4I3JA

Structures of pr1 intermediate of photoactive yellow prtein e46q muntant from time-resolved laue crystallography collected at 14id aps
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAQGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Luminescent protein
molecule keywords Photoactive yellow protein
publication title Volume-conserving trans-cis isomerization pathways in photoactive yellow protein visualized by picosecond X-ray crystallography
pubmed doi rcsb
source organism Halorhodospira halophila
total genus 37
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2012-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4i3jA00
2V1BA 3UB7A 4L9FA 2VV7A 1TS0A 5AVEA 1LT0A 2A24B 1DP9A 3RH8B 3E4PA 4HHDA 2P7JA 1P97A 1ODVA 4DJ3A 1S1ZA 3F1OB 3NOTC 3LUQA 4I3JA 5HZHA 4JGPA 1OTIA 2KX6A 2V1AA 3FC7A 5HD5A 1TS6A 3UB8A 5DKLA 1OTEA 3K3DA 3UE6A 5HD3A 1NWZA 3ULFA 3H82B 2PYPA 5HSQA 1X0OA 3RTYA 2BASA 3PHYA 5F6AA 2GJ3A 1F9IA 3LIFA 1XJ2A 4HP4A 4LRYC 1TS8A 4M4XA 3IS2B 3UB9A 1T18A 2W27A 3MQOA 4HOIA 1DP8A 1EW0A 1DRMA 2K7SA 3F1PA 4HJ4A 2JHEA 4LRXC 4HY8A 4B9OA 4EEUA 5TBMA 3NOUC 3HJKA 1T1CA 4L9GA 2YKHA 5J3WA 2V0WA 4GS9A 4HI4A 4HIAA 5J7EA 1Y28A 1S67L 2Z6CA 1LSXA 1LSVA 3BY8A 3C8CA 3P7NA 1T1AA 5DJUA 3VOLA 1N9NA 1MZUA 2PD8A 3NOPC 4XT2A 5I5LA 1V9YA 3K3CA 1VB6A 3BWLA 1G28A 4LPZA 4R38A 4GHIA 4EW7A 4NXBA 4EQ1A 5AVFA 2CMNA 1S4SA 3E4OA 2QKPA 3ZQ5A 1XJ3A 4EERA 5HWWA 4WF0A 1OJGA 1UWPX 2D01A 4KQDA 5HDSA 3E4QA 3F1PB 4EESA 3FG8A 4HH2A 1LL8A 4EETB 4KUOA 2W0NA 4RQ9A 1S4RA 2L1MA 2L0WA 4I39A 5TBMB 5J4EA 3SW1A 5HDDA 3HJIA 3H7WA 4WL9A 2Z6DA 1XFQA 4E04A 4GS9B 4EEPA 3OLOA 2D02A 3D72A 5HWVA 4R70A 3LYXA 4BBVA 2QJ7A 2VV8A 1LSWA 4K08A 4HJ3A 5DKKA 3GDIA 2OOLA 4XT2B 1N9OA 1OT6A 2KDKA 5F69A 4EXOA 4L9EA 1T1BA 4KUKA 2VEAA 2ZOHA 4GHIB 3LIAA 2JN7A 1KOUA 2J80A 4MN5A 5G4ZA 4R6LA 4NXEA 3CWFA 4LRZE 4F3LA 1GSWA 2QHKA 4I3IA 4BBUA 3H9WA 4I38A 1GSXA 3LIEA 4HQAA 3F1NA 2ZBBA 3C2WA 2VLGA 4H6JA 4HP9A 3UMEA 1JNUA 2L4RA 2PR5A 3LIDA 4JGRA 4YWZA 3T50A 3H7WB 4HH3A 1UWNX 3A0RA 2WKQA 1XJ6A 4JGQA 2B02A 4NXGA 1BYWA 2V9AA 3VE4A 1OT9A 5IS1A 1D06A 4R3AA 4MN6A 3G6OA 5F5YA 3NJAA 3LI9A 5A8BA 1F98A 2PYRA 2VV6A 2I9VA 5G4YA 3GECA 3PYPA 4GW9A 3B33A 3BY9A 2QJ5A 1S66L 3MXQA 2PR6A 5F68A 4WLAA 5HWTA 2YKFA 5EFWA 1OTBA 2H28A 1UGUA 2R78A 1GSVA 4WUJA 3KX0X 3A0SA 2V0UA 2M1CA 5IU1A 4F3LB 5KIZA 4HJ6A 3EWKA 1OTAA 3MQQA 3LICA 4HNBA 5HDCA 2PHYA 3F1NB 4PKYG 3LI8A 2PD7A 2ZOIA 4H6JB 2PDRA 1P0ZA 2A24A 3VE3A 3UB6A 1T19A 2HV1A 3UMDA 4BBTA 4LLOB 2WKRA 2OWHA 4JGOA 3EEHA 2QWSA 3F1OA 4I3AA 1DP6A 5DJTA 2EA9A 3CAXA 3IBRA 1S1YA 3MFXA 2WKPA 3MR0A 1N9LA 1D7EA 2INWA 1XJ4A 3NHQA 4GCZA 3LIBA 4NXFA 3MJQA 3A0VA 1V9ZA 3H82A 1OJ5A 1XFNA 2OWJA 1OTDA 4WN5A 4I5SA 4PKYA 1TS7A 3CLOA 4DJ2A 3IS2A 1WA9A 3ICYA
chains in the Genus database with same CATH superfamily
