3RFBA

Structure of frmsr
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
160
structure length
160
Chain Sequence
SEKQSRYQMLNEELSFLLEGETNVLANLSNASALIKSRFPNTVFAGFYLFDGKELVLGPFQGGVSCIRIALGKGVCGEAAHFQETVIVGDVTTYLNYISCDSLAKSEIVVPMMKNGQLLGVLDLDSSEIEDYDAMDRDYLEQFVAILLEKTTWDFTMFEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Structure of fRMsr
rcsb
source organism Streptococcus pneumoniae
molecule tags Oxidoreductase
total genus 51
structure length 160
sequence length 160
chains with identical sequence B
ec nomenclature ec 1.8.4.14: L-methionine (R)-S-oxide reductase.
pdb deposition date 2011-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13185 GAF_2 GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3rfbA00
4ZRRA 3MMHA 4GLQA 4Q0IA 4E04A 3RFBA 3TRCA 4EUVA 2XSSA 4G3VA 2Y8HA 3NOPC 4GW9A 2VKSA 3S7PA 4MDZA 2W3HA 1ZTUA 1VHMA 3S7NA 2W3DA 2W3EA 1F5MA 4O01A 5HPIA 2KOIA 2VJWA 4LRZE 3CITA 4IUKA 2M7UA 3W2ZA 5HSQA 3G6OA 5AJGA 2VEAA 4BWIA 3KSIA 4PAUA 2KLIA 3KSHA 4QPRA 2XROA 2W1RA 1YSQA 5C5KA 3C2WA 1TF1A 2K2NA 5LBRA 3K2NA 4R6LA 2QYBA 4Y5FA 3BJNA 3ZQ5A 4DN0A 5DFYA 4Q0JA 4R70A 2G7UA 3IBJA 3KO6A 5L8MA 4G3WA 2OOLA 4ETZA 3VV4A 1YSPA 1MKMA 2HGVA 2ZMFA 3MF0A 3O5YA 4FOFA 2M7VA 2GX5A 2VZWA 4Q0HA 2O9BA 4O8GA 3E0YA 3S7OA 4IUHA 3IBRA 4O0PA 3D3OA 3OOVA 2W3FA 4G3KA 3S7QA 4YOFA 2O0YA 4YNRA 2O9CA 4ETXA 4LRXC 4DMZA 4IJGA 3MQ0A 5HPFA 2K31A 3NOUC 4ME4A 3KSGA 3HCYA 4RQ9A 3LFVA 2LB9A 4MMNA 2O9AA 5HL6A 2LB5A 3DBAA 2XRNA 3NOTC 4LRYC 2W1TB 4Y2FA 2O99A 1YKDA 5K5BA 1TD5A 3CI6A 4MN7A 2B18A 3KSFA 5I5LA 4CQHA 2W1TA 5TJJA 1STZA 4Y3IA 2W3GA 3OBFA 4MCWA 3NHQA 3R4KA 3E98A 3EEAA 2Y79A 1MC0A 4EU0A 5DFXA 4Z1WA 2IA2A
chains in the Genus database with same CATH superfamily
5A8BA 1T19A 3S1YA 2C6WB 1DJAA 2V1BA 4FTXA 1H0MA 3MBZA 1G28A 1LI9A 2W3HA 1AXBA 3NDEA 3G35A 3WS0A 4Y0UA 1F5MA 2V20A 4GDNA 3C7VA 1XX2A 1ODVA 1LL9A 5M1AA 2XDMA 3N7WA 2KLIA 2XROA 1ZKJA 3CWFA 4R6LA 3VE4A 2QYBA 1NJ4A 4LCMA 4YWZA 4QB8A 3LCEA 4DN0A 4RX3A 4P6BA 3IBJA 3N8RA 2ZL1B 4GOGA 5FEFA 5EVIA 4DF6A 3S4XA 3UE6A 1NZOA 4IUHA 4QHCA 3V50A 5TBMA 4EESA 1FR1A 3B3XA 3VP4A 5IU1A 4GD6A 3QP6A 1M6KA 3UDIA 3SH9A 3PBTA 3LFVA 5HL6A 3Q82A 4GKUA 3DWZA 1LLBA 2PYRA 2J3WA 3BFEA 4GZBA 3CJMA 4R38A 3UE1A 4BENA 4HNBA 3KSFA 1PRQA 4CQHA 4DE0A 1MWUA 4OPRA 2HJEA 4ZDXA 1SCWA 2XFSA 3MZDA 3R4KA 1F98A 4NXGA 1LL5A 5DFXA 4PM8A 4KZ4A 2IA2A 1W8QA 2P74A 5GL9A 3E4OA 5EVID 3Q7ZA 4O01A 2KOIA 1SKOB 4LRZE 2Q9MA 3W2ZA 2ZJ9A 4GHIB 1ZG4A 5EUAA 4RVAA 1P9WA 1JTDA 2OAQ1 2EXAA 3VSLA 3C2WA 1DRMA 3T4KA 3T4LA 1EWZA 1J3WA 2G2WA 4GHIA 5AQ7A 3PR6A 1YT4A 2G7UA 2ZOHA 5HFOA 5HD3A 3MS6A 2Y91A 4DRTA 4B4XA 4EBPA 2Q0OA 1ES2A 2VLGA 2J8YA 2JKTI 4DJ3A 2HJ9C 3F1OB 2L1MA 3EOIA 3IWQA 5GHZA 4PMAA 5FATA 3OCNA 3ZG9B 1UGUA 4WZ5C 5CTMA 1KE3A 4YNRA 3Q1FA 2KDKA 2A24B 4CLCE 4L9EA 5FQIA 1S1YA 3NOUC 1JNUA 4RQ9A 1HLUP 2JKRI 4XT2B 2ZQ7A 1TDLA 4BL2A 1YKDA 1CF0A 2Y2QA 3ITBA 4QU3A 5FAOA 1FCMA 3MFXA 4H6JB 4UHUA 2FFYA 1PWGA 2OSUA 4ZTKA 2H28A 3EGXC 2A2LA 2W3GA 3KYEA 3OBFA 5FI2A 3Q7VA 3EEAA 2B5RA 3G2ZA 1XGJA 3LICA 4LENA 4LCLA 3T4QA 4BJPA 4ESPA 1YLWA 3QNBA 2EFXA 1NYMA 1P97A 2Z6DA 3LGOA 1LL8A 3HLGA 3VMAA 5HW3A 4YINA 3A0SA 3UO9A 4KZ9A 4M4XA 1HZOA 2OAP1 2JHEA 1X0OA 3D72A 4WEKA 4OOYA 3MFDA 2VV7A 3A3EA 3P09A 4LV1A 3TSGA 3M2JA 4KZ7A 2ZC5B 3DTIA 3V3RA 1VB6A 3PYPA 1XA7A 2VK3A 3A3IA 2EX8A 1YSPA 4DDSA 1NZUA 2IWBA 3O5YA 1IYQA 1ES5A 3HBRA 4WZ4A 3RXXA 3CUEA 2VZWA 2BG1A 2O9BA 3KYZA 1OT9A 3W4QA 3D3OA 3ZG7B 3JVUA 1S1ZA 3BQ8A 5GLAA 5HPFA 1XPBA 3LY4A 5AVFA 3H82B 4CPKA 5EECA 4ME4A 2ZQDA 3KSGA 1TS7A 1ZC2A 3IWIA 4JGPA 4PKYG 5GLBA 5GLCA 2WK0A 2WADA 2PR6A 4HBTA 3AGDA 4ARZA 2Y2JA 3UB8A 1BLCA 3IXHA 1V9ZA 4K0WA 5JYPA 4JXGA 2JN7A 1ACFA 3E98A 2UV0E 1VETA 4UAAA 1C3BA 2PU2A 1NY0A 4S2MA 1FR6A 1DP8A 2ZC3B 4RX2A 5TR7A 3M2KA 1MXOA 3V5MA 1DP9A 3GQZA 4E04A 4EEPA 3MZEA 3CZDA 4D2OA 4GW9A 1G5UA 3IXBA 5F1GA 2ZQCA 3NECA 2P9VA 3D4FA 1FILA 3G32A 3FC7A 1PNEA 3UB6A 4ID4A 1CI9A 4PAUA 1K4FA 5F1FA 5HARA 5HAQA 4HOIA 2E8IA 2PT7A 3C7UA 5E43A 5L8MA 3NDGA 4O7DA 4HJ4A 3MZFA 4EXOA 4NXFA 4C75A 2X01A 5FA7A 1ES4A 3PBQA 3UPPA 3K3DA 3PXPA 4WBGA 5J7EA 2W3FA 3OPRA 4HEFA 4YOFA 2BLSA 3UB7A 4JXWA 1SZVA 2NUPC 1K6SA 3OPPA 1N9BA 1OMEA 3A0VA 2O9AA 3SS4A 4B88A 4K0XA 2O99A 1TD5A 4S2PA 2B18A 2ZQAA 4GN2A 2EWVA 1RGYA 1LT0A 5HAPA 3BLMA 1E4DA 4MBFA 1CJFA 1SDNA 3UPNA 2DMWA 1Y4OA 4X69A 2INWA 3UY6A 4EU0A 2H0TA 4P0MA 4EV4A 2VGKA 2XR0A 3O87A 1IELA 4GS9B 2Y2LA 2OWJA 5HL1A 3HLWA 1L3LA 1L0FA 3LIDA 3ISGA 5EPHA 3K3CA 1VHMA 1K54C 4E3MA 1L0EA 1S4SA 5FQQA 3DTEA 1OTAA 4OPQA 4OVDA 2Y2NA 1EW0A 1PWDA 2V1AA 4Y0TA 3LYXA 2H10A 3KSIA 4QPRA 2HPBA 1YSQA 2RL3A 3SS5A 1FCNA 1G68A 1ESIA 1BLHA 4R70A 3KO6A 3E4PA 5FDHA 3NULA 2WKIA 1VEUA 1FSYA 1ESUA 1DJCA 4DXBA 3QP5A 4R1GA 