3RFBA

Structure of frmsr
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
160
structure length
160
Chain Sequence
SEKQSRYQMLNEELSFLLEGETNVLANLSNASALIKSRFPNTVFAGFYLFDGKELVLGPFQGGVSCIRIALGKGVCGEAAHFQETVIVGDVTTYLNYISCDSLAKSEIVVPMMKNGQLLGVLDLDSSEIEDYDAMDRDYLEQFVAILLEKTTWDFTMFEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Putative uncharacterized protein
publication title Structure of fRMsr
rcsb
source organism Streptococcus pneumoniae
total genus 51
structure length 160
sequence length 160
chains with identical sequence B
ec nomenclature ec 1.8.4.14: L-methionine (R)-S-oxide reductase.
pdb deposition date 2011-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13185 GAF_2 GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3rfbA00
3KSHA 2O0YA 5DFXA 2VJWA 3KSFA 3ZQ5A 3KSIA 4G3VA 4ETXA 4ETZA 4MN7A 3VV4A 3C2WA 2Y8HA 2O9AA 2Y79A 3E98A 5HSQA 5HPIA 4BWIA 4R70A 2W3FA 3EEAA 4FOFA 1YKDA 2K31A 2KLIA 4LRZE 3O5YA 3W2ZA 2IA2A 3HCYA 4IJGA 5AJGA 2O9CA 3K2NA 4RQ9A 2W3HA 2W3GA 1MKMA 2K2NA 4Y3IA 1VHMA 4QPRA 3MQ0A 4Y5FA 1STZA 4YNRA 4G3KA 3CITA 4IUKA 4EUVA 5TJJA 3S7OA 2M7UA 5HPFA 1YSPA 5K5BA 4Q0JA 2ZMFA 2O9BA 3OOVA 2KOIA 4G3WA 4EU0A 2O99A 2VEAA 3IBRA 3IBJA 2W1TB 1YSQA 4IUHA 4YOFA 2W3DA 3OBFA 3S7QA 5LBRA 2LB5A 3KSGA 4O01A 2W1TA 4PAUA 3DBAA 4DN0A 2M7VA 3NHQA 3NOUC 2W1RA 2XROA 2HGVA 3BJNA 4Y2FA 5HL6A 2OOLA 3R4KA 3G6OA 4LRYC 4O8GA 3NOPC 3S7PA 1TF1A 3NOTC 3LFVA 2GX5A 4Q0IA 2W3EA 4LRXC 4MCWA 5DFYA 3KO6A 4ME4A 2B18A 1TD5A 3E0YA 5L8MA 3TRCA 4O0PA 3MF0A 2LB9A 2QYBA 4MDZA 1F5MA 4GLQA 4Q0HA 3S7NA 3CI6A 1ZTUA 4E04A 4R6LA 3D3OA 2XRNA 5C5KA 1MC0A 2XSSA 4CQHA 4MMNA 4GW9A 4Z1WA 4DMZA 2G7UA 5I5LA 4ZRRA 2VKSA 3RFBA 3MMHA 2VZWA
chains in the Genus database with same CATH superfamily
2OWJA 3KSHA 2FFFB 1S0WA 4ETXA 4ETZA 3BFDA 2G2WA 3VV4A 3RXXA 3ZG9B 3LCEA 3UNWA 5GHXA 4FUWA 5F83A 4DKIA 2VX8A 2ZQ9A 3E2KA 3GDIA 1OJGA 3NULA 1TS0A 5DTKA 4IJGA 3A3IA 3K2NA 1IELA 4EXOA 2FFYA 2XFSA 5FI7A 2ZL1A 1XFQA 4WYYA 1P0ZA 4X55A 1ONGA 4HH2A 2IWBA 1W5DA 1DP9A 1TS7A 2JBFA 2RL3A 4MEZA 4MNRA 3PAEA 5TBMB 3C30A 2QMIA 1HD8A 4JF5A 1WA9A 3ZG0A 1Z09A 2V8FA 1MBLA 3O87A 1LHYA 4WMCD 2BG1A 2WGIA 5CERA 3DAVA 3WRTA 1Q2QA 3GR2A 3ZYTA 2XK1A 4HJ6A 5IS1A 4GS9B 3FC7A 1T1CA 3UE0A 4S2KA 2E8IA 2JC7A 3IQAA 3G6OA 3NOTC 3FKVA 2P04A 3ICYA 2BTFP 4PPRA 3MF0A 4CPKA 4JGRA 1NZUA 3ZG8B 1L3LA 2Y2NA 2H0TA 2Y2IA 3L9KA 1JTGA 4E04A 4GHIB 1MC0A 4HBUA 5AQAA 4Q8IA 1G28A 2V0UA 3MZEA 4GB7A 4DJ3A 3HJIA 4LCMA 3F1PB 2QPNA 3GQZA 2ZM2A 1PI4A 2JKRI 1MWRA 3ZQ5A 5F5YA 4GZBA 3S1YA 4GKUA 1ESUA 2PBDP 2O9AA 3IH9A 3VMAA 5KIZA 2IWCA 4OP8A 5HAPA 3F1OB 4X25A 2W3FA 4GD8A 4KG5A 1W63Q 2O9CA 2W3HA 3NECA 4H6JB 1G6AA 3A3EA 5CHJA 3ZHHA 1S6RA 2GNXA 2HDRA 4X6TA 4HH3A 5M1AA 1BLCA 1CEGA 1K25A 2Y4AA 3G2YA 1YSPA 1EI5A 4Q0JA 3H7WA 5AVEA 1DP8A 3IBJA 3UB5P 1S4RA 3KSGA 1JVJA 1Y28A 2XF3A 5CTMA 3DBAA 3SOIA 4DN0A 5CEBA 4LV2A 3NHQA 4KUKA 2YKFA 4DXBA 3OZHA 4WL9A 2V0WA 3QP5A 2OOLA 3SH8A 4LRYC 4DE3A 1D06A 5DFYA 1GSXA 3KO6A 3TE8A 3LR4A 1ACFA 1VETB 5EPHA 5L09A 3T1RA 3R7WA 1PW8A 3Q7ZA 2XRNA 4LFUA 3TG9A 4MMNA 3IS2A 1T1AA 4BENA 1DY6A 4I5SA 3K3DA 1YM1A 3SS4A 3V50A 1H5XA 3H9WA 4OLDA 5HWWA 3BW6A 1PZPA 1X0OA 4MN7A 5CEDA 4BMWA 3T1XA 3GV9A 3LO7A 3EEAA 3G31A 3VP0A 4LPZA 2JCHA 1Y4OA 3GRJA 4E3OA 4QD4A 1HZOA 4EWFA 5DTTA 3PAGA 4OQHA 4EESA 1FOFA 3G30A 1MPLA 5K5BA 2WGVA 1FR1A 1KGGA 3I7JA 4NXGA 1W79A 4U0XA 3Q7VA 4WN5A 2LB5A 2Z6CA 4N92A 4S2NC 4UA9A 2A49A 3MXSA 2G2UA 3HREA 1K4EA 4Y0TA 4DRTA 4EQ1A 2DMWA 1YPRA 1CI8A 1K6RA 4WF0A 1VB6A 3G34A 1GHMA 1I2WA 1VQQA 4XUXA 4R4RA 4PM7A 3ULFA 5L8MA 3T1QB 3TOIA 2XH9A 3FPVA 2WKRA 2DNSA 3OCNA 5TFQA 2L4RA 5C5KA 2XSSA 1H0MA 1PYYA 3BEBA 4Y13A 4KUOA 3HLWA 1PFLA 1IYQA 5AQBA 5I5LA 4I3JA 4EEUA 2WKEA 2J8YA 3V3SA 2Y2GA 4MLLA 5DVAA 4RX3A 3T4JA 3EQUA 3HLFA 4ZJ2A 4S2NA 5A92A 4LV1A 1XA7A 1AXBA 4R70A 3V39A 1Q2PA 4MN6A 3OCLA 3W2ZA 3SH9A 5FQKA 2M1CA 3E4QA 1IYOA 2XA7M 4CLCC 4DE1A 3MKEA 3SZTA 3CUEA 5EVEA 3FV7A 1QMEA 1O7EA 1P9RA 3NI9A 2JHEA 2NUTC 2JKTI 2PR5A 4P87A 4OONA 5CHMA 1FSYA 1A0KA 1LL9A 2DRWA 3C4OA 5EVID 4GDBA 5FSRA 3S7QA 4QB8A 4WZ5C 4E3NA 2ZC5B 4HP9A 5GLAA 2EWVA 5FQJA 5AVFA 2XD5A 1GA9A 3C5AA 4HOIA 3F1NA 3IWOA 4HIAA 2E8JA 4N9LA 4Q0IA 1C3BA 2H10A 1PZOA 2A3UA 3P98A 3VOLA 1N9OA 3TSGA 1K56D 3D3OA 1L2SA 3PHYA 1XJ4A 3VSLA 2J80A 4XT2A 3ZVWA 2VK3A 2OV5A 4WZ4A 4S2IA 4WZ5A 4Y17A 1S1ZA 2V1AA 3WS0A 1ERMA 4JPMA 5HSQA 4BD1A 4WUJA 3IXHA 3DWKA 2K31A 2KLIA 4FD8A 4E6WA 1JWPA 4QHCA 1VEUB 2J9OA 3E4PA 1K55C 1QMFA 1STZA 3LIDA 3C38A 5HAQA 3G35A 1KDWA 5DKKA 2GDNA 5HPFA 4PM8A 5TGFA 3HLCA 3EGDC 4GJ4A 3IF6B 3OC2A 4F94A 1CF0A 3EEHA 1FSWA 2Y2JA 2JKGA 2HDUA 2WGWA 2V20A 4EQIA 1SKOB 2CC1A 4KZBA 2EWWA 3A0VA 3FYZA 4KENB 1IYPA 2Q9NA 4OPRA 3IF5A 4OOLA 3UPPA 1K55A 2QJ5A 3C7VA 