4KZ7A 2VJWA 1YAXA 2BTFP 1FOFA 4L9FA 1GCEA 3IF6A 2K31A 4GD8A 3T1QB 2EX9A 4ZJ1A 1XGIA 3HLBA 3T4LA 1LT0A 1K57A 2A24B 4OQ0A 1DP9A 3E4PA 1K4EA 1RCJA 2ZM8A 5CGXA 3QNCA 2J7VA 1RP5A 1BLCA 3UNWA 5CGSA 5EUAA 5HL1A 4DJ3A 3B42A 3NOTC 1Q2PA 4JXWA 2ZQ9A 3IHAA 3ZGAB 4KENB 1HD8A 3FC7A 5HD5A 1VEUB 4ZJ2A 2JKGA 4GB7A 3NDEA 3ZYTA 3IHBA 2J9PA 2Z2LB 1MKIA 2PYPA 1FR6A 1XX2A 2W3GA 1F9IA 1XJ2A 2XRNA 4JBFA 5JYOA 4O8GA 5FI6A 3IS2B 4E6WA 1GHIA 3FPWA 3TJZC 2J3TC 3N8RA 3D3OA 4HJ4A 3LY3A 4LRXC 4JXGA 3WS2A 2OAQ1 4B9OA 1QMEA 5FQ9A 5TBMA 4DE1A 3NOUC 4OH0A 2G7UA 2VGKA 5J3WA 3KSIA 4LGWA 3T4JA 5FL3A 4UA6A 1K55C 1E3UD 4UA7A 5L2FA 3EEAA 3HUNA 1S67L 4BJPA 4PMAA 2HJEA 1T1AA 3IX4A 4FCFA 2JKRI 3VOLA 2DRWA 1N9NA 4GDBA 1S6RA 2PD8A 3BFCA 3HLWA 4XT2A 4L0LA 2Y2PA 5I5LA 3ZNYA 2ACGA 4CLCD 3S7QA 3RFBA 3KSGA 1H8ZA 4LPZA 4GHIA 4EQ1A 4PHTA 1TVFA 4S2PA 3LFVA 5MC7A 1K55A 3HREA 4G3VA 1S4SA 1IOUA 4MEZA 1CI8A 4Q0IA 3PBOA 1VHMA 5HPFA 1A0KA 2QKPA 3ZQ5A 4QPRA 4RA7A 4EERA 3LEZA 4JKTA 3OCNA 1K56D 4FUWA 2Y79A 1FSWA 1G5UA 3G35A 3UDFA 5G18A 3PBSA 1ZTUA 2WAEA 3A3FA 5EVIC 1YPRA 3G4PA 1PNEA 2Y4AA 3ZG7B 4UEYA 1CQAA 2XEPA 1BZAA 2XFSA 2OLUA 2V2FF 5HDDA 1VQQA 2IWCA 2Z6DA 4E04A 4MMNA 3RJUA 5TR7A 3OLOA 3MKEA 3OPPA 2QZ6A 3QP5A 4S2KA 2XDMA 3D72A 4EBPA 4MLLA 1L0EA 1QMFA 4OOLA 3UB5P 1GA0A 2M7VA 5HWVA 4OP8A 2Y2NA 3LYXA 3A3IA 4BBVA 2QJ7A 2XH9A 3C7VA 3HUMA 2V8CA 4GNUA 1CJFA 2ZQ8A 3G31A 2B5RA 5DKKA 3BEBA 3L9KA 2ZC6B 4E3IA 2XA7S 1KGFA 3E98A 3ZG5A 1HTZA 2GZAA 4KUKA 3SOIA 3DTMA 1BTLA 3T4TA 1L0FA 1LLBA 4O01A 4EV4A 3MZFA 4WMCD 3MZEA 3O87A 3TG9A 4F3LA 1GSWA 3W8KA 1CEGA 4C6YA 4BL3A 2Y2IA 2VGLS 2O9BA 3G30A 4MN7A 1GSXA 3IT9A 3F1NA 3C2WA 5E43A 3T1SA 1L3LA 2EX6A 3QP1A 4HP9A 1MXOA 2W3FA 4Y7PA 3MF0A 2L4RA 2XD5A 4ZTKA 5HL6A 3SS4A 5GHYA 5GLBA 5E2HA 5CTMA 2KLIA 1FR1A 3BM6A 3H7WB 4HH3A 5F1FA 4ME4A 1TEMA 4PM5A 3JPUA 4EBNA 2ZC7A 2JKTI 3ITAA 3OBFA 3G2ZA 5EM1A 1BYWA 1JTDA 2V9AA 1KGGA 2JKRM 4R3AA 5FDSA 3P09A 2ZMAA 4Q0JA 1F98A 3HLEA 3N8LA 2VV6A 1TF1A 3V3SA 2Y2JA 3UY6A 5F68A 4Y17A 5HWTA 3S22A 1UGUA 1KE4A 5HAQA 1GA9A 5IU1A 3EQUA 3MQQA 3DAVA 3SZTA 4H6JB 2PDRA 1W79A 2A24A 3S7PA 3MQ0A 1AXBA 2EXAA 5DF9A 3DW0A 3MXSA 3V3RA 2WKRA 3UPOA 2WZZA 2OWHA 4C3QA 3WRZA 1PI5A 4N9LA 4I3AA 1BUEA 4O7DA 2EA9A 3IBRA 3MFXA 4Y2FA 1LHYA 2WKPA 5GHZA 4PM6A 1VEUA 2J3WA 3OCLA 4Y0OA 3LIBA 3MJQA 3A0VA 1V9ZA 1N4OA 2JC7A 3KYZA 1W7FA 4Y3IA 5TFQA 3M6BA 3VOYA 1OJ5A 4JXSA 4Z1WA 3IWOA 1ONHA 3CI6A 2E8JA 5EV0A 2DMWA 2HDSA 2WADA 4I5SA 4MBKA 4B4XA 3C38A 3IS2A 5DTKA 4KZAA 3LY4A 4BQMA 1KGEA 3OZHA 2ZLYA 4OOYA 2NUTC 2M7UA 4NK3A 4Q0HA 2VV7A 2XGNA 3FKWA 4EUVA 2W1RA 4ETXA 1TD5A 3KSHA 2ZJ9A 3W4PA 1KVMA 4WYYA 1NZOA 2P7JA 4KZ6A 3DTEA 3PBQA 3EQVA 3T4QA 1MKMA 4LENA 1JTGA 4KG6A 3ZDJA 3LUQA 1OTIA 1IYQA 2KX6A 2V1AA 3TRCA 1K4FA 2ZQ7A 1FILA 1MY8A 2JKTM 1TS6A 1H8YA 1OTEA 3OOVA 3UE6A 2P74A 3UE1A 5GLCA 3CG5A 1FCNA 1NYMA 2GNXA 4MBFA 3S7OA 4NKPA 3LR4A 3VSKA 2BASA 3PBNA 5F6AA 2GJ3A 2W1TB 1MBLA 3WRTA 2W3EA 4D2OA 5HW3A 3T1RA 4LCMA 3Q7VB 4IVIA 1TS8A 4M4XA 3IH9A 1T18A 1L0DA 