3VP3A 1NLZA 3RJUA 5TFQA 3UDXA 4Y17A 1I2SA 4Y13A 3MQ0A 3EGDC 3FPWA 3VSKA 1ZG6A 1IKIA 2XA7M 2JC7A 3WS1A 5CERA 3VFHA 3LEQA 1N9NA 3IH8A 2G2UA 5IHVA 1TS0A 5DJUA 3VFFA 3HLCA 4JBFA 2QHKA 1IYPA 2Q9NA 2XD5A 2XA7S 2WAFA 1MKIA 5EVLA 2J7VA 5E2EA 5AQ9A 5HWTA 3ZVWA 1K55C 1MC0A 5J4EA 3NIAA 4MBKA 2IWCA 1BULA 4Z1WA 2QJ7A 5HX9A 5CHUA 2D02A 2ZM8A 3U4LP 3LIFA 4G3VA 1Y54A 2ZD8A 4EUZA 3HLEA 1K6RA 2W3DA 4WN5A 1D7EA 5IS1A 3CITA 3Q81A 1WA9A 2VEAA 1I5QA 4RA7A 3ZFZA 2WKQA 4PHTA 3SH8A 2Y59A 3BJNA 1RCJA 5DFYA 3MJQA 3PBRA 3LEZA 4KQDA 5F82A 1EROA 2OOLA 2ACGA 2EXBA 2J3TC 3A3DA 2WKRA 3MF0A 2ZM2A 4I3JA 1KDWA 3M6BA 3E0YA 1W63M 2JKTM 3UE0A 3LUQA 2XEPA 2ZC6B 1Z6FA 1LHYA 2PHYA 3EQVA 4IJGA 3T1XA 1PZOA 3MSHA 3FZCA 4QY6A 2LB5A 4KG6A 4LGWA 4OLDA 5A90A 2BTFP 2AVXA 4Y2FA 4X6TA 2ZL1A 5L09A 3T4SA 3U2AA 5D3OA 3CI6A 2L4RA 4PM6A 4FSFA 4HP4A 3MXRA 4MCWA 1KGEA 1GA0A 1KE4A 3B42A 1FCOA 4JXSA 3T4TA 4FD8A 1BT5A 5FASA 2WKHA 3TE8A 3C38A 4E3OA 4I39A 4OQHA 3ZGAB 3QP4A 2R9WA 4F94A 3ZNYA 1HD8A 1KGGA 3L9KA 4HY8A 3G6OA 3IX3A 5AJGA 1NRFA 3ITAA 4MBHA 5DKLA 4C3QA 1MWRA 1RP5A 4EBLA 2K2NA 1YLYA 2Z6CA 4NK3A 4II7A 3R7WB 4S2JA 4NEED 4G3WA 3VV4A 4JGQA 4B93A 2Y2HA 5FSRA 2R9XA 3GVBA 3N8LA 1MZUA 2PU4A 1IYSA 4R4SA 2ZC4B 1SKOA 3LR3A 3FG8A 4G3KA 4CLCB 4WM9A 3AGEA 1JWVA 4KQOA 2Y2OA 1T1CA 2I72A 1YLPA 1PWCA 3UNWA 4ZJ3A 1K54A 5FQMA 1GSVA 3HCYA 4R3AA 2HDQA 2PRFA 4KZBA 2W1TB 4LLOB 1O7EA 4P87A 2QZ6A 2H0YA 3CHWP 2W1TA 2W27A 3F1OA 4PKYA 4LV0A 3GRJA 1STZA 5HDCA 3T1RA 3B47A 3NHQA 3T4JA 4PM7A 4ZAMA 2WYXA 3MXQA 2A24A 2B95A 1W79A 3HUOA 3BFDA 3HUMA 1N9LA 3TRCA 3A0RA 4XT2A 3BW6A 2JBFA 3BEBA 2DRWA 3HLBA 3V39A 3IX4A 2ZBBA 2M7UA 4H6JA 5KMWA 3GECA 3MQQA 5HSQA 1XJ3A 4GD8A 5KIZA 3N8SA 4UQIM 3KSHA 2W1RA 5GHXA 4F3LB 2QWSA 4DKIA 1TDGA 3DWKA 2V9AA 4Q0JA 5FAQA 4CJNA 4X25A 5FI7A 2WAEA 2WZZA 2XF3A 4E3IA 4F3LA 2YKHA 4UQIS 1F9IA 3OLOA 2QMIA 2HDRA 4DE3A 3MR0A 2XQZA 2OWHA 4X1LA 2VX8A 2HV1A 3ZG5A 2RCXA 2O0YA 1HVBA 3C8CA 5CGSA 5EE8A 1PW1A 4LRXC 5FDSA 3GDIA 5CHJA 1ERQA 2WUQA 3UMDA 3T1QB 2BASA 5DF8A 1H8YA 2R78A 1MWTA 1FIKA 3IH9A 3JVVA 3O86A 1LSVA 3PBOA 1V9YA 1G6OA 3SZTA 3IQAA 4Y3IA 1Q2QA 4N9LA 4OPYA 3HLDA 1F2KA 5EM1A 4ZRRA 3H82A 1IOUA 2PBDP 5E2GA 4N1XA 2XSSA 4X1MA 1T18A 4R3JA 3PAEA 2GZAA 4LV3A 3ZYTA 3L7HA 5HD5A 4S2IA 2ZMVA 3FKWA 1JTGA 5G18A 5F5YA 3G4PA 2EA9A 3D9YA 1TF1A 5LBRA 2QJ5A 1GHPA 4QWOA 4GDBA 3V3SA 1SDEA 4I3AA 4ZBEA 3PBSA 2FZ0A 3MXSA 1S0WA 3BY9A 2CMNA 4X55A 4HIAA 4JGOA 3VOYA 3OOVA 2Y2MA 2J3TD 4XUZA 5HDDA 1YLZA 3KX0X 4ETXA 2EWWA 3LR0A 1L0GA 4BD0A 5CEBA 1TVFA 1FSWA 4S2OA 3WRTA 1CI8A 3AGFA 1YQSA 1IEMA 3DBAA 4Z9QA 1JVJA 2Z2MB 4KZ3A 3FKVA 2V1ZA 1L2SA 4PM9A 1BZAA 5KZHA 4QY5A 1TS6A 4FUWA 3E2LA 2WGWB 4OQ0A 1BLPA 4WEJA 2FH5A 5EV0A 3WS4A 2VA0A 3QP2A 1H3QA 3C5AA 4EUVA 4U3TA 4S2KA 4GNUA 4PM5A 2W3EA 3DTKA 4K08A 1ONHA 2J80A 3UDFA 1P0ZA 1YMXA 2V8CA 4KZAA 5C5KA 1LSWA 3GMWA 3UMEA 2PDRA 4KENB 3WRZA 2Y2KA 4KUOA 4LPZA 1MPLA 4HHDA 4N9KA 4WZ5A 3QP1A 4UEYA 3B33A 2WKEA 4A5RA 4CLCC 4GS9A 3RH8B 3I7JA 1DP6A 3WS2A 4B4ZA 2XH9A 1NWZA 5F69A 1TS8A 4O8GA 5EOOA 1T1AA 3HUNA 1U60A 1PI4A 1CEGA 3ZDJA 2PAVP 4WL9A 1BUEA 2ZM0A 4HJ3A 2X71A 4EEUA 3LI9A 4DMZA 3V67A 3LO7A 5L07A 1XJ6A 4HP9A 5EFWA 4JF4A 1W63Q 3VP0A 3OCLA 3GR2A 3T4OA 1SHVA 1YPRA 4OONA 1GHMA 1BSGA 4OQIA 5I5LA 5E2HA 3DW0A 4MLLA 5TJJA 1XFQA 1NRJA 2IWDA 4U0XA 4UA9A 1D1JA 3TOIA 1K57C 4OPZA 3ZG8B 3LR5A 4QJGA 4HH3A 3G31A 1ZHHB 4Q0IA 1MWSA 2Y8HA 5IT5A 1IYOA 1XJ4A 3ZNTA 5GHYA 1NYYA 1S4RA 4YFMA 2K7SA 1JWZA 1OTDA 2GDNA 2PYPA 3IWOA 5J3WA 2VGLM 3T50A 2GJ3A 1CEFA 3C30A 4KZ8A 2P08A 4IEDA 1CQAA 3M6HA 4GCZA 4GJ4A 1YLJA 4KG5A 1HTZA 2A49A 5U47A 1T1BA 2HP6A 4QD4A 4Q0HA 3EWKA 1A0KA 3IXGA 3OPHA 3S7QA 2WZXA 3W4OA 3UB9A 2V2FF 3H7WB 4IVIA 1CK3A 2V0WA 4XUXA 2H5SA 5TGFA 1ONGA 5CRFA 1GHIA 2LB9A 5L10A 1Y28A 1XFNA 2UWXA 3IF6C 3NOTC 4LRYC 5EM0A 5FL3A 5G4ZA 4X56A 3TW8A 1PIOA 1LI0A 1YMSA 4E3KA 1XKZA 4KQRA 4I38A 4OOMA 2HP5A 4L9FA 3EQUA 2XD1A 5CHMA 3OZHA 4BBUA 1WE4A 4LFUA 2KX6A 3UB5P 3NJAA 2JKRM 2X02A 3SH7A 4GLQA 1BLSA 4JGRA 3W8KA 2HP9A 2NUTC 3NOPC 3OC2A 4JLFA 1RGZA 5EVIB 3ZHHA 3IS2B 4U0TA 2EFUA 3QP8A 3TG9A 2ZLYA 4E6WA 5TBMB 2VV8A 3UPOA 1KVLA 3CG5A 4KQQA 3BM6A 3IS2A 4DE1A 3VP1A 3K2NA 5FQKA 4Y5FA 3UE3A 5AVEA 3NC8A 3LIBA 2GNXA 3RXWA 1K56A 4NXEA 4E3JA 1GA9A 4MEZA 5DKKA 1BTLA 4L0LA 4OKPA 1TEMA 2JKGA 1XP4A 3WWXA 2XGNA 4OP5A 1K4EA 2HZ5A 5AQAA 1YLTA 4BD1A 2C5WB 1OJ5A 3BLSA 2EX2A 2XFTA 3C4PA 3R7WA 2ZOIA 3FWLA 5DJTA 4NETA 3F1NB 4Y7PA 4PPRA 5F6AA 4S2NC 1NLYA 1P9RA 2ZQ9A 1BYWA 5CGXA 3F1NA 4BLMA 1AWIA 3A3JA 3NY4A 1KOUA 3CPTB 3GV9A 4CLCA 4E3LA 4E3NA 2JKFA 4WMCA 3H9WA 1K0KA 3BFGA 3IHAA 4ZJ1A 2Y55A 1EI5A 3CPTA 3MMHA 2FFFB 3BY8A 5HAIA 3LI8A 1K56D 3LY3A 1XXMA 3FV7A 5M19A 1ZTUA 2EX9A 3VOLA 3QNCA 4IVKA 1OT6A 2MJ6A 3IF5A 1PZPA 3O88A 4FH2A 2PD8A 