3RFBA

Structure of frmsr
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
160
structure length
160
Chain Sequence
SEKQSRYQMLNEELSFLLEGETNVLANLSNASALIKSRFPNTVFAGFYLFDGKELVLGPFQGGVSCIRIALGKGVCGEAAHFQETVIVGDVTTYLNYISCDSLAKSEIVVPMMKNGQLLGVLDLDSSEIEDYDAMDRDYLEQFVAILLEKTTWDFTMFEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of fRMsr
rcsb
source organism Streptococcus pneumoniae
molecule tags Oxidoreductase
molecule keywords Putative uncharacterized protein
total genus 51
structure length 160
sequence length 160
chains with identical sequence B
ec nomenclature ec 1.8.4.14: L-methionine (R)-S-oxide reductase.
pdb deposition date 2011-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13185 GAF_2 GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3rfbA00
4YOFA 3E98A 2ZMFA 2O0YA 1TD5A 3S7QA 1VHMA 4FOFA 3W2ZA 4CQHA 3OBFA 3OOVA 4RQ9A 5I5LA 3KO6A 1MC0A 3KSIA 4LRXC 5HSQA 3S7OA 3NOUC 2W3GA 4G3KA 2KOIA 5DFXA 2O99A 3TRCA 4Y5FA 2B18A 4EU0A 4ZRRA 2Y79A 4Q0IA 4BWIA 5HL6A 3CI6A 3ZQ5A 4PAUA 2O9AA 4LRZE 2M7VA 2OOLA 2QYBA 3NOPC 2IA2A 5L8MA 4ME4A 2VKSA 3LFVA 3DBAA 3C2WA 3NOTC 5K5BA 1YSPA 4IJGA 4MMNA 3VV4A 3G6OA 4EUVA 1ZTUA 3HCYA 2O9BA 5HPFA 3KSGA 3IBRA 4ETXA 2KLIA 4GW9A 4MDZA 1STZA 2VEAA 3S7PA 4IUKA 2W3EA 5LBRA 4O0PA 2K31A 1TF1A 3D3OA 2VJWA 3EEAA 4G3VA 5DFYA 2W1RA 4Z1WA 2XSSA 3O5YA 4O01A 2W3DA 4O8GA 2XRNA 3MMHA 3BJNA 3IBJA 3NHQA 4YNRA 2LB9A 2W3HA 3CITA 4QPRA 5AJGA 4MN7A 5HPIA 1MKMA 4IUHA 2W3FA 1YSQA 4Y3IA 3K2NA 2G7UA 4R70A 3S7NA 2K2NA 4DMZA 4DN0A 2XROA 3KSHA 3MQ0A 4G3WA 3MF0A 2GX5A 2VZWA 4GLQA 2Y8HA 4Y2FA 1YKDA 3R4KA 2HGVA 4R6LA 2LB5A 5C5KA 4E04A 2M7UA 3RFBA 4MCWA 2W1TA 4Q0JA 2O9CA 4Q0HA 4ETZA 2W1TB 3E0YA 3KSFA 4LRYC 5TJJA 1F5MA
chains in the Genus database with same CATH superfamily
1T18A 5TBMA 3KYEA 1OT6A 3OBFA 4RQ9A 4HJ3A 2Y2IA 4KG5A 1Z6FA 1TEMA 2Y2PA 3TSGA 2P9VB 3QP1A 2ZC7A 5L09A 2ZOHA 2PR6A 4OQGA 1KGFA 2NUPC 5GHYA 1K38A 4U3TA 1V9YA 1FILA 2HDQA 3NOTC 4H8RA 4NXBA 2WZXA 3SH7A 1PW1A 4KZ7A 2VV7A 2HJEA 4RA7A 2C5WB 4GW9A 4UA6A 1N9LA 1G28A 4NXEA 2VJWA 4X1LA 2HP5A 2W1RA 3C5AA 1TS6A 3C7UA 1D1JA 1OMEA 1TS7A 4KUKA 5EM0A 2LB9A 3BQAA 3V67A 1WE4A 2Y59A 5HPIA 1IOUA 4WEKA 5E2EA 5FDSA 1F2KA 5HAQA 1T1AA 3BLMA 1KE3A 3MF0A 2WGWB 4X68A 4X69A 3N6IA 5EECA 2OWJA 1WA9A 4MCWA 1ALQA 2BG1A 4KZ6A 1E3UA 3A3EA 5EVIC 1MPLA 1IKIA 4QD4A 3T4TA 5TR7A 3WRTA 1HLUP 2RCXA 3QP4A 1NLYA 2V1BA 4OP5A 3B47A 1EWZA 2WKQA 3O86A 3UE1A 3MBZA 1LSXA 2B18A 2IWBA 1XXMA 3MFDA 3ULFA 4IVKA 4LCMA 3UE3A 4EESA 4QU3A 4HI4A 1D06A 2XGNA 4HY8A 1CK3A 4JXVA 1ZKJA 3HVFA 4UA7A 3VP1A 4OVDA 2A24B 1YT4A 3HLFA 5EUAA 1FSYA 5CGWA 3RTYA 4Y0TA 5CECA 2ZQCA 1K54C 3C7VA 5EVID 2GJ3A 5BOHA 5MC7A 2QJ7A 1OPXA 3PYPA 2Y2QA 5AVEA 1FCOA 3G4PA 2V1ZA 3CJMA 4JLFA 1E25A 3IXGA 4CLCE 5HAIA 2XFTA 2Z2LB 4HH3A 1GSVA 4DN0A 3LO7A 2VZWA 4WELA 1AXBA 4S2NA 3TJZC 3SS3A 4I39A 3AGEA 4A5RA 4HIAA 3V3SA 5HW3A 1O7EA 3MKFA 2ZL1A 4XXRA 1HD8A 5EVEA 3ZNTA 3MS6A 2E8IA 3OCNA 5JYPA 2ZMVA 4NETA 1PZOA 5J3WA 5DTSA 3UE0A 1FR6A 4B9OA 3BM6A 5F82A 1SDEA 3HUMA 1JVJA 3T1RA 3UPPA 2Y79A 2RL3A 1PW8A 3QP5A 1U60A 4NXFA 1ES5A 4FH4A 4PM7A 3UB7A 1PYYA 3E4PA 5CERA 2EX6A 3LFVA 4OQHA 1ACFA 2AVXA 3VV4A 3OPRA 1Q2QA 4DKIA 1SHVA 3A0RA 4EXOA 4GCZA 2O9BA 1KVMA 3CAXA 4ETXA 3GTCA 4X56A 3P98A 2A3UA 1BZAA 5G4ZA 5FL3A 4MBKA 4FSFA 3CG5A 1W8QA 3V50A 2QKPA 1BLPA 3G30A 3W4OA 1DJCA 4YNRA 2WADA 4LV0A 4KZAA 3LR4A 3T1QB 4RYEA 4NEED 4P6ZS 3EQUA 4EETB 3GMWA 5DKLA 3VP2A 4CLCC 3UB6A 3B3XA 3R7WA 1W63Q 1UWNX 2EXBA 1IKGA 4WF0A 3L7HA 4OH0A 3IF6B 3SH8A 2EA9A 3MSHA 5C5KA 1Q2PA 3O3VA 4IEDA 3ZG7B 2XA7M 2G2WA 1PWDA 2W1TA 2I72A 3Q82A 4JKTA 1ZC2A 2EWWA 1MZUA 5G4YA 4JBFA 4KQRA 2V0WA 3KO6A 4HEFA 3SZTA 2OLUA 4EW7A 3NDGA 5FAOA 3F1OA 4DE2A 3VOYA 2O99A 5HARA 3EWKA 3BRMA 1BULA 3CZDA 1F9IA 3MQQA 1RGYA 2XD5A 4LV2A 3DTIA 4I38A 5GLDA 5FQMA 1KE0A 1YLYA 1TDLA 5AQBA 1CQAA 3C2WA 2G2UA 2Y2JA 1A0KA 1IYQA 4GD6A 3PBRA 1H8MA 3Q7ZA 3IXBA 2Y2NA 4JXSA 5E43A 5DTTA 1YLWA 4LFUA 4E3NA 2R9WA 2VV6A 3T4QA 5HD5A 4WN5A 1XA7A 2H0YA 4EWFA 1Y54A 4GOGA 1XGIA 3MR0A 2GDNA 3LIAA 2YKFA 1OTBA 3MMHA 5HDDA 1NYMA 1SCWA 2ZOIA 3U2AA 2QMIA 3IF6C 3PBQA 5CTMA 3SS5A 3HJIA 1W5DA 1M40A 4BL3A 4B88A 2Y8HA 3MZFA 4C6YA 2QJ5A 4DE0A 2I9VA 3LICA 4OOMA 4CLCB 3ZDJA 4JXWA 4DE1A 3N8LA 2J9PA 4X53A 2O0YA 4S2OA 3IT9A 4CQHA 2Y2OA 1EW0A 1CI9A 4EERA 3HJKA 1CEFA 4HQAA 4G3KA 5KIZA 1P97A 5GLCA 4BD0A 1LT0A 3OC2A 1K55C 4R4RA 5HL6A 3ZQ5A 5CX7A 1P9RA 1XFNA 4PHTA 4ME4A 3FC7A 2ZC4B 5KSCA 2WGWA 5CGXA 4B4XA 3IX3A 3M6BA 3T1XA 1YLTA 2X71A 2X01A 5CHUA 3OPLA 2EFUA 1S1YA 3S7PA 1YPRA 1PI5A 3OPPA 3E2LA 4ID4A 1RP5A 1XJ2A 3V39A 1OT9A 1JWZA 3MQOA 1ONHA 2WKPA 3ICYA 3ZYTA 3LI9A 3IH8A 2XSSA 4EQ1A 2KDKA 4QPRA 3IWQA 2GZAA 3N8RA 1FQGA 4R70A 3O88A 2FFFB 3BYDA 2PAVP 2CC1A 4G3WA 