1KDWA 4N1HA 4HOIA 1DP8A 4BD1A 1PZPA 3QP2A 3VP1A 1SKOB 4PAUA 4EU0A 4ZRRA 4HY8A 3C5AA 3QHYA 4PM7A 4OQIA 3S7NA 3GVBA 1WYCA 3LEQA 2HDRA 3JVUA 4L9GA 2HP5A 5HAIA 4CLCE 2B18A 2O9AA 1IFQA 4HI4A 1O7EA 1LSXA 3BY8A 3P7NA 2DCFA 1ZC2A 5I94A 2IWDA 2QMIA 3IXHA 2EWWA 1U60A 3WWXA 3NOPC 4P85A 4ESPA 2WKEA 3BWLA 4IEDA 4R38A 4EW7A 2Q9NA 4JF4A 3SS5A 4E3LA 3BQ8A 1YM1A 2WAFA 2O0YA 1ZHHB 1YSQA 3Q81A 5FI2A 5EOOA 5HWWA 2J9OA 3CUEC 4WF0A 4KZ5A 1LL5A 3LR3A 3F1PB 3VSLA 2A49A 5A93A 4E3JA 4EESA 4PM8A 2VKSA 1NXYA 5CEDA 4KUOA 4KZ9A 1DJBA 3NBLA 4RQ9A 2L1MA 3O86A 2L0WA 4I39A 1JVJA 1YLTA 3TSGA 4CLCC 5J4EA 2FZ0A 1G6AA 3HLDA 1O07A 3H7WA 4WL9A 1DJCA 1I5QA 1XFQA 2Y55A 3P98A 5FDHA 1E3UA 3L7HA 2HPBA 1ESUA 3KO6A 3M6HA 2ZL1A 1H3QA 1ACFA 3N7WA 4S2JA 2VV8A 4LV1A 2HGVA 1LSWA 2ZC4B 4JF5A 4CPKA 2O99A 2HZ5A 3R7WA 2UWXA 2QYBA 2OOLA 3IX8A 2C6WB 1N9OA 2KDKA 4YINA 3V50A 4H8RA 3PTEA 2H0TA 3BLMA 2OV5A 4IBRA 1GHPA 2ZOHA 3BECA 2JN7A 1KOUA 3IF5A 2J80A 3EGDC 4S2IA 3PBTA 4MN5A 5G4ZA 4R1GA 3GR2A 4IUHA 3QP6A 2RL3A 3OPLA 4S2NC 1BLSA 4OP5A 3H9WA 2HF6A 2ZBBA 2VLGA 4H6JA 4ZAMA 4U0XA 3UMEA 2PAVP 5EVEA 4S2LA 4R4RA 2XQZA 1YT4A 2PR5A 3LIDA 4OLGA 2H10A 3FZCA 2JCHA 2WKQA 1XJ6A 5BOHA 4OPQA 2K2NA 4JGQA 2R9WA 4S2NA 4E3MA 2DNSA 1SZVA 4JLFA 5IT5A 3K2NA 3QP4A 1YLPA 3PXPA 3NJAA 5A8BA 3BRMA 4E3NA 2PYRA 3B47A 1JWPA 4IUKA 3U4LP 3B33A 3BY9A 2Y2QA 3MXQA 1PZOA 2YKFA 1OTBA 2H28A 1STZA 3GSGA 4JF6A 3G2YA 2M1CA 1FSYA 3EWKA 2WUQA 2XR0A 3NI9A 4U0TA 3LICA 1ONGA 1SHVA 5EE8A 1P0ZA 5EVIA 1T19A 1NJ4A 3SH8A 2HV1A 3UN7A 3UMDA 3IXDA 4LLOB 1NRJA 3LR0A 4II7A 4P6BA 4JGOA 2AVXA 2QWSA 3MS6A 1W8YA 2ZM0A 1WE4A 2EFUA 3B3XA 3DWZA 2Y59A 2Q0OA 5DJTA 3UDIA 4DE3A 1S0WA 3CAXA 2Q9MA 2ZQCA 3AGDA 4D60A 2BG1A 1D7EA 2G2UA 1XJ4A 4GCZA 4GDNA 4XUXA 4NXFA 3HL9A 3MBZA 4IVKA 1XKZA 3T4OA 2W1TA 4DDYA 2PBDP 5L09A 3NULA 2OWJA 4Q8IA 3BFGA 4DF6A 3CJMA 1MC0A 4OPZA 3GV9A 3Q7VA 4PKYA 5DTTA 3CLOA 1E25A 4UQIM 2W3DA 3O3VA 3FWLA 4FOFA 4RYEA 2X02A 4KZ8A 4OONA 4KG2A 3UPNA 3I7JA 5KSHA 3UDXA 1SKOA 4KQOA 4UAAA 5AVEA 3BW6A 5F1GA 4QY5A 3A3DA 5E2GA 1J9MA 3NECA 4A5RA 4HHDA 4OVDA 2IWBA 5AQAA 3E0YA 4ID4A 3ZVTA 1P97A 4CLCB 1G6OA 4C75A 1PI4A 1S1ZA 3F1OB 1CF0A 2LB9A 4I3JA 4JGPA 3IWQA 1NY0A 3V67A 2JKFA 3GQZA 3AGEA 4LCLA 4QU3A 3UB8A 1M6KA 2Z2MB 1MPLA 5HD3A 5HFOA 4QJGA 1NWZA 2W3HA 1J3WA 5CEBA 5HAPA 3ULFA 4NG2A 3H82B 1NZUA 2Y8HA 5HSQA 1X0OA 3PHYA 4DRTA 1CEFA 4HP4A 2CC1A 3AGFA 3BYDA 4DE2A 1K38A 4Y0UA 4GN2A 3C7UA 2E8IA 3UB9A 2OLVA 2XK1A 2W27A 1BSGA 3MQOA 3N4IA 2VZWA 4MBHA 3JVVA 2I72A 4ZBEA 1EW0A 1BT5A 2K7SA 3F1PA 2VX8A 2JHEA 2PU2A 1SDNA 2B95A 5CHMA 3VOZA 2HDQA 2JBFA 3A3JA 3MKFA 5FA7A 1OPXA 5AQBA 3HCYA 1T1CA 2YKHA 4WM9A 1CK3A 2V0WA 3UE0A 4QB8A 3O5YA 4P0MA 4KZBA 4DN0A 5J7EA 3MZDA 1Y28A 2Y2LA 1YSPA 3VP2A 2Z6CA 5J8XA 2HDUA 3C8CA 5E2EA 1K25A 4G3WA 1DJAA 4OPYA 4DDSA 1MZUA 2ZMVA 1Y54A 3UO9A 2RCXA 5M19A 1DY6A 3OC2A 3TOIA 2X71A 2FFFB 3HBRA 2XROA 5M18A 1W8QA 3DTKA 4GOGA 3PBRA 1K6SA 2ZM2A 