2W3FA

Reduced structure of the first gaf domain of mycobacterium tuberculosis doss
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
148
structure length
148
Chain Sequence
b'GAMDPDLEATLRAIVHSATSLVDARYGAMEVHDRQHRVLHFVYEGIDEETVRRIGHLPKGLGVIGLLIEDPKPLRLDDVSAHPASIGFPPYHPPMRTFLGVPVRVRDESFGTLYLTDKTNGQPFSDDDEVLVQALAAAAGIAVANARL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TWO COMPONENT SENSOR HISTIDINE KINASE DEVS (GAF FAMILY PROTE
molecule tags Transferase
source organism Mycobacterium tuberculosis
publication title Structural Insight Into the Heme-Based Redox Sensing by Doss from Mycobacterium Tuberculosis.
pubmed doi rcsb
total genus 40
structure length 148
sequence length 148
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2008-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01590 GAF GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2w3fA00
4O8GA 2XSSA 4PAUA 2HGVA 4BWIA 5HPIA 1F5MA 2LB5A 4IUHA 2QYBA 2VZWA 2W1RA 2W1TA 2Y79A 2VKSA 2W3EA 4R6LA 4Z1WA 2VEAA 3O5YA 2K2NA 3RFBA 2O9CA 4YNRA 3NOTC 3HCYA 5HPFA 4GW9A 3OOVA 1MC0A 3DBAA 2XROA 4MDZA 3IBJA 4Y5FA 4Q0HA 5DFYA 5L8MA 4Q0JA 3KSIA 1STZA 3KSFA 5HL6A 2W3FA 2M7VA 2Y8HA 2ZMFA 2W3GA 3VV4A 4E04A 4Y2FA 3CI6A 3MF0A 4DMZA 3K2NA 2OOLA 4ETZA 3OBFA 2W3DA 2LB9A 4O0PA 3NOPC 2G7UA 1YKDA 4CQHA 4ME4A 4G3KA 4EU0A 2KLIA 2IA2A 3C2WA 3EEAA 2VJWA 3KO6A 3LFVA 2GX5A 4LRYC 4FOFA 3KSHA 4MN7A 3ZQ5A 3E98A 1YSQA 3G6OA 1TF1A 4IUKA 5I5LA 4DN0A 3S7OA 4MCWA 2W1TB 2XRNA 2B18A 3D3OA 3E0YA 4YOFA 4R70A 4QPRA 4G3WA 3S7NA 3IBRA 1YSPA 3W2ZA 4EUVA 2O99A 2O0YA 5DFXA 3R4KA 2O9AA 3S7QA 3TRCA 5C5KA 4G3VA 4IJGA 2W3HA 4GLQA 2KOIA 1VHMA 3S7PA 1MKMA 4MMNA 4LRXC 4Q0IA 4ZRRA 4ETXA 5TJJA 2M7UA 1TD5A 3MMHA 5K5BA 2K31A 1ZTUA 3KSGA 3NHQA 4LRZE 5AJGA 3NOUC 3MQ0A 2O9BA 4RQ9A 4Y3IA 5LBRA 4O01A 3CITA 5HSQA 3BJNA
chains in the Genus database with same CATH superfamily
1J3WA 3ZG8B 3O86A 5EVID 1XJ6A 3IXHA 1DP6A 1P9WA 2ZC5B 1IYOA 4B93A 2W3EA 5EUAA 1ZKJA 4KZ7A 1O7EA 1BUEA 3ZNYA 3JVUA 2VX8A 1D06A 2M1CA 4FD8A 1OPXA 4EWFA 4EEUA 4Y5FA 4BBVA 4S2PA 2EX6A 3ZG0A 3DWZA 1QMFA 4FH2A 3FWLA 4S2MA 4RA7A 2ZMFA 4JF4A 2ZQCA 1JNUA 2ZM2A 1W5DA 2HP6A 1SKFA 3IHAA 1KGGA 1LT0A 1XGIA 4P0MA 4BD1A 3LCEA 3SOIA 3FPVA 3H82B 3MFDA 5TR7A 2ZL1A 2FH5A 4B88A 4QHCA 1LSVA 3PBOA 1DY6A 2O9AA 1ONGA 2VV6A 2WKIA 1UGUA 3IXGA 3P98A 3T4SA 2V9AA 1MKMA 5L10A 4U0XA 4JXWA 2PYPA 3MMHA 4OPZA 1ZTUA 3QP6A 2XFTA 5E2HA 4B4XA 4WMCA 3G2YA 3OLOA 2OAP1 1YMXA 2QHKA 4OQIA 3GMWA 1YQSA 1PWDA 4O8GA 2QWSA 4IEDA 1T18A 4CLCD 2PRFA 4ZAMA 2J8YA 2W1RA 2V0UA 4R6LA 4Z1WA 1PI4A 3FZCA 4JGOA 1GHIA 5FI2A 4HH3A 4JBFA 2JKRI 4R3BA 3JVVA 2BASA 2M7VA 1Q2PA 4QD4A 4C3QA 4KZ4A 4R38A 4WL9A 4HHDA 4EEPA 3D9YA 5FQKA 1XFNA 5HAIA 2LB9A 2V1ZA 3CUEC 3HREA 2J3WA 5A93A 3EEAA 2Y2OA 2K7SA 3AGDA 4EERA 4YFMA 2J80A 3IWQA 3MZFA 2JCHA 3E0YA 2A24B 1F98A 5EV0A 4X55A 3UB5P 1BLHA 4OVDA 2XD5A 4ZBEA 3TRCA 3T4QA 3UB9A 4GLQA 3LYXA 3HL9A 4HQAA 2PBDP 1PWCA 3E4PA 5DKLA 4PPRA 2B02A 5CTMA 3ZGAB 2OAQ1 3BFFA 3QP5A 5DTSA 3MQ0A 5M19A 1V9YA 2XD1A 2P04A 1S4RA 1E25A 3LIDA 1YMSA 5HPIA 4XUZA 4EETB 2BTFP 1BSGA 2Z2MB 4WZ5C 5CHMA 4FH4A 4ZDXA 1CQAA 1U60A 3UPNA 1I5QA 4EQIA 3IBJA 3NIAA 4HP9A 5F5YA 3ULFA 2A24A 3VP3A 5HL6A 3LEZA 2EFXA 1K38A 1ES2A 2J9OA 2XEPA 1YLYA 3EOIA 3SH9A 4ETZA 1JWVA 2QPNA 4R4SA 3IH9A 1K55A 5FQJA 3E4OA 5HDDA 3FV7A 4PM8A 2OSUA 1OT6A 3BFCA 4KZ8A 2EX9A 4X69A 3SH7A 4GS9B 3ZQ5A 3E98A 1TF1A 4IUKA 3ITAA 4CLCC 3IT9A 1YLTA 1T1AA 3S7NA 2BLSA 1DP8A 5AQ9A 2O99A 1H8MA 1KVMA 4HY8A 1VEUA 1L3LA 2Y2KA 3PYPA 5C5KA 4IJGA 4HBTA 3QP2A 1VETA 2KOIA 4MBHA 5HAPA 4OOLA 5EECA 1L0EA 1MWTA 4Q8IA 1XA7A 2JHEA 1RP5A 4LLOB 3NI9A 2HJ9C 2O9BA 4I3IA 3BLMA 2WKQA 3WRTA 4UA7A 4KG5A 2A49A 2IWCA 4NXGA 2ZC4B 4WELA 4HESA 4KZ9A 3VSLA 4JPMA 4PMAA 1IKGA 3IF6A 5FQIA 3UB7A 1F2KA 1W79A 2AVXA 1MC0A 4WYYA 1KOUA 2XROA 4UQIM 3QNCA 3LR0A 1K57C 3PXPA 4KUKA 1TS8A 1TEMA 1GHPA 2JBFA 3HVFA 4R23A 1MZUA 1SCWA 4NXBA 3WS4A 1HD8A 2ZD8A 4E3IA 4DE2A 3MF0A 3FG8A 3OBFA 4KENB 4L9EA 2KX6A 4HP4A 2IA2A 4Y0OA 3KO6A 2VJWA 3IS2A 1K0KA 2W27A 4R1GA 4II7A 3BLSA 3A0RA 5IU1A 5CERA 3CAXA 3IF5A 2GNXA 4MBFA 4N1HA 1IYPA 5CEDA 3N8LA 3ZVTA 2RL3A 4OH0A 1XP4A 3F1NB 4R4RA 4JF6A 2HP9A 5GHZA 4X68A 4DDSA 5CGXA 5FDHA 4JXGA 1JTDA 3HJKA 2M7UA 3KSGA 3NOUC 4S2IA 4DKIA 4WF0A 2B95A 3GECA 4QU3A 3CWFA 4OP8A 4GZBA 1PFLA 3UMDA 4EESA 2LB5A 1M6KA 1TDLA 1N4OA 1EWZA 4X1MA 4M4XA 3UE6A 2WKRA 4S2LA 5E43A 1XA1A 4IHQA 1KE3A 1TDGA 3OCLA 4IVKA 4Q0HA 1C3BA 5FDSA 1I2WA 5D3OA 3CJMA 2VV8A 2Y8HA 5CX7A 5L07A 2VV7A 4LPZA 2WGWB 2R9XA 1HZOA 1CEGA 1CEFA 5F1GA 3MFXA 3V39A 2OWJA 2OOLA 1GA0A 3TSGA 5EVIC 4HBUA 5DJUA 3NY4A 4HJ3A 1G6AA 3UB8A 2HDSA 4WEKA 4IBRA 4RYEA 3PBSA 3PTEA 2KLIA 3M2JA 2Y91A 3HUOA 5F6AA 1KGEA 3G6OA 4GKUA 4S2NA 1BLSA 1FCNA 1IKIA 2ZQ8A 