA 3OEED 2KJQA 3RTYA 4KUKA 1VG9B 4EPRA 2WVJA 2XOKA 3V4RA 1JR3D 3A1UA 1G16A 5C46F 4MDFA 2J0SA 5FL7D 4LRWA 4O2RA 4BUJA 1EWQA 4LV8B 3AF2A 3TKLA 1E79A 3UMSA 4M1YA 4BE7B 1VHTA 4LUCA 4A8JC 3DKPA 1EFUA 1R0ZA 3ETLA 1YZQA 4O3MA 2FZ4A 4HUTA 4IXMA 621PA 1NN5A 1Y3AA 2OXCA 1UAAA 3QUSA 3EIQA 3H2YA 1OFUX 5BYJA 4Q7JB 4TL6A 4XWOA 3E4QA 3C5CA 3VR6A 2R6AA 4C0JA 4UNRA 4F91B 5IT5A 3KX0X 3QE0A 3SFZA 2VP6A 4Q1CA 4Q7KA 1SVMA 4OL0A 1LNZA 3T50A 3GJ6A 5KO2A 4HLUC 1ZJ6A 1YR8A 4LPZA 4L15A 4BEJA 1KNQA 1Q3TA 1TS7A 2GJ8A 2QMHA 1W36D 4DIEA 3NDPA 2AWOA 3FYHA 1C9KA 5H70A 1HEIA 5FBRB 5TMPA 3EZ6A 1E2PA 3QKRB 4JLNA 1NWZA 3TW4A 4DKXA 2IL1A 1T5LA 3SJCA 1LTQA 3QF4A 3RSLA 2OLKA 3V4FA 5BN5A 5KSOA 1XF9A 3QBTA 4AG5A 2Q0HA 3KKQA 1MRNA 2NOAA 3Q7QA 4B73A 1EWRA 3DVLA 4QBHA 2LCFA 3C2WA 3VE3A 2H92A 2P6NA 2ZRKA 1UF9A 3AVQA 3CR7A 1GL6A 4HAZA 2ATVA 2ERYA 4XWAA 3ZJYA 1KAOA 4TMVA 5A4JA 1YKSA 5I5LA 2XXAA 2XNDD 5F98A 4QG7A 1DP9A 4A0HA 1OIXA 5LD2C 1SVLA 2J0UB 2IS1A 4NPHA 4AG6A 4GBMA 2GDJA 2CNWA 3PVSA 3AF1A 3A0RA 2FSGA 2F1IA 2WBLC 3RRNA 4BBUA 1K6MA 1AS3A 1CR1A 1GRRA 1NJGA 3AF0A 5AJWA 3TIFA 4HNBA 2R6CA 1DG1G 4PQRA 1U0HC 3K0EA 5KNDA 3K70C 1TS0A 5HPYB 3NBYC 2ZOIA 2C03A 3CRRA 4D0GA 5HR5A 3KQNA 1DEKA 1N6HA 3LIFA 3EG5A 1KSJA 1TF5A 1E9SA 1E0AA 1ZIPA 1S0UA 1HURA 3FPAA 1E2FA 3W9YA 3WHLA 3IUYA 2KSQA 1U0JA 3GEIA 1EX7A 3A1VA 1VHLA 1RZ3A 2ZRIA 3RRYA 3RDPA 2XNSA 1OJ5A 1M7BA 3ZZTA 1KI7A 2V1XA 1GNRA 2QP4A 4Q4AB 4HLCA 5FL7A 2EFHB 1I2MA 4M1OA 1QHYA 2F3TA 2R65A 2XTMA 1WP9A 1UKEA 4NKRA 4UNSA 5FOVA 3UIEA 3GLHE 4GRAA 3VNVA 4V0MA 3BB3A 1W0JD 2NO9A 2BKUA 1E0SA 1WF3A 4IFEA 1XZQA 3UG6A 5HKKA 5DYIA 3RNLA 4CVNA 4C0LA 2WWGA 1SXJA 3G5UA 3PXGA 1UBGA 4QJ3A 1M7HA 2PJRA 2ZJBA 1DAIA 3I73A 1T3SA 4BWYA 1E9CA 4FCWA 5K8IA 2AFHE 4A82A 1C4OA 2B21A 1XCMA 3EWAA 2AWNA 4BLQA 2INWA 1G20E 2ZU6A 5C1BA 5DHAA 1UDXA 1CU1A 3S1AA 4P4SA 4CEJA 3CB4A 2XITA 5JHHB 2IS2A 3BWLA 1YJ5A 2GEDA 3OEHA 1G8HA 1CS4C 2B7CA 3TH5A 2J0QA 2ANBA 2PX3A 4JZKA 1OF1A 4DLXA 1TUEA 4A2WA 3L43A 3LW8A 4ZCLA 2QZ4A 1SKQA 1KJZA 3B1VA 1S1YA 4XSGA 2AN9A 5LB4A 4DCNA 2YOHA 4JLBA 1E96A 3AP3A 1N6KA 3GFTA 1FQKA 4FI3C 4Z54A 3UB8A 2FSHA 5E95A 2O8CA 3N2EA 4HHDA 4QC2A 1TPZA 2WPDD 2YINC 2XJ4A 3C8UA 3QI2A 4WW0A 4DLVA 1CF4A 1UKYA 3NC0C 4AK9A 2WWFA 5EJEA 1OH7A 1IY2A 1RRPA 4P33A 2QMUA 2DBYA 3A0SA 1SVIA 1OSNA 4HP4A 1AIPA 4L5BA 4M1TA 2QMOA 2ZIAA 1Z47A 3MWLA 4GI7A 1R10A 2VF7A 3B82A 4WIAA 3TR5A 3O8BA 1NL3A 4KODA 4B34A 2OWJA 3H4MA 2D02A 3F1OB 1FUUA 2O0JA 3I72A 3QEJA 4XVQA 3O8CA 2QJ5A 3LI9A 3HWSA 3BXZA 