1G6AA 4IBXA 3VOZA 2WGIA 4OP8A 3G34A 1GSXA 3JPUA 4KZ6A 5KSHA 3DAVA 4OQGA 2PD7A 4EQ1A 1ERMA 1PW8A 2HGVA 4N1HA 3O3VA 2HF6A 3HL9A 1SKFA 3PHYA 1NXYA 1H5XA 1K57A 4NXBA 2D01A 3Q7VB 2XK1A 3SOIA 1PI5A 3E4QA 1YAXA 3HLFA 5A93A 4CLCD 2A3UA 1ALQA 2K31A 4HJ6A 4WMCD 2P04A 5MC7A 3MKEA 5GLDA 3ZCZA 3WS5A 2ZMAA 1L0DA 5G4YA 2XRNA 1K55A 2OLVA 4HH2A 2YKFA 4P85A 5DTKA 4JXVA 2OV5A 4Q8IA 1VM1A 4DXCA 1S66L 2E8JA 1E3UA 1E25A 5L2FA 2P7JA 3GTCA 1XGIA 4FH4A 5FQJA 1QMFA 4OOLA 4OLGA 4UA6A 3IXDA 5DTSA 4MN5A 4I3IA 3S7PA 4WUJA 4JF6A 1OTIA 3BFFA 5CEDA 2OLUA 3OPLA 3IF6B 2M1CA 4IUKA 4JF5A 3T1SA 3HJKA 2WKPA 3S22A 4I5SA 4X53A 1OPXA 1YM1A 1Q2PA 3IF6A 3QHYA 4HI4A 1OTBA 2J9PA 4K91A 3N4IA 4WF0A 1W5DA 1H8MA 3BYDA 4HQAA 2ZQ8A 3IT9A 1MKMA 1UWNX 2ZMFA 4R3BA 3ZG0A 5CX7A 1KDSA 4ARZB 4EETB 5KSCA 4WLAA 3S7OA 3E2KA 3IBRA 4O0PA 3T12B 2VGJA 4JKTA 1VETB 3HVFA 1IKGA 1E3UD 3W4PA 1XA1A 4R0QA 5E2FA 5DF7A 2JE5A 1VQQA 2W0NA 5EOEA 5HWWA 1N9OA 1LSXA 4MMNA 2J9OA 3HJIA 4WYYA 2P9VB 2ZC7A 4UA7A 3F1PB 4WELA 3MKFA 5A92A 4BBTA 2QPNA 4DDYA 4NKPA 2VV6A 3TJZC 5CECA 3F1PA 5F68A 5EVIC 5FI6A 2Y79A 5EVEA 1Z09A 4HESA 5HDSA 4EERA 2QKPA 3IX8A 3RFBA 1JWPA 1UWPX 3BECA 5F83A 1H8ZA 2WGVA 5CTNA 5HPIA 3SW1A 1OTEA 2VJWA 2L0WA 4IBRA 5AQBA 3VP2A 4NG2A 3BRMA 4Y0OA 5HZHA 3IHBA 4BWIA 3ULFA 4BMWA 2WGWA 4ZJ2A 4L9GA 3P01A 1WYCA 4S2NA 2EX6A 3ICYA 1MY8A 3CMZA 3FPVA 5DF9A 3Q07A 4KZ5A 1K25A 2PR5A 1MBLA 4JPMA 5FEGA 3LIEA 3PBNA 4P6ZM 1DJBA 1OJGA 3JYIA 4MNRA 1GCEA 4EBNA 1W7FA 3LIAA 5M18A 2O9CA 1XJ2A 4DJ2A 3PAGA 2CC1A 4KUKA 1KVMA 4P6ZS 3ZVTA 3CLOA 2Y2GA 4H8RA 5JYOA 1QMEA 2V0UA 3P7NA 3N6IA 5HWVA 2DNSA 1M40A 2Y2PA 3PTEA 4BL3A 3BQAA 2Y2IA 1IFQA 3NCKA 1S6RA 1N4OA 3EEHA 1PYYA 3KYQA 4M3KA 3CAXA 4X68A 3NI9A 3C4OA 1VEUB 2VKSA 4MDZA 4AFIA 4E6XA 3S7NA 3HREA 5DVAA 3A3FA 1W8YA 3MQOA 2Y4AA 1D06A 2HDUA 3GSGA 2HDSA 1GSWA 1KE0A 5J8XA 1DY6A 4OH0A 3P98A 3LR4A 4EWFA 1J9MA 2JCHA 4MN6A 4IHQA 4HBUA 2I9VA 4KG2A 3ZQ5A 1PFLA 4BBVA 1S67L 1ES3A 4D60A 4ETZA 3BWLA 4XXRA 4N92A 5CGWA 4EQIA 2M7VA 4FOFA 3NBLA 5A91A 3RTYA 4B9OA 3VE3A 2GX5A 4Y15A 3G2YA 3FYZA 1WYBA 3G30A 4RYEA 4GB7A 4BQMA 2V8FA 2XLNA 3DTMA 1K38A 4EW7A 1FOFA 4S2LA 2DCFA 1I2WA 3SS3A 2VGLS 1KGFA 4FCFA 4C6YA 1O07A 4LV2A 5K5BA 1FQGA 2B02A 4R4RA 4MN7A 5CXWA 5DTTA 3BFCA 4DE2A 2PBYA 5FQ9A 3CUEC 5BOHA 3UN7A 5FAPA 5I94A 4R23A 3H7WA 2Z2LB
chains in the Genus database with same CATH topology
4ZRRA 3H82A 5A8BA 1T19A 1IOUA 3MMHA 3BY8A 4GS9B 2OWJA 3LI8A 2V1BA 2XSSA 1T18A 1G28A 3LIDA 2W3HA 1ZTUA 3K3CA 3VOLA 1VHMA 1S4SA 1F5MA 1OT6A 2MJ6A 2GZAA 1OTAA 1ODVA 2PD8A 3ZYTA 1EW0A 5HD5A 2V1AA 3LYXA 2ZMVA 3KSIA 2KLIA 4QPRA 2XROA 5F5YA 2EA9A 1YSQA 3CWFA 1TF1A 5LBRA 4R6LA 3VE4A 2QYBA 1GSXA 4YWZA 4DN0A 5KSHA 4R70A 3IBJA 2QJ5A 3KO6A 2PD7A 4EQ1A 3E4PA 2HGVA 4I3AA 2HF6A 3PBSA 2FZ0A 3PHYA 3BY9A 3UE6A 2CMNA 4NXBA 4IUHA 4HIAA 4JGOA 2D01A 3OOVA 5TBMA 4EESA 1NLZA 2J3TD 3E4QA 1YAXA 5HDDA 5IU1A 3KX0X 4CLCD 4ETXA 3MQ0A 3EGDC 3FPWA 2EWWA 2K31A 4HJ6A 3LR0A 2P04A 5MC7A 3PBTA 2XA7M 3LFVA 5HL6A 3DBAA 5G4YA 2XRNA 2PYRA 2J3WA 1N9NA 4HH2A 2YKFA 4R38A 1TS0A 5DJUA 4HNBA 3KSFA 4CQHA 2QHKA 1TS6A 2HJEA 2XA7S 1S66L 4WEJA 5HWTA 3R4KA 2FH5A 1F98A 1MC0A 2P7JA 4NXGA 5J4EA 2VA0A 5DFXA 4Z1WA 2QJ7A 2IA2A 2D02A 1H3QA 4OOLA 3LIFA 4EUVA 4G3VA 4MN5A 3E4OA 4I3IA 3S7PA 4WUJA 1OTIA 2W3DA 4WN5A 2W3EA 1D7EA 4O01A 5IS1A 2KOIA 4LRZE 2M1CA 3CITA 4IUKA 3W2ZA 4K08A 2J80A 1WA9A 3HJKA 2WKPA 4GHIB 2VEAA 4I5SA 1P9WA 1P0ZA 1OPXA 2OAQ1 2WKQA 4HI4A 3C2WA 4PHTA 5C5KA 1DRMA 1LSWA 3T4KA 3UMEA 2PDRA 1OTBA 4KUOA 3T4LA 4GHIA 4WF0A 3BJNA 5DFYA 3MJQA 3PBRA 3PR6A 4LPZA 1H8MA 2G7UA 4KQDA 4HHDA 2ZOHA 5HD3A 2OOLA 4HQAA 4UEYA 2J3TC 3B33A 1MKMA 2WKRA 1UWNX 2ZMFA 4GS9A 4CLCC 3MF0A 3RH8B 5CX7A 2VLGA 4I3JA 4ARZB 4EETB 1DP6A 1NWZA 4WLAA 5F69A 1TS8A 2JKTI 3E0YA 1T1AA 4O8GA 1W63M 2JKTM 3S7OA 4DJ3A 2HJ9C 3F1OB 2L1MA 3EOIA 3IBRA 3LUQA 4O0PA 4WL9A 3OCNA 4HJ3A 1UGUA 4YNRA 2KDKA 2A24B 2PHYA 3EQVA 4EEUA 3LI9A 4DMZA 4IJGA 4CLCE 4L9EA 3V67A 1XJ6A 2W0NA 1S1YA 3NOUC 4HP9A 1JNUA 5EFWA 5HWWA 1N9OA 4RQ9A 2JKRI 1W63Q 1LSXA 4MMNA 4XT2B 3OCLA 2LB5A 3HJIA 3T4OA 4Y2FA 1YKDA 3MFXA 3F1PB 4H6JB 3T4SA 3U2AA 3CI6A 4WELA 5I5LA 4BBTA 2L4RA 4NKPA 4FSFA 4HP4A 5TJJA 2VV6A 3TJZC 2H28A 3EGXC 1XFQA 2A2LA 2W3GA 3F1PA 1NRJA 3OBFA 4MCWA 5F68A 3B42A 3EEAA 2Y79A 3LICA 3T4TA 3LR5A 5HDSA 4EERA 3T4QA 4HH3A 4BJPA 1ZHHB 4Q0IA 2QKPA 1P97A 2Z6DA 3RFBA 3TE8A 3C38A 2Y8HA 1UWPX 5IT5A 4I39A 1LL8A 1XJ4A 5HPIA 3SW1A 1OTEA 2VJWA 2L0WA 1S4RA 4HY8A 3A0SA 3G6OA 5AJGA 5HZHA 4M4XA 2K7SA 2OAP1 2JHEA 1X0OA 3D72A 4WEKA 1OTDA 2PYPA 5DKLA 2VV7A 3ULFA 4BWIA 4BMWA 5J3WA 2VGLM 3T50A 2GJ3A 2K2NA 3C30A 2Z6CA 4L9GA 3P01A 4II7A 2P08A 3R7WB 4GCZA 1VB6A 3PYPA 4GJ4A 4NEED 4G3WA 3VV4A 1YSPA 4JGQA 3ICYA 3FPVA 3O5YA 4B93A 5DF9A 1T1BA 3CUEA 2VZWA 