4I3JA

Structures of pr1 intermediate of photoactive yellow prtein e46q muntant from time-resolved laue crystallography collected at 14id aps
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAQGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Volume-conserving trans-cis isomerization pathways in photoactive yellow protein visualized by picosecond X-ray crystallography
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Luminescent protein
molecule keywords Photoactive yellow protein
total genus 37
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2012-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4i3jA00
5DJUA 3VE4A 4HP4A 2QKPA 4GS9A 4PKYG 4E04A 4JGPA 2ZOHA 4KQDA 3T50A 1MZUA 3SW1A 3CAXA 4LRXC 2M1CA 1T1AA 3UE6A 3UMEA 3C2WA 4I39A 1TS7A 1T1CA 4RQ9A 1OTAA 1N9LA 3IS2B 3FC7A 4GS9B 3F1OA 2PYRA 3LYXA 4L9EA 5HDSA 3H7WB 2V1AA 3H82B 3LI9A 4LRZE 5KIZA 2HV1A 2JHEA 1LSWA 2A24A 2YKFA 3KX0X 3MQQA 4PKYA 5J7EA 3GDIA 2WKPA 3ZQ5A 1OJGA 1S1YA 2Z6DA 4KUOA 4GW9A 4MN5A 3ULFA 5IS1A 3H7WA 3IBRA 3H82A 4EERA 2V0UA 3EWKA 4EXOA 2W27A 5F69A 4HH2A 2YKHA 5IU1A 1OT9A 3PYPA 2VEAA 3NOPC 4WUJA 1DP8A 5I5LA 4HP9A 4R3AA 2KX6A 4JGOA 1UWPX 2WKRA 4H6JA 3A0RA 1OT6A 1N9OA 1F9IA 4NXBA 3LIDA 5HDDA 1V9ZA 3NHQA 2KDKA 4HI4A 2L0WA 3NJAA 2VV7A 4DJ2A 2R78A 4HIAA 4WN5A 4BBVA 1OTBA 3RH8B 1DRMA 1D06A 3E4QA 4HQAA 3UB9A 2V9AA 1LSXA 4XT2A 2PR6A 3UB7A 4GHIA 3UMDA 3ICYA 1JNUA 1T19A 4LLOB 5DKKA 5TBMA 1KOUA 2JN7A 3HJIA 5HD3A 1DP9A 4MN6A 2D02A 4EEUA 2VV8A 3F1NA 4HHDA 3K3DA 2I9VA 1S4SA 1P97A 3IS2A 1OTIA 3E4OA 4HH3A 4EETB 2EA9A 2PD8A 1GSWA 2VV6A 5F5YA 3UB6A 2OOLA 2QWSA 5HWTA 4EESA 5HSQA 4WLAA 5J4EA 4M4XA 5AVFA 4I5SA 5HWVA 5J3WA 2W0NA 2H28A 5HWWA 2PYPA 3D72A 4I3JA 2GJ3A 3CWFA 4R38A 4H6JB 1G28A 4XT2B 1DP6A 1OJ5A 3GECA 5G4YA 3G6OA 1F98A 2PHYA 5HDCA 4I38A 4F3LB 4JGQA 2QHKA 4R70A 1XFQA 3B33A 4I3IA 4YWZA 1S67L 1XJ6A 3MFXA 5DKLA 3F1NB 4I3AA 3CLOA 3F1PA 2PR5A 1WA9A 4F3LA 2BASA 3BWLA 1GSVA 1XJ4A 5HZHA 1TS6A 2ZOIA 2OWHA 4KUKA 4EEPA 4EW7A 4HNBA 4NXGA 4WL9A 5DJTA 3UB8A 5A8BA 3F1PB 1S4RA 2WKQA 3MR0A 1LSVA 1TS0A 3H9WA 4HJ4A 5G4ZA 3RTYA 3NOTC 1T18A 3LIFA 3A0SA 3F1OB 3MQOA 1NWZA 4NXEA 1Y28A 3C8CA 2L4RA 1EW0A 4JGRA 2PDRA 3HJKA 3LI8A 5EFWA 1V9YA 3VOLA 4EQ1A 2D01A 4HJ6A 3VE3A 1UGUA 1S66L 3E4PA 4HY8A 5F6AA 3LIBA 1BYWA 1UWNX 1XJ3A 2CMNA 3K3CA 4GHIB 4L9GA 5TBMB 2B02A 2V1BA 1LL8A 5F68A 4BBTA 4K08A 3BY9A 4WF0A 1XFNA 3BY8A 2ZBBA 3FG8A 4LPZA 1T1BA 2A24B 2VLGA 3P7NA 2INWA 4DJ3A 4R6LA 4NXFA 1D7EA 2PD7A 2QJ7A 3NOUC 2P7JA 1LT0A 1S1ZA 3LUQA 4HOIA 3MXQA 2J80A 1GSXA 1OTDA 1X0OA 3PHYA 4HJ3A 2K7SA 2Z6CA 3OLOA 4GCZA 1VB6A 1TS8A 3LIEA 3MJQA 4B9OA 1OTEA 1N9NA 3LICA 2L1MA 2V0WA 4LRYC 5AVEA 4L9FA 4BBUA 1ODVA 1XJ2A 2OWJA 3A0VA 3EEHA 3LIAA 2QJ5A 5HD5A 1P0ZA
chains in the Genus database with same CATH superfamily
1FOFA 4JGPA 3S4XA 2HF6A 5FDSA 2ZJ9A 4DMZA 3IQAA 4U0XA 4N92A 4X69A 5FAOA 4QB8A 1TVFA 3EGDC 3Q1FA 1H5XA 3CPTA 1PNEA 4X68A 2FFYA 3GRJA 3ULFA 5FQMA 2AVXA 1YMXA 2XH9A 4BD1A 1CF0A 1OT6A 4R3BA 1PW8A 2JKTI 2XF3A 4GD8A 2EFXA 1QMEA 4MDZA 1ES3A 1LSXA 3E98A 4BENA 4EUZA 3UMDA 4GHIA 2RCXA 4JF5A 1Z6FA 4NK3A 4R3JA 2EWVA 5F83A 5IT5A 3S7QA 1NYYA 5A91A 4CQHA 2EX8A 5CEBA 3VP1A 4EESA 4MCWA 5AVFA 4BD0A 4KZ8A 2PYPA 3D3OA 2QHKA 1K57C 4R70A 3B33A 2JKFA 4GB7A 4OPRA 2Y4AA 3ZYTA 3HCYA 4X1LA 4EEPA 3WS4A 2WKQA 3V5MA 3MSHA 2QZ6A 1Y28A 5DTTA 1OPXA 4HJ6A 4BWIA 3E4PA 4HY8A 2ZQ9A 2ZM8A 1HZOA 5F1FA 4UA6A 1W63M 1N9BA 2XEPA 4NEED 5M19A 1JTGA 2XLNA 1YLPA 5EE8A 4HOIA 1ONGA 3L9KA 4S2MA 3TJZC 2WAEA 2ZQAA 3LICA 3VP4A 5FQ9A 1YKDA 4N9LA 4OP5A 3T1QB 1F5MA 4E04A 1K0KA 3DTKA 3QNCA 4ARZB 4R4RA 3UE6A 4RQ9A 1N9LA 4B93A 1IOUA 3A3FA 4LRZE 1YSQA 3GDIA 3R4KA 5FATA 3ZG9B 3T1XA 2H0TA 2PU4A 3PBQA 5HAQA 2VEAA 3O3VA 4DRTA 1YLJA 5EVLA 2R9WA 2H10A 2KDKA 3EOIA 2EXAA 2WK0A 1YT4A 1OTBA 3RH8B 4HBTA 2WZXA 2K31A 4CLCE 2XA7M 2JKGA 5KSCA 1JNUA 1T19A 2ZL1A 3G2ZA 1DP9A 4KG2A 1AXBA 1GHIA 2ZC7A 1ESIA 2Y79A 4HH3A 5JYPA 4U0TA 2IA2A 2Q0OA 2H28A 4P85A 2WAFA 1IKGA 1BLHA 3G6OA 3HREA 3VSKA 1ES5A 2BASA 4X6TA 2GX5A 4Y0UA 4Q0JA 4BJPA 5A8BA 1VEUB 3QP8A 5GHXA 4RVAA 3JYIA 3ZG0A 1XJ3A 1L2SA 4Y0OA 4PMAA 3B47A 3FZCA 2G2UA 3C7UA 3GR2A 3MZFA 2XROA 4R0QA 1ES4A 1PI4A 2QMIA 2W3FA 4UA9A 1S1ZA 2XD5A 3CZDA 2Y8HA 4IBXA 3QNBA 1OTDA 5HX9A 2EWWA 2L1MA 2V0WA 3EEHA 3LCEA 2P08A 3SH9A 4JXSA 2DMWA 4S2LA 2W1TA 3CAXA 4LRXC 4EQIA 4E3IA 3UMEA 1SKOA 3WRZA 3W2ZA 1SDEA 3DBAA 4L9EA 4ZDXA 3CMZA 4ZJ2A 3LI9A 1LI9A 4NETA 5A92A 1OJGA 4N1XA 3A3IA 3RFBA 2YKHA 3A3EA 1KGFA 2A3UA 5G18A 3A0RA 1ZHHB 3FPVA 3LIDA 3MXSA 1I2WA 1V9ZA 3G35A 4HIAA 2A2LA 3LEZA 3HLGA 1LHYA 3DAVA 1I5QA 4B4XA 1CEFA 1KVMA 4E3OA 4BL2A 1F2KA 5FL3A 4L0LA 1E25A 5HWTA 3MKFA 4I5SA 1Q2QA 1W5DA 2W0NA 4D2OA 4PAUA 5G4YA 2VA0A 4FUWA 1S67L 3D9YA 4GOGA 2PAVP 5HW3A 2FZ0A 3QHYA 4HJ4A 3EGXC 3RTYA 2ZL1B 4NXEA 1NWZA 1EW0A 1FSWA 3K2NA 4IVIA 3A3DA 4GHIB 3PBTA 2B02A 5F68A 2H5SA 3HLBA 2HP6A 4CJNA 5CGSA 3IX8A 4OQIA 3G4PA 4GNUA 1YLYA 2OLUA 3IHAA 3IH8A 3P01A 1G68A 3AGFA 4HJ3A 5FI7A 2OV5A 1TS8A 4L9FA 3JPUA 3C4PA 3A0VA 3LIAA 3PBSA 1JWVA 4HP4A 2QKPA 5HAPA 4WM9A 2HGVA 1J3WA 3BFCA 1DJAA 4YFMA 