5U47A 1K25A 5HDSA 3Q7VA 3G35A 3Q7VB 4X6TA 1AWIA 3HLBA 4CLCA 1K0KA 3KSFA 4Y13A 3LY3A 3UPNA 4KQDA 2WKRA 5I5LA 1MXOA 4WZ5C 2H5SA 5DF8A 2HDSA 3R7WB 3DAVA 5EFWA 2GNXA 2FH5A 3ZVTA 4GDNA 1XGJA 5CHMA 4KZ8A 4LRZE 2M7VA 4E3OA 2HP9A 3GDIA 4ZAMA 4EEPA 1V9ZA 2BTFP 4UHUA 3DBAA 2P74A 3MXSA 1L3LA 1RCJA 2NUTC 3BFEA 4OP8A 3D9YA 2JBFA 2XFSA 2B02A 2ZM8A 3LGOA 4Y15A 4Q8IA 2D01A 3KSGA 3SW1A 3N4IA 3CMZA 4O7DA 1H5XA 3TOIA 2W27A 4PM5A 4KZ5A 4OPQA 2M1CA 1SKOA 4PKYA 3E4QA 4IVIA 1S0WA 3S22A 3BFDA 4EBLA 2BLSA 3WRZA 5FASA 2UWXA 4CLCD 1DJBA 3LEZA 4HHDA 1JNUA 2A24A 4II7A 3T4SA 1P9WA 4Q0JA 4E3JA 4QB8A 4EV4A 4CJNA 3NCKA 5EOOA 1ONGA 3QP6A 5EV0A 5F83A 4GD8A 4IHQA 1LLBA 4KZBA 4LRXC 2ZBBA 3LIBA 1YLZA 4PKYG 3LIFA 3F1NB 3QNBA 4Y5FA 3LUQA 2JHEA 4ZRRA 1N9OA 2Y4AA 4PAUA 4MEZA 2JKTM 5HFOA 3L9KA 1ZG4A 1VM1A 3Q81A 3BEBA 1I2WA 5AQ9A 2VLGA 3ZG0A 3IQAA 3EGXC 1FOFA 5KMWA 2K7SA 1S66L 4MNRA 1OJ5A 2VGLM 3BQ8A 1S1ZA 4P6ZM 2WGIA 2VEAA 4BQMA 4JF5A 2Y2MA 1MBLA 1HVBA 3LR3A 3EEHA 3PBTA 2IWDA 1L0DA 5FAPA 1NYYA 2JKTI 4N1XA 2Y2LA 5FI6A 1G6OA 4GN2A 1XJ3A 4L9EA 1OJGA 3TE8A 3CUEC 2C6WB 1ES2A 2XA7S 4MLLA 3K2NA 5AQ7A 1FCMA 1K56A 1C3BA 4JGRA 4OQ0A 4GLQA 3OCLA 1CEGA 2JKRM 4OLGA 3FV7A 3IF6A 1L0FA 1ZG6A 4BBUA 4R23A 3PAGA 4B93A 1BSGA 2OWHA 4HBUA 1K6SA 1NY0A 4ZJ3A 2EXAA 1MC0A 3IHAA 3M6HA 3HLEA 1H8ZA 4OPRA 5FQ9A 2W3GA 2WGVA 2HV1A 2WKEA 4KENB 1HTZA 3UDIA 1ODVA 4NKPA 4BWIA 3PHYA 2WAFA 4MBHA 1ERMA 3DW0A 3V3RA 2OSUA 4XT2A 4KZ3A 4ARZB 2ZM2A 3AGFA 3NOPC 1OTDA 1TS8A 2HZ5A 2PYRA 5DJUA 2HDRA 5EOEA 4IJGA 1LSVA 1G68A 2PDRA 1N4OA 4F3LA 5F5YA 3H82A 3MXRA 3LY4A 3FWLA 3D4FA 4N9KA 1FIKA 4K0XA 1BLSA 4PM8A 2JC7A 1LL9A 1X0OA 1TS0A 5FI7A 1PNEA 2V2FF 4R3JA 3QP2A 2Y55A 1RGZA 4OQIA 4R0QA 3IBJA 4HH2A 2XEPA 1G6AA 5AJGA 4FUWA 3PBNA 4MN7A 2P7JA 5A93A 4BLMA 3ZGAB 1FCNA 3UPOA 3A3DA 4WBGA 1IFQA 3EGDC 4PM6A 5IS1A 3A3FA 1LSWA 2ZC3B 1KVLA 4B4ZA 2ZM0A 3MJQA 3ZG9B 3ITBA 4ZDXA 5HWVA 3ZVWA 3FPVA 4GNUA 3NC8A 2W1TB 3CITA 4LRYC 4OPYA 4PM9A 1XKZA 3S1YA 1VEUA 4I5SA 5F68A 4FH2A 4N1HA 3LCEA 3WWXA 2VGLS 1K6RA 3IWOA 4C3QA 5DFXA 3TW8A 5DVAA 2PR5A 3NI9A 5IU1A 4EU0A 4FTXA 3E2KA 3HREA 4JXGA 1JTDA 4S2MA 2EX9A 3BWLA 2QYBA 4ARZA 1H0MA 2L1MA 2JKRI 4N92A 5E2HA 2QZ6A 3GVBA 4QY6A 5DTKA 3IWIA 1DRMA 2J3WA 2OLVA 2XLNA 5EE8A 5CEDA 2KX6A 3ZG8B 1VQQA 5HPFA 1L0GA 3LR0A 4R3AA 1NZOA 3FYZA 4RX2A 5GLBA 5HWWA 5J4EA 3B33A 2K31A 5F6AA 1W8YA 3P01A 2JCHA 5DKKA 3DTEA 3NHQA 3ITAA 1DP6A 4HJ6A 2MJ6A 4AFIA 4WM9A 3VFHA 1JTGA 2VA0A 5HAPA 2D02A 4WZ4A 3WS2A 1MWTA 5DJTA 4Y2FA 3DWKA 4BBTA 1YKDA 5FAQA 2XD1A 1PWCA 3RFBA 1BLCA 3UO9A 4LV1A 5L10A 3F1PA 1OTEA 3IXHA 4KG2A 2WKIA 1VHMA 3T4KA 3Q1FA 1ESUA 3NOUC 2KOIA 4WMCA 3BFCA 2DCFA 4BL2A 4GZBA 5HZHA 3A0SA 3UNWA 2VX8A 4EUZA 2Z6DA 3T4LA 2Y2KA 2Q9NA 1GHMA 2ZJ9A 2ZC5B 1CI8A 2DRWA 1QMEA 5K5BA 4MMNA 2V1AA 3CPTA 3GV9A 5AVFA 3OLOA 5IHVA 3KYQA 2HDUA 4MN5A 1UGUA 1ZHHB 3JVVA 3IX8A 1SZVA 5M19A 3ZNYA 5DF9A 4DXCA 4GDBA 2H10A 1PRQA 5EVIA 1VEUB 4JF4A 2W3DA 3BJNA 1GA0A 1YLJA 2WYXA 3GR2A 2G7UA 4JGQA 2JN7A 2A49A 4RVAA 1CF0A 1IYOA 3R4KA 3WS1A 1OTIA 3VP0A 3LR5A 4R6LA 2XQZA 3A3JA 3WS5A 1CJFA 1S6RA 4OKPA 4F94A 3IX4A 3T12B 1S4RA 2O9CA 4K91A 4GJ4A 2VGJA 2V20A 2Q9MA 5CGSA 3G2YA 3ZHHA 4DRTA 3NBLA 1Z09A 1XX2A 3GQZA 1K4FA 2WAEA 4M4XA 4OLDA 1I2SA 3CI6A 1S4SA 2O9AA 2PBDP 1YAXA 2IA2A 3H9WA 2DMWA 4P0MA 1VETB 2P9VA 5CRFA 4HP4A 4H6JA 1ESIA 2J8YA 2Y91A 1VETA 4WUJA 4E3IA 4E6WA 1GCEA 1L0EA 4EUVA 4JGPA 4KG6A 3C8CA 3CHWP 4NG2A 4WL9A 3D72A 5FA7A 2XR0A 1MWRA 2H28A 2V8FA 2YKHA 5GL9A 4Y0OA 4JPMA 4XUZA 5F69A 4DF6A 4IBXA 3NECA 4YFMA 2VV8A 4MBFA 2R9XA 3VOZA 3ZCZA 4GHIB 5EVIB 3CLOA 3BLSA 1XA1A 5HL1A 3LIEA 1NWZA 4Y3IA 4U0TA 2PBYA 3S7NA 1K57C 1IEMA 1KDWA 5J8XA 1JWVA 3NDEA 3A0VA 4KZ4A 5TFQA 3H7WB 2ZD8A 2Z2MB 3E0YA 5AQAA 5FQJA 1F5MA 3CUEA 1TD5A 4FOFA 4YINA 3W2ZA 4DDYA 1SKFA 4DJ3A 3KSIA 1PWGA 2HPBA 1ERQA 4L9GA 1PFLA 5FEGA 3O87A 2FFYA 4OOLA 4E3LA 5FQKA 1K4EA 3B42A 4LV3A 2ZQAA 1H3QA 3BY9A 3GSGA 4DXBA 3VP3A 2ACGA 5L8MA 1EROA 2EX8A 4Y17A 3IHBA 3HLGA 1NRJA 5L2FA 4RX3A 2QPNA 3HBRA 1YSPA 3MFXA 4S2IA 5EM1A 4XUXA 1SKOB 1XJ6A 1ZTUA 1VB6A 4QWOA 1GA9A 2ZMAA 1K55A 4I3AA 3ISGA 4BMWA 3VOLA 4C75A 2KLIA 3WS0A 3W4QA 4MDZA 1LI0A 2XF3A 3BECA 4O0PA 3JPUA 3D3OA 3VP4A 4Y0UA 2ZLYA 2WZZA 3Q07A 2XRNA 2W3HA 3K3CA 5G18A 5L07A 3T1SA 4F3LB 5FSRA 1LL5A 4HJ4A 1TDGA 1YSQA 5IT5A 2IWCA 3VSKA 1IYSA 1NLZA 3FPWA 1P0ZA 5FATA 2HGVA 4L0LA 4UQIM 2LB5A 5JYOA 4IBRA 4QY5A 1K56D 4FCFA 2ZQ7A 4GS9B 1T1BA 3PR6A 3MXQA 2VKSA 5TJJA 1ES3A 1PIOA 4E3MA 4KZ9A 4OOYA 4E6XA 3DWZA 4HBTA 1T1CA 5E2GA 3NY4A 4GHIA 3VE4A 1LHYA 3OZHA 2PU4A 2J7VA 1HZOA 2R78A 2FZ0A 4M3KA 4LENA 2H0TA 3HLDA 5A92A 1Y4OA 2OOLA 1NJ4A 2QWSA 4GKUA 3QP8A 3MKEA 1BUEA 3UB9A 4R1GA 4ESPA 3CPTB 3HL9A 5A90A 2J3TC 3KX0X 3RXXA 3ZG5A 4BJPA 5F1GA 3VE3A 5M1AA 3M2JA 3HUNA 3RJUA 