2W3FA

Reduced structure of the first gaf domain of mycobacterium tuberculosis doss
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
148
structure length
148
Chain Sequence
GAMDPDLEATLRAIVHSATSLVDARYGAMEVHDRQHRVLHFVYEGIDEETVRRIGHLPKGLGVIGLLIEDPKPLRLDDVSAHPASIGFPPYHPPMRTFLGVPVRVRDESFGTLYLTDKTNGQPFSDDDEVLVQALAAAAGIAVANARL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords TWO COMPONENT SENSOR HISTIDINE KINASE DEVS (GAF FAMILY PROTE
publication title Structural Insight Into the Heme-Based Redox Sensing by Doss from Mycobacterium Tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 40
structure length 148
sequence length 148
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2008-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01590 GAF GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2w3fA00
4Q0HA 3HCYA 4O01A 5AJGA 3NOUC 3R4KA 3MF0A 3KO6A 2W3EA 3OBFA 3S7PA 4Y2FA 3S7NA 4G3WA 1YKDA 4BWIA 2GX5A 3E0YA 1TF1A 1YSQA 4IUKA 1VHMA 4Q0JA 4EU0A 3KSHA 4MMNA 5LBRA 5DFYA 4LRXC 4FOFA 2KOIA 4CQHA 4G3VA 4O0PA 3RFBA 3O5YA 5C5KA 4MCWA 4YNRA 4ZRRA 4ETZA 2Y79A 2K31A 5K5BA 3MMHA 3C2WA 3KSIA 2O9CA 4GLQA 3DBAA 4Z1WA 4DMZA 3NOPC 2VKSA 4LRZE 1F5MA 2M7UA 4EUVA 4LRYC 2IA2A 2W3DA 4G3KA 3LFVA 4MDZA 3E98A 2O9AA 3TRCA 2W3HA 3NOTC 4DN0A 4O8GA 4R70A 2VEAA 5L8MA 3OOVA 1MC0A 2LB5A 1YSPA 2Y8HA 2LB9A 2HGVA 4QPRA 3S7OA 4R6LA 4RQ9A 4Y5FA 2OOLA 3NHQA 2M7VA 4ETXA 2B18A 2VZWA 2O99A 2O9BA 3CI6A 1STZA 1MKMA 4GW9A 1ZTUA 3KSFA 5I5LA 3KSGA 4YOFA 3MQ0A 2K2NA 4IUHA 2QYBA 2XROA 4ME4A 3G6OA 3S7QA 2G7UA 2KLIA 2VJWA 3CITA 2W3FA 5TJJA 3EEAA 5HPFA 3W2ZA 4Y3IA 3BJNA 4IJGA 2W1TA 2XSSA 4E04A 1TD5A 2W1TB 3K2NA 2ZMFA 4MN7A 3IBRA 2XRNA 5DFXA 4Q0IA 5HPIA 3ZQ5A 5HL6A 3D3OA 5HSQA 3IBJA 2W1RA 3VV4A 2W3GA 2O0YA 4PAUA
chains in the Genus database with same CATH superfamily
4QJGA 2WKHA 3FYZA 1JWZA 2P04A 2WKEA 5TFQA 4B88A 3FKVA 5M19A 3A3IA 1FIKA 1PWGA 3WRTA 4G3WA 4BWIA 1N4OA 4OP8A 1P0ZA 1TS6A 1WYBA 4II7A 1H3QA 1W63Q 4LV1A 1L0EA 2KOIA 3UB9A 5DKKA 4MCWA 4ZAMA 3VOYA 3VFHA 1FCMA 3FPWA 3FG8A 1SDEA 5FQKA 4FSFA 1XGJA 2QZ6A 1CF0A 5DF8A 3T4QA 3Q7ZA 5DTSA 3TRCA 2PU4A 4X55A 5HX9A 4OQGA 3G31A 1FCNA 2VK3A 2VEAA 2PDRA 3QNBA 1FOFA 3LR4A 1NYYA 4HJ3A 3SS4A 2PRFA 3NCKA 2Y2MA 2BTFP 3N8RA 1ES2A 4PHTA 3LY4A 1EI5A 2EFUA 5FAPA 3VP2A 5L10A 3IT9A 3EEAA 5HPFA 4KG6A 3UDXA 1DP6A 1D1JA 1PI5A 1XPBA 3NJAA 2PU2A 2W1TB 4E3LA 2OLUA 2GJ3A 3OCLA 4N1XA 1V9ZA 3UNWA 4DE2A 3DWZA 3VE4A 2HP5A 1T1AA 3G32A 2B95A 4XUXA 2VA0A 4O01A 1HLUP 1MWTA 2JKFA 4WBGA 5CGXA 2HF6A 1O7EA 5EVLA 5D3OA 3BW6A 3UY6A 3WS4A 3ZNYA 2GX5A 2JBFA 4CLCC 1K56A 4EU0A 4E3MA 3BYDA 4FH2A 3A3FA 4KUKA 2P74A 3MXSA 1TS8A 3Q82A 3Q07A 2EA9A 4ZBEA 1QMEA 3ZNTA 4FUWA 4PM9A 4P87A 4KZ5A 4S2JA 3R7WB 3DTKA 4E3JA 1IOUA 1KOUA 4LV2A 3Q1FA 5TGFA 2ZJ9A 4XXRA 2W27A 2W3DA 5KSHA 5AQ7A 3DAVA 4EETB 3ZG7B 2ACGA 2VGJA 2Y2JA 5CRFA 3ZGAB 3E4PA 3NBLA 2LB9A 3T50A 2ZM8A 3N4IA 2EFXA 1UWNX 4XT2A 3H7WA 4UA9A 5DVAA 4PM8A 5HFOA 1I5QA 2O99A 5GHXA 3T4SA 4C6YA 5AQBA 1ZG6A 1SKFA 2ZQCA 3JPUA 3MJQA 2GDNA 3IQAA 4KZ8A 2G7UA 1KE3A 5E2FA 1LLBA 1ZHHB 1GA0A 3F1NB 3M6HA 3NDGA 3NY4A 5F6AA 1H8YA 5E43A 1TEMA 1WE4A 4E04A 1GHPA 3IHBA 3UPOA 5DFXA 4NXGA 1BUEA 3IS2A 3T1SA 5EVID 3S22A 4B4ZA 1XJ2A 4EUZA 4CLCB 3W4QA 5JYPA 2ZQ8A 2CMNA 4UA6A 4WM9A 3I7JA 4PM6A 2ZL1B 5HL1A 3VP0A 5A8BA 3FZCA 3ITAA 1PZPA 4Y0OA 4R3AA 5F1GA 4GZBA 2INWA 3HVFA 4WELA 2OLVA 3GQZA 5K5BA 3ICYA 2BLSA 4JGPA 1F5MA 4K91A 4RYEA 3C8CA 2EX6A 3AGDA 4OQ0A 2ZOHA 2PBYA 4X69A 5F5YA 4N92A 1T18A 5FQ9A 2WKPA 1OTEA 2X02A 1MC0A 4DXBA 4PKYA 4OOLA 1TS0A 3MKEA 2FZ0A 1T1BA 5KIZA 2WAEA 4QPRA 1DP9A 4M4XA 1EW0A 2VZWA 5DF7A 2EXBA 4ZJ3A 1XJ4A 4EV4A 1KDWA 2E8JA 2QYBA 4WLAA 3A0VA 3PAGA 3D72A 3EQVA 1VB6A 4OLGA 2W3FA 3MQQA 1GHMA 3K2NA 1YLPA 3DTMA 3D3OA 5HSQA 1VETA 4C75A 3F1OA 4R23A 5HDSA 3ZG8B 4JXVA 4MN6A 2ZMVA 1Y4OA 4QY6A 2DNSA 4ID4A 4DE3A 2Y2KA 4WF0A 4BLMA 1YPRA 5TBMB 3IXDA 4LV3A 4AFIA 4IUKA 3U2AA 3VP3A 2PHYA 4JXWA 1OTAA 1WA9A 1GSVA 3QP6A 3LIFA 4O0PA 5HDCA 4HJ4A 1YT4A 2L4RA 5A91A 4PPRA 1IKIA 2PYPA 3UO9A 3QP8A 2IWDA 4EESA 5G18A 4DMZA 1NYMA 2GNXA 4FH4A 4Y0TA 4LRYC 3L7HA 3LFVA 1G28A 3B33A 3DWKA 3C4OA 4K08A 4GJ4A 2WGWA 2A3UA 2V0WA 5DTKA 3W4OA 3HLDA 1W8YA 4LENA 2JKRI 5HAPA 4KZ6A 5GLDA 1Z09A 3IF6C 2QJ7A 1IYOA 2AVXA 4R6LA 3MFDA 2EX8A 4EBNA 2B18A 4DJ2A 3GRJA 5I5LA 4YFMA 1NZOA 2OAQ1 3OLOA 3NDEA 2JC7A 3GSGA 3VSKA 2ZM0A 3CITA 3VOLA 3IHAA 3PR6A 4HH3A 4BBVA 4JPMA 3HUOA 2WGVA 1TD5A 4NXBA 3MR0A 2C5WB 5HL6A 1PFLA 4DE1A 5EVIC 5GLAA 2J3TD 3F1PB 3BLSA 2Y2NA 3FPVA 3MXQA 3LIDA 1KGEA 4JGQA 5CEBA 2HZ5A 5HD5A 1X0OA 3LEQA 1DJCA 1LL8A 1XX2A 5HD3A 4GDBA 1F2KA 1AXBA 5FDSA 1MPLA 2ZC5B 3D9YA 3LIAA 3LICA 4P6ZS 5FDHA 1WYCA 2WUQA 1N9LA 3K3CA 3S4XA 4YNRA 4P6ZM 4X1LA 2OAP1 3HLEA 5EM1A 3CPTB 