3RFBA

Structure of frmsr
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
160
structure length
160
Chain Sequence
b'SEKQSRYQMLNEELSFLLEGETNVLANLSNASALIKSRFPNTVFAGFYLFDGKELVLGPFQGGVSCIRIALGKGVCGEAAHFQETVIVGDVTTYLNYISCDSLAKSEIVVPMMKNGQLLGVLDLDSSEIEDYDAMDRDYLEQFVAILLEKTTWDFTMFEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Structure of fRMsr
rcsb
source organism Streptococcus pneumoniae
molecule tags Oxidoreductase
total genus 51
structure length 160
sequence length 160
chains with identical sequence B
ec nomenclature ec 1.8.4.14: L-methionine (R)-S-oxide reductase.
pdb deposition date 2011-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13185 GAF_2 GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3rfbA00
2QYBA 2W1TB 3KSHA 5DFXA 2M7UA 2O99A 3DBAA 4Q0HA 2LB5A 3KO6A 2GX5A 2XSSA 3NHQA 5K5BA 2HGVA 2K2NA 5I5LA 4E04A 4PAUA 2LB9A 4G3VA 5L8MA 4MMNA 3TRCA 3IBJA 3E98A 3NOPC 4DMZA 3MMHA 1YKDA 3ZQ5A 3S7NA 3D3OA 4BWIA 1TD5A 2KOIA 2ZMFA 5LBRA 3S7OA 5C5KA 2VEAA 5HPFA 2O9AA 4R70A 3R4KA 4GLQA 4EUVA 3OOVA 4Y5FA 4IUKA 2O9CA 2M7VA 4Y2FA 2B18A 4O8GA 1ZTUA 4G3KA 3S7PA 2O9BA 4QPRA 3O5YA 1MC0A 4ETZA 1TF1A 2W3HA 4ZRRA 5HPIA 4YNRA 3KSIA 3IBRA 2W3DA 3HCYA 3LFVA 4RQ9A 4IJGA 2XRNA 4G3WA 1MKMA 2W1TA 2Y79A 3MF0A 4Z1WA 4O0PA 2G7UA 2W3EA 4MDZA 4FOFA 3KSGA 5TJJA 3VV4A 4CQHA 2Y8HA 3CI6A 3BJNA 4MCWA 4R6LA 2IA2A 4GW9A 3NOUC 2W3FA 4ME4A 3W2ZA 2XROA 3CITA 2VZWA 4YOFA 3G6OA 4DN0A 5DFYA 4IUHA 1YSQA 4LRYC 1F5MA 2VKSA 1VHMA 3K2NA 4EU0A 3OBFA 2O0YA 4LRZE 3MQ0A 4Y3IA 3EEAA 3S7QA 4ETXA 2VJWA 1YSPA 2OOLA 4Q0IA 3C2WA 3KSFA 5HSQA 5HL6A 2W3GA 3NOTC 3RFBA 1STZA 3E0YA 2W1RA 4Q0JA 2K31A 4LRXC 4O01A 4MN7A 5AJGA 2KLIA
chains in the Genus database with same CATH superfamily
3NHQA 4U3TA 3QP8A 2EFUA 1PIOA 4R0QA 1YPRA 3SW1A 2Y59A 2EA9A 3S7NA 1WYCA 4BWIA 3O88A 3BQ8A 3IWOA 3VFHA 5FI6A 2PD8A 4I3JA 2PHYA 3EWKA 4H6JA 1ALQA 4BD0A 3HLFA 3UB5P 1KE0A 2O9CA 4KUKA 4CLCD 3SZTA 2Z6CA 3GTCA 2QMIA 3V50A 3GDIA 3EQVA 4BL2A 3GV9A 4KZ3A 3P01A 4KUOA 2D01A 1SCWA 1CQAA 3IQAA 2J80A 4R3BA 5CERA 4ZTKA 2GZAA 2BG1A 3TOIA 3KSGA 3CHWP 4OPQA 3D72A 1TS8A 2G2WA 3G6OA 1ES4A 1OJ5A 4LENA 4YWZA 4DXBA 5JYOA 5L09A 3H82A 3F1OB 4EU0A 3BY9A 1KGFA 2WKPA 1ZHHB 1F2KA 3KSFA 3G32A 3BEBA 3NJAA 2K31A 5HSQA 2JKGA 4DF6A 4DXCA 2O99A 4Q0HA 3VE4A 4K0XA 4HJ3A 1ZG6A 1N9LA 3CJMA 4GNUA 2IWDA 3IBJA 3VFFA 5HDDA 4E6WA 1IKIA 1KDSA 3VSKA 2Y91A 2WKRA 3NI9A 3T4SA 4R23A 4OVDA 3S7OA 2HV1A 2V1BA 3OOVA 4Y5FA 3N6IA 2NUPC 4I39A 3DW0A 4HBTA 1ONHA 2A2LA 1PW1A 3IX8A 5CHJA 1PWCA 5FDSA 1ONGA 1XJ2A 4KG6A 2XD1A 5HL1A 5FQJA 3MSHA 4GS9B 1FSWA 4GW9A 2A24B 2CMNA 2P74A 4DDSA 2PD7A 3BFDA 4EESA 2R9WA 1N9BA 1LSXA 4X68A 2IWCA 3RJUA 4QD4A 1J9MA 4KG5A 2PYPA 3C7UA 4WBGA 4Y0TA 3M2JA 3Q7VA 1YMXA 4CLCB 2Y2HA 3HVFA 4GHIA 4LRXC 3LUQA 3EGXC 3FKWA 4C3QA 5HWWA 4X1MA 2A3UA 5FATA 5G18A 3VOLA 5CXWA 4WZ5A 1E3UD 1C3BA 4HP4A 4N1HA 4PMAA 1CK3A 5DF9A 2RCXA 4DRTA 1SZVA 5FQMA 3V39A 3FG8A 3HJKA 4KZAA 3RTYA 1MXOA 3LIEA 2ZQ7A 3IS2A 2KX6A 1T1BA 4PPRA 4X25A 4ZJ3A 1N4OA 4Y17A 2OAQ1 4ETZA 1RP5A 3SS5A 2OWJA 3VSLA 4B88A 1EWZA 2WGWB 1DJBA 2EX2A 4ID4A 2V0UA 2OAP1 4X56A 4FOFA 1P0ZA 3A3JA 5EM1A 3WS0A 4E3OA 3VV4A 1K6SA 4QY6A 1D06A 1T1AA 3W4OA 2PR6A 4RX3A 1KVMA 2XFSA 5HAPA 3ISGA 3PXPA 1O07A 1Y54A 4GJ4A 3LO7A 5A92A 5CGSA 3MXSA 1XGJA 1YLYA 3ZG8B 2G2UA 5J8XA 5E2EA 1NYMA 2ZQAA 2ZL1B 3NIAA 1YLPA 4LLOB 2OOLA 4Q0IA 1BLSA 4WLAA 1VETA 4FD8A 1L0GA 3QP1A 3LY4A 3E2KA 2XLNA 5HZHA 3SS3A 4B4XA 4OONA 3T1SA 2QJ5A 2WKQA 4HQAA 1XXMA 1LL8A 4CJNA 1KGGA 4K91A 4KZ5A 5F83A 1E4DA 3NOPC 1YKDA 5FAPA 2PBYA 2Z6DA 4GCZA 2QHKA 4PKYA 1WE4A 1K38A 1SKFA 5LBRA 3JPUA 1S4RA 1HZOA 1OTAA 4S2IA 2HDSA 2M7VA 5FAQA 4DE2A 3O86A 4E6XA 1PYYA 4KZ6A 4F3LB 3HCYA 2WAFA 3EOIA 2XRNA 4QU3A 4HIAA 3NBLA 2GDNA 4NEED 1G28A 4N9LA 3E4OA 5A8BA 3ZYTA 1W7FA 2ZM2A 1CF0A 2OLUA 1OJGA 3KX0X 4DJ2A 2XF3A 3Q82A 2V0WA 4OKPA 5EPHA 4EEPA 1MPLA 2C5WB 2WKEA 2JE5A 4X1LA 3T12B 1KE3A 3C2WA 1TEMA 2E8JA 3RFBA 3H7WA 2W1RA 4EQIA 1ZKJA 3Q07A 4PKYG 3OCNA 1PWGA 2HP9A 1E3UA 4EBLA 3ZNYA 5EVEA 1T19A 4WZ4A 3F1PB 5CGWA 5FI2A 4HNBA 2WKHA 3HREA 4JXSA 5FDHA 2Y2OA 4BBTA 5CHUA 2VLGA 3RH8B 4XT2A 1VQQA 1K6RA 4EV4A 2INWA 2XR0A 4U0TA 3BFEA 4R1GA 3KYQA 3TSGA 1IELA 2J3WA 2KOIA 1TDGA 3T4QA 3F1NB 1BUEA 1G5UA 1WA9A 4E3IA 1HTZA 4WMCD 2B95A 4LPZA 4EUVA 1VB6A 1NRJA 5E43A 2ZM8A 4LGWA 4UAAA 1YM1A 5AQ9A 3QNBA 5A91A 3G4PA 3KSIA 1ACFA 2V8CA 4HH3A 4ZAMA 2HZ5A 5HWVA 3OPPA 3IXDA 2YKHA 4IHQA 4CQHA 4GDNA 3PYPA 3C38A 1NZOA 2Z2LB 3BFCA 1PI4A 1XPBA 2WAEA 3IX3A 3LR4A 1T18A 2GNXA 1JTGA 3FV7A 5FQQA 1GHIA 4E3JA 3HLDA 2H10A 2O0YA 4LRZE 1K57C 3P09A 1YSPA 2JC7A 3IWIA 5FAOA 4NK3A 3A3FA 3GRJA 2I9VA 4O01A 3P7NA 4KQQA 4FTXA 2H0TA 1LL9A 2XQZA 1YLTA 3PBQA 3FC7A 2LB5A 2XSSA 4WN5A 3WRZA 4WYYA 