3MZDA 5DFYA 3WS5A 4CPKA 5IS1A 2Y2NA 3E2LA 2HP9A 5AQBA 5F1GA 2V8CA 3JVUA 5HPIA 2O9CA 3LR5A 2WZZA 5CX7A 2M7UA 3NIAA 1QMFA 2VGLS 4PM8A 1PIOA 2PU2A 4BBVA 3VFHA 1SKOB 2PR6A 2Y59A 3Q7VB 3SS4A 4LFUA 2JN7A 1KDSA 1FQGA 2R9XA 4QHCA 4M3KA 5DTKA 4X53A 3LY3A 5HWVA 5HWWA 4I3JA 3VFFA 1XFQA 3IWQA 5DFXA 4KZ6A 2PR5A 2X02A 1GA9A 1LSVA 3QP4A 1AWIA 3MS6A 4DE0A 3B3XA 4WEJA 1PWDA 4O0PA 4DDYA 2ACGA 4H8RA 2P9VB 3IXDA 2W3DA 5L8MA 5FI6A 2P7JA 2Y2OA 4ID4A 4O01A 5FAPA 2UV0E 3OLOA 4R1GA 2H0YA 5L09A 3LIEA 3W8KA 1PWCA 2Y55A 1YMSA 4ZBEA 5U47A 4ETXA 1MZUA 4KZ4A 3S7NA 3T4TA 3OPLA 1W8QA 4EUVA 3VOZA 4O8GA 3T4KA 4EBNA 1DJCA 5KIZA 2HV1A 2OSUA 3CUEA 4GDNA 2WKHA 1K38A 3UY6A 2O99A 4UQIM 4JKTA 3OCLA 4A5RA 4GN2A 3WWXA 2C5WB 3HLCA 1J9MA 3NJAA 1W79A 1MWUA 2E8JA 3E4QA 1G5UA 4X25A 4XT2A 4JF4A 2XGNA 2VV8A 4N1HA 1JWZA 5IHVA 3EQUA 2PD8A 1NLZA 5F5YA 3DW0A 5HSQA 5GHYA 2P9VA 3BLSA 3BEBA 1EROA 1G28A 3IWIA 2PHYA 1ERMA 5DKLA 3BQAA 4F3LA 1GSVA 2OWHA 4YINA 2UWXA 5AQ7A 3Q7ZA 2EXBA 1T18A 4JXVA 2G2WA 3LI8A 4KQQA 2D01A 1S66L 1OMEA 3NI9A 4YNRA 3ZG7B 4Q8IA 4OQGA 1Z09A 4Y5FA 2RL3A 2VLGA 4Y0TA 3KYEA 1D7EA 1KGGA 2JCHA 5HAIA 1FR6A 2WUQA 2J3TC 5FI2A 4OOLA 1VM1A 3KSHA 5F69A 2PBYA 3ZNYA 3HUMA 4Y15A 3UPNA 3VE4A 4QU3A 3MQ0A 3OCNA 4MBFA 4PHTA 3IS2B 2J7VA 2J8YA 1YLTA 1NY0A 1S1YA 2Z6DA 4QY5A 4GW9A 2B5RA 3H7WA 4EERA 5CHUA 3P98A 1YLWA 3V50A 3BYDA 3A3JA 3W4PA 2B95A 3T1RA 3TSGA 4QD4A 3DWKA 2V9AA 4OH0A 3ZGAB 4FSFA 1ESUA 3OPHA 2VK3A 5EVID 3PAEA 3K3DA 4Y13A 1P97A 1TF1A 4WMCA 1OTIA 4P87A 1NRFA 3OZHA 3RJUA 1O07A 1NZUA 4XT2B 3Q07A 5HL6A 4I38A 4JF6A 4LCLA 4E6XA 2Y2LA 4KUKA 3ITAA 4HNBA 3KSGA 4BQMA 4X56A 3F1PB 1TS0A 3H9WA 4FH2A 3NOTC 5J7EA 4E3KA 3WS0A 4JGRA 3PBRA 4UHUA 5M1AA 3CPTB 3OC2A 4MMNA 2HDRA 5E43A 2ZC6B 3CHWP 1MWRA 3BW6A 3BY9A 3VSLA 1E4DA 2INWA 1BSGA 5KMWA 3IT9A 1LT0A 3MXQA 4UA7A 2Z6CA 2V1ZA 5DJUA 3MFDA 1ZG4A 5EVEA 1FCNA 2Y2JA 2ZOHA 4KQDA 3T4LA 1MKMA 3KSFA 3E0YA 4PM9A 1E3UD 3FKWA 4C75A 1JVJA 5EOOA 3IX3A 3TRCA 2V0UA 5EECA 5MC7A 3NOPC 3IF6C 1DP8A 4R3AA 1XA7A 3UDXA 2NUTC 1NYMA 5GLCA 3NHQA 3O87A 3Q81A 1PFLA 3CJMA 3HLFA 4LV3A 1KE4A 5TBMA 5HD3A 4PPRA 3O88A 4MN6A 4EEUA 1FR1A 3ZFZA 4Y3IA 5FQIA 3S1YA 3BRMA 4JPMA 5J4EA 5J3WA 3U2AA 4DDSA 1XGJA 2A49A 1XJ6A 3GSGA 5KSHA 5HZHA 3BFGA 3ZVWA 1ZKJA 5EFWA 2JKRM 3LGOA 3LR4A 4L9GA 2V1BA 4LV0A 5FA7A 4S2KA 4DKIA 2QJ7A 1WYBA 3HLDA 2ZLYA 5K5BA 1EI5A 3M2KA 4WZ4A 4OOMA 4EBPA 1ONHA 4CLCB 5EUAA 4BL3A 5HFOA 3ZNTA 4DN0A 4LV2A 5CTNA 3V39A 3HLWA 3PR6A 2KLIA 3HUOA 3FC7A 4KENB 3LY4A 2PYRA 2ZQCA 2JKTM 4HBUA 4OPZA 3H82B 2ZD8A 3T4SA 2GZAA 3KX0X 3ZQ5A 4EXOA 3PYPA 3UDIA 1U60A 5EM1A 3O5YA 4JGOA 1UWPX 5BOHA 2VX8A 3UB5P 4ZTKA 4O7DA 4GZBA 1PZPA 1XKZA 1W7FA 3R7WB 1KOUA 2WYXA 3NDGA 5FEFA 3LR3A 1S6RA 2ZM0A 3MBZA 2V20A 2EFUA 4DF6A 5C5KA 1H0MA 2Y2HA 5L2FA 4EV4A 3FPWA 1WA9A 3BWLA 5DF7A 2P04A 3MR0A 1CQAA 4XUXA 3A0SA 1GCEA 2K2NA 3VOLA 5EVIA 4EWFA 1VEUA 1D1JA 1IFQA 1MWTA 2ZQ8A 1BYWA 3QP1A 1NLYA 5GLDA 2Y2MA 4BBTA 2X71A 2Z2LB 3BY8A 3Q82A 1YLZA 3B42A 2DRWA 5GLBA 4PM7A 3LO7A 3DWZA 2HDSA 4S2NC 3C30A 3ZG8B 5CGWA 3PHYA 3WRTA 1H8MA 2W1RA 5AVEA 3BQ8A 1HD8A 1Y54A 3MXRA 1K4FA 4GS9A 3MF0A 2OAP1 4I39A 1ZC2A 4GS9B 1BLSA 3MQQA 2WGIA 2WGWB 4ZJ1A 3UDFA 4ZAMA 4RYEA 5FDHA 5CHJA 5I5LA 4HP9A 1N9OA 1F9IA 1W8YA 3IF5A 5FEGA 3C38A 2VV7A 4DJ2A 3PTEA 5JYOA 2HZ5A 1MY8A 1XP4A 1K56D 2QYBA 3BLMA 1H8YA 4G3KA 1PW1A 3UB6A 1HVBA 1CJFA 4M4XA 3CWFA 4CLCC 4H6JB 1OJ5A 4JGQA 3NY4A 2P74A 3SH7A 4NG2A 3RXWA 5I94A 3LIFA 1SCWA 3S7PA 4IHQA 1V9YA 4JBFA 1RGZA 3LIBA 3VOYA 2LB5A 2WADA 3FG8A 1T1BA 1FCMA 3NECA 2PD7A 4FD8A 2W1TB 3V67A 3LUQA 4OVDA 4BMWA 3NC8A 1ES2A 3BECA 2J80A 5CTMA 3MKEA 2ZC5B 4DJ3A 4MNRA 4MBKA 3FYZA 1P0ZA 1CI9A 4KZ5A 4Z1WA 2Z2MB 1M40A 3SS3A 1OTAA 4HEFA 4KQRA 3F1OA 5HDSA 3T4JA 4S2NA 1E3UA 4GLQA 4MN5A 4P6ZS 1L0DA 4FH4A 4Y2FA 4S2OA 1OT9A 3VP2A 1P9WA 4H6JA 3IBJA 2IWDA 5HDDA 2PT7A 3TE8A 4WMCD 3R7WA 1DRMA 1D06A 3OOVA 5CECA 2BTFP 2B18A 3HJIA 2D02A 4G3VA 2KOIA 3EEAA 2Y2IA 5FAQA 4JXWA 3IS2A 2VV6A 1XA1A 1NRJA 4BBUA 4R38A 2NUPC 2GNXA 4Y17A 1KDWA 1YQSA 4DE3A 4P6ZM 3KYZA 4NKPA 4KZAA 2BG1A 2JKRI 1UGUA 1UWNX 1HTZA 3VV4A 1YSPA 2DCFA 4JXGA 1L3LA 1LL8A 3AGDA 1H3QA 4RA7A 1YPRA 2BLSA 2ZQDA 4E3JA 3QP5A 3VMAA 4OONA 4LRYC 1YAXA 3HBRA 3T1SA 1ODVA 3ZHHA 5HD5A 1RP5A 4K0WA 2FFFB 3C7VA 3HL9A 2ZMAA 4DE1A 2HDQA 1MWSA 3Q7VA 2VZWA 2V1AA 3GMWA 2ZMVA 3C5AA 3HVFA 3LEQA 4WBGA 5EM0A 4K0XA 3M6BA 2DNSA 3KYQA 3W4QA 4F94A 4DXBA 3WS1A 3P09A 5HL1A 1BULA 5E2HA 2HDUA 3GVBA 1I2SA 2VGJA 2L0WA 3ITBA 3JVVA 3OBFA 3KSIA 4LLOB 3D4FA 2C6WB 4GDBA 3QP2A 1Y4OA 3M6HA 2O9AA 4OOYA 1MPLA 2VKSA 2ZMFA 5GL9A 2XD1A 3G32A 1VHMA 4ZJ3A 4RX2A 3ZVTA 2PRFA 5CRFA 4KG5A 4NXGA 4C6YA 1L0EA 4WN5A 2PDRA 3HJKA 4RX3A 1IYQA 3VE3A 4C3QA 4KZ3A 1PYYA 5TBMB 3DTEA 4ESPA 2XRNA 5EVIC 5L10A 1JTDA 2XK1A 5EVIB 3PBOA 1X0OA 4X1MA 5F82A 1DY6A 1LI0A 1VB6A 3MJQA 1WYCA 2LB9A 4EU0A 2OWJA 1ACFA 3N7WA 3PXPA 3G34A 4MBHA 3DTMA 1MXOA 2XSSA 3G2YA 3SW1A 3C4OA 3CI6A 3C2WA 4FOFA 4ME4A 1PZOA 1HLUP 3BJNA 5FSRA 4KZ9A 2M7VA 2JHEA 1LSWA 1Q2PA 2WKPA 3LR0A 2W27A 2Y2GA 1S0WA 3SZTA 3G31A 4GD6A 4OLGA 2IWBA 4DE2A 3N8SA 3ISGA 4OP8A 3LFVA 4QJGA 3DTIA 1K55C 5DKKA 3ICYA 