3G34A 2Z6CA 1STZA 2QHKA 4IUKA 3IS2B 2DNSA 1DY6A 4HOIA 2XDMA 1QMFA 3UB8A 2V9AA 3FZCA 3V5MA 5J7EA 1BT5A 1LI9A 1MWSA 4Z1WA 5F1FA 3FKVA 3N7WA 3SOIA 3M2KA 5CTNA 2V8CA 1TVFA 3UDXA 1KGEA 2ZQ9A 2INWA 3W8KA 4CPKA 3G31A 3DTKA 4S2NC 1D7EA 1OTAA 4NK3A 4P87A 3LEQA 4E04A 4X25A 5KZHA 2M7UA 4OONA 3BFFA 4GS9A 1L2SA 4P85A 5GHXA 3IH9A 1LL8A 2XK1A 1FSWA 4XT2B 5A8BA 3IF5A 4EEUA 3NIAA 1MKIA 2Y2GA 1E3UD 2OAP1 3CWFA 4QHCA 1N9BA 5HD3A 4DE3A 1XFQA 4WEJA 3VFFA 2WUQA 3SS4A 1H8YA 2EFXA 3UMEA 3HLCA 3E4OA 4EBPA 5A91A 3LYXA 1IELA 2J3TD 5FQIA 1EI5A 1YLPA 4DDSA 1NZUA 4UAAA 4K0WA 4PPRA 5FEFA 4BD1A 2JKGA 3AGDA 2X02A 1DP9A 2L4RA 3DTMA 3TG9A 4N9LA 3GRJA 3HUOA 2PYPA 4BENA 3NJAA 3LI8A 2HF6A 4Y7PA 3ZFZA 3EEAA 5DFYA 4H6JB 3UE6A 1MY8A 1JWPA 4PMAA 4ZJ1A 5HWTA 3UDFA 3H82B 4EQIA 1ES4A 2BASA 3UN7A 1J3WA 1J9MA 3GECA 2HP6A 1MKMA 4IUHA 3G32A 5HDCA 4U0XA 2JE5A 2K2NA 1KDSA 3JYIA 3KSHA 3UY6A 3QNCA 2UV0E 3N8SA 2L0WA 4R3BA 5D3OA 1YMSA 1YMXA 1W79A 3OPHA 1O07A 3W4PA 3VSLA 4EBNA 5GHZA 4Q0HA 4E3KA 5FI2A 1PZPA 2PRFA 1DP8A 2B95A 1PI4A 4R38A 2J9OA 2ZMFA 3S7QA 4JGOA 3FG8A 4WMCD 4KQOA 4NXGA 5HSQA 3S7OA 1MWUA 3C30A 4MN6A 2PHYA 1W7FA 4ZBEA 3LIDA 1K54A 5FQQA 5CEBA 4D60A 4JF6A 3SH9A 2ZL1B 5EVLA 2ZC6B 4QJGA 1GHPA 2PT7A 3VMAA 4UEYA 1G5UA 3RXWA 3T4OA 2JKFA 4KUOA 3T50A 1W63M 3IS2A 2CMNA 3BY8A 4KQQA 2P08A 4P6BA 4S2PA 3C4PA 3FKWA 5CHJA 2Y2HA 3IBRA 3PBOA 4LPZA 2PD7A 4X1MA 5TGFA 3P7NA 1F98A 4HESA 3G2ZA 5TBMB 2W3EA 2OV5A 2P04A 2WK0A 1I5QA 3NULA 3T4JA 3K3DA 5M18A 4HP9A 1BTLA 1WYCA 4O01A 1XP4A 4O8GA 3MZEA 1E4DA 2VK3A 5I94A 3QHYA 1KOUA 4UQIS 1SDNA 2ZQ8A 1GHIA 1N9NA 3MQ0A 1BYWA 2HJ9C 2PD8A 1YQSA 3UB5P 2GX5A 2W0NA 1DJAA 2OAQ1 3H7WA 4HNBA 1WYBA 4WLAA 3UMDA 3S4XA 3C38A 1YM1A 3PTEA 2PU2A 4D2OA 4ETZA 1S67L 4YOFA 2EWVA 3PBSA 3F1NA 3E98A 5GLAA 4S2LA 3RH8B 1XJ4A 4WYYA 5KSHA 2ZQDA 3OOVA 2Q0OA 4Z9QA 3F1OB 3P09A 2B5RA 1NXYA 5CXWA 4X55A 3MZDA 3TRCA 2J80A 2EX2A 4Q0IA 3BFGA 1NRFA 2E8JA 4LLOB 3A3IA 5HX9A 3WS4A 2WKHA 4ZTKA 2XH9A 4FD8A 4S2JA 3HLWA 5FDHA 3G6OA 1UWPX 3HCYA 2V0UA 4LGWA 1KE4A 1Y28A 4I3IA 1XPBA 1KGGA 3U4LP 5DF7A 4GB7A 5LBRA 2A2LA 4R4SA 1TF1A 1T19A 4YWZA 1FR1A 4G3VA 1M6KA 3O5YA 4WZ5A 1GSXA 3JVUA 3PXPA 4L9FA 4I3JA 1IYPA 1GSWA 2W3FA 4S2KA 3KYZA 3PAEA 4K08A 5EPHA 5E2FA 4DMZA 2XROA 3BW6A 4BBVA 3F1PB 4OPZA 2VGKA 4LCLA 3C4OA 1BLHA 4DJ2A 3IXDA 4UA9A 1K57A 4ZJ2A 3I7JA 3EQVA 3EOIA
chains in the Genus database with same CATH topology
1T18A 5TBMA 2O0YA 1OT6A 4I5SA 5F68A 4CQHA 3OBFA 4RQ9A 4HJ3A 1EW0A 4EERA 1T1CA 3HJKA 2VGLS 4HQAA 4G3KA 4GHIA 3VE4A 5DFXA 3TW8A 5KIZA 2ZOHA 2PR5A 2PR6A 1P97A 5IU1A 4EU0A 1LT0A 2R78A 3OC2A 2NUPC 2FZ0A 5HL6A 3ZQ5A 5CX7A 2OOLA 3BWLA 2QYBA 1P9RA 4ARZA 1XFNA 1V9YA 4ME4A 4PHTA 2L1MA 3FC7A 2QWSA 2JKRI 3NOTC 4NXBA 1DRMA 2J3WA 3UB9A 2J3TC 3KX0X 4BJPA 2KX6A 5HPFA 2VV7A 3VE3A 2HJEA 3LR0A 4R3AA 4GW9A 1S1YA 2Z6CA 1STZA 3S7PA 5HWWA 2QHKA 4IUKA 5J4EA 3B33A 1N9LA 3IS2B 1G28A 4NXEA 2K31A 1XJ2A 5F6AA 1OT9A 2VJWA 3MQOA 4HOIA 2WKPA 2V9AA 3ICYA 2W1RA 3UB8A 1TS6A 3ZYTA 5J7EA 3LI9A 3P01A 2XSSA 4Z1WA 1TS7A 4EQ1A 2KDKA 5DKKA 4KUKA 3NHQA 2LB9A 4QPRA 3BQAA 1DP6A 2GZAA 3V67A 5HPIA 4HJ6A 2MJ6A 1IOUA 4WEKA 4R70A 4AFIA 2INWA 2VA0A 2D02A 4G3WA 1T1AA 5HDSA 3MF0A 5DJTA 1D7EA 1OTAA 4Y2FA 4BBTA 1YKDA 4E04A 2OWJA 2M7UA 3RFBA 1WA9A 4MCWA 4GS9A 4CLCA 3F1PA 3KSFA 1OTEA 1LL8A 3T4TA 1VHMA 4KQDA 2WKRA 5I5LA 4XT2B 3T4KA 5A8BA 1NLYA 2V1BA 4EEUA 3NOUC 3B47A 2WKQA 2KOIA 2OAP1 3CWFA 3R7WB 5HD3A 1LSXA 2B18A 1XFQA 4WEJA 5HZHA 3A0SA 2VX8A 3ULFA 5EFWA 3UMEA 2GNXA 2Z6DA 2FH5A 3UE3A 3E4OA 3T4LA 4LRZE 2M7VA 4EESA 4HI4A 1D06A 3GDIA 3LYXA 4HY8A 2VKSA 4EEPA 1V9ZA 2J3TD 3DBAA 5K5BA 4MMNA 2V1AA 2NUTC 2A24B 5AVFA 3OLOA 2B02A 3RTYA 2D01A 3KYQA 1DP9A 2L4RA 3KSGA 4MN5A 3SW1A 2GJ3A 5MC7A 1UGUA 1ZHHB 2QJ7A 3JVVA 2PYPA 3NJAA 3LI8A 1OPXA 2HF6A 3PYPA 3EEAA 5DF9A 2W27A 5DFYA 4H6JB 2M1CA 3UE6A 2W3DA 4PKYA 5AVEA 3BJNA 5HWTA 3E4QA 3H82B 2BASA 3GECA 1MKMA 4IUHA 4CLCE 2G7UA 5HDCA 4JGQA 4HH3A 2K2NA 1GSVA 4DN0A 2JN7A 3KSHA 2VZWA 4WELA 4CLCD 2L0WA 3R4KA 3TJZC 1OTIA 3LR5A 4I39A 4R6LA 4HHDA 1JNUA 2A24A 4II7A 4HIAA 3T4SA 1P9WA 1S4RA 4Q0JA 2O9CA 4Q0HA 4GJ4A 3OCNA 1DP8A 4R38A 2ZMVA 2ZMFA 3S7QA 4JGOA 5J3WA 3FG8A 4IHQA 4KQOA 4NXGA 4B9OA 4LRXC 2ZBBA 5HSQA 3S7OA 3LIBA 3C30A 4MN6A 2PHYA 4PKYG 3LIDA 3LIFA 3F1NB 4Y5FA 3LUQA 4M4XA 2JHEA 4ZRRA 1N9OA 2Y79A 3CI6A 4NXFA 1S4SA 2PT7A 4PAUA 2O9AA 2JKTM 1YAXA 2IA2A 3H9WA 3UB7A 4UEYA 2DMWA 3E4PA 4HP4A 3LFVA 4H6JA 3T4OA 4KUOA 2VLGA 3T50A 1W63M 3IS2A 3EGXC 4WUJA 3VV4A 2CMNA 3BY8A 4EUVA 3A0RA 4EXOA 2K7SA 1S66L 2P08A 4JGPA 4GCZA 3C8CA 1OJ5A 2O9BA 2VGLM 4WL9A 3BQ8A 3D72A 1S1ZA 3PBOA 3CAXA 3IBRA 4LPZA 4P6ZM 4ETXA 2PD7A 3P7NA 1F98A 2VEAA 5TBMB 2W3EA 2H28A 3LR3A 2P04A 2YKHA 5G4ZA 5FL3A 3EEHA 3PBTA 5F69A 3T4JA 4FSFA 3K3DA 2VV8A 4HP9A 