4NXBA 5AVFA 2CMNA 3E4OA 4WZ5C 3GTCA 1XXMA 4ZDXA 1Q2QA 3ZNTA 5EVLA 4KZ3A 1KDSA 2JE5A 2P9VB 1C3BA 2D01A 4JXVA 5HDSA 3E4QA 4IJGA 3BFDA 3NC8A 4HH2A 4EETB 3CPTB 2P04A 4IBXA 5LBRA 5AQ9A 3SW1A 2ZC5B 4OQGA 3HJIA 4WZ5A 3ZHHA 5D3OA 2WGWB 4GS9B 4RX2A 2HJ9C 4YOFA 3TE8A 4EBLA 1TDGA 3P01A 4U3TA 3Q07A 3VFFA 2EXBA 2FH5A 3HLFA 3N8SA 1LI0A 2H0YA 4B93A 2ZC3B 1PWCA 2XA7M 4UA9A 1OT6A 4ARZB 5F69A 1MWUA 5K5BA 4EXOA 3W4OA 4L9EA 2Y2HA 4NEED 3LIAA 3C4PA 3W2ZA 1K0KA 3M2JA 4R4SA 4BMWA 5CXWA 5CERA 5FQIA 3EOIA 3CZDA 1XA1A 4NXEA 4R6LA 4M3KA 2QHKA 4WELA 3VMAA 5CECA 2VGLM 4I3IA 5F82A 4BBUA 4R3BA 5GLDA 3IF6C 3ZVWA 3OPHA 3LIEA 1NLYA 4HQAA 3IXGA 4GZBA 1K57C 1RGZA 5FASA 5DF7A 1JNUA 4FD8A 4ZJ3A 4EWFA 3M2KA 4JGRA 4YWZA 4E3KA 4UQIS 1N9BA 1HLUP 3MSHA 1EWZA 1YQSA 3ZFZA 2B02A 1BULA 3HVFA 2PT7A 1TDLA 4F94A 1JWZA 4NXGA 4DE0A 4RVAA 4X69A 3SS3A 5IS1A 4X1MA 5L8MA 1D06A 1YKDA 2LB5A 4WZ4A 1PYYA 2J8YA 4IHQA 2A2LA 3LI9A 4PM9A 1FCMA 3NY4A 1P9WA 3C4OA 1XP4A 3PR6A 5FAOA 2Y2KA 1W63M 3T1XA 4R3JA 2PR6A 1D1JA 4WLAA 5EFWA 1YMSA 1K6RA 3LCEA 2R78A 3KX0X 3A0SA 2V0UA 3MFDA 5KIZA 4HJ6A 3CUEA 1OTAA 4X68A 3LI8A 2ZOIA 5AJGA 4CJNA 4FTXA 2ZQDA 3W4QA 4FH4A 1H0MA 2GDNA 3IX3A 3UPPA 4K0XA 4QY6A 5A92A 4X6TA 3U2AA 3EEHA 4CLCA 5FAQA 5KMWA 1ERQA 3F1OA 1EROA 5E2FA 1LI9A 1ERMA 4AFIA 4N9KA 2WGIA 3ISGA 4YFMA 1ES3A 1PW1A 3V5MA 4DXCA 4Z9QA 3MR0A 3CMZA 4P87A 5GHXA 1N9LA 1IKIA 1NYYA 2INWA 3TW8A 1K56A 1ES4A 5FSRA 4KQRA 1W5DA 5CHJA 1ZG4A 4FSFA 3KYEA 3FYZA 3H82A 2EWVA 5DVAA 4BENA 3BQAA 1XFNA 3LGOA 5CTNA 3VFHA 3LR5A 5L10A 4WN5A 5FQMA 4X56A 1TS7A 1PWGA 1Y4OA 1XPBA 3BLSA 1VM1A 2V1BA 4B88A 4X55A 1M40A 3PAGA 3UB7A 1H5XA 2G2WA 3ZG0A 1TS0A 2Y2OA 4OQHA 3RH8B 4P6ZM 2WGVA 4LV0A 5TJJA 2X01A 1VETB 1SKFA 4GD6A 1ODVA 1IELA 2FFYA 5M1AA 5DFYA 5HZHA 3NCKA 3ZG9B 4N92A 4QD4A 3A3EA 1L0GA 3VP0A 2J3TD 4WMCA 1IYOA 3VP4A 5FI7A 3ITBA 1I2WA 1SDEA 5C5KA 2EX2A 3R4KA 2PU4A 2V8FA 1L2SA 2P08A 5DKLA 1ES2A 3K3DA 4OLDA 5JYPA 2OAP1 3EGXC 1AWIA 3V39A 1KE3A 1BLHA 5DFXA 3MMHA 3WS5A 4GLQA 2OSUA 3RTYA 3LIFA 2MJ6A 4LRYC 5CHUA 3O88A 3HLCA 2WKHA 2P9VA 1YMXA 1I2SA 1KVLA 4K91A 3IF6B 1DRMA 2KOIA 4DMZA 2Y91A 5CRFA 2UV0E 4EEUA 3CPTA 3VP3A 4BWIA 3HJKA 3WS1A 5FEFA 1K54C 1HZOA 5FAPA 2WGWA 4RX3A 4GS9A 1ALQA 4XXRA 4OPRA 3CHWP 1LL9A 4HIAA 3FPVA 5DF8A 4WEJA 3DBAA 3Q82A 1LSVA 5U47A 3S4XA 5DJUA 4LV3A 5EVID 3MXRA 4E3OA 2HP9A 4EUZA 4X1LA 4CQHA 4ARZA 1ZKJA 1V9YA 2GX5A 1K54A 3KSFA 3K3CA 1VB6A 3DWKA 1ESIA 1G28A 3N6IA 1Z09A 5GLAA 3BJNA 4HEFA 4X53A 1PRQA 1IKGA 4HBTA 4K0WA 3E2KA 3D4FA 2ZL1B 4DKIA 1XJ3A 3FV7A 2WYXA 1OJGA 1UWPX 4BD0A 4KQDA 3GMWA 3R7WB 3FG8A 4MDZA 1LL8A 2ZQAA 2W0NA 1S4RA 4PPRA 5TBMB 4BLMA 4YNRA 4S2MA 3KYQA 4O0PA 1FIKA 4B4ZA 4EEPA 5L07A 2D02A 1E4DA 1JWVA 1EI5A 2R9XA 4DXBA 4Y0TA 3JYIA 3VV4A 4R70A 3G32A 4LV2A 3Q1FA 4Y15A 3C30A 4E6XA 3RXWA 4K08A 3T4KA 3GRJA 4HJ3A 4ETZA 3GDIA 2IA2A 2Y2MA 2ZD8A 4XT2B 5EPHA 5GL9A 3T12B 3IWIA 2O9CA 1T1BA 1CI9A 1ZG6A 1MWSA 2VEAA 5FQKA 