2ZC3B 1A0KA 4HHDA 4AFIA 2I9VA 3E4OA 1VQQA 1XXMA 1GSWA 4WLAA 3N8LA 2WKIA 3D72A 2GJ3A 3KO6A 1DP6A 3M2JA 1NXYA 2JE5A 2XR0A 4I3IA 4YWZA 1XX2A 3UE0A 5A90A 2Y2QA 4WL9A 5DJTA 3UB8A 3SS5A 1FSYA 4R4SA 3QP6A 3UNWA 4OQHA 2MJ6A 2CMNA 3K3CA 4Z9QA 4WF0A 2WGVA 4LPZA 2A24B 3IXHA 3WS2A 1PI5A 3S22A 1JWPA 3BFDA 1OTEA 1N9NA 4B88A 3IF6A 1ZTUA 4MN7A 5FQQA 3IH9A 1T1CA 4KZ7A 1IYPA 4UQIS 3EWKA 4KZBA 2XDMA 1EWZA 2KX6A 4NXBA 1SDNA 5EV0A 2WKEA 1FCOA 4HI4A 5L07A 2IWCA 5E2EA 3IXBA 5D3OA 1KE3A 1K57A 3F1NA 3L7HA 1CI8A 4BLMA 3MMHA 2W3GA 4GJ4A 4X55A 3IXGA 4IEDA 4U3TA 4P0MA 1NZOA 1FIKA 4EBLA 4F3LB 1CEGA 1K56A 3T4QA 3CLOA 1MC0A 2Q9MA 5CHMA 2X01A 4E3LA 1WE4A 3F1OB 4K91A 5TFQA 5LBRA 3TOIA 2VJWA 5TR7A 1GHMA 4XUZA 5F6AA 4UAAA 5CERA 4K08A 2Y91A 2EX6A 5EPHA 4NXFA 1DJBA 4LENA 3NOUC 3CUEC 5CGXA 4FTXA 5DTSA 1GSXA 3U4LP 4B9OA 3FWLA 3V3RA 4R23A 5FQKA 4S2IA 2CC1A 3T50A 5DF8A 1MKIA 2M1CA 1T1AA 4PM5A 5DF9A 3LYXA 2QPNA 1BT5A 3O86A 1ERQA 2A24A 1BLCA 1GA0A 4KUOA 3NDEA 3T4OA 1LL5A 2ZQ7A 3UPPA 2E8IA 4OLDA 1L0GA 2ZC4B 3G30A 2WKRA 2ZM2A 1IYOA 3W4OA 2HP5A 4MLLA 3E2KA 4OKPA 1BUEA 2Y2KA 2Y2PA 4GKUA 1K4EA 4HQAA 1C3BA 3UB7A 1K6SA 1SZVA 2W3HA 4ARZA 2GDNA 3GQZA 3UN7A 3S7OA 2EA9A 3AGEA 2QWSA 2HJEA 2HPBA 4MEZA 4QY6A 1SKFA 3NCKA 4UEYA 4LGWA 1BTLA 1CK3A 4II7A 3HLEA 1BZAA 5EOEA 1PRQA 3N6IA 1TS6A 4HESA 4EW7A 4D60A 1VETA 3SOIA 4WELA 2OAQ1 1KGEA 2JC7A 1L0FA 1K54C 4OPYA 1XFNA 1XPBA 2V2FF 5HPFA 3N4IA 4R6LA 1IEMA 3UE1A 1RCJA 3VP0A 5TGFA 5FASA 2XA7S 1TD5A 2K7SA 4E3MA 4GCZA 4CLCD 2G7UA 3FV7A 1XJ2A 3SH8A 1LL9A 3BM6A 4IUKA 3BFEA 2V8FA 2O9BA 4WEKA 4DXCA 1TS7A 4P6BA 1ZG6A 1FILA 2YKFA 5HARA 3IBRA 3ZDJA 1STZA 4HH2A 5IU1A 3ZCZA 1IYSA 1P9RA 3GV9A 4G3WA 1G6OA 2WGWA 3UPOA 2VGLM 2HJ9C 3IX4A 1RGYA 3N8RA 4JLFA 4CLCA 1TDLA 4WZ5A 4WZ5C 4LCMA 2R78A 4PM6A 5CXWA 3HUNA 2EX2A 1M6KA 2FH5A 1YM1A 1IKIA 3PAGA 2XQZA 1ALQA 1S4SA 4EETB 2OOLA 3CG5A 3NBLA 4OPQA 3UO9A 4WYYA 3OPRA 3GECA 1F98A 2W3EA 4IJGA 3T12B 3VP3A 1MBLA 3TW8A 1XJ4A 1PWGA 5G4ZA 1S4RA 1TEMA 2J3WA 4Q0IA 3C8CA 4EQ1A 4LV1A 3RXXA 4ETZA 3UE3A 1K55A 3MZEA 3IHBA 3TG9A 3P7NA 3FKVA 1K54A 4OQ0A 5GHZA 4N9KA 3I7JA 1VETB 5KZHA 4PKYG 2OLVA 4QWOA 4ZRRA 2I72A 1IELA 5DVAA 5J8XA 4KG6A 5GLAA 3H7WB 5CEDA 1NJ4A 3IF6B 4E3NA 4PKYA 1G6AA 3NULA 3H82A 4FCFA 1W63Q 4WUJA 4KQOA 4IUHA 1H8ZA 3ZG5A 3CITA 5AJGA 5TJJA 1GHPA 3UB9A 3IWOA 5FQJA 2PBDP 4IVKA 1K6RA 2XFSA 4XXRA 1BLPA 3BFFA 2J3TD 5HDCA 4E6WA 4IBRA 3MFXA 3GTCA 3F1NB 4I3AA 3F1PA 1KE0A 2JBFA 2ZOIA 5A93A 1LLBA 3MQOA 1KVLA 4S2JA 2L4RA 4QPRA 3PBNA 3V3SA 1K25A 5AQ9A 5E2GA 2Q9NA 1SHVA 4YOFA 1O7EA 2O0YA 2ZBBA 1XGIA 2EX9A 5AQAA 4Y7PA 1TDGA 5M18A 3EQVA 4B4ZA 1N4OA 2J9OA 4S2PA 4Q0HA 2VGKA 2J9PA 2QJ5A 5E2FA 3OPPA 2XFTA
chains in the Genus database with same CATH topology
4ETXA 4GS9A 4JGPA 2HF6A 3MF0A 1MZUA 4DMZA 2OAP1 3S7NA 4I39A 3T4TA 1T1CA 4EUVA 4GS9B 3EGDC 4O8GA 3T4KA 5KIZA 2HV1A 3CUEA 4UQIS 3MQQA 3ULFA 3EWKA 2O99A 4UQIM 3OCLA 5I5LA 4HP9A 2KX6A 1OT6A 1N9OA 1F9IA 4NXBA 3C38A 4HI4A 2JKTI 3NJAA 2VV7A 4DJ2A 3E4QA 4MDZA 1LSXA 3E98A 4XT2A 3UMDA 4GHIA 2EWVA 2VV8A 5IT5A 3S7QA 3F1NA 2QYBA 4CQHA 3MMHA 4G3KA 3EQUA 2PD8A 1NLZA 2W3GA 4GJ4A 5F5YA 3UB6A 4EESA 5HSQA 4MCWA 4M4XA 5AVFA 2PYPA 3CWFA 4CLCC 4H6JB 1G28A 1OJ5A 4F3LB 2PHYA 3D3OA 4JGQA 2QHKA 4R70A 3B33A 5DKLA 3T4QA 3CLOA 1MC0A 3BQAA 3ZYTA 4F3LA 1GSVA 3HCYA 2OWHA 4EEPA 2WKQA 1T18A 3LIFA 3F1OB 1Y28A 3S7PA 4IHQA 1OPXA 3LI8A 1V9YA 5LBRA 2D01A 2VJWA 4HJ6A 4BWIA 1S66L 3E4PA 4HY8A 5F6AA 3LIBA 4YNRA 2LB5A 4K08A 3FG8A 1W63M 1T1BA 4Y5FA 2VLGA 4NEED 4NXFA 1D7EA 2PD7A 2W1TB 3NOUC 3V67A 3CUEC 3LUQA 4BMWA 4HOIA 2J3TC 4OOLA 2J80A 1GSXA 3KSHA 5F69A 4DJ3A 3TJZC 4B9OA 3LICA 1YKDA 1P0ZA 4Z1WA 3VE4A 1F5MA 4E04A 3T50A 4ARZB 3MQ0A 2M1CA 1T1AA 3UE6A 3OCNA 4PHTA 4RQ9A 5DF9A 1OTAA 1N9LA 3IS2B 4B93A 1IOUA 3F1OA 3LYXA 5HDSA 3T4JA 4LRZE 1YSQA 2A24A 3GDIA 4GLQA 2Z6DA 1S1YA 4KUOA 4GW9A 4MN5A 3T4OA 3H7WA 3R4KA 4P6ZS 4EERA 4Y2FA 3PBQA 1OT9A 2VEAA 1P9WA 2WKRA 4H6JA 3IBJA 5HDDA 2PT7A 2KDKA 3EOIA 3TE8A 3R7WA 1OTBA 3RH8B 1DRMA 1D06A 4HQAA 3OOVA 2K31A 4CLCE 2V9AA 2XA7M 3UB7A 1JNUA 1T19A 2B18A 3HJIA 2W3HA 1DP9A 2D02A 4FSFA 4G3VA 4ARZA 2KOIA 3K3DA 3EEAA 1P97A 1TF1A 3IS2A 1OTIA 2Y79A 4HH3A 3S7OA 2EA9A 2VV6A 2IA2A 2QWSA 2HJEA 2H28A 4UEYA 1NRJA 4XT2B 4R38A 2NUPC 4BBUA 5HL6A 3G6OA 4II7A 4I38A 2GNXA 2BASA 4P6ZM 1TS6A 2GX5A 4KUKA 4EW7A 4HNBA 3KSGA 4Q0JA 4BJPA 5A8BA 3F1PB 1TS0A 3H9WA 3KYZA 3NOTC 4NKPA 5J7EA 4JGRA 3PBRA 2JKRI 4WELA 2OAQ1 3OC2A 4MMNA 1UGUA 1UWNX 1XJ3A 3VV4A 1YSPA 3BW6A 1LL8A 3B47A 3BY9A 1H3QA 1XFNA 5HPFA 2XROA 2INWA 4R6LA 2W3FA 1LT0A 1S1ZA 2Y8HA 3MXQA 1OTDA 2XA7S 1TD5A 2K7SA 2Z6CA 4GCZA 4CLCD 2EWWA 2G7UA 2L1MA 2V0WA 4LRYC 1YAXA 1ODVA 1XJ2A 3EEHA 2P08A 5HD5A 2DMWA 4IUKA 5DJUA 2ZOHA 4KQDA 2W1TA 3T4LA 1MKMA 3CAXA 2O9BA 4LRXC 4WEKA 3UMEA 3KSFA 3E0YA 1TS7A 3W2ZA 3DBAA 2VZWA 4L9EA 2V1AA 3LI9A 2ZMVA 2YKFA 1OJGA 3IBRA 3TRCA 2V0UA 1STZA 5MC7A 4HH2A 3RFBA 2YKHA 5IU1A 3NOPC 1DP8A 1P9RA 4R3AA 4G3WA 1G6OA 3KYQA 2VGLM 2HJ9C 3A0RA 1ZHHB 3FPVA 3LIDA 4CLCA 2NUTC 1V9ZA 3NHQA 2L0WA 2R78A 4HIAA 3JVVA 3OBFA 2A2LA 3KSIA 2FH5A 5TBMA 4LLOB 5HD3A 4MN6A 4EEUA 4Y3IA 1S4SA 