4R6LA 2NMVA 2CVHA 2Z5FA 3UMEA 4NDZA 4AYTA 3I92A 3A8TA 1CR2A 2XAUA 3AP1A 4C0QC 2A24A 1XTRA 1T0JB 5JRJA 4QNRA 1KO1A 4LYFA 1U99A 2G77B 4POAA 4QHSA 5JCZA 4WLAA 2QTHA 4RD0A 1Z07A 3EWSA 4TT3A 3HP1A 3SFVA 2QPAA 4OQXA 3REGA 2HF9A 4PSVA 3CF2A 4OBEA 3R7WB 3WMFA 4BFUA 1KI9A 5FUWA 3WNDA 3ZVLA 3WNCA 4MKGA 2QA5A 1WRBA 2PMDA 5HTKA 4IDQA 3QKUA 1CRPA 4P3YA 1KSFX 3EA0A 4KLZA 4RD4A 4JKYA 2CL7X 1UEIA 3D3QA 2FEOA 4MUBA 2OBNA 2YV5A 4Y0VA 1QHNA 3C15C 1S4RA 3BS4A 4GP7A 3PENA 3UK6A 2O8EA 3NOTC 4UQOA 4LPSA 5SZKB 5IHPA 3TSWA 4A2PA 4Q9IA 1IXRC 3CX6A 2BKEA 2ZYWX 4AIIA 4D80A 1E99A 2QN6A 2EWWA 1AGPA 2OSBA 1F3OA 1RJ9B 1XTSA 4LY6A 3L0SA 4DB4A 4JBWA 5EE5B 421PA 2HEIA 5GADl 1EFHA 2F1HA 2BM1A 3KJIA 1XXHE 3T5GA 3RWMB 4HEJA 2HJVA 3QKSA 4KBGA 1OFHA 3CNOA 1E2QA 3RYTC 4B2IA 4B75A 2REOA 3KTAB 5F68A 4HUQB 5L3QB 5FUXA 3T1OA 2QHKA 2WOOA 4WAUA 2YWEA 3KQLA 3LA6A 3UB6A 3VAAA 3PYPA 3AKEA 4NCNA 4B2PA 3I5XA 1YR6A 1OLOA 3WRYC 2A9KA 2V9PA 2OXRA 3VKWA 1RFLA 1P62B 3LO5A 5DN6A 4WA7A 1NBMD 3K0FA 3X2SA 3MWKA 4QGAA 4K81B 2MMGA 2C95A 3B9PA 2ZVQX 3VTKA 2FG5A 3K9GA 4ON9A 4QBFA 4EQ1A 5JI3E 3B1XA 3PUVA 3Q5EA 4O2LA 3M6AA 4OQNA 1NKSA 2YYZA 3CWFA 2WIBA 3F1NA 1GSWA 3ZVRA 1HY3A 1G3QA 5CJPA 4TTQA 2ZOHA 4W5HA 4BFVA 4AYWA 5AR1A 4LI0A 2IYUA 4B74A 4PZLA 5KDOA 1KOFA 4Q9LA 4LOAA 1NN3A 3LIAA 2HCJB 3IQWA 3T35A 4KFSA 2JLZA 2VF8A 3D31A 4PPGA 2G6BA 5TY0A 1KZGB 1Z0IA 2OCYC 1OFIA 3D8BA 3MXQA 1J90A 4MKIA 5F5YA 4CT5A 2HLDA 4HYYA 2GAAA 5C4MA 4PSAA 4DDWA 1RVDA 2H1LA 2P65A 4W5JA 3R20A 4ZDWA 4EDHA 3ZD7A 5FUYA 2ZEJA 3SN6A 3AVYA 1GSXA 3X1XA 1ZM4A 1NY6A 4MRVA 4DSOA 3FB4A 3X1YA 1W0JA 5JCPA 2PD7A 3BB4A 1YU9A 4B47A 2J3EA 3T1QA 4F4JA 3SI7A 1P0ZA 2ZRLA 5FI0B 3RS7A 1KDPA 1E4VA 2OT3B 2ZRHA 4BZQA 2BBSA 1N6OA 1XP8A 2XJ9A 2GNOA 2W6ID 2R6DA 1JNYA 3EC2A 1JXMA 4F7WA 2FA9A 1AA9A 2Z6CA 1NRJB 2IF2A 2REBA 2ZRJA 4Q4JA
chains in the Genus database with same CATH superfamily
3CCBA 2ZVDA 4OHPA 5DNWA 2QNRA 4YMIA 1VJCA 2BGJA 1R5NA 2PH1A 1D4ZA 4IKPA 4QYIB 5CNKA 3TVDA 5K6TA 1C4WA 2VSXA 3A9VA 3PX2A 3IBYA 4FMCB 3OT5A 4O33A 4Y1FA 3ZHHA 3K30A 4JV5B 3QU5A 4RKFA 5EHNA 1SCBA 3N05A 4MW4A 4MRMA 1DJPA 5IDWA 3L0DA 1U3FA 3SG0A 4HSGA 3QV1A 3UB7A 2GVZC 1NMEA 3GVBA 4JI0B 1J49A 5A9RA 5EVID 2F3UA 3UOAB 1BCSA 4G67A 5FUMA 4CU5A 5A62A 5LDHA 1S96A 3P5SA 4WINA 3ILSA 1KVRA 3N39C 1DC5A 3I61A 4L8FA 1P2BA 3THRA 4PCVA 2H4FA 2JKVA 5DOVA 1ONSA 4RAQA 3ICQB 2CN1A 5LZ7A 3ENQA 3GW8A 4RMJA 2GDNA 2BI4A 4E1VA 5E4FA 1EK1A 2BEWB 2KI5A 4OHVA 1C9MA 1OMOA 1G3RA 2IOHA 1BKDR 4PAMA 2QWXA 2JIQA 4JY7A 