5KSCA 1W63Q 1GHMA 4GHIB 5A90A 4N1XA 3WS0A 3WS4A 1FQGA 3UE3A 2WKIA 5KZHA 4KQQA 4UHUA 4OKPA 1G68A 3CWFA 3HLGA 4LRZE 4R23A 1FCOA 2C5WB 4I38A 5EOEA 5FEGA 5HX9A 2HP6A 5AQ7A 3SH7A 2A3UA 2NUPC 2ZMFA 2XFTA 3FKVA 4S2OA 4WBGA 3NDGA 2EFXA 1ES5A 3T50A 3RXXA 4MNRA 1PIOA 3HUOA 1UWNX 3A0RA 4MCWA 1YLZA 4KZ4A 5FATA 3LO7A 2XF3A 4NETA 1HVBA 4WEKA 3QNBA 5EECA 3QP8A 1Z6FA 1NLZA 2V20A 5EVIB 3VE4A 1OT9A 1P9RA 2H5SA 4P6ZS 3PAEA 1YLWA 5DTSA 4MN6A 4OOMA 5FQJA 3G6OA 5CX7A 5F5YA 3NIAA 5G4YA 2I9VA 3GECA 3PYPA 1MWTA 4GW9A 2WZXA 3DTIA 2QJ5A 1S66L 1WYBA 1IYPA 1GSVA 4WUJA 1NRFA 3IBJA 4F3LB 2Y2GA 2EX8A 2VA0A 1IEMA 5HARA 1YLYA 4LFUA 3S1YA 1SCWA 5EM0A 3D9YA 4HNBA 5HDCA 2PHYA 3F1NB 4PKYG 5IHVA 4FH2A 2PD7A 5A91A 4QHCA 5F83A 3VE3A 3UB6A 4Y13A 3T4SA 1F5MA 4BBTA 4QWOA 1MWRA 5CGWA 3BFFA 3ZG8B 5FQQA 1VETA 4G3KA 1IYSA 4Y5FA 1KE0A 3CITA 2VGJA 3IXBA 1YLJA 1DP6A 1XGJA 4XUZA 4X25A 2VK3A 2XSSA 1H8MA 4KG5A 5HPIA 1S1YA 1PW8A 1OMEA 3Q7ZA 3G34A 1PWDA 1RGYA 3E2LA 3ZCZA 3NHQA 4GKUA 2BLSA 2QPNA 3OPRA 2WK0A 4JPMA 4BL2A 3IH8A 3IQAA 2PRFA 3SH9A 1F2KA 4R0QA 3BFEA 2XD1A 2XLNA 1OTDA 4GJ4A 5TGFA 2PBYA 1XA7A 2V1ZA 4HBUA 4EQIA 1BLPA 1PFLA 4DJ2A 1WA9A 3ICYA 4HESA
chains in the Genus database with same CATH topology
2W3DA 2V1BA 4FOFA 2VJWA 1YAXA 2NUTC 2M7UA 3UB7A 4Q0HA 4L9FA 2VV7A 2K31A 5KSHA 4EUVA 4KQOA 1TS0A 5AVEA 2W1RA 3BW6A 4ETXA 3T4LA 1LT0A 2A24B 1TD5A 1DP9A 3RH8B 3KSHA 3E4PA 4P6ZM 4HHDA 3E0YA 5TJJA 2P7JA 1P97A 4CLCB 1G6OA 3PBQA 1ODVA 3EQVA 3T4QA 4DJ3A 1S1ZA 1MKMA 3F1OB 3B42A 3NOTC 3LUQA 2LB9A 4I3JA 5DFYA 5HZHA 4JGPA 1OTIA 3V67A 2J3TD 2KX6A 2V1AA 3TRCA 5C5KA 3FC7A 3R4KA 2JKTM 1TS6A 5HD5A 3UB8A 2P08A 5DKLA 1OTEA 3OOVA 3K3DA 3UE6A 5HD3A 3ZYTA 1NWZA 2OAP1 2GNXA 2W3HA 3EGXC 3S7OA 3ULFA 4NKPA 3H82B 2PYPA 3LR4A 2Y8HA 3MMHA 5DFXA 4GLQA 5HSQA 1X0OA 3RTYA 2BASA 3PBNA 3PHYA 5F6AA 2GJ3A 2W1TB 2W3GA 1F9IA 3LIFA 2W3EA 1XJ2A 2MJ6A 2XRNA 4HP4A 4LRYC 1TS8A 4M4XA 4O8GA 3IS2B 3UB9A 1T18A 2W27A 3MQOA 2VZWA 3FPWA 3TJZC 3JVVA 4HOIA 2J3TC 1DP8A 1EW0A 1DRMA 3D3OA 2K7SA 4PAUA 3F1PA 4EU0A 2VX8A 4HJ4A 4ZRRA 2JHEA 4LRXC 4HY8A 2KOIA 4DMZA 2OAQ1 4B9OA 4EEUA 5TBMA 3NOUC 4BWIA 3HJKA 1OPXA 3S7NA 2G7UA 3HCYA 1T1CA 3JVUA 4L9GA 2YKHA 5J3WA 3KSIA 2V0WA 3O5YA 4CLCE 4GS9A 2B18A 3T4JA 2O9AA 5FL3A 1IFQA 4HI4A 4DN0A 4HIAA 3EEAA 3FPVA 5J7EA 4WEJA 1Y28A 1S67L 4BJPA 1YSPA 2Z6CA 3DBAA 1LSXA 1LSVA 3BY8A 3C8CA 3P7NA 2HJEA 1T1AA 5DJUA 2JKRI 4G3WA 3VOLA 1N9NA 1MZUA 2PD8A 2EWWA 2ZMVA 4CQHA 3NOPC 4XT2A 3OC2A 4L0LA 4ARZA 5I5LA 4CLCD 3S7QA 2GX5A 1V9YA 3KSFA 3K3CA 3RFBA 1VB6A 3KSGA 3BWLA 2XROA 1G28A 4LPZA 4R38A 4GHIA 4EW7A 3PBRA 4NXBA 4EQ1A 5AVFA 3BJNA 4PHTA 3LFVA 5MC7A 2CMNA 3BQ8A 4G3VA 1S4SA 3E4OA 1IOUA 2O0YA 1ZHHB 4Q0IA 3PBOA 1YSQA 1VHMA 5HPFA 2QKPA 3ZQ5A 4QPRA 1XJ3A 4EERA 5HWWA 3OCNA 3CUEC 4WF0A 1OJGA 1UWPX 2Y79A 2D01A 4KQDA 5HDSA 3E4QA 3R7WB 3PBSA 1ZTUA 4IJGA 3LR3A 3F1PB 4EESA 3FG8A 4MDZA 2VKSA 4HH2A 1LL8A 4UEYA 4EETB 4KUOA 2W0NA 4RQ9A 