4H8RA 3N7WA 2KX6A 2PR6A 3BM6A 4CQHA 1L0EA 3BLSA 4ZTKA 4PM9A 4RX2A 1NY0A 1E3UD 3ZCZA 3VOYA 4ESPA 3N8LA 4XUZA 1S66L 2A24B 3IXGA 1JWVA 2HDSA 2Y91A 4BL3A 1TDLA 2V8CA 1N9BA 2NUPC 4PMAA 3RH8B 4LGWA 3SH7A 3MXQA 4L9GA 1OMEA 2XR0A 4B4ZA 1MKMA 2JKFA 2Z2MB 4JXVA 3JVVA 3G32A 4F3LA 1XGIA 4EBNA 4YFMA 3NCKA 3CITA 3D9YA 4EBLA 5FAQA 1L0DA 5KSHA 5CGSA 4S2PA 5A90A 4OPYA 1BZAA 4X68A 2V2FF 2ZM0A 2BASA 1OJ5A 4Y0UA 3PR6A 5FI6A 3SS3A 4EERA 3FPWA 2YKHA 3NOPC 3MQQA 2Y2OA 5KMWA 4R38A 1DJCA 5FDHA 3TRCA 3OPLA 1L0FA 1LL5A 4WBGA 1F5MA 3CPTB 4LCLA 3PBQA 3MZDA 4ZJ1A 4ZBEA 3S4XA 3ZG5A 1CI9A 4RYEA 3RFBA 3MMHA 5GHZA 4PM6A 3UB7A 1W63M 4HHDA 4MBHA 2VJWA 1K54C 3HBRA 4Y15A 1ZHHB 1DRMA 3UB8A 3BFCA 5EVLA 2H28A 3IXDA 3A0RA 4NK3A 5HDDA 4EETB 1XXMA 1BULA 2EXBA 4GN2A 5E2EA 1D1JA 1H8YA 4ZJ3A 5DF8A 2VGJA 3DTEA 4FH2A 4Y0OA 1SZVA 5EECA 4AFIA 1ES2A 3HUMA 1NZOA 1I2SA 3VFHA 2O99A 5TBMA 2H0YA 3Q07A 5CECA 2W1TB 2W3DA 3OBFA 2ACGA 3QP6A 4O01A 1K54A 4R3BA 4EEPA 4JXGA 5IU1A 4K08A 2W1RA 1ONHA 3CG5A 2BLSA 5HD3A 1KE0A 1SDEA 1TS6A 4KZ5A 4GS9A 3BRMA 4FCFA 4YWZA 4B88A 3U4LP 2WYXA 2L0WA 1PWCA 1S67L 1H8ZA 5M19A 1OTDA 2WAEA 2PYRA 5CXWA 1V9ZA 4IHQA 1KGEA 4YINA 1GSVA 3ITAA 1BUEA 4IBRA 4M3KA 5EUAA 4GHIA 5HL1A 1JTDA 1WYCA 3LYXA 1XX2A 1BT5A 5DFXA 1FCOA 3F1PA 3LY3A 4HNBA 3CJMA 3WS5A 4HP4A 4L9FA 5A93A 2B02A 1K38A 4DXCA 4R3AA 3QNCA 4R4SA 1PW1A 3ZDJA 1NLYA 3F1OA 3A3DA 3V5MA 2WKHA 3RXWA 3ISGA 3MXRA 2W3GA 4CLCD 3BQAA 3LIEA 3BY9A 3PBOA 1YLZA 4H6JA 3CMZA 2PT7A 4YNRA 3LR3A 3PYPA 3QP4A 3CHWP 1KVLA 2XFTA 2QKPA 4BBTA 1S1YA 2PYPA 3MFDA 4DDYA 1FIKA 3IBRA 3T4TA 1UGUA 2Q9MA 2JN7A 1L0GA 4PAUA 3BY8A 3IWIA 4IEDA 5F1FA 2WKIA 1J3WA 2K7SA 2EX2A 4OP5A 1ZC2A 3ZGAB 5L10A 2OLVA 3HUNA 1LT0A 3B47A 3R4KA 1OT6A 2VA0A 4KQOA 4NKPA 4R3JA 4LRXC 4MBFA 4WMCA 5FDSA 4FTXA 3LEZA 3HUOA 2VV6A 3TJZC 5FASA 2OLUA 2LB9A 3S7NA 3AGDA 4C3QA 1VETA 1F2KA 4OQ0A 3W4OA 3ZFZA 3LGOA 5BOHA 3E4OA 3UPOA 2VZWA 2VV7A 4ZAMA 4KZ6A 4NETA 3BYDA 2ZC4B 3KSFA 3CUEC 1YMXA 3KSIA 3MZFA 4OQGA 1XA1A 1MWSA 5D3OA 1CEFA 4N1XA 5HPIA 1U60A 3Q82A 1SKFA 2HP6A 3EGXC 3NBLA 2Y2MA 2IA2A 4KZ7A 4S2MA 1XJ3A 1KE4A 5G4YA 1VHMA 4S2LA 2FZ0A 3DWZA 2ZD8A 4IUKA 5G18A 2XLNA 1IFQA 1KE3A 2ZQAA 5L2FA 3LR0A 1BLHA 4CLCB 3HL9A 1GA0A 3M2KA 4OOMA 4FH4A 5LBRA 1FQGA 3QNBA 1W8QA 1ERQA 1ES5A 4HBTA 1BTLA 3H82B 2VGLM 4WEKA 3NOUC 3ZNTA 5GLDA 2WAFA 3ITBA 4Y2FA 1E4DA 5EM1A 4IVKA 4BBVA 2C6WB 5HWVA 2A2LA 4IBXA 3AGFA 5EE8A 3P09A 3LI8A 2W27A 1TD5A 3M6HA 4JXSA 2INWA 2EX9A 2QYBA 1YMSA 5F68A 4OPZA 2OAP1 4EV4A 4GDNA 3LEQA 3PBSA 2VLGA 1IYSA 4GW9A 2X01A 1HVBA 1EW0A 4WELA 1OTAA 3UDXA 2Y2LA 3Q1FA 2D01A 3SS5A 5A8BA 2Y8HA 3NIAA 1YT4A 5FI2A 1SDNA 3IH8A 1BLPA 2Y2QA 4ARZB 2QWSA 4S2JA 2XEPA 4BWIA 1LLBA 5HDCA 1YKDA 3T4QA 3SW1A 1K0KA 1ESIA 2PD8A 1K4FA 1GHIA 4RA7A 4X56A 4HY8A 4Y5FA 5IHVA 1J9MA 4WM9A 3PBRA 4KQRA 3JYIA 2Y2PA 4K0WA 2ZQ8A 4U0TA 5FQMA 4YOFA 1NRJA 4BQMA 3PXPA 4BJPA 3LI9A 2Y59A 4UHUA 2PHYA 4KQQA 3UN7A 1LI9A 5KSCA 1O07A 4EUZA 3WS1A 1LSXA 1P97A 1EWZA 1KVMA 2P9VB 2EFUA 4K91A 3O88A 4LV3A 2GX5A 5CX7A 3G4PA 4KG2A 4MCWA 4ME4A 3BFEA 3VP3A 3FG8A 3L7HA 1V9YA 4KZ9A 2Z6DA 2EA9A 2Y2KA 1MZUA 5EVIB 1RGZA 1N9NA 4ARZA 3HLEA 3A3FA 2G7UA 1NJ4A 3IF6C 4E3MA 4HJ4A 3UB9A 2HV1A 3GTCA 2ZM8A 4DE0A 4E6XA 4M4XA 4UEYA 1H8MA 1TDGA 1PIOA 3EOIA 3UDFA 3E2LA 2JE5A 4GOGA 3VSKA 3O5YA 1XPBA 3HCYA 2ZL1B 4OLGA 2WKQA 4R0QA 4RQ9A 2WADA 4QPRA 2W0NA 4P6ZS 1VEUA 5HX9A 4LV0A 5HW3A 1GHPA 4UA6A 3KYEA 3P7NA 1HLUP 1YQSA 5GL9A 2O9BA 3W4PA 3LUQA 2VEAA 4I38A 4QY6A 3CLOA 1YSQA 1DJAA 3AGEA 3IF6A 4XXRA 3NY4A 5HD5A 1LSWA 5U47A 4B9OA 1LSVA 3HVFA 1SKOA 5DJTA 2JKRM 4KQDA 5FATA 2Y55A 5FA7A 5F69A 2KDKA 5GLBA 3S7PA 2VGKA 3DTMA 4X69A 3KYQA 1DJBA 5E2HA 3V67A 2ZOHA 1G68A 2DCFA 2PD7A 3CI6A 4KZ4A 4BD0A 3CZDA 2WZZA 1CK3A 1G5UA 1OPXA 5F6AA 2QZ6A 4Z1WA 3LIBA 1CJFA 3N8RA 3WS2A 4ZRRA 2C5WB 3RTYA 2V9AA 1PRQA 1YLPA 3T1SA 1K56A 3CAXA 4JLFA 5DKLA 2VV8A 4Y7PA 3NC8A 1MWUA 3OPRA 2P08A 4N9KA 5A91A 1TEMA 4K0XA 2XQZA 3T12B 5FEFA 2A24A 4FOFA 1FILA 1WYBA 1OTBA 3VE4A 1PWGA 2ZC3B 4QY5A 1OTEA 3A3JA 4LENA 2PRFA 2ZJ9A 4FSFA 2ZOIA 4NXFA 3M2JA 1MWTA 4G3KA 1YLWA 1LL8A 3H7WB 5TJJA 4N1HA 2V1BA 3QHYA 3UMEA 2HP9A 1RP5A 2KOIA 1W7FA 3EWKA 3BFGA 2L1MA 4IUHA 1BSGA 3DTKA 3FZCA 3PBNA 1EROA 4D2OA 4I3IA 3GVBA 2J3TC 2QJ7A 1D7EA 3N8SA 1M40A 3UY6A 2J9PA 3OPHA 1ZG4A 1OTIA 2ZC6B 1UWNX 3QP1A 2RCXA 4UQIS 3MJQA 3B33A 5F1GA 4HESA 5EOEA 4JGOA 3Q81A 4I39A 1GCEA 4HI4A 3R7WB 2XD1A 3WWXA 2B95A 3FWLA 3HJKA 5JYOA 2PDRA 3O3VA 3IS2B 5CGWA 1ZTUA 4EBPA 1XP4A 1ES3A 4X1MA 4MN5A 3CPTA 5E2GA 4B93A 5GHYA 1RCJA 5FQQA 2VKSA 1T19A 3C7UA 4A5RA 5HZHA 3BFFA 3PTEA 4Z9QA 1E25A 3NJAA 2HJ9C 2PBYA 3UO9A 2J3WA 5TR7A 4WLAA 3NDEA 4BL2A 1XKZA 5E43A 5AJGA 1E3UA 4IVIA 1YLJA 1F9IA 2ZBBA 2PAVP 4OQIA 3JVUA 4OVDA 3GECA 5EV0A 3HLDA 5EM0A 4X53A 