5FQIA 4FH4A 5L07A 4E04A 5EVIB 4G3VA 2KDKA 3MZFA 1BSGA 5IHVA 3MXQA 1XFNA 4D60A 3T4TA 2JKTI 3ZFZA 3V3RA 1PRQA 3HLBA 2ZMFA 4GDBA 3I7JA 4N92A 5C5KA 2VEAA 2O9AA 2PR5A 3NDEA 3R4KA 5DF7A 1H5XA 4HHDA 2H5SA 3G2ZA 3WS5A 3Q81A 5A90A 2O9BA 3PAEA 1K57A 3DWZA 2P7JA 1ES2A 2Y2PA 4S2OA 1DJCA 4U0XA 2ZC6B 1MKMA 2Y79A 3MF0A 3IT9A 1Z6FA 1BLHA 4O7DA 1RGYA 1NLYA 1NYYA 1E25A 3OZHA 1ZG4A 3UB6A 2HPBA 4KZ4A 5HD3A 1I2WA 2V8FA 2OV5A 1O7EA 4HH2A 4S2JA 3M6HA 3SH9A 3PR6A 4OPRA 4JXWA 1OMEA 3H82B 1BLPA 4P6ZS 4JGRA 3TJZC 3FKVA 2RL3A 5KSHA 4XUZA 5I5LA 1K4EA 4PAUA 1PZOA 3MZEA 3N8SA 5U47A 5D3OA 4MMNA 3TRCA 4PM5A 1GHMA 2QKPA 2P9VA 4KZ8A 3D3OA 5AQBA 2B02A 3T4KA 1PI5A 3R7WA 4UEYA 3UDFA 4R4RA 1BZAA 2PT7A 4P87A 5HDCA 3F1OA 4X6TA 4FUWA 2ZMAA 1Y28A 4QPRA 5DJTA 4BBVA 1W79A 2QPNA 1OT9A 4LFUA 2Y2QA 3CPTB 4YNRA 2ZJ9A 3IBRA 1K56D 4C75A 3C30A 3NDGA 3NECA 4LV3A 2JN7A 3IF5A 4WELA 3W4PA 4MCWA 4PM7A 1ZC2A 4BBUA 3CITA 4HY8A 3LEZA 4L9GA 4LRYC 5JYPA 1F5MA 4R38A 1CEFA 2ZD8A 2ZMVA 1N9NA 4H8RA 2WKIA 4GN2A 2HJ9C 1DRMA 5AQAA 3EEAA 4CLCC 5KSCA 4NXEA 2I72A 2VJWA 4Y7PA 1NWZA 1ES3A 4FH2A 3UY6A 1PWDA 4IBRA 3B42A 1VEUB 1G68A 2QYBA 1ESIA 3IXHA 5EM0A 3KO6A 4KZ9A 4JBFA 5CHMA 4GHIB 3S22A 3V5MA 3LIBA 2ZM0A 1XP4A 1P9RA 1JNUA 5HD5A 5AVEA 5FQ9A 1QMFA 1SKOB 3G2YA 1OT6A 4NXGA 1Z09A 1IKGA 3FPVA 1QMEA 3UMEA 1MWSA 5F82A 1LT0A 5CTMA 2QJ7A 4JPMA 4P6ZM 5M1AA 1BLCA 5GLDA 4GOGA 2ZOHA 3FWLA 3HBRA 1LLBA 1W63M 1W8YA 5MC7A 1ZTUA 1V9YA 1S0WA 4BL3A 4HESA 3G34A 5M18A 3RXXA 3C8CA 3IS2B 1TF1A 2Z2MB 3VOZA 4CLCA 1TVFA 3IH9A 3T4LA 1TS0A 1IFQA 1MBLA 3A3IA 1AWIA 3ZG9B 1KDWA 2VGJA 4Y0UA 3ULFA 5TJJA 3UNWA 1FOFA 2HDRA 2IA2A 4OLDA 4YFMA 2XA7S 4OPZA 5M19A 3Q1FA 4R4SA 3IF6B 4RX2A 3IXBA 5CX7A 2J8YA 4XXRA 2PAVP 1KE4A 5IS1A 1Q2QA 4NKPA 1SDNA 1TS6A 5DJUA 1FR6A 2IWBA 3SOIA 5E2FA 2L0WA 2DCFA 2EWWA 3ZG0A 1STZA 1L0FA 2QZ6A 5AJGA 4JGQA 1JWZA 2MJ6A 2M7UA 5K5BA 2JBFA 3HLWA 1FIKA 2PRFA 1NY0A 2ZQ8A 4OQGA 4Y13A 4GB7A 2P04A 3P98A 2WGWA 1M40A 2X71A 5F1GA 1A0KA 4ARZB 2Y2NA 3IH8A 5FI7A 1M6KA 1XJ6A 4KENB 4B4ZA 1LI9A 5HARA 2XD5A 3WS4A 3AGFA 3CAXA 3BRMA 3PBSA 5F6AA 2XEPA 2CC1A 2ZL1A 5CEDA 2ZC7A 1GSVA 2WGIA 5HPIA 2B5RA 3DTEA 4OQIA 1XFQA 3VE3A 3HUNA 3C4OA 3IX4A 3CZDA 1IYQA 4MN5A 2ZLYA 3E4PA 3BFGA 5TBMB 4BMWA 1U60A 1S1ZA 1SHVA 4OP8A 1X0OA 4DN0A 2J9PA 3LR3A 5F69A 1XA1A 3A3EA 1VHMA 3N8RA 4IEDA 4PM6A 1K0KA 3BYDA 3LCEA 1FCNA 5IU1A 4F94A 3MQ0A 5A93A 5EVID 3IHBA 3S7QA 3IXGA 3BLSA 2C6WB 4JF4A 4WM9A 2FFYA 4JGOA 4UA6A 4LCMA 1NXYA 4D2OA 5HWTA 4WL9A 5CEBA 1XKZA 3KYZA 3OCLA 3ITBA 3JVUA 3RXWA 1NRFA 2Y2IA 3ZGAB 1LHYA 3DBAA 3JVVA 1ERMA 3UE3A 2K2NA 2J3TD 4QJGA 2L1MA 2XA7M 3HUOA 2VV7A 3E2LA 3WRTA 3LICA 1JVJA 1AXBA 3NC8A 2XH9A 1D1JA 3MMHA 3UPNA 4EEUA 5J4EA 5EV0A 1FR1A 3LIDA 1OTDA 5FASA 1GSWA 5DTSA 2HP5A 1WYBA 1T1CA 4LV2A 1S1YA 3B33A 5EE8A 3UE6A 4JF5A 5TR7A 4Y2FA 3QP5A 4O8GA 5CGXA 2PYRA 1JWPA 3GVBA 1W8QA 3GSGA 3UDXA 5IT5A 2VX8A 4S2PA 1EI5A 1I2SA 4X55A 4KQRA 2G7UA 3OLOA 3BQAA 3C4PA 3F1PA 3VP2A 3C5AA 5CECA 2W3FA 1YMSA 1KOUA 2VA0A 4ESPA 1MWTA 3BWLA 4X69A 5I94A 2X01A 1YSQA 2XFTA 4YINA 4HP9A 3O87A 3PHYA 2VGKA 2VGLS 4Y3IA 4DKIA 2Y2MA 5KIZA 4OOLA 4BLMA 2ZBBA 1I5QA 3B3XA 3MXRA 5CTNA 3OPRA 3MZDA 4RVAA 2W1TB 3LIFA 4UQIS 4LCLA 4QB8A 4XUXA 4BENA 2D02A 3LI9A 4NXFA 3W4QA 2LB9A 4P85A 5BOHA 4BQMA 3VP1A 1W5DA 5HW3A 3IHAA 5DTTA 2EXAA 3MFXA 1H0MA 3QP6A 3S4XA 4KZBA 2WYXA 2DMWA 2ZC5B 3CWFA 3L7HA 1TD5A 1FILA 5F68A 3G31A 3KYEA 2H28A 3N8LA 1GA0A 2ZOIA 5GHZA 2Y55A 4GLQA 1G6AA 1LSVA 3QP2A 3MQOA 5DTKA 3O5YA 3U2AA 2L4RA 4ZRRA 1IOUA 1CI8A 2WZXA 4WUJA 4O0PA 3O3VA 4CLCE 3HLEA 1Y4OA 2FH5A 1K25A 3MBZA 1GHPA 3C7VA 2VZWA 3T1QB 3UE1A 3DTKA 3HL9A 3AGDA 1S67L 2VKSA 4H6JB 4JGPA 2Y2KA 2GJ3A 4GZBA 1FQGA 4KQOA 3LR0A 1OTEA 1S6RA 1RGZA 4B93A 1TS7A 5EVLA 3BM6A 2WUQA 3ZHHA 1DJAA 3D9YA 2W27A 4I38A 4E3MA 2BLSA 1GCEA 5J7EA 2EFXA 4EXOA 2P08A 2KLIA 4DJ3A 3UB9A 5DFXA 5FEFA 1UWPX 1J3WA 2A49A 2VV6A 1YLWA 3MR0A 1XJ4A 3T4JA 4JXVA 1HLUP 1PFLA 2J9OA 1OTBA 3E98A 2JHEA 5G4ZA 3WS2A 3SH7A 2VGLM 4R3AA 3V67A 1Q2PA 1K54C 4OH0A 5HPFA 4R70A 3LEQA 2P9VB 1CI9A 3OC2A 5FA7A 3NULA 4IUKA 3R7WB 4UQIM 3ZCZA 2XDMA 2VV8A 4WMCA 5F1FA 3VOYA 3GR2A 2W3HA 4M3KA 1XA7A 2J7VA 2W3DA 4KZ7A 3LFVA 4RYEA 5J3WA 3HUMA 3UO9A 4DDYA 3EQUA 3BECA 3CI6A 3BJNA 4P6BA 3UPOA 2ZC4B 2PDRA 4R6LA 3NOUC 2R78A 2OLVA 2V1AA 5FEGA 1P9WA 4IUHA 3MKFA 4PM9A 3Q7ZA 3S1YA 2HDUA 4UA7A 2V2FF 3TG9A 3GQZA 3OPHA 2PBDP 3PTEA 5HL6A 4R3JA 1K54A 1LL5A 1IEMA 3ZG7B 5HX9A 3VP3A 2ZQ9A 4GD8A 1XJ3A 4KQDA 4EBPA 1NLZA 5TFQA 1FSYA 5GHYA 3CPTA 3LI8A 3MJQA 1NZUA 2EX6A 4QWOA 1L2SA 5G4YA 2HDQA 4HBUA 4Y0OA 1BT5A 4NXBA 4NETA 1H3QA 4WZ5C 3T1RA 4CPKA 1LSWA 3PBNA 2V9AA 4KG2A 3DWKA 1H8YA 3T4OA 2HP6A 3NY4A 3Q7VB 3BLMA 3T50A 4E3NA 4OOYA 3FZCA 4HJ6A 4EUZA 2B18A 2R9XA 2HJEA 4L0LA 5KZHA 3S7PA 2Q0OA 1XX2A 