2QKPA 2JKTI 4O01A 4O8GA 4GHIB 1G6OA 4YNRA 3LR4A 1XJ3A 3CLOA 4L9EA 4NEED 4P6ZS 3EQUA 4EETB 1OJGA 3TE8A 3CUEC 1KOUA 3LIEA 2XA7S 4UQIS 5DKLA 1NWZA 4Y3IA 4CLCC 3K2NA 3UB6A 3R7WA 3S7NA 1W63Q 1UWNX 1N9NA 3MQ0A 1BYWA 2HJ9C 2PD8A 4JGRA 4WF0A 2GX5A 2W0NA 4GLQA 2OAQ1 3H7WA 4HNBA 2EA9A 3OCLA 3A0VA 4WLAA 3UMDA 2JKRM 5C5KA 3H7WB 2XA7M 3C38A 2W1TA 4BBUA 4ETZA 3E0YA 1F5MA 1S67L 3CUEA 2EWVA 3PBSA 4YOFA 3F1NA 2EWWA 1MZUA 3E98A 5G4YA 3RH8B 1TD5A 1XJ4A 4B93A 2OWHA 4FOFA 3W2ZA 5KSHA 3OOVA 2V0WA 3F1OB 3KO6A 1MC0A 4DJ3A 3KSIA 4L9GA 4EW7A 4OOLA 3F1OA 2W3GA 2HV1A 2O99A 3B42A 3TRCA 3EWKA 1ODVA 4NKPA 2J80A 1H3QA 1F9IA 3BY9A 3PHYA 3MQQA 4Q0IA 4BWIA 4LLOB 4I38A 4XT2A 4ARZB 3NOPC 5L8MA 1OTDA 1TS8A 2PYRA 5DJUA 1NRJA 3C2WA 1YSPA 3MFXA 4IJGA 1LSVA 3G6OA 1XJ6A 1UWPX 1ZTUA 1VB6A 2PDRA 3PBRA 1H8MA 3HCYA 2V0UA 4I3AA 4F3LA 5F5YA 4BMWA 1Y28A 3H82A 4I3IA 3VOLA 2KLIA 4MDZA 2VV6A 3T4QA 5HD5A 4WN5A 5LBRA 2A2LA 4O0PA 3MR0A 1X0OA 1TF1A 1TS0A 3D3OA 1T19A 4YWZA 4G3VA 3LIAA 2YKFA 3O5YA 1OTBA 1GSXA 2XRNA 3MMHA 3IBJA 3JVUA 4HH2A 3PXPA 2W3HA 4L9FA 3K3CA 4I3JA 5AJGA 5HDDA 2ZOIA 3PBNA 3U2AA 4MN7A 2P7JA 4F3LB 4HJ4A 1GSWA 2W3FA 1YSQA 3KYZA 5IT5A 4K08A 4DMZA 1IFQA 2XROA 3EGDC 3PBQA 3BW6A 5IS1A 4BBVA 1LSWA 3F1PB 3HJIA 1NLZA 2Y8HA 3MJQA 4DJ2A 3FPWA 1P0ZA 5HWVA 2HGVA 3FPVA 4L0LA 4UQIM 2LB5A 2QJ5A 2I9VA 3LICA 4OOMA 4GS9B 4CLCB 1T1BA 3PR6A 3MXQA 2W1TB 3EQVA 3CITA 4LRYC 5TJJA 3EOIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YOF A;  3E98 A;  2ZMF A;  2O0Y A;  1TD5 A;  3S7Q A;  1VHM A;  4FOF A;  3W2Z A;  4CQH A;  3OBF A;  3OOV A;  4RQ9 A;  5I5L A;  3KO6 A;  1MC0 A;  3KSI A;  4LRX C;  5HSQ A;  3S7O A;  3NOU C;  2W3G A;  4G3K A;  2KOI A;  5DFX A;  2O99 A;  3TRC A;  4Y5F A;  2B18 A;  4EU0 A;  4ZRR A;  2Y79 A;  4Q0I A;  4BWI A;  5HL6 A;  3CI6 A;  3ZQ5 A;  4PAU A;  2O9A A;  4LRZ E;  2M7V A;  2OOL A;  2QYB A;  3NOP C;  2IA2 A;  5L8M A;  4ME4 A;  2VKS A;  3LFV A;  3DBA A;  3C2W A;  3NOT C;  5K5B A;  1YSP A;  4IJG A;  4MMN A;  3VV4 A;  3G6O A;  4EUV A;  1ZTU A;  3HCY A;  2O9B A;  5HPF A;  3KSG A;  3IBR A;  4ETX A;  2KLI A;  4GW9 A;  4MDZ A;  1STZ A;  2VEA A;  3S7P A;  4IUK A;  2W3E A;  5LBR A;  4O0P A;  2K31 A;  1TF1 A;  3D3O A;  2VJW A;  3EEA A;  4G3V A;  5DFY A;  2W1R A;  4Z1W A;  2XSS A;  3O5Y A;  4O01 A;  2W3D A;  4O8G A;  2XRN A;  3MMH A;  3BJN A;  3IBJ A;  3NHQ A;  4YNR A;  2LB9 A;  2W3H A;  3CIT A;  4QPR A;  5AJG A;  4MN7 A;  5HPI A;  1MKM A;  4IUH A;  2W3F A;  1YSQ A;  4Y3I A;  3K2N A;  2G7U A;  4R70 A;  3S7N A;  2K2N A;  4DMZ A;  4DN0 A;  2XRO A;  3KSH A;  3MQ0 A;  4G3W A;  3MF0 A;  2GX5 A;  2VZW A;  4GLQ A;  2Y8H A;  4Y2F A;  1YKD A;  3R4K A;  2HGV A;  4R6L A;  2LB5 A;  5C5K A;  4E04 A;  2M7U A;  3RFB A;  4MCW A;  2W1T A;  4Q0J A;  2O9C A;  4Q0H A;  4ETZ A;  2W1T B;  3E0Y A;  3KSF A;  4LRY C;  5TJJ A;  1F5M A; 
#chains in the Genus database with same CATH topology
 1T18 A;  5TBM A;  3KYE A;  1OT6 A;  3OBF A;  4RQ9 A;  4HJ3 A;  2Y2I A;  4KG5 A;  1Z6F A;  1TEM A;  2Y2P A;  3TSG A;  2P9V B;  3QP1 A;  2ZC7 A;  5L09 A;  2ZOH A;  2PR6 A;  4OQG A;  1KGF A;  2NUP C;  5GHY A;  1K38 A;  4U3T A;  1V9Y A;  1FIL A;  2HDQ A;  3NOT C;  4H8R A;  4NXB A;  2WZX A;  3SH7 A;  1PW1 A;  4KZ7 A;  2VV7 A;  2HJE A;  4RA7 A;  2C5W B;  4GW9 A;  4UA6 A;  1N9L A;  1G28 A;  4NXE A;  2VJW A;  4X1L A;  2HP5 A;  2W1R A;  3C5A A;  1TS6 A;  3C7U A;  1D1J A;  1OME A;  1TS7 A;  4KUK A;  5EM0 A;  2LB9 A;  3BQA A;  3V67 A;  1WE4 A;  2Y59 A;  5HPI A;  1IOU A;  4WEK A;  5E2E A;  5FDS A;  1F2K A;  5HAQ A;  1T1A A;  3BLM A;  1KE3 A;  3MF0 A;  2WGW B;  4X68 A;  4X69 A;  3N6I A;  5EEC A;  2OWJ A;  1WA9 A;  4MCW A;  1ALQ A;  2BG1 A;  4KZ6 A;  1E3U A;  3A3E A;  5EVI C;  1MPL A;  1IKI A;  4QD4 A;  3T4T A;  5TR7 A;  3WRT A;  1HLU P;  2RCX A;  3QP4 A;  1NLY A;  2V1B A;  4OP5 A;  3B47 A;  1EWZ A;  2WKQ A;  3O86 A;  3UE1 A;  3MBZ A;  1LSX A;  2B18 A;  2IWB A;  1XXM A;  3MFD A;  3ULF A;  4IVK A;  4LCM A;  3UE3 A;  4EES A;  4QU3 A;  4HI4 A;  1D06 A;  2XGN A;  4HY8 A;  1CK3 A;  4JXV A;  1ZKJ A;  3HVF A;  4UA7 A;  3VP1 A;  4OVD A;  2A24 B;  1YT4 A;  3HLF A;  5EUA A;  1FSY A;  5CGW A;  3RTY A;  4Y0T A;  5CEC A;  2ZQC A;  1K54 C;  3C7V A;  5EVI D;  2GJ3 A;  5BOH A;  5MC7 A;  2QJ7 A;  1OPX A;  3PYP A;  2Y2Q A;  5AVE A;  1FCO A;  3G4P A;  2V1Z A;  3CJM A;  4JLF A;  1E25 A;  3IXG A;  4CLC E;  5HAI A;  2XFT A;  2Z2L B;  4HH3 A;  1GSV A;  4DN0 A;  3LO7 A;  2VZW A;  4WEL A;  1AXB A;  4S2N A;  3TJZ C;  3SS3 A;  4I39 A;  3AGE A;  4A5R A;  4HIA A;  3V3S A;  5HW3 A;  1O7E A;  3MKF A;  2ZL1 A;  4XXR A;  1HD8 A;  5EVE A;  3ZNT A;  3MS6 A;  2E8I A;  3OCN A;  5JYP A;  2ZMV A;  4NET A;  1PZO A;  5J3W A;  5DTS A;  3UE0 A;  1FR6 A;  4B9O