4P0MA 3P01A 1SCWA 3VP4A 4EUVA 3S7OA 4R1GA 3ZVTA 3MSHA 2P74A 3Q7VB 2HF6A 4JBFA 5L07A 1M6KA 5G4ZA 3W8KA 3EQVA 4JGPA 2P7JA 4JXWA 2H5SA 5FAOA 2W1TA 2D02A 1ZG6A 1IOUA 2QHKA 3IX8A 2ZQ7A 2EFXA 3KX0X 5FL3A 4NEED 1CQAA 2XROA 3O86A 3BJNA 5HL6A 3GSGA 4E3JA 2WK0A 1YLTA 3MR0A 5IT5A 3W4QA 2PU2A 2UWXA 4O0PA 4Q0HA 3U2AA 1IKGA 1ODVA 5GLCA 1ALQA 2OWHA 1YAXA 2HJEA 3K3CA 3UE3A 4II7A 2JKTM 2V1ZA 4R23A 4ZDXA 3PBTA 4JKTA 4G3VA 3UPNA 3OPPA 2Q0OA 4UA7A 5EOOA 4QU3A 5HARA 3VOZA 3C8CA 3IX3A 1IEMA 5HAIA 4GCZA 3VP2A 2I9VA 3GMWA 4ID4A 3V3RA 4Y3IA 3WS4A 5MC7A 3KYZA 4D60A 1G6OA 3IXBA 5CTNA 3RJUA 2EXAA 3N4IA 4OKPA 2I72A 1IKIA 4WEJA 4EW7A 1BLSA 3OOVA 1UWPX 3ZNYA 4U3TA 2ZMVA 2FH5A 4KZ8A 1WE4A 2PU4A 2X71A 4BBUA 2ZLYA 5HWTA 2Y2HA 5DF7A 3F1NB 3M6BA 4E3LA 3UDIA 5CRFA 4CJNA 2ZMAA 1W8YA 2IWDA 3NDGA 4O8GA 1TF1A 1LI0A 4PHTA 3T4KA 4E3IA 1XFNA 4HJ3A 4OH0A 1FR6A 4P6BA 1MY8A 4PKYA 2XDMA 4MDZA 4QWOA 4GLQA 3T4LA 2GJ3A 1FCMA 1NYMA 3D4FA 4XT2B 1NLZA 4JGQA 3QP2A 1XGJA 3VP1A 3IHBA 1TS8A 2O0YA 4S2OA 5EFWA 4NG2A 1JWZA 1N4OA 5HDSA 3HLGA 1T18A 1YLYA 3C2WA 4KZAA 1MKIA 2Y79A 3E98A 4L0LA 3TW8A 5E2FA 5AQ9A 2ZQCA 4GNUA 1NYYA 5FQIA 3BWLA 1NRFA 4B4XA 2X02A 4RVAA 4NXBA 3BECA 3LY4A 4BLMA 4QJGA 5M18A 1KGFA 4PM5A 3MKFA 2M7UA 4P6ZM 4DE2A 1VM1A 2ZMFA 3B3XA 2WGWB 4CLCA 3QP8A 2R78A 2R9XA 3LIAA 2CMNA 3A0SA 5AQ7A 1KDSA 3LICA 5F82A 4KG6A 2HZ5A 1N9LA 2M7VA 4C75A 1JNUA 3S22A 1T1BA 3H82A 4MBKA 3WRZA 1PNEA 3D72A 4DDSA 3T4SA 2J7VA 1Z6FA 1GSWA 1HTZA 3BQ8A 2EX8A 2B5RA 2OSUA 3IWQA 1S4SA 3MBZA 4HEFA 5FQ9A 3UE6A 3VFFA 5J4EA 4GD6A 3LIFA 4R6LA 5DTSA 1MXOA 1PI5A 1I5QA 3G2ZA 3N6IA 4JF6A 3HLBA 3OLOA 4E3KA 1KOUA 2UV0E 4LLOB 4PKYG 5HFOA 5J3WA 2XGNA 5CHUA 2EX6A 2HPBA 3VE3A 3LR5A 4L9EA 2XA7S 4P85A 3FKWA 4LRZE 1DP6A 1OT9A 2VGLS 3T50A 2GZAA 3UB6A 3CWFA 4F3LB 2K2NA 1PWDA 3MQ0A 3UE1A 3MFXA 3MS6A 1FCNA 5KZHA 1XJ2A 4O7DA 2MJ6A 1BYWA 4HQAA 3MQOA 1H3QA 3UMDA 5EVIC 1ZKJA 4JF4A 4G3WA 4EU0A 1K57C 3JPUA 1NXYA 1ES4A 1AWIA 2Z2LB 3IHAA 2HDQA 4OOYA 2J3TD 4UAAA 3ZG7B 2HP5A 1Y54A 2OAQ1 2WKPA 2R9WA 2ZC7A 2HGVA 1XJ6A 3IX4A 4NXEA 1F98A 1TVFA 3B42A 4I3AA 3LFVA 5I94A 2W3EA 5J8XA 3DW0A 2P9VA 5FEGA 2B18A 3E0YA 3BLMA 4CLCE 4UQIM 5DJUA 1K6SA 4OPQA 4KZ3A 3C4PA 5JYPA 3IT9A 2WZXA 2WUQA 4DF6A 1P9WA 3T4OA 5J7EA 1SHVA 1NWZA 5CGXA 2ZQDA 4C6YA 3DTIA 1RGYA 2AVXA 5EVIA 4DMZA 5FAPA 4DJ2A 1K57A 5DF9A 4X1LA
chains in the Genus database with same CATH topology
2OWJA 3KSHA 5HZHA 3KSFA 1S1ZA 3CUEC 3KSIA 2V1AA 4ETXA 4ETZA 3VV4A 3NJAA 2HJ9C 5HSQA 5HPIA 2VX8A 4WUJA 3GDIA 2J3WA 1OJGA 4WLAA 3EGXC 2K31A 1TS0A 2KLIA 2IA2A 4IJGA 5AJGA 3K2NA 1XJ3A 1F9IA 2ZBBA 4EXOA 3JVUA 1XFQA 5G4YA 1VHMA 3E4PA 3GECA 1STZA 2FZ0A 3LIDA 1P0ZA 3C38A 3P01A 4HH2A 1DP9A 1TS7A 4IUKA 4EUVA 5DKKA 1IFQA 3S7OA 5HPFA 5TBMB 3C30A 3LR0A 4CLCB 1WA9A 3EGDC 4GJ4A 2HF6A 5G4ZA 3OC2A 3EEHA 3EQVA 4JGPA 2P7JA 4OOMA 5LBRA 2W1TA 2D02A 1IOUA 2QHKA 3H82B 2VGLM 4WEKA 3NOUC 3ZYTA 4HJ6A 5IS1A 3KX0X 4GS9B 5FL3A 4NEED 2XROA 3FC7A 1T1CA 3BJNA 2EWWA 3A0VA 4Y2FA 5HL6A 4BBVA 3G6OA 3NOTC 5HWVA 2A2LA 3MR0A 5IT5A 2P04A 3LI8A 3ICYA 2W27A 1TD5A 4O0PA 2INWA 3MF0A 4OOLA 4JGRA 2QJ5A 2QYBA 4Q0HA 5F68A 3U2AA 2OAP1 1ODVA 4E04A 2KX6A 2OWHA 3PBSA 2PR6A 4GHIB 1MC0A 4CQHA 1YAXA 2VLGA 4GW9A 2HJEA 3K3CA 1G28A 2V0UA 3UE3A 4DJ3A 3HJIA 4II7A 2JKTM 3F1PB 1EW0A 4WELA 1OTAA 2JKRI 2D01A 3PBTA 5F5YA 3ZQ5A 4G3VA 1S66L 5A8BA 2Y8HA 2O9AA 2A24B 4ARZB 5KIZA 2QWSA 3C8CA 4BWIA 3F1OB 2W3FA 2NUPC 5HDCA 3RH8B 3MXQA 1YKDA 4L9GA 3T4QA 3SW1A 4GCZA 2PD8A 1W63Q 2O9CA 2W3HA 4H6JB 2I9VA 1MKMA 4Y3IA 5MC7A 3KYZA 4HY8A 4Y5FA 2GNXA 3JVVA 4F3LA 1G6OA 4HH3A 3CITA 3PBRA 1YSPA 4WEJA 4EW7A 4Q0JA 5KSHA 3H7WA 3OOVA 1UWPX 5AVEA 1DP8A 3IBJA 2ZMVA 1S4RA 2FH5A 4YOFA 4BBUA 1NRJA 3PXPA 4BJPA 2BASA 3KSGA 3LI9A 1Y28A 1OJ5A 5HWTA 2PHYA 3DBAA 4DN0A 3F1NB 3NHQA 4KUKA 2YKFA 3PR6A 4WL9A 4EERA 3FPWA 1LSXA 1P97A 2V0WA 2YKHA 2OOLA 4LRYC 4O8GA 3NOPC 1TF1A 3T4KA 4PHTA 1D06A 1XFNA 4HJ3A 2GX5A 3MQQA 5CX7A 5DFYA 4MCWA 1GSXA 3KO6A 3TE8A 4ME4A 4R38A 3LR4A 3TRCA 3FG8A 4PKYA 4MDZA 1F5MA 4GLQA 3T4LA 1V9YA 3R7WA 3PBQA 2GJ3A 2EA9A 2Z6DA 1MZUA 2XRNA 4XT2B 4MMNA 3IS2A 1N9NA 1T1AA 4ARZA 1NLZA 4JGQA 4I5SA 2G7UA 3K3DA 3RFBA 3MMHA 1TS8A 2O0YA 5EFWA 3UB7A 1W63M 3H9WA 4HHDA 3BW6A 5HWWA 2VJWA 4HJ4A 3UB9A 5HDSA 1X0OA 4MN7A 1T18A 3C2WA 2HV1A 1ZHHB 1DRMA 4BMWA 4M4XA 4UEYA 2Y79A 3E98A 1H8MA 4L0LA 3TW8A 3UB8A 3EOIA 3EEAA 4LPZA 2H28A 3O5YA 3HCYA 3A0RA 5HDDA 4EETB 2WKQA 4RQ9A 3BWLA 4NXBA 4QPRA 2W0NA 4P6ZS 4EESA 4AFIA 2M7UA 5K5BA 4P6ZM 3P7NA 2ZMFA 2O9BA 2O99A 3LUQA 2VEAA 4I38A 5TBMA 2W1TB 4CLCA 2R78A 3CLOA 3LIAA 4NXGA 1YSQA 2CMNA 2W3DA 3A0SA 3OBFA 4WN5A 2LB5A 3LICA 4O01A 4EEPA 5HD5A 2Z6CA 1LSWA 4B9OA 5IU1A 1N9LA 1LSVA 2M7VA 4K08A 1JNUA 5DJTA 2W1RA 2JKRM 1T1BA 4EQ1A 3H82A 4KQDA 2DMWA 5HD3A 3D72A 5F69A 