5IMSA 3AR5A 3WYEA 1S6YA 5CA1B 3U61B 4ED9A 1J0EA 2WC1A 3L3BA 3PBSA 3PTZA 3QV2A 5FOUA 5LZ5A 3VR1A 2B8NA 1WA5A 2H54A 1ZNYA 2HWUA 3DLTA 4RY0A 2ZUTA 3OZDA 4ZU3A 1S5PA 1YHZA 1F0NA 4EITA 4BBAA 3DDUA 1LGYA 4OX9B 1X7DA 3GH1A 4N1AA 4KO2S 3RJTA 1C1HA 1P1JA 1QDLB 2P6UA 1LL5A 3O4JA 5EXTA 1BEUB 3QVJA 4FSFA 4Q37A 1FDVA 1SCJA 2PZKA 5HFAA 2FSVA 4Z4QA 2VPZA 4TLEA 1PL8A 4E3WA 1HL7A 2W3EA 1YMVA 1LRLA 5BV1A 3BJZA 3IUEA 5ITZB 1IN4A 3UHJA 4DZRA 5IKPA 3P7NA 1KZ1A 4JUAA 3SZOA 4CQNA 3H9GA 4HEFA 1QTQA 1MTZA 3QLJA 4BFWA 3T4PA 2VG8A 2OBLA 3PUZA 2NPIA 3WWPA 4CFYA 2GS9A 3GZJA 4EVIA 2CXSA 3TIGA 3TPCA 1EKXA 3IUSA 3NOPC 2XD9A 3UMRA 5B1IA 4AG3A 3GX1A 3FVVA 3OJFA 1DIAA 4IBOA 4LJLA 5EIAA 3NI2A 4LZWA 3STWA 1IE3A 4BD0A 3FIJA 1UC4B 1VBMA 1NZUA 4GOXA 2ACKA 4M8SA 1Y4OA 1LQTA 3CZDA 1QQ6A 2CYAA 3P19A 5CDFE 3NIFB 5KYUB 2OGWA 1V4VA 3WLEA 2X01A 2Y8EA 4YJGB 2XZOA 1Z28A 3KZVA 5I9LA 1GT6A 2O2GA 3BERA 4FFDA 2ZYIA 16PKA 1CP2A 4LDNA 2DTEA 2GT1A 1M1NB 3GL9A 4UNNA 2NU7B 2IGTA 4FTXA 1SU7A 2QTGA 4KQEA 3PC4A 1RT9A 3CT4A 5B1DA 3PFGA 1R4NB 4PSDA 2XFSA 5F4ZA 4A1FA 4C6RA 1E9BA 3KJGA 4P83A 3DGFC 2QR3A 3HCEA 3KFXA 5HFNA 3UE3A 3H6HA 3T9DA 3B60A 3MEQA 4BX8A 4FZVA 4HLDA 1GQRA 2Y67A 3MKFA 2IUTA 3AUXA 4IL5A 4TUYA 2OXFA 3Q3EA 1QU2A 3KSUA 4JMLA 5FPQA 3IDQA 1NFFA 1I3OA 2C9OA 2QNIA 5DHRA 3U26A 4XAQA 2VRCD 1R2QA 2YWHA 3GLIB 1BJRE 2CBZA 4X60A 3EX7C 5JCJD 4BLMA 3TSCA 1HBJA 1RI4A 1WCV1 1EFRD 2QW1A 3DBHA 5HIMA 4BGIA 2FF7A 2QXTA 2QAGB 5CGWA 1SJ9A 5FLEX 5ALVA 3H87A 4FC6A 4GDNA 1U9YA 3GO4A 5HKAA 1PFUA 4WCFC 2PVSA 4LGYA 1NVFA 1PSWA 4M1SA 2Z30A 1EXDA 3GPCA 3ZEAA 1P2GA 4HB3A 3C6BA 1UADA 1NY0A 5EJ4A 2VYND 3W8KA 1Y4ZA 2HXGA 3OLXA 4TMXA 3NW9A 4YFMA 1V0JA 2RK6A 5E6UB 3LV8A 5H59A 4CMHA 1T13A 1JEYB 4MUNA 4NIMA 1OBVA 1RD4A 4HO1X 3WIOA 3JW8A 1IOUA 3LXXA 3DHWC 5BWNA 1T5IA 3FNIA 4ZI2A 3MT0A 3SXUB 2ZSEA 1MA0A 4G4GA 3I09A 2PYIA 2XMPA 3KRTA 4RKEA 4P80A 5CJ2A 1DBWA 5FADA 4ZI7F 3MS6A 1K54C 1XAGA 1K38A 2P78A 4FW9A 2E85A 2ZL1B 3ADKA 3BN3A 5B1HA 1HE3A 1XVVA 4B4KA 4DXHA 4G0WA 5JATA 1Z3CA 1ZU4A 2BN4A 4QEZA 2RGWA 4K46A 4X1MA 5IS2A 4H4DA 3AFGA 1I9GA 3SR0A 5LL6P 2WKHA 1H2FA 5CHJA 4PCUA 3KHSA 4L4SA 3FTPA 4LSZA 4ZD6A 2FH5A 1GYQA 2PO5A 3CVVA 1JEDA 2EL9A 1DCFA 2PSDA 4BMSA 5HNKA 2Q5QA 4XPZA 1DWPA 2I8AA 2XE7A 3C39A 4QBTA 4WK2B 5JR3A 3Q11A 4PC1A 1PG2A 4LOJA 2QUKA 3QGMA 3ETDA 1IEQA 1ZIOA 5HF8A 3CNBA 3RTGA 2IHBA 4C3QA 2HF6A 2XNCA 1PWEA 3YASA 3I4LA 1FBTA 1A96A 1Z75A 1MXOA 4OGLA 2GD6A 1O97C 2JFZA 4U2EA 1Z4IA 4W5WA 4EPYA 2O5VA 2OCAA 1YS4A 3IIIA 5KTMA 4UA9A 