2B18A 4DJ3A 5CXWA 4EV4A 4YOFA 3G4PA 2E8IA 4NG2A 5G18A 2HDUA 2WKEA 1NLYA 1MXOA 2ZBBA 4HJ4A 3OPHA 3ZG5A 4BL2A 3ZG7B 3NULA 1N9BA 3GVBA 3S7PA 1L0GA 5GHXA 4WM9A 4LRXC 2WZZA 1PNEA 4L0LA 2GZAA 5GL9A 1BLPA 4Y3IA 3EGXC 3Q07A 4KQDA 3H82A 1FIKA 1E3UD 3SS5A 2XSSA 2I72A 5HW3A 1F5MA 1BYWA 3SS4A 1YLJA 1XFQA 2VEAA 3BEBA 4MN6A 3UDXA 1RCJA 1N9LA 3G30A 3NOTC 2VLGA 3NBLA 3VP1A 5AVFA 2IWDA 3O3VA 2Q9NA 2JKTM 1DP9A 1MBLA 1VM1A 5DKKA 4CJNA 5HFOA 3CI6A 4NK3A 4HEFA 5EVEA 1VETB 3C7VA 2WAFA 1ZC2A 4PM6A 2HPBA 5J8XA 4BBTA 1K55C 4X1LA 4WLAA 4YWZA 5KSHA 4E3OA 4BL3A 3C2WA 3KYQA 2XK1A 3O87A 3EEHA 3VSKA 4IBXA 2VGKA 3V67A 3ZVWA 5FAOA 1J9MA 1YSQA 3LY4A 1RGYA 3ICYA 2ZC3B 2WZXA 4KQQA 4BLMA 3MZDA 4KZ3A 4HH2A 5HD3A 5TBMB 2WGVA 5F82A 1CK3A 1YLPA 3BY8A 2DRWA 1ODVA 3W2ZA 1ACFA 4BMWA 3UO9A 3RTYA 4LV2A 3GTCA 3PBRA 4I3JA 1W8YA 3A3EA 1K6SA 2WAEA 5GLCA 2JKFA 4MMNA 3QP1A 4Q0IA 2ZM0A 3H9WA 4EQ1A 2Y2MA 4ARZA 3F1OA 1WYCA 2ZOHA 5LBRA 2XLNA 2ZQ9A 3IQAA 4R0QA 2Z6CA 3VP2A 2YKFA 3K3CA 5J3WA 5GLAA 5EOOA 4P6BA 4Z9QA 3EWKA 2JKGA 3RFBA 1S1YA 1KDSA 2MJ6A 1P0ZA 2J3TD 3W4OA 4KG6A 3A3DA 3RXWA 1ESUA 1LL9A 3Q81A 5DFYA 1Y54A 3AGEA 5L8MA 4Q0JA 1IELA 5HX9A 4XT2A 1SZVA 1GHMA 1LI9A 1TS6A 3EGDC 5KZHA 3NJAA 3Q7VB 2PD8A 2P9VB 1AXBA 3NOPC 1WYBA 3UE1A 1Y28A 5DF8A 4CQHA 1IFQA 4EU0A 2ZJ9A 3LI9A 3PHYA 1ZG4A 3V3RA 2GX5A 1HVBA 1P97A 2XGNA 5IT5A 3MXQA 4X53A 2A2LA 3O88A 4B4ZA 2A3UA 2Y2LA 4LFUA 5I5LA 5EOEA 4MCWA 1KGFA 1YLZA 1XJ4A 1OT9A 3DWKA 3HLWA 4OP5A 3MKEA 1K4FA 4FCFA 3S7QA 3OZHA 5E2EA 1LLBA 3F1NA 1XKZA 1SHVA 5FEGA 1T19A 4LRZE 3HJIA 5KMWA 4MEZA 2H0YA 4OQ0A 4O01A 3D72A 3BJNA 4UA6A 2JE5A 5CRFA 4PAUA 2V20A 3VOZA 5EPHA 4KQRA 2Y79A 2EX8A 3ZG9B 2WK0A 3UMEA 2KDKA 2Y59A 2X01A 3LR4A 5A92A 3ZCZA 1TS7A 4PKYG 3UE0A 4E3LA 3ITBA 1NRFA 2HDRA 5HAQA 2Y2NA 3WS0A 4F94A 1VQQA 3T1RA 2Y2IA 4F3LB 1KVLA 1XX2A 3G34A 5TFQA 5HWTA 2C5WB 1PYYA 4OLGA 3LFVA 4IVIA 4K91A 2VGLM 1SKOB 3A3FA 1YT4A 3PAEA 2NUTC 2P74A 3I7JA 5FI7A 3CLOA 4GHIA 4JGPA 5G4ZA 4EUVA 3CHWP 1BZAA 4FTXA 1CJFA 5J4EA 4LGWA 3OCNA 1FQGA 2X71A 3UDIA 4ZJ3A 4ESPA 1S67L 1ERQA 2PDRA 1DJCA 3VFHA 1IYQA 4OLDA 1FOFA 3BWLA 1AWIA 2OV5A 3MS6A 5AJGA 1MWUA 3VE4A 1OJ5A 2H28A 3D4FA 2OWHA 4EBNA 1ONHA 2HGVA 4F3LA 3GSGA 4I5SA 3LICA 2VKSA 3VOYA 1FSYA 4DE0A 5CECA 3SS3A 4Y15A 3T4LA 4GW9A 1NY0A 3M6BA 1Z6FA 1I2SA 1MWRA 1W8QA 2HZ5A 2OLUA 1ES5A 2L4RA 4HNBA 1VEUB 3W4PA 3A0SA 4WZ4A 4JKTA 1S0WA 5HWWA 1Q2QA 1V9ZA 3GR2A 4RX3A 5EM1A 3A0VA 3DW0A 1D7EA 2PU2A 4PKYA 3IX4A 5MC7A 3T4TA 3KSHA 4Y13A 3IX3A 3C38A 3PAGA 2FFFB 4R70A 5A8BA 1BULA 3PBTA 1IOUA 2O0YA 5DFXA 1NZUA 1PW1A 3PBQA 4G3VA 1XJ2A 4N9LA 5DF9A 1BLCA 1JVJA 5HL1A 3IX8A 5EM0A 1CI9A 3BQ8A 2H5SA 4ZRRA 1NRJA 2R9WA 2P9VA 2JKRM 2QKPA 2HDQA 3ZFZA 1N9OA 1XGJA 3MZEA 3Q7VA 3RH8B 5FATA 2YKHA 1G68A 3N8RA 3BW6A 3VOLA 4P6ZM 4X6TA 4ARZB 3RJUA 5HD5A 1OTIA 2P08A 2QYBA 4DF6A 4D60A 1K56D 4XXRA 1LL5A 2K2NA 4DE3A 4C75A 3MQQA 4GDNA 1Z09A 1ES3A 4JGQA 4P87A 1FR1A 1DJAA 2V8FA 4PM5A 1H5XA 3KSIA 1GA9A 3SZTA 3LIBA 1GSXA 2XF3A 4P85A 4YINA 4FUWA 3LR5A 3T1QB 4EUZA 2W3DA 4OPQA 3GDIA 1Y4OA 4QJGA 4OPRA 2ZQDA 1IYSA 3ZHHA 2WYXA 4O7DA 4PM9A 3V3SA 5E2FA 3FPWA 3N6IA 4EBPA 4DJ2A 4RX2A 1MPLA 5G4YA 3IBRA 1PZOA 4LV0A 3T50A 3HLCA 4CPKA 3BM6A 4L9FA 3N4IA 2HV1A 3BFEA 4JF5A 1PIOA 2W3HA 3IXDA 4LCLA 3UN7A 4CLCA 4U3TA 2ZMVA 3B3XA 2H10A 3LI8A 5TJJA 4MN5A 4A5RA 2ZQAA 4GJ4A 2XH9A 1G5UA 1HTZA 3T1SA 2I9VA 3L9KA 1OTEA 4E6XA 4BD0A 2PR6A 3LEQA 3EQVA 3ZDJA 3WWXA 1HLUP 4HOIA 2FZ0A 4MNRA 5TGFA 1FR6A 1KE4A 4JGRA 3SW1A 1ESIA 1K57A 4P6ZS 5HZHA 3CPTB 4GDBA 5DVAA 2JN7A 5CHJA 5CTNA 1NWZA 4D2OA 3Q1FA 3OOVA 4CLCE 4GN2A 1GSWA 4UA9A 1LL8A 3N7WA 5FSRA 4ZJ1A 3BY9A 3T1XA 1YM1A 1OMEA 2Q0OA 2EFUA 3G35A 3K3DA 2V0WA 2WUQA 2CC1A 3IHBA 2Y55A 3VV4A 1ERMA 3C5AA 3HUNA 1JWPA 3UNWA 3E2LA 3LIEA 1S1ZA 5L2FA 3IWOA 3Q82A 3TW8A 1SDNA 1K56A 4K08A 3C4PA 1W7FA 2EA9A 2L0WA 3B47A 3DTKA 3VMAA 4UAAA 3HLDA 4Y0TA 3MKFA 4MN7A 2EXBA 2WADA 3L7HA 2EX2A 2OLVA 3P01A 2G2UA 2QZ6A 1SKOA 3T4KA 1NZOA 3ZNTA 1BT5A 3IF6C 4NKPA 3FKWA 3DTEA 4N1XA 3JYIA 1H8YA 1MY8A 3A3IA 4ETXA 1WE4A 3AGFA 3MR0A 2NUPC 4LV1A 2PHYA 5FASA 2WKHA 2XA7S 4KG2A 3IWIA 3LY3A 3WS1A 4EW7A 4NETA 2JC7A 2VZWA 4X25A 3T12B 4BQMA 2EXAA 2PYRA 4Y7PA 2XA7M 3PBNA 3H7WA 5HPFA 1K6RA 2P7JA 1LHYA 1PW8A 3HBRA 3DBAA 4MDZA 2R78A 2XQZA 4H6JB 1EI5A 3S4XA 2Z6DA 4UEYA 1CI8A 2GDNA 4GD6A 1STZA 4GNUA 2ZQ7A 3RXXA 1YLWA 4E04A 1KDWA 1K54A 2Q9MA 1XJ3A 2WKPA 3F1PB 1NJ4A 1YPRA 3HLGA 3GV9A 3CPTA 3PR6A 3F1PA 3SH8A 1GCEA 1TS0A 3C8CA 5HDSA 4N9KA 3NCKA 2VA0A 2PT7A 1E3UA 3BFGA 3S7OA 3R7WA 2W1TB 3D3OA 3LUQA 4QPRA 5FAPA 3MSHA 3WRZA 1K4EA 4G3WA 4LV3A 4E3MA 1YSPA 3NDEA 2Y2PA 1ZG6A 1T1BA 3G32A 4CLCB 4S2JA 1E4DA 3BRMA 4BJPA 4H8RA 2Y2QA 1NYYA 4QY5A 4S2KA 1S6RA 2K31A 4HI4A 2V2FF 5CGWA 1MKIA 5F68A 5FEFA 2PU4A 4RQ9A 5HSQA 1DJBA 3WS5A 1G28A 