2KDKA 4WF0A 1TS6A 1VB6A 4GS9A 3T4SA 4YWZA 3S7PA 1GSWA 3BQ8A 3ULFA 2L0WA 1S67L 3KYQA 1S4SA 5L8MA 3UE6A 1OTDA 3V67A 2PYRA 2ZOHA 3FPVA 1V9ZA 4IHQA 2WKRA 3CI6A 2PD7A 5J4EA 3LIFA 4R6LA 3OCNA 1GSVA 2L4RA 5C5KA 1OPXA 2XSSA 5F6AA 4KUOA 3OLOA 4Z1WA 3LIBA 4GHIA 5I5LA 4I3JA 4ZRRA 4EEUA 3RTYA 1KOUA 2V9AA 3LYXA 4LLOB 4PKYG 5J3WA 5DFXA 3F1PA 3CAXA 3T4JA 3EQUA 4HNBA 2VV8A 5DKLA 2P08A 3VE3A 3LR5A 4HP4A 4L9EA 4L9FA 2B02A 2XA7S 4R3AA 4R70A 2A24A 4FOFA 4MN6A 3OCLA 4LRZE 1NLYA 1OTBA 3F1OA 3VE4A 1DP6A 3W2ZA 1OT9A 2VGLS 3T50A 2GZAA 2M1CA 3E4QA 2XA7M 4CLCC 3UB6A 1OTEA 2W3GA 3CWFA 4CLCD 4F3LB 3BQAA 2K2NA 3CUEA 3LIEA 3BY9A 4FSFA 2ZOIA 4NXFA 1P9RA 3MQ0A 3PBOA 4H6JA 2JHEA 3MFXA 1XJ2A 2NUTC 2PT7A 2JKTI 4YNRA 2MJ6A 4G3KA 1BYWA 2PR5A 3LR3A 3PYPA 1LL8A 3H7WB 5TJJA 2QKPA 2V1BA 1S1YA 4BBTA 2PYPA 3MQOA 4HQAA 1H3QA 3UMDA 3UMEA 2KOIA 4G3WA 4EU0A 3EWKA 3IBRA 3T4TA 2L1MA 4IUHA 3PBNA 3S7QA 1UGUA 4I3IA 2J3TC 2QJ7A 1D7EA 2JN7A 4PAUA 4HP9A 3BY8A 2J3TD 2EWVA 5AVFA 2OAQ1 2WKPA 2K7SA 1OTIA 2HGVA 4HOIA 1UWNX 3F1NA 1XJ6A 4NXEA 1LT0A 1F98A 3B47A 3R4KA 4UQIS 3MJQA 1OT6A 3B42A 2VA0A 4HIAA 3B33A 4KQOA 4I3AA 3LFVA 4NKPA 4Q0IA 4JGOA 2W3EA 4LRXC 2B18A 3E0YA 4I39A 4HI4A 4CLCE 2VV6A 4UQIM 3R7WB 5DJUA 3TJZC 3VOLA 1N9OA 2LB9A 3HJKA 3S7NA 2PDRA 3IS2B 1ZTUA 3D3OA 3PHYA 1P9WA 4MN5A 3T4OA 5J7EA 1NWZA 1XJ4A 4B93A 2J80A 4XT2A 4DMZA 4DJ2A 3E4OA 5DF9A 2VKSA 1T19A 2VZWA 2VV7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KSH A;  2O0Y A;  5DFX A;  2VJW A;  3KSF A;  3ZQ5 A;  3KSI A;  4G3V A;  4ETX A;  4ETZ A;  4MN7 A;  3VV4 A;  3C2W A;  2Y8H A;  2O9A A;  2Y79 A;  3E98 A;  5HSQ A;  5HPI A;  4BWI A;  4R70 A;  2W3F A;  3EEA A;  4FOF A;  1YKD A;  2K31 A;  2KLI A;  4LRZ E;  3O5Y A;  3W2Z A;  2IA2 A;  3HCY A;  4IJG A;  5AJG A;  2O9C A;  3K2N A;  4RQ9 A;  2W3H A;  2W3G A;  1MKM A;  2K2N A;  4Y3I A;  1VHM A;  4QPR A;  3MQ0 A;  4Y5F A;  1STZ A;  4YNR A;  4G3K A;  3CIT A;  4IUK A;  4EUV A;  5TJJ A;  3S7O A;  2M7U A;  5HPF A;  1YSP A;  5K5B A;  4Q0J A;  2ZMF A;  2O9B A;  3OOV A;  2KOI A;  4G3W A;  4EU0 A;  2O99 A;  2VEA A;  3IBR A;  3IBJ A;  2W1T B;  1YSQ A;  4IUH A;  4YOF A;  2W3D A;  3OBF A;  3S7Q A;  5LBR A;  2LB5 A;  3KSG A;  4O01 A;  2W1T A;  4PAU A;  3DBA A;  4DN0 A;  2M7V A;  3NHQ A;  3NOU C;  2W1R A;  2XRO A;  2HGV A;  3BJN A;  4Y2F A;  5HL6 A;  2OOL A;  3R4K A;  3G6O A;  4LRY C;  4O8G A;  3NOP C;  3S7P A;  1TF1 A;  3NOT C;  3LFV A;  2GX5 A;  4Q0I A;  2W3E A;  4LRX C;  4MCW A;  5DFY A;  3KO6 A;  4ME4 A;  2B18 A;  1TD5 A;  3E0Y A;  5L8M A;  3TRC A;  4O0P A;  3MF0 A;  2LB9 A;  2QYB A;  4MDZ A;  1F5M A;  4GLQ A;  4Q0H A;  3S7N A;  3CI6 A;  1ZTU A;  4E04 A;  4R6L A;  3D3O A;  2XRN A;  5C5K A;  1MC0 A;  2XSS A;  4CQH A;  4MMN A;  4GW9 A;  4Z1W A;  4DMZ A;  2G7U A;  5I5L A;  4ZRR A;  2VKS A;  3RFB A;  3MMH A;  2VZW A; 
#chains in the Genus database with same CATH topology
 2OWJ A;  3KSH A;  2FFF B;  1S0W A;  4ETX A;  4ETZ A;  3BFD A;  2G2W A;  3VV4 A;  3RXX A;  3ZG9 B;  3LCE A;  3UNW A;  5GHX A;  4FUW A;  5F83 A;  4DKI A;  2VX8 A;  2ZQ9 A;  3E2K A;  3GDI A;  1OJG A;  3NUL A;  1TS0 A;  5DTK A;  4IJG A;  3A3I A;  3K2N A;  1IEL A;  4EXO A;  2FFY A;  2XFS A;  5FI7 A;  2ZL1 A;  1XFQ A;  4WYY A;  1P0Z A;  4X55 A;  1ONG A;  4HH2 A;  2IWB A;  1W5D A;  1DP9 A;  1TS7 A;  2JBF A;  2RL3 A;  4MEZ A;  4MNR A;  3PAE A;  5TBM B;  3C30 A;  2QMI A;  1HD8 A;  4JF5 A;  1WA9 A;  3ZG0 A;  1Z09 A;  2V8F A;  1MBL A;  3O87 A;  1LHY A;  4WMC D;  2BG1 A;  2WGI A;  5CER A;  3DAV A;  3WRT A;  1Q2Q A;  3GR2 A;  3ZYT A;  2XK1 A;  4HJ6 A;  5IS1 A;  4GS9 B;  3FC7 A;  1T1C A;  3UE0 A;  4S2K A;  2E8I A;  2JC7 A;  3IQA A;  3G6O A;  3NOT C;  3FKV A;  2P04 A;  3ICY A;  2BTF P;  4PPR A;  3MF0 A;  4CPK A;  4JGR A;  1NZU A;  3ZG8 B;  1L3L A;  2Y2N A;  2H0T A;  2Y2I A;  3L9K A;  1JTG A;  4E04 A;  4GHI B;  1MC0 A;  4HBU A;  5AQA A;  4Q8I A;  1G28 A;  2V0U A;  3MZE A;  4GB7 A;  4DJ3 A;  3HJI A;  4LCM A;  3F1P B;  2QPN A;  3GQZ A;  2ZM2 A;  1PI4 A;  2JKR I;  1MWR A;  3ZQ5 A;  5F5Y A;  4GZB A;  3S1Y A;  4GKU A;  1ESU A;  2PBD P;  2O9A A;  3IH9 A;  3VMA A;  5KIZ A;  2IWC A;  4OP8 A;  5HAP A;  3F1O B;  4X25 A;  2W3F A;  4GD8 A;  4KG5 A;  1W63 Q;  2O9C A;  2W3H A;  3NEC A;  4H6J B;  1G6A A;  3A3E A;  5CHJ A;  3ZHH A;  1S6R A;  2GNX A;  2HDR A;  4X6T A;  4HH3 A;  5M1A A;  1BLC A;  1CEG A;  1K25 A;  2Y4A A;  3G2Y A;  1YSP A;  1EI5 A;  4Q0J A;  3H7W A;  5AVE A;  1DP8 A;  3IBJ A;  3UB5 P;  1S4R A;  3KSG A;  1JVJ A;  1Y28 A;  2XF3 A;  5CTM A;  3DBA A;  3SOI A;  4DN0 A;  5CEB A;  4LV2 A;  3NHQ A;  4KUK A;  2YKF A;  4DXB A;  3OZH A;  4WL9 A;  2V0W A;  3QP5 A;  2OOL A;  3SH8 A;  4LRY C;  4DE3 A;  1D06 A;  5DFY A;  1GSX A;  3KO6 A;  3TE8 