5FL3A 4EETB 2O9AA 2OOLA 4L0LA 5HWTA 5J4EA 4I5SA 5J3WA 2W0NA 3U2AA 2VKSA 2ZMFA 4PAUA 5G4YA 3GECA 2VA0A 1F98A 2W3EA 4IJGA 1S67L 1XJ6A 1VHMA 3TW8A 1XJ4A 5KSHA 5HZHA 2FZ0A 4NXGA 5G4ZA 1S4RA 4HJ4A 3EGXC 3RTYA 2J3WA 4Q0IA 4NXEA 4WN5A 1NWZA 3C8CA 1EW0A 5EFWA 2PDRA 3HJKA 4EQ1A 3K2NA 2JKRM 3VE3A 3LR4A 4GHIB 5TBMB 3PBTA 4L9GA 2B02A 2V1BA 5F68A 4ETZA 3UE3A 2XRNA 3P7NA 2QJ7A 3P01A 3PBOA 5K5BA 1X0OA 4HJ3A 4OOMA 3MJQA 1VB6A 1TS8A 2LB9A 4EU0A 4L9FA 2OWJA 3A0VA 3LIAA 3PXPA 4CLCB 3PBSA 2XSSA 4HP4A 2QKPA 4PKYG 4ZRRA 4DN0A 3SW1A 2HGVA 3CI6A 3C2WA 4FOFA 4ME4A 3PR6A 2KLIA 3FC7A 3BJNA 2PYRA 2JKTM 3H7WB 5DFYA 3H82B 2M7VA 2JHEA 1LSWA 3T4SA 2GZAA 3KX0X 4PKYA 3ZQ5A 2WKPA 5IS1A 3H82A 3LR0A 4EXOA 2W27A 3PYPA 1W63Q 4WUJA 3JVUA 3O5YA 4KQOA 4IUHA 4JGOA 5HPIA 1UWPX 2O9CA 3LR5A 3CITA 5CX7A 5AJGA 5TJJA 2M7UA 2VX8A 3LFVA 2VGLS 4BBVA 3UB9A 2PR6A 3ICYA 5DKKA 3R7WB 1KOUA 2JN7A 4HHDA 4AFIA 2I9VA 3LR3A 3E4OA 1GSWA 5C5KA 4WLAA 2J3TD 5HWVA 5HWWA 3D72A 4I3JA 2GJ3A 3KO6A 1DP6A 5HDCA 1XFQA 4I3IA 4YWZA 3MFXA 5DFXA 3F1NB 4I3AA 3F1PA 2PR5A 3FPWA 1WA9A 3BWLA 2ZOIA 4WL9A 5DJTA 3UB8A 2P04A 3MR0A 1LSVA 3MQOA 3A0SA 2L4RA 2K2NA 4QPRA 3PBNA 3VOLA 4WEJA 2MJ6A 4O0PA 1IFQA 1BYWA 2CMNA 3K3CA 4YOFA 1NLYA 4BBTA 2O0YA 4WF0A 3BY8A 2ZBBA 3B42A 4LPZA 2A24B 2W3DA 5L8MA 2P7JA 3C30A 3EQVA 4O01A 3PHYA 3OLOA 3LIEA 1H8MA 2W1RA 1OTEA 1N9NA 5AVEA 3BQ8A 4Q0HA 2QJ5A 1ZTUA 4MN7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DJU A;  3VE4 A;  4HP4 A;  2QKP A;  4GS9 A;  4PKY G;  4E04 A;  4JGP A;  2ZOH A;  4KQD A;  3T50 A;  1MZU A;  3SW1 A;  3CAX A;  4LRX C;  2M1C A;  1T1A A;  3UE6 A;  3UME A;  3C2W A;  4I39 A;  1TS7 A;  1T1C A;  4RQ9 A;  1OTA A;  1N9L A;  3IS2 B;  3FC7 A;  4GS9 B;  3F1O A;  2PYR A;  3LYX A;  4L9E A;  5HDS A;  3H7W B;  2V1A A;  3H82 B;  3LI9 A;  4LRZ E;  5KIZ A;  2HV1 A;  2JHE A;  1LSW A;  2A24 A;  2YKF A;  3KX0 X;  3MQQ A;  4PKY A;  5J7E A;  3GDI A;  2WKP A;  3ZQ5 A;  1OJG A;  1S1Y A;  2Z6D A;  4KUO A;  4GW9 A;  4MN5 A;  3ULF A;  5IS1 A;  3H7W A;  3IBR A;  3H82 A;  4EER A;  2V0U A;  3EWK A;  4EXO A;  2W27 A;  5F69 A;  4HH2 A;  2YKH A;  5IU1 A;  1OT9 A;  3PYP A;  2VEA A;  3NOP C;  4WUJ A;  1DP8 A;  5I5L A;  4HP9 A;  4R3A A;  2KX6 A;  4JGO A;  1UWP X;  2WKR A;  4H6J A;  3A0R A;  1OT6 A;  1N9O A;  1F9I A;  4NXB A;  3LID A;  5HDD A;  1V9Z A;  3NHQ A;  2KDK A;  4HI4 A;  2L0W A;  3NJA A;  2VV7 A;  4DJ2 A;  2R78 A;  4HIA A;  4WN5 A;  4BBV A;  1OTB A;  3RH8 B;  1DRM A;  1D06 A;  3E4Q A;  4HQA A;  3UB9 A;  2V9A A;  1LSX A;  4XT2 A;  2PR6 A;  3UB7 A;  4GHI A;  3UMD A;  3ICY A;  1JNU A;  1T19 A;  4LLO B;  5DKK A;  5TBM A;  1KOU A;  2JN7 A;  3HJI A;  5HD3 A;  1DP9 A;  4MN6 A;  2D02 A;  4EEU A;  2VV8 A;  3F1N A;  4HHD A;  3K3D A;  2I9V A;  1S4S A;  1P97 A;  3IS2 A;  1OTI A;  3E4O A;  4HH3 A;  4EET B;  2EA9 A;  2PD8 A;  1GSW A;  2VV6 A;  5F5Y A;  3UB6 A;  2OOL A;  2QWS A;  5HWT A;  4EES A;  5HSQ A;  4WLA A;  5J4E A;  4M4X A;  5AVF A;  4I5S A;  5HWV A;  5J3W A;  2W0N A;  2H28 A;  5HWW A;  2PYP A;  3D72 A;  4I3J A;  2GJ3 A;  3CWF A;  4R38 A;  4H6J B;  1G28 A;  4XT2 B;  1DP6 A;  1OJ5 A;  3GEC A;  5G4Y A;  3G6O A;  1F98 A;  2PHY A;  5HDC A;  4I38 A;  4F3L B;  4JGQ A;  2QHK A;  4R70 A;  1XFQ A;  3B33 A;  4I3I A;  4YWZ A;  1S67 L;  1XJ6 A;  3MFX A;  5DKL A;  3F1N B;  4I3A A;  3CLO A;  3F1P A;  2PR5 A;  1WA9 A;  4F3L A;  2BAS A;  3BWL A;  1GSV A;  1XJ4 A;  5HZH A;  1TS6 A;  2ZOI A;  2OWH A;  4KUK A;  4EEP A;  4EW7 A;  4HNB A;  4NXG A;  4WL9 A;  5DJT A;  3UB8 A;  5A8B A;  3F1P B;  1S4R A;  2WKQ A;  3MR0 A;  1LSV A;  1TS0 A;  3H9W A;  4HJ4 A;  5G4Z A;  3RTY A;  3NOT C;  1T18 A;  3LIF A;  3A0S A;  3F1O B;  3MQO A;  1NWZ A;  4NXE A;  1Y28 A;  3C8C A;  2L4R A;  1EW0 A;  4JGR A;  2PDR A;  3HJK A;  3LI8 A;  5EFW A;  1V9Y A;  3VOL A;  4EQ1 A;  2D01 A;  4HJ6 A;  3VE3 A;  1UGU A;  1S66 L;  3E4P A;  4HY8 A;  5F6A A;  3LIB A;  1BYW A;  1UWN X;  1XJ3 A;  2CMN A;  3K3C A;  4GHI B;  4L9G A;  5TBM B;  2B02 A;  2V1B A;  1LL8 A;  5F68 A;  4BBT A;  4K08 A;  3BY9 A;  4WF0 A;  1XFN A;  3BY8 A;  2ZBB A;  3FG8 A;  4LPZ A;  1T1B A;  2A24 B;  2VLG A;  3P7N A;  2INW A;  4DJ3 A;  4R6L A;  4NXF A;  1D7E A;  2PD7 A;  2QJ7 A;  3NOU C;  2P7J A;  1LT0 A;  1S1Z A;  3LUQ A;  4HOI A;  3MXQ A;  2J80 A;  1GSX A;  1OTD A;  1X0O A;  3PHY A;  4HJ3 A;  2K7S A;  2Z6C A;  3OLO A;  4GCZ A;  1VB6 A;  1TS8 A;  3LIE A;  3MJQ A;  4B9O A;  1OTE A;  1N9N A;  3LIC A;  2L1M A;  2V0W A;  4LRY C;  5AVE A;  4L9F A;  4BBU A;  1ODV A;  1XJ2 A;  2OWJ A;  3A0V A;  3EEH A;  3LIA A;  2QJ5 A;  5HD5 A;  1P0Z A; 
#chains in the Genus database with same CATH topology