1S4RA 2P04A 2L1MA 2L0WA 4I39A 5TBMB 5LBRA 5J4EA 4CLCC 2FZ0A 4YNRA 3SW1A 5HDDA 3HJIA 3H7WA 3KYQA 4WL9A 2Z6DA 1XFQA 4O0PA 4E04A 4MMNA 4GS9B 4EEPA 3OLOA 2HJ9C 2D02A 4YOFA 3TE8A 3D72A 4OOLA 3P01A 3KO6A 2M7VA 5HWVA 3VV4A 4R70A 3LYXA 1H3QA 4BBVA 2QJ7A 2FH5A 2VV8A 3C30A 2HGVA 1LSWA 4K08A 2O99A 3T4KA 4HJ3A 5DKKA 3R7WA 4ETZA 4B93A 3GDIA 2XA7M 2IA2A 2QYBA 2OOLA 2XA7S 4XT2B 1N9OA 1OT6A 4ARZB 3E98A 2KDKA 5F69A 5K5BA 4EXOA 2O9CA 4L9EA 1T1BA 2GZAA 4KUKA 2VEAA 4NEED 1W63Q 3T4TA 2ZOHA 4GHIB 3LIAA 2JN7A 3W2ZA 1KOUA 2J80A 4O01A 3UE3A 4BMWA 3EGDC 3EOIA 3PBTA 4MN5A 5G4ZA 4R6LA 4NXEA 3CWFA 4LRZE 4F3LA 1GSWA 2QHKA 4WELA 4IUHA 2VGLM 4I3IA 4BBUA 2VGLS 2O9BA 3H9WA 4I38A 4MN7A 2HF6A 1GSXA 3LIEA 1NLYA 4HQAA 3F1NA 2ZBBA 3C2WA 2VLGA 4H6JA 4HP9A 3UMEA 2NUPC 2W3FA 2ZMFA 3MF0A 1JNUA 2L4RA 2PR5A 3LIDA 5HL6A 4JGRA 4YWZA 3T50A 2KLIA 3H7WB 4HH3A 4UQIS 1UWNX 3A0RA 2WKQA 1XJ6A 4MCWA 4ME4A 2K2NA 4JGQA 4WEKA 2B02A 2PT7A 1NLZA 2JKTI 3OBFA 4NXGA 1BYWA 2V9AA 5IT5A 3K2NA 3VE4A 1OT9A 2JKRM 5IS1A 5L8MA 1P9RA 1D06A 1YKDA 3PXPA 4P6ZS 4R3AA 2LB5A 4MN6A 4OOMA 4IHQA 2A2LA 3G6OA 5CX7A 3NJAA 5F5YA 3LI9A 4Q0JA 5A8BA 1P9WA 1F98A 2PYRA 2VV6A 2I9VA 1TF1A 3B47A 5G4YA 3GECA 3PYPA 4IUKA 3PR6A 4GW9A 1W63M 3B33A 3BY9A 2QJ5A 1S66L 3MXQA 2PR6A 5F68A 4WLAA 5HWTA 2YKFA 5EFWA 1OTBA 2H28A 1UGUA 2R78A 1GSVA 1STZA 3KX0X 4WUJA 3A0SA 2V0UA 2M1CA 5IU1A 3IBJA 4F3LB 5KIZA 3EQUA 4HJ6A 3EWKA 2VA0A 3CUEA 1OTAA 3MQQA 3LICA 4HNBA 5HDCA 2PHYA 3F1NB 4PKYG 3LI8A 2PD7A 2ZOIA 4H6JB 5AJGA 2PDRA 1P0ZA 2A24A 3S7PA 3VE3A 3UB6A 1T19A 3T4SA 3MQ0A 1F5MA 2HV1A 3UMDA 4BBTA 4LLOB 1NRJA 3LR0A 5DF9A 4II7A 2WKRA 2OWHA 4JGOA 4G3KA 3U2AA 3EEHA 4CLCA 4Y5FA 2QWSA 3CITA 3F1OA 4I3AA 1DP6A 4AFIA 5DJTA 2EA9A 2XSSA 3CAXA 1H8MA 3IBRA 5HPIA 1S1YA 3MFXA 4Y2FA 2WKPA 3MR0A 1N9LA 1D7EA 2J3WA 2INWA 3OCLA 1XJ4A 3NHQA 3TW8A 4GCZA 3LIBA 4NXFA 3MJQA 3A0VA 1V9ZA 4FSFA 3H82A 2EWVA 3KYZA 4Y3IA 3BQAA 1OJ5A 1XFNA 3T4OA 2W1TA 4Z1WA 2OWJA 3CI6A 3LR5A 1OTDA 4GJ4A 1MC0A 2DMWA 4WN5A 4I5SA 4PKYA 1TS7A 3CLOA 4DJ2A 3C38A 3IS2A 1WA9A 3ICYA 4UQIM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V1B A;  3UB7 A;  4L9F A;  2VV7 A;  1TS0 A;  5AVE A;  1LT0 A;  2A24 B;  1DP9 A;  3RH8 B;  3E4P A;  4HHD A;  2P7J A;  1P97 A;  1ODV A;  4DJ3 A;  1S1Z A;  3F1O B;  3NOT C;  3LUQ A;  4I3J A;  5HZH A;  4JGP A;  1OTI A;  2KX6 A;  2V1A A;  3FC7 A;  5HD5 A;  1TS6 A;  3UB8 A;  5DKL A;  1OTE A;  3K3D A;  3UE6 A;  5HD3 A;  1NWZ A;  3ULF A;  3H82 B;  2PYP A;  5HSQ A;  1X0O A;  3RTY A;  2BAS A;  3PHY A;  5F6A A;  2GJ3 A;  1F9I A;  3LIF A;  1XJ2 A;  4HP4 A;  4LRY C;  1TS8 A;  4M4X A;  3IS2 B;  3UB9 A;  1T18 A;  2W27 A;  3MQO A;  4HOI A;  1DP8 A;  1EW0 A;  1DRM A;  2K7S A;  3F1P A;  4HJ4 A;  2JHE A;  4LRX C;  4HY8 A;  4B9O A;  4EEU A;  5TBM A;  3NOU C;  3HJK A;  1T1C A;  4L9G A;  2YKH A;  5J3W A;  2V0W A;  4GS9 A;  4HI4 A;  4HIA A;  5J7E A;  1Y28 A;  1S67 L;  2Z6C A;  1LSX