A;  3BM6 A;  5F82 A;  1SDE A;  3HUM A;  1JVJ A;  3T1R A;  3UPP A;  2Y79 A;  2RL3 A;  1PW8 A;  3QP5 A;  1U60 A;  4NXF A;  1ES5 A;  4FH4 A;  4PM7 A;  3UB7 A;  1PYY A;  3E4P A;  5CER A;  2EX6 A;  3LFV A;  4OQH A;  1ACF A;  2AVX A;  3VV4 A;  3OPR A;  1Q2Q A;  4DKI A;  1SHV A;  3A0R A;  4EXO A;  4GCZ A;  2O9B A;  1KVM A;  3CAX A;  4ETX A;  3GTC A;  4X56 A;  3P98 A;  2A3U A;  1BZA A;  5G4Z A;  5FL3 A;  4MBK A;  4FSF A;  3CG5 A;  1W8Q A;  3V50 A;  2QKP A;  1BLP A;  3G30 A;  3W4O A;  1DJC A;  4YNR A;  2WAD A;  4LV0 A;  4KZA A;  3LR4 A;  3T1Q B;  4RYE A;  4NEE D;  4P6Z S;  3EQU A;  4EET B;  3GMW A;  5DKL A;  3VP2 A;  4CLC C;  3UB6 A;  3B3X A;  3R7W A;  1W63 Q;  1UWN X;  2EXB A;  1IKG A;  4WF0 A;  3L7H A;  4OH0 A;  3IF6 B;  3SH8 A;  2EA9 A;  3MSH A;  5C5K A;  1Q2P A;  3O3V A;  4IED A;  3ZG7 B;  2XA7 M;  2G2W A;  1PWD A;  2W1T A;  2I72 A;  3Q82 A;  4JKT A;  1ZC2 A;  2EWW A;  1MZU A;  5G4Y A;  4JBF A;  4KQR A;  2V0W A;  3KO6 A;  4HEF A;  3SZT A;  2OLU A;  4EW7 A;  3NDG A;  5FAO A;  3F1O A;  4DE2 A;  3VOY A;  2O99 A;  5HAR A;  3EWK A;  3BRM A;  1BUL A;  3CZD A;  1F9I A;  3MQQ A;  1RGY A;  2XD5 A;  4LV2 A;  3DTI A;  4I38 A;  5GLD A;  5FQM A;  1KE0 A;  1YLY A;  1TDL A;  5AQB A;  1CQA A;  3C2W A;  2G2U A;  2Y2J A;  1A0K A;  1IYQ A;  4GD6 A;  3PBR A;  1H8M A;  3Q7Z A;  3IXB A;  2Y2N A;  4JXS A;  5E43 A;  5DTT A;  1YLW A;  4LFU A;  4E3N A;  2R9W A;  2VV6 A;  3T4Q A;  5HD5 A;  4WN5 A;  1XA7 A;  2H0Y A;  4EWF A;  1Y54 A;  4GOG A;  1XGI A;  3MR0 A;  2GDN A;  3LIA A;  2YKF A;  1OTB A;  3MMH A;  5HDD A;  1NYM A;  1SCW A;  2ZOI A;  3U2A A;  2QMI A;  3IF6 C;  3PBQ A;  5CTM A;  3SS5 A;  3HJI A;  1W5D A;  1M40 A;  4BL3 A;  4B88 A;  2Y8H A;  3MZF A;  4C6Y A;  2QJ5 A;  4DE0 A;  2I9V A;  3LIC A;  4OOM A;  4CLC B;  3ZDJ A;  4JXW A;  4DE1 A;  3N8L A;  2J9P A;  4X53 A;  2O0Y A;  4S2O A;  3IT9 A;  4CQH A;  2Y2O A;  1EW0 A;  1CI9 A;  4EER A;  3HJK A;  1CEF A;  4HQA A;  4G3K A;  5KIZ A;  1P97 A;  5GLC A;  4BD0 A;  1LT0 A;  3OC2 A;  1K55 C;  4R4R A;  5HL6 A;  3ZQ5 A;  5CX7 A;  1P9R A;  1XFN A;  4PHT A;  4ME4 A;  3FC7 A;  2ZC4 B;  5KSC A;  2WGW A;  5CGX A;  4B4X A;  3IX3 A;  3M6B A;  3T1X A;  1YLT A;  2X71 A;  2X01 A;  5CHU A;  3OPL A;  2EFU A;  1S1Y A;  3S7P A;  1YPR A;  1PI5 A;  3OPP A;  3E2L A;  4ID4 A;  1RP5 A;  1XJ2 A;  3V39 A;  1OT9 A;  1JWZ A;  3MQO A;  1ONH A;  2WKP A;  3ICY A;  3ZYT A;  3LI9 A;  3IH8 A;  2XSS A;  4EQ1 A;  2KDK A;  4QPR A;  3IWQ A;  2GZA A;  3N8R A;  1FQG A;  4R70 A;  3O88 A;  2FFF B;  3BYD A;  2PAV P;  2CC1 A;  4G3W A;  5U47 A;  1K25 A;  5HDS A;  3Q7V A;  3G35 A;  3Q7V B;  4X6T A;  1AWI A;  3HLB A;  4CLC A;  1K0K A;  3KSF A;  4Y13 A;  3LY3 A;  3UPN A;  4KQD A;  2WKR A;  5I5L A;  1MXO A;  4WZ5 C;  2H5S A;  5DF8 A;  2HDS A;  3R7W B;  3DAV A;  5EFW A;  2GNX A;  2FH5 A;  3ZVT A;  4GDN A;  1XGJ A;  5CHM A;  4KZ8 A;  4LRZ E;  2M7V A;  4E3O A;  2HP9 A;  3GDI A;  4ZAM A;  4EEP A;  1V9Z A;  2BTF P;  4UHU A;  3DBA A;  2P74 A;  3MXS A;  1L3L A;  1RCJ A;  2NUT C;  3BFE A;  4OP8 A;  3D9Y A;  2JBF A;  2XFS A;  2B02 A;  2ZM8 A;  3LGO A;  4Y15 A;  4Q8I A;  2D01 A;  3KSG A;  3SW1 A;  3N4I A;  3CMZ A;  4O7D A;  1H5X A;  3TOI A;  2W27 A;  4PM5 A;  4KZ5 A;  4OPQ A;  2M1C A;  1SKO A;  4PKY A;  3E4Q A;  4IVI A;  1S0W A;  3S22 A;  3BFD A;  4EBL A;  2BLS A;  3WRZ A;  5FAS A;  2UWX A;  4CLC D;  1DJB A;  3LEZ A;  4HHD A;  1JNU A;  2A24 A;  4II7 A;  3T4S A;  1P9W A;  4Q0J A;  4E3J A;  4QB8 A;  4EV4 A;  4CJN A;  3NCK A;  5EOO A;  1ONG A;  3QP6 A;  5EV0 A;  5F83 A;  4GD8 A;  4IHQ A;  1LLB A;  4KZB A;  4LRX C;  2ZBB A;  3LIB A;  1YLZ A;  4PKY G;  3LIF A;  3F1N B;  3QNB A;  4Y5F A;  3LUQ A;  2JHE A;  4ZRR A;  1N9O A;  2Y4A A;  4PAU A;  4MEZ A;  2JKT M;  5HFO A;  3L9K A;  1ZG4 A;  1VM1 A;  3Q81 A;  3BEB A;  1I2W A;  5AQ9 A;  2VLG A;  3ZG0 A;  3IQA A;  3EGX C;  1FOF A;  5KMW A;  2K7S A;  1S66 L;  4MNR A;  1OJ5 A;  2VGL M;  3BQ8 A;  1S1Z A;  4P6Z M;  2WGI A;  2VEA A;  4BQM A;  4JF5 A;  2Y2M A;  1MBL A;  1HVB A;  3LR3 A;  3EEH A;  3PBT A;  2IWD A;  1L0D A;  5FAP A;  1NYY A;  2JKT I;  4N1X A;  2Y2L A;  5FI6 A;  1G6O A;  4GN2 A;  1XJ3 A;  4L9E A;  1OJG A;  3TE8 A;  3CUE C;  2C6W B;  1ES2 A;  2XA7 S;  4MLL A;  3K2N A;  5AQ7 A;  1FCM A;  1K56 A;  1C3B A;  4JGR A;  4OQ0 A;  4GLQ A;  3OCL A;  1CEG A;  2JKR M;  4OLG A;  3FV7 A;  3IF6 A;  1L0F A;  1ZG6 A;  4BBU A;  4R23 A;  3PAG A;  4B93 A;  1BSG A;  2OWH A;  4HBU A;  1K6S A;  1NY0 A;  4ZJ3 A;  2EXA A;  1MC0 A;  3IHA A;  3M6H A;  3HLE A;  1H8Z A;  4OPR A;  5FQ9 A;  2W3G A;  2WGV A;  2HV1 A;  2WKE A;  4KEN B;  1HTZ A;  3UDI A;  1ODV A;  4NKP A;  4BWI A;  3PHY A;  2WAF A;  4MBH A;  1ERM A;  3DW0 A;  3V3R A;  2OSU