2PR5A 4Q0HA 2O9BA 3KYZA 1OT9A 3EWKA 1MZUA 3LIEA 3PBNA 4P6ZM 3D3OA 1OJGA 3LR3A 3FG8A 4G3KA 3S7QA 4CLCB 3LIAA 3JVUA 4KQOA 1S1ZA 3BQ8A 1T1CA 2O9CA 3UB9A 5HPFA 1XJ2A 3H7WB 5AVFA 3H82B 4DJ2A 2V0WA 4KUKA 4ME4A 3KSGA 1GSVA 3HCYA 1TS7A 2LB9A 1Y28A 4P6ZS 4JGPA 4R3AA 4PKYG 1XFNA 3NOTC 4LRYC 5G4ZA 2W1TB 3CLOA 4LLOB 2PR6A 5FL3A 3TW8A 2V0UA 3P7NA 4ARZA 5HWVA 4I38A 2W1TA 2W27A 4OOMA 4L9FA 3F1OA 3EQUA 4PKYA 3UB8A 1V9ZA 1STZA 4BBUA 5HDCA 2JN7A 3B47A 2KX6A 3NHQA 3T4JA 3E98A 3BQAA 3NJAA 3MXQA 2JKRM 2A24A 1IFQA 1DP8A 3EEHA 3KYQA 4GLQA 1DP9A 4JGRA 4E04A 4EEPA 3CAXA 2NUTC 1N9LA 3TRCA 3A0RA 4XT2A 3BW6A 3NOPC 3OC2A 4GW9A 2VKSA 4MDZA 3IS2B 4AFIA 3S7NA 2ZBBA 5TBMB 2VV8A 2M7UA 4H6JA 3GECA 3MQQA 3MQOA 3FC7A 5HSQA 1D06A 3UB6A 3IS2A 1XJ3A 1GSWA 5KIZA 4UQIM 4PAUA 3KSHA 3LR4A 2W1RA 4MN6A 3K2NA 4IHQA 4HOIA 3UE3A 4Y5FA 2PT7A 4F3LB 2I9VA 2QWSA 5AVEA 3ZQ5A 2V9AA 4Q0JA 4BBVA 3LIBA 5L8MA 2GNXA 1S67L 4HJ4A 4ETZA 4EXOA 3BWLA 4NXEA 4NXFA 2M7VA 4FOFA 4F3LA 2YKHA 3RTYA 4UQIS 4B9OA 3VE3A 2GX5A 1F9IA 5DKKA 3OLOA 3PBQA 3K3DA 4L0LA 3MR0A 2OWHA 3PXPA 2VX8A 5J7EA 2W3FA 2HV1A 4YOFA 2O0YA 3C8CA 4LRXC 3UB7A 2NUPC 4EW7A 3GDIA 1OJ5A 3UMDA 3A0VA 3R7WA 2O9AA 2ZOIA 2BASA 2VGLS 5DJTA 2R78A 3F1NB 2O99A 5F6AA 5K5BA 1TD5A 2B02A 1NLYA 4MN7A 2B18A 3JVVA 1P9RA 1LSVA 2EWVA 1BYWA 3PBOA 1LT0A 3F1NA 1V9YA 1G6OA 4Y3IA 1KOUA 4CLCA 3CUEC 2DMWA 2INWA 4EU0A 3H9WA 3H7WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZRR A;  3MMH A;  4GLQ A;  4Q0I A;  4E04 A;  3RFB A;  3TRC A;  4EUV A;  2XSS A;  4G3V A;  2Y8H A;  3NOP C;  4GW9 A;  2VKS A;  3S7P A;  4MDZ A;  2W3H A;  1ZTU A;  1VHM A;  3S7N A;  2W3D A;  2W3E A;  1F5M A;  4O01 A;  5HPI A;  2KOI A;  2VJW A;  4LRZ E;  3CIT A;  4IUK A;  2M7U A;  3W2Z A;  5HSQ A;  3G6O A;  5AJG A;  2VEA A;  4BWI A;  3KSI A;  4PAU A;  2KLI A;  3KSH A;  4QPR A;  2XRO A;  2W1R A;  1YSQ A;  5C5K A;  3C2W A;  1TF1 A;  2K2N A;  5LBR A;  3K2N A;  4R6L A;  2QYB A;  4Y5F A;  3BJN A;  3ZQ5 A;  4DN0 A;  5DFY A;  4Q0J A;  4R70 A;  2G7U A;  3IBJ A;  3KO6 A;  5L8M A;  4G3W A;  2OOL A;  4ETZ A;  3VV4 A;  1YSP A;  1MKM A;  2HGV A;  2ZMF A;  3MF0 A;  3O5Y A;  4FOF A;  2M7V A;  2GX5 A;  2VZW A;  4Q0H A;  2O9B A;  4O8G A;  3E0Y A;  3S7O A;  4IUH A;  3IBR A;  4O0P A;  3D3O A;  3OOV A;  2W3F A;  4G3K A;  3S7Q A;  4YOF A;  2O0Y A;  4YNR A;  2O9C A;  4ETX A;  4LRX C;  4DMZ A;  4IJG A;  3MQ0 A;  5HPF A;  2K31 A;  3NOU C;  4ME4 A;  3KSG A;  3HCY A;  4RQ9 A;  3LFV A;  2LB9 A;  4MMN A;  2O9A A;  5HL6 A;  2LB5 A;  3DBA A;  2XRN A;  3NOT C;  4LRY C;  2W1T B;  4Y2F A;  2O99 A;  1YKD A;  5K5B A;  1TD5 A;  3CI6 A;  4MN7 A;  2B18 A;  3KSF A;  5I5L A;  4CQH A;  2W1T A;  5TJJ A;  1STZ A;  4Y3I A;  2W3G A;  3OBF A;  4MCW A;  3NHQ A;  3R4K A;  3E98 A;  3EEA A;  2Y79 A;  1MC0 A;  4EU0 A;  5DFX A;  4Z1W A;  2IA2 A; 
#chains in the Genus database with same CATH topology
 5A8B A;  1T19 A;  3S1Y A;  2C6W B;  1DJA A;  2V1B A;  4FTX A;  1H0M A;  3MBZ A;  1G28 A;  1LI9 A;  2W3H A;  1AXB A;  3NDE A;  3G35 A;  3WS0 A;  4Y0U A;  1F5M A;  2V20 A;  4GDN A;  3C7V A;  1XX2 A;  1ODV A;  1LL9 A;  5M1A A;  2XDM A;  3N7W A;  2KLI A;  2XRO A;  1ZKJ A;  3CWF A;  4R6L A;  3VE4 A;  2QYB A;  1NJ4 A;  4LCM A;  4YWZ A;  4QB8 A;  3LCE A;  4DN0 A;  4RX3 A;  4P6B A;  3IBJ A;  3N8R A;  2ZL1 B;  4GOG A;  5FEF A;  5EVI A;  4DF6 A;  3S4X A;  3UE6 A;  1NZO A;  4IUH A;  4QHC A;  3V50 A;  5TBM A;  4EES A;  1FR1 A;  3B3X A;  3VP4 A;  5IU1 A;  4GD6 A;  3QP6 A;  1M6K A;  3UDI A;  3SH9 A;  3PBT A;  3LFV A;  5HL6 A;  3Q82 A;  4GKU A;  3DWZ A;  1LLB A;  2PYR A;  2J3W A;  3BFE A;  4GZB A;  3CJM A;  4R38 A;  3UE1 A;  4BEN A;  4HNB A;  3KSF A;  1PRQ A;  4CQH A;  4DE0 A;  1MWU A;  4OPR A;  2HJE A;  4ZDX A;  1SCW A;  2XFS A;  3MZD A;  3R4K A;  1F98 A;  4NXG A;  1LL5 A;  5DFX A;  4PM8 A;  4KZ4 A;  2IA2 A;  1W8Q A;  2P74 A;  5GL9 A;  3E4O A;  5EVI D;  3Q7Z A;  4O01 A;  2KOI A;  1SKO B;  4LRZ E;  2Q9M A;  3W2Z A;  2ZJ9 A;  4GHI B;  1ZG4 A;  5EUA A;  4RVA A;  1P9W A;  1JTD A;  2OAQ 1;  2EXA A;  3VSL A;  3C2W A;  1DRM A;  3T4K A;  3T4L A;  1EWZ A;  1J3W A;  2G2W A;  4GHI A;  5AQ7 A;  3PR6 A;  1YT4 A;  2G7U A;  2ZOH A;  5HFO A;  5HD3 A;  3MS6 A;  2Y91 A;  4DRT A;  4B4X A;  4EBP A;  2Q0O A;  1ES2 A;  2VLG A;  2J8Y A;  2JKT I;  4DJ3 A;  2HJ9 C;  3F1O B;  2L1M A;  3EOI A;  3IWQ A;  5GHZ A;  4PMA A;  5FAT A;  3OCN A;  3ZG9 B;  1UGU A;  4WZ5 C;  5CTM A;  1KE3 A;  4YNR A;  3Q1F A;  2KDK A;  2A24 B;  4CLC E;  4L9E A;  5FQI A;  1S1Y A;  3NOU C;  1JNU A;  4RQ9 A;  1HLU P;  2JKR I;  4XT2 B;  2ZQ7 A;  1TDL A;  4BL2 A;  1YKD A;  1CF0 A;  2Y2Q A;  3ITB A;  4QU3 A;  5FAO A;  1FCM A;  3MFX A;  4H6J B;  4UHU A;  2FFY A;  1PWG A;  2OSU A;  4ZTK A;  2H28 