A;  1LSV A;  3BY8 A;  3C8C A;  3P7N A;  1T1A A;  5DJU A;  3VOL A;  1N9N A;  1MZU A;  2PD8 A;  3NOP C;  4XT2 A;  5I5L A;  1V9Y A;  3K3C A;  1VB6 A;  3BWL A;  1G28 A;  4LPZ A;  4R38 A;  4GHI A;  4EW7 A;  4NXB A;  4EQ1 A;  5AVF A;  2CMN A;  1S4S A;  3E4O A;  2QKP A;  3ZQ5 A;  1XJ3 A;  4EER A;  5HWW A;  4WF0 A;  1OJG A;  1UWP X;  2D01 A;  4KQD A;  5HDS A;  3E4Q A;  3F1P B;  4EES A;  3FG8 A;  4HH2 A;  1LL8 A;  4EET B;  4KUO A;  2W0N A;  4RQ9 A;  1S4R A;  2L1M A;  2L0W A;  4I39 A;  5TBM B;  5J4E A;  3SW1 A;  5HDD A;  3HJI A;  3H7W A;  4WL9 A;  2Z6D A;  1XFQ A;  4E04 A;  4GS9 B;  4EEP A;  3OLO A;  2D02 A;  3D72 A;  5HWV A;  4R70 A;  3LYX A;  4BBV A;  2QJ7 A;  2VV8 A;  1LSW A;  4K08 A;  4HJ3 A;  5DKK A;  3GDI A;  2OOL A;  4XT2 B;  1N9O A;  1OT6 A;  2KDK A;  5F69 A;  4EXO A;  4L9E A;  1T1B A;  4KUK A;  2VEA A;  2ZOH A;  4GHI B;  3LIA A;  2JN7 A;  1KOU A;  2J80 A;  4MN5 A;  5G4Z A;  4R6L A;  4NXE A;  3CWF A;  4LRZ E;  4F3L A;  1GSW A;  2QHK A;  4I3I A;  4BBU A;  3H9W A;  4I38 A;  1GSX A;  3LIE A;  4HQA A;  3F1N A;  2ZBB A;  3C2W A;  2VLG A;  4H6J A;  4HP9 A;  3UME A;  1JNU A;  2L4R A;  2PR5 A;  3LID A;  4JGR A;  4YWZ A;  3T50 A;  3H7W B;  4HH3 A;  1UWN X;  3A0R A;  2WKQ A;  1XJ6 A;  4JGQ A;  2B02 A;  4NXG A;  1BYW A;  2V9A A;  3VE4 A;  1OT9 A;  5IS1 A;  1D06 A;  4R3A A;  4MN6 A;  3G6O A;  5F5Y A;  3NJA A;  3LI9 A;  5A8B A;  1F98 A;  2PYR A;  2VV6 A;  2I9V A;  5G4Y A;  3GEC A;  3PYP A;  4GW9 A;  3B33 A;  3BY9 A;  2QJ5 A;  1S66 L;  3MXQ A;  2PR6 A;  5F68 A;  4WLA A;  5HWT A;  2YKF A;  5EFW A;  1OTB A;  2H28 A;  1UGU A;  2R78 A;  1GSV A;  4WUJ A;  3KX0 X;  3A0S A;  2V0U A;  2M1C A;  5IU1 A;  4F3L B;  5KIZ A;  4HJ6 A;  3EWK A;  1OTA A;  3MQQ A;  3LIC A;  4HNB A;  5HDC A;  2PHY A;  3F1N B;  4PKY G;  3LI8 A;  2PD7 A;  2ZOI A;  4H6J B;  2PDR A;  1P0Z A;  2A24 A;  3VE3 A;  3UB6 A;  1T19 A;  2HV1 A;  3UMD A;  4BBT A;  4LLO B;  2WKR A;  2OWH A;  4JGO A;  3EEH A;  2QWS A;  3F1O A;  4I3A A;  1DP6 A;  5DJT A;  2EA9 A;  3CAX A;  3IBR A;  1S1Y A;  3MFX A;  2WKP A;  3MR0 A;  1N9L A;  1D7E A;  2INW A;  1XJ4 A;  3NHQ A;  4GCZ A;  3LIB A;  4NXF A;  3MJQ A;  3A0V A;  1V9Z A;  3H82 A;  1OJ5 A;  1XFN A;  2OWJ A;  1OTD A;  4WN5 A;  4I5S A;  4PKY A;  1TS7 A;  3CLO A;  4DJ2 A;  3IS2 A;  1WA9 A;  3ICY A; 
#chains in the Genus database with same CATH topology
 4KZ7 A;  2VJW A;  1YAX A;  2BTF P;  1FOF A;  4L9F A;  1GCE A;  3IF6 A;  2K31 A;  4GD8 A;  3T1Q B;  2EX9 A;  4ZJ1 A;  1XGI A;  3HLB A;  3T4L A;  1LT0 A;  1K57 A;  2A24 B;  4OQ0 A;  1DP9 A;  3E4P A;  1K4E A;  1RCJ A;  2ZM8 A;  5CGX A;  3QNC A;  2J7V A;  1RP5 A;  1BLC A;  3UNW A;  5CGS A;  5EUA A;  5HL1 A;  4DJ3 A;  3B42 A;  3NOT C;  1Q2P A;  4JXW A;  2ZQ9 A;  3IHA A;  3ZGA B;  4KEN B;  1HD8 A;  3FC7 A;  5HD5 A;  1VEU B;  4ZJ2 A;  2JKG A;  4GB7 A;  3NDE A;  3ZYT A;  3IHB A;  2J9P A;  2Z2L B;  1MKI A;  2PYP