A;  4XT2 A;  4KZ3 A;  4ARZ B;  2ZM2 A;  3AGF A;  3NOP C;  1OTD A;  1TS8 A;  2HZ5 A;  2PYR A;  5DJU A;  2HDR A;  5EOE A;  4IJG A;  1LSV A;  1G68 A;  2PDR A;  1N4O A;  4F3L A;  5F5Y A;  3H82 A;  3MXR A;  3LY4 A;  3FWL A;  3D4F A;  4N9K A;  1FIK A;  4K0X A;  1BLS A;  4PM8 A;  2JC7 A;  1LL9 A;  1X0O A;  1TS0 A;  5FI7 A;  1PNE A;  2V2F F;  4R3J A;  3QP2 A;  2Y55 A;  1RGZ A;  4OQI A;  4R0Q A;  3IBJ A;  4HH2 A;  2XEP A;  1G6A A;  5AJG A;  4FUW A;  3PBN A;  4MN7 A;  2P7J A;  5A93 A;  4BLM A;  3ZGA B;  1FCN A;  3UPO A;  3A3D A;  4WBG A;  1IFQ A;  3EGD C;  4PM6 A;  5IS1 A;  3A3F A;  1LSW A;  2ZC3 B;  1KVL A;  4B4Z A;  2ZM0 A;  3MJQ A;  3ZG9 B;  3ITB A;  4ZDX A;  5HWV A;  3ZVW A;  3FPV A;  4GNU A;  3NC8 A;  2W1T B;  3CIT A;  4LRY C;  4OPY A;  4PM9 A;  1XKZ A;  3S1Y A;  1VEU A;  4I5S A;  5F68 A;  4FH2 A;  4N1H A;  3LCE A;  3WWX A;  2VGL S;  1K6R A;  3IWO A;  4C3Q A;  5DFX A;  3TW8 A;  5DVA A;  2PR5 A;  3NI9 A;  5IU1 A;  4EU0 A;  4FTX A;  3E2K A;  3HRE A;  4JXG A;  1JTD A;  4S2M A;  2EX9 A;  3BWL A;  2QYB A;  4ARZ A;  1H0M A;  2L1M A;  2JKR I;  4N92 A;  5E2H A;  2QZ6 A;  3GVB A;  4QY6 A;  5DTK A;  3IWI A;  1DRM A;  2J3W A;  2OLV A;  2XLN A;  5EE8 A;  5CED A;  2KX6 A;  3ZG8 B;  1VQQ A;  5HPF A;  1L0G A;  3LR0 A;  4R3A A;  1NZO A;  3FYZ A;  4RX2 A;  5GLB A;  5HWW A;  5J4E A;  3B33 A;  2K31 A;  5F6A A;  1W8Y A;  3P01 A;  2JCH A;  5DKK A;  3DTE A;  3NHQ A;  3ITA A;  1DP6 A;  4HJ6 A;  2MJ6 A;  4AFI A;  4WM9 A;  3VFH A;  1JTG A;  2VA0 A;  5HAP A;  2D02 A;  4WZ4 A;  3WS2 A;  1MWT A;  5DJT A;  4Y2F A;  3DWK A;  4BBT A;  1YKD A;  5FAQ A;  2XD1 A;  1PWC A;  3RFB A;  1BLC A;  3UO9 A;  4LV1 A;  5L10 A;  3F1P A;  1OTE A;  3IXH A;  4KG2 A;  2WKI A;  1VHM A;  3T4K A;  3Q1F A;  1ESU A;  3NOU C;  2KOI A;  4WMC A;  3BFC A;  2DCF A;  4BL2 A;  4GZB A;  5HZH A;  3A0S A;  3UNW A;  2VX8 A;  4EUZ A;  2Z6D A;  3T4L A;  2Y2K A;  2Q9N A;  1GHM A;  2ZJ9 A;  2ZC5 B;  1CI8 A;  2DRW A;  1QME A;  5K5B A;  4MMN A;  2V1A A;  3CPT A;  3GV9 A;  5AVF A;  3OLO A;  5IHV A;  3KYQ A;  2HDU A;  4MN5 A;  1UGU A;  1ZHH B;  3JVV A;  3IX8 A;  1SZV A;  5M19 A;  3ZNY A;  5DF9 A;  4DXC A;  4GDB A;  2H10 A;  1PRQ A;  5EVI A;  1VEU B;  4JF4 A;  2W3D A;  3BJN A;  1GA0 A;  1YLJ A;  2WYX A;  3GR2 A;  2G7U A;  4JGQ A;  2JN7 A;  2A49 A;  4RVA A;  1CF0 A;  1IYO A;  3R4K A;  3WS1 A;  1OTI A;  3VP0 A;  3LR5 A;  4R6L A;  2XQZ A;  3A3J A;  3WS5 A;  1CJF A;  1S6R A;  4OKP A;  4F94 A;  3IX4 A;  3T12 B;  1S4R A;  2O9C A;  4K91 A;  4GJ4 A;  2VGJ A;  2V20 A;  2Q9M A;  5CGS A;  3G2Y A;  3ZHH A;  4DRT A;  3NBL A;  1Z09 A;  1XX2 A;  3GQZ A;  1K4F A;  2WAE A;  4M4X A;  4OLD A;  1I2S A;  3CI6 A;  1S4S A;  2O9A A;  2PBD P;  1YAX A;  2IA2 A;  3H9W A;  2DMW A;  4P0M A;  1VET B;  2P9V A;  5CRF A;  4HP4 A;  4H6J A;  1ESI A;  2J8Y A;  2Y91 A;  1VET A;  4WUJ A;  4E3I A;  4E6W A;  1GCE A;  1L0E A;  4EUV A;  4JGP A;  4KG6 A;  3C8C A;  3CHW P;  4NG2 A;  4WL9 A;  3D72 A;  5FA7 A;  2XR0 A;  1MWR A;  2H28 A;  2V8F A;  2YKH A;  5GL9 A;  4Y0O A;  4JPM A;  4XUZ A;  5F69 A;  4DF6 A;  4IBX A;  3NEC A;  4YFM A;  2VV8 A;  4MBF A;  2R9X A;  3VOZ A;  3ZCZ A;  4GHI B;  5EVI B;  3CLO A;  3BLS A;  1XA1 A;  5HL1 A;  3LIE A;  1NWZ A;  4Y3I A;  4U0T A;  2PBY A;  3S7N A;  1K57 C;  1IEM A;  1KDW A;  5J8X A;  1JWV A;  3NDE A;  3A0V A;  4KZ4 A;  5TFQ A;  3H7W B;  2ZD8 A;  2Z2M B;  3E0Y A;  5AQA A;  5FQJ A;  1F5M A;  3CUE A;  1TD5 A;  4FOF A;  4YIN A;  3W2Z A;  4DDY A;  1SKF A;  4DJ3 A;  3KSI A;  1PWG A;  2HPB A;  1ERQ A;  4L9G A;  1PFL A;  5FEG A;  3O87 A;  2FFY A;  4OOL A;  4E3L A;  5FQK A;  1K4E A;  3B42 A;  4LV3 A;  2ZQA A;  1H3Q A;  3BY9 A;  3GSG A;  4DXB A;  3VP3 A;  2ACG A;  5L8M A;  1ERO A;  2EX8 A;  4Y17 A;  3IHB A;  3HLG A;  1NRJ A;  5L2F A;  4RX3 A;  2QPN A;  3HBR A;  1YSP A;  3MFX A;  4S2I A;  5EM1 A;  4XUX A;  1SKO B;  1XJ6 A;  1ZTU A;  1VB6 A;  4QWO A;  1GA9 A;  2ZMA A;  1K55 A;  4I3A A;  3ISG A;  4BMW A;  3VOL A;  4C75 A;  2KLI A;  3WS0 A;  3W4Q A;  4MDZ A;  1LI0 A;  2XF3 A;  3BEC A;  4O0P A;  3JPU A;  3D3O A;  3VP4 A;  4Y0U A;  2ZLY A;  2WZZ A;  3Q07 A;  2XRN A;  2W3H A;  3K3C A;  5G18 A;  5L07 A;  3T1S A;  4F3L B;  5FSR A;  1LL5 A;  4HJ4 A;  1TDG A;  1YSQ A;  5IT5 A;  2IWC A;  3VSK A;  1IYS A;  1NLZ A;  3FPW A;  1P0Z A;  5FAT A;  2HGV A;  4L0L A;  4UQI M;  2LB5 A;  5JYO A;  4IBR A;  4QY5 A;  1K56 D;  4FCF A;  2ZQ7 A;  4GS9 B;  1T1B A;  3PR6 A;  3MXQ A;  2VKS A;  5TJJ A;  1ES3 A;  1PIO A;  4E3M A;  4KZ9 A;  4OOY A;  4E6X A;  3DWZ A;  4HBT A;  1T1C A;  5E2G A;  3NY4 A;  4GHI A;  3VE4 A;  1LHY A;  3OZH A;  2PU4 A;  2J7V A;  1HZO A;  2R78 A;  2FZ0 A;  4M3K A;  4LEN A;  2H0T A;  3HLD A;  5A92 A;  1Y4O A;  2OOL A;  