1MC0A 4GS9A 4MNRA 1MKIA 2Y2GA 4L9FA 3UDIA 4FCFA 3UB8A 2A24A 1G6OA 3GECA 3U4LP 2WGVA 1VEUA 3T1XA 4LV1A 1ERQA 4JLFA 4Z1WA 3NCKA 4Z9QA 3TW8A 3N4IA 4JF6A 1FCOA 1ESUA 5AVFA 3MFDA 3IF6C 2XROA 3W2ZA 2UWXA 2X02A 1YAXA 2UV0E 3PBRA 2M1CA 4EETB 3N7WA 1ES5A 2QWSA 4S2LA 4OLGA 1DP8A 3OBFA 3DAVA 3OPLA 4EW7A 1SKOA 4M4XA 2DNSA 1V9ZA 1CEGA 5EUAA 3QNCA 2WZZA 1S66L 3E0YA 3K3CA 2FZ0A 1P97A 4GKUA 3VP4A 4IBXA 1UGUA 1ODVA 2V1ZA 3W8KA 5DVAA 1DP6A 1BTLA 1MZUA 3SH8A 1TDLA 3L9KA 3BY8A 4DE1A 1IYOA 3A0SA 2JKFA 2WK0A 3ZNTA 4I3AA 3UE0A 5HFOA 4MBHA 3M2KA 3UPPA 4Q8IA 3IF6A 1VETB 2EWVA 3TE8A 3CG5A 1PW8A 4N1XA 3PBTA 4G3KA 3ZVWA 2ACGA 2Y2JA 5FQKA 2PU4A 2Q9NA 1DY6A 1N9OA 2VK3A 4L9EA 2V20A 4MEZA 4GD6A 3LY3A 3M6BA 1VM1A 2ZQDA 3MS6A 1IYPA 4WEJA 2H0YA 3HLGA 5DF8A 3SS4A 4HOIA 3EGDC 4OQ0A 1K56A 4I5SA 1EROA 1GA9A 4ME4A 2EX9A 1UWNX 5CRFA 3CUEC 1YLJA 5DFYA 1IYSA 3H9WA 2OWHA 5GLBA 4S2NC 3MQQA 4II7A 3BFFA 2FFFB 1L0EA 4I3IA 1DP9A 4S2KA 2BTFP 4E3LA 3A3DA 4ARZA 1H8ZA 3ITAA 4ETXA 3AGEA 4MBFA 3G35A 1YQSA 1MWUA 5FSRA 4MLLA 3V3SA 3WS1A 4C6YA 5TGFA 1HVBA 3KSHA 1LI0A 2HGVA 1PZPA 2W0NA 2JKRM 3CMZA 4OQHA 1F98A 3B47A 1FCMA 2K7SA 2HF6A 3LIAA 3IWQA 5GLAA 5GHXA 3GMWA 1PNEA 4OP5A 3MKEA 2Y2LA 4QHCA 1RCJA 3ICYA 4WF0A 5TBMA 2DRWA 4HI4A 4ZDXA 3PAGA 3H7WB 4RA7A 2YKFA 3FYZA 4DE3A 3HLCA 4WEKA 4F3LA 3CUEA 4S2MA 4A5RA 3BW6A 4K0WA 3WWXA 1YT4A 3LYXA 4S2NA 1KGEA 1OPXA 4BD1A 2ZQCA 4XT2B 2XK1A 4JKTA 4RQ9A 4IJGA 3LR5A 4G3WA 3UMDA 4MDZA 3EEHA 1L3LA 2EX8A 3UB7A 4PM8A 4BJPA 4HEFA 4JXGA 2NUTC 3A0RA 5HAIA 1YLZA 4MN6A 1NJ4A 4LV0A 1JTDA 4NG2A 2OSUA 4FSFA 2Q9MA 1D7EA 4OOMA 5GLCA 1MY8A 1GSXA 2EXBA 4EWFA 1XGIA 1H8MA 2XGNA 1MWRA 2Y4AA 1F9IA 1CJFA 4ZJ1A 1HD8A 4MBKA 3NOTC 1KVLA 3D4FA 4EERA 4ZJ2A 5EOOA 5EOEA 2JKTM 4EQ1A 3K3DA 5DKKA 2JKRI 4DE0A 2AVXA 2GX5A 1S4SA 1EW0A 3DTMA 4HJ4A 5L8MA 3ZVTA 3PBOA 3F1NA 4IVIA 5F5YA 3E4QA 4DMZA 3ZQ5A 3QP4A 3CLOA 4X53A 4EBNA 3LGOA 5E2GA 3FPWA 1K55C 5GL9A 1W63Q 5EVIC 5HDSA 4ZBEA 3A0VA 3JYIA 4Y15A 4UHUA 2PU2A 3HJIA 1K4FA 1L0DA 4P0MA 3G30A 5EECA 4N9KA 4B9OA 4PHTA 2J3TC 4QY5A 4AFIA 3QHYA 2ZC3B 5AQ7A 1BYWA 5L10A 2W1TA 5L2FA 2W3EA 2BASA 1BULA 5E2HA 5HAQA 2Y8HA 4IVKA 2WADA 4K08A 3ZG5A 3DTIA 5EFWA 4YOFA 3VMAA 5DKLA 4OPYA 3VP0A 3K2NA 1OTIA 3ZDJA 4UA9A 2E8IA 5FL3A 4E3KA 2JCHA 1SDEA 3UN7A 5KMWA 2W3GA 1K55A 1JWVA 4Q0JA 5EVIA 4MN7A
chains in the Genus database with same CATH topology
2M7UA 4PKYG 3OCNA 1T19A 3NHQA 3F1PB 5K5BA 1XJ3A 4KQDA 4HNBA 1NLZA 4BBTA 2VLGA 3RH8B 3LI8A 3MJQA 4XT2A 2P04A 2INWA 5G4YA 3SW1A 4NXBA 3KYQA 2EA9A 3S7NA 4ARZB 4BWIA 1H3QA 1LSWA 2J3WA 1XJ6A 3BQ8A 2KOIA 2V9AA 3PBNA 3T4QA 3F1NB 3T4OA 2PD8A 4I3JA 1WA9A 3T50A 2PHYA 3EWKA 4H6JA 4LPZA 3CAXA 4EUVA 4HJ6A 3PBSA 2O9CA 1VB6A 5F6AA 2B18A 4KUKA 1NRJA 4CLCD 2HJEA 4L0LA 2Z6CA 3S7PA 3GDIA 1GSVA 1MC0A 3EQVA 5HPIA 3P01A 4GS9A 4KUOA 2D01A 3KSIA 4L9FA 2J80A 3UB8A 2A24A 1G6OA 3GECA 4HH3A 1XFQA 3VE3A 2GZAA 4Z1WA 5HWVA 4MN5A 3TW8A 3E4PA 2YKHA 3KSGA 4IHQA 4CQHA 5TBMB 3PYPA 4BMWA 3C38A 1S1ZA 5AVFA 2XROA 3W2ZA 3D72A 1YAXA 1TS8A 3PBRA 3LR4A 1T18A 2GNXA 1X0OA 3G6OA 4DN0A 2M1CA 4EETB 1OJ5A 3LR3A 5F69A 4YWZA 2QWSA 1VHMA 3H82A 3F1OB 4EU0A 1DP8A 3BY9A 3OBFA 4EW7A 2O0YA 4M4XA 5IU1A 4LRZE 1V9ZA 3MQ0A 3S7QA 2WKPA 4JGOA 1YSPA 1ZHHB 3KSFA 5HWTA 4WL9A 2I9VA 1S66L 3E0YA 3KYZA 2K31A 3NJAA 3OCLA 4O01A 3P7NA 5HSQA 3JVUA 3PBQA 3K3CA 2FZ0A 1P97A 3FC7A 2O99A 3DBAA 4Q0HA 2LB5A 1UGUA 2XSSA 3JVVA 4WN5A 3UE3A 1ODVA 3VE4A 2K2NA 4HJ3A 4E04A 2J3TD 4G3VA 2L1MA 2KDKA 1DP6A 2XA7M 1N9LA 2VV7A 3MXQA 1XFNA 3LICA 1MZUA 3T4TA 2JKTI 3IBJA 3MMHA 5HDDA 3BY8A 4EEUA 5J4EA 3A0SA 3LIDA 1OTDA 2WKRA 1GSWA 4I3AA 3T4SA 2ZMFA 3S7OA 2HV1A 1T1CA 5C5KA 2V1BA 2VEAA 2O9AA 2PR5A 3R4KA 1S1YA 2EWVA 3TE8A 3B33A 3UE6A 3OOVA 4Y5FA 4HHDA 3PBTA 4Y2FA 4O8GA 2NUPC 4I39A 4G3KA 2O9BA 2PYRA 2A2LA 1N9OA 4L9EA 2P7JA 1XJ2A 5IT5A 2VX8A 1MKMA 4WEJA 2Y79A 3MF0A 2G7UA 3OLOA 4HOIA 3EGDC 3BQAA 4GS9B 3F1PA 1NLYA 4I5SA 4GW9A 2A24B 2CMNA 4ME4A 2W3FA 1UWNX 2PD7A 1KOUA 2VA0A 3UB6A 5HD3A 3CUEC 4EESA 3BWLA 5DFYA 1YSQA 1LSXA 3H9WA 4HH2A 2OWHA 3MQQA 4II7A 4I3IA 2PYPA 1DP9A 4HP9A 4ARZA 3PHYA 3PR6A 2VGLS 4Y3IA 5KIZA 4OOLA 4ETXA 2ZBBA 4CLCB 3H82B 4GHIA 4P6ZS 4LRXC 4JGRA 3LUQA 2W1TB 3KSHA 3LIFA 3EGXC 4UQIS 5HWWA 2D02A 3LI9A 4NXFA 3TJZC 2HGVA 2W0NA 2JKRM 5KSHA 5I5LA 4PAUA 1F98A 2LB9A 3B47A 2K7SA 2HF6A 3VOLA 3LIAA 4MMNA 3TRCA 4HP4A 5DF9A 3MFXA 2QKPA 3ICYA 4WF0A 3D3OA 2B02A 5TBMA 2DMWA 3CWFA 3T4KA 1TD5A 4HI4A 5F68A 3R7WA 2H28A 3FG8A 3HJKA 4UEYA 3RTYA 3H7WB 3LIEA 3IS2A 2YKFA 2KX6A 2ZOIA 2PT7A 4GLQA 5HDCA 4WEKA 4F3LA 1LSVA 3CUEA 1T1BA 3F1OA 3BW6A 3MQOA 3LYXA 1Y28A 4QPRA 5DJTA 4BBVA 2OAQ1 1OPXA 3O5YA 3U2AA 1OT9A 2L4RA 4ETZA 4ZRRA 1IOUA 4YNRA 2OWJA 3IBRA 4XT2B 3C30A 4IJGA 4RQ9A 3LR5A 4G3WA 3UMDA 4WUJA 2V0UA 2OAP1 4MDZA 