2P7JA 1OTBA 1LT0A 1W5DA 5EPHA 1MY8A 1UWPX 1G5UA 3IF6B 3ZYTA 4ESPA 2H5SA 3B3XA 1IEMA 2J9OA 4IVKA 3A3EA 1BSGA 4ZJ2A 5EUAA 2R78A 1FQGA 4OOYA 1S4RA 3G34A 3RTYA 4NEED 3TE8A 5FAOA 3A3JA 3LYXA 2J7VA 1A0KA 3PTEA 1SZVA 4Y17A 4B4XA 5GLCA 3S7QA 2JE5A 1S0WA 4ARZB 5EVIB 2H28A 4IJGA 1L0FA 2W1TA 2UWXA 2XSSA 3MS6A 3ISGA 4F3LB 3ZQ5A 4E3IA 5CHUA 4GB7A 4H6JB 1FR1A 3U4LP 3IX3A 4S2NC 3DTIA 3HREA 3UB5P 2V2FF 2XLNA 2A2LA 2C6WB 4LV0A 2P08A 4HP9A 1YKDA 3SH8A 1TS7A 4HBTA 1HZOA 3UE1A 4MMNA 3E2LA 3GV9A 5FL3A 1PWCA 1YLJA 5FI2A 4NXFA 5EV0A 3R7WA 2G2UA 2L1MA 1U60A 2M7UA 1NY0A 2Y2OA 4OQIA 2ZC4B 4G3KA 1CEFA 3BEBA 4IBXA 1ZC2A 4KQQA 3V3SA 2UV0E 3IX8A 5FASA 3VFFA 4LCMA 4BD0A 1N9BA 3HLCA 4UA7A 3QHYA 4MBFA 4MNRA 3T4LA 3N7WA 1FCOA 5EOEA 1OTIA 1Z6FA 4K0WA 3CMZA 4YWZA 2Z2MB 5BOHA 4XUZA 5J8XA 2Q0OA 3CLOA 3NC8A 5A92A 2FFYA 3O3VA 4GHIB 3F1NA 4UAAA 1PNEA 1W8QA 4I38A 2Y2QA 4CLCE 1PYYA 2Y2IA 2I72A 2ZD8A 5CERA 3G4PA 1N9OA 5KZHA 4IBRA 5IT5A 3PAEA 2WAFA 4IHQA 4CLCA 3P01A 1NWZA 5EM0A 3S7PA 2ZL1A 5A93A 1TF1A 2XD1A 4MBHA 3BQ8A 4Q0JA 3BFDA 4WN5A 4WZ5C 4LCLA 3BQAA 4LRXC 1K55C 3IXGA 4HP4A 3BFGA 2R9XA 2Y79A 1RGZA 1H8ZA 3O88A 3M6BA 2V20A 1P9WA 3SH9A 4GLQA 4R38A 4Z1WA 1I2SA 1UGUA 2XQZA 1IYPA 4EUVA 4S2IA 5M1AA 3UB6A 2PBDP 2OV5A 4OPYA 3QP4A 1D7EA 1S6RA 1KGGA 4HHDA 1E3UA 1CK3A 3LO7A 4R70A 1TDLA 3BECA 5FI6A 3ZHHA 1ZKJA 4HQAA 1FILA 4PM7A 1K0KA 1K4EA 2J9PA 3UB7A 5FSRA 1C3BA 3UDIA 3CI6A 4JXGA 5EFWA 3BLMA 1ZTUA 3JVUA 2Y2PA 4RVAA 4D2OA 4IUHA 4L9FA 4EQ1A 3PBNA 3UPPA 4Y15A 1KGFA 3UMDA 1E4DA 1S1YA 2P9VB 4L0LA 2QJ5A 2ZMFA 1P9RA 2NUPC 4Y13A 2MJ6A 4UEYA 5AVEA 3ZCZA 5J4EA 5CGWA 3KYQA 1Y28A 4OH0A 1AWIA 4JF6A 3UE3A 2WADA 2XFSA 2ZQ9A 1ONGA 1S4SA 1LSXA 3KYZA 3G2YA 3IWQA 5TBMA 3LR5A 5DTTA 4JF4A 5GL9A 1D06A 4JLFA 4WEKA 2PAVP 4A5RA 2DMWA 1H0MA 3N8SA 2XF3A 4R3JA 2Z6CA 4GDNA 3SS5A 4JBFA 3HLWA 2OWJA 1DRMA 2HP9A 1K54C 2H10A 2VV6A 1CQAA 3WS0A 1SKOB 3HJIA 1S1ZA 5CHJA 2B02A 1CI8A 3B42A 3CG5A 5G4ZA 1Y54A 1Q2PA 3BFEA 3KX0X 4ZJ1A 2XK1A 1ACFA 3S7OA 5FA7A 4JGRA 4PKYG 1K57C 1LI0A 4I5SA 4LFUA 3SOIA 3UMEA 5HWVA 2V0UA 3VP4A 1LHYA 3TJZC 4KZ4A 3G6OA 2RCXA 3W2ZA 1CI9A 3H9WA 1PW8A 1JTGA 2PR5A 1PIOA 5HPIA 1RCJA 1MWSA 3AGEA 3IBJA 5G4YA 2HDRA 3F1PA 5F82A 3S1YA 3HCYA 5FQJA 3NOUC 4E3NA 4GS9B 3E2KA 3V50A 1ZG4A 1PWDA 4Z9QA 1MZUA 5E2GA 3ZVTA 3K3DA 3LEZA 1PZOA 4CQHA 4K0XA 3O5YA 5F68A 3HUNA 3MXRA 2Y2GA 5GLBA 3G2ZA 3HLFA 3CPTA 3PHYA 1YLYA 1JVJA 5FEGA 4LRZE 2VGKA 2V1ZA 4E3KA 1HD8A 4DXCA 1H5XA 3IF6A 1LL9A 2Y2LA 4WMCD 4U0XA 4O8GA 1XA7A 4X53A 5FQMA 1W79A 2ZQAA 4KZBA 4B9OA 3RXXA 4X56A 3UPNA 3CUEC 1YLTA 1W7FA 2BASA 4BENA 2VV7A 4R0QA 3V67A 3TW8A 2B5RA 3KSGA 4HJ6A 2ZOIA 3EOIA 3OZHA 4FCFA 4PMAA 2K2NA 2I9VA 4ARZA 5EVIA 1L2SA 3G30A 1NLZA 4MN7A 3WS1A 4F3LA 3IX4A 4H6JA 1YLZA 1YLWA 1L3LA 4HOIA 3V39A 2JKTM 3BRMA 4R3BA 2ZBBA 1XJ3A 3JVVA 3IH8A 2PD8A 2V1BA 3E0YA 4QU3A 1VHMA 2A24B 3KSHA 1P97A 2BG1A 3LR0A 2PD7A 2ZC6B 1CEGA 3TSGA 3ZDJA 4X1MA 4DDYA 3W8KA 4GCZA 1OJGA 1L0DA 1IELA 3C4PA 1E25A 2Y2HA 2O9CA 3NOPC 3V3RA 4BMWA 3SZTA 3EQUA 1MWRA 3T1RA 4WL9A 3SW1A 2WGIA 3OOVA 2Y55A 1NZUA 3P09A 2Y8HA 4R1GA 1BTLA 5HW3A 4WYYA 5DKLA 2FFFB 1HTZA 1YAXA 1F98A 3NECA 3W4PA 3LIBA 4EERA 2Q9NA 4F94A 4GHIA 5CTNA 1M40A 4MEZA 4H8RA 5M18A 2OWHA 5TJJA 5GHYA 4BJPA 3A0RA 4S2NA 2M1CA 3MZEA 3A0SA 2XRNA 4Q8IA 3GMWA 4OP5A 1JTDA 4Q0HA 4S2PA 4BBTA 3Q7VB 4S2KA 3MF0A 4HIAA 3RH8B 4Y2FA 1K25A 3BFFA 3MZDA 4RX2A 1F9IA 1H8MA 5CECA 2Z6DA 2Y59A 2QHKA 5LBRA 4I3JA 4BL2A 4GNUA 2L0WA 4EEPA 1S67L 3QNCA 2WZZA 3QP1A 4KENB 1K56D 1LI9A 3NI9A 4I3IA 3T4OA 3QP2A 3H82B 2Z2LB 4R4SA 4DN0A 5F69A 2J80A 3QP5A 4KQRA 3IWOA 1KE4A 2IWBA 1IFQA 1GSXA 2LB5A 3SH7A 4HBUA 3LUQA 4E3OA 4WUJA 1YSPA 1ERMA 2A49A 1KDSA 3LR3A 2HGVA 1XP4A 2XEPA 3E4OA 3ZVWA 5CHMA 2OOLA 1OJ5A 4P6BA 5IS1A 1DJBA 2XDMA 3LIEA 2H0TA 2D01A 4OLDA 4DDSA 1K4FA 4S2MA 4KZAA 4EW7A 1FSYA 4RX3A 2EXAA 2R9WA 4DF6A 2P9VA 1I2WA 4GKUA 4QWOA 2JHEA 4GD8A 4OPQA 1XKZA 4LGWA 2XH9A 1IYSA 5CGSA 2W1RA 2K7SA 4OQHA 3T4JA 1K6RA 3PBRA 3A3DA 3MQOA 2JN7A 3GDIA 3LGOA 4EQIA 3E4QA 5AJGA 4WZ5A 3D4FA 5L07A 5EE8A 3PBSA 1K55A 4JKTA 1K6SA 3S7NA 1MWUA 2WKRA 4NG2A 5U47A 5KSCA 5E2EA 1YSQA 3RXWA 1VM1A 2V8FA 2V8CA 3ULFA 2XA7S 3N8LA 3ITBA 4FOFA 2J3TC 2XA7M 3V5MA 4WEJA 5CXWA 3CAXA 3VMAA 3FKWA 4KQOA 1KVLA 2XD5A 4DRTA 4R4RA 5F83A 3G35A 2QMIA 3T1XA 1LL5A 5A90A 4IEDA 2IA2A 5TR7A 4HI4A 4NKPA 4JXSA 4DE0A 2ZC3B 2W3HA 1VEUB 1SKOA 4CPKA 5L8MA 1G68A 3WWXA 2DCFA 3MKFA 4M3KA 2HPBA 3NHQA 3N6IA 4ETXA 2JKGA 2WKQA 5HZHA 3SS3A 3LY3A 3MZFA 1STZA 3WS5A 2X71A 5HDDA 4EBLA 2ZM2A 1GCEA 4OONA 2ZQ7A 1BT5A 3T4KA 3GVBA 3PBOA 4MN5A 3MBZA 1Q2QA 2VLGA 3FV7A 4X68A 5CTMA 2WKIA 2E8IA 2W3GA 2O0YA 4PAUA 1GHIA 1YMSA 3B47A 4BD1A 3OC2A 4U0TA 4KUOA 3OBFA 4GS9A 1IKGA 5I94A 4QY5A 5AVFA 1XA1A 3CWFA 5CX7A 4IVIA 3PBTA 1T19A 1JWPA 2KDKA 