3GGGA 2D13A 2OBYA 4OXRA 1H1TA 4WSOA 6LDHA 1DKQA 1HORA 2NM0A 1M2FA 5IC6A 3RASA 1HLFA 3TEJA 4HNQA 3JYPA 4EABA 1B42A 3RR2A 1ISHA 4BGDA 3KM0A 4UEJA 3VZPA 5FOWA 2NYUA 1YZVA 1T6BY 5T67A 5M18A 4WEOA 3USCS 5I01A 5IKEA 5L3RA 1ZRHA 5F1GA 2JGMA 3KB2A 2O3QA 2Y4OA 3WNQA 3ZE8A 4JZYA 2AMFA 4WXEA 4HFJA 2O07A 4DA7A 4YX9A 4LCBA 3DMHA 1QGYA 1HM5A 4RHXA 4S2PA 4CJXA 3D0RA 5IJ9A 5K3OA 1YRYE 2ZB8A 4TXLA 5D86A 4D3XA 1NXXA 3AFIA 1CPYA 2H1WA 3LW7A 1MABA 1OX6A 1DV2A 4KR9A 4JI2B 4IHQA 1TVCA 2I3DA 3QTLA 4U7FA 4BMCA 5JH7B 3PHYA 1J9ZA 2J7KA 1LLUA 3GHHA 1EFPA 4H60A 5LDGA 3DKRA 4W8GA 1WBJB 1RYFA 4US0R 3JWPA 4PXAA 1NI5A 1ZH4A 2YASA 1H3FA 3F5DA 3PJDA 4WKCA 5CCXA 2QR2A 2SBTA 4U7TB 1BTLA 4UE6A 1K92A 1Q2XA 4PLVA 1V95A 4OF4A 2OVFA 3HSYA 5E6SA 3GLIA 1LPBB 3OPHA 3W2FA 4ZZ3A 1BXRA 1M2OA 1FSSA 3AOGA 4J2OA 3U0VA 3AU9A 3AVUA 1S8FA 4D25A 1NOJA 2CLKB 1XG5A 4JVSB 3OKFA 4HFMA 4TKVB 3BW6A 3B1WA 3K2EA 2YN4A 3C1TA 1PFWA 1WY7A 2H7XA 3HU2A 3GR6A 1IWBB 3GJSA 4Z86A 1GJRA 3U3KA 4BVKA 3O8OB 4AUEA 5JNVA 4CLCC 3RYFA 3HJIA 2QY9A 1JJBA 1GCUA 2A35A 3R24A 2PZBA 4PPNA 1EZ1A 2AFHA 1MAUA 4JCCA 3E8MA 1NIPA 1Z68A 1OXMA 4EHBA 3OZTA 1YRHA 1MVLA 3OZEA 4I1VA 3FHOA 2PBLA 1BN7A 4KQXA 2GBIA 2BFWA 1Z0DA 2Y4AA 5BVGB 1WSDA 3P7MA 4YT4A 4LYEA 4TKVA 1WXDA 2XCTB 2FPIA 2VYCA 4D92A 2VDOB 3DOUA 3EA5A 5JBNA 1YGYA 4D42A 4I4NA 5AVFA 4II2A 3M1AA 4KXNA 1XZBA 4QUJA 4WCFA 4LBVA 4L73A 3ZGAB 1EM8A 3DZ8A 2IP2A 3PDWA 1V39A 1DARA 2JS7A 4K6OA 4EUZA 3A3PA 4HVAA 1ZK2A 2CHUA 1KI2A 2IKSA 2P08A 1C7ZA 4IRMA 4PFJA 3AHJA 4RSRA 3HUOA 1IVNA 3FCAA 4HS9A 2DQ4A 4LDPA 5DJ5A 2QIPA 3NJ4A 1HZZC 2I34A 3T7AA 3U4QB 5EEGA 5M19A 1DRVA 2F3QA 5D2CA 4AP9A 3E3NA 1TX4B 2B3TA 1LD3A 4V0QA 4Q1DA 1KMMA 4ER5A 3SLKA 3DMFA 2VUIB 1OILA 3A1EA 4CG3A 1YZ3A 1CNMA 1MQSA 1GPDG 2P75A 2AN1A 3PNSA 1COWA 1CQAA 3SZTA 4LRYC 2R8BA 3L07A 1H2ZA 3D4OA 1Y0BA 3ZG6A 4DEXA 1NBAA 2ZBVA 1I6WA 4GCZA 1CULC 1JBKA 4B76A 5CDYA 3WGUA 4ETXA 5EZQA 3KQVA 3UHOA 4EFNA 3PC3A 1J3WA 1HFKA 2HREA 2XMQA 3GEBA 3HZOA 2R44A 3O03A 4UVHA 2FN9A 2IH5A 1LPNA 2VPWA 3CG5A 3ROGA 1LBQA 4TV8F 2I6QA 4Q3LA 3MGCA 5H3CA 1CUZA 2HMVA 2MTBA 4PXSA 3WWXA 2EGGA 1MLDA 2ETVA 4WHMA 1NA5A 2EKZA 2ZUWA 3AKYA 2B0JA 1JZSA 3BH0A 4GYJA 5JS2A 3DZCA 3FLBA 3MD0A 3AERA 5DI3A 3I2HA 2WQZA 3ME5A 4C2AA 3IMKA 3FFWA 4UM9B 5CLLA 1XFNA 2QY6A 3OURA 3M8KA 2F1RA 3HBLA 2C2BA 2FFRA 2JD1A 1KXZA 2QLLA 2Z6QA 3VPSA 1N0HA 4KZ5A 2JJMA 5ALHA 4TZ6A 2OQIA 3CF0A 4QU5A 2GXUA 1L4MA 2Z4TA 4MAAA 4UDNA 1NATA 2GLTA 3C6XA 3CUEF 3O82A 2BF4A 3DOEA 4DREA 5HM8A 2GN9A 4W5OA 3HUNA 