 1FOF A;  4JGP A;  3S4X A;  2HF6 A;  5FDS A;  2ZJ9 A;  4DMZ A;  3IQA A;  4U0X A;  4N92 A;  4X69 A;  5FAO A;  4QB8 A;  1TVF A;  3EGD C;  3Q1F A;  1H5X A;  3CPT A;  1PNE A;  4X68 A;  2FFY A;  3GRJ A;  3ULF A;  5FQM A;  2AVX A;  1YMX A;  2XH9 A;  4BD1 A;  1CF0 A;  1OT6 A;  4R3B A;  1PW8 A;  2JKT I;  2XF3 A;  4GD8 A;  2EFX A;  1QME A;  4MDZ A;  1ES3 A;  1LSX A;  3E98 A;  4BEN A;  4EUZ A;  3UMD A;  4GHI A;  2RCX A;  4JF5 A;  1Z6F A;  4NK3 A;  4R3J A;  2EWV A;  5F83 A;  5IT5 A;  3S7Q A;  1NYY A;  5A91 A;  4CQH A;  2EX8 A;  5CEB A;  3VP1 A;  4EES A;  4MCW A;  5AVF A;  4BD0 A;  4KZ8 A;  2PYP A;  3D3O A;  2QHK A;  1K57 C;  4R70 A;  3B33 A;  2JKF A;  4GB7 A;  4OPR A;  2Y4A A;  3ZYT A;  3HCY A;  4X1L A;  4EEP A;  3WS4 A;  2WKQ A;  3V5M A;  3MSH A;  2QZ6 A;  1Y28 A;  5DTT A;  1OPX A;  4HJ6 A;  4BWI A;  3E4P A;  4HY8 A;  2ZQ9 A;  2ZM8 A;  1HZO A;  5F1F A;  4UA6 A;  1W63 M;  1N9B A;  2XEP A;  4NEE D;  5M19 A;  1JTG A;  2XLN A;  1YLP A;  5EE8 A;  4HOI A;  1ONG A;  3L9K A;  4S2M A;  3TJZ C;  2WAE A;  2ZQA A;  3LIC A;  3VP4 A;  5FQ9 A;  1YKD A;  4N9L A;  4OP5 A;  3T1Q B;  1F5M A;  4E04 A;  1K0K A;  3DTK A;  3QNC A;  4ARZ B;  4R4R A;  3UE6 A;  4RQ9 A;  1N9L A;  4B93 A;  1IOU A;  3A3F A;  4LRZ E;  1YSQ A;  3GDI A;  3R4K A;  5FAT A;  3ZG9 B;  3T1X A;  2H0T A;  2PU4 A;  3PBQ A;  5HAQ A;  2VEA A;  3O3V A;  4DRT A;  1YLJ A;  5EVL A;  2R9W A;  2H10 A;  2KDK A;  3EOI A;  2EXA A;  2WK0 A;  1YT4 A;  1OTB A;  3RH8 B;  4HBT A;  2WZX A;  2K31 A;  4CLC E;  2XA7 M;  2JKG A;  5KSC A;  1JNU A;  1T19 A;  2ZL1 A;  3G2Z A;  1DP9 A;  4KG2 A;  1AXB A;  1GHI A;  2ZC7 A;  1ESI A;  2Y79 A;  4HH3 A;  5JYP A;  4U0T A;  2IA2 A;  2Q0O A;  2H28 A;  4P85 A;  2WAF A;  1IKG A;  1BLH A;  3G6O A;  3HRE A;  3VSK A;  1ES5 A;  2BAS A;  4X6T A;  2GX5 A;  4Y0U A;  4Q0J A;  4BJP A;  5A8B A;  1VEU B;  3QP8 A;  5GHX A;  4RVA A;  3JYI A;  3ZG0 A;  1XJ3 A;  1L2S A;  4Y0O A;  4PMA A;  3B47 A;  3FZC A;  2G2U A;  3C7U A;  3GR2 A;  3MZF A;  2XRO A;  4R0Q A;  1ES4 A;  1PI4 A;  2QMI A;  2W3F A;  4UA9 A;  1S1Z A;  2XD5 A;  3CZD A;  2Y8H A;  4IBX A;  3QNB A;  1OTD A;  5HX9 A;  2EWW A;  2L1M A;  2V0W A;  3EEH A;  3LCE A;  2P08 A;  3SH9 A;  4JXS A;  2DMW A;  4S2L A;  2W1T A;  3CAX A;  4LRX C;  4EQI A;  4E3I A;  3UME A;  1SKO A;  3WRZ A;  3W2Z A;  1SDE A;  3DBA A;  4L9E A;  4ZDX A;  3CMZ A;  4ZJ2 A;  3LI9 A;  1LI9 A;  4NET A;  5A92 A;  1OJG A;  4N1X A;  3A3I A;  3RFB A;  2YKH A;  3A3E A;  1KGF A;  2A3U A;  5G18 A;  3A0R A;  1ZHH B;  3FPV A;  3LID A;  3MXS A;  1I2W A;  1V9Z A;  3G35 A;  4HIA A;  2A2L A;  3LEZ A;  3HLG A;  1LHY A;  3DAV A;  1I5Q A;  4B4X A;  1CEF A;  1KVM A;  4E3O A;  4BL2 A;  1F2K A;  5FL3 A;  4L0L A;  1E25 A;  5HWT A;  3MKF A;  4I5S A;  1Q2Q A;  1W5D A;  2W0N A;  4D2O A;  4PAU A;  5G4Y A;  2VA0 A;  4FUW A;  1S67 L;  3D9Y A;  4GOG A;  2PAV P;  5HW3 A;  2FZ0 A;  3QHY A;  4HJ4 A;  3EGX C;  3RTY A;  2ZL1 B;  4NXE A;  1NWZ A;  1EW0 A;  1FSW A;  3K2N A;  4IVI A;  3A3D A;  4GHI B;  3PBT A;  2B02 A;  5F68 A;  2H5S A;  3HLB A;  2HP6 A;  4CJN A;  5CGS A;  3IX8 A;  4OQI A;  3G4P A;  4GNU A;  1YLY A;  2OLU A;  3IHA A;  3IH8 A;  3P01 A;  1G68 A;  3AGF A;  4HJ3 A;  5FI7 A;  2OV5 A;  1TS8 A;  4L9F A;  3JPU A;  3C4P A;  3A0V A;  3LIA A;  3PBS A;  1JWV A;  4HP4 A;  2QKP A;  5HAP A;  4WM9 A;  2HGV A;  1J3W A;  3BFC A;  1DJA A;  4YFM A;  3MZD A;  5DFY A;  3WS5 A;  4CPK A;  5IS1 A;  2Y2N A;  3E2L A;  2HP9 A;  5AQB A;  5F1G A;  2V8C A;  3JVU A;  5HPI A;  2O9C A;  3LR5 A;  2WZZ A;  5CX7 A;  2M7U A;  3NIA A;  1QMF A;  2VGL S;  4PM8 A;  1PIO A;  2PU2 A;  4BBV A;  3VFH A;  1SKO B;  2PR6 A;  2Y59 A;  3Q7V B;  3SS4 A;  4LFU A;  2JN7 A;  1KDS A;  1FQG A;  2R9X A;  4QHC A;  4M3K A;  5DTK A;  4X53 A;  3LY3 A;  5HWV A;  5HWW A;  4I3J A;  3VFF A;  1XFQ A;  3IWQ A;  5DFX A;  4KZ6 A;  2PR5 A;  2X02 A;  1GA9 A;  1LSV A;  3QP4 A;  1AWI A;  3MS6 A;  4DE0 A;  3B3X A;  4WEJ A;  1PWD A;  4O0P A;  4DDY A;  2ACG A;  4H8R A;  2P9V B;  3IXD A;  2W3D A;  5L8M A;  5FI6 A;  2P7J A;  2Y2O A;  4ID4 A;  4O01 A;  5FAP A;  2UV0 E;  3OLO A;  4R1G A;  2H0Y A;  5L09 A;  3LIE A;  3W8K A;  1PWC A;  2Y55 A;  1YMS A;  4ZBE A;  5U47 A;  4ETX A;  1MZU A;  4KZ4 A;  3S7N A;  3T4T A;  3OPL A;  1W8Q A;  4EUV A;  3VOZ A;  4O8G A;  3T4K A;  4EBN A;  1DJC A;  5KIZ A;  2HV1 A;  2OSU A;  3CUE A;  4GDN A;  2WKH A;  1K38 A;  3UY6 A;  2O99 A;  4UQI M;  4JKT A;  3OCL A;  4A5R A;  4GN2 A;  3WWX A;  2C5W B;  3HLC A;  1J9M A;  3NJA A;  1W79 A;  1MWU A;  2E8J A;  3E4Q A;  1G5U A;  4X25 A;  4XT2 A;  4JF4 A;  2XGN A;  2VV8 A;  4N1H A;  1JWZ A;  5IHV A;  3EQU A;  2PD8 A;  1NLZ A;  5F5Y A;  3DW0 A;  5HSQ A;  5GHY A;  2P9V A;  3BLS A;  3BEB A;  1ERO A;  1G28 A;  3IWI A;  2PHY A;  1ERM A;  5DKL A;  3BQA A;  4F3L A;  1GSV A;  2OWH A;  4YIN A;  2UWX A;  5AQ7 A;  3Q7Z A;  2EXB A;  1T18 A;  4JXV A;  2G2W A;  3LI8 A;  4KQQ A;  2D01 A;  1S66 L;  1OME A;  3NI9 A;  4YNR A;  3ZG7 B;  4Q8I A;  4OQG A;  1Z09 A;  4Y5F A;  2RL3 A;  2VLG A;  4Y0T A;  3KYE A;  1D7E A;  1KGG A;  2JCH A;  5HAI A;  1FR6 A;  2WUQ A;  2J3T C;  5FI2 A;  4OOL A;  1VM1 A;  3KSH A;  5F69 A;  2PBY A;  3ZNY A;  3HUM A;  4Y15 A;  3UPN A;  3VE4 A;  4QU3 A;  3MQ0 A;  3OCN A;  4MBF A;  4PHT A;  3IS2 B;  2J7V A;  2J8Y A;  1YLT A;  1NY0 A;  1S1Y A;  2Z6D A;  4QY5 A;  4GW9 A;  2B5R A;  3H7W A;  4EER A;  5CHU A;  3P98 A;  1YLW A;  3V50 A;  3BYD A;  3A3J A;  3W4P A;  2B95 A;  3T1R A;  3TSG A;  4QD4 A;  3DWK A;  2V9A A;  4OH0 A;  