A;  3LR4 A;  1ACF A;  1VET B;  5EPH A;  5L09 A;  3T1R A;  3R7W A;  1PW8 A;  3Q7Z A;  2XRN A;  4LFU A;  3TG9 A;  4MMN A;  3IS2 A;  1T1A A;  4BEN A;  1DY6 A;  4I5S A;  3K3D A;  1YM1 A;  3SS4 A;  3V50 A;  1H5X A;  3H9W A;  4OLD A;  5HWW A;  3BW6 A;  1PZP A;  1X0O A;  4MN7 A;  5CED A;  4BMW A;  3T1X A;  3GV9 A;  3LO7 A;  3EEA A;  3G31 A;  3VP0 A;  4LPZ A;  2JCH A;  1Y4O A;  3GRJ A;  4E3O A;  4QD4 A;  1HZO A;  4EWF A;  5DTT A;  3PAG A;  4OQH A;  4EES A;  1FOF A;  3G30 A;  1MPL A;  5K5B A;  2WGV A;  1FR1 A;  1KGG A;  3I7J A;  4NXG A;  1W79 A;  4U0X A;  3Q7V A;  4WN5 A;  2LB5 A;  2Z6C A;  4N92 A;  4S2N C;  4UA9 A;  2A49 A;  3MXS A;  2G2U A;  3HRE A;  1K4E A;  4Y0T A;  4DRT A;  4EQ1 A;  2DMW A;  1YPR A;  1CI8 A;  1K6R A;  4WF0 A;  1VB6 A;  3G34 A;  1GHM A;  1I2W A;  1VQQ A;  4XUX A;  4R4R A;  4PM7 A;  3ULF A;  5L8M A;  3T1Q B;  3TOI A;  2XH9 A;  3FPV A;  2WKR A;  2DNS A;  3OCN A;  5TFQ A;  2L4R A;  5C5K A;  2XSS A;  1H0M A;  1PYY A;  3BEB A;  4Y13 A;  4KUO A;  3HLW A;  1PFL A;  1IYQ A;  5AQB A;  5I5L A;  4I3J A;  4EEU A;  2WKE A;  2J8Y A;  3V3S A;  2Y2G A;  4MLL A;  5DVA A;  4RX3 A;  3T4J A;  3EQU A;  3HLF A;  4ZJ2 A;  4S2N A;  5A92 A;  4LV1 A;  1XA7 A;  1AXB A;  4R70 A;  3V39 A;  1Q2P A;  4MN6 A;  3OCL A;  3W2Z A;  3SH9 A;  5FQK A;  2M1C A;  3E4Q A;  1IYO A;  2XA7 M;  4CLC C;  4DE1 A;  3MKE A;  3SZT A;  3CUE A;  5EVE A;  3FV7 A;  1QME A;  1O7E A;  1P9R A;  3NI9 A;  2JHE A;  2NUT C;  2JKT I;  2PR5 A;  4P87 A;  4OON A;  5CHM A;  1FSY A;  1A0K A;  1LL9 A;  2DRW A;  3C4O A;  5EVI D;  4GDB A;  5FSR A;  3S7Q A;  4QB8 A;  4WZ5 C;  4E3N A;  2ZC5 B;  4HP9 A;  5GLA A;  2EWV A;  5FQJ A;  5AVF A;  2XD5 A;  1GA9 A;  3C5A A;  4HOI A;  3F1N A;  3IWO A;  4HIA A;  2E8J A;  4N9L A;  4Q0I A;  1C3B A;  2H10 A;  1PZO A;  2A3U A;  3P98 A;  3VOL A;  1N9O A;  3TSG A;  1K56 D;  3D3O A;  1L2S A;  3PHY A;  1XJ4 A;  3VSL A;  2J80 A;  4XT2 A;  3ZVW A;  2VK3 A;  2OV5 A;  4WZ4 A;  4S2I A;  4WZ5 A;  4Y17 A;  1S1Z A;  2V1A A;  3WS0 A;  1ERM A;  4JPM A;  5HSQ A;  4BD1 A;  4WUJ A;  3IXH A;  3DWK A;  2K31 A;  2KLI A;  4FD8 A;  4E6W A;  1JWP A;  4QHC A;  1VEU B;  2J9O A;  3E4P A;  1K55 C;  1QMF A;  1STZ A;  3LID A;  3C38 A;  5HAQ A;  3G35 A;  1KDW A;  5DKK A;  2GDN A;  5HPF A;  4PM8 A;  5TGF A;  3HLC A;  3EGD C;  4GJ4 A;  3IF6 B;  3OC2 A;  4F94 A;  1CF0 A;  3EEH A;  1FSW A;  2Y2J A;  2JKG A;  2HDU A;  2WGW A;  2V20 A;  4EQI A;  1SKO B;  2CC1 A;  4KZB A;  2EWW A;  3A0V A;  3FYZ A;  4KEN B;  1IYP A;  2Q9N A;  4OPR A;  3IF5 A;  4OOL A;  3UPP A;  1K55 A;  2QJ5 A;  3C7V A;  4H8R A;  3N7W A;  2KX6 A;  2PR6 A;  3BM6 A;  4CQH A;  1L0E A;  3BLS A;  4ZTK A;  4PM9 A;  4RX2 A;  1NY0 A;  1E3U D;  3ZCZ A;  3VOY A;  4ESP A;  3N8L A;  4XUZ A;  1S66 L;  2A24 B;  3IXG A;  1JWV A;  2HDS A;  2Y91 A;  4BL3 A;  1TDL A;  2V8C A;  1N9B A;  2NUP C;  4PMA A;  3RH8 B;  4LGW A;  3SH7 A;  3MXQ A;  4L9G A;  1OME A;  2XR0 A;  4B4Z A;  1MKM A;  2JKF A;  2Z2M B;  4JXV A;  3JVV A;  3G32 A;  4F3L A;  1XGI A;  4EBN A;  4YFM A;  3NCK A;  3CIT A;  3D9Y A;  4EBL A;  5FAQ A;  1L0D A;  5KSH A;  5CGS A;  4S2P A;  5A90 A;  4OPY A;  1BZA A;  4X68 A;  2V2F F;  2ZM0 A;  2BAS A;  1OJ5 A;  4Y0U A;  3PR6 A;  5FI6 A;  3SS3 A;  4EER A;  3FPW A;  2YKH A;  3NOP C;  3MQQ A;  2Y2O A;  5KMW A;  4R38 A;  1DJC A;  5FDH A;  3TRC A;  3OPL A;  1L0F A;  1LL5 A;  4WBG A;  1F5M A;  3CPT B;  4LCL A;  3PBQ A;  3MZD A;  4ZJ1 A;  4ZBE A;  3S4X A;  3ZG5 A;  1CI9 A;  4RYE A;  3RFB A;  3MMH A;  5GHZ A;  4PM6 A;  3UB7 A;  1W63 M;  4HHD A;  4MBH A;  2VJW A;  1K54 C;  3HBR A;  4Y15 A;  1ZHH B;  1DRM A;  3UB8 A;  3BFC A;  5EVL A;  2H28 A;  3IXD A;  3A0R A;  4NK3 A;  5HDD A;  4EET B;  1XXM A;  1BUL A;  2EXB A;  4GN2 A;  5E2E A;  1D1J A;  1H8Y A;  4ZJ3 A;  5DF8 A;  2VGJ A;  3DTE A;  4FH2 A;  4Y0O A;  1SZV A;  5EEC A;  4AFI A;  1ES2 A;  3HUM A;  1NZO A;  1I2S A;  3VFH A;  2O99 A;  5TBM A;  2H0Y A;  3Q07 A;  5CEC A;  2W1T B;  2W3D A;  3OBF A;  2ACG A;  3QP6 A;  4O01 A;  1K54 A;  4R3B A;  4EEP A;  4JXG A;  5IU1 A;  4K08 A;  2W1R A;  1ONH A;  3CG5 A;  2BLS A;  5HD3 A;  1KE0 A;  1SDE A;  1TS6 A;  4KZ5 A;  4GS9 A;  3BRM A;  4FCF A;  4YWZ A;  4B88 A;  3U4L P;  2WYX A;  2L0W A;  1PWC A;  1S67 L;  1H8Z A;  5M19 A;  1OTD A;  2WAE A;  2PYR A;  5CXW A;  1V9Z A;  4IHQ A;  1KGE A;  4YIN A;  1GSV A;  3ITA A;  1BUE A;  4IBR A;  4M3K A;  5EUA A;  4GHI A;  5HL1 A;  1JTD A;  1WYC A;  3LYX A;  1XX2 A;  1BT5 A;  5DFX A;  1FCO A;  3F1P A;  3LY3 A;  4HNB A;  3CJM A;  3WS5 A;  4HP4 A;  4L9F A;  5A93 A;  2B02 A;  1K38 A;  4DXC A;  4R3A A;  3QNC A;  4R4S A;  1PW1 A;  3ZDJ A;  1NLY A;  3F1O A;  3A3D A;  3V5M A;  2WKH A;  3RXW A;  3ISG A;  3MXR A;  2W3G