1DY6A 5KMWA 4BBUA 5DFYA 5IU1A 3C5AA 3EGDC 3RFBA 4ZRRA 1K54A 4I3AA 4OKPA 1SHVA 2K31A 4L9GA 1LSWA 1BYWA 1NXYA 5MC7A 2VKSA 3HLBA 1HVBA 1RGYA 1YM1A 4S2OA 5DJUA 4S2LA 1OT9A 2FH5A 3KYEA 3IWIA 5FQIA 1V9YA 3UDFA 4P0MA 1TDGA 1MXOA 4OPZA 3UE6A 3UN7A 3CZDA 4X25A 3LI9A 1K57A 4PM5A 3C38A 3OPHA 4ZDXA 5E2HA 2EWVA 1SDNA 4RQ9A 4OPRA 4KZ3A 2ZC7A 3OPLA 1ESUA 1MKMA 1ES4A 1ODVA 4NETA 4FTXA 1DJAA 4KZ9A 2EWWA 2HDQA 5F1FA 1EWZA 2NUTC 5EVEA 3CHWP 2HP6A 4Y3IA 4HNBA 3FC7A 3PBQA 5DF9A 2X01A 1GA9A 1MKIA 1JNUA 4Q0IA 4UQIS 3M2KA 3VE3A 4RA7A 3VV4A 2PYRA 4UQIM 4CJNA 1QMFA 1BLPA 5L2FA 2DRWA 1NRFA 3L9KA 4YINA 2HJEA 1BLCA 2JKTI 3HL9A 3BWLA 4WZ4A 3DW0A 3EEHA 1K38A 3BY8A 2A24A 4BL3A 2EX2A 4MLLA 4EWFA 1OTDA 3GECA 2PT7A 1NJ4A 1YQSA 3GTCA 4GOGA 4JGOA 4G3VA 4NXEA 1KE0A 2WYXA 4EXOA 1XGIA 4UHUA 1BLSA 3P98A 5J3WA 2Q9MA 3NULA 2GZAA 3PYPA 3NOTC 3CUEA 4HEFA 1VQQA 2HDUA 1G6AA 3M2JA 4QD4A 1S66L 5EOOA 3HBRA 2J8YA 5HAIA 5JYOA 5HAQA 1BULA 4XT2B 1JWVA 4NK3A 3WS2A 3H7WB 1XFNA 2WZXA 2O9BA 3EGXC 3LCEA 3MQ0A 5CEDA 2H0YA 3RJUA 3C30A 2XROA 3OPPA 3MFXA 2VX8A 1BZAA 1ES5A 4FD8A 2VJWA 4ZTKA 3ZG9B 3BJNA 1ALQA 3HLGA 1NLYA 3HJKA 3C7VA 1TVFA 2WK0A 3IS2B 2YKFA 4LLOB 4KQDA 4KG2A 4GD6A 2KX6A 3FWLA 3Q7VA 2VV8A 3R4KA 4D60A 3KO6A 4Y0UA 3IXHA 2V9AA 4OVDA 1PRQA 5HWWA 5HWTA 4KG5A 4B93A 1PI4A 4GN2A 1FR6A 3WRZA 1XFQA 5FI7A 2XGNA 1J3WA 1NRJA 4E6XA 4EEUA 2JCHA 3DBAA 4E6WA 1PW1A 2Y91A 3H82A 3DTEA 3TG9A 2Y4AA 3UB8A 1ES3A 3T4TA 3E98A 2O9AA 2HV1A 2ZMAA 5GHZA 5L09A 4DKIA 1W63M 1T1CA 2ZQDA 3BM6A 4OOMA 2V1AA 4Y5FA 3BY9A 1RP5A 2M7VA 2OSUA 4C3QA 4X6TA 3P7NA 5FAQA 3KSFA 4YOFA 3BFCA 1ERQA 4ME4A 2D02A 4DJ3A 1KVMA 3IXBA 5EECA 1XXMA 2KLIA 2QPNA 1J9MA 5FQQA 1ONHA 2CC1A 2XFTA 2HDSA 2IWCA 1FSWA 1SCWA 3IBRA 2W0NA 3VP1A 1VETB 5FATA 3F1OB 1ESIA 1L0GA 2EX9A 1M6KA 1O07A 3ZG0A 2W3EA 4P85A 4QB8A 4O7DA 1YMXA 4HESA 1OMEA 4I39A 1XJ6A 1DP8A 4CLCD 4N9KA 3MSHA 3GR2A 4EBPA 3ZG5A 5AQAA 3PXPA 4BQMA 1EROA 5HARA 3C7UA 5J7EA 5C5KA 2PR6A 4HY8A 4ETZA 2YKHA 3MMHA 4QHCA 4WMCA 3VOZA 1OT6A 3C2WA 3KSIA 4L9EA 5AQ9A 3OPRA 4JF5A 4MDZA 1VEUA 3IH9A 3HUMA 4N1HA 3EWKA 3AGFA 3VSLA 1OPXA 2WGWB 1N9NA 3LI8A 2JKRM 4HH2A 4N9LA 2VGLS 3CJMA 3OCNA 2RL3A 3TOIA 2HJ9C 1G6OA 2J3WA 5IHVA 3Q81A 1E3UD 2VGLM 1BLHA 3T12B 1MBLA 4KZ7A 4Y7PA 3O86A 4GW9A 4U3TA 2XR0A 2G2WA 4LPZA 1CJFA 1IYQA 3NIAA 2QWSA 4MBKA 1LSVA 3O87A 3T1QB 5DJTA 5FEFA 1GSWA 3JYIA 2QKPA 3IF5A 3ZFZA 3UE0A 2ZLYA
chains in the Genus database with same CATH topology
3FPVA 3MXQA 3LIDA 3B47A 2P04A 4JGQA 3OC2A 3HCYA 3NOUC 4KUOA 3OBFA 5HD5A 4GS9A 4GS9B 5AVFA 1X0OA 3CWFA 4G3WA 5CX7A 1MZUA 3PBTA 1LL8A 4BWIA 1T19A 5HD3A 2KDKA 4BBUA 1P0ZA 1TS6A 5DFYA 4II7A 1H3QA 5IU1A 3K3DA 3LIAA 1W63Q 3LICA 4P6ZS 2KOIA 3UB9A 4CQHA 3EGDC 5DKKA 1N9LA 3RFBA 3O5YA 3K3CA 5F68A 4MCWA 4P6ZM 4YNRA 4ZRRA 2OAP1 4I3AA 3FPWA 2K31A 3FG8A 4L9GA 1LSWA 3PHYA 1BYWA 5MC7A 4FSFA 2VKSA 2P7JA 4LRZE 1OTBA 5DJUA 3T4QA 1LT0A 1OT9A 2FH5A 1UWPX 1V9YA 3TRCA 3UE6A 3ZYTA 4O8GA 2VEAA 3LI9A 2PDRA 3C38A 4B9OA 2R78A 2EWVA 1S4RA 4RQ9A 3CUEC 3LR4A 4HJ3A 2BASA 3RTYA 2VV7A 4NEED 3V67A 3TE8A 1MKMA 3TW8A 3LYXA 1ODVA 3KSGA 4HJ6A 2ZOIA 3EOIA 4PHTA 2K2NA 2EWWA 2I9VA 3S7QA 4ARZA 2NUTC 4ARZB 1NLZA 3EEAA 5HPFA 4Y3IA 1DP6A 2H28A 4HNBA 3FC7A 3PBQA 4IJGA 5DF9A 2W1TA 3NJAA 2XSSA 4MN7A 2W1TB 4F3LA 1JNUA 4Q0IA 4UQIS 4F3LB 2GJ3A 3ZQ5A 3VE3A 3OCLA 4H6JA 1V9ZA 4H6JB 3VV4A 2PYRA 4UQIM 3VE4A 4HOIA 1T1AA 2HJEA 2VA0A 4O01A 2JKTM 2JKTI 2ZBBA 2HF6A 2A2LA 1XJ3A 3JVVA 2P08A 3BWLA 3BW6A 3EEHA 4HP9A 1YKDA 2PD8A 3BY8A 2V1BA 2GX5A 3E0YA 2A24A 4CLCC 1TS7A 1VHMA 2A24B 4EU0A 3KSHA 4MMNA 1OTDA 3GECA 2PT7A 1P97A 4KUKA 3LR0A 2PD7A 1TS8A 4JGOA 5FL3A 4G3VA 4NXEA 4GCZA 4NXFA 1OJGA 2EA9A 3R7WA 4EXOA 2O9CA 2L1MA 3R7WB 3NOPC 1IOUA 1KOUA 2M7UA 4BMWA 5J3WA 3EQUA 2W27A 2W3DA 4G3KA 5KSHA 2GZAA 3PYPA 3NOTC 3CUEA 4EETB 4WL9A 3SW1A 3OOVA 3E4PA 2Y8HA 2LB9A 3T50A 1S66L 5DKLA 1UWNX 3T4LA 1YAXA 4XT2A 3H7WA 4XT2B 1F98A 3H7WB 1OTIA 2O99A 1XFNA 3T4SA 2O9BA 3EGXC 4YWZA 3LIBA 3MQ0A 4EERA 3CLOA 3C30A 2XROA 3MFXA 3MJQA 4GHIA 2VX8A 4GHIB 2G7UA 3F1NA 1ZHHB 2VJWA 3F1NB 2OWHA 5TJJA 4BJPA 3A0RA 3BJNA 5F6AA 4I38A 2M1CA 1NLYA 4E04A 3HJKA 3A0SA 4CLCE 2XRNA 5DFXA 4NXGA 1N9OA 3IS2A 3IS2B 2YKFA 5IT5A 4LLOB 4KQDA 4Q0HA 1XJ2A 2KX6A 4IHQA 4CLCA 2VV8A 4BBTA 4CLCB 3P01A 3R4KA 2CMNA 1NWZA 3MF0A 4HIAA 3KO6A 3RH8B 3S7PA 4Y2FA 5A8BA 2V9AA 1F9IA 1H8MA 1TF1A 5HWWA 3BQ8A 4Q0JA 5HWTA 4WN5A 2Z6DA 2QHKA 5LBRA 4R3AA 3BQAA 4I3JA 4LRXC 4B93A 2INWA 2L0WA 4EEPA 1S67L 4HP4A 1XFQA 4WELA 1NRJA 2Y79A 5K5BA 3ICYA 4EEUA 1P9WA 4GLQA 4R38A 3DBAA 4I3IA 1UGUA 4JGPA 4Z1WA 3T4OA 1F5MA 4EUVA 3UB6A 3C8CA 3H82A 3H82B 3UB8A 3T4TA 3E98A 2O9AA 2ZOHA 1D7EA 4DN0A 5F69A 2J80A 2HV1A 5F5YA 4HHDA 1T18A 4R70A 2WKPA 1OTEA 1IFQA 1MC0A 1GSXA 2LB5A 4PKYA 4OOLA 1TS0A 3LUQA 4WUJA 1YSPA 