A;  3EGX C;  2A2L A;  2W3G A;  3KYE A;  3OBF A;  5FI2 A;  3Q7V A;  3EEA A;  2B5R A;  3G2Z A;  1XGJ A;  3LIC A;  4LEN A;  4LCL A;  3T4Q A;  4BJP A;  4ESP A;  1YLW A;  3QNB A;  2EFX A;  1NYM A;  1P97 A;  2Z6D A;  3LGO A;  1LL8 A;  3HLG A;  3VMA A;  5HW3 A;  4YIN A;  3A0S A;  3UO9 A;  4KZ9 A;  4M4X A;  1HZO A;  2OAP 1;  2JHE A;  1X0O A;  3D72 A;  4WEK A;  4OOY A;  3MFD A;  2VV7 A;  3A3E A;  3P09 A;  4LV1 A;  3TSG A;  3M2J A;  4KZ7 A;  2ZC5 B;  3DTI A;  3V3R A;  1VB6 A;  3PYP A;  1XA7 A;  2VK3 A;  3A3I A;  2EX8 A;  1YSP A;  4DDS A;  1NZU A;  2IWB A;  3O5Y A;  1IYQ A;  1ES5 A;  3HBR A;  4WZ4 A;  3RXX A;  3CUE A;  2VZW A;  2BG1 A;  2O9B A;  3KYZ A;  1OT9 A;  3W4Q A;  3D3O A;  3ZG7 B;  3JVU A;  1S1Z A;  3BQ8 A;  5GLA A;  5HPF A;  1XPB A;  3LY4 A;  5AVF A;  3H82 B;  4CPK A;  5EEC A;  4ME4 A;  2ZQD A;  3KSG A;  1TS7 A;  1ZC2 A;  3IWI A;  4JGP A;  4PKY G;  5GLB A;  5GLC A;  2WK0 A;  2WAD A;  2PR6 A;  4HBT A;  3AGD A;  4ARZ A;  2Y2J A;  3UB8 A;  1BLC A;  3IXH A;  1V9Z A;  4K0W A;  5JYP A;  4JXG A;  2JN7 A;  1ACF A;  3E98 A;  2UV0 E;  1VET A;  4UAA A;  1C3B A;  2PU2 A;  1NY0 A;  4S2M A;  1FR6 A;  1DP8 A;  2ZC3 B;  4RX2 A;  5TR7 A;  3M2K A;  1MXO A;  3V5M A;  1DP9 A;  3GQZ A;  4E04 A;  4EEP A;  3MZE A;  3CZD A;  4D2O A;  4GW9 A;  1G5U A;  3IXB A;  5F1G A;  2ZQC A;  3NEC A;  2P9V A;  3D4F A;  1FIL A;  3G32 A;  3FC7 A;  1PNE A;  3UB6 A;  4ID4 A;  1CI9 A;  4PAU A;  1K4F A;  5F1F A;  5HAR A;  5HAQ A;  4HOI A;  2E8I A;  2PT7 A;  3C7U A;  5E43 A;  5L8M A;  3NDG A;  4O7D A;  4HJ4 A;  3MZF A;  4EXO A;  4NXF A;  4C75 A;  2X01 A;  5FA7 A;  1ES4 A;  3PBQ A;  3UPP A;  3K3D A;  3PXP A;  4WBG A;  5J7E A;  2W3F A;  3OPR A;  4HEF A;  4YOF A;  2BLS A;  3UB7 A;  4JXW A;  1SZV A;  2NUP C;  1K6S A;  3OPP A;  1N9B A;  1OME A;  3A0V A;  2O9A A;  3SS4 A;  4B88 A;  4K0X A;  2O99 A;  1TD5 A;  4S2P A;  2B18 A;  2ZQA A;  4GN2 A;  2EWV A;  1RGY A;  1LT0 A;  5HAP A;  3BLM A;  1E4D A;  4MBF A;  1CJF A;  1SDN A;  3UPN A;  2DMW A;  1Y4O A;  4X69 A;  2INW A;  3UY6 A;  4EU0 A;  2H0T A;  4P0M A;  4EV4 A;  2VGK A;  2XR0 A;  3O87 A;  1IEL A;  4GS9 B;  2Y2L A;  2OWJ A;  5HL1 A;  3HLW A;  1L3L A;  1L0F A;  3LID A;  3ISG A;  5EPH A;  3K3C A;  1VHM A;  1K54 C;  4E3M A;  1L0E A;  1S4S A;  5FQQ A;  3DTE A;  1OTA A;  4OPQ A;  4OVD A;  2Y2N A;  1EW0 A;  1PWD A;  2V1A A;  4Y0T A;  3LYX A;  2H10 A;  3KSI A;  4QPR A;  2HPB A;  1YSQ A;  2RL3 A;  3SS5 A;  1FCN A;  1G68 A;  1ESI A;  1BLH A;  4R70 A;  3KO6 A;  3E4P A;  5FDH A;  3NUL A;  2WKI A;  1VEU A;  1FSY A;  1ESU A;  1DJC A;  4DXB A;  3QP5 A;  4R1G A;  3VP3 A;  1NLZ A;  3RJU A;  5TFQ A;  3UDX A;  4Y17 A;  1I2S A;  4Y13 A;  3MQ0 A;  3EGD C;  3FPW A;  3VSK A;  1ZG6 A;  1IKI A;  2XA7 M;  2JC7 A;  3WS1 A;  5CER A;  3VFH A;  3LEQ A;  1N9N A;  3IH8 A;  2G2U A;  5IHV A;  1TS0 A;  5DJU A;  3VFF A;  3HLC A;  4JBF A;  2QHK A;  1IYP A;  2Q9N A;  2XD5 A;  2XA7 S;  2WAF A;  1MKI A;  5EVL A;  2J7V A;  5E2E A;  5AQ9 A;  5HWT A;  3ZVW A;  1K55 C;  1MC0 A;  5J4E A;  3NIA A;  4MBK A;  2IWC A;  1BUL A;  4Z1W A;  2QJ7 A;  5HX9 A;  5CHU A;  2D02 A;  2ZM8 A;  3U4L P;  3LIF A;  4G3V A;  1Y54 A;  2ZD8 A;  4EUZ A;  3HLE A;  1K6R A;  2W3D A;  4WN5 A;  1D7E A;  5IS1 A;  3CIT A;  3Q81 A;  1WA9 A;  2VEA A;  1I5Q A;  4RA7 A;  3ZFZ A;  2WKQ A;  4PHT A;  3SH8 A;  2Y59 A;  3BJN A;  1RCJ A;  5DFY A;  3MJQ A;  3PBR A;  3LEZ A;  4KQD A;  5F82 A;  1ERO A;  2OOL A;  2ACG A;  2EXB A;  2J3T C;  3A3D A;  2WKR A;  3MF0 A;  2ZM2 A;  4I3J A;  1KDW A;  3M6B A;  3E0Y A;  1W63 M;  2JKT M;  3UE0 A;  3LUQ A;  2XEP A;  2ZC6 B;  1Z6F A;  1LHY A;  2PHY A;  3EQV A;  4IJG A;  3T1X A;  1PZO A;  3MSH A;  3FZC A;  4QY6 A;  2LB5 A;  4KG6 A;  4LGW A;  4OLD A;  5A90 A;  2BTF P;  2AVX A;  4Y2F A;  4X6T A;  2ZL1 A;  5L09 A;  3T4S A;  3U2A A;  5D3O A;  3CI6 A;  2L4R A;  4PM6 A;  4FSF A;  4HP4 A;  3MXR A;  4MCW A;  1KGE A;  1GA0 A;  1KE4 A;  3B42 A;  1FCO A;  4JXS A;  3T4T A;  4FD8 A;  1BT5 A;  5FAS A;  2WKH A;  3TE8 A;  3C38 A;  4E3O A;  4I39 A;  4OQH A;  3ZGA B;  3QP4 A;  2R9W A;  4F94 A;  3ZNY A;  1HD8 A;  1KGG A;  3L9K A;  4HY8 A;  3G6O A;  3IX3 A;  5AJG A;  1NRF A;  3ITA A;  4MBH A;  5DKL A;  4C3Q A;  1MWR A;  1RP5 A;  4EBL A;  2K2N A;  1YLY A;  2Z6C A;  4NK3 A;  4II7 A;  3R7W B;  4S2J A;  4NEE D;  4G3W A;  3VV4 A;  4JGQ A;  4B93 A;  2Y2H A;  5FSR A;  2R9X A;  3GVB A;  3N8L A;  1MZU A;  2PU4 A;  1IYS A;  4R4S A;  2ZC4 B;  1SKO A;  3LR3 A;  3FG8 A;  4G3K A;  4CLC B;  4WM9 A;  3AGE A;  1JWV A;  4KQO A;  2Y2O A;  1T1C A;  2I72 A;  1YLP A;  1PWC A;  3UNW A;  4ZJ3 A;  1K54 A;  5FQM A;  1GSV A;  3HCY A;  4R3A A;  2HDQ A;  2PRF A;  4KZB A;  2W1T B;  4LLO B;  1O7E A;  4P87 A;  2QZ6 