2JN7A 4O0PA 3EEHA 4CLCE 4FOFA 4WELA 1P0ZA 3VV4A 4MCWA 3UB7A 2FH5A 1D06A 1T1AA 4BJPA 2NUTC 2PR6A 3A0RA 4BBUA 4MN6A 4FSFA 3CITA 1D7EA 2VZWA 4OOMA 4HY8A 3PXPA 4L9GA 4LRYC 1F5MA 1S67L 2VKSA 1GSXA 4H6JB 4R38A 4JGPA 4GJ4A 2ZMVA 1N9NA 2GJ3A 4KQOA 3LR0A 1OTEA 1H8MA 2HJ9C 1F9IA 1DRMA 4B93A 1TS7A 3EEAA 4CLCC 4NXEA 2VJWA 4LLOB 2W27A 1NWZA 2OOLA 4I38A 4Q0IA 3NOTC 4WLAA 4EERA 5J7EA 4EXOA 2P08A 2JKTM 3B42A 2KLIA 2QYBA 3UB9A 4DJ3A 5DFXA 3K3DA 4EQ1A 5DKKA 2JKRI 5HZHA 1UWPX 3KO6A 2GX5A 2QJ5A 2WKQA 2VV6A 4HQAA 1S4SA 1LL8A 1EW0A 4GHIB 3MR0A 3LIBA 1XJ4A 3T4JA 1P9RA 1JNUA 4HJ4A 5L8MA 3PBOA 1OTBA 3F1NA 5F5YA 3E4QA 3E98A 2JHEA 3NOPC 4DMZA 1YKDA 3ZQ5A 5G4ZA 5HD5A 3CLOA 5AVEA 1OT6A 2Z6DA 4NXGA 4GCZA 3FPWA 3FPVA 2VGLM 1W63Q 2QHKA 4PKYA 4R3AA 3V67A 5LBRA 3UMEA 5HDSA 1S4RA 3A0VA 1LT0A 4R70A 2QJ7A 5HPFA 1OTAA 3OC2A 4P6ZM 4IUKA 2ZOHA 3R7WB 4UQIM 3HJIA 2M7VA 1W63M 5MC7A 1ZTUA 1V9YA 2VV8A 3C8CA 3IS2B 1TF1A 2W3HA 4B9OA 4PHTA 4F3LB 4CLCA 2J3TC 2W3DA 3T4LA 4AFIA 3HCYA 3LFVA 1TS0A 1BYWA 2XRNA 3EOIA 5J3WA 1IFQA 2W1TA 4HIAA 2W3EA 2BASA 3ULFA 5TJJA 3EQUA 2Y8HA 3CI6A 3BJNA 4NEED 1G28A 4R6LA 2PDRA 2IA2A 4K08A 3E4OA 5A8BA 3ZYTA 3NOUC 2XA7S 2R78A 2V1AA 5EFWA 4YOFA 1P9WA 4IUHA 5DKLA 1OJGA 3KX0X 5CX7A 4DJ2A 3K2NA 5IS1A 1OTIA 2V0WA 4EEPA 4NKPA 1TS6A 5DJUA 5FL3A 2L0WA 2EWWA 3C2WA 5HL6A 2W3GA 3RFBA 1STZA 3H7WA 4Q0JA 2W1RA 5AJGA 4JGQA 4MN7A 2MJ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QYB A;  2W1T B;  3KSH A;  5DFX A;  2M7U A;  2O99 A;  3DBA A;  4Q0H A;  2LB5 A;  3KO6 A;  2GX5 A;  2XSS A;  3NHQ A;  5K5B A;  2HGV A;  2K2N A;  5I5L A;  4E04 A;  4PAU A;  2LB9 A;  4G3V A;  5L8M A;  4MMN A;  3TRC A;  3IBJ A;  3E98 A;  3NOP C;  4DMZ A;  3MMH A;  1YKD A;  3ZQ5 A;  3S7N A;  3D3O A;  4BWI A;  1TD5 A;  2KOI A;  2ZMF A;  5LBR A;  3S7O A;  5C5K A;  2VEA A;  5HPF A;  2O9A A;  4R70 A;  3R4K A;  4GLQ A;  4EUV A;  3OOV A;  4Y5F A;  4IUK A;  2O9C A;  2M7V A;  4Y2F A;  2B18 A;  4O8G A;  1ZTU A;  4G3K A;  3S7P A;  2O9B A;  4QPR A;  3O5Y A;  1MC0 A;  4ETZ A;  1TF1 A;  2W3H A;  4ZRR A;  5HPI A;  4YNR A;  3KSI A;  3IBR A;  2W3D A;  3HCY A;  3LFV A;  4RQ9 A;  4IJG A;  2XRN A;  4G3W A;  1MKM A;  2W1T A;  2Y79 A;  3MF0 A;  4Z1W A;  4O0P A;  2G7U A;  2W3E A;  4MDZ A;  4FOF A;  3KSG A;  5TJJ A;  3VV4 A;  4CQH A;  2Y8H A;  3CI6 A;  3BJN A;  4MCW A;  4R6L A;  2IA2 A;  4GW9 A;  3NOU C;  2W3F A;  4ME4 A;  3W2Z A;  2XRO A;  3CIT A;  2VZW A;  4YOF A;  3G6O A;  4DN0 A;  5DFY A;  4IUH A;  1YSQ A;  4LRY C;  1F5M A;  2VKS A;  1VHM A;  3K2N A;  4EU0 A;  3OBF A;  2O0Y A;  4LRZ E;  3MQ0 A;  4Y3I A;  3EEA A;  3S7Q A;  4ETX A;  2VJW A;  1YSP A;  2OOL A;  4Q0I A;  3C2W A;  3KSF A;  5HSQ A;  5HL6 A;  2W3G A;  3NOT C;  3RFB A;  1STZ A;  3E0Y A;  2W1R A;  4Q0J A;  2K31 A;  4LRX C;  4O01 A;  4MN7 A;  5AJG A;  2KLI A; 
#chains in the Genus database with same CATH topology
 3NHQ A;  4U3T A;  3QP8 A;  2EFU A;  1PIO A;  4R0Q A;  1YPR A;  3SW1 A;  2Y59 A;  2EA9 A;  3S7N A;  1WYC A;  4BWI A;  3O88 A;  3BQ8 A;  3IWO A;  3VFH A;  5FI6 A;  2PD8 A;  4I3J A;  2PHY A;  3EWK A;  4H6J A;  1ALQ A;  4BD0 A;  3HLF A;  3UB5 P;  1KE0 A;  2O9C A;  4KUK A;  4CLC D;  3SZT A;  2Z6C A;  3GTC A;  2QMI A;  3V50 A;  3GDI A;  3EQV A;  4BL2 A;  3GV9 A;  4KZ3 A;  3P01 A;  4KUO A;  2D01 A;  1SCW A;  1CQA A;  3IQA A;  2J80 A;  4R3B A;  5CER A;  4ZTK A;  2GZA A;  2BG1 A;  3TOI A;  3KSG A;  3CHW P;  4OPQ A;  3D72 A;  1TS8 A;  2G2W A;  3G6O A;  1ES4 A;  1OJ5 A;  4LEN A;  4YWZ A;  4DXB A;  5JYO A;  5L09 A;  3H82 A;  3F1O B;  4EU0 A;  3BY9 A;  1KGF A;  2WKP A;  1ZHH B;  1F2K A;  3KSF A;  3G32 A;  3BEB A;  3NJA A;  2K31 A;  5HSQ A;  2JKG A;  4DF6 A;  4DXC A;  2O99 A;  4Q0H A;  3VE4 A;  4K0X A;  4HJ3 A;  1ZG6 A;  1N9L A;  3CJM A;  4GNU A;  2IWD A;  3IBJ A;  3VFF A;  5HDD A;  4E6W A;  1IKI A;  1KDS A;  3VSK A;  2Y91 A;  2WKR A;  3NI9 A;  3T4S A;  4R23 A;  4OVD A;  3S7O A;  2HV1 A;  2V1B A;  3OOV A;  4Y5F A;  3N6I A;  2NUP C;  4I39 A;  3DW0 A;  4HBT A;  1ONH A;  2A2L A;  1PW1 A;  3IX8 A;  5CHJ A;  1PWC A;  5FDS A;  1ONG A;  1XJ2 A;  4KG6 A;  2XD1 A;  5HL1 A;  5FQJ A;  3MSH A;  4GS9 B;  1FSW A;  4GW9 A;  2A24 B;  2CMN A;  2P74 A;  4DDS A;  2PD7 A;  3BFD A;  4EES A;  2R9W A;  1N9B A;  1LSX A;  4X68 A;  2IWC A;  3RJU A;  4QD4 A;  1J9M A;  4KG5 A;  2PYP A;  3C7U A;  4WBG A;  4Y0T A;  3M2J A;  3Q7V A;  1YMX A;  4CLC B;  2Y2H A;  3HVF A;  4GHI A;  4LRX C;  3LUQ A;  3EGX C;  3FKW A;  4C3Q A;  5HWW A;  4X1M A;  2A3U A;  5FAT A;  5G18 A;  3VOL A;  5CXW A;  4WZ5 A;  1E3U D;  1C3B A;  4HP4 A;  4N1H A;  4PMA A;  1CK3 A;  5DF9 A;  2RCX A;  4DRT A;  1SZV A;  5FQM A;  3V39 A;  3FG8 A;  3HJK A;  4KZA A;  3RTY A;  1MXO A;  3LIE A;  2ZQ7 A;  3IS2 