4DNXA 4RTQA 5KPJA 4A10A 3QFTA 4ARAA 3L1UA 1ZH2A 1HOXA 3V8VA 2HP5A 4MW6A 2R4TA 2YBEA 1TQHA 3BGIA 1DQYA 2AI2A 4E5PA 2HXSA 1NJSA 1LI7A 4IS3A 1K0FA 3RT9A 3SIPA 5IANA 5IFKA 5M04A 1C8VB 5EHIA 5A3SA 4CV3A 3ESRA 4MI9A 4YRAA 5CEDA 5LP6B 1S2NA 1QYIA 1ZOOA 3EUFA 3PXAA 4FHFA 4RD3A 3RVLA 5TPZD 3KSMA 5ICMA 2DHRA 2HYIC 2J6IA 5FNVB 4HOIA 5TV2A 4CM9D 3H19A 4W63A 4ZGGA 1SHTX 4ROSA 3RTEA 3SNHA 4YXWD 4DDVA 1VEUB 3DLPX 3WOHA 2E4ZA 1TD5A 3WQHA 1Y1QA 3NS7A 3OJWA 1XDSA 3IOYA 4JUFA 5DNYB 1G7TA 3DYVA 2ZG6A 3GOQA 2QD2A 2V96A 3NHAA 3BFVA 4CMAA 2QPOA 2FDCA 3HYSA 1EIZA 2CJXA 3MLAA 1TVEA 1JTVA 1YZTA 2C2YA 2RK3A 3M4NA 4GMGA 1FPQA 4OH7A 4KK3A 2JFUA 4FDAA 5KWSA 2H7YA 2IWDA 4NARA 1NE2A 4J16A 1XOIA 4C7OA 1JKJB 2ZBRA 4OKPA 3EOZA 2PD8A 1YL5A 2WNHA 2JFXA 2JLAA 3A58B 1KVQA 3H11A 3IO5A 3WKBA 3SBXA 3H7WB 1A2BA 2G70A 2OEPA 1G55A 2JCGA 4LHWA 3IHKA 1JEQB 3VNRA 5JZ9A 2VJMB 4ZAVA 1B43A 4E6EA 1D1PA 4JI3B 1XD2B 2BTQB 1L5QA 5A02A 4PVCA 5KTNA 1XFAA 2PN1A 3RABA 3J80A 2EGUA 1MXHA 3OHPA 2Q3EA 2V7VA 3CNQS 4HFNA 4L9AA 3WB2A 3IDZA 1JFFA 2UZAA 1YDWA 5KHLB 4MN7A 4KQDA 4LMAA 4E3OA 1SHZA 1FFAA 1RXSA 4A5SA 1E3JA 1G19A 4MI6A 5EI5A 4FIZA 3TW8A 5IJ0B 3LUJA 4MVJI 1YZKA 1RRVA 5FOXA 3BICA 1N7JA 1NRWA 4PZDA 3B42A 1FMLA 1JW9B 4FUTA 4HX2A 3SJZA 1UKCA 1KEEB 3GJRA 3HYLA 1OT9A 3OOEA 3ZE2B 3WGZA 3N5KA 4FZ3A 3BQ8A 3I6YA 1A5TA 1TRHA 4Z2AA 5KSZA 4I4TF 5FQMA 2O3UA 1USVA 1NM5C 2HM7A 2WU1A 3PNYA 4W4TA 3IEMA 5DKKA 1M5UA 2GCIA 1GUYA 3HKBA 3A2MA 3KEQA 3M6MD 4UBMA 1I13A 1W85B 4D97A 1PRQA 2GCPA 3UJCA 3C8DA 1H8MA 4OUKX 2YVUA 5EOVA 4DCSA 4FH2A 5FDSA 2GK7A 3G2IA 3D64A 5DN9A 4BNLA 3LUFA 1J06A 1G21E 1RM3A 2I7VA 1PUJA 3A6ZA 3K9HA 4LKRA 4MYHA 4Y1RA 5CK5A 2IEZA 1CEFA 4PBSA 4TV9A 2WV9A 3O8DA 1QWOA 1GM5A 4E88A 1A0KA 1P81A 4LHYA 3H8WA 4DRTA 4G65A 2COKA 2VDPB 3FFBA 4ZVUA 3K5WA 1B14A 4E22A 4EF6A 3MIIA 2JFVA 1LI4A 1PW5A 5B12A 3TECE 1PVVA 1ZVJA 2BFAA 2G1JA 3NOVA 2NVUB 2JZNA 3VYUB 4KP7A 4LZAA 1VEUA 1UJ6A 3WLIA 4C5AA 3VSBA 5JXJA 1U7PA 5F73A 4A8JB 1NUSA 4KR3A 1Z4PX 5IMBA 1ZGBA 1QQAA 2ZSFA 4UUOA 4A1OA 4GGOA 5B36A 4EQIA 4RE6A 2G0NA 2MU1A 2TMGA 3SVZA 3JASA 1L5HB 2A1UB 1F8GA 2PLAA 1JLLB 1MH1A 5JQGB 4JGQA 2JCSA 5BN3A 1TCCA 5HWVA 1W2HA 4GE0A 4A3SA 2DQKA 1GCOA 3RIGA 4BLSA 1NXWA 2VAXA 4BLWA 4IDHA 1AM4D 4YC7A 1G7SA 3FSGA 3N0RA 4DLUA 4HZGA 2E48A 2CJFA 4J07A 2IU0A 1XLTC 1AHHA 2OHFA 4X25A 5CCBA 4OM8A 2XUKA 4ZYXA 1P2TA 2SICE 3WYGA 2X58A 1W7FA 3LCEA 4G3WA 2WIKA 3MMSA 1YA6A 4IXNA 3V00A 5K0TA 1Y1KE 2RB5A 1I2DA 3UYKA 2I67A 4E94A 1FEZA 4EYGA 1ZZEA 3P20A 