2FZ0A 1W63M 1T1CA 4HQAA 1T1BA 3LR3A 5KIZA 2HGVA 4OOMA 4QPRA 1DP9A 2V1AA 3E4OA 4Y5FA 2OOLA 3BY9A 4M4XA 1OJ5A 2M7VA 3UB7A 1EW0A 5IS1A 2VZWA 3CI6A 3LIEA 5EFWA 3P7NA 2D01A 1ZTUA 3KSFA 3JVUA 4YOFA 1XJ4A 4IUHA 2QYBA 4L9FA 4WLAA 4ME4A 2D02A 4EW7A 3A0VA 4DJ3A 4EQ1A 3PBNA 3D72A 3EQVA 1VB6A 2KLIA 2W3FA 3MQQA 3UMDA 1S1YA 4L0LA 2QJ5A 2ZMFA 3K2NA 3IBRA 1P9RA 2W0NA 2JHEA 2NUPC 3D3OA 5HSQA 2MJ6A 2K7SA 2W1RA 4UEYA 5AVEA 3F1OA 3T4JA 5J4EA 3PBRA 5HDSA 3F1OB 3KYQA 1Y28A 3MQOA 4MN6A 2JN7A 2ZMVA 3GDIA 3E4QA 5AJGA 2W3EA 3UE3A 1S4SA 1LSXA 3KYZA 3PBSA 3S7NA 4WF0A 5TBMA 3LR5A 2WKRA 4I39A 5TBMB 1XJ6A 1YSQA 1DP8A 4CLCD 4AFIA 4IUKA 1D06A 3ULFA 3U2AA 4WEKA 2XA7S 2PHYA 3PXPA 1OTAA 2DMWA 1WA9A 1GSVA 4FOFA 2J3TC 2XA7M 3LIFA 4O0PA 2Z6CA 4WEJA 4HJ4A 5HDCA 3CAXA 2L4RA 5J7EA 5C5KA 2PR6A 4KQOA 2PYPA 4HY8A 4ETZA 2YKHA 3MMHA 1OT6A 3C2WA 3KSIA 4EESA 4DMZA 2OWJA 1DRMA 2GNXA 4LRYC 2IA2A 4L9EA 4HI4A 4NKPA 2VV6A 3LFVA 4MDZA 1G28A 2W3HA 3B33A 3EWKA 3HJIA 1S1ZA 4K08A 4GJ4A 2B02A 5L8MA 1OPXA 3B42A 5G4ZA 1N9NA 3LI8A 2JKRM 2V0WA 3KX0X 4HH2A 2JKRI 2VGLS 3OCNA 2QJ7A 3S7OA 4R6LA 2HJ9C 1G6OA 2J3WA 4JGRA 4PKYG 2VGLM 3NHQA 4ETXA 2B18A 2WKQA 5HZHA 4I5SA 4DJ2A 1STZA 4GW9A 3UMEA 5HDDA 5I5LA 5HWVA 4LPZA 2V0UA 2OAQ1 3OLOA 3TJZC 3G6OA 4PAUA 3CITA 3T4KA 3VOLA 2QWSA 3PR6A 3PBOA 4MN5A 3H9WA 4HH3A 3W2ZA 4BBVA 1LSVA 2PR5A 2VLGA 1TD5A 4NXBA 5HPIA 3MR0A 5DJTA 5HL6A 1GSWA 3IBJA 2QKPA 5G4YA 2W3GA 2O0YA 3F1PA 2J3TD 3F1PB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q0H A;  3HCY A;  4O01 A;  5AJG A;  3NOU C;  3R4K A;  3MF0 A;  3KO6 A;  2W3E A;  3OBF A;  3S7P A;  4Y2F A;  3S7N A;  4G3W A;  1YKD A;  4BWI A;  2GX5 A;  3E0Y A;  1TF1 A;  1YSQ A;  4IUK A;  1VHM A;  4Q0J A;  4EU0 A;  3KSH A;  4MMN A;  5LBR A;  5DFY A;  4LRX C;  4FOF A;  2KOI A;  4CQH A;  4G3V A;  4O0P A;  3RFB A;  3O5Y A;  5C5K A;  4MCW A;  4YNR A;  4ZRR A;  4ETZ A;  2Y79 A;  2K31 A;  5K5B A;  3MMH A;  3C2W A;  3KSI A;  2O9C A;  4GLQ A;  3DBA A;  4Z1W A;  4DMZ A;  3NOP C;  2VKS A;  4LRZ E;  1F5M A;  2M7U A;  4EUV A;  4LRY C;  2IA2 A;  2W3D A;  4G3K A;  3LFV A;  4MDZ A;  3E98 A;  2O9A A;  3TRC A;  2W3H A;  3NOT C;  4DN0 A;  4O8G A;  4R70 A;  2VEA A;  5L8M A;  3OOV A;  1MC0 A;  2LB5 A;  1YSP A;  2Y8H A;  2LB9 A;  2HGV A;  4QPR A;  3S7O A;  4R6L A;  4RQ9 A;  4Y5F A;  2OOL A;  3NHQ A;  2M7V A;  4ETX A;  2B18 A;  2VZW A;  2O99 A;  2O9B A;  3CI6 A;  1STZ A;  1MKM A;  4GW9 A;  1ZTU A;  3KSF A;  5I5L A;  3KSG A;  4YOF A;  3MQ0 A;  2K2N A;  4IUH A;  2QYB A;  2XRO A;  4ME4 A;  3G6O A;  3S7Q A;  2G7U A;  2KLI A;  2VJW A;  3CIT A;  2W3F A;  5TJJ A;  3EEA A;  5HPF A;  3W2Z A;  4Y3I A;  3BJN A;  4IJG A;  2W1T A;  2XSS A;  4E04 A;  1TD5 A;  2W1T B;  3K2N A;  2ZMF A;  4MN7 A;  3IBR A;  2XRN A;  5DFX A;  4Q0I A;  5HPI A;  3ZQ5 A;  5HL6 A;  3D3O A;  5HSQ A;  3IBJ A;  2W1R A;  3VV4 A;  2W3G A;  2O0Y A;  4PAU A; 
#chains in the Genus database with same CATH topology
 4QJG A;  2WKH A;  3FYZ A;  1JWZ A;  2P04 A;  2WKE A;  5TFQ A;  4B88 A;  3FKV A;  5M19 A;  3A3I A;  1FIK A;  1PWG A;  3WRT A;  4G3W A;  4BWI A;  1N4O A;  4OP8 A;  1P0Z A;  1TS6 A;  1WYB A;  4II7 A;  1H3Q A;  1W63 Q;  4LV1 A;  1L0E A;  2KOI A;  3UB9 A;  5DKK A;  4MCW A;  4ZAM A;  3VOY A;  3VFH A;  1FCM A;  3FPW A;  3FG8 A;  1SDE A;  5FQK A;  4FSF A;  1XGJ A;  2QZ6 A;  1CF0 A;  5DF8 A;  3T4Q A;  3Q7Z A;  5DTS A;  3TRC A;  2PU4 A;  4X55 A;  5HX9 A;  4OQG A;  3G31 A;  1FCN A;  2VK3 A;  2VEA A;  2PDR A;  3QNB A;  1FOF A;  3LR4 A;  1NYY A;  4HJ3 A;  3SS4 A;  2PRF A;  3NCK A;  2Y2M A;  2BTF P;  3N8R A;  1ES2 A;  4PHT A;  3LY4 A;  1EI5 A;  2EFU A;  5FAP A;  3VP2 A;  5L10 A;  3IT9 A;  3EEA A;  5HPF A;  4KG6 A;  3UDX A;  1DP6 A;  1D1J A;  1PI5 A;  1XPB A;  3NJA A;  2PU2 A;  2W1T B;  4E3L A;  2OLU A;  2GJ3 A;  3OCL A;  4N1X A;  1V9Z A;  3UNW A;  4DE2 A;  3DWZ A;  3VE4 A;  2HP5 A;  1T1A A;  3G32 A;  2B95 A;  4XUX A;  2VA0 A;  4O01 A;  1HLU P;  1MWT A;  2JKF A;  4WBG A;  5CGX A;  2HF6 A;  1O7E A;  5EVL A;  5D3O A;  3BW6 A;  3UY6 A;  3WS4 A;  3ZNY A;  2GX5 A;  2JBF A;  4CLC C;  1K56 A;  4EU0 A;  4E3M A;  3BYD A;  4FH2 A;  3A3F A;  4KUK A;  2P74 A;  3MXS A;  1TS8 A;  3Q82 A;  3Q07 A;  2EA9 A;  4ZBE A;  1QME A;  3ZNT A;  4FUW A;  4PM9 A;  4P87 A;  4KZ5 A;  4S2J A;  3R7W B;  3DTK A;  4E3J A;  1IOU A;  1KOU A;  4LV2 A;  3Q1F A;  5TGF A;  2ZJ9 A;  4XXR A;  2W27 A;  2W3D A;  5KSH A;  5AQ7 A;  3DAV A;  4EET B;  3ZG7 B;  2ACG A;  2VGJ A;  2Y2J A;  5CRF A;  3ZGA B;  3E4P A;  3NBL A;  2LB9 A;  3T50 A;  2ZM8 A;  3N4I A;  2EFX A;  1UWN X;  4XT2 A;  3H7W A;  4UA9 A;  5DVA A;  4PM8 A;  5HFO A;  1I5Q A;  2O99 A;  5GHX A;  3T4S A;  4C6Y A;  5AQB A;  1ZG6 A;  1SKF A;  2ZQC A;  3JPU A;  3MJQ A;  2GDN A;  3IQA