3UE3A 2VGJA 2B5RA 3P7NA 3IH8A 3TG9A 4WN5A 5EVIB 4BWIA 4WEJA 1NLZA 4R3JA 5FA7A 5CEBA 5A90A 3FKVA 2DNSA 1H8ZA 4C6YA 2Y2HA 4JXVA 3V5MA 5KIZA 5EFWA 2PAVP 3BFDA 1KE0A 2G2WA 4OOYA 5KSCA 2UV0E 3LIFA 3KSFA 3C7UA 2RCXA 2ZLYA 1D1JA 1FSWA 4I38A 5I94A 1PI5A 1OTAA 3OPPA 4BBUA 4X56A 2CMNA 3UB6A 2PR5A 4PHTA 1RGZA 4DDYA 1YKDA 1X0OA 4JXSA 1NXYA 1DRMA 3QP4A 2ACGA 5A91A 1ES4A 4FOFA 2W0NA 1QMEA 4DXBA 1TVFA 4XT2B 4E3JA 3NC8A 2D02A 2GJ3A 3UPOA 3P09A 5F1FA 5AVEA 1PRQA 2WGIA 4HJ6A 3UPPA 3MQOA 1W63M 1LSXA 1GSVA 2XDMA 2J3TC 4WUJA 2QJ7A 4OOMA 1F9IA 1IEMA 4NXEA 3N8SA 4OONA 5F83A 1L2SA 3HLBA 2XR0A 1N9NA 3E2KA 4EBLA 2VGLS 4N92A 1A0KA 4IUHA 3ISGA 3QP8A 3TE8A 5AQAA 5HWVA 2O9CA 2X02A 1EW0A 5GHYA 4I39A 3B42A 4S2OA 4XUXA 3MBZA 1JWZA 2HP5A 3VFFA 4MLLA 2W3FA 3CZDA 3DTIA 1FCOA 4GB7A 1H0MA 5J7EA 4DE1A 5EVIA 4OPYA 4UQIS 2J7VA 5IS1A 1MWSA 4KUOA 1LI0A 2G7UA 4ME4A 3F1OB 5IHVA 4E6WA 4ZTKA 4KZ5A 1XPBA 2INWA 5FQ9A 2FFYA 5FL3A 4GOGA 3FC7A 3CG5A 4Y17A 3OPRA 4LENA 1OTBA 3T4OA 4S2NC 1NYMA 2XRNA 4KZAA 3S1YA 3VE3A 2Y2JA 2ZMAA 5DTTA 4WMCD 3NECA 5DTKA 1K25A 3M6HA 3R4KA 2VK3A 1T1CA 4I3AA 3TJZC 5JYOA 4MBKA 3NHQA 3W8KA 5AQBA 5HDCA 3C4OA 3LIAA 3BECA 1UWNX 4M3KA 3CITA 4WBGA 4GD8A 2C6WB 3QNBA 5FQQA 5DF7A 3LGOA 3FYZA 1O07A 2D01A 4Y0UA 3HLFA 4E3NA 2EWWA 4DRTA 3O5YA 2Z2LB 2ZC7A 2QMIA 3A3JA 3DAVA 4KZ6A 1M40A 3JPUA 1FILA 5GLDA 2UWXA 4GCZA 3LR3A 3EQUA 3V50A 3U2AA 3KX0X 5TBMA 1P9RA 5DJTA 3S22A 4QWOA 5M1AA 1K54C 4R3AA 4Y2FA 1L0FA 5EVLA 3K2NA 4PM7A 2Y2GA 4QY6A 2QJ5A 3ZYTA 4OKPA 4WZ5A 4OQHA 1S4SA 2BG1A 2V1AA 1PZPA 4DN0A 3E4QA 4UHUA 5JYPA 5CHUA 5CGSA 1G6OA 3OPLA 3HLEA 5F69A 3R7WB 3VP4A 5M18A 2EWVA 1SDEA 2ZL1B 1WA9A 3H7WB 2PD7A 2JKTI 1H3QA 2L1MA 3C30A 1UWPX 1PWGA 3G2ZA 2HF6A 3W4QA 5K5BA 3WS2A 1S66L 1VB6A 2Y4AA 2DCFA 1ZHHB 3M2KA 5AQ7A 1OTDA 3UDFA 3T4JA 4AFIA 2DMWA 3MXRA 4EXOA 3IXBA 2W1TA 3BQAA 1W63Q 5FI6A 3MJQA 3G31A 1ALQA 4YNRA 3IS2B 3KYEA 3HCYA 4HIAA 3KYZA 4OQGA 3GRJA 1XXMA 4FSFA 4NXFA 2V8CA 4ID4A 2WGWA 5FQMA 3MXSA 4KZBA 3BYDA 5BOHA 4H6JA 4B9OA 4DXCA 4LCMA 2H0TA 2J9PA 3Q7ZA 3LO7A 2W3GA 3TOIA 1YAXA 4DMZA 4ZJ2A 1JTGA 3DTMA 2ZC6B 4RVAA 4O0PA 5FAQA 5E2GA 2V1BA 1EROA 4G3KA 4NEED 2ZOIA 3U4LP 3IF6B 3OC2A 2IWBA 3QHYA 4LRYC 1FCMA 4GHIB 4E3KA 4KQOA 5U47A 3UY6A 3CMZA 2XFSA 1OJGA 1L0DA 3HUMA 2HJEA 4GS9A 4QB8A 5L09A 2PBYA 1BTLA 2E8JA 2ZM8A 3B33A 5EE8A 5HARA 4JLFA 1CF0A 1VHMA 3CUEA 1LSWA 3GQZA 4K0XA 3NDGA 3VP0A 4U0TA 1TD5A 4L9GA 4K0WA 4BENA 5GLBA
chains in the Genus database with same CATH topology
1G28A 3UE3A 3CWFA 3P7NA 3UMDA 2HGVA 4WN5A 4BWIA 4F3LA 1XJ6A 4I5SA 3LICA 4WEJA 4EESA 1DP6A 1P9WA 2LB5A 1NLZA 2VKSA 4B93A 4M4XA 2W3EA 3UE6A 2WKRA 3JVUA 2VX8A 3T4LA 4GW9A 1D06A 4IHQA 2M1CA 1OPXA 4EEUA 5KIZA 4Y5FA 3OCLA 5EFWA 4BBVA 4Q0HA 2L4RA 3LIFA 4HNBA 3KSFA 4I38A 2VV8A 2Y8HA 3A0SA 5CX7A 2ZMFA 2VV7A 4LPZA 1OTAA 1JNUA 4BBUA 5HWWA 3MFXA 2CMNA 2OWJA 2OOLA 2PR5A 3UB6A 4PHTA 5DJUA 1V9ZA 3A0VA 4HJ3A 3UB8A 4WEKA 1YKDA 1X0OA 1D7EA 4PKYA 3PBSA 1LT0A 5MC7A 2KLIA 3T4TA 1DRMA 5F6AA 4FOFA 3KSHA 3FPVA 3G6OA 3H82B 2W0NA 3C38A 2B18A 4DJ3A 4YOFA 4R70A 4XT2B 5A8BA 2FH5A 3PBTA 2D02A 2GJ3A 1IOUA 5AVEA 1LSVA 1NLYA 2O0YA 2ZBBA 5DFXA 3PBOA 2O9AA 4HJ4A 4HJ6A 2VV6A 3PBQA 3MQOA 4G3VA 1XJ2A 1W63M 1LSXA 1UGUA 5DF9A 3T4SA 1GSVA 3S7PA 3BQ8A 2V9AA 1MKMA 2J3TC 4WUJA 4LRXC 4ZRRA 1NRJA 2QJ7A 4OOMA 1F9IA 2PYPA 3MMHA 2JKRM 2QKPA 1ZTUA 4L0LA 2GZAA 4NXEA 3OLOA 2OAP1 1N9OA 4Y3IA 3RH8B 3EGXC 2YKHA 2QHKA 4KQDA 3H82A 3BW6A 4O8GA 1N9NA 2QWSA 2XSSA 4P6ZM 2VGLS 3VOLA 1T18A 4ARZB 5HD5A 1OTIA 1F5MA 4CLCD 1BYWA 4IUHA 2P08A 2QYBA 2W1RA 3TE8A 2V0UA 4R6LA 4Z1WA 1XFQA 2VEAA 4MN6A 2K2NA 5HWVA 1N9LA 2O9CA 4JGOA 3NOTC 3MQQA 4JGQA 1EW0A 4HH3A 4I39A 2VLGA 3B42A 2JKRI 3JVVA 5AVFA 3KSIA 2BASA 3LIBA 2JKTM 1GSXA 1DP9A 2W3FA 2M7VA 5DKKA 4R38A 3CI6A 4WL9A 4HHDA 4EEPA 5J7EA 3LR5A 1XFNA 2W3DA 2LB9A 3CUEC 4UQIS 4BBTA 5IS1A 4KUOA 3GDIA 2G7UA 4WLAA 4YWZA 4ME4A 5KSHA 2J3WA 3F1OB 3C2WA 3KYQA 3EEAA 3EEHA 2INWA 2K7SA 4EERA 3V67A 5FL3A 3FC7A 1YSQA 1OTBA 2J80A 3ICYA 3T4OA 2XRNA 3FPWA 3E0YA 3VE3A 4HH2A 5HD3A 4DJ2A 2A24B 5TBMB 1F98A 3BY8A 5G4YA 1ODVA 3IBRA 3W2ZA 3T50A 4BMWA 3R4KA 4L9FA 3RTYA 3TRCA 2HV1A 3PBRA 4I3JA 3T4QA 1T1CA 3UB9A 2W3HA 4GLQA 3LYXA 4I3AA 4HQAA 3TJZC 3E4PA 4CLCA 4MMNA 2ZMVA 5DKLA 4Q0IA 2B02A 3LI8A 5TJJA 2OAQ1 4MN5A 3NHQA 3H9WA 4GJ4A 4EQ1A 5HDCA 4ARZA 3F1OA 3MQ0A 2ZOHA 2I9VA 3LIAA 1V9YA 5LBRA 1OTEA 1UWNX 3CITA 2P04A 2PR6A 1S4RA 3EQVA 4HOIA 2FZ0A 3LIDA 2Z6CA 5HPIA 4JGRA 3SW1A 2YKFA 3K3CA 5J3WA 4EETB 2D01A 5HZHA 4P6ZS 3EWKA 2EWWA 3O5YA 3RFBA 1S1YA 2MJ6A 2JN7A 1P0ZA 2J3TD 1NWZA 3OOVA 4CLCE 1GSWA 3IBJA 1LL8A 4GCZA 3BY9A 3LR3A 3EQUA 4HP9A 5DFYA 5F5YA 5L8MA 3KX0X 4Q0JA 3U2AA 3ULFA 2A24A 5TBMA 4XT2A 5HL6A 3K3DA 1P9RA 1TS6A 5DJTA 2V0WA 3EGDC 3VV4A 4R3AA 4Y2FA 3NJAA 3EOIA 2PD8A 