3ZGA B;  4FSF A;  1ESU A;  3OPH A;  2VK3 A;  5EVI D;  3PAE A;  3K3D A;  4Y13 A;  1P97 A;  1TF1 A;  4WMC A;  1OTI A;  4P87 A;  1NRF A;  3OZH A;  3RJU A;  1O07 A;  1NZU A;  4XT2 B;  3Q07 A;  5HL6 A;  4I38 A;  4JF6 A;  4LCL A;  4E6X A;  2Y2L A;  4KUK A;  3ITA A;  4HNB A;  3KSG A;  4BQM A;  4X56 A;  3F1P B;  1TS0 A;  3H9W A;  4FH2 A;  3NOT C;  5J7E A;  4E3K A;  3WS0 A;  4JGR A;  3PBR A;  4UHU A;  5M1A A;  3CPT B;  3OC2 A;  4MMN A;  2HDR A;  5E43 A;  2ZC6 B;  3CHW P;  1MWR A;  3BW6 A;  3BY9 A;  3VSL A;  1E4D A;  2INW A;  1BSG A;  5KMW A;  3IT9 A;  1LT0 A;  3MXQ A;  4UA7 A;  2Z6C A;  2V1Z A;  5DJU A;  3MFD A;  1ZG4 A;  5EVE A;  1FCN A;  2Y2J A;  2ZOH A;  4KQD A;  3T4L A;  1MKM A;  3KSF A;  3E0Y A;  4PM9 A;  1E3U D;  3FKW A;  4C75 A;  1JVJ A;  5EOO A;  3IX3 A;  3TRC A;  2V0U A;  5EEC A;  5MC7 A;  3NOP C;  3IF6 C;  1DP8 A;  4R3A A;  1XA7 A;  3UDX A;  2NUT C;  1NYM A;  5GLC A;  3NHQ A;  3O87 A;  3Q81 A;  1PFL A;  3CJM A;  3HLF A;  4LV3 A;  1KE4 A;  5TBM A;  5HD3 A;  4PPR A;  3O88 A;  4MN6 A;  4EEU A;  1FR1 A;  3ZFZ A;  4Y3I A;  5FQI A;  3S1Y A;  3BRM A;  4JPM A;  5J4E A;  5J3W A;  3U2A A;  4DDS A;  1XGJ A;  2A49 A;  1XJ6 A;  3GSG A;  5KSH A;  5HZH A;  3BFG A;  3ZVW A;  1ZKJ A;  5EFW A;  2JKR M;  3LGO A;  3LR4 A;  4L9G A;  2V1B A;  4LV0 A;  5FA7 A;  4S2K A;  4DKI A;  2QJ7 A;  1WYB A;  3HLD A;  2ZLY A;  5K5B A;  1EI5 A;  3M2K A;  4WZ4 A;  4OOM A;  4EBP A;  1ONH A;  4CLC B;  5EUA A;  4BL3 A;  5HFO A;  3ZNT A;  4DN0 A;  4LV2 A;  5CTN A;  3V39 A;  3HLW A;  3PR6 A;  2KLI A;  3HUO A;  3FC7 A;  4KEN B;  3LY4 A;  2PYR A;  2ZQC A;  2JKT M;  4HBU A;  4OPZ A;  3H82 B;  2ZD8 A;  3T4S A;  2GZA A;  3KX0 X;  3ZQ5 A;  4EXO A;  3PYP A;  3UDI A;  1U60 A;  5EM1 A;  3O5Y A;  4JGO A;  1UWP X;  5BOH A;  2VX8 A;  3UB5 P;  4ZTK A;  4O7D A;  4GZB A;  1PZP A;  1XKZ A;  1W7F A;  3R7W B;  1KOU A;  2WYX A;  3NDG A;  5FEF A;  3LR3 A;  1S6R A;  2ZM0 A;  3MBZ A;  2V20 A;  2EFU A;  4DF6 A;  5C5K A;  1H0M A;  2Y2H A;  5L2F A;  4EV4 A;  3FPW A;  1WA9 A;  3BWL A;  5DF7 A;  2P04 A;  3MR0 A;  1CQA A;  4XUX A;  3A0S A;  1GCE A;  2K2N A;  3VOL A;  5EVI A;  4EWF A;  1VEU A;  1D1J A;  1IFQ A;  1MWT A;  2ZQ8 A;  1BYW A;  3QP1 A;  1NLY A;  5GLD A;  2Y2M A;  4BBT A;  2X71 A;  2Z2L B;  3BY8 A;  3Q82 A;  1YLZ A;  3B42 A;  2DRW A;  5GLB A;  4PM7 A;  3LO7 A;  3DWZ A;  2HDS A;  4S2N C;  3C30 A;  3ZG8 B;  5CGW A;  3PHY A;  3WRT A;  1H8M A;  2W1R A;  5AVE A;  3BQ8 A;  1HD8 A;  1Y54 A;  3MXR A;  1K4F A;  4GS9 A;  3MF0 A;  2OAP 1;  4I39 A;  1ZC2 A;  4GS9 B;  1BLS A;  3MQQ A;  2WGI A;  2WGW B;  4ZJ1 A;  3UDF A;  4ZAM A;  4RYE A;  5FDH A;  5CHJ A;  5I5L A;  4HP9 A;  1N9O A;  1F9I A;  1W8Y A;  3IF5 A;  5FEG A;  3C38 A;  2VV7 A;  4DJ2 A;  3PTE A;  5JYO A;  2HZ5 A;  1MY8 A;  1XP4 A;  1K56 D;  2QYB A;  3BLM A;  1H8Y A;  4G3K A;  1PW1 A;  3UB6 A;  1HVB A;  1CJF A;  4M4X A;  3CWF A;  4CLC C;  4H6J B;  1OJ5 A;  4JGQ A;  3NY4 A;  2P74 A;  3SH7 A;  4NG2 A;  3RXW A;  5I94 A;  3LIF A;  1SCW A;  3S7P A;  4IHQ A;  1V9Y A;  4JBF A;  1RGZ A;  3LIB A;  3VOY A;  2LB5 A;  2WAD A;  3FG8 A;  1T1B A;  1FCM A;  3NEC A;  2PD7 A;  4FD8 A;  2W1T B;  3V67 A;  3LUQ A;  4OVD A;  4BMW A;  3NC8 A;  1ES2 A;  3BEC A;  2J80 A;  5CTM A;  3MKE A;  2ZC5 B;  4DJ3 A;  4MNR A;  4MBK A;  3FYZ A;  1P0Z A;  1CI9 A;  4KZ5 A;  4Z1W A;  2Z2M B;  1M40 A;  3SS3 A;  1OTA A;  4HEF A;  4KQR A;  3F1O A;  5HDS A;  3T4J A;  4S2N A;  1E3U A;  4GLQ A;  4MN5 A;  4P6Z S;  1L0D A;  4FH4 A;  4Y2F A;  4S2O A;  1OT9 A;  3VP2 A;  1P9W A;  4H6J A;  3IBJ A;  2IWD A;  5HDD A;  2PT7 A;  3TE8 A;  4WMC D;  3R7W A;  1DRM A;  1D06 A;  3OOV A;  5CEC A;  2BTF P;  2B18 A;  3HJI A;  2D02 A;  4G3V A;  2KOI A;  3EEA A;  2Y2I A;  5FAQ A;  4JXW A;  3IS2 A;  2VV6 A;  1XA1 A;  1NRJ A;  4BBU A;  4R38 A;  2NUP C;  2GNX A;  4Y17 A;  1KDW A;  1YQS A;  4DE3 A;  4P6Z M;  3KYZ A;  4NKP A;  4KZA A;  2BG1 A;  2JKR I;  1UGU A;  1UWN X;  1HTZ A;  3VV4 A;  1YSP A;  2DCF A;  4JXG A;  1L3L A;  1LL8 A;  3AGD A;  1H3Q A;  4RA7 A;  1YPR A;  2BLS A;  2ZQD A;  4E3J A;  3QP5 A;  3VMA A;  4OON A;  4LRY C;  1YAX A;  3HBR A;  3T1S A;  1ODV A;  3ZHH A;  5HD5 A;  1RP5 A;  4K0W A;  2FFF B;  3C7V A;  3HL9 A;  2ZMA A;  4DE1 A;  2HDQ A;  1MWS A;  3Q7V A;  2VZW A;  2V1A A;  3GMW A;  2ZMV A;  3C5A A;  3HVF A;  3LEQ A;  4WBG A;  5EM0 A;  4K0X A;  3M6B A;  2DNS A;  3KYQ A;  3W4Q A;  4F94 A;  4DXB A;  3WS1 A;  3P09 A;  5HL1 A;  1BUL A;  5E2H A;  2HDU A;  3GVB A;  1I2S A;  2VGJ A;  2L0W A;  3ITB A;  3JVV A;  3OBF A;  3KSI A;  4LLO B;  3D4F A;  2C6W B;  4GDB A;  3QP2 A;  1Y4O A;  3M6H A;  2O9A A;  4OOY A;  1MPL A;  2VKS A;  2ZMF A;  5GL9 A;  2XD1 A;  3G32 A;  1VHM A;  4ZJ3 A;  4RX2 A;  3ZVT A;  2PRF A;  5CRF A;  4KG5 A;  4NXG A;  4C6Y A;  1L0E A;  4WN5 A;  2PDR A;  3HJK A;  4RX3 A;  1IYQ A;  3VE3 A;  4C3Q A;  4KZ3 A;  1PYY A;  5TBM B;  3DTE A;  4ESP A;  2XRN A;  5EVI C;  5L10 A;  1JTD A;  2XK1 A;  5EVI B;  3PBO A;  1X0O A;  4X1M A;  5F82 A;  1DY6 A;  1LI0 A;  1VB6 A;  3MJQ A;  1WYC A;  2LB9 A;  4EU0 A;  2OWJ A;  1ACF A;  3N7W A;  3PXP A;  3G34 A;  4MBH A;  3DTM A;  1MXO A;  2XSS A;  3G2Y A;  3SW1 A;  3C4O A;  3CI6 A;  3C2W A;  4FOF A;  4ME4 A;  1PZO A;  1HLU P;  3BJN A;  5FSR A;  4KZ9 A;  2M7V A;  2JHE A;  1LSW A;  1Q2P A;  2WKP A;  3LR0 A;  2W27 A;  2Y2G A;  1S0W A;  3SZT A;  3G31 A;  4GD6 A;  4OLG A;  2IWB A;  4DE2 A;  3N8S A;  3ISG A;  4OP8 A;  3LFV A;  4QJG A;  3DTI A;  1K55 C;  5DKK A;  3ICY A;  2ZC3 B;  1A0K A;  4HHD A;  4AFI A;  2I9V A;  3E4O A;  1VQQ A;  1XXM A;  1GSW A;  4WLA A;  3N8L A;  2WKI A;  3D72 A;  2GJ3 A;  3KO6 A;  1DP6 A;  3M2J A;  1NXY A;  2JE5 A;  2XR0 A;  4I3I A;  4YWZ A;  1XX2 A;  3UE0 A;  5A90 A;  2Y2Q A;  4WL9 A;  5DJT A;  3UB8 A;  3SS5 A;  1FSY A;  4R4S A;  3QP6 A;  3UNW A;  4OQH A;  2MJ6 A;  2CMN A;  3K3C A;  4Z9Q A;  4WF0 A;  2WGV A;  4LPZ A;  2A24 B;  3IXH A;  3WS2 A;  1PI5 A;  3S22 A;  1JWP A;  3BFD A;  1OTE A;  1N9N A;  4B88 A;  3IF6 A;  1ZTU A;  4MN7 A;  5FQQ A;  3IH9 A;  1T1C A;  4KZ7 A;  1IYP A;  4UQI S;  3EWK A;  4KZB A;  2XDM A;  1EWZ A;  2KX6 A;  4NXB A;  1SDN A;  5EV0 A;  2WKE A;  1FCO A;  4HI4 A;  5L07 A;  2IWC A;  5E2E A;  3IXB A;  5D3O A;  1KE3 A;  1K57 A;  3F1N A;  3L7H A;  1CI8 A;  4BLM A;  3MMH A;  2W3G A;  4GJ4 A;  4X55 A;  3IXG A;  4IED A;  4U3T A;  4P0M A;  1NZO A;  1FIK A;  4EBL A;  4F3L B;  1CEG A;  1K56 A;  3T4Q A;  3CLO A;  1MC0 A;  2Q9M A;  5CHM A;  2X01 A;  4E3L A;  1WE4 A;  3F1O B;  4K91 A;  5TFQ A;  5LBR A;  3TOI A;  2VJW A;  5TR7 A;  1GHM A;  4XUZ A;  5F6A A;  4UAA A;  5CER A;  4K08 A;  2Y91 A;  2EX6 A;  5EPH A;  4NXF A;  1DJB A;  4LEN A;  3NOU C;  3CUE C;  5CGX A;  4FTX A;  5DTS A;  1GSX A;  3U4L P;  4B9O A;  3FWL A;  3V3R A;  4R23 A;  5FQK A;  4S2I A;  2CC1 A;  3T50 A;  5DF8 A;  1MKI A;  2M1C A;  1T1A A;  4PM5 A;  5DF9 A;  3LYX A;  2QPN A;  1BT5 A;  3O86 A;  1ERQ A;  2A24 A;  1BLC A;  1GA0 A;  4KUO A;  3NDE A;  3T4O A;  1LL5 A;  2ZQ7 A;  3UPP A;  2E8I A;  4OLD A;  1L0G A;  2ZC4 B;  3G30 A;  2WKR A;  2ZM2 A;  1IYO A;  3W4O A;  2HP5 A;  4MLL A;  3E2K A;  4OKP A;  1BUE A;  2Y2K A;  2Y2P A;  4GKU A;  1K4E A;  4HQA A;  1C3B A;  3UB7 A;  1K6S A;  1SZV A;  2W3H A;  4ARZ A;  2GDN A;  3GQZ A;  3UN7 A;  3S7O A;  2EA9 A;  3AGE A;  2QWS A;  2HJE A;  2HPB A;  4MEZ A;  4QY6 A;  1SKF A;  3NCK A;  4UEY A;  4LGW A;  1BTL A;  1CK3 A;  4II7 A;  3HLE A;  1BZA A;  5EOE A;  1PRQ A;  3N6I A;  1TS6 A;  4HES A;  4EW7 A;  4D60 A;  1VET A;  3SOI A;  4WEL A;  2OAQ 1;  1KGE A;  2JC7 A;  1L0F A;  1K54 C;  4OPY A;  1XFN A;  1XPB A;  2V2F F;  5HPF A;  3N4I A;  4R6L A;  1IEM A;  3UE1 A;  1RCJ A;  3VP0 A;  5TGF A;  5FAS A;  2XA7 S;  1TD5 A;  2K7S A;  4E3M A;  4GCZ A;  4CLC D;  2G7U A;  3FV7 A;  1XJ2 A;  3SH8 A;  1LL9 A;  3BM6 A;  4IUK A;  3BFE A;  2V8F A;  2O9B A;  4WEK A;  4DXC A;  1TS7 A;  4P6B A;  1ZG6 A;  1FIL A;  2YKF A;  5HAR A;  3IBR A;  3ZDJ A;  1STZ A;  4HH2 A;  5IU1 A;  3ZCZ A;  1IYS A;  1P9R A;  3GV9 A;  4G3W A;  1G6O A;  2WGW A;  3UPO A;  2VGL M;  2HJ9 C;  3IX4 A;  1RGY A;  3N8R A;  4JLF A;  4CLC A;  1TDL A;  4WZ5 A;  4WZ5 C;  4LCM A;  2R78 A;  4PM6 A;  5CXW A;  3HUN A;  2EX2 A;  1M6K A;  2FH5 A;  1YM1 A;  1IKI A;  3PAG A;  2XQZ A;  1ALQ A;  1S4S A;  4EET B;  2OOL A;  3CG5 A;  3NBL A;  4OPQ A;  3UO9 A;  4WYY A;  3OPR A;  3GEC A;  1F98 A;  2W3E A;  4IJG A;  3T12 B;  3VP3 A;  1MBL A;  3TW8 A;  1XJ4 A;  1PWG A;  5G4Z A;  1S4R A;  1TEM A;  2J3W A;  4Q0I A;  3C8C A;  4EQ1 A;  4LV1 A;  3RXX A;  4ETZ A;  3UE3 A;  1K55 A;  3MZE A;  3IHB A;  3TG9 A;  3P7N A;  3FKV A;  1K54 A;  4OQ0 A;  5GHZ A;  4N9K A;  3I7J A;  1VET B;  5KZH A;  4PKY G;  2OLV A;  4QWO A;  4ZRR A;  2I72 A;  1IEL A;  5DVA A;  5J8X A;  4KG6 A;  5GLA A;  3H7W B;  5CED A;  1NJ4 A;  3IF6 B;  4E3N A;  4PKY A;  1G6A A;  3NUL A;  3H82 A;  4FCF A;  1W63 Q;  4WUJ A;  4KQO A;  4IUH A;  1H8Z A;  3ZG5 A;  3CIT A;  5AJG A;  5TJJ A;  1GHP A;  3UB9 A;  3IWO A;  5FQJ A;  2PBD P;  4IVK A;  1K6R A;  2XFS A;  4XXR A;  1BLP A;  3BFF A;  2J3T D;  5HDC A;  4E6W A;  4IBR A;  3MFX A;  3GTC A;  3F1N B;  4I3A A;  3F1P A;  1KE0 A;  2JBF A;  2ZOI A;  5A93 A;  1LLB A;  3MQO A;  1KVL A;  4S2J A;  2L4R A;  4QPR A;  3PBN A;  3V3S A;  1K25 A;  5AQ9 A;  5E2G A;  2Q9N A;  1SHV A;  4YOF A;  1O7E A;  2O0Y A;  2ZBB A;  1XGI A;  2EX9 A;  5AQA A;  4Y7P A;  1TDG A;  5M18 A;  3EQV A;  4B4Z A;  1N4O A;  2J9O A;  4S2P A;  4Q0H A;  2VGK A;  2J9P A;  2QJ5 A;  5E2F A;  3OPP A;  2XFT A; 
#chains in the Genus database with same CATH homology