A;  4KZ8 A;  2G7U A;  1KE3 A;  5E2F A;  1LLB A;  1ZHH B;  1GA0 A;  3F1N B;  3M6H A;  3NDG A;  3NY4 A;  5F6A A;  1H8Y A;  5E43 A;  1TEM A;  1WE4 A;  4E04 A;  1GHP A;  3IHB A;  3UPO A;  5DFX A;  4NXG A;  1BUE A;  3IS2 A;  3T1S A;  5EVI D;  3S22 A;  4B4Z A;  1XJ2 A;  4EUZ A;  4CLC B;  3W4Q A;  5JYP A;  2ZQ8 A;  2CMN A;  4UA6 A;  4WM9 A;  3I7J A;  4PM6 A;  2ZL1 B;  5HL1 A;  3VP0 A;  5A8B A;  3FZC A;  3ITA A;  1PZP A;  4Y0O A;  4R3A A;  5F1G A;  4GZB A;  2INW A;  3HVF A;  4WEL A;  2OLV A;  3GQZ A;  5K5B A;  3ICY A;  2BLS A;  4JGP A;  1F5M A;  4K91 A;  4RYE A;  3C8C A;  2EX6 A;  3AGD A;  4OQ0 A;  2ZOH A;  2PBY A;  4X69 A;  5F5Y A;  4N92 A;  1T18 A;  5FQ9 A;  2WKP A;  1OTE A;  2X02 A;  1MC0 A;  4DXB A;  4PKY A;  4OOL A;  1TS0 A;  3MKE A;  2FZ0 A;  1T1B A;  5KIZ A;  2WAE A;  4QPR A;  1DP9 A;  4M4X A;  1EW0 A;  2VZW A;  5DF7 A;  2EXB A;  4ZJ3 A;  1XJ4 A;  4EV4 A;  1KDW A;  2E8J A;  2QYB A;  4WLA A;  3A0V A;  3PAG A;  3D72 A;  3EQV A;  1VB6 A;  4OLG A;  2W3F A;  3MQQ A;  1GHM A;  3K2N A;  1YLP A;  3DTM A;  3D3O A;  5HSQ A;  1VET A;  4C75 A;  3F1O A;  4R23 A;  5HDS A;  3ZG8 B;  4JXV A;  4MN6 A;  2ZMV A;  1Y4O A;  4QY6 A;  2DNS A;  4ID4 A;  4DE3 A;  2Y2K A;  4WF0 A;  4BLM A;  1YPR A;  5TBM B;  3IXD A;  4LV3 A;  4AFI A;  4IUK A;  3U2A A;  3VP3 A;  2PHY A;  4JXW A;  1OTA A;  1WA9 A;  1GSV A;  3QP6 A;  3LIF A;  4O0P A;  5HDC A;  4HJ4 A;  1YT4 A;  2L4R A;  5A91 A;  4PPR A;  1IKI A;  2PYP A;  3UO9 A;  3QP8 A;  2IWD A;  4EES A;  5G18 A;  4DMZ A;  1NYM A;  2GNX A;  4FH4 A;  4Y0T A;  4LRY C;  3L7H A;  3LFV A;  1G28 A;  3B33 A;  3DWK A;  3C4O A;  4K08 A;  4GJ4 A;  2WGW A;  2A3U A;  2V0W A;  5DTK A;  3W4O A;  3HLD A;  1W8Y A;  4LEN A;  2JKR I;  5HAP A;  4KZ6 A;  5GLD A;  1Z09 A;  3IF6 C;  2QJ7 A;  1IYO A;  2AVX A;  4R6L A;  3MFD A;  2EX8 A;  4EBN A;  2B18 A;  4DJ2 A;  3GRJ A;  5I5L A;  4YFM A;  1NZO A;  2OAQ 1;  3OLO A;  3NDE A;  2JC7 A;  3GSG A;  3VSK A;  2ZM0 A;  3CIT A;  3VOL A;  3IHA A;  3PR6 A;  4HH3 A;  4BBV A;  4JPM A;  3HUO A;  2WGV A;  1TD5 A;  4NXB A;  3MR0 A;  2C5W B;  5HL6 A;  1PFL A;  4DE1 A;  5EVI C;  5GLA A;  2J3T D;  3F1P B;  3BLS A;  2Y2N A;  3FPV A;  3MXQ A;  3LID A;  1KGE A;  4JGQ A;  5CEB A;  2HZ5 A;  5HD5 A;  1X0O A;  3LEQ A;  1DJC A;  1LL8 A;  1XX2 A;  5HD3 A;  4GDB A;  1F2K A;  1AXB A;  5FDS A;  1MPL A;  2ZC5 B;  3D9Y A;  3LIA A;  3LIC A;  4P6Z S;  5FDH A;  1WYC A;  2WUQ A;  1N9L A;  3K3C A;  3S4X A;  4YNR A;  4P6Z M;  4X1L A;  2OAP 1;  3HLE A;  5EM1 A;  3CPT B;  2P7J A;  1OTB A;  1LT0 A;  1W5D A;  5EPH A;  1MY8 A;  1UWP X;  1G5U A;  3IF6 B;  3ZYT A;  4ESP A;  2H5S A;  3B3X A;  1IEM A;  2J9O A;  4IVK A;  3A3E A;  1BSG A;  4ZJ2 A;  5EUA A;  2R78 A;  1FQG A;  4OOY A;  1S4R A;  3G34 A;  3RTY A;  4NEE D;  3TE8 A;  5FAO A;  3A3J A;  3LYX A;  2J7V A;  1A0K A;  3PTE A;  1SZV A;  4Y17 A;  4B4X A;  5GLC A;  3S7Q A;  2JE5 A;  1S0W A;  4ARZ B;  5EVI B;  2H28 A;  4IJG A;  1L0F A;  2W1T A;  2UWX A;  2XSS A;  3MS6 A;  3ISG A;  4F3L B;  3ZQ5 A;  4E3I A;  5CHU A;  4GB7 A;  4H6J B;  1FR1 A;  3U4L P;  3IX3 A;  4S2N C;  3DTI A;  3HRE A;  3UB5 P;  2V2F F;  2XLN A;  2A2L A;  2C6W B;  4LV0 A;  2P08 A;  4HP9 A;  1YKD A;  3SH8 A;  1TS7 A;  4HBT A;  1HZO A;  3UE1 A;  4MMN A;  3E2L A;  3GV9 A;  5FL3 A;  1PWC A;  1YLJ A;  5FI2 A;  4NXF A;  5EV0 A;  3R7W A;  2G2U A;  2L1M A;  1U60 A;  2M7U A;  1NY0 A;  2Y2O A;  4OQI A;  2ZC4 B;  4G3K A;  1CEF A;  3BEB A;  4IBX A;  1ZC2 A;  4KQQ A;  3V3S A;  2UV0 E;  3IX8 A;  5FAS A;  3VFF A;  4LCM A;  4BD0 A;  1N9B A;  3HLC A;  4UA7 A;  3QHY A;  4MBF A;  4MNR A;  3T4L A;  3N7W A;  1FCO A;  5EOE A;  1OTI A;  1Z6F A;  4K0W A;  3CMZ A;  4YWZ A;  2Z2M B;  5BOH A;  4XUZ A;  5J8X A;  2Q0O A;  3CLO A;  3NC8 A;  5A92 A;  2FFY A;  3O3V A;  4GHI B;  3F1N A;  4UAA A;  1PNE A;  1W8Q A;  4I38 A;  2Y2Q A;  4CLC E;  1PYY A;  2Y2I A;  2I72 A;  2ZD8 A;  5CER A;  3G4P A;  1N9O A;  5KZH A;  4IBR A;  5IT5 A;  3PAE A;  2WAF A;  4IHQ A;  4CLC A;  3P01 A;  1NWZ A;  5EM0 A;  3S7P A;  2ZL1 A;  5A93 A;  1TF1 A;  2XD1 A;  4MBH A;  3BQ8 A;  4Q0J A;  3BFD A;  4WN5 A;  4WZ5 C;  4LCL A;  3BQA A;  4LRX C;  1K55 C;  3IXG A;  4HP4 A;  3BFG A;  2R9X A;  2Y79 A;  1RGZ A;  1H8Z A;  3O88 A;  3M6B A;  2V20 A;  1P9W A;  3SH9 A;  4GLQ A;  4R38 A;  4Z1W A;  1I2S A;  1UGU A;  2XQZ A;  1IYP A;  4EUV A;  4S2I A;  5M1A A;  3UB6 A;  2PBD P;  2OV5 A;  4OPY A;  3QP4 A;  1D7E A;  1S6R A;  1KGG A;  4HHD A;  1E3U A;  1CK3 A;  3LO7 A;  4R70 A;  1TDL A;  3BEC A;  5FI6 A;  3ZHH A;  1ZKJ A;  4HQA A;  1FIL A;  4PM7 A;  1K0K A;  1K4E A;  2J9P A;  3UB7 A;  5FSR A;  1C3B A;  3UDI A;  3CI6 A;  4JXG A;  5EFW A;  3BLM A;  1ZTU A;  3JVU A;  2Y2P A;  4RVA A;  4D2O A;  4IUH