3K2NA 3LIEA 1S1ZA 4ETZA 3TW8A 3NOPC 1Y28A 3E4OA 4CQHA 5HDDA 1IFQA 4EU0A 2QJ5A 4K08A 3ZYTA 3LI9A 2L0WA 2EA9A 3B47A 3PHYA 1OT6A 2GX5A 1P97A 1S4SA 5IT5A 4GS9B 4MN7A 3ZQ5A 3E98A 3MXQA 2A2LA 3P01A 2V1AA 1TF1A 4IUKA 5I5LA 4DN0A 3E4QA 4MCWA 4CLCC 1XJ4A 1T1AA 1OT9A 3S7NA 1G6OA 1DP8A 3T4KA 5F69A 3R7WB 2O99A 1H8MA 2EWVA 4HY8A 3S7QA 4NKPA 1WA9A 3PYPA 3H7WB 5C5KA 4IJGA 2PD7A 2JKTI 1H3QA 2L1MA 3F1NA 2KOIA 3C30A 1UWPX 4OOLA 4ETXA 1T19A 2HF6A 5K5BA 2JHEA 3MR0A 1S66L 4LLOB 4LRZE 2NUPC 1VB6A 2HJ9C 3HJIA 2O9BA 2PHYA 4I3IA 4O01A 3D72A 2XA7S 3BJNA 2WKQA 1ZHHB 4EW7A 1OTDA 4PAUA 3T4JA 4AFIA 2DMWA 4NXGA 4WELA 4EXOA 2VZWA 2W1TA 3BQAA 1W63Q 2Y79A 3MJQA 3UMEA 2PYRA 2XA7M 2KDKA 3PBNA 3IS2B 4YNRA 3H7WA 3HCYA 5HPFA 3UB7A 2P7JA 4HIAA 3KYZA 1MC0A 1KOUA 3DBAA 3LR4A 4FSFA 4MDZA 4NXFA 2R78A 4UQIM 2XROA 1TS7A 4PKYG 4H6JB 3LR0A 2Z6DA 3PXPA 4KUKA 4UEYA 1TS8A 1STZA 4H6JA 4B9OA 1MZUA 4NXBA 2W3GA 4E04A 1YAXA 3MF0A 4DMZA 3FG8A 1XJ3A 2WKPA 3F1PB 3OBFA 4F3LB 4L9EA 2KX6A 4O0PA 5HWTA 2V1BA 4HP4A 3PR6A 4G3KA 4NEED 2ZOIA 2IA2A 3F1PA 3KO6A 2VJWA 3IS2A 3LFVA 2W27A 3OC2A 1TS0A 4II7A 3C8CA 5HDSA 4LRYC 3A0RA 2VGLM 4GHIB 5IU1A 3CAXA 2VA0A 2PT7A 4KQOA 2NUTC 2GNXA 3S7OA 3R7WA 2W1TB 3D3OA 3LUQA 1OJGA 4QPRA 4G3WA 3CLOA 4GHIA 2HJEA 1YSPA 4GS9A 4JGPA 5G4ZA 4EUVA 3F1NB 1T1BA 5J4EA 3OCNA 4CLCB 3B33A 4BJPA 1S67L 1VHMA 3CUEA 1LSWA 2PDRA 3HJKA 2M7UA 1TD5A 4L9GA 2K31A 4HI4A 3BWLA 3KSGA 5AJGA 3NOUC 5F68A 4WF0A 3VE4A 1OJ5A 4RQ9A 2H28A 2OWHA 5HSQA 3GECA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O8G A;  2XSS A;  4PAU A;  2HGV A;  4BWI A;  5HPI A;  1F5M A;  2LB5 A;  4IUH A;  2QYB A;  2VZW A;  2W1R A;  2W1T A;  2Y79 A;  2VKS A;  2W3E A;  4R6L A;  4Z1W A;  2VEA A;  3O5Y A;  2K2N A;  3RFB A;  2O9C A;  4YNR A;  3NOT C;  3HCY A;  5HPF A;  4GW9 A;  3OOV A;  1MC0 A;  3DBA A;  2XRO A;  4MDZ A;  3IBJ A;  4Y5F A;  4Q0H A;  5DFY A;  5L8M A;  4Q0J A;  3KSI A;  1STZ A;  3KSF A;  5HL6 A;  2W3F A;  2M7V A;  2Y8H A;  2ZMF A;  2W3G A;  3VV4 A;  4E04 A;  4Y2F A;  3CI6 A;  3MF0 A;  4DMZ A;  3K2N A;  2OOL A;  4ETZ A;  3OBF A;  2W3D A;  2LB9 A;  4O0P A;  3NOP C;  2G7U A;  1YKD A;  4CQH A;  4ME4 A;  4G3K A;  4EU0 A;  2KLI A;  2IA2 A;  3C2W A;  3EEA A;  2VJW A;  3KO6 A;  3LFV A;  2GX5 A;  4LRY C;  4FOF A;  3KSH A;  4MN7 A;  3ZQ5 A;  3E98 A;  1YSQ A;  3G6O A;  1TF1 A;  4IUK A;  5I5L A;  4DN0 A;  3S7O A;  4MCW A;  2W1T B;  2XRN A;  2B18 A;  3D3O A;  3E0Y A;  4YOF A;  4R70 A;  4QPR A;  4G3W A;  3S7N A;  3IBR A;  1YSP A;  3W2Z A;  4EUV A;  2O99 A;  2O0Y A;  5DFX A;  3R4K A;  2O9A A;  3S7Q A;  3TRC A;  5C5K A;  4G3V A;  4IJG A;  2W3H A;  4GLQ A;  2KOI A;  1VHM A;  3S7P A;  1MKM A;  4MMN A;  4LRX C;  4Q0I A;  4ZRR A;  4ETX A;  5TJJ A;  2M7U A;  1TD5 A;  3MMH A;  5K5B A;  2K31 A;  1ZTU A;  3KSG A;  3NHQ A;  4LRZ E;  5AJG A;  3NOU C;  3MQ0 A;  2O9B A;  4RQ9 A;  4Y3I A;  5LBR A;  4O01 A;  3CIT A;  5HSQ A;  3BJN A; 
#chains in the Genus database with same CATH topology
 1J3W A;  3ZG8 B;  3O86 A;  5EVI D;  1XJ6 A;  3IXH A;  1DP6 A;  1P9W A;  2ZC5 B;  1IYO A;  4B93 A;  2W3E A;  5EUA A;  1ZKJ A;  4KZ7 A;  1O7E A;  1BUE A;  3ZNY A;  3JVU A;  2VX8 A;  1D06 A;  2M1C A;  4FD8 A;  1OPX A;  4EWF A;  4EEU A;  4Y5F A;  4BBV A;  4S2P A;  2EX6 A;  3ZG0 A;  3DWZ A;  1QMF A;  4FH2 A;  3FWL A;  4S2M A;  4RA7 A;  2ZMF A;  4JF4 A;  2ZQC A;  1JNU A;  2ZM2 A;  1W5D A;  2HP6 A;  1SKF A;  3IHA A;  1KGG A;  1LT0 A;  1XGI A;  4P0M A;  4BD1 A;  3LCE A;  3SOI A;  3FPV A;  3H82 B;  3MFD A;  5TR7 A;  2ZL1 A;  2FH5 A;  4B88 A;  4QHC A;  1LSV A;  3PBO A;  1DY6 A;  2O9A A;  1ONG A;  2VV6 A;  2WKI A;  1UGU A;  3IXG A;  3P98 A;  3T4S A;  2V9A A;  1MKM A;  5L10 A;  4U0X A;  4JXW A;  2PYP A;  3MMH A;  4OPZ A;  1ZTU A;  3QP6 A;  2XFT A;  5E2H A;  4B4X A;  4WMC A;  3G2Y A;  3OLO A;  2OAP 1;  1YMX A;  2QHK A;  4OQI A;  3GMW A;  1YQS A;  1PWD A;  4O8G A;  2QWS A;  4IED A;  1T18 A;  4CLC D;  2PRF A;  4ZAM A;  2J8Y A;  2W1R A;  2V0U A;  4R6L A;  4Z1W A;  1PI4 A;  3FZC A;  4JGO A;  1GHI A;  5FI2 A;  4HH3 A;  4JBF A;  2JKR I;  4R3B A;  3JVV A;  2BAS A;  2M7V A;  1Q2P A;  4QD4 A;  4C3Q A;  4KZ4 A;  4R38 A;  4WL9 A;  4HHD A;  4EEP A;  3D9Y A;  5FQK A;  1XFN A;  5HAI A;  2LB9 A;  2V1Z A;  3CUE C;  3HRE A;  2J3W A;  5A93 A;  3EEA A;  2Y2O A;  2K7S A;  3AGD A;  4EER A;  4YFM A;  2J80 A;  3IWQ A;  3MZF A;  2JCH A;  3E0Y A;  2A24 B;  1F98 A;  5EV0 A;  4X55 A;  3UB5 P;  1BLH A;  4OVD A;  2XD5 A;  4ZBE A;  3TRC A;  3T4Q A;  3UB9 A;  4GLQ A;  3LYX A;  3HL9 A;  4HQA A;  2PBD P;  1PWC A;  3E4P A;  5DKL A;  4PPR A;  2B02 A;  5CTM A;  3ZGA B;  2OAQ 1;  3BFF A;  3QP5 A;  5DTS A;  3MQ0 A;  5M19 A;  1V9Y A;  2XD1 A;  2P04 A;  1S4R A;  1E25 A;  3LID A;  1YMS A;  5HPI A;  4XUZ A;  4EET B;  2BTF P;  1BSG A;  2Z2M B;  4WZ5 C;  5CHM A;  4FH4 A;  4ZDX A;  1CQA A;  1U60 A;  3UPN A;  1I5Q A;  4EQI A;  3IBJ A;  3NIA A;  4HP9 A;  5F5Y A;  3ULF A;  2A24 A;  3VP3 A;  5HL6 A;  3LEZ A;  2EFX A;  1K38 A;  1ES2 A;  2J9O A;  2XEP A;  1YLY A;  3EOI A;  3SH9 A;  4ETZ A;  1JWV A;  2QPN A;  4R4S A;  3IH9 A;  1K55 A;  5FQJ A;  3E4O A;  5HDD A;  3FV7 A;  4PM8 A;  2OSU A;  1OT6 A;  3BFC A;  4KZ8 A;  2EX9 A;  4X69 A;  3SH7 A;  4GS9 B;  3ZQ5 A;  3E98 A;  1TF1 A;  4IUK A;  3ITA A;  4CLC C;  3IT9 A;  1YLT A;  1T1A A;  3S7N A;  2BLS A;  1DP8 A;  5AQ9 A;  2O99 A;  1H8M A;  1KVM A;  4HY8 A;  1VEU A;  1L3L A;  2Y2K A;  3PYP A;  5C5K A;  4IJG A;  4HBT A;  3QP2 A;  1VET A;  2KOI A;  4MBH A;  5HAP A;  4OOL A;  5EEC A;  1L0E A;  1MWT A;  4Q8I A;  1XA7 A;  2JHE A;  1RP5 A;  4LLO B;  3NI9 A;  2HJ9 C;  2O9B A;  4I3I A;  3BLM A;  2WKQ A;  3WRT A;  4UA7 A;  4KG5 A;  2A49 A;  2IWC A;  4NXG A;  2ZC4 B;  4WEL A;  4HES A;  4KZ9 A;  3VSL A;  4JPM A;  4PMA A;  1IKG A;  3IF6 A;  5FQI A;  3UB7 A;  1F2K A;  1W79 A;  2AVX A;  1MC0 A;  4WYY A;  1KOU A;  2XRO A;  4UQI M;  3QNC A;  3LR0 A;  1K57 C;  3PXP A;  4KUK A;  1TS8 A;  1TEM A;  1GHP A;  2JBF A;  3HVF A;  4R23 A;  1MZU A;  1SCW A;  4NXB A;  3WS4 A;  1HD8 A;  2ZD8 A;  4E3I A;  4DE2 A;  3MF0 A;  3FG8 A;  3OBF A;  4KEN B;  4L9E A;  2KX6 A;  4HP4 A;  2IA2 A;  4Y0O A;  3KO6 A;  2VJW A;  3IS2 A;  1K0K A;  2W27 A;  4R1G A;  4II7 A;  3BLS A;  3A0R A;  5IU1 A;  5CER A;  3CAX A;  3IF5 A;  2GNX A;  4MBF A;  4N1H A;  1IYP A;  5CED A;  3N8L A;  3ZVT A;  2RL3 A;  4OH0 A;  1XP4 A;  3F1N B;  4R4R A;  4JF6 A;  2HP9 A;  5GHZ A;  4X68 A;  4DDS A;  5CGX A;  5FDH A;  4JXG A;  1JTD A;  3HJK A;  2M7U A;  3KSG A;  3NOU C;  4S2I A;  4DKI A;  4WF0 A;  2B95 A;  3GEC A;  4QU3 A;  3CWF A;  4OP8 A;  4GZB A;  1PFL A;  3UMD A;  4EES A;  2LB5 A;  1M6K A;  1TDL A;  1N4O A;  1EWZ A;  4X1M A;  4M4X A;  3UE6 A;  2WKR A;  4S2L A;  5E43 A;  1XA1 A;  4IHQ A;  1KE3 A;  1TDG A;  3OCL A;  4IVK A;  4Q0H A;  1C3B A;  5FDS A;  1I2W A;  5D3O A;  3CJM A;  2VV8 A;  2Y8H A;  5CX7 A;  5L07 A;  2VV7 A;  4LPZ A;  2WGW B;  2R9X A;  1HZO A;  1CEG A;  1CEF A;  5F1G A;  3MFX A;  3V39 A;  2OWJ A;  2OOL A;  1GA0 A;  3TSG A;  5EVI C;  4HBU A;  5DJU A;  3NY4 A;  4HJ3 A;  1G6A A;  3UB8 A;  2HDS A;  4WEK A;  4IBR A;  4RYE A;  3PBS A;  3PTE A;  2KLI A;  3M2J A;  2Y91 A;  3HUO A;  5F6A A;  1KGE A;  3G6O A;  4GKU A;  4S2N A;  1BLS A;  1FCN A;  1IKI A;  2ZQ8 A;  2B18 A;  4DJ3 A;  5CXW A;  4EV4 A;  4YOF A;  3G4P A;  2E8I A;  4NG2 A;  5G18 A;  2HDU A;  2WKE A;  1NLY A;  1MXO A;  2ZBB A;  4HJ4 A;  3OPH A;  3ZG5 A;  4BL2 A;  3ZG7 B;  3NUL A;  1N9B A;  3GVB A;  3S7P A;  1L0G A;  5GHX A;  4WM9 A;  4LRX C;  2WZZ A;  1PNE A;  4L0L A;  2GZA A;  5GL9 A;  1BLP A;  4Y3I A;  3EGX C;  3Q07 A;  4KQD A;  3H82 A;  1FIK A;  1E3U D;  3SS5 A;  2XSS A;  2I72 A;  5HW3 A;  1F5M A;  1BYW A;  3SS4 A;  1YLJ A;  1XFQ A;  2VEA A;  3BEB A;  4MN6 A;  3UDX A;  1RCJ A;  1N9L A;  3G30 A;  3NOT C;  2VLG A;  3NBL A;  3VP1 A;  5AVF A;  2IWD A;  3O3V A;  2Q9N A;  2JKT M;  1DP9 A;  1MBL A;  1VM1 A;  5DKK A;  4CJN A;  5HFO A;  3CI6 A;  4NK3 A;  4HEF A;  5EVE A;  1VET B;  3C7V A;  2WAF A;  1ZC2 A;  4PM6 A;  2HPB A;  5J8X A;  4BBT A;  1K55 C;  4X1L A;  4WLA A;  4YWZ A;  5KSH A;  4E3O A;  4BL3 A;  3C2W A;  3KYQ A;  2XK1 A;  3O87 A;  3EEH A;  3VSK A;  4IBX A;  2VGK A;  3V67 A;  3ZVW A;  5FAO A;  1J9M A;  1YSQ A;  3LY4 A;  1RGY A;  3ICY A;  2ZC3 B;  2WZX A;  4KQQ A;  4BLM A;  3MZD A;  4KZ3 A;  4HH2 A;  5HD3 A;  5TBM B;  2WGV A;  5F82 A;  1CK3 A;  1YLP A;  3BY8 A;  2DRW A;  1ODV A;  3W2Z A;  1ACF A;  4BMW A;  3UO9 A;  3RTY A;  4LV2 A;  3GTC A;  3PBR A;  4I3J A;  1W8Y A;  3A3E A;  1K6S A;  2WAE A;  5GLC A;  2JKF A;  4MMN A;  3QP1 A;  4Q0I A;  2ZM0 A;  3H9W A;  4EQ1 A;  2Y2M A;  4ARZ A;  3F1O A;  1WYC A;  2ZOH A;  5LBR A;  2XLN A;  2ZQ9 A;  3IQA A;  4R0Q A;  2Z6C A;  3VP2 A;  2YKF A;  3K3C A;  5J3W A;  5GLA A;  5EOO A;  4P6B A;  4Z9Q A;  3EWK A;  2JKG A;  3RFB A;  1S1Y A;  1KDS A;  2MJ6 A;  1P0Z A;  2J3T D;  3W4O A;  4KG6 A;  3A3D A;  3RXW A;  1ESU A;  1LL9 A;  3Q81 A;  5DFY A;  1Y54 A;  3AGE A;  5L8M A;  4Q0J A;  1IEL A;  5HX9 A;  4XT2 A;  1SZV A;  1GHM A;  1LI9 A;  1TS6 A;  3EGD C;  5KZH A;  3NJA A;  3Q7V B;  2PD8 A;  2P9V B;  1AXB A;  3NOP C;  1WYB A;  3UE1 A;  1Y28 A;  5DF8 A;  4CQH A;  1IFQ A;  4EU0 A;  2ZJ9 A;  3LI9 A;  3PHY A;  1ZG4 A;  3V3R A;  2GX5 A;  1HVB A;  1P97 A;  2XGN A;  5IT5 A;  3MXQ A;  4X53 A;  2A2L A;  3O88 A;  4B4Z A;  2A3U A;  2Y2L A;  4LFU A;  5I5L A;  5EOE A;  4MCW A;  1KGF A;  1YLZ A;  1XJ4 A;  1OT9 A;  3DWK A;  3HLW A;  4OP5 A;  3MKE A;  1K4F A;  4FCF A;  3S7Q A;  3OZH A;  5E2E