A;  4CLC D;  3BQA A;  3LIE A;  3BY9 A;  3PBO A;  1YLZ A;  4H6J A;  3CMZ A;  2PT7 A;  4YNR A;  3LR3 A;  3PYP A;  3QP4 A;  3CHW P;  1KVL A;  2XFT A;  2QKP A;  4BBT A;  1S1Y A;  2PYP A;  3MFD A;  4DDY A;  1FIK A;  3IBR A;  3T4T A;  1UGU A;  2Q9M A;  2JN7 A;  1L0G A;  4PAU A;  3BY8 A;  3IWI A;  4IED A;  5F1F A;  2WKI A;  1J3W A;  2K7S A;  2EX2 A;  4OP5 A;  1ZC2 A;  3ZGA B;  5L10 A;  2OLV A;  3HUN A;  1LT0 A;  3B47 A;  3R4K A;  1OT6 A;  2VA0 A;  4KQO A;  4NKP A;  4R3J A;  4LRX C;  4MBF A;  4WMC A;  5FDS A;  4FTX A;  3LEZ A;  3HUO A;  2VV6 A;  3TJZ C;  5FAS A;  2OLU A;  2LB9 A;  3S7N A;  3AGD A;  4C3Q A;  1VET A;  1F2K A;  4OQ0 A;  3W4O A;  3ZFZ A;  3LGO A;  5BOH A;  3E4O A;  3UPO A;  2VZW A;  2VV7 A;  4ZAM A;  4KZ6 A;  4NET A;  3BYD A;  2ZC4 B;  3KSF A;  3CUE C;  1YMX A;  3KSI A;  3MZF A;  4OQG A;  1XA1 A;  1MWS A;  5D3O A;  1CEF A;  4N1X A;  5HPI A;  1U60 A;  3Q82 A;  1SKF A;  2HP6 A;  3EGX C;  3NBL A;  2Y2M A;  2IA2 A;  4KZ7 A;  4S2M A;  1XJ3 A;  1KE4 A;  5G4Y A;  1VHM A;  4S2L A;  2FZ0 A;  3DWZ A;  2ZD8 A;  4IUK A;  5G18 A;  2XLN A;  1IFQ A;  1KE3 A;  2ZQA A;  5L2F A;  3LR0 A;  1BLH A;  4CLC B;  3HL9 A;  1GA0 A;  3M2K A;  4OOM A;  4FH4 A;  5LBR A;  1FQG A;  3QNB A;  1W8Q A;  1ERQ A;  1ES5 A;  4HBT A;  1BTL A;  3H82 B;  2VGL M;  4WEK A;  3NOU C;  3ZNT A;  5GLD A;  2WAF A;  3ITB A;  4Y2F A;  1E4D A;  5EM1 A;  4IVK A;  4BBV A;  2C6W B;  5HWV A;  2A2L A;  4IBX A;  3AGF A;  5EE8 A;  3P09 A;  3LI8 A;  2W27 A;  1TD5 A;  3M6H A;  4JXS A;  2INW A;  2EX9 A;  2QYB A;  1YMS A;  5F68 A;  4OPZ A;  2OAP 1;  4EV4 A;  4GDN A;  3LEQ A;  3PBS A;  2VLG A;  1IYS A;  4GW9 A;  2X01 A;  1HVB A;  1EW0 A;  4WEL A;  1OTA A;  3UDX A;  2Y2L A;  3Q1F A;  2D01 A;  3SS5 A;  5A8B A;  2Y8H A;  3NIA A;  1YT4 A;  5FI2 A;  1SDN A;  3IH8 A;  1BLP A;  2Y2Q A;  4ARZ B;  2QWS A;  4S2J A;  2XEP A;  4BWI A;  1LLB A;  5HDC A;  1YKD A;  3T4Q A;  3SW1 A;  1K0K A;  1ESI A;  2PD8 A;  1K4F A;  1GHI A;  4RA7 A;  4X56 A;  4HY8 A;  4Y5F A;  5IHV A;  1J9M A;  4WM9 A;  3PBR A;  4KQR A;  3JYI A;  2Y2P A;  4K0W A;  2ZQ8 A;  4U0T A;  5FQM A;  4YOF A;  1NRJ A;  4BQM A;  3PXP A;  4BJP A;  3LI9 A;  2Y59 A;  4UHU A;  2PHY A;  4KQQ A;  3UN7 A;  1LI9 A;  5KSC A;  1O07 A;  4EUZ A;  3WS1 A;  1LSX A;  1P97 A;  1EWZ A;  1KVM A;  2P9V B;  2EFU A;  4K91 A;  3O88 A;  4LV3 A;  2GX5 A;  5CX7 A;  3G4P A;  4KG2 A;  4MCW A;  4ME4 A;  3BFE A;  3VP3 A;  3FG8 A;  3L7H A;  1V9Y A;  4KZ9 A;  2Z6D A;  2EA9 A;  2Y2K A;  1MZU A;  5EVI B;  1RGZ A;  1N9N A;  4ARZ A;  3HLE A;  3A3F A;  2G7U A;  1NJ4 A;  3IF6 C;  4E3M A;  4HJ4 A;  3UB9 A;  2HV1 A;  3GTC A;  2ZM8 A;  4DE0 A;  4E6X A;  4M4X A;  4UEY A;  1H8M A;  1TDG A;  1PIO A;  3EOI A;  3UDF A;  3E2L A;  2JE5 A;  4GOG A;  3VSK A;  3O5Y A;  1XPB A;  3HCY A;  2ZL1 B;  4OLG A;  2WKQ A;  4R0Q A;  4RQ9 A;  2WAD A;  4QPR A;  2W0N A;  4P6Z S;  1VEU A;  5HX9 A;  4LV0 A;  5HW3 A;  1GHP A;  4UA6 A;  3KYE A;  3P7N A;  1HLU P;  1YQS A;  5GL9 A;  2O9B A;  3W4P A;  3LUQ A;  2VEA A;  4I38 A;  4QY6 A;  3CLO A;  1YSQ A;  1DJA A;  3AGE A;  3IF6 A;  4XXR A;  3NY4 A;  5HD5 A;  1LSW A;  5U47 A;  4B9O A;  1LSV A;  3HVF A;  1SKO A;  5DJT A;  2JKR M;  4KQD A;  5FAT A;  2Y55 A;  5FA7 A;  5F69 A;  2KDK A;  5GLB A;  3S7P A;  2VGK A;  3DTM A;  4X69 A;  3KYQ A;  1DJB A;  5E2H A;  3V67 A;  2ZOH A;  1G68 A;  2DCF A;  2PD7 A;  3CI6 A;  4KZ4 A;  4BD0 A;  3CZD A;  2WZZ A;  1CK3 A;  1G5U A;  1OPX A;  5F6A A;  2QZ6 A;  4Z1W A;  3LIB A;  1CJF A;  3N8R A;  3WS2 A;  4ZRR A;  2C5W B;  3RTY A;  2V9A A;  1PRQ A;  1YLP A;  3T1S A;  1K56 A;  3CAX A;  4JLF A;  5DKL A;  2VV8 A;  4Y7P A;  3NC8 A;  1MWU A;  3OPR A;  2P08 A;  4N9K A;  5A91 A;  1TEM A;  4K0X A;  2XQZ A;  3T12 B;  5FEF A;  2A24 A;  4FOF A;  1FIL A;  1WYB A;  1OTB A;  3VE4 A;  1PWG A;  2ZC3 B;  4QY5 A;  1OTE A;  3A3J A;  4LEN A;  2PRF A;  2ZJ9 A;  4FSF A;  2ZOI A;  4NXF A;  3M2J A;  1MWT A;  4G3K A;  1YLW A;  1LL8 A;  3H7W B;  5TJJ A;  4N1H A;  2V1B A;  3QHY A;  3UME A;  2HP9 A;  1RP5 A;  2KOI A;  1W7F A;  3EWK A;  3BFG A;  2L1M A;  4IUH A;  1BSG A;  3DTK A;  3FZC A;  3PBN A;  1ERO A;  4D2O A;  4I3I A;  3GVB A;  2J3T C;  2QJ7 A;  1D7E A;  3N8S A;  1M40 A;  3UY6 A;  2J9P A;  3OPH A;  1ZG4 A;  1OTI A;  2ZC6 B;  1UWN X;  3QP1 A;  2RCX A;  4UQI S;  3MJQ A;  3B33 A;  5F1G A;  4HES A;  5EOE A;  4JGO A;  3Q81 A;  4I39 A;  1GCE A;  4HI4 A;  3R7W B;  2XD1 A;  3WWX A;  2B95 A;  3FWL A;  3HJK A;  5JYO A;  2PDR A;  3O3V A;  3IS2 B;  5CGW A;  1ZTU A;  4EBP A;  1XP4 A;  1ES3 A;  4X1M A;  4MN5 A;  3CPT A;  5E2G A;  4B93 A;  5GHY A;  1RCJ A;  5FQQ A;  2VKS A;  1T19 A;  3C7U A;  4A5R A;  5HZH A;  3BFF A;  3PTE A;  4Z9Q A;  1E25 A;  3NJA A;  2HJ9 