1NJ4 A;  2QWS A;  4GKU A;  3QP8 A;  3MKE A;  1BUE A;  3UB9 A;  4R1G A;  4ESP A;  3CPT B;  3HL9 A;  5A90 A;  2J3T C;  3KX0 X;  3RXX A;  3ZG5 A;  4BJP A;  5F1G A;  3VE3 A;  5M1A A;  3M2J A;  3HUN A;  3RJU A;  3G34 A;  2Z6C A;  1STZ A;  2QHK A;  4IUK A;  3IS2 B;  2DNS A;  1DY6 A;  4HOI A;  2XDM A;  1QMF A;  3UB8 A;  2V9A A;  3FZC A;  3V5M A;  5J7E A;  1BT5 A;  1LI9 A;  1MWS A;  4Z1W A;  5F1F A;  3FKV A;  3N7W A;  3SOI A;  3M2K A;  5CTN A;  2V8C A;  1TVF A;  3UDX A;  1KGE A;  2ZQ9 A;  2INW A;  3W8K A;  4CPK A;  3G31 A;  3DTK A;  4S2N C;  1D7E A;  1OTA A;  4NK3 A;  4P87 A;  3LEQ A;  4E04 A;  4X25 A;  5KZH A;  2M7U A;  4OON A;  3BFF A;  4GS9 A;  1L2S A;  4P85 A;  5GHX A;  3IH9 A;  1LL8 A;  2XK1 A;  1FSW A;  4XT2 B;  5A8B A;  3IF5 A;  4EEU A;  3NIA A;  1MKI A;  2Y2G A;  1E3U D;  2OAP 1;  3CWF A;  4QHC A;  1N9B A;  5HD3 A;  4DE3 A;  1XFQ A;  4WEJ A;  3VFF A;  2WUQ A;  3SS4 A;  1H8Y A;  2EFX A;  3UME A;  3HLC A;  3E4O A;  4EBP A;  5A91 A;  3LYX A;  1IEL A;  2J3T D;  5FQI A;  1EI5 A;  1YLP A;  4DDS A;  1NZU A;  4UAA A;  4K0W A;  4PPR A;  5FEF A;  4BD1 A;  2JKG A;  3AGD A;  2X02 A;  1DP9 A;  2L4R A;  3DTM A;  3TG9 A;  4N9L A;  3GRJ A;  3HUO A;  2PYP A;  4BEN A;  3NJA A;  3LI8 A;  2HF6 A;  4Y7P A;  3ZFZ A;  3EEA A;  5DFY A;  4H6J B;  3UE6 A;  1MY8 A;  1JWP A;  4PMA A;  4ZJ1 A;  5HWT A;  3UDF A;  3H82 B;  4EQI A;  1ES4 A;  2BAS A;  3UN7 A;  1J3W A;  1J9M A;  3GEC A;  2HP6 A;  1MKM A;  4IUH A;  3G32 A;  5HDC A;  4U0X A;  2JE5 A;  2K2N A;  1KDS A;  3JYI A;  3KSH A;  3UY6 A;  3QNC A;  2UV0 E;  3N8S A;  2L0W A;  4R3B A;  5D3O A;  1YMS A;  1YMX A;  1W79 A;  3OPH A;  1O07 A;  3W4P A;  3VSL A;  4EBN A;  5GHZ A;  4Q0H A;  4E3K A;  5FI2 A;  1PZP A;  2PRF A;  1DP8 A;  2B95 A;  1PI4 A;  4R38 A;  2J9O A;  2ZMF A;  3S7Q A;  4JGO A;  3FG8 A;  4WMC D;  4KQO A;  4NXG A;  5HSQ A;  3S7O A;  1MWU A;  3C30 A;  4MN6 A;  2PHY A;  1W7F A;  4ZBE A;  3LID A;  1K54 A;  5FQQ A;  5CEB A;  4D60 A;  4JF6 A;  3SH9 A;  2ZL1 B;  5EVL A;  2ZC6 B;  4QJG A;  1GHP A;  2PT7 A;  3VMA A;  4UEY A;  1G5U A;  3RXW A;  3T4O A;  2JKF A;  4KUO A;  3T50 A;  1W63 M;  3IS2 A;  2CMN A;  3BY8 A;  4KQQ A;  2P08 A;  4P6B A;  4S2P A;  3C4P A;  3FKW A;  5CHJ A;  2Y2H A;  3IBR A;  3PBO A;  4LPZ A;  2PD7 A;  4X1M A;  5TGF A;  3P7N A;  1F98 A;  4HES A;  3G2Z A;  5TBM B;  2W3E A;  2OV5 A;  2P04 A;  2WK0 A;  1I5Q A;  3NUL A;  3T4J A;  3K3D A;  5M18 A;  4HP9 A;  1BTL A;  1WYC A;  4O01 A;  1XP4 A;  4O8G A;  3MZE A;  1E4D A;  2VK3 A;  5I94 A;  3QHY A;  1KOU A;  4UQI S;  1SDN A;  2ZQ8 A;  1GHI A;  1N9N A;  3MQ0 A;  1BYW A;  2HJ9 C;  2PD8 A;  1YQS A;  3UB5 P;  2GX5 A;  2W0N A;  1DJA A;  2OAQ 1;  3H7W A;  4HNB A;  1WYB A;  4WLA A;  3UMD A;  3S4X A;  3C38 A;  1YM1 A;  3PTE A;  2PU2 A;  4D2O A;  4ETZ A;  1S67 L;  4YOF A;  2EWV A;  3PBS A;  3F1N A;  3E98 A;  5GLA A;  4S2L A;  3RH8 B;  1XJ4 A;  4WYY A;  5KSH A;  2ZQD A;  3OOV A;  2Q0O A;  4Z9Q A;  3F1O B;  3P09 A;  2B5R A;  1NXY A;  5CXW A;  4X55 A;  3MZD A;  3TRC A;  2J80 A;  2EX2 A;  4Q0I A;  3BFG A;  1NRF A;  2E8J A;  4LLO B;  3A3I A;  5HX9 A;  3WS4 A;  2WKH A;  4ZTK A;  2XH9 A;  4FD8 A;  4S2J A;  3HLW A;  5FDH A;  3G6O A;  1UWP X;  3HCY A;  2V0U A;  4LGW A;  1KE4 A;  1Y28 A;  4I3I A;  1XPB A;  1KGG A;  3U4L P;  5DF7 A;  4GB7 A;  5LBR A;  2A2L A;  4R4S A;  1TF1 A;  1T19 A;  4YWZ A;  1FR1 A;  4G3V A;  1M6K A;  3O5Y A;  4WZ5 A;  1GSX A;  3JVU A;  3PXP A;  4L9F A;  4I3J A;  1IYP A;  1GSW A;  2W3F A;  4S2K A;  3KYZ A;  3PAE A;  4K08 A;  5EPH A;  5E2F A;  4DMZ A;  2XRO A;  3BW6 A;  4BBV A;  3F1P B;  4OPZ A;  2VGK A;  4LCL A;  3C4O A;  1BLH A;  4DJ2 A;  3IXD A;  4UA9 A;  1K57 A;  4ZJ2 A;  3I7J A;  3EQV A;  3EOI A; 
#chains in the Genus database with same CATH homology
 1T18 A;  5TBM A;  2O0Y A;  1OT6 A;  4I5S A;  5F68 A;  4CQH A;  3OBF A;  4RQ9 A;  4HJ3 A;  1EW0 A;  4EER A;  1T1C A;  3HJK A;  2VGL S;  4HQA A;  4G3K A;  4GHI A;  3VE4 A;  5DFX A;  3TW8 A;  5KIZ A;  2ZOH A;  2PR5 A;  2PR6 A;  1P97 A;  5IU1 A;  4EU0 A;  1LT0 A;  2R78 A;  3OC2 A;  2NUP C;  2FZ0 A;  5HL6 A;  3ZQ5 A;  5CX7 A;  2OOL A;  3BWL A;  2QYB A;  1P9R A;  4ARZ A;  1XFN A;  1V9Y A;  4ME4 A;  4PHT A;  2L1M A;  3FC7 A;  2QWS A;  2JKR I;  3NOT C;  4NXB A;  1DRM A;  2J3W A;  3UB9 A;  2J3T C;  3KX0 X;  4BJP A;  2KX6 A;  5HPF A;  2VV7 A;  3VE3 A;  2HJE A;  3LR0 A;  4R3A A;  4GW9 A;  1S1Y A;  2Z6C A;  1STZ A;  3S7P A;  5HWW A;  2QHK A;  4IUK A;  5J4E A;  3B33 A;  1N9L A;  3IS2 B;  1G28 A;  4NXE A;  2K31 A;  1XJ2 A;  5F6A A;  1OT9 A;  2VJW A;  3MQO A;  4HOI A;  2WKP A;  2V9A A;  3ICY A;  2W1R A;  3UB8 A;  1TS6 A;  3ZYT A;  5J7E A;  3LI9 A;  3P01 A;  2XSS A;  4Z1W A;  1TS7 A;  4EQ1 A;  2KDK