A;  1LLB A;  3F1N A;  1XKZ A;  1SHV A;  5FEG A;  1T19 A;  4LRZ E;  3HJI A;  5KMW A;  4MEZ A;  2H0Y A;  4OQ0 A;  4O01 A;  3D72 A;  3BJN A;  4UA6 A;  2JE5 A;  5CRF A;  4PAU A;  2V20 A;  3VOZ A;  5EPH A;  4KQR A;  2Y79 A;  2EX8 A;  3ZG9 B;  2WK0 A;  3UME A;  2KDK A;  2Y59 A;  2X01 A;  3LR4 A;  5A92 A;  3ZCZ A;  1TS7 A;  4PKY G;  3UE0 A;  4E3L A;  3ITB A;  1NRF A;  2HDR A;  5HAQ A;  2Y2N A;  3WS0 A;  4F94 A;  1VQQ A;  3T1R A;  2Y2I A;  4F3L B;  1KVL A;  1XX2 A;  3G34 A;  5TFQ A;  5HWT A;  2C5W B;  1PYY A;  4OLG A;  3LFV A;  4IVI A;  4K91 A;  2VGL M;  1SKO B;  3A3F A;  1YT4 A;  3PAE A;  2NUT C;  2P74 A;  3I7J A;  5FI7 A;  3CLO A;  4GHI A;  4JGP A;  5G4Z A;  4EUV A;  3CHW P;  1BZA A;  4FTX A;  1CJF A;  5J4E A;  4LGW A;  3OCN A;  1FQG A;  2X71 A;  3UDI A;  4ZJ3 A;  4ESP A;  1S67 L;  1ERQ A;  2PDR A;  1DJC A;  3VFH A;  1IYQ A;  4OLD A;  1FOF A;  3BWL A;  1AWI A;  2OV5 A;  3MS6 A;  5AJG A;  1MWU A;  3VE4 A;  1OJ5 A;  2H28 A;  3D4F A;  2OWH A;  4EBN A;  1ONH A;  2HGV A;  4F3L A;  3GSG A;  4I5S A;  3LIC A;  2VKS A;  3VOY A;  1FSY A;  4DE0 A;  5CEC A;  3SS3 A;  4Y15 A;  3T4L A;  4GW9 A;  1NY0 A;  3M6B A;  1Z6F A;  1I2S A;  1MWR A;  1W8Q A;  2HZ5 A;  2OLU A;  1ES5 A;  2L4R A;  4HNB A;  1VEU B;  3W4P A;  3A0S A;  4WZ4 A;  4JKT A;  1S0W A;  5HWW A;  1Q2Q A;  1V9Z A;  3GR2 A;  4RX3 A;  5EM1 A;  3A0V A;  3DW0 A;  1D7E A;  2PU2 A;  4PKY A;  3IX4 A;  5MC7 A;  3T4T A;  3KSH A;  4Y13 A;  3IX3 A;  3C38 A;  3PAG A;  2FFF B;  4R70 A;  5A8B A;  1BUL A;  3PBT A;  1IOU A;  2O0Y A;  5DFX A;  1NZU A;  1PW1 A;  3PBQ A;  4G3V A;  1XJ2 A;  4N9L A;  5DF9 A;  1BLC A;  1JVJ A;  5HL1 A;  3IX8 A;  5EM0 A;  1CI9 A;  3BQ8 A;  2H5S A;  4ZRR A;  1NRJ A;  2R9W A;  2P9V A;  2JKR M;  2QKP A;  2HDQ A;  3ZFZ A;  1N9O A;  1XGJ A;  3MZE A;  3Q7V A;  3RH8 B;  5FAT A;  2YKH A;  1G68 A;  3N8R A;  3BW6 A;  3VOL A;  4P6Z M;  4X6T A;  4ARZ B;  3RJU A;  5HD5 A;  1OTI A;  2P08 A;  2QYB A;  4DF6 A;  4D60 A;  1K56 D;  4XXR A;  1LL5 A;  2K2N A;  4DE3 A;  4C75 A;  3MQQ A;  4GDN A;  1Z09 A;  1ES3 A;  4JGQ A;  4P87 A;  1FR1 A;  1DJA A;  2V8F A;  4PM5 A;  1H5X A;  3KSI A;  1GA9 A;  3SZT A;  3LIB A;  1GSX A;  2XF3 A;  4P85 A;  4YIN A;  4FUW A;  3LR5 A;  3T1Q B;  4EUZ A;  2W3D A;  4OPQ A;  3GDI A;  1Y4O A;  4QJG A;  4OPR A;  2ZQD A;  1IYS A;  3ZHH A;  2WYX A;  4O7D A;  4PM9 A;  3V3S A;  5E2F A;  3FPW A;  3N6I A;  4EBP A;  4DJ2 A;  4RX2 A;  1MPL A;  5G4Y A;  3IBR A;  1PZO A;  4LV0 A;  3T50 A;  3HLC A;  4CPK A;  3BM6 A;  4L9F A;  3N4I A;  2HV1 A;  3BFE A;  4JF5 A;  1PIO A;  2W3H A;  3IXD A;  4LCL A;  3UN7 A;  4CLC A;  4U3T A;  2ZMV A;  3B3X A;  2H10 A;  3LI8 A;  5TJJ A;  4MN5 A;  4A5R A;  2ZQA A;  4GJ4 A;  2XH9 A;  1G5U A;  1HTZ A;  3T1S A;  2I9V A;  3L9K A;  1OTE A;  4E6X A;  4BD0 A;  2PR6 A;  3LEQ A;  3EQV A;  3ZDJ A;  3WWX A;  1HLU P;  4HOI A;  2FZ0 A;  4MNR A;  5TGF A;  1FR6 A;  1KE4 A;  4JGR A;  3SW1 A;  1ESI A;  1K57 A;  4P6Z S;  5HZH A;  3CPT B;  4GDB A;  5DVA A;  2JN7 A;  5CHJ A;  5CTN A;  1NWZ A;  4D2O A;  3Q1F A;  3OOV A;  4CLC E;  4GN2 A;  1GSW A;  4UA9 A;  1LL8 A;  3N7W A;  5FSR A;  4ZJ1 A;  3BY9 A;  3T1X A;  1YM1 A;  1OME A;  2Q0O A;  2EFU A;  3G35 A;  3K3D A;  2V0W A;  2WUQ A;  2CC1 A;  3IHB A;  2Y55 A;  3VV4 A;  1ERM A;  3C5A A;  3HUN A;  1JWP A;  3UNW A;  3E2L A;  3LIE A;  1S1Z A;  5L2F A;  3IWO A;  3Q82 A;  3TW8 A;  1SDN A;  1K56 A;  4K08 A;  3C4P A;  1W7F A;  2EA9 A;  2L0W A;  3B47 A;  3DTK A;  3VMA A;  4UAA A;  3HLD A;  4Y0T A;  3MKF A;  4MN7 A;  2EXB A;  2WAD A;  3L7H A;  2EX2 A;  2OLV A;  3P01 A;  2G2U A;  2QZ6 A;  1SKO A;  3T4K A;  1NZO A;  3ZNT A;  1BT5 A;  3IF6 C;  4NKP A;  3FKW A;  3DTE A;  4N1X A;  3JYI A;  1H8Y A;  1MY8 A;  3A3I A;  4ETX A;  1WE4 A;  3AGF A;  3MR0 A;  2NUP C;  4LV1 A;  2PHY A;  5FAS A;  2WKH A;  2XA7 S;  4KG2 A;  3IWI A;  3LY3 A;  3WS1 A;  4EW7 A;  4NET A;  2JC7 A;  2VZW A;  4X25 A;  3T12 B;  4BQM A;  2EXA A;  2PYR A;  4Y7P A;  2XA7 M;  3PBN A;  3H7W A;  5HPF A;  1K6R A;  2P7J A;  1LHY A;  1PW8 A;  3HBR A;  3DBA A;  4MDZ A;  2R78 A;  2XQZ A;  4H6J B;  1EI5 A;  3S4X A;  2Z6D A;  4UEY A;  1CI8 A;  2GDN A;  4GD6 A;  1STZ A;  4GNU A;  2ZQ7 A;  3RXX A;  1YLW A;  4E04 A;  1KDW A;  1K54 A;  2Q9M A;  1XJ3 A;  2WKP A;  3F1P B;  1NJ4 A;  1YPR A;  3HLG A;  3GV9 A;  3CPT A;  3PR6 A;  3F1P A;  3SH8 A;  1GCE A;  1TS0 A;  3C8C A;  5HDS A;  4N9K A;  3NCK A;  2VA0 A;  2PT7 A;  1E3U A;  3BFG A;  3S7O A;  3R7W A;  2W1T B;  3D3O A;  3LUQ A;  4QPR A;  5FAP A;  3MSH A;  3WRZ A;  1K4E A;  4G3W A;  4LV3 A;  4E3M A;  1YSP A;  3NDE A;  2Y2P A;  1ZG6 A;  1T1B A;  3G32 A;  4CLC B;  4S2J A;  1E4D A;  3BRM A;  4BJP A;  4H8R A;  2Y2Q A;  1NYY A;  4QY5 A;  4S2K A;  1S6R A;  