 4ETX A;  4GS9 A;  4JGP A;  2HF6 A;  3MF0 A;  1MZU A;  4DMZ A;  2OAP 1;  3S7N A;  4I39 A;  3T4T A;  1T1C A;  4EUV A;  4GS9 B;  3EGD C;  4O8G A;  3T4K A;  5KIZ A;  2HV1 A;  3CUE A;  4UQI S;  3MQQ A;  3ULF A;  3EWK A;  2O99 A;  4UQI M;  3OCL A;  5I5L A;  4HP9 A;  2KX6 A;  1OT6 A;  1N9O A;  1F9I A;  4NXB A;  3C38 A;  4HI4 A;  2JKT I;  3NJA A;  2VV7 A;  4DJ2 A;  3E4Q A;  4MDZ A;  1LSX A;  3E98 A;  4XT2 A;  3UMD A;  4GHI A;  2EWV A;  2VV8 A;  5IT5 A;  3S7Q A;  3F1N A;  2QYB A;  4CQH A;  3MMH A;  4G3K A;  3EQU A;  2PD8 A;  1NLZ A;  2W3G A;  4GJ4 A;  5F5Y A;  3UB6 A;  4EES A;  5HSQ A;  4MCW A;  4M4X A;  5AVF A;  2PYP A;  3CWF A;  4CLC C;  4H6J B;  1G28 A;  1OJ5 A;  4F3L B;  2PHY A;  3D3O A;  4JGQ A;  2QHK A;  4R70 A;  3B33 A;  5DKL A;  3T4Q A;  3CLO A;  1MC0 A;  3BQA A;  3ZYT A;  4F3L A;  1GSV A;  3HCY A;  2OWH A;  4EEP A;  2WKQ A;  1T18 A;  3LIF A;  3F1O B;  1Y28 A;  3S7P A;  4IHQ A;  1OPX A;  3LI8 A;  1V9Y A;  5LBR A;  2D01 A;  2VJW A;  4HJ6 A;  4BWI A;  1S66 L;  3E4P A;  4HY8 A;  5F6A A;  3LIB A;  4YNR A;  2LB5 A;  4K08 A;  3FG8 A;  1W63 M;  1T1B A;  4Y5F A;  2VLG A;  4NEE D;  4NXF A;  1D7E A;  2PD7 A;  2W1T B;  3NOU C;  3V67 A;  3CUE C;  3LUQ A;  4BMW A;  4HOI A;  2J3T C;  4OOL A;  2J80 A;  1GSX A;  3KSH A;  5F69 A;  4DJ3 A;  3TJZ C;  4B9O A;  3LIC A;  1YKD A;  1P0Z A;  4Z1W A;  3VE4 A;  1F5M A;  4E04 A;  3T50 A;  4ARZ B;  3MQ0 A;  2M1C A;  1T1A A;  3UE6 A;  3OCN A;  4PHT A;  4RQ9 A;  5DF9 A;  1OTA A;  1N9L A;  3IS2 B;  4B93 A;  1IOU A;  3F1O A;  3LYX A;  5HDS A;  3T4J A;  4LRZ E;  1YSQ A;  2A24 A;  3GDI A;  4GLQ A;  2Z6D A;  1S1Y A;  4KUO A;  4GW9 A;  4MN5 A;  3T4O A;  3H7W A;  3R4K A;  4P6Z S;  4EER A;  4Y2F A;  3PBQ A;  1OT9 A;  2VEA A;  1P9W A;  2WKR A;  4H6J A;  3IBJ A;  5HDD A;  2PT7 A;  2KDK A;  3EOI A;  3TE8 A;  3R7W A;  1OTB A;  3RH8 B;  1DRM A;  1D06 A;  4HQA A;  3OOV A;  2K31 A;  4CLC E;  2V9A A;  2XA7 M;  3UB7 A;  1JNU A;  1T19 A;  2B18 A;  3HJI A;  2W3H A;  1DP9 A;  2D02 A;  4FSF A;  4G3V A;  4ARZ A;  2KOI A;  3K3D A;  3EEA A;  1P97 A;  1TF1 A;  3IS2 A;  1OTI A;  2Y79 A;  4HH3 A;  3S7O A;  2EA9 A;  2VV6 A;  2IA2 A;  2QWS A;  2HJE A;  2H28 A;  4UEY A;  1NRJ A;  4XT2 B;  4R38 A;  2NUP C;  4BBU A;  5HL6 A;  3G6O A;  4II7 A;  4I38 A;  2GNX A;  2BAS A;  4P6Z M;  1TS6 A;  2GX5 A;  4KUK A;  4EW7 A;  4HNB A;  3KSG A;  4Q0J A;  4BJP A;  5A8B A;  3F1P B;  1TS0 A;  3H9W A;  3KYZ A;  3NOT C;  4NKP A;  5J7E A;  4JGR A;  3PBR A;  2JKR I;  4WEL A;  2OAQ 1;  3OC2 A;  4MMN A;  1UGU A;  1UWN X;  1XJ3 A;  3VV4 A;  1YSP A;  3BW6 A;  1LL8 A;  3B47 A;  3BY9 A;  1H3Q A;  1XFN A;  5HPF A;  2XRO A;  2INW A;  4R6L A;  2W3F A;  1LT0 A;  1S1Z A;  2Y8H A;  3MXQ A;  1OTD A;  2XA7 S;  1TD5 A;  2K7S A;  2Z6C A;  4GCZ A;  4CLC D;  2EWW A;  2G7U A;  2L1M A;  2V0W A;  4LRY C;  1YAX A;  1ODV A;  1XJ2 A;  3EEH A;  2P08 A;  5HD5 A;  2DMW A;  4IUK A;  5DJU A;  2ZOH A;  4KQD A;  2W1T A;  3T4L A;  1MKM A;  3CAX A;  2O9B A;  4LRX C;  4WEK A;  3UME A;  3KSF A;  3E0Y A;  1TS7 A;  3W2Z A;  3DBA A;  2VZW A;  4L9E A;  2V1A A;  3LI9 A;  2ZMV A;  2YKF A;  1OJG A;  3IBR A;  3TRC A;  2V0U A;  1STZ A;  5MC7 A;  4HH2 A;  3RFB A;  2YKH A;  5IU1 A;  3NOP C;  1DP8 A;  1P9R A;  4R3A A;  4G3W A;  1G6O A;  3KYQ A;  2VGL M;  2HJ9 C;  3A0R A;  1ZHH B;  3FPV A;  3LID A;  4CLC A;  2NUT C;  1V9Z A;  3NHQ A;  2L0W A;  2R78 A;  4HIA A;  3JVV A;  3OBF A;  2A2L A;  3KSI A;  2FH5 A;  5TBM A;  4LLO B;  5HD3 A;  4MN6 A;  4EEU A;  4Y3I A;  1S4S A;  5FL3 A;  4EET B;  2O9A A;  2OOL A;  4L0L A;  5HWT A;  5J4E A;  4I5S A;  5J3W A;  2W0N A;  3U2A A;  2VKS A;  2ZMF A;  4PAU A;  5G4Y A;  3GEC A;  2VA0 A;  1F98 A;  2W3E A;  4IJG A;  1S67 L;  1XJ6 A;  1VHM A;  3TW8 A;  1XJ4 A;  5KSH A;  5HZH A;  2FZ0 A;  4NXG A;  5G4Z A;  1S4R A;  4HJ4 A;  3EGX C;  3RTY A;  2J3W A;  4Q0I A;  4NXE A;  4WN5 A;  1NWZ A;  3C8C A;  1EW0 A;  5EFW A;  2PDR A;  3HJK A;  4EQ1 A;  3K2N A;  2JKR M;  3VE3 A;  3LR4 A;  4GHI B;  5TBM B;  3PBT A;  4L9G A;  2B02 A;  2V1B A;  5F68 A;  4ETZ A;  3UE3 A;  2XRN A;  3P7N A;  2QJ7 A;  3P01 A;  3PBO A;  5K5B A;  1X0O A;  4HJ3 A;  4OOM A;  3MJQ A;  1VB6 A;  1TS8 A;  2LB9 A;  4EU0 A;  4L9F A;  2OWJ A;  3A0V A;  3LIA A;  3PXP A;  4CLC B;  3PBS A;  2XSS A;  4HP4 A;  2QKP A;  4PKY G;  4ZRR A;  4DN0 A;  3SW1 A;  2HGV A;  3CI6 A;  3C2W A;  4FOF A;  4ME4 A;  3PR6 A;  2KLI A;  3FC7 A;  3BJN A;  2PYR A;  2JKT M;  3H7W B;  5DFY A;  3H82 B;  2M7V A;  2JHE A;  1LSW A;  3T4S A;  2GZA A;  3KX0 X;  4PKY A;  3ZQ5 A;  2WKP A;  5IS1 A;  3H82 A;  3LR0 A;  4EXO A;  2W27 A;  3PYP A;  1W63 Q;  4WUJ A;  3JVU A;  3O5Y A;  4KQO A;  4IUH A;  4JGO A;  5HPI A;  1UWP X;  2O9C A;  3LR5 A;  3CIT A;  5CX7 A;  5AJG A;  5TJJ A;  2M7U A;  2VX8 A;  3LFV A;  2VGL S;  4BBV A;  3UB9 A;  2PR6 A;  3ICY A;  5DKK A;  3R7W B;  1KOU A;  2JN7 A;  4HHD A;  4AFI A;  2I9V A;  3LR3 A;  3E4O A;  1GSW A;  5C5K A;  4WLA A;  2J3T D;  5HWV A;  5HWW A;  3D72 A;  4I3J A;  2GJ3 A;  3KO6 A;  1DP6 A;  5HDC A;  1XFQ A;  4I3I A;  4YWZ A;  3MFX A;  5DFX A;  3F1N B;  4I3A A;  3F1P A;  2PR5 A;  3FPW A;  1WA9 A;  3BWL A;  2ZOI A;  4WL9 A;  5DJT A;  3UB8 A;  2P04 A;  3MR0 A;  1LSV A;  3MQO A;  3A0S A;  2L4R A;  2K2N A;  4QPR A;  3PBN A;  3VOL A;  4WEJ A;  2MJ6 A;  4O0P A;  1IFQ A;  1BYW A;  2CMN A;  3K3C A;  4YOF A;  1NLY A;  4BBT A;  2O0Y A;  4WF0 A;  3BY8 A;  2ZBB A;  3B42 A;  4LPZ A;  2A24 B;  2W3D A;  5L8M A;  2P7J A;  3C30 A;  3EQV A;  4O01 A;  3PHY A;  3OLO A;  3LIE A;  1H8M A;  2W1R A;  1OTE A;  1N9N A;  5AVE A;  3BQ8 A;  4Q0H A;  2QJ5 A;  1ZTU A;  4MN7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...