A;  2KX6 A;  1T1B A;  4PPR A;  4X25 A;  4ZJ3 A;  1N4O A;  4Y17 A;  2OAQ 1;  4ETZ A;  1RP5 A;  3SS5 A;  2OWJ A;  3VSL A;  4B88 A;  1EWZ A;  2WGW B;  1DJB A;  2EX2 A;  4ID4 A;  2V0U A;  2OAP 1;  4X56 A;  4FOF A;  1P0Z A;  3A3J A;  5EM1 A;  3WS0 A;  4E3O A;  3VV4 A;  1K6S A;  4QY6 A;  1D06 A;  1T1A A;  3W4O A;  2PR6 A;  4RX3 A;  1KVM A;  2XFS A;  5HAP A;  3ISG A;  3PXP A;  1O07 A;  1Y54 A;  4GJ4 A;  3LO7 A;  5A92 A;  5CGS A;  3MXS A;  1XGJ A;  1YLY A;  3ZG8 B;  2G2U A;  5J8X A;  5E2E A;  1NYM A;  2ZQA A;  2ZL1 B;  3NIA A;  1YLP A;  4LLO B;  2OOL A;  4Q0I A;  1BLS A;  4WLA A;  1VET A;  4FD8 A;  1L0G A;  3QP1 A;  3LY4 A;  3E2K A;  2XLN A;  5HZH A;  3SS3 A;  4B4X A;  4OON A;  3T1S A;  2QJ5 A;  2WKQ A;  4HQA A;  1XXM A;  1LL8 A;  4CJN A;  1KGG A;  4K91 A;  4KZ5 A;  5F83 A;  1E4D A;  3NOP C;  1YKD A;  5FAP A;  2PBY A;  2Z6D A;  4GCZ A;  2QHK A;  4PKY A;  1WE4 A;  1K38 A;  1SKF A;  5LBR A;  3JPU A;  1S4R A;  1HZO A;  1OTA A;  4S2I A;  2HDS A;  2M7V A;  5FAQ A;  4DE2 A;  3O86 A;  4E6X A;  1PYY A;  4KZ6 A;  4F3L B;  3HCY A;  2WAF A;  3EOI A;  2XRN A;  4QU3 A;  4HIA A;  3NBL A;  2GDN A;  4NEE D;  1G28 A;  4N9L A;  3E4O A;  5A8B A;  3ZYT A;  1W7F A;  2ZM2 A;  1CF0 A;  2OLU A;  1OJG A;  3KX0 X;  4DJ2 A;  2XF3 A;  3Q82 A;  2V0W A;  4OKP A;  5EPH A;  4EEP A;  1MPL A;  2C5W B;  2WKE A;  2JE5 A;  4X1L A;  3T12 B;  1KE3 A;  3C2W A;  1TEM A;  2E8J A;  3RFB A;  3H7W A;  2W1R A;  4EQI A;  1ZKJ A;  3Q07 A;  4PKY G;  3OCN A;  1PWG A;  2HP9 A;  1E3U A;  4EBL A;  3ZNY A;  5EVE A;  1T19 A;  4WZ4 A;  3F1P B;  5CGW A;  5FI2 A;  4HNB A;  2WKH A;  3HRE A;  4JXS A;  5FDH A;  2Y2O A;  4BBT A;  5CHU A;  2VLG A;  3RH8 B;  4XT2 A;  1VQQ A;  1K6R A;  4EV4 A;  2INW A;  2XR0 A;  4U0T A;  3BFE A;  4R1G A;  3KYQ A;  3TSG A;  1IEL A;  2J3W A;  2KOI A;  1TDG A;  3T4Q A;  3F1N B;  1BUE A;  1G5U A;  1WA9 A;  4E3I A;  1HTZ A;  4WMC D;  2B95 A;  4LPZ A;  4EUV A;  1VB6 A;  1NRJ A;  5E43 A;  2ZM8 A;  4LGW A;  4UAA A;  1YM1 A;  5AQ9 A;  3QNB A;  5A91 A;  3G4P A;  3KSI A;  1ACF A;  2V8C A;  4HH3 A;  4ZAM A;  2HZ5 A;  5HWV A;  3OPP A;  3IXD A;  2YKH A;  4IHQ A;  4CQH A;  4GDN A;  3PYP A;  3C38 A;  1NZO A;  2Z2L B;  3BFC A;  1PI4 A;  1XPB A;  2WAE A;  3IX3 A;  3LR4 A;  1T18 A;  2GNX A;  1JTG A;  3FV7 A;  5FQQ A;  1GHI A;  4E3J A;  3HLD A;  2H10 A;  2O0Y A;  4LRZ E;  1K57 C;  3P09 A;  1YSP A;  2JC7 A;  3IWI A;  5FAO A;  4NK3 A;  3A3F A;  3GRJ A;  2I9V A;  4O01 A;  3P7N A;  4KQQ A;  4FTX A;  2H0T A;  1LL9 A;  2XQZ A;  1YLT A;  3PBQ A;  3FC7 A;  2LB5 A;  2XSS A;  4WN5 A;  3WRZ A;  4WYY A;  5FQI A;  4FH4 A;  5L07 A;  4E04 A;  5EVI B;  4G3V A;  2KDK A;  3MZF A;  1BSG A;  5IHV A;  3MXQ A;  1XFN A;  4D60 A;  3T4T A;  2JKT I;  3ZFZ A;  3V3R A;  1PRQ A;  3HLB A;  2ZMF A;  4GDB A;  3I7J A;  4N92 A;  5C5K A;  2VEA A;  2O9A A;  2PR5 A;  3NDE A;  3R4K A;  5DF7 A;  1H5X A;  4HHD A;  2H5S A;  3G2Z A;  3WS5 A;  3Q81 A;  5A90 A;  2O9B A;  3PAE A;  1K57 A;  3DWZ A;  2P7J A;  1ES2 A;  2Y2P A;  4S2O A;  1DJC A;  4U0X A;  2ZC6 B;  1MKM A;  2Y79 A;  3MF0 A;  3IT9 A;  1Z6F A;  1BLH A;  4O7D A;  1RGY A;  1NLY A;  1NYY A;  1E25 A;  3OZH A;  1ZG4 A;  3UB6 A;  2HPB A;  4KZ4 A;  5HD3 A;  1I2W A;  2V8F A;  2OV5 A;  1O7E A;  4HH2 A;  4S2J A;  3M6H A;  3SH9 A;  3PR6 A;  4OPR A;  4JXW A;  1OME A;  3H82 B;  1BLP A;  4P6Z S;  4JGR A;  3TJZ C;  3FKV A;  2RL3 A;  5KSH A;  4XUZ A;  5I5L A;  1K4E A;  4PAU A;  1PZO A;  3MZE A;  3N8S A;  5U47 A;  5D3O A;  4MMN A;  3TRC A;  4PM5 A;  1GHM A;  2QKP A;  2P9V A;  4KZ8 A;  3D3O A;  5AQB A;  2B02 A;  3T4K A;  1PI5 A;  3R7W A;  4UEY A;  3UDF A;  4R4R A;  1BZA A;  2PT7 A;  4P87 A;  5HDC A;  3F1O A;  4X6T A;  4FUW A;  2ZMA A;  1Y28 A;  4QPR A;  5DJT A;  4BBV A;  1W79 A;  2QPN A;  1OT9 A;  4LFU A;  2Y2Q A;  3CPT B;  4YNR A;  2ZJ9 A;  3IBR A;  1K56 D;  4C75 A;  3C30 A;  3NDG A;  3NEC A;  4LV3 A;  2JN7 A;  3IF5 A;  4WEL A;  3W4P A;  4MCW A;  4PM7 A;  1ZC2 A;  4BBU A;  3CIT A;  4HY8 A;  3LEZ A;  4L9G A;  4LRY C;  5JYP A;  1F5M A;  4R38 A;  1CEF A;  2ZD8 A;  2ZMV A;  1N9N A;  4H8R A;  2WKI A;  4GN2 A;  2HJ9 C;  1DRM A;  5AQA A;  3EEA A;  4CLC C;  5KSC A;  4NXE A;  2I72 A;  2VJW A;  4Y7P A;  1NWZ A;  1ES3 A;  4FH2 A;  3UY6 A;  1PWD A;  4IBR A;  3B42 A;  1VEU B;  1G68 A;  2QYB A;  1ESI A;  3IXH A;  5EM0 A;  3KO6 A;  4KZ9 A;  4JBF A;  5CHM A;  4GHI B;  3S22 A;  3V5M A;  3LIB A;  2ZM0 A;  1XP4 A;  1P9R A;  1JNU A;  5HD5 A;  5AVE A;  5FQ9 A;  1QMF A;  1SKO B;  3G2Y A;  1OT6 A;  4NXG A;  1Z09 A;  1IKG A;  3FPV A;  1QME A;  3UME A;  1MWS A;  5F82 A;  1LT0 A;  5CTM A;  2QJ7 A;  4JPM A;  4P6Z M;  5M1A A;  1BLC A;  5GLD A;  4GOG A;  2ZOH A;  3FWL A;  3HBR A;  1LLB A;  1W63 