A;  4L9F A;  4EQ1 A;  3PBN A;  3UPP A;  4Y15 A;  1KGF A;  3UMD A;  1E4D A;  1S1Y A;  2P9V B;  4L0L A;  2QJ5 A;  2ZMF A;  1P9R A;  2NUP C;  4Y13 A;  2MJ6 A;  4UEY A;  5AVE A;  3ZCZ A;  5J4E A;  5CGW A;  3KYQ A;  1Y28 A;  4OH0 A;  1AWI A;  4JF6 A;  3UE3 A;  2WAD A;  2XFS A;  2ZQ9 A;  1ONG A;  1S4S A;  1LSX A;  3KYZ A;  3G2Y A;  3IWQ A;  5TBM A;  3LR5 A;  5DTT A;  4JF4 A;  5GL9 A;  1D06 A;  4JLF A;  4WEK A;  2PAV P;  4A5R A;  2DMW A;  1H0M A;  3N8S A;  2XF3 A;  4R3J A;  2Z6C A;  4GDN A;  3SS5 A;  4JBF A;  3HLW A;  2OWJ A;  1DRM A;  2HP9 A;  1K54 C;  2H10 A;  2VV6 A;  1CQA A;  3WS0 A;  1SKO B;  3HJI A;  1S1Z A;  5CHJ A;  2B02 A;  1CI8 A;  3B42 A;  3CG5 A;  5G4Z A;  1Y54 A;  1Q2P A;  3BFE A;  3KX0 X;  4ZJ1 A;  2XK1 A;  1ACF A;  3S7O A;  5FA7 A;  4JGR A;  4PKY G;  1K57 C;  1LI0 A;  4I5S A;  4LFU A;  3SOI A;  3UME A;  5HWV A;  2V0U A;  3VP4 A;  1LHY A;  3TJZ C;  4KZ4 A;  3G6O A;  2RCX A;  3W2Z A;  1CI9 A;  3H9W A;  1PW8 A;  1JTG A;  2PR5 A;  1PIO A;  5HPI A;  1RCJ A;  1MWS A;  3AGE A;  3IBJ A;  5G4Y A;  2HDR A;  3F1P A;  5F82 A;  3S1Y A;  3HCY A;  5FQJ A;  3NOU C;  4E3N A;  4GS9 B;  3E2K A;  3V50 A;  1ZG4 A;  1PWD A;  4Z9Q A;  1MZU A;  5E2G A;  3ZVT A;  3K3D A;  3LEZ A;  1PZO A;  4CQH A;  4K0X A;  3O5Y A;  5F68 A;  3HUN A;  3MXR A;  2Y2G A;  5GLB A;  3G2Z A;  3HLF A;  3CPT A;  3PHY A;  1YLY A;  1JVJ A;  5FEG A;  4LRZ E;  2VGK A;  2V1Z A;  4E3K A;  1HD8 A;  4DXC A;  1H5X A;  3IF6 A;  1LL9 A;  2Y2L A;  4WMC D;  4U0X A;  4O8G A;  1XA7 A;  4X53 A;  5FQM A;  1W79 A;  2ZQA A;  4KZB A;  4B9O A;  3RXX A;  4X56 A;  3UPN A;  3CUE C;  1YLT A;  1W7F A;  2BAS A;  4BEN A;  2VV7 A;  4R0Q A;  3V67 A;  3TW8 A;  2B5R A;  3KSG A;  4HJ6 A;  2ZOI A;  3EOI A;  3OZH A;  4FCF A;  4PMA A;  2K2N A;  2I9V A;  4ARZ A;  5EVI A;  1L2S A;  3G30 A;  1NLZ A;  4MN7 A;  3WS1 A;  4F3L A;  3IX4 A;  4H6J A;  1YLZ A;  1YLW A;  1L3L A;  4HOI A;  3V39 A;  2JKT M;  3BRM A;  4R3B A;  2ZBB A;  1XJ3 A;  3JVV A;  3IH8 A;  2PD8 A;  2V1B A;  3E0Y A;  4QU3 A;  1VHM A;  2A24 B;  3KSH A;  1P97 A;  2BG1 A;  3LR0 A;  2PD7 A;  2ZC6 B;  1CEG A;  3TSG A;  3ZDJ A;  4X1M A;  4DDY A;  3W8K A;  4GCZ A;  1OJG A;  1L0D A;  1IEL A;  3C4P A;  1E25 A;  2Y2H A;  2O9C A;  3NOP C;  3V3R A;  4BMW A;  3SZT A;  3EQU A;  1MWR A;  3T1R A;  4WL9 A;  3SW1 A;  2WGI A;  3OOV A;  2Y55 A;  1NZU A;  3P09 A;  2Y8H A;  4R1G A;  1BTL A;  5HW3 A;  4WYY A;  5DKL A;  2FFF B;  1HTZ A;  1YAX A;  1F98 A;  3NEC A;  3W4P A;  3LIB A;  4EER A;  2Q9N A;  4F94 A;  4GHI A;  5CTN A;  1M40 A;  4MEZ A;  4H8R A;  5M18 A;  2OWH A;  5TJJ A;  5GHY A;  4BJP A;  3A0R A;  4S2N A;  2M1C A;  3MZE A;  3A0S A;  2XRN A;  4Q8I A;  3GMW A;  4OP5 A;  1JTD A;  4Q0H A;  4S2P A;  4BBT A;  3Q7V B;  4S2K A;  3MF0 A;  4HIA A;  3RH8 B;  4Y2F A;  1K25 A;  3BFF A;  3MZD A;  4RX2 A;  1F9I A;  1H8M A;  5CEC A;  2Z6D A;  2Y59 A;  2QHK A;  5LBR A;  4I3J A;  4BL2 A;  4GNU A;  2L0W A;  4EEP A;  1S67 L;  3QNC A;  2WZZ A;  3QP1 A;  4KEN B;  1K56 D;  1LI9 A;  3NI9 A;  4I3I A;  3T4O A;  3QP2 A;  3H82 B;  2Z2L B;  4R4S A;  4DN0 A;  5F69 A;  2J80 A;  3QP5 A;  4KQR A;  3IWO A;  1KE4 A;  2IWB A;  1IFQ A;  1GSX A;  2LB5 A;  3SH7 A;  4HBU A;  3LUQ A;  4E3O A;  4WUJ A;  1YSP A;  1ERM A;  2A49 A;  1KDS A;  3LR3 A;  2HGV A;  1XP4 A;  2XEP A;  3E4O A;  3ZVW A;  5CHM A;  2OOL A;  1OJ5 A;  4P6B A;  5IS1 A;  1DJB A;  2XDM A;  3LIE A;  2H0T A;  2D01 A;  4OLD A;  4DDS A;  1K4F A;  4S2M A;  4KZA A;  4EW7 A;  1FSY A;  4RX3 A;  2EXA A;  2R9W A;  4DF6 A;  2P9V A;  1I2W A;  4GKU A;  4QWO A;  2JHE A;  4GD8 A;  4OPQ A;  1XKZ A;  4LGW A;  2XH9 A;  1IYS A;  5CGS A;  2W1R A;  2K7S A;  4OQH A;  3T4J A;  1K6R A;  3PBR A;  3A3D A;  3MQO A;  2JN7 A;  3GDI A;  3LGO A;  4EQI A;  3E4Q A;  5AJG A;  4WZ5 A;  3D4F A;  5L07 A;  5EE8 A;  3PBS A;  1K55 A;  4JKT A;  1K6S A;  3S7N A;  1MWU A;  2WKR A;  4NG2 A;  5U47 A;  5KSC A;  5E2E A;  1YSQ A;  3RXW A;  1VM1 A;  2V8F A;  2V8C A;  3ULF A;  2XA7 S;  3N8L A;  3ITB A;  4FOF A;  2J3T C;  2XA7 M;  3V5M A;  4WEJ A;  5CXW A;  3CAX A;  3VMA A;  3FKW A;  4KQO A;  1KVL A;  2XD5 A;  4DRT A;  4R4R A;  5F83 A;  3G35 A;  2QMI A;  3T1X A;  1LL5 A;  5A90 A;  4IED A;  2IA2 A;  5TR7 A;  4HI4 A;  4NKP A;  4JXS A;  4DE0 A;  2ZC3 B;  2W3H A;  1VEU B;  1SKO A;  4CPK A;  5L8M A;  1G68 A;  3WWX A;  2DCF A;  3MKF A;  4M3K A;  2HPB A;  3NHQ A;  3N6I A;  4ETX A;  2JKG A;  2WKQ A;  5HZH A;  3SS3 A;  3LY3 A;  3MZF A;  1STZ A;  3WS5 A;  2X71 A;  5HDD A;  4EBL A;  2ZM2 A;  1GCE A;  4OON A;  2ZQ7 A;  1BT5 A;  3T4K A;  3GVB A;  3PBO A;  4MN5 A;  3MBZ A;  1Q2Q A;  2VLG A;  3FV7 A;  4X68 A;  5CTM A;  2WKI A;  2E8I A;  2W3G A;  2O0Y A;  4PAU A;  1GHI A;  1YMS A;  3B47 A;  4BD1 