2K31 A;  4HI4 A;  2V2F F;  5CGW A;  1MKI A;  5F68 A;  5FEF A;  2PU4 A;  4RQ9 A;  5HSQ A;  1DJB A;  3WS5 A;  1G28 A;  3UE3 A;  2VGJ A;  2B5R A;  3P7N A;  3IH8 A;  3TG9 A;  4WN5 A;  5EVI B;  4BWI A;  4WEJ A;  1NLZ A;  4R3J A;  5FA7 A;  5CEB A;  5A90 A;  3FKV A;  2DNS A;  1H8Z A;  4C6Y A;  2Y2H A;  4JXV A;  3V5M A;  5KIZ A;  5EFW A;  2PAV P;  3BFD A;  1KE0 A;  2G2W A;  4OOY A;  5KSC A;  2UV0 E;  3LIF A;  3KSF A;  3C7U A;  2RCX A;  2ZLY A;  1D1J A;  1FSW A;  4I38 A;  5I94 A;  1PI5 A;  1OTA A;  3OPP A;  4BBU A;  4X56 A;  2CMN A;  3UB6 A;  2PR5 A;  4PHT A;  1RGZ A;  4DDY A;  1YKD A;  1X0O A;  4JXS A;  1NXY A;  1DRM A;  3QP4 A;  2ACG A;  5A91 A;  1ES4 A;  4FOF A;  2W0N A;  1QME A;  4DXB A;  1TVF A;  4XT2 B;  4E3J A;  3NC8 A;  2D02 A;  2GJ3 A;  3UPO A;  3P09 A;  5F1F A;  5AVE A;  1PRQ A;  2WGI A;  4HJ6 A;  3UPP A;  3MQO A;  1W63 M;  1LSX A;  1GSV A;  2XDM A;  2J3T C;  4WUJ A;  2QJ7 A;  4OOM A;  1F9I A;  1IEM A;  4NXE A;  3N8S A;  4OON A;  5F83 A;  1L2S A;  3HLB A;  2XR0 A;  1N9N A;  3E2K A;  4EBL A;  2VGL S;  4N92 A;  1A0K A;  4IUH A;  3ISG A;  3QP8 A;  3TE8 A;  5AQA A;  5HWV A;  2O9C A;  2X02 A;  1EW0 A;  5GHY A;  4I39 A;  3B42 A;  4S2O A;  4XUX A;  3MBZ A;  1JWZ A;  2HP5 A;  3VFF A;  4MLL A;  2W3F A;  3CZD A;  3DTI A;  1FCO A;  4GB7 A;  1H0M A;  5J7E A;  4DE1 A;  5EVI A;  4OPY A;  4UQI S;  2J7V A;  5IS1 A;  1MWS A;  4KUO A;  1LI0 A;  2G7U A;  4ME4 A;  3F1O B;  5IHV A;  4E6W A;  4ZTK A;  4KZ5 A;  1XPB A;  2INW A;  5FQ9 A;  2FFY A;  5FL3 A;  4GOG A;  3FC7 A;  3CG5 A;  4Y17 A;  3OPR A;  4LEN A;  1OTB A;  3T4O A;  4S2N C;  1NYM A;  2XRN A;  4KZA A;  3S1Y A;  3VE3 A;  2Y2J A;  2ZMA A;  5DTT A;  4WMC D;  3NEC A;  5DTK A;  1K25 A;  3M6H A;  3R4K A;  2VK3 A;  1T1C A;  4I3A A;  3TJZ C;  5JYO A;  4MBK A;  3NHQ A;  3W8K A;  5AQB A;  5HDC A;  3C4O A;  3LIA A;  3BEC A;  1UWN X;  4M3K A;  3CIT A;  4WBG A;  4GD8 A;  2C6W B;  3QNB A;  5FQQ A;  5DF7 A;  3LGO A;  3FYZ A;  1O07 A;  2D01 A;  4Y0U A;  3HLF A;  4E3N A;  2EWW A;  4DRT A;  3O5Y A;  2Z2L B;  2ZC7 A;  2QMI A;  3A3J A;  3DAV A;  4KZ6 A;  1M40 A;  3JPU A;  1FIL A;  5GLD A;  2UWX A;  4GCZ A;  3LR3 A;  3EQU A;  3V50 A;  3U2A A;  3KX0 X;  5TBM A;  1P9R A;  5DJT A;  3S22 A;  4QWO A;  5M1A A;  1K54 C;  4R3A A;  4Y2F A;  1L0F A;  5EVL A;  3K2N A;  4PM7 A;  2Y2G A;  4QY6 A;  2QJ5 A;  3ZYT A;  4OKP A;  4WZ5 A;  4OQH A;  1S4S A;  2BG1 A;  2V1A A;  1PZP A;  4DN0 A;  3E4Q A;  4UHU A;  5JYP A;  5CHU A;  5CGS A;  1G6O A;  3OPL A;  3HLE A;  5F69 A;  3R7W B;  3VP4 A;  5M18 A;  2EWV A;  1SDE A;  2ZL1 B;  1WA9 A;  3H7W B;  2PD7 A;  2JKT I;  1H3Q A;  2L1M A;  3C30 A;  1UWP X;  1PWG A;  3G2Z A;  2HF6 A;  3W4Q A;  5K5B A;  3WS2 A;  1S66 L;  1VB6 A;  2Y4A A;  2DCF A;  1ZHH B;  3M2K A;  5AQ7 A;  1OTD A;  3UDF A;  3T4J A;  4AFI A;  2DMW A;  3MXR A;  4EXO A;  3IXB A;  2W1T A;  3BQA A;  1W63 Q;  5FI6 A;  3MJQ A;  3G31 A;  1ALQ A;  4YNR A;  3IS2 B;  3KYE A;  3HCY A;  4HIA A;  3KYZ A;  4OQG A;  3GRJ A;  1XXM A;  4FSF A;  4NXF A;  2V8C A;  4ID4 A;  2WGW A;  5FQM A;  3MXS A;  4KZB A;  3BYD A;  5BOH A;  4H6J A;  4B9O A;  4DXC A;  4LCM A;  2H0T A;  2J9P A;  3Q7Z A;  3LO7 A;  2W3G A;  3TOI A;  1YAX A;  4DMZ A;  4ZJ2 A;  1JTG A;  3DTM A;  2ZC6 B;  4RVA A;  4O0P A;  5FAQ A;  5E2G A;  2V1B A;  1ERO A;  4G3K A;  4NEE D;  2ZOI A;  3U4L P;  3IF6 B;  3OC2 A;  2IWB A;  3QHY A;  4LRY C;  1FCM A;  4GHI B;  4E3K A;  4KQO A;  5U47 A;  3UY6 A;  3CMZ A;  2XFS A;  1OJG A;  1L0D A;  3HUM A;  2HJE A;  4GS9 A;  4QB8 A;  5L09 A;  2PBY A;  1BTL A;  2E8J A;  2ZM8 A;  3B33 A;  5EE8 A;  5HAR A;  4JLF A;  1CF0 A;  1VHM A;  3CUE A;  1LSW A;  3GQZ A;  4K0X A;  3NDG A;  3VP0 A;  4U0T A;  1TD5 A;  4L9G A;  4K0W A;  4BEN A;  5GLB A; 
#chains in the Genus database with same CATH homology
 1G28 A;  3UE3 A;  3CWF A;  3P7N A;  3UMD A;  2HGV A;  4WN5 A;  4BWI A;  4F3L A;  1XJ6 A;  4I5S A;  3LIC A;  4WEJ A;  4EES A;  1DP6 A;  1P9W A;  2LB5 A;  1NLZ A;  2VKS A;  4B93 A;  4M4X A;  2W3E A;  3UE6 A;  2WKR A;  3JVU A;  2VX8 A;  3T4L A;  4GW9 A;  1D06 A;  4IHQ A;  2M1C A;  1OPX A;  4EEU A;  5KIZ A;  4Y5F A;  3OCL A;  5EFW A;  4BBV A;  4Q0H A;  2L4R A;  3LIF A;  4HNB A;  3KSF A;  4I38 A;  2VV8 A;  2Y8H A;  3A0S A;  5CX7 A;  2ZMF A;  2VV7 A;  4LPZ A;  1OTA A;  1JNU A;  4BBU A;  5HWW A;  3MFX A;  2CMN A;  2OWJ A;  2OOL A;  2PR5 A;  3UB6 A;  4PHT A;  5DJU A;  1V9Z A;  3A0V A;  4HJ3 A;  3UB8 A;  4WEK A;  1YKD A;  1X0O A;  1D7E A;  4PKY A;  3PBS A;  1LT0 A;  5MC7 A;  2KLI A;  3T4T A;  1DRM A;  5F6A A;  4FOF A;  3KSH A;  3FPV A;  3G6O A;  3H82 B;  2W0N A;  3C38 A;  2B18 A;  4DJ3 A;  4YOF A;  4R70 A;  4XT2 B;  5A8B A;  2FH5 A;  3PBT A;  2D02 A;  2GJ3 A;  1IOU A;  5AVE A;  