M;  1W8Y A;  5MC7 A;  1ZTU A;  1V9Y A;  1S0W A;  4BL3 A;  4HES A;  3G34 A;  5M18 A;  3RXX A;  3C8C A;  3IS2 B;  1TF1 A;  2Z2M B;  3VOZ A;  4CLC A;  1TVF A;  3IH9 A;  3T4L A;  1TS0 A;  1IFQ A;  1MBL A;  3A3I A;  1AWI A;  3ZG9 B;  1KDW A;  2VGJ A;  4Y0U A;  3ULF A;  5TJJ A;  3UNW A;  1FOF A;  2HDR A;  2IA2 A;  4OLD A;  4YFM A;  2XA7 S;  4OPZ A;  5M19 A;  3Q1F A;  4R4S A;  3IF6 B;  4RX2 A;  3IXB A;  5CX7 A;  2J8Y A;  4XXR A;  2PAV P;  1KE4 A;  5IS1 A;  1Q2Q A;  4NKP A;  1SDN A;  1TS6 A;  5DJU A;  1FR6 A;  2IWB A;  3SOI A;  5E2F A;  2L0W A;  2DCF A;  2EWW A;  3ZG0 A;  1STZ A;  1L0F A;  2QZ6 A;  5AJG A;  4JGQ A;  1JWZ A;  2MJ6 A;  2M7U A;  5K5B A;  2JBF A;  3HLW A;  1FIK A;  2PRF A;  1NY0 A;  2ZQ8 A;  4OQG A;  4Y13 A;  4GB7 A;  2P04 A;  3P98 A;  2WGW A;  1M40 A;  2X71 A;  5F1G A;  1A0K A;  4ARZ B;  2Y2N A;  3IH8 A;  5FI7 A;  1M6K A;  1XJ6 A;  4KEN B;  4B4Z A;  1LI9 A;  5HAR A;  2XD5 A;  3WS4 A;  3AGF A;  3CAX A;  3BRM A;  3PBS A;  5F6A A;  2XEP A;  2CC1 A;  2ZL1 A;  5CED A;  2ZC7 A;  1GSV A;  2WGI A;  5HPI A;  2B5R A;  3DTE A;  4OQI A;  1XFQ A;  3VE3 A;  3HUN A;  3C4O A;  3IX4 A;  3CZD A;  1IYQ A;  4MN5 A;  2ZLY A;  3E4P A;  3BFG A;  5TBM B;  4BMW A;  1U60 A;  1S1Z A;  1SHV A;  4OP8 A;  1X0O A;  4DN0 A;  2J9P A;  3LR3 A;  5F69 A;  1XA1 A;  3A3E A;  1VHM A;  3N8R A;  4IED A;  4PM6 A;  1K0K A;  3BYD A;  3LCE A;  1FCN A;  5IU1 A;  4F94 A;  3MQ0 A;  5A93 A;  5EVI D;  3IHB A;  3S7Q A;  3IXG A;  3BLS A;  2C6W B;  4JF4 A;  4WM9 A;  2FFY A;  4JGO A;  4UA6 A;  4LCM A;  1NXY A;  4D2O A;  5HWT A;  4WL9 A;  5CEB A;  1XKZ A;  3KYZ A;  3OCL A;  3ITB A;  3JVU A;  3RXW A;  1NRF A;  2Y2I A;  3ZGA B;  1LHY A;  3DBA A;  3JVV A;  1ERM A;  3UE3 A;  2K2N A;  2J3T D;  4QJG A;  2L1M A;  2XA7 M;  3HUO A;  2VV7 A;  3E2L A;  3WRT A;  3LIC A;  1JVJ A;  1AXB A;  3NC8 A;  2XH9 A;  1D1J A;  3MMH A;  3UPN A;  4EEU A;  5J4E A;  5EV0 A;  1FR1 A;  3LID A;  1OTD A;  5FAS A;  1GSW A;  5DTS A;  2HP5 A;  1WYB A;  1T1C A;  4LV2 A;  1S1Y A;  3B33 A;  5EE8 A;  3UE6 A;  4JF5 A;  5TR7 A;  4Y2F A;  3QP5 A;  4O8G A;  5CGX A;  2PYR A;  1JWP A;  3GVB A;  1W8Q A;  3GSG A;  3UDX A;  5IT5 A;  2VX8 A;  4S2P A;  1EI5 A;  1I2S A;  4X55 A;  4KQR A;  2G7U A;  3OLO A;  3BQA A;  3C4P A;  3F1P A;  3VP2 A;  3C5A A;  5CEC A;  2W3F A;  1YMS A;  1KOU A;  2VA0 A;  4ESP A;  1MWT A;  3BWL A;  4X69 A;  5I94 A;  2X01 A;  1YSQ A;  2XFT A;  4YIN A;  4HP9 A;  3O87 A;  3PHY A;  2VGK A;  2VGL S;  4Y3I A;  4DKI A;  2Y2M A;  5KIZ A;  4OOL A;  4BLM A;  2ZBB A;  1I5Q A;  3B3X A;  3MXR A;  5CTN A;  3OPR A;  3MZD A;  4RVA A;  2W1T B;  3LIF A;  4UQI S;  4LCL A;  4QB8 A;  4XUX A;  4BEN A;  2D02 A;  3LI9 A;  4NXF A;  3W4Q A;  2LB9 A;  4P85 A;  5BOH A;  4BQM A;  3VP1 A;  1W5D A;  5HW3 A;  3IHA A;  5DTT A;  2EXA A;  3MFX A;  1H0M A;  3QP6 A;  3S4X A;  4KZB A;  2WYX A;  2DMW A;  2ZC5 B;  3CWF A;  3L7H A;  1TD5 A;  1FIL A;  5F68 A;  3G31 A;  3KYE A;  2H28 A;  3N8L A;  1GA0 A;  2ZOI A;  5GHZ A;  2Y55 A;  4GLQ A;  1G6A A;  1LSV A;  3QP2 A;  3MQO A;  5DTK A;  3O5Y A;  3U2A A;  2L4R A;  4ZRR A;  1IOU A;  1CI8 A;  2WZX A;  4WUJ A;  4O0P A;  3O3V A;  4CLC E;  3HLE A;  1Y4O A;  2FH5 A;  1K25 A;  3MBZ A;  1GHP A;  3C7V A;  2VZW A;  3T1Q B;  3UE1 A;  3DTK A;  3HL9 A;  3AGD A;  1S67 L;  2VKS A;  4H6J B;  4JGP A;  2Y2K A;  2GJ3 A;  4GZB A;  1FQG A;  4KQO A;  3LR0 A;  1OTE A;  1S6R A;  1RGZ A;  4B93 A;  1TS7 A;  5EVL A;  3BM6 A;  2WUQ A;  3ZHH A;  1DJA A;  3D9Y A;  2W27 A;  4I38 A;  4E3M A;  2BLS A;  1GCE A;  5J7E A;  2EFX A;  4EXO A;  2P08 A;  2KLI A;  4DJ3 A;  3UB9 A;  5DFX A;  5FEF A;  1UWP X;  1J3W A;  2A49 A;  2VV6 A;  1YLW A;  3MR0 A;  1XJ4 A;  3T4J A;  4JXV A;  1HLU P;  1PFL A;  2J9O A;  1OTB A;  3E98 A;  2JHE A;  5G4Z A;  3WS2 A;  3SH7 A;  2VGL M;  4R3A A;  3V67 A;  1Q2P A;  1K54 C;  4OH0 A;  5HPF A;  4R70 A;  3LEQ A;  2P9V B;  1CI9 A;  3OC2 A;  5FA7 A;  3NUL A;  4IUK A;  3R7W B;  4UQI M;  3ZCZ A;  2XDM A;  2VV8 A;  4WMC A;  5F1F A;  3VOY A;  3GR2 A;  2W3H A;  4M3K A;  1XA7 A;  2J7V A;  2W3D A;  4KZ7 A;  3LFV A;  4RYE A;  5J3W A;  3HUM A;  3UO9 A;  4DDY A;  3EQU A;  3BEC A;  3CI6 A;  3BJN A;  4P6B A;  3UPO A;  2ZC4 B;  2PDR A;  4R6L A;  3NOU C;  2R78 A;  2OLV A;  2V1A A;  5FEG A;  1P9W A;  4IUH A;  3MKF A;  4PM9 A;  3Q7Z A;  3S1Y A;  2HDU A;  4UA7 A;  2V2F F;  3TG9 A;  3GQZ A;  3OPH A;  2PBD P;  3PTE A;  5HL6 A;  4R3J A;  1K54 A;  1LL5 A;  1IEM A;  3ZG7 B;  5HX9 A;  3VP3 A;  2ZQ9 A;  4GD8 A;  1XJ3 A;  4KQD A;  4EBP A;  1NLZ A;  5TFQ A;  1FSY A;  5GHY A;  3CPT A;  3LI8 A;  3MJQ A;  1NZU A;  2EX6 A;  4QWO A;  1L2S A;  5G4Y A;  2HDQ A;  4HBU A;  4Y0O A;  1BT5 A;  4NXB A;  4NET A;  1H3Q A;  4WZ5 C;  