3UJPA 2OLVA 2JKTI 2Y2OA 1OAKA 4G84A 4AJEA 2CB9A 4DLZA 3GARA 5IZCA 4QJ5A 1YC2A 1YK0A 4KDRA 3NBUA 1J8YF 1D8AA 4J0IA 4IKOA 3JD1A 4RX2A 5J4EA 3TQHA 3ZHRA 4YT2A 2ONZA 4MWBA 3NWJA 3V2IA 4KBFA 3I7JA 5EQJB 4TVSA 1Z6FA 1YL7A 1SUDA 2VSFA 3CNLA 1SURA 4XIJA 3RANA 3NANA 1YE5A 1V5EA 2Y1FA 1CTQA 2ZAMA 5ALWA 5JECA 4Z4FA 2BKXA 2WHPB 4UU1A 1RACA 4V3BA 4KWCA 1XCGB 3MXSA 5TGFA 1JJFA 1RBZA 1V3UA 3ZZ1A 4AWBA 3O8RA 4OPYA 4RZIA 1NYRA 1I10A 1K97A 1PR3A 1QYXA 2IW1A 4D4HA 1QU3A 1EZ4A 1T4CA 4L08A 1MAHA 3BE5A 1JWVA 5FA8A 3DLHA 1XMSA 1LZKA 1XE3A 3RKRA 1KE0A 4AF7A 2EDCA 3BMOA 1S1CA 4K9MA 5E3IA 1TF7A 3T3HA 1Q0HA 4QUEA 3ZY6A 5J3JA 3U4LP 2W6JA 2V59A 3C87A 2ECQA 4M8IA 1ADGA 1X8KA 2IHUA 4AMUA 4GMXA 5JVDB 3UA4A 5JXHA 4BFZA 2GQ0A 3ZVKA 2PUCA 4R3AA 1Z34A 5K3FA 1XAJA 2BC9A 4PFQA 2QJRA 4TQ9A 2PJZA 5AUQA 2QYBA 5EP2A 3I42A 1RYYA 4DIOA 5D00A 4LQCA 2CMDA 1LVHA 4IQGA 4UFNA 2QG6A 2PX4A 1N77A 4OP2A 1ZVKA 4NE7A 4NOMA 4L8VA 1S3SA 2J0UA 3P0JA 4IYRA 1FTYA 4M6WA 3CY6A 4OFXA 3DLBA 2FGKA 2FUEA 2WAXA 2LKDA 3WWYA 4G1MB 5HJ7A 4LTNA 1CW2B 2CNBA 2XBUA 4LXHA 3AUSA 3JQBA 3A1FA 4ASUA 5BRAA 1PYYA 4JJFA 3ZHUA 5CA1F 4V02A 5CIYA 4PSCA 3E5HA 3GJZA 3CKKA 3HI6A 1QE3A 1TT7A 4L9WA 2V7PA 1RPJA 5HMLA 2ZYSA 1NN1A 1SDEA 1GZ6A 1I7NA 4KI7A 1FDIA 4FYXA 5IDXA 3QBVA 1LPPA 1QZTA 2ADOA 1I1QB 2IZ6A 3F5SA 3QM1A 4RZ3A 4TVBA 4XDYA 4FIDA 5F64A 3ZW8A 4AAYA 1I0IA 5BP7A 3SWWA 3VR2A 3LEZA 1HDEA 1M5RA 2M1CA 4J0DA 1PF7E 3AB3A 3PR6A 3PBRA 4N1HA 1Y4AE 2FDXA 5I4BA 1O8CA 4NJEB 4CGZA 2BP7A 2G7MC 4G24A 2QS9A 2VI5A 3B53X 3CLSC 3CUSA 2WU3A 1MZVA 3FGPA 3VHXB 4CW7A 1BDHA 2DJ5A 1YQUA 3DFMA 3FRHA 1X94A 4TROA 3UJ6A 4EI7A 3HDGA 1UAYA 1ZUIA 5TBMB 3TGWA 1TAUA 4Z8YA 4G0UA 4DDHA 1U8TA 1XTBA 2EIHA 3LHFA 4BEBA 1XVIA 3JALB 1M1YB 4UTOA 4C7KA 2UZ3A 4BNDA 1C30B 4H31A 1W5FA 4K6CA 3RRJA 3DEKA 1RYZA 5E0KB 3BQAA 3CM0A 4H2DA 4K03A 4UD6A 4JBHA 3F73A 4GXRA 3JQAA 1QO9A 1A9QA 1FYVA 2WINI 1WULS 1ZHFA 2GBPA 2I76A 2QTWB 3AL2A 3M4JA 4MWTA 3ND5A 4X63A 3ULKA 4KHPB 5EIEA 2A49A 2PUVA 5CURA 1T1JA 1KOLA 2QROA 4FGSA 4OTZA 3W2HA 5HJ5A 4AQYB 5CAEA 2EZUA 3NHRA 5GZ3A 4RKQA 3H05A 1DIBA 1BQ3A 3FSRA 2B1QA 1UGUA 2BEUA 4ND4A 1IBRA 3PLAE 3QYJA 1ZVVA 1S2IA 4EHKA 4ZFNA 3HLCA 2R79A 1PWYE 2W2XA 4JROA 5LXTA 1ZGZA 1LHYA 2W6JD 2CF5A 4NBVA 1JFSA 2W0SA 1UWNX 4AZTA 2CXNA 1G41A 4N0PA 4PAOA 1SCQA 1DRWA 1T0UA 3L18A 4V0SA 4RMIA 3LX6A 2CVPA 4F72A 3GUYA 2P9EA 1OC4A 1PWHA 2WJJA 1TT5B 3EE6A 1DRMA 1W5AA 4R9NA 4H0CA 1LDYA 2EX0A 2GZDA 3O1JC 4H7JA 3UGTA 4RULA 2CV0A 1EBUA 2I3BA 3VYRB 2JLVA 2AOUB 2E4AA 4BDSA 