C;  2PBY A;  3UO9 A;  2J3W A;  5TR7 A;  4WLA A;  3NDE A;  4BL2 A;  1XKZ A;  5E43 A;  5AJG A;  1E3U A;  4IVI A;  1YLJ A;  1F9I A;  2ZBB A;  2PAV P;  4OQI A;  3JVU A;  4OVD A;  3GEC A;  5EV0 A;  3HLD A;  5EM0 A;  4X53 A;  4P0M A;  3P01 A;  1SCW A;  3VP4 A;  4EUV A;  3S7O A;  4R1G A;  3ZVT A;  3MSH A;  2P74 A;  3Q7V B;  2HF6 A;  4JBF A;  5L07 A;  1M6K A;  5G4Z A;  3W8K A;  3EQV A;  4JGP A;  2P7J A;  4JXW A;  2H5S A;  5FAO A;  2W1T A;  2D02 A;  1ZG6 A;  1IOU A;  2QHK A;  3IX8 A;  2ZQ7 A;  2EFX A;  3KX0 X;  5FL3 A;  4NEE D;  1CQA A;  2XRO A;  3O86 A;  3BJN A;  5HL6 A;  3GSG A;  4E3J A;  2WK0 A;  1YLT A;  3MR0 A;  5IT5 A;  3W4Q A;  2PU2 A;  2UWX A;  4O0P A;  4Q0H A;  3U2A A;  1IKG A;  1ODV A;  5GLC A;  1ALQ A;  2OWH A;  1YAX A;  2HJE A;  3K3C A;  3UE3 A;  4II7 A;  2JKT M;  2V1Z A;  4R23 A;  4ZDX A;  3PBT A;  4JKT A;  4G3V A;  3UPN A;  3OPP A;  2Q0O A;  4UA7 A;  5EOO A;  4QU3 A;  5HAR A;  3VOZ A;  3C8C A;  3IX3 A;  1IEM A;  5HAI A;  4GCZ A;  3VP2 A;  2I9V A;  3GMW A;  4ID4 A;  3V3R A;  4Y3I A;  3WS4 A;  5MC7 A;  3KYZ A;  4D60 A;  1G6O A;  3IXB A;  5CTN A;  3RJU A;  2EXA A;  3N4I A;  4OKP A;  2I72 A;  1IKI A;  4WEJ A;  4EW7 A;  1BLS A;  3OOV A;  1UWP X;  3ZNY A;  4U3T A;  2ZMV A;  2FH5 A;  4KZ8 A;  1WE4 A;  2PU4 A;  2X71 A;  4BBU A;  2ZLY A;  5HWT A;  2Y2H A;  5DF7 A;  3F1N B;  3M6B A;  4E3L A;  3UDI A;  5CRF A;  4CJN A;  2ZMA A;  1W8Y A;  2IWD A;  3NDG A;  4O8G A;  1TF1 A;  1LI0 A;  4PHT A;  3T4K A;  4E3I A;  1XFN A;  4HJ3 A;  4OH0 A;  1FR6 A;  4P6B A;  1MY8 A;  4PKY A;  2XDM A;  4MDZ A;  4QWO A;  4GLQ A;  3T4L A;  2GJ3 A;  1FCM A;  1NYM A;  3D4F A;  4XT2 B;  1NLZ A;  4JGQ A;  3QP2 A;  1XGJ A;  3VP1 A;  3IHB A;  1TS8 A;  2O0Y A;  4S2O A;  5EFW A;  4NG2 A;  1JWZ A;  1N4O A;  5HDS A;  3HLG A;  1T18 A;  1YLY A;  3C2W A;  4KZA A;  1MKI A;  2Y79 A;  3E98 A;  4L0L A;  3TW8 A;  5E2F A;  5AQ9 A;  2ZQC A;  4GNU A;  1NYY A;  5FQI A;  3BWL A;  1NRF A;  4B4X A;  2X02 A;  4RVA A;  4NXB A;  3BEC A;  3LY4 A;  4BLM A;  4QJG A;  5M18 A;  1KGF A;  4PM5 A;  3MKF A;  2M7U A;  4P6Z M;  4DE2 A;  1VM1 A;  2ZMF A;  3B3X A;  2WGW B;  4CLC A;  3QP8 A;  2R78 A;  2R9X A;  3LIA A;  2CMN A;  3A0S A;  5AQ7 A;  1KDS A;  3LIC A;  5F82 A;  4KG6 A;  2HZ5 A;  1N9L A;  2M7V A;  4C75 A;  1JNU A;  3S22 A;  1T1B A;  3H82 A;  4MBK A;  3WRZ A;  1PNE A;  3D72 A;  4DDS A;  3T4S A;  2J7V A;  1Z6F A;  1GSW A;  1HTZ A;  3BQ8 A;  2EX8 A;  2B5R A;  2OSU A;  3IWQ A;  1S4S A;  3MBZ A;  4HEF A;  5FQ9 A;  3UE6 A;  3VFF A;  5J4E A;  4GD6 A;  3LIF A;  4R6L A;  5DTS A;  1MXO A;  1PI5 A;  1I5Q A;  3G2Z A;  3N6I A;  4JF6 A;  3HLB A;  3OLO A;  4E3K A;  1KOU A;  2UV0 E;  4LLO B;  4PKY G;  5HFO A;  5J3W A;  2XGN A;  5CHU A;  2EX6 A;  2HPB A;  3VE3 A;  3LR5 A;  4L9E A;  2XA7 S;  4P85 A;  3FKW A;  4LRZ E;  1DP6 A;  1OT9 A;  2VGL S;  3T50 A;  2GZA A;  3UB6 A;  3CWF A;  4F3L B;  2K2N A;  1PWD A;  3MQ0 A;  3UE1 A;  3MFX A;  3MS6 A;  1FCN A;  5KZH A;  1XJ2 A;  4O7D A;  2MJ6 A;  1BYW A;  4HQA A;  3MQO A;  1H3Q A;  3UMD A;  5EVI C;  1ZKJ A;  4JF4 A;  4G3W A;  4EU0 A;  1K57 C;  3JPU A;  1NXY A;  1ES4 A;  1AWI A;  2Z2L B;  3IHA A;  2HDQ A;  4OOY A;  2J3T D;  4UAA A;  3ZG7 B;  2HP5 A;  1Y54 A;  2OAQ 1;  2WKP A;  2R9W A;  2ZC7 A;  2HGV A;  1XJ6 A;  3IX4 A;  4NXE A;  1F98 A;  1TVF A;  3B42 A;  4I3A A;  3LFV A;  5I94 A;  2W3E A;  5J8X A;  3DW0 A;  2P9V A;  5FEG A;  2B18 A;  3E0Y A;  3BLM A;  4CLC E;  4UQI M;  5DJU A;  1K6S A;  4OPQ A;  4KZ3 A;  3C4P A;  5JYP A;  3IT9 A;  2WZX A;  2WUQ A;  4DF6 A;  1P9W A;  3T4O A;  5J7E A;  1SHV A;  1NWZ A;  5CGX A;  2ZQD A;  4C6Y A;  3DTI A;  1RGY A;  2AVX A;  5EVI A;  4DMZ A;  5FAP A;  4DJ2 A;  1K57 A;  5DF9 A;  4X1L A; 
#chains in the Genus database with same CATH homology
 2OWJ A;  3KSH A;  5HZH A;  3KSF A;  1S1Z A;  3CUE C;  3KSI A;  2V1A A;  4ETX A;  4ETZ A;  3VV4 A;  3NJA A;  2HJ9 C;  5HSQ A;  5HPI A;  2VX8 A;  4WUJ A;  3GDI A;  2J3W A;  1OJG A;  4WLA A;  3EGX C;  2K31 A;  1TS0 A;  2KLI A;  2IA2 A;  4IJG A;  5AJG A;  3K2N A;  1XJ3 A;  1F9I A;  2ZBB A;  4EXO A;  3JVU A;  1XFQ A;  5G4Y A;  1VHM A;  3E4P A;  3GEC A;  1STZ A;  2FZ0 A;  3LID A;  1P0Z A;  3C38 A;  3P01 A;  4HH2 A;  1DP9 A;  1TS7 A;  4IUK A;  4EUV A;  5DKK A;  1IFQ A;  3S7O A;  5HPF A;  5TBM B;  3C30 A;  3LR0 A;  4CLC B;  1WA9 A;  3EGD C;  4GJ4 A;  2HF6 A;  5G4Z A;  3OC2 A;  3EEH A;  3EQV A;  4JGP A;  2P7J A;  4OOM A;  5LBR A;  2W1T A;  2D02 A;  1IOU A;  2QHK A;  3H82 B;  2VGL M;  4WEK A;  3NOU C;  3ZYT A;  4HJ6 A;  5IS1 A;  3KX0 X;  4GS9 B;  5FL3 A;  4NEE D;  2XRO A;  3FC7 A;  1T1C A;  3BJN A;  2EWW A;  3A0V A;  4Y2F A;  5HL6 A;  4BBV A;  3G6O A;  3NOT C;  5HWV A;  2A2L A;  3MR0 A;  5IT5 