A;  2H0Y A;  3CHW P;  2W1T A;  2W27 A;  3F1O A;  4PKY A;  4LV0 A;  3GRJ A;  1STZ A;  5HDC A;  3T1R A;  3B47 A;  3NHQ A;  3T4J A;  4PM7 A;  4ZAM A;  2WYX A;  3MXQ A;  2A24 A;  2B95 A;  1W79 A;  3HUO A;  3BFD A;  3HUM A;  1N9L A;  3TRC A;  3A0R A;  4XT2 A;  3BW6 A;  2JBF A;  3BEB A;  2DRW A;  3HLB A;  3V39 A;  3IX4 A;  2ZBB A;  2M7U A;  4H6J A;  5KMW A;  3GEC A;  3MQQ A;  5HSQ A;  1XJ3 A;  4GD8 A;  5KIZ A;  3N8S A;  4UQI M;  3KSH A;  2W1R A;  5GHX A;  4F3L B;  2QWS A;  4DKI A;  1TDG A;  3DWK A;  2V9A A;  4Q0J A;  5FAQ A;  4CJN A;  4X25 A;  5FI7 A;  2WAE A;  2WZZ A;  2XF3 A;  4E3I A;  4F3L A;  2YKH A;  4UQI S;  1F9I A;  3OLO A;  2QMI A;  2HDR A;  4DE3 A;  3MR0 A;  2XQZ A;  2OWH A;  4X1L A;  2VX8 A;  2HV1 A;  3ZG5 A;  2RCX A;  2O0Y A;  1HVB A;  3C8C A;  5CGS A;  5EE8 A;  1PW1 A;  4LRX C;  5FDS A;  3GDI A;  5CHJ A;  1ERQ A;  2WUQ A;  3UMD A;  3T1Q B;  2BAS A;  5DF8 A;  1H8Y A;  2R78 A;  1MWT A;  1FIK A;  3IH9 A;  3JVV A;  3O86 A;  1LSV A;  3PBO A;  1V9Y A;  1G6O A;  3SZT A;  3IQA A;  4Y3I A;  1Q2Q A;  4N9L A;  4OPY A;  3HLD A;  1F2K A;  5EM1 A;  4ZRR A;  3H82 A;  1IOU A;  2PBD P;  5E2G A;  4N1X A;  2XSS A;  4X1M A;  1T18 A;  4R3J A;  3PAE A;  2GZA A;  4LV3 A;  3ZYT A;  3L7H A;  5HD5 A;  4S2I A;  2ZMV A;  3FKW A;  1JTG A;  5G18 A;  5F5Y A;  3G4P A;  2EA9 A;  3D9Y A;  1TF1 A;  5LBR A;  2QJ5 A;  1GHP A;  4QWO A;  4GDB A;  3V3S A;  1SDE A;  4I3A A;  4ZBE A;  3PBS A;  2FZ0 A;  3MXS A;  1S0W A;  3BY9 A;  2CMN A;  4X55 A;  4HIA A;  4JGO A;  3VOY A;  3OOV A;  2Y2M A;  2J3T D;  4XUZ A;  5HDD A;  1YLZ A;  3KX0 X;  4ETX A;  2EWW A;  3LR0 A;  1L0G A;  4BD0 A;  5CEB A;  1TVF A;  1FSW A;  4S2O A;  3WRT A;  1CI8 A;  3AGF A;  1YQS A;  1IEM A;  3DBA A;  4Z9Q A;  1JVJ A;  2Z2M B;  4KZ3 A;  3FKV A;  2V1Z A;  1L2S A;  4PM9 A;  1BZA A;  5KZH A;  4QY5 A;  1TS6 A;  4FUW A;  3E2L A;  2WGW B;  4OQ0 A;  1BLP A;  4WEJ A;  2FH5 A;  5EV0 A;  3WS4 A;  2VA0 A;  3QP2 A;  1H3Q A;  3C5A A;  4EUV A;  4U3T A;  4S2K A;  4GNU A;  4PM5 A;  2W3E A;  3DTK A;  4K08 A;  1ONH A;  2J80 A;  3UDF A;  1P0Z A;  1YMX A;  2V8C A;  4KZA A;  5C5K A;  1LSW A;  3GMW A;  3UME A;  2PDR A;  4KEN B;  3WRZ A;  2Y2K A;  4KUO A;  4LPZ A;  1MPL A;  4HHD A;  4N9K A;  4WZ5 A;  3QP1 A;  4UEY A;  3B33 A;  2WKE A;  4A5R A;  4CLC C;  4GS9 A;  3RH8 B;  3I7J A;  1DP6 A;  3WS2 A;  4B4Z A;  2XH9 A;  1NWZ A;  5F69 A;  1TS8 A;  4O8G A;  5EOO A;  1T1A A;  3HUN A;  1U60 A;  1PI4 A;  1CEG A;  3ZDJ A;  2PAV P;  4WL9 A;  1BUE A;  2ZM0 A;  4HJ3 A;  2X71 A;  4EEU A;  3LI9 A;  4DMZ A;  3V67 A;  3LO7 A;  5L07 A;  1XJ6 A;  4HP9 A;  5EFW A;  4JF4 A;  1W63 Q;  3VP0 A;  3OCL A;  3GR2 A;  3T4O A;  1SHV A;  1YPR A;  4OON A;  1GHM A;  1BSG A;  4OQI A;  5I5L A;  5E2H A;  3DW0 A;  4MLL A;  5TJJ A;  1XFQ A;  1NRJ A;  2IWD A;  4U0X A;  4UA9 A;  1D1J A;  3TOI A;  1K57 C;  4OPZ A;  3ZG8 B;  3LR5 A;  4QJG A;  4HH3 A;  3G31 A;  1ZHH B;  4Q0I A;  1MWS A;  2Y8H A;  5IT5 A;  1IYO A;  1XJ4 A;  3ZNT A;  5GHY A;  1NYY A;  1S4R A;  4YFM A;  2K7S A;  1JWZ A;  1OTD A;  2GDN A;  2PYP A;  3IWO A;  5J3W A;  2VGL M;  3T50 A;  2GJ3 A;  1CEF A;  3C30 A;  4KZ8 A;  2P08 A;  4IED A;  1CQA A;  3M6H A;  4GCZ A;  4GJ4 A;  1YLJ A;  4KG5 A;  1HTZ A;  2A49 A;  5U47 A;  1T1B A;  2HP6 A;  4QD4 A;  4Q0H A;  3EWK A;  1A0K A;  3IXG A;  3OPH A;  3S7Q A;  2WZX A;  3W4O A;  3UB9 A;  2V2F F;  3H7W B;  4IVI A;  1CK3 A;  2V0W A;  4XUX A;  2H5S A;  5TGF A;  1ONG A;  5CRF A;  1GHI A;  2LB9 A;  5L10 A;  1Y28 A;  1XFN A;  2UWX A;  3IF6 C;  3NOT C;  4LRY C;  5EM0 A;  5FL3 A;  5G4Z A;  4X56 A;  3TW8 A;  1PIO A;  1LI0 A;  1YMS A;  4E3K A;  1XKZ A;  4KQR A;  4I38 A;  4OOM A;  2HP5 A;  4L9F A;  3EQU A;  2XD1 A;  5CHM A;  3OZH A;  4BBU A;  1WE4 A;  4LFU A;  2KX6 A;  3UB5 P;  3NJA A;  2JKR M;  2X02 A;  3SH7 A;  4GLQ A;  1BLS A;  4JGR A;  3W8K A;  2HP9 A;  2NUT C;  3NOP C;  3OC2 A;  4JLF A;  1RGZ A;  5EVI B;  3ZHH A;  3IS2 B;  4U0T A;  2EFU A;  3QP8 A;  3TG9 A;  2ZLY A;  4E6W A;  5TBM B;  2VV8 A;  3UPO A;  1KVL A;  3CG5 A;  4KQQ A;  3BM6 A;  3IS2 A;  4DE1 A;  3VP1 A;  3K2N A;  5FQK A;  4Y5F A;  3UE3 A;  5AVE A;  3NC8 A;  3LIB A;  2GNX A;  3RXW A;  1K56 A;  4NXE A;  4E3J A;  1GA9 A;  4MEZ A;  5DKK A;  1BTL A;  4L0L A;  4OKP A;  1TEM A;  2JKG A;  1XP4 A;  3WWX A;  2XGN A;  4OP5 A;  1K4E A;  2HZ5 A;  5AQA A;  1YLT A;  4BD1 A;  2C5W B;  1OJ5 A;  3BLS A;  2EX2 A;  2XFT A;  3C4P A;  3R7W A;  2ZOI A;  3FWL A;  5DJT A;  4NET A;  3F1N B;  4Y7P A;  4PPR A;  5F6A A;  4S2N C;  1NLY A;  1P9R A;  2ZQ9 A;  1BYW A;  5CGX A;  3F1N A;  4BLM A;  1AWI A;  3A3J A;  3NY4 A;  1KOU A;  3CPT B;  3GV9 A;  4CLC A;  4E3L A;  4E3N A;  2JKF A;  4WMC A;  3H9W A;  1K0K A;  3BFG A;  