1PNQA 2MYUA 1GDDA 1NRXA 3HC7A 4MV8A 4NFHA 2ZRQA 4QTUB 3CVUA 1QUEA 3ZIAD 4YV0A 1DJBA 2GB4A 3IVRA 4TLBA 1B74A 1PNEA 3NBMA 4WK4B 5EFZA 5JS8A 1HMYA 1WM1A 1HDIA 1AXBA 5CNMA 4LCLA 5AHWA 3ZYTA 3NP9A 3R0IA 3LY3A 5L09A 3NR2A 1ODLA 1CUFA 3GLRA 3OIDA 1MJGA 2YJ3A 3FSEA 4MNRA 4ZEXA 1VPWA 1A5ZA 2DP4E 3IO3A 4REQA 4AZWA 5F1FA 1I6LA 2Q9NA 5TBMA 1AT1A 1IN6A 2QTZA 2Q7XA 3AHDA 5E7JA 3VBEA 3OQBA 4Y2TA 4IXTA 7GPBA 1S89A 3A0UA 4GGPA 1T26A 5HQTA 4ZXPA 4NOLA 3VSLA 4DBZA 3W2GA 4I9HA 1FSZA 1DQZA 1O95C 2W2NA 3KQQA 3FSGD 3VO9A 4AKIA 1VE3A 3ITNA 3LUAA 5H81A 2WKPA 4GT1A 5D3MB 3AY0A 4UOZA 2PHZA 3I9LA 3PE4A 4GQBA 1PQWA 1W76A 3A3NA 1E2HA 4NI5A 6REQB 3VR2D 4S1NA 5KTTA 1JNUA 2Q6LA 5L6MB 2I91A 3MELA 3SY8A 2WYVA 1U3WA 1E3UA 3U9SA 1RP1A 2ZBQA 4DZZA 3G4PA 1Z4NA 4UNPA 1ZK4A 3JQDA 1AKEA 4DLTA 3DNFA 1KZ7B 4EG8A 1ZMBA 2CVZA 5K2OA 3JCZA 4I5DA 1DP8A 4JB8A 4RY8A 1FXUA 5LLTA 3AU8A 1C30A 5JIBA 5T6MA 3ZJTA 1ZBDA 4ZOLF 4XYBA 3T9AA 3BJNA 2RL3A 2G9ZA 3BJMA 2IUUA 4UARA 4WY8A 1XTZA 1QUFA 3PHCA 2PY6A 1OBFO 3KOXA 5H68A 5AVQA 3PFKA 3K4PA 1F4VA 2A5JA 3W5AA 4KAJA 1NOKA 2ZB3A 3U6KA 1OTEA 4JJKA 3PF8A 3P9QA 1WE2A 1YRWA 2YS7A 3AC0A 4RS3A 2ZDGA 3D7MA 1SB8A 1T8TA 4JEIA 3MNFA 4RPJA 3W8RA 4G56A 4C4PA 1XMJA 1DE0A 5K3FB 6ABPA 1KWGA 4RIFA 5L4NA 4C7JA 1PKXA 1ADJA 2R8OA 4NNJA 1AGRA 4RD1A 1SVSA 3I23A 5GJCA 4CCAA 2XYRA 1QKKA 1V1JA 2WLSA 3BY8A 1Z0FA 1DKLA 4G4SO 4M0FA 4Q6WA 4PHHA 5JSYA 5BVHB 5JEEA 3UHAA 4OLBA 2R7NA 4LRUA 2JFYA 1KBOA 2FW9A 1TA4A 2XRYA 5IYZA 1IUPA 2V97A 4B4DA 4CPKA 2V3VA 1GHPA 1SC4A 2Q4EA 4IHKA 1T5SA 3IXLA 4ZI5A 3JZMA 1JVNA 4HADA 1RHKA 2HK6A 1KL7A 1TM2A 1EE1A 2VZ0A 1YOVA 5CGQB 3B6JA 1V8FA 2C54A 1ZWLA 2ATIA 3KB1A 4N7BA 4L95C 4JYBA 3BFXA 1VLJA 4IIDA 5DEOA 3KR9A 2O1EA 3WGHA 5AW8A 3JR3A 2W58A 1MO5A 4OLDA 2NTEA 3CEJA 3FNGA 3HXLA 4FXOA 2IW3A 2YCLA 2CLCX 3Q10A 3VJMA 1PK8A 3BTUA 3LGAA 1KYQA 5HDBB 4CEIB 2O0HA 1RJEA 3U7HB 2RI6A 4QL3A 1AV7A 1QC5B 1XN1A 4ZQCB 1FQJA 2VEDA 2E2WA 1KJQA 1TZKA 3K5PA 5ELMA 4DA8A 3NHLA 1GNSA 1Y6RA 5EWMB 5GZ6A 3KYEA 1LDGA 4ABYA 1VB3A 2GXQA 1W93A 3IHWA 4OQIA 5JHGB 1NP7A 4TV8B 1YK1A 1PNVA 1CJKC 3NB0A 4F1JA 4KNYA 3L46A 1FNNA 5FYQA 1QRAA 1A8IA 2VJAA 2JFGA 4I2VA 5K0GA 3QOYA 2I29A 4K8OA 4N9QA 2XGGA 2XCOA 3JD0A 4QXPA 3W2TA 4AMGA 5K8JB 1IXKA 3WQBA 2DPXA 2B8TA 3LX5A 4Q0IA 4LNAA 4LF4B 1TDJA 2LWIA 5AIBA 1UMCB 2OO5A 1Y7IA 5CA1A 4BNUA 3DOHA 3TSAA 3OESA 4B4ZA 1P91A 4LDZA 4ZEOA 4QPCA 3WLNA 3SFTA 3LUGA 5JCOC 1H1DA 3O87A 3ZLTA 2W37A 5C32A 1Q2PA 1U8AA 1W75A 3FYCA 1CDDA 1V9LA 4C0WA 2PK3A 4KHZA 3RHZA 4WZBB 