1LSV A;  1NLY A;  2O0Y A;  2ZBB A;  5DFX A;  3PBO A;  2O9A A;  4HJ4 A;  4HJ6 A;  2VV6 A;  3PBQ A;  3MQO A;  4G3V A;  1XJ2 A;  1W63 M;  1LSX A;  1UGU A;  5DF9 A;  3T4S A;  1GSV A;  3S7P A;  3BQ8 A;  2V9A A;  1MKM A;  2J3T C;  4WUJ A;  4LRX C;  4ZRR A;  1NRJ A;  2QJ7 A;  4OOM A;  1F9I A;  2PYP A;  3MMH A;  2JKR M;  2QKP A;  1ZTU A;  4L0L A;  2GZA A;  4NXE A;  3OLO A;  2OAP 1;  1N9O A;  4Y3I A;  3RH8 B;  3EGX C;  2YKH A;  2QHK A;  4KQD A;  3H82 A;  3BW6 A;  4O8G A;  1N9N A;  2QWS A;  2XSS A;  4P6Z M;  2VGL S;  3VOL A;  1T18 A;  4ARZ B;  5HD5 A;  1OTI A;  1F5M A;  4CLC D;  1BYW A;  4IUH A;  2P08 A;  2QYB A;  2W1R A;  3TE8 A;  2V0U A;  4R6L A;  4Z1W A;  1XFQ A;  2VEA A;  4MN6 A;  2K2N A;  5HWV A;  1N9L A;  2O9C A;  4JGO A;  3NOT C;  3MQQ A;  4JGQ A;  1EW0 A;  4HH3 A;  4I39 A;  2VLG A;  3B42 A;  2JKR I;  3JVV A;  5AVF A;  3KSI A;  2BAS A;  3LIB A;  2JKT M;  1GSX A;  1DP9 A;  2W3F A;  2M7V A;  5DKK A;  4R38 A;  3CI6 A;  4WL9 A;  4HHD A;  4EEP A;  5J7E A;  3LR5 A;  1XFN A;  2W3D A;  2LB9 A;  3CUE C;  4UQI S;  4BBT A;  5IS1 A;  4KUO A;  3GDI A;  2G7U A;  4WLA A;  4YWZ A;  4ME4 A;  5KSH A;  2J3W A;  3F1O B;  3C2W A;  3KYQ A;  3EEA A;  3EEH A;  2INW A;  2K7S A;  4EER A;  3V67 A;  5FL3 A;  3FC7 A;  1YSQ A;  1OTB A;  2J80 A;  3ICY A;  3T4O A;  2XRN A;  3FPW A;  3E0Y A;  3VE3 A;  4HH2 A;  5HD3 A;  4DJ2 A;  2A24 B;  5TBM B;  1F98 A;  3BY8 A;  5G4Y A;  1ODV A;  3IBR A;  3W2Z A;  3T50 A;  4BMW A;  3R4K A;  4L9F A;  3RTY A;  3TRC A;  2HV1 A;  3PBR A;  4I3J A;  3T4Q A;  1T1C A;  3UB9 A;  2W3H A;  4GLQ A;  3LYX A;  4I3A A;  4HQA A;  3TJZ C;  3E4P A;  4CLC A;  4MMN A;  2ZMV A;  5DKL A;  4Q0I A;  2B02 A;  3LI8 A;  5TJJ A;  2OAQ 1;  4MN5 A;  3NHQ A;  3H9W A;  4GJ4 A;  4EQ1 A;  5HDC A;  4ARZ A;  3F1O A;  3MQ0 A;  2ZOH A;  2I9V A;  3LIA A;  1V9Y A;  5LBR A;  1OTE A;  1UWN X;  3CIT A;  2P04 A;  2PR6 A;  1S4R A;  3EQV A;  4HOI A;  2FZ0 A;  3LID A;  2Z6C A;  5HPI A;  4JGR A;  3SW1 A;  2YKF A;  3K3C A;  5J3W A;  4EET B;  2D01 A;  5HZH A;  4P6Z S;  3EWK A;  2EWW A;  3O5Y A;  3RFB A;  1S1Y A;  2MJ6 A;  2JN7 A;  1P0Z A;  2J3T D;  1NWZ A;  3OOV A;  4CLC E;  1GSW A;  3IBJ A;  1LL8 A;  4GCZ A;  3BY9 A;  3LR3 A;  3EQU A;  4HP9 A;  5DFY A;  5F5Y A;  5L8M A;  3KX0 X;  4Q0J A;  3U2A A;  3ULF A;  2A24 A;  5TBM A;  4XT2 A;  5HL6 A;  3K3D A;  1P9R A;  1TS6 A;  5DJT A;  2V0W A;  3EGD C;  3VV4 A;  4R3A A;  4Y2F A;  3NJA A;  3EOI A;  2PD8 A;  3K2N A;  3LIE A;  1S1Z A;  4ETZ A;  3TW8 A;  3NOP C;  1Y28 A;  3E4O A;  4CQH A;  5HDD A;  1IFQ A;  4EU0 A;  2QJ5 A;  4K08 A;  3ZYT A;  3LI9 A;  2L0W A;  2EA9 A;  3B47 A;  3PHY A;  1OT6 A;  2GX5 A;  1P97 A;  1S4S A;  5IT5 A;  4GS9 B;  4MN7 A;  3ZQ5 A;  3E98 A;  3MXQ A;  2A2L A;  3P01 A;  2V1A A;  1TF1 A;  4IUK A;  5I5L A;  4DN0 A;  3E4Q A;  4MCW A;  4CLC C;  1XJ4 A;  1T1A A;  1OT9 A;  3S7N A;  1G6O A;  1DP8 A;  3T4K A;  5F69 A;  3R7W B;  2O99 A;  1H8M A;  2EWV A;  4HY8 A;  3S7Q A;  4NKP A;  1WA9 A;  3PYP A;  3H7W B;  5C5K A;  4IJG A;  2PD7 A;  2JKT I;  1H3Q A;  2L1M A;  3F1N A;  2KOI A;  3C30 A;  1UWP X;  4OOL A;  4ETX A;  1T19 A;  2HF6 A;  5K5B A;  2JHE A;  3MR0 A;  1S66 L;  4LLO B;  4LRZ E;  2NUP C;  1VB6 A;  2HJ9 C;  3HJI A;  2O9B A;  2PHY A;  4I3I A;  4O01 A;  3D72 A;  2XA7 S;  3BJN A;  2WKQ A;  1ZHH B;  4EW7 A;  1OTD A;  4PAU A;  3T4J A;  4AFI A;  2DMW A;  4NXG A;  4WEL A;  4EXO A;  2VZW A;  2W1T A;  3BQA A;  1W63 Q;  2Y79 A;  3MJQ A;  3UME A;  2PYR A;  2XA7 M;  2KDK A;  3PBN A;  3IS2 B;  4YNR A;  3H7W A;  3HCY A;  5HPF A;  3UB7 A;  2P7J A;  4HIA A;  3KYZ A;  1MC0 A;  1KOU A;  3DBA A;  3LR4 A;  4FSF A;  4MDZ A;  4NXF A;  2R78 A;  4UQI M;  2XRO A;  1TS7 A;  4PKY G;  4H6J B;  3LR0 A;  2Z6D A;  3PXP A;  4KUK A;  4UEY A;  1TS8 A;  1STZ A;  4H6J A;  4B9O A;  1MZU A;  4NXB A;  2W3G A;  4E04 A;  1YAX A;  3MF0 A;  4DMZ A;  3FG8 A;  1XJ3 A;  2WKP A;  3F1P B;  3OBF A;  4F3L B;  4L9E A;  2KX6 A;  4O0P A;  5HWT A;  2V1B A;  4HP4 A;  3PR6 A;  4G3K A;  4NEE D;  2ZOI A;  2IA2 A;  3F1P A;  3KO6 A;  2VJW A;  3IS2 A;  3LFV A;  2W27 A;  3OC2 A;  1TS0 A;  4II7 A;  3C8C A;  5HDS A;  4LRY C;  3A0R A;  2VGL M;  4GHI B;  5IU1 A;  3CAX A;  2VA0 A;  2PT7 A;  4KQO A;  2NUT C;  2GNX A;  3S7O A;  3R7W A;  2W1T B;  3D3O A;  3LUQ A;  1OJG A;  4QPR A;  4G3W A;  3CLO A;  4GHI A;  2HJE A;  1YSP A;  4GS9 A;  4JGP A;  5G4Z A;  4EUV A;  3F1N B;  1T1B A;  5J4E A;  3OCN A;  4CLC B;  3B33 A;  4BJP A;  1S67 L;  1VHM A;  3CUE A;  1LSW A;  2PDR A;  3HJK A;  2M7U A;  1TD5 A;  4L9G A;  2K31 A;  4HI4 A;  3BWL A;  3KSG A;  5AJG A;  3NOU C;  5F68 A;  4WF0 A;  3VE4 A;  1OJ5 A;  4RQ9 A;  2H28 A;  2OWH A;  5HSQ A;  3GEC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...