3IHA A;  4ZJ1 A;  2Y55 A;  1EI5 A;  3CPT A;  3MMH A;  2FFF B;  3BY8 A;  5HAI A;  3LI8 A;  1K56 D;  3LY3 A;  1XXM A;  3FV7 A;  5M19 A;  1ZTU A;  2EX9 A;  3VOL A;  3QNC A;  4IVK A;  1OT6 A;  2MJ6 A;  3IF5 A;  1PZP A;  3O88 A;  4FH2 A;  2PD8 A;  1G6A A;  4IBX A;  3VOZ A;  2WGI A;  4OP8 A;  3G34 A;  1GSX A;  3JPU A;  4KZ6 A;  5KSH A;  3DAV A;  4OQG A;  2PD7 A;  4EQ1 A;  1ERM A;  1PW8 A;  2HGV A;  4N1H A;  3O3V A;  2HF6 A;  3HL9 A;  1SKF A;  3PHY A;  1NXY A;  1H5X A;  1K57 A;  4NXB A;  2D01 A;  3Q7V B;  2XK1 A;  3SOI A;  1PI5 A;  3E4Q A;  1YAX A;  3HLF A;  5A93 A;  4CLC D;  2A3U A;  1ALQ A;  2K31 A;  4HJ6 A;  4WMC D;  2P04 A;  5MC7 A;  3MKE A;  5GLD A;  3ZCZ A;  3WS5 A;  2ZMA A;  1L0D A;  5G4Y A;  2XRN A;  1K55 A;  2OLV A;  4HH2 A;  2YKF A;  4P85 A;  5DTK A;  4JXV A;  2OV5 A;  4Q8I A;  1VM1 A;  4DXC A;  1S66 L;  2E8J A;  1E3U A;  1E25 A;  5L2F A;  2P7J A;  3GTC A;  1XGI A;  4FH4 A;  5FQJ A;  1QMF A;  4OOL A;  4OLG A;  4UA6 A;  3IXD A;  5DTS A;  4MN5 A;  4I3I A;  3S7P A;  4WUJ A;  4JF6 A;  1OTI A;  3BFF A;  5CED A;  2OLU A;  3OPL A;  3IF6 B;  2M1C A;  4IUK A;  4JF5 A;  3T1S A;  3HJK A;  2WKP A;  3S22 A;  4I5S A;  4X53 A;  1OPX A;  1YM1 A;  1Q2P A;  3IF6 A;  3QHY A;  4HI4 A;  1OTB A;  2J9P A;  4K91 A;  3N4I A;  4WF0 A;  1W5D A;  1H8M A;  3BYD A;  4HQA A;  2ZQ8 A;  3IT9 A;  1MKM A;  1UWN X;  2ZMF A;  4R3B A;  3ZG0 A;  5CX7 A;  1KDS A;  4ARZ B;  4EET B;  5KSC A;  4WLA A;  3S7O A;  3E2K A;  3IBR A;  4O0P A;  3T12 B;  2VGJ A;  4JKT A;  1VET B;  3HVF A;  1IKG A;  1E3U D;  3W4P A;  1XA1 A;  4R0Q A;  5E2F A;  5DF7 A;  2JE5 A;  1VQQ A;  2W0N A;  5EOE A;  5HWW A;  1N9O A;  1LSX A;  4MMN A;  2J9O A;  3HJI A;  4WYY A;  2P9V B;  2ZC7 A;  4UA7 A;  3F1P B;  4WEL A;  3MKF A;  5A92 A;  4BBT A;  2QPN A;  4DDY A;  4NKP A;  2VV6 A;  3TJZ C;  5CEC A;  3F1P A;  5F68 A;  5EVI C;  5FI6 A;  2Y79 A;  5EVE A;  1Z09 A;  4HES A;  5HDS A;  4EER A;  2QKP A;  3IX8 A;  3RFB A;  1JWP A;  1UWP X;  3BEC A;  5F83 A;  1H8Z A;  2WGV A;  5CTN A;  5HPI A;  3SW1 A;  1OTE A;  2VJW A;  2L0W A;  4IBR A;  5AQB A;  3VP2 A;  4NG2 A;  3BRM A;  4Y0O A;  5HZH A;  3IHB A;  4BWI A;  3ULF A;  4BMW A;  2WGW A;  4ZJ2 A;  4L9G A;  3P01 A;  1WYC A;  4S2N A;  2EX6 A;  3ICY A;  1MY8 A;  3CMZ A;  3FPV A;  5DF9 A;  3Q07 A;  4KZ5 A;  1K25 A;  2PR5 A;  1MBL A;  4JPM A;  5FEG A;  3LIE A;  3PBN A;  4P6Z M;  1DJB A;  1OJG A;  3JYI A;  4MNR A;  1GCE A;  4EBN A;  1W7F A;  3LIA A;  5M18 A;  2O9C A;  1XJ2 A;  4DJ2 A;  3PAG A;  2CC1 A;  4KUK A;  1KVM A;  4P6Z S;  3ZVT A;  3CLO A;  2Y2G A;  4H8R A;  5JYO A;  1QME A;  2V0U A;  3P7N A;  3N6I A;  5HWV A;  2DNS A;  1M40 A;  2Y2P A;  3PTE A;  4BL3 A;  3BQA A;  2Y2I A;  1IFQ A;  3NCK A;  1S6R A;  1N4O A;  3EEH A;  1PYY A;  3KYQ A;  4M3K A;  3CAX A;  4X68 A;  3NI9 A;  3C4O A;  1VEU B;  2VKS A;  4MDZ A;  4AFI A;  4E6X A;  3S7N A;  3HRE A;  5DVA A;  3A3F A;  1W8Y A;  3MQO A;  2Y4A A;  1D06 A;  2HDU A;  3GSG A;  2HDS A;  1GSW A;  1KE0 A;  5J8X A;  1DY6 A;  4OH0 A;  3P98 A;  3LR4 A;  4EWF A;  1J9M A;  2JCH A;  4MN6 A;  4IHQ A;  4HBU A;  2I9V A;  4KG2 A;  3ZQ5 A;  1PFL A;  4BBV A;  1S67 L;  1ES3 A;  4D60 A;  4ETZ A;  3BWL A;  4XXR A;  4N92 A;  5CGW A;  4EQI A;  2M7V A;  4FOF A;  3NBL A;  5A91 A;  3RTY A;  4B9O A;  3VE3 A;  2GX5 A;  4Y15 A;  3G2Y A;  3FYZ A;  1WYB A;  3G30 A;  4RYE A;  4GB7 A;  4BQM A;  2V8F A;  2XLN A;  3DTM A;  1K38 A;  4EW7 A;  1FOF A;  4S2L A;  2DCF A;  1I2W A;  3SS3 A;  2VGL S;  1KGF A;  4FCF A;  4C6Y A;  1O07 A;  4LV2 A;  5K5B A;  1FQG A;  2B02 A;  4R4R A;  4MN7 A;  5CXW A;  5DTT A;  3BFC A;  4DE2 A;  2PBY A;  5FQ9 A;  3CUE C;  5BOH A;  3UN7 A;  5FAP A;  5I94 A;  4R23 A;  3H7W A;  2Z2L B; 
#chains in the Genus database with same CATH homology
 4ZRR A;  3H82 A;  5A8B A;  1T19 A;  1IOU A;  3MMH A;  3BY8 A;  4GS9 B;  2OWJ A;  3LI8 A;  2V1B A;  2XSS A;  1T18 A;  1G28 A;  3LID A;  2W3H A;  1ZTU A;  3K3C A;  3VOL A;  1VHM A;  1S4S A;  1F5M A;  1OT6 A;  2MJ6 A;  2GZA A;  1OTA A;  1ODV A;  2PD8 A;  3ZYT A;  1EW0 A;  5HD5 A;  2V1A A;  3LYX A;  2ZMV A;  3KSI A;  2KLI A;  4QPR A;  2XRO A;  5F5Y A;  2EA9 A;  1YSQ A;  3CWF A;  1TF1 A;  5LBR A;  4R6L A;  3VE4 A;  2QYB A;  1GSX A;  4YWZ A;  4DN0 A;  5KSH A;  4R70 A;  3IBJ A;  2QJ5 A;  3KO6 A;  2PD7 A;  4EQ1 A;  3E4P A;  2HGV A;  4I3A A;  2HF6 A;  3PBS A;  2FZ0 A;  3PHY A;  3BY9 A;  3UE6 A;  2CMN A;  4NXB A;  4IUH A;  4HIA A;  4JGO A;  2D01 A;  3OOV A;  5TBM A;  4EES A;  1NLZ A;  2J3T D;  3E4Q A;  1YAX A;  5HDD A;  5IU1 A;  3KX0 X;  4CLC D;  4ETX A;  3MQ0 A;  3EGD C;  3FPW A;  2EWW A;  2K31 A;  4HJ6 A;  3LR0 A;  2P04 A;  5MC7 A;  3PBT A;  2XA7 M;  3LFV A;  5HL6 A;  3DBA A;  5G4Y A;  2XRN A;  