5DN6D 5IZCC 1SIUA 3WNZA 1IHUA 3EOAI 1UPUA 4JQSA 1FLVA 1NU6A 3IKJA 4FINA 4BECA 1EHCA 2VP5A 5L07A 1DINA 1ZONA 4ARZA 5F12A 5BQOA 4LPKA 5C8YB 2AG8A 2BBTA 2NSJA 3O2NA 4FGZA 1ZC3A 4TKUB 4DQKA 5ALRA 4GEGA 4W6QA 5D1NA 4EGCB 4XX1A 3C8CA 3HLKA 1ZSYA 2ZWIA 3EXG1 2G2UA 1N9NA 2XCQA 3BD7A 2ADMA 3L4JA 2Y99A 1NULA 4HWPA 4ZAMA 3A0VA 5HRAA 2PQ2A 3COYA 3PFWO 4JQYA 4DWOA 2W27A 4KG6A 4BE9A 3DWFA 1KR2A 1Z5NA 1JN0A 2Q3CA 2DG2A 4AFIA 3M6LA 4N5NA 4W1QA 4Q6BA 3U4IA 4XPIB 3WL3A 2AK3A 1GKKA 1ESDA 2IYLD 4TWAA 5GGXA 3TKYA 4E1BA 3WB9A 3COJA 1JNXX 2WG1A 1P0IA 5FEGA 2Y8HA 3FRJA 3BRWD 3AONB 3N75A 5IM4F 3IT2A 3W4PA 1EVQA 2HA0A 3W3ZB 2GD0A 4YROA 3NIDB 2BMFA 3H8JA 3CHWP 4WESA 3IILA 2VDRB 3ZNYA 3OWHA 3L01A 1S2GA 1E79D 4HXYA 4YRFA 4AKEA 3AM3A 4OI1A 1A9ZA 1XRQA 4DUZB 1MWSA 2Y92A 3QQ5A 3GECA 5CVCA 4ZCQA 4E07A 2ID7A 4UAAA 2AHRA 4MLZA 4NX2A 4R3BA 4ZEWA 4B3IA 4REOA 1MR3F 3K8YA 5K1ZA 4P87A 2XCLA 4QUKA 4NESA 1Y80A 4WE3A 3WI7A 3F6PA 1QV6A 2R7MA 4KL8S 1YAJA 5EXXA 2GCOB 5CG2A 4EHDA 1EP2B 4HBZA 4L7QA 4EO7A 5I7VA 3N2NA 4LE1A 1T1CA 4NMMA 3OFNA 5KVSA 4FHCA 4ID3A 4KSCA 2J5KA 4TV9B 2DGDA 2FGJA 2QX9A 2V98A 2YFYA 3GMDA 3L1VA 4HUQA 4HAWA 3KKZA 4QPZA 4RGQA 3R2JA 4LZJA 4PPRA 4FEGA 3A3EA 2ZC6B 1TEXA 3DCYA 3IQIX 2Q07A 3G7UA 3PCRB 4U8GA 5DZSA 1NW9B 1RWVA 1X0OA 4AURA 2BDEA 3M3DA 3ZC3A 4US2R 2ZOSA 4HX5A 3PUJA 3ZVNA 4DA9A 5JSUA 4I14A 3FI0A 4AZVA 2I6FA 1DU4A 4XIYA 3NUGA 5KX5F 4J8PA 1Z6TA 5EKTA 5F7JA 4TZ0A 1Z13A 1W5SA 4FDMA 1E3UD 1DX6A 4TMKA 1G2IA 4YNRA 1N2CB 4F71A 1EP3B 1RWOA 3WSTA 1GR0A 2A1TS 3TS1A 3VTFA 3LICA 4MBFA 1F2UB 5EFWA 1NF2A 1Z8HA 2J08A 2OC4A 1SULA 3GK3A 1DTEA 2C8VA 3QLUC 5JWRA 3WRZA 5KUTA 4PLCA 1DBSA 3M3PA 5IAAA 2ZB7A 1C1XB 4BQNA 4ZZIA 1AGYA 4YRTA 4XM0A 5SYMA 3KWLA 5B58C 1E9FA 2WWWA 1ACMA 3IBJA 2B7BA 1XEWX 4QBIA 521PA 2C5SA 2Y2KA 5BXQC 1YIDA 1I3CA 1ZESA 2Z5VA 5KMWA 4WESB 3Q82A 2XIJA 1RLIA 3R7WA 2LV8A 4KYTA 3CUWA 5DP1A 2OOKA 4R0QA 2OZLA 2A2ZA 2QGFA 3QHAA 4HAUA 2EIXA 2ZRPA 4LNHA 3RUHA 3SC2A 4DC9A 4R2LA 4ZEMA 4ZRNA 1OB5A 1SBQA 4RA9B 2OGZA 4F5YA 4KR7A 4N48A 1PL7A 2UYHA 2ZRCA 1KY5A 3FPGA 4FOPA 4XIFA 2PR7A 3AXSA 3T7CA 3IAS1 5EUAA 4IKEA 1XHLA 1VMKA 4L22A 4CM6A 2OYCA 3IF6C 1U2GA 2WWTA 3HN6A 1UBCA 2LW7A 2GYVA 1A2KC 1W88A 1XL0A 2BDTA 4H18A 4G5OA 2PS3A 2Z1MA 3S99A 4LV3A 3KOYA 2PVCA 8LDHA 1PEKE 1UFVA 4KTVE 2VJCA 1WHSA 3P94A 4W99A 4NG2A 2Y1KA 4KXYA 3FMOB 2WY2D 4DBLC 3O1IC 3H5TA 4NHOA 2HI0A 2CCKA 1NC3A 2QD5A 3L7JA 3DQPA 4G6ZA 3EPKA 1XBTA 4WZAE 1YLPA 2NX2A 3L6OO 4NATA 3RPEA 4JGPA 4EG3A 4G5RA 5FT9A 4BO7A 4RKWA