3T1R A;  4CPK A;  1LSW A;  3PBN A;  2V9A A;  4KG2 A;  3DWK A;  1H8Y A;  3T4O A;  2HP6 A;  3NY4 A;  3Q7V B;  3BLM A;  3T50 A;  4E3N A;  4OOY A;  3FZC A;  4HJ6 A;  4EUZ A;  2B18 A;  2R9X A;  2HJE A;  4L0L A;  5KZH A;  3S7P A;  2Q0O A;  1XX2 A;  1MC0 A;  4GS9 A;  4MNR A;  1MKI A;  2Y2G A;  4L9F A;  3UDI A;  4FCF A;  3UB8 A;  2A24 A;  1G6O A;  3GEC A;  3U4L P;  2WGV A;  1VEU A;  3T1X A;  4LV1 A;  1ERQ A;  4JLF A;  4Z1W A;  3NCK A;  4Z9Q A;  3TW8 A;  3N4I A;  4JF6 A;  1FCO A;  1ESU A;  5AVF A;  3MFD A;  3IF6 C;  2XRO A;  3W2Z A;  2UWX A;  2X02 A;  1YAX A;  2UV0 E;  3PBR A;  2M1C A;  4EET B;  3N7W A;  1ES5 A;  2QWS A;  4S2L A;  4OLG A;  1DP8 A;  3OBF A;  3DAV A;  3OPL A;  4EW7 A;  1SKO A;  4M4X A;  2DNS A;  1V9Z A;  1CEG A;  5EUA A;  3QNC A;  2WZZ A;  1S66 L;  3E0Y A;  3K3C A;  2FZ0 A;  1P97 A;  4GKU A;  3VP4 A;  4IBX A;  1UGU A;  1ODV A;  2V1Z A;  3W8K A;  5DVA A;  1DP6 A;  1BTL A;  1MZU A;  3SH8 A;  1TDL A;  3L9K A;  3BY8 A;  4DE1 A;  1IYO A;  3A0S A;  2JKF A;  2WK0 A;  3ZNT A;  4I3A A;  3UE0 A;  5HFO A;  4MBH A;  3M2K A;  3UPP A;  4Q8I A;  3IF6 A;  1VET B;  2EWV A;  3TE8 A;  3CG5 A;  1PW8 A;  4N1X A;  3PBT A;  4G3K A;  3ZVW A;  2ACG A;  2Y2J A;  5FQK A;  2PU4 A;  2Q9N A;  1DY6 A;  1N9O A;  2VK3 A;  4L9E A;  2V20 A;  4MEZ A;  4GD6 A;  3LY3 A;  3M6B A;  1VM1 A;  2ZQD A;  3MS6 A;  1IYP A;  4WEJ A;  2H0Y A;  3HLG A;  5DF8 A;  3SS4 A;  4HOI A;  3EGD C;  4OQ0 A;  1K56 A;  4I5S A;  1ERO A;  1GA9 A;  4ME4 A;  2EX9 A;  1UWN X;  5CRF A;  3CUE C;  1YLJ A;  5DFY A;  1IYS A;  3H9W A;  2OWH A;  5GLB A;  4S2N C;  3MQQ A;  4II7 A;  3BFF A;  2FFF B;  1L0E A;  4I3I A;  1DP9 A;  4S2K A;  2BTF P;  4E3L A;  3A3D A;  4ARZ A;  1H8Z A;  3ITA A;  4ETX A;  3AGE A;  4MBF A;  3G35 A;  1YQS A;  1MWU A;  5FSR A;  4MLL A;  3V3S A;  3WS1 A;  4C6Y A;  5TGF A;  1HVB A;  3KSH A;  1LI0 A;  2HGV A;  1PZP A;  2W0N A;  2JKR M;  3CMZ A;  4OQH A;  1F98 A;  3B47 A;  1FCM A;  2K7S A;  2HF6 A;  3LIA A;  3IWQ A;  5GLA A;  5GHX A;  3GMW A;  1PNE A;  4OP5 A;  3MKE A;  2Y2L A;  4QHC A;  1RCJ A;  3ICY A;  4WF0 A;  5TBM A;  2DRW A;  4HI4 A;  4ZDX A;  3PAG A;  3H7W B;  4RA7 A;  2YKF A;  3FYZ A;  4DE3 A;  3HLC A;  4WEK A;  4F3L A;  3CUE A;  4S2M A;  4A5R A;  3BW6 A;  4K0W A;  3WWX A;  1YT4 A;  3LYX A;  4S2N A;  1KGE A;  1OPX A;  4BD1 A;  2ZQC A;  4XT2 B;  2XK1 A;  4JKT A;  4RQ9 A;  4IJG A;  3LR5 A;  4G3W A;  3UMD A;  4MDZ A;  3EEH A;  1L3L A;  2EX8 A;  3UB7 A;  4PM8 A;  4BJP A;  4HEF A;  4JXG A;  2NUT C;  3A0R A;  5HAI A;  1YLZ A;  4MN6 A;  1NJ4 A;  4LV0 A;  1JTD A;  4NG2 A;  2OSU A;  4FSF A;  2Q9M A;  1D7E A;  4OOM A;  5GLC A;  1MY8 A;  1GSX A;  2EXB A;  4EWF A;  1XGI A;  1H8M A;  2XGN A;  1MWR A;  2Y4A A;  1F9I A;  1CJF A;  4ZJ1 A;  1HD8 A;  4MBK A;  3NOT C;  1KVL A;  3D4F A;  4EER A;  4ZJ2 A;  5EOO A;  5EOE A;  2JKT M;  4EQ1 A;  3K3D A;  5DKK A;  2JKR I;  4DE0 A;  2AVX A;  2GX5 A;  1S4S A;  1EW0 A;  3DTM A;  4HJ4 A;  5L8M A;  3ZVT A;  3PBO A;  3F1N A;  4IVI A;  5F5Y A;  3E4Q A;  4DMZ A;  3ZQ5 A;  3QP4 A;  3CLO A;  4X53 A;  4EBN A;  3LGO A;  5E2G A;  3FPW A;  1K55 C;  5GL9 A;  1W63 Q;  5EVI C;  5HDS A;  4ZBE A;  3A0V A;  3JYI A;  4Y15 A;  4UHU A;  2PU2 A;  3HJI A;  1K4F A;  1L0D A;  4P0M A;  3G30 A;  5EEC A;  4N9K A;  4B9O A;  4PHT A;  2J3T C;  4QY5 A;  4AFI A;  3QHY A;  2ZC3 B;  5AQ7 A;  1BYW A;  5L10 A;  2W1T A;  5L2F A;  2W3E A;  2BAS A;  1BUL A;  5E2H A;  5HAQ A;  2Y8H A;  4IVK A;  2WAD A;  4K08 A;  3ZG5 A;  3DTI A;  5EFW A;  4YOF A;  3VMA A;  5DKL A;  4OPY A;  3VP0 A;  3K2N A;  1OTI A;  3ZDJ A;  4UA9 A;  2E8I A;  5FL3 A;  4E3K A;  2JCH A;  1SDE A;  3UN7 A;  5KMW A;  2W3G A;  1K55 A;  1JWV A;  4Q0J A;  5EVI A;  4MN7 A; 
#chains in the Genus database with same CATH homology
 2M7U A;  4PKY G;  3OCN A;  1T19 A;  3NHQ A;  3F1P B;  5K5B A;  1XJ3 A;  4KQD A;  4HNB A;  1NLZ A;  4BBT A;  2VLG A;  3RH8 B;  3LI8 A;  3MJQ A;  4XT2 A;  2P04 A;  2INW A;  5G4Y A;  3SW1 A;  4NXB A;  3KYQ A;  2EA9 A;  3S7N A;  4ARZ B;  4BWI A;  1H3Q A;  1LSW A;  2J3W A;  1XJ6 A;  3BQ8 A;  2KOI A;  2V9A A;  3PBN A;  3T4Q A;  3F1N B;  3T4O A;  2PD8 A;  4I3J A;  1WA9 A;  3T50 A;  2PHY A;  3EWK A;  4H6J A;  4LPZ A;  3CAX A;  4EUV A;  4HJ6 A;  3PBS A;  2O9C A;  1VB6 A;  5F6A A;  2B18 A;  4KUK A;  1NRJ A;  4CLC D;  2HJE A;  4L0L A;  2Z6C A;  3S7P A;  3GDI A;  1GSV A;  1MC0 A;  3EQV A;  5HPI A;  3P01 A;  4GS9 A;  4KUO A;  2D01 A;  3KSI A;  4L9F A;  2J80 A;  3UB8 A;  2A24 A;  1G6O A;  3GEC A;  4HH3 A;  1XFQ A;  3VE3 A;  2GZA A;  4Z1W A;  5HWV A;  4MN5 A;  3TW8 A;  3E4P A;  2YKH A;  3KSG A;  4IHQ A;  4CQH A;  5TBM B;  3PYP A;  4BMW A;  3C38 A;  1S1Z A;  5AVF A;  2XRO A;  3W2Z A;  3D72 A;  1YAX