A;  5DKK A;  4KUK A;  3NHQ A;  2LB9 A;  4QPR A;  3BQA A;  1DP6 A;  2GZA A;  3V67 A;  5HPI A;  4HJ6 A;  2MJ6 A;  1IOU A;  4WEK A;  4R70 A;  4AFI A;  2INW A;  2VA0 A;  2D02 A;  4G3W A;  1T1A A;  5HDS A;  3MF0 A;  5DJT A;  1D7E A;  1OTA A;  4Y2F A;  4BBT A;  1YKD A;  4E04 A;  2OWJ A;  2M7U A;  3RFB A;  1WA9 A;  4MCW A;  4GS9 A;  4CLC A;  3F1P A;  3KSF A;  1OTE A;  1LL8 A;  3T4T A;  1VHM A;  4KQD A;  2WKR A;  5I5L A;  4XT2 B;  3T4K A;  5A8B A;  1NLY A;  2V1B A;  4EEU A;  3NOU C;  3B47 A;  2WKQ A;  2KOI A;  2OAP 1;  3CWF A;  3R7W B;  5HD3 A;  1LSX A;  2B18 A;  1XFQ A;  4WEJ A;  5HZH A;  3A0S A;  2VX8 A;  3ULF A;  5EFW A;  3UME A;  2GNX A;  2Z6D A;  2FH5 A;  3UE3 A;  3E4O A;  3T4L A;  4LRZ E;  2M7V A;  4EES A;  4HI4 A;  1D06 A;  3GDI A;  3LYX A;  4HY8 A;  2VKS A;  4EEP A;  1V9Z A;  2J3T D;  3DBA A;  5K5B A;  4MMN A;  2V1A A;  2NUT C;  2A24 B;  5AVF A;  3OLO A;  2B02 A;  3RTY A;  2D01 A;  3KYQ A;  1DP9 A;  2L4R A;  3KSG A;  4MN5 A;  3SW1 A;  2GJ3 A;  5MC7 A;  1UGU A;  1ZHH B;  2QJ7 A;  3JVV A;  2PYP A;  3NJA A;  3LI8 A;  1OPX A;  2HF6 A;  3PYP A;  3EEA A;  5DF9 A;  2W27 A;  5DFY A;  4H6J B;  2M1C A;  3UE6 A;  2W3D A;  4PKY A;  5AVE A;  3BJN A;  5HWT A;  3E4Q A;  3H82 B;  2BAS A;  3GEC A;  1MKM A;  4IUH A;  4CLC E;  2G7U A;  5HDC A;  4JGQ A;  4HH3 A;  2K2N A;  1GSV A;  4DN0 A;  2JN7 A;  3KSH A;  2VZW A;  4WEL A;  4CLC D;  2L0W A;  3R4K A;  3TJZ C;  1OTI A;  3LR5 A;  4I39 A;  4R6L A;  4HHD A;  1JNU A;  2A24 A;  4II7 A;  4HIA A;  3T4S A;  1P9W A;  1S4R A;  4Q0J A;  2O9C A;  4Q0H A;  4GJ4 A;  3OCN A;  1DP8 A;  4R38 A;  2ZMV A;  2ZMF A;  3S7Q A;  4JGO A;  5J3W A;  3FG8 A;  4IHQ A;  4KQO A;  4NXG A;  4B9O A;  4LRX C;  2ZBB A;  5HSQ A;  3S7O A;  3LIB A;  3C30 A;  4MN6 A;  2PHY A;  4PKY G;  3LID A;  3LIF A;  3F1N B;  4Y5F A;  3LUQ A;  4M4X A;  2JHE A;  4ZRR A;  1N9O A;  2Y79 A;  3CI6 A;  4NXF A;  1S4S A;  2PT7 A;  4PAU A;  2O9A A;  2JKT M;  1YAX A;  2IA2 A;  3H9W A;  3UB7 A;  4UEY A;  2DMW A;  3E4P A;  4HP4 A;  3LFV A;  4H6J A;  3T4O A;  4KUO A;  2VLG A;  3T50 A;  1W63 M;  3IS2 A;  3EGX C;  4WUJ A;  3VV4 A;  2CMN A;  3BY8 A;  4EUV A;  3A0R A;  4EXO A;  2K7S A;  1S66 L;  2P08 A;  4JGP A;  4GCZ A;  3C8C A;  1OJ5 A;  2O9B A;  2VGL M;  4WL9 A;  3BQ8 A;  3D72 A;  1S1Z A;  3PBO A;  3CAX A;  3IBR A;  4LPZ A;  4P6Z M;  4ETX A;  2PD7 A;  3P7N A;  1F98 A;  2VEA A;  5TBM B;  2W3E A;  2H28 A;  3LR3 A;  2P04 A;  2YKH A;  5G4Z A;  5FL3 A;  3EEH A;  3PBT A;  5F69 A;  3T4J A;  4FSF A;  3K3D A;  2VV8 A;  4HP9 A;  2QKP A;  2JKT I;  4O01 A;  4O8G A;  4GHI B;  1G6O A;  4YNR A;  3LR4 A;  1XJ3 A;  3CLO A;  4L9E A;  4NEE D;  4P6Z S;  3EQU A;  4EET B;  1OJG A;  3TE8 A;  3CUE C;  1KOU A;  3LIE A;  2XA7 S;  4UQI S;  5DKL A;  1NWZ A;  4Y3I A;  4CLC C;  3K2N A;  3UB6 A;  3R7W A;  3S7N A;  1W63 Q;  1UWN X;  1N9N A;  3MQ0 A;  1BYW A;  2HJ9 C;  2PD8 A;  4JGR A;  4WF0 A;  2GX5 A;  2W0N A;  4GLQ A;  2OAQ 1;  3H7W A;  4HNB A;  2EA9 A;  3OCL A;  3A0V A;  4WLA A;  3UMD A;  2JKR M;  5C5K A;  3H7W B;  2XA7 M;  3C38 A;  2W1T A;  4BBU A;  4ETZ A;  3E0Y A;  1F5M A;  1S67 L;  3CUE A;  2EWV A;  3PBS A;  4YOF A;  3F1N A;  2EWW A;  1MZU A;  3E98 A;  5G4Y A;  3RH8 B;  1TD5 A;  1XJ4 A;  4B93 A;  2OWH A;  4FOF A;  3W2Z A;  5KSH A;  3OOV A;  2V0W A;  3F1O B;  3KO6 A;  1MC0 A;  4DJ3 A;  3KSI A;  4L9G A;  4EW7 A;  4OOL A;  3F1O A;  2W3G A;  2HV1 A;  2O99 A;  3B42 A;  3TRC A;  3EWK A;  1ODV A;  4NKP A;  2J80 A;  1H3Q A;  1F9I A;  3BY9 A;  3PHY A;  3MQQ A;  4Q0I A;  4BWI A;  4LLO B;  4I38 A;  4XT2 A;  4ARZ B;  3NOP C;  5L8M A;  1OTD A;  1TS8 A;  2PYR A;  5DJU A;  1NRJ A;  3C2W A;  1YSP A;  3MFX A;  4IJG A;  1LSV A;  3G6O A;  1XJ6 A;  1UWP X;  1ZTU A;  1VB6 A;  2PDR A;  3PBR A;  1H8M A;  3HCY A;  2V0U A;  4I3A A;  4F3L A;  5F5Y A;  4BMW A;  1Y28 A;  3H82 A;  4I3I A;  3VOL A;  2KLI A;  4MDZ A;  2VV6 A;  3T4Q A;  5HD5 A;  4WN5 A;  5LBR A;  2A2L A;  4O0P A;  3MR0 A;  1X0O A;  1TF1 A;  1TS0 A;  3D3O A;  1T19 A;  4YWZ A;  4G3V A;  3LIA A;  2YKF A;  3O5Y A;  1OTB A;  1GSX A;  2XRN A;  3MMH A;  3IBJ A;  3JVU A;  4HH2 A;  3PXP A;  2W3H A;  4L9F A;  3K3C A;  4I3J A;  5AJG A;  5HDD A;  2ZOI A;  3PBN A;  3U2A A;  4MN7 A;  2P7J A;  4F3L B;  4HJ4 A;  1GSW A;  2W3F A;  1YSQ A;  3KYZ A;  5IT5 A;  4K08 A;  4DMZ A;  1IFQ A;  2XRO A;  3EGD C;  3PBQ A;  3BW6 A;  5IS1 A;  4BBV A;  1LSW A;  3F1P B;  3HJI A;  1NLZ A;  2Y8H A;  3MJQ A;  4DJ2 A;  3FPW A;  1P0Z A;  5HWV A;  2HGV A;  3FPV A;  4L0L A;  4UQI M;  2LB5 A;  2QJ5 A;  2I9V A;  3LIC A;  4OOM A;  4GS9 B;  4CLC B;  1T1B A;  3PR6 A;  3MXQ A;  2W1T B;  3EQV A;  3CIT A;  4LRY C;  5TJJ A;  3EOI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...