2PYR A;  2J3W A;  1N9N A;  4HH2 A;  2YKF A;  4R38 A;  1TS0 A;  5DJU A;  4HNB A;  3KSF A;  4CQH A;  2QHK A;  1TS6 A;  2HJE A;  2XA7 S;  1S66 L;  4WEJ A;  5HWT A;  3R4K A;  2FH5 A;  1F98 A;  1MC0 A;  2P7J A;  4NXG A;  5J4E A;  2VA0 A;  5DFX A;  4Z1W A;  2QJ7 A;  2IA2 A;  2D02 A;  1H3Q A;  4OOL A;  3LIF A;  4EUV A;  4G3V A;  4MN5 A;  3E4O A;  4I3I A;  3S7P A;  4WUJ A;  1OTI A;  2W3D A;  4WN5 A;  2W3E A;  1D7E A;  4O01 A;  5IS1 A;  2KOI A;  4LRZ E;  2M1C A;  3CIT A;  4IUK A;  3W2Z A;  4K08 A;  2J80 A;  1WA9 A;  3HJK A;  2WKP A;  4GHI B;  2VEA A;  4I5S A;  1P9W A;  1P0Z A;  1OPX A;  2OAQ 1;  2WKQ A;  4HI4 A;  3C2W A;  4PHT A;  5C5K A;  1DRM A;  1LSW A;  3T4K A;  3UME A;  2PDR A;  1OTB A;  4KUO A;  3T4L A;  4GHI A;  4WF0 A;  3BJN A;  5DFY A;  3MJQ A;  3PBR A;  3PR6 A;  4LPZ A;  1H8M A;  2G7U A;  4KQD A;  4HHD A;  2ZOH A;  5HD3 A;  2OOL A;  4HQA A;  4UEY A;  2J3T C;  3B33 A;  1MKM A;  2WKR A;  1UWN X;  2ZMF A;  4GS9 A;  4CLC C;  3MF0 A;  3RH8 B;  5CX7 A;  2VLG A;  4I3J A;  4ARZ B;  4EET B;  1DP6 A;  1NWZ A;  4WLA A;  5F69 A;  1TS8 A;  2JKT I;  3E0Y A;  1T1A A;  4O8G A;  1W63 M;  2JKT M;  3S7O A;  4DJ3 A;  2HJ9 C;  3F1O B;  2L1M A;  3EOI A;  3IBR A;  3LUQ A;  4O0P A;  4WL9 A;  3OCN A;  4HJ3 A;  1UGU A;  4YNR A;  2KDK A;  2A24 B;  2PHY A;  3EQV A;  4EEU A;  3LI9 A;  4DMZ A;  4IJG A;  4CLC E;  4L9E A;  3V67 A;  1XJ6 A;  2W0N A;  1S1Y A;  3NOU C;  4HP9 A;  1JNU A;  5EFW A;  5HWW A;  1N9O A;  4RQ9 A;  2JKR I;  1W63 Q;  1LSX A;  4MMN A;  4XT2 B;  3OCL A;  2LB5 A;  3HJI A;  3T4O A;  4Y2F A;  1YKD A;  3MFX A;  3F1P B;  4H6J B;  3T4S A;  3U2A A;  3CI6 A;  4WEL A;  5I5L A;  4BBT A;  2L4R A;  4NKP A;  4FSF A;  4HP4 A;  5TJJ A;  2VV6 A;  3TJZ C;  2H28 A;  3EGX C;  1XFQ A;  2A2L A;  2W3G A;  3F1P A;  1NRJ A;  3OBF A;  4MCW A;  5F68 A;  3B42 A;  3EEA A;  2Y79 A;  3LIC A;  3T4T A;  3LR5 A;  5HDS A;  4EER A;  3T4Q A;  4HH3 A;  4BJP A;  1ZHH B;  4Q0I A;  2QKP A;  1P97 A;  2Z6D A;  3RFB A;  3TE8 A;  3C38 A;  2Y8H A;  1UWP X;  5IT5 A;  4I39 A;  1LL8 A;  1XJ4 A;  5HPI A;  3SW1 A;  1OTE A;  2VJW A;  2L0W A;  1S4R A;  4HY8 A;  3A0S A;  3G6O A;  5AJG A;  5HZH A;  4M4X A;  2K7S A;  2OAP 1;  2JHE A;  1X0O A;  3D72 A;  4WEK A;  1OTD A;  2PYP A;  5DKL A;  2VV7 A;  3ULF A;  4BWI A;  4BMW A;  5J3W A;  2VGL M;  3T50 A;  2GJ3 A;  2K2N A;  3C30 A;  2Z6C A;  4L9G A;  3P01 A;  4II7 A;  2P08 A;  3R7W B;  4GCZ A;  1VB6 A;  3PYP A;  4GJ4 A;  4NEE D;  4G3W A;  3VV4 A;  1YSP A;  4JGQ A;  3ICY A;  3FPV A;  3O5Y A;  4B93 A;  5DF9 A;  1T1B A;  3CUE A;  2VZW A;  2PR5 A;  4Q0H A;  2O9B A;  3KYZ A;  1OT9 A;  3EWK A;  1MZU A;  3LIE A;  3PBN A;  4P6Z M;  3D3O A;  1OJG A;  3LR3 A;  3FG8 A;  4G3K A;  3S7Q A;  4CLC B;  3LIA A;  3JVU A;  4KQO A;  1S1Z A;  3BQ8 A;  1T1C A;  2O9C A;  3UB9 A;  5HPF A;  1XJ2 A;  3H7W B;  5AVF A;  3H82 B;  4DJ2 A;  2V0W A;  4KUK A;  4ME4 A;  3KSG A;  1GSV A;  3HCY A;  1TS7 A;  2LB9 A;  1Y28 A;  4P6Z S;  4JGP A;  4R3A A;  4PKY G;  1XFN A;  3NOT C;  4LRY C;  5G4Z A;  2W1T B;  3CLO A;  4LLO B;  2PR6 A;  5FL3 A;  3TW8 A;  2V0U A;  3P7N A;  4ARZ A;  5HWV A;  4I38 A;  2W1T A;  2W27 A;  4OOM A;  4L9F A;  3F1O A;  3EQU A;  4PKY A;  3UB8 A;  1V9Z A;  1STZ A;  4BBU A;  5HDC A;  2JN7 A;  3B47 A;  2KX6 A;  3NHQ A;  3T4J A;  3E98 A;  3BQA A;  3NJA A;  3MXQ A;  2JKR M;  2A24 A;  1IFQ A;  1DP8 A;  3EEH A;  3KYQ A;  4GLQ A;  1DP9 A;  4JGR A;  4E04 A;  4EEP A;  3CAX A;  2NUT C;  1N9L A;  3TRC A;  3A0R A;  4XT2 A;  3BW6 A;  3NOP C;  3OC2 A;  4GW9 A;  2VKS A;  4MDZ A;  3IS2 B;  4AFI A;  3S7N A;  2ZBB A;  5TBM B;  2VV8 A;  2M7U A;  4H6J A;  3GEC A;  3MQQ A;  3MQO A;  3FC7 A;  5HSQ A;  1D06 A;  3UB6 A;  3IS2 A;  1XJ3 A;  1GSW A;  5KIZ A;  4UQI M;  4PAU A;  3KSH A;  3LR4 A;  2W1R A;  4MN6 A;  3K2N A;  4IHQ A;  4HOI A;  3UE3 A;  4Y5F A;  2PT7 A;  4F3L B;  2I9V A;  2QWS A;  5AVE A;  3ZQ5 A;  2V9A A;  4Q0J A;  4BBV A;  3LIB A;  5L8M A;  2GNX A;  1S67 L;  4HJ4 A;  4ETZ A;  4EXO A;  3BWL A;  4NXE A;  4NXF A;  2M7V A;  4FOF A;  4F3L A;  2YKH A;  3RTY A;  4UQI S;  4B9O A;  3VE3 A;  2GX5 A;  1F9I A;  5DKK A;  3OLO A;  3PBQ A;  3K3D A;  4L0L A;  3MR0 A;  2OWH A;  3PXP A;  2VX8 A;  5J7E A;  2W3F A;  2HV1 A;  4YOF A;  2O0Y A;  3C8C A;  4LRX C;  3UB7 A;  2NUP C;  4EW7 A;  3GDI A;  1OJ5 A;  3UMD A;  3A0V A;  3R7W A;  2O9A A;  2ZOI A;  2BAS A;  2VGL S;  5DJT A;  2R78 A;  3F1N B;  2O99 A;  5F6A A;  5K5B A;  1TD5 A;  2B02 A;  1NLY A;  4MN7 A;  2B18 A;  3JVV A;  1P9R A;  1LSV A;  2EWV A;  1BYW A;  3PBO A;  1LT0 A;  3F1N A;  1V9Y A;  1G6O A;  4Y3I A;  1KOU A;  4CLC A;  3CUE C;  2DMW A;  2INW A;  4EU0 A;  3H9W A;  3H7W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...