A;  1TS8 A;  3PBR A;  3LR4 A;  1T18 A;  2GNX A;  1X0O A;  3G6O A;  4DN0 A;  2M1C A;  4EET B;  1OJ5 A;  3LR3 A;  5F69 A;  4YWZ A;  2QWS A;  1VHM A;  3H82 A;  3F1O B;  4EU0 A;  1DP8 A;  3BY9 A;  3OBF A;  4EW7 A;  2O0Y A;  4M4X A;  5IU1 A;  4LRZ E;  1V9Z A;  3MQ0 A;  3S7Q A;  2WKP A;  4JGO A;  1YSP A;  1ZHH B;  3KSF A;  5HWT A;  4WL9 A;  2I9V A;  1S66 L;  3E0Y A;  3KYZ A;  2K31 A;  3NJA A;  3OCL A;  4O01 A;  3P7N A;  5HSQ A;  3JVU A;  3PBQ A;  3K3C A;  2FZ0 A;  1P97 A;  3FC7 A;  2O99 A;  3DBA A;  4Q0H A;  2LB5 A;  1UGU A;  2XSS A;  3JVV A;  4WN5 A;  3UE3 A;  1ODV A;  3VE4 A;  2K2N A;  4HJ3 A;  4E04 A;  2J3T D;  4G3V A;  2L1M A;  2KDK A;  1DP6 A;  2XA7 M;  1N9L A;  2VV7 A;  3MXQ A;  1XFN A;  3LIC A;  1MZU A;  3T4T A;  2JKT I;  3IBJ A;  3MMH A;  5HDD A;  3BY8 A;  4EEU A;  5J4E A;  3A0S A;  3LID A;  1OTD A;  2WKR A;  1GSW A;  4I3A A;  3T4S A;  2ZMF A;  3S7O A;  2HV1 A;  1T1C A;  5C5K A;  2V1B A;  2VEA A;  2O9A A;  2PR5 A;  3R4K A;  1S1Y A;  2EWV A;  3TE8 A;  3B33 A;  3UE6 A;  3OOV A;  4Y5F A;  4HHD A;  3PBT A;  4Y2F A;  4O8G A;  2NUP C;  4I39 A;  4G3K A;  2O9B A;  2PYR A;  2A2L A;  1N9O A;  4L9E A;  2P7J A;  1XJ2 A;  5IT5 A;  2VX8 A;  1MKM A;  4WEJ A;  2Y79 A;  3MF0 A;  2G7U A;  3OLO A;  4HOI A;  3EGD C;  3BQA A;  4GS9 B;  3F1P A;  1NLY A;  4I5S A;  4GW9 A;  2A24 B;  2CMN A;  4ME4 A;  2W3F A;  1UWN X;  2PD7 A;  1KOU A;  2VA0 A;  3UB6 A;  5HD3 A;  3CUE C;  4EES A;  3BWL A;  5DFY A;  1YSQ A;  1LSX A;  3H9W A;  4HH2 A;  2OWH A;  3MQQ A;  4II7 A;  4I3I A;  2PYP A;  1DP9 A;  4HP9 A;  4ARZ A;  3PHY A;  3PR6 A;  2VGL S;  4Y3I A;  5KIZ A;  4OOL A;  4ETX A;  2ZBB A;  4CLC B;  3H82 B;  4GHI A;  4P6Z S;  4LRX C;  4JGR A;  3LUQ A;  2W1T B;  3KSH A;  3LIF A;  3EGX C;  4UQI S;  5HWW A;  2D02 A;  3LI9 A;  4NXF A;  3TJZ C;  2HGV A;  2W0N A;  2JKR M;  5KSH A;  5I5L A;  4PAU A;  1F98 A;  2LB9 A;  3B47 A;  2K7S A;  2HF6 A;  3VOL A;  3LIA A;  4MMN A;  3TRC A;  4HP4 A;  5DF9 A;  3MFX A;  2QKP A;  3ICY A;  4WF0 A;  3D3O A;  2B02 A;  5TBM A;  2DMW A;  3CWF A;  3T4K A;  1TD5 A;  4HI4 A;  5F68 A;  3R7W A;  2H28 A;  3FG8 A;  3HJK A;  4UEY A;  3RTY A;  3H7W B;  3LIE A;  3IS2 A;  2YKF A;  2KX6 A;  2ZOI A;  2PT7 A;  4GLQ A;  5HDC A;  4WEK A;  4F3L A;  1LSV A;  3CUE A;  1T1B A;  3F1O A;  3BW6 A;  3MQO A;  3LYX A;  1Y28 A;  4QPR A;  5DJT A;  4BBV A;  2OAQ 1;  1OPX A;  3O5Y A;  3U2A A;  1OT9 A;  2L4R A;  4ETZ A;  4ZRR A;  1IOU A;  4YNR A;  2OWJ A;  3IBR A;  4XT2 B;  3C30 A;  4IJG A;  4RQ9 A;  3LR5 A;  4G3W A;  3UMD A;  4WUJ A;  2V0U A;  2OAP 1;  4MDZ A;  2JN7 A;  4O0P A;  3EEH A;  4CLC E;  4FOF A;  4WEL A;  1P0Z A;  3VV4 A;  4MCW A;  3UB7 A;  2FH5 A;  1D06 A;  1T1A A;  4BJP A;  2NUT C;  2PR6 A;  3A0R A;  4BBU A;  4MN6 A;  4FSF A;  3CIT A;  1D7E A;  2VZW A;  4OOM A;  4HY8 A;  3PXP A;  4L9G A;  4LRY C;  1F5M A;  1S67 L;  2VKS A;  1GSX A;  4H6J B;  4R38 A;  4JGP A;  4GJ4 A;  2ZMV A;  1N9N A;  2GJ3 A;  4KQO A;  3LR0 A;  1OTE A;  1H8M A;  2HJ9 C;  1F9I A;  1DRM A;  4B93 A;  1TS7 A;  3EEA A;  4CLC C;  4NXE A;  2VJW A;  4LLO B;  2W27 A;  1NWZ A;  2OOL A;  4I38 A;  4Q0I A;  3NOT C;  4WLA A;  4EER A;  5J7E A;  4EXO A;  2P08 A;  2JKT M;  3B42 A;  2KLI A;  2QYB A;  3UB9 A;  4DJ3 A;  5DFX A;  3K3D A;  4EQ1 A;  5DKK A;  2JKR I;  5HZH A;  1UWP X;  3KO6 A;  2GX5 A;  2QJ5 A;  2WKQ A;  2VV6 A;  4HQA A;  1S4S A;  1LL8 A;  1EW0 A;  4GHI B;  3MR0 A;  3LIB A;  1XJ4 A;  3T4J A;  1P9R A;  1JNU A;  4HJ4 A;  5L8M A;  3PBO A;  1OTB A;  3F1N A;  5F5Y A;  3E4Q A;  3E98 A;  2JHE A;  3NOP C;  4DMZ A;  1YKD A;  3ZQ5 A;  5G4Z A;  5HD5 A;  3CLO A;  5AVE A;  1OT6 A;  2Z6D A;  4NXG A;  4GCZ A;  3FPW A;  3FPV A;  2VGL M;  1W63 Q;  2QHK A;  4PKY A;  4R3A A;  3V67 A;  5LBR A;  3UME A;  5HDS A;  1S4R A;  3A0V A;  1LT0 A;  4R70 A;  2QJ7 A;  5HPF A;  1OTA A;  3OC2 A;  4P6Z M;  4IUK A;  2ZOH A;  3R7W B;  4UQI M;  3HJI A;  2M7V A;  1W63 M;  5MC7 A;  1ZTU A;  1V9Y A;  2VV8 A;  3C8C A;  3IS2 B;  1TF1 A;  2W3H A;  4B9O A;  4PHT A;  4F3L B;  4CLC A;  2J3T C;  2W3D A;  3T4L A;  4AFI A;  3HCY A;  3LFV A;  1TS0 A;  1BYW A;  2XRN A;  3EOI A;  5J3W A;  1IFQ A;  2W1T A;  4HIA A;  2W3E A;  2BAS A;  3ULF A;  5TJJ A;  3EQU A;  2Y8H A;  3CI6 A;  3BJN A;  4NEE D;  1G28 A;  4R6L A;  2PDR A;  2IA2 A;  4K08 A;  3E4O A;  5A8B A;  3ZYT A;  3NOU C;  2XA7 S;  2R78 A;  2V1A A;  5EFW A;  4YOF A;  1P9W A;  4IUH A;  5DKL A;  1OJG A;  3KX0 X;  5CX7 A;  4DJ2 A;  3K2N A;  5IS1 A;  1OTI A;  2V0W A;  4EEP A;  4NKP A;  1TS6 A;  5DJU A;  5FL3 A;  2L0W A;  2EWW A;  3C2W A;  5HL6 A;  2W3G A;  3RFB A;  1STZ A;  3H7W A;  4Q0J A;  2W1R A;  5AJG A;  4JGQ A;  4MN7 A;  2MJ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...