A;  3OC2 A;  4U0T A;  4KUO A;  3OBF A;  4GS9 A;  1IKG A;  5I94 A;  4QY5 A;  5AVF A;  1XA1 A;  3CWF A;  5CX7 A;  4IVI A;  3PBT A;  1T19 A;  1JWP A;  2KDK A;  1DY6 A;  5KMW A;  4BBU A;  5DFY A;  5IU1 A;  3C5A A;  3EGD C;  3RFB A;  4ZRR A;  1K54 A;  4I3A A;  4OKP A;  1SHV A;  2K31 A;  4L9G A;  1LSW A;  1BYW A;  1NXY A;  5MC7 A;  2VKS A;  3HLB A;  1HVB A;  1RGY A;  1YM1 A;  4S2O A;  5DJU A;  4S2L A;  1OT9 A;  2FH5 A;  3KYE A;  3IWI A;  5FQI A;  1V9Y A;  3UDF A;  4P0M A;  1TDG A;  1MXO A;  4OPZ A;  3UE6 A;  3UN7 A;  3CZD A;  4X25 A;  3LI9 A;  1K57 A;  4PM5 A;  3C38 A;  3OPH A;  4ZDX A;  5E2H A;  2EWV A;  1SDN A;  4RQ9 A;  4OPR A;  4KZ3 A;  2ZC7 A;  3OPL A;  1ESU A;  1MKM A;  1ES4 A;  1ODV A;  4NET A;  4FTX A;  1DJA A;  4KZ9 A;  2EWW A;  2HDQ A;  5F1F A;  1EWZ A;  2NUT C;  5EVE A;  3CHW P;  2HP6 A;  4Y3I A;  4HNB A;  3FC7 A;  3PBQ A;  5DF9 A;  2X01 A;  1GA9 A;  1MKI A;  1JNU A;  4Q0I A;  4UQI S;  3M2K A;  3VE3 A;  4RA7 A;  3VV4 A;  2PYR A;  4UQI M;  4CJN A;  1QMF A;  1BLP A;  5L2F A;  2DRW A;  1NRF A;  3L9K A;  4YIN A;  2HJE A;  1BLC A;  2JKT I;  3HL9 A;  3BWL A;  4WZ4 A;  3DW0 A;  3EEH A;  1K38 A;  3BY8 A;  2A24 A;  4BL3 A;  2EX2 A;  4MLL A;  4EWF A;  1OTD A;  3GEC A;  2PT7 A;  1NJ4 A;  1YQS A;  3GTC A;  4GOG A;  4JGO A;  4G3V A;  4NXE A;  1KE0 A;  2WYX A;  4EXO A;  1XGI A;  4UHU A;  1BLS A;  3P98 A;  5J3W A;  2Q9M A;  3NUL A;  2GZA A;  3PYP A;  3NOT C;  3CUE A;  4HEF A;  1VQQ A;  2HDU A;  1G6A A;  3M2J A;  4QD4 A;  1S66 L;  5EOO A;  3HBR A;  2J8Y A;  5HAI A;  5JYO A;  5HAQ A;  1BUL A;  4XT2 B;  1JWV A;  4NK3 A;  3WS2 A;  3H7W B;  1XFN A;  2WZX A;  2O9B A;  3EGX C;  3LCE A;  3MQ0 A;  5CED A;  2H0Y A;  3RJU A;  3C30 A;  2XRO A;  3OPP A;  3MFX A;  2VX8 A;  1BZA A;  1ES5 A;  4FD8 A;  2VJW A;  4ZTK A;  3ZG9 B;  3BJN A;  1ALQ A;  3HLG A;  1NLY A;  3HJK A;  3C7V A;  1TVF A;  2WK0 A;  3IS2 B;  2YKF A;  4LLO B;  4KQD A;  4KG2 A;  4GD6 A;  2KX6 A;  3FWL A;  3Q7V A;  2VV8 A;  3R4K A;  4D60 A;  3KO6 A;  4Y0U A;  3IXH A;  2V9A A;  4OVD A;  1PRQ A;  5HWW A;  5HWT A;  4KG5 A;  4B93 A;  1PI4 A;  4GN2 A;  1FR6 A;  3WRZ A;  1XFQ A;  5FI7 A;  2XGN A;  1J3W A;  1NRJ A;  4E6X A;  4EEU A;  2JCH A;  3DBA A;  4E6W A;  1PW1 A;  2Y91 A;  3H82 A;  3DTE A;  3TG9 A;  2Y4A A;  3UB8 A;  1ES3 A;  3T4T A;  3E98 A;  2O9A A;  2HV1 A;  2ZMA A;  5GHZ A;  5L09 A;  4DKI A;  1W63 M;  1T1C A;  2ZQD A;  3BM6 A;  4OOM A;  2V1A A;  4Y5F A;  3BY9 A;  1RP5 A;  2M7V A;  2OSU A;  4C3Q A;  4X6T A;  3P7N A;  5FAQ A;  3KSF A;  4YOF A;  3BFC A;  1ERQ A;  4ME4 A;  2D02 A;  4DJ3 A;  1KVM A;  3IXB A;  5EEC A;  1XXM A;  2KLI A;  2QPN A;  1J9M A;  5FQQ A;  1ONH A;  2CC1 A;  2XFT A;  2HDS A;  2IWC A;  1FSW A;  1SCW A;  3IBR A;  2W0N A;  3VP1 A;  1VET B;  5FAT A;  3F1O B;  1ESI A;  1L0G A;  2EX9 A;  1M6K A;  1O07 A;  3ZG0 A;  2W3E A;  4P85 A;  4QB8 A;  4O7D A;  1YMX A;  4HES A;  1OME A;  4I39 A;  1XJ6 A;  1DP8 A;  4CLC D;  4N9K A;  3MSH A;  3GR2 A;  4EBP A;  3ZG5 A;  5AQA A;  3PXP A;  4BQM A;  1ERO A;  5HAR A;  3C7U A;  5J7E A;  5C5K A;  2PR6 A;  4HY8 A;  4ETZ A;  2YKH A;  3MMH A;  4QHC A;  4WMC A;  3VOZ A;  1OT6 A;  3C2W A;  3KSI A;  4L9E A;  5AQ9 A;  3OPR A;  4JF5 A;  4MDZ A;  1VEU A;  3IH9 A;  3HUM A;  4N1H A;  3EWK A;  3AGF A;  3VSL A;  1OPX A;  2WGW B;  1N9N A;  3LI8 A;  2JKR M;  4HH2 A;  4N9L A;  2VGL S;  3CJM A;  3OCN A;  2RL3 A;  3TOI A;  2HJ9 C;  1G6O A;  2J3W A;  5IHV A;  3Q81 A;  1E3U D;  2VGL M;  1BLH A;  3T12 B;  1MBL A;  4KZ7 A;  4Y7P A;  3O86 A;  4GW9 A;  4U3T A;  2XR0 A;  2G2W A;  4LPZ A;  1CJF A;  1IYQ A;  3NIA A;  2QWS A;  4MBK A;  1LSV A;  3O87 A;  3T1Q B;  5DJT A;  5FEF A;  1GSW A;  3JYI A;  2QKP A;  3IF5 A;  3ZFZ A;  3UE0 A;  2ZLY A; 
#chains in the Genus database with same CATH homology
 3FPV A;  3MXQ A;  3LID A;  3B47 A;  2P04 A;  4JGQ A;  3OC2 A;  3HCY A;  3NOU C;  4KUO A;  3OBF A;  5HD5 A;  4GS9 A;  4GS9 B;  5AVF A;  1X0O A;  3CWF A;  4G3W A;  5CX7 A;  1MZU A;  3PBT A;  1LL8 A;  4BWI A;  1T19 A;  5HD3 A;  2KDK A;  4BBU A;  1P0Z A;  1TS6 A;  5DFY A;  4II7 A;  1H3Q A;  5IU1 A;  3K3D A;  3LIA A;  1W63 Q;  3LIC A;  4P6Z S;  2KOI A;  3UB9 A;  4CQH A;  3EGD C;  5DKK A;  1N9L A;  3RFB A;  3O5Y A;  3K3C A;  5F68 A;  4MCW A;  4P6Z M;  4YNR A;  4ZRR A;  2OAP 1;  4I3A A;  3FPW A;  2K31 A;  3FG8 A;  4L9G A;  1LSW A;  3PHY A;  1BYW A;  5MC7 A;  4FSF A;  2VKS A;  2P7J A;  4LRZ E;  1OTB A;  5DJU A;  3T4Q A;  1LT0 A;  1OT9 A;  2FH5 A;  1UWP X;  1V9Y A;  3TRC A;  3UE6 A;  3ZYT A;  4O8G A;  2VEA A;  3LI9 A;  2PDR A;  3C38 A;  4B9O A;  2R78 A;  2EWV A;  1S4R A;  4RQ9 A;  3CUE C;  3LR4 A;  4HJ3 A;  2BAS A;  3RTY A;  2VV7 A;  4NEE D;  3V67 A;  3TE8 A;  1MKM A;  3TW8 A;  3LYX