A;  2P04 A;  3LI8 A;  3ICY A;  2W27 A;  1TD5 A;  4O0P A;  2INW A;  3MF0 A;  4OOL A;  4JGR A;  2QJ5 A;  2QYB A;  4Q0H A;  5F68 A;  3U2A A;  2OAP 1;  1ODV A;  4E04 A;  2KX6 A;  2OWH A;  3PBS A;  2PR6 A;  4GHI B;  1MC0 A;  4CQH A;  1YAX A;  2VLG A;  4GW9 A;  2HJE A;  3K3C A;  1G28 A;  2V0U A;  3UE3 A;  4DJ3 A;  3HJI A;  4II7 A;  2JKT M;  3F1P B;  1EW0 A;  4WEL A;  1OTA A;  2JKR I;  2D01 A;  3PBT A;  5F5Y A;  3ZQ5 A;  4G3V A;  1S66 L;  5A8B A;  2Y8H A;  2O9A A;  2A24 B;  4ARZ B;  5KIZ A;  2QWS A;  3C8C A;  4BWI A;  3F1O B;  2W3F A;  2NUP C;  5HDC A;  3RH8 B;  3MXQ A;  1YKD A;  4L9G A;  3T4Q A;  3SW1 A;  4GCZ A;  2PD8 A;  1W63 Q;  2O9C A;  2W3H A;  4H6J B;  2I9V A;  1MKM A;  4Y3I A;  5MC7 A;  3KYZ A;  4HY8 A;  4Y5F A;  2GNX A;  3JVV A;  4F3L A;  1G6O A;  4HH3 A;  3CIT A;  3PBR A;  1YSP A;  4WEJ A;  4EW7 A;  4Q0J A;  5KSH A;  3H7W A;  3OOV A;  1UWP X;  5AVE A;  1DP8 A;  3IBJ A;  2ZMV A;  1S4R A;  2FH5 A;  4YOF A;  4BBU A;  1NRJ A;  3PXP A;  4BJP A;  2BAS A;  3KSG A;  3LI9 A;  1Y28 A;  1OJ5 A;  5HWT A;  2PHY A;  3DBA A;  4DN0 A;  3F1N B;  3NHQ A;  4KUK A;  2YKF A;  3PR6 A;  4WL9 A;  4EER A;  3FPW A;  1LSX A;  1P97 A;  2V0W A;  2YKH A;  2OOL A;  4LRY C;  4O8G A;  3NOP C;  1TF1 A;  3T4K A;  4PHT A;  1D06 A;  1XFN A;  4HJ3 A;  2GX5 A;  3MQQ A;  5CX7 A;  5DFY A;  4MCW A;  1GSX A;  3KO6 A;  3TE8 A;  4ME4 A;  4R38 A;  3LR4 A;  3TRC A;  3FG8 A;  4PKY A;  4MDZ A;  1F5M A;  4GLQ A;  3T4L A;  1V9Y A;  3R7W A;  3PBQ A;  2GJ3 A;  2EA9 A;  2Z6D A;  1MZU A;  2XRN A;  4XT2 B;  4MMN A;  3IS2 A;  1N9N A;  1T1A A;  4ARZ A;  1NLZ A;  4JGQ A;  4I5S A;  2G7U A;  3K3D A;  3RFB A;  3MMH A;  1TS8 A;  2O0Y A;  5EFW A;  3UB7 A;  1W63 M;  3H9W A;  4HHD A;  3BW6 A;  5HWW A;  2VJW A;  4HJ4 A;  3UB9 A;  5HDS A;  1X0O A;  4MN7 A;  1T18 A;  3C2W A;  2HV1 A;  1ZHH B;  1DRM A;  4BMW A;  4M4X A;  4UEY A;  2Y79 A;  3E98 A;  1H8M A;  4L0L A;  3TW8 A;  3UB8 A;  3EOI A;  3EEA A;  4LPZ A;  2H28 A;  3O5Y A;  3HCY A;  3A0R A;  5HDD A;  4EET B;  2WKQ A;  4RQ9 A;  3BWL A;  4NXB A;  4QPR A;  2W0N A;  4P6Z S;  4EES A;  4AFI A;  2M7U A;  5K5B A;  4P6Z M;  3P7N A;  2ZMF A;  2O9B A;  2O99 A;  3LUQ A;  2VEA A;  4I38 A;  5TBM A;  2W1T B;  4CLC A;  2R78 A;  3CLO A;  3LIA A;  4NXG A;  1YSQ A;  2CMN A;  2W3D A;  3A0S A;  3OBF A;  4WN5 A;  2LB5 A;  3LIC A;  4O01 A;  4EEP A;  5HD5 A;  2Z6C A;  1LSW A;  4B9O A;  5IU1 A;  1N9L A;  1LSV A;  2M7V A;  4K08 A;  1JNU A;  5DJT A;  2W1R A;  2JKR M;  1T1B A;  4EQ1 A;  3H82 A;  4KQD A;  2DMW A;  5HD3 A;  3D72 A;  5F69 A;  2KDK A;  4WF0 A;  1TS6 A;  1VB6 A;  4GS9 A;  3T4S A;  4YWZ A;  3S7P A;  1GSW A;  3BQ8 A;  3ULF A;  2L0W A;  1S67 L;  3KYQ A;  1S4S A;  5L8M A;  3UE6 A;  1OTD A;  3V67 A;  2PYR A;  2ZOH A;  3FPV A;  1V9Z A;  4IHQ A;  2WKR A;  3CI6 A;  2PD7 A;  5J4E A;  3LIF A;  4R6L A;  3OCN A;  1GSV A;  2L4R A;  5C5K A;  1OPX A;  2XSS A;  5F6A A;  4KUO A;  3OLO A;  4Z1W A;  3LIB A;  4GHI A;  5I5L A;  4I3J A;  4ZRR A;  4EEU A;  3RTY A;  1KOU A;  2V9A A;  3LYX A;  4LLO B;  4PKY G;  5J3W A;  5DFX A;  3F1P A;  3CAX A;  3T4J A;  3EQU A;  4HNB A;  2VV8 A;  5DKL A;  2P08 A;  3VE3 A;  3LR5 A;  4HP4 A;  4L9E A;  4L9F A;  2B02 A;  2XA7 S;  4R3A A;  4R70 A;  2A24 A;  4FOF A;  4MN6 A;  3OCL A;  4LRZ E;  1NLY A;  1OTB A;  3F1O A;  3VE4 A;  1DP6 A;  3W2Z A;  1OT9 A;  2VGL S;  3T50 A;  2GZA A;  2M1C A;  3E4Q A;  2XA7 M;  4CLC C;  3UB6 A;  1OTE A;  2W3G A;  3CWF A;  4CLC D;  4F3L B;  3BQA A;  2K2N A;  3CUE A;  3LIE A;  3BY9 A;  4FSF A;  2ZOI A;  4NXF A;  1P9R A;  3MQ0 A;  3PBO A;  4H6J A;  2JHE A;  3MFX A;  1XJ2 A;  2NUT C;  2PT7 A;  2JKT I;  4YNR A;  2MJ6 A;  4G3K A;  1BYW A;  2PR5 A;  3LR3 A;  3PYP A;  1LL8 A;  3H7W B;  5TJJ A;  2QKP A;  2V1B A;  1S1Y A;  4BBT A;  2PYP A;  3MQO A;  4HQA A;  1H3Q A;  3UMD A;  3UME A;  2KOI A;  4G3W A;  4EU0 A;  3EWK A;  3IBR A;  3T4T A;  2L1M A;  4IUH A;  3PBN A;  3S7Q A;  1UGU A;  4I3I A;  2J3T C;  2QJ7 A;  1D7E A;  2JN7 A;  4PAU A;  4HP9 A;  3BY8 A;  2J3T D;  2EWV A;  5AVF A;  2OAQ 1;  2WKP A;  2K7S A;  1OTI A;  2HGV A;  4HOI A;  1UWN X;  3F1N A;  1XJ6 A;  4NXE A;  1LT0 A;  1F98 A;  3B47 A;  3R4K A;  4UQI S;  3MJQ A;  1OT6 A;  3B42 A;  2VA0 A;  4HIA A;  3B33 A;  4KQO A;  4I3A A;  3LFV A;  4NKP A;  4Q0I A;  4JGO A;  2W3E A;  4LRX C;  2B18 A;  3E0Y A;  4I39 A;  4HI4 A;  4CLC E;  2VV6 A;  4UQI M;  3R7W B;  5DJU A;  3TJZ C;  3VOL A;  1N9O A;  2LB9 A;  3HJK A;  3S7N A;  2PDR A;  3IS2 B;  1ZTU A;  3D3O A;  3PHY A;  1P9W A;  4MN5 A;  3T4O A;  5J7E A;  1NWZ A;  1XJ4 A;  4B93 A;  2J80 A;  4XT2 A;  4DMZ A;  4DJ2 A;  3E4O A;  5DF9 A;  2VKS A;  1T19 A;  2VZW A;  2VV7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...