A;  1ODV A;  3KSG A;  4HJ6 A;  2ZOI A;  3EOI A;  4PHT A;  2K2N A;  2EWW A;  2I9V A;  3S7Q A;  4ARZ A;  2NUT C;  4ARZ B;  1NLZ A;  3EEA A;  5HPF A;  4Y3I A;  1DP6 A;  2H28 A;  4HNB A;  3FC7 A;  3PBQ A;  4IJG A;  5DF9 A;  2W1T A;  3NJA A;  2XSS A;  4MN7 A;  2W1T B;  4F3L A;  1JNU A;  4Q0I A;  4UQI S;  4F3L B;  2GJ3 A;  3ZQ5 A;  3VE3 A;  3OCL A;  4H6J A;  1V9Z A;  4H6J B;  3VV4 A;  2PYR A;  4UQI M;  3VE4 A;  4HOI A;  1T1A A;  2HJE A;  2VA0 A;  4O01 A;  2JKT M;  2JKT I;  2ZBB A;  2HF6 A;  2A2L A;  1XJ3 A;  3JVV A;  2P08 A;  3BWL A;  3BW6 A;  3EEH A;  4HP9 A;  1YKD A;  2PD8 A;  3BY8 A;  2V1B A;  2GX5 A;  3E0Y A;  2A24 A;  4CLC C;  1TS7 A;  1VHM A;  2A24 B;  4EU0 A;  3KSH A;  4MMN A;  1OTD A;  3GEC A;  2PT7 A;  1P97 A;  4KUK A;  3LR0 A;  2PD7 A;  1TS8 A;  4JGO A;  5FL3 A;  4G3V A;  4NXE A;  4GCZ A;  4NXF A;  1OJG A;  2EA9 A;  3R7W A;  4EXO A;  2O9C A;  2L1M A;  3R7W B;  3NOP C;  1IOU A;  1KOU A;  2M7U A;  4BMW A;  5J3W A;  3EQU A;  2W27 A;  2W3D A;  4G3K A;  5KSH A;  2GZA A;  3PYP A;  3NOT C;  3CUE A;  4EET B;  4WL9 A;  3SW1 A;  3OOV A;  3E4P A;  2Y8H A;  2LB9 A;  3T50 A;  1S66 L;  5DKL A;  1UWN X;  3T4L A;  1YAX A;  4XT2 A;  3H7W A;  4XT2 B;  1F98 A;  3H7W B;  1OTI A;  2O99 A;  1XFN A;  3T4S A;  2O9B A;  3EGX C;  4YWZ A;  3LIB A;  3MQ0 A;  4EER A;  3CLO A;  3C30 A;  2XRO A;  3MFX A;  3MJQ A;  4GHI A;  2VX8 A;  4GHI B;  2G7U A;  3F1N A;  1ZHH B;  2VJW A;  3F1N B;  2OWH A;  5TJJ A;  4BJP A;  3A0R A;  3BJN A;  5F6A A;  4I38 A;  2M1C A;  1NLY A;  4E04 A;  3HJK A;  3A0S A;  4CLC E;  2XRN A;  5DFX A;  4NXG A;  1N9O A;  3IS2 A;  3IS2 B;  2YKF A;  5IT5 A;  4LLO B;  4KQD A;  4Q0H A;  1XJ2 A;  2KX6 A;  4IHQ A;  4CLC A;  2VV8 A;  4BBT A;  4CLC B;  3P01 A;  3R4K A;  2CMN A;  1NWZ A;  3MF0 A;  4HIA A;  3KO6 A;  3RH8 B;  3S7P A;  4Y2F A;  5A8B A;  2V9A A;  1F9I A;  1H8M A;  1TF1 A;  5HWW A;  3BQ8 A;  4Q0J A;  5HWT A;  4WN5 A;  2Z6D A;  2QHK A;  5LBR A;  4R3A A;  3BQA A;  4I3J A;  4LRX C;  4B93 A;  2INW A;  2L0W A;  4EEP A;  1S67 L;  4HP4 A;  1XFQ A;  4WEL A;  1NRJ A;  2Y79 A;  5K5B A;  3ICY A;  4EEU A;  1P9W A;  4GLQ A;  4R38 A;  3DBA A;  4I3I A;  1UGU A;  4JGP A;  4Z1W A;  3T4O A;  1F5M A;  4EUV A;  3UB6 A;  3C8C A;  3H82 A;  3H82 B;  3UB8 A;  3T4T A;  3E98 A;  2O9A A;  2ZOH A;  1D7E A;  4DN0 A;  5F69 A;  2J80 A;  2HV1 A;  5F5Y A;  4HHD A;  1T18 A;  4R70 A;  2WKP A;  1OTE A;  1IFQ A;  1MC0 A;  1GSX A;  2LB5 A;  4PKY A;  4OOL A;  1TS0 A;  3LUQ A;  4WUJ A;  1YSP A;  2FZ0 A;  1W63 M;  1T1C A;  4HQA A;  1T1B A;  3LR3 A;  5KIZ A;  2HGV A;  4OOM A;  4QPR A;  1DP9 A;  2V1A A;  3E4O A;  4Y5F A;  2OOL A;  3BY9 A;  4M4X A;  1OJ5 A;  2M7V A;  3UB7 A;  1EW0 A;  5IS1 A;  2VZW A;  3CI6 A;  3LIE A;  5EFW A;  3P7N A;  2D01 A;  1ZTU A;  3KSF A;  3JVU A;  4YOF A;  1XJ4 A;  4IUH A;  2QYB A;  4L9F A;  4WLA A;  4ME4 A;  2D02 A;  4EW7 A;  3A0V A;  4DJ3 A;  4EQ1 A;  3PBN A;  3D72 A;  3EQV A;  1VB6 A;  2KLI A;  2W3F A;  3MQQ A;  3UMD A;  1S1Y A;  4L0L A;  2QJ5 A;  2ZMF A;  3K2N A;  3IBR A;  1P9R A;  2W0N A;  2JHE A;  2NUP C;  3D3O A;  5HSQ A;  2MJ6 A;  2K7S A;  2W1R A;  4UEY A;  5AVE A;  3F1O A;  3T4J A;  5J4E A;  3PBR A;  5HDS A;  3F1O B;  3KYQ A;  1Y28 A;  3MQO A;  4MN6 A;  2JN7 A;  2ZMV A;  3GDI A;  3E4Q A;  5AJG A;  2W3E A;  3UE3 A;  1S4S A;  1LSX A;  3KYZ A;  3PBS A;  3S7N A;  4WF0 A;  5TBM A;  3LR5 A;  2WKR A;  4I39 A;  5TBM B;  1XJ6 A;  1YSQ A;  1DP8 A;  4CLC D;  4AFI A;  4IUK A;  1D06 A;  3ULF A;  3U2A A;  4WEK A;  2XA7 S;  2PHY A;  3PXP A;  1OTA A;  2DMW A;  1WA9 A;  1GSV A;  4FOF A;  2J3T C;  2XA7 M;  3LIF A;  4O0P A;  2Z6C A;  4WEJ A;  4HJ4 A;  5HDC A;  3CAX A;  2L4R A;  5J7E A;  5C5K A;  2PR6 A;  4KQO A;  2PYP A;  4HY8 A;  4ETZ A;  2YKH A;  3MMH A;  1OT6 A;  3C2W A;  3KSI A;  4EES A;  4DMZ A;  2OWJ A;  1DRM A;  2GNX A;  4LRY C;  2IA2 A;  4L9E A;  4HI4 A;  4NKP A;  2VV6 A;  3LFV A;  4MDZ A;  1G28 A;  2W3H A;  3B33 A;  3EWK A;  3HJI A;  1S1Z A;  4K08 A;  4GJ4 A;  2B02 A;  5L8M A;  1OPX A;  3B42 A;  5G4Z A;  1N9N A;  3LI8 A;  2JKR M;  2V0W A;  3KX0 X;  4HH2 A;  2JKR I;  2VGL S;  3OCN A;  2QJ7 A;  3S7O A;  4R6L A;  2HJ9 C;  1G6O A;  2J3W A;  4JGR A;  4PKY G;  2VGL M;  3NHQ A;  4ETX A;  2B18 A;  2WKQ A;  5HZH A;  4I5S A;  4DJ2 A;  1STZ A;  4GW9 A;  3UME A;  5HDD A;  5I5L A;  5HWV A;  4LPZ A;  2V0U A;  2OAQ 1;  3OLO A;  3TJZ C;  3G6O A;  4PAU A;  3CIT A;  3T4K A;  3VOL A;  2QWS A;  3PR6 A;  3PBO A;  4MN5 A;  3H9W A;  4HH3 A;  3W2Z A;  4BBV A;  1LSV A;  2PR5 A;  2VLG A;  1TD5 A;  4NXB A;  5HPI A;  3MR0 A;  5DJT A;  5HL6 A;  1GSW A;  3IBJ A;  2QKP A;  5G4Y A;  2W3G A;  2O0Y A;  3F1P A;  2J3T D;  3F1P B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...