A;  1FR6 A;  1XX2 A;  2W3G A;  1F9I A;  1XJ2 A;  2XRN A;  4JBF A;  5JYO A;  4O8G A;  5FI6 A;  3IS2 B;  4E6W A;  1GHI A;  3FPW A;  3TJZ C;  2J3T C;  3N8R A;  3D3O A;  4HJ4 A;  3LY3 A;  4LRX C;  4JXG A;  3WS2 A;  2OAQ 1;  4B9O A;  1QME A;  5FQ9 A;  5TBM A;  4DE1 A;  3NOU C;  4OH0 A;  2G7U A;  2VGK A;  5J3W A;  3KSI A;  4LGW A;  3T4J A;  5FL3 A;  4UA6 A;  1K55 C;  1E3U D;  4UA7 A;  5L2F A;  3EEA A;  3HUN A;  1S67 L;  4BJP A;  4PMA A;  2HJE A;  1T1A A;  3IX4 A;  4FCF A;  2JKR I;  3VOL A;  2DRW A;  1N9N A;  4GDB A;  1S6R A;  2PD8 A;  3BFC A;  3HLW A;  4XT2 A;  4L0L A;  2Y2P A;  5I5L A;  3ZNY A;  2ACG A;  4CLC D;  3S7Q A;  3RFB A;  3KSG A;  1H8Z A;  4LPZ A;  4GHI A;  4EQ1 A;  4PHT A;  1TVF A;  4S2P A;  3LFV A;  5MC7 A;  1K55 A;  3HRE A;  4G3V A;  1S4S A;  1IOU A;  4MEZ A;  1CI8 A;  4Q0I A;  3PBO A;  1VHM A;  5HPF A;  1A0K A;  2QKP A;  3ZQ5 A;  4QPR A;  4RA7 A;  4EER A;  3LEZ A;  4JKT A;  3OCN A;  1K56 D;  4FUW A;  2Y79 A;  1FSW A;  1G5U A;  3G35 A;  3UDF A;  5G18 A;  3PBS A;  1ZTU A;  2WAE A;  3A3F A;  5EVI C;  1YPR A;  3G4P A;  1PNE A;  2Y4A A;  3ZG7 B;  4UEY A;  1CQA A;  2XEP A;  1BZA A;  2XFS A;  2OLU A;  2V2F F;  5HDD A;  1VQQ A;  2IWC A;  2Z6D A;  4E04 A;  4MMN A;  3RJU A;  5TR7 A;  3OLO A;  3MKE A;  3OPP A;  2QZ6 A;  3QP5 A;  4S2K A;  2XDM A;  3D72 A;  4EBP A;  4MLL A;  1L0E A;  1QMF A;  4OOL A;  3UB5 P;  1GA0 A;  2M7V A;  5HWV A;  4OP8 A;  2Y2N A;  3LYX A;  3A3I A;  4BBV A;  2QJ7 A;  2XH9 A;  3C7V A;  3HUM A;  2V8C A;  4GNU A;  1CJF A;  2ZQ8 A;  3G31 A;  2B5R A;  5DKK A;  3BEB A;  3L9K A;  2ZC6 B;  4E3I A;  2XA7 S;  1KGF A;  3E98 A;  3ZG5 A;  1HTZ A;  2GZA A;  4KUK A;  3SOI A;  3DTM A;  1BTL A;  3T4T A;  1L0F A;  1LLB A;  4O01 A;  4EV4 A;  3MZF A;  4WMC D;  3MZE A;  3O87 A;  3TG9 A;  4F3L A;  1GSW A;  3W8K A;  1CEG A;  4C6Y A;  4BL3 A;  2Y2I A;  2VGL S;  2O9B A;  3G30 A;  4MN7 A;  1GSX A;  3IT9 A;  3F1N A;  3C2W A;  5E43 A;  3T1S A;  1L3L A;  2EX6 A;  3QP1 A;  4HP9 A;  1MXO A;  2W3F A;  4Y7P A;  3MF0 A;  2L4R A;  2XD5 A;  4ZTK A;  5HL6 A;  3SS4 A;  5GHY A;  5GLB A;  5E2H A;  5CTM A;  2KLI A;  1FR1 A;  3BM6 A;  3H7W B;  4HH3 A;  5F1F A;  4ME4 A;  1TEM A;  4PM5 A;  3JPU A;  4EBN A;  2ZC7 A;  2JKT I;  3ITA A;  3OBF A;  3G2Z A;  5EM1 A;  1BYW A;  1JTD A;  2V9A A;  1KGG A;  2JKR M;  4R3A A;  5FDS A;  3P09 A;  2ZMA A;  4Q0J A;  1F98 A;  3HLE A;  3N8L A;  2VV6 A;  1TF1 A;  3V3S A;  2Y2J A;  3UY6 A;  5F68 A;  4Y17 A;  5HWT A;  3S22 A;  1UGU A;  1KE4 A;  5HAQ A;  1GA9 A;  5IU1 A;  3EQU A;  3MQQ A;  3DAV A;  3SZT A;  4H6J B;  2PDR A;  1W79 A;  2A24 A;  3S7P A;  3MQ0 A;  1AXB A;  2EXA A;  5DF9 A;  3DW0 A;  3MXS A;  3V3R A;  2WKR A;  3UPO A;  2WZZ A;  2OWH A;  4C3Q A;  3WRZ A;  1PI5 A;  4N9L A;  4I3A A;  1BUE A;  4O7D A;  2EA9 A;  3IBR A;  3MFX A;  4Y2F A;  1LHY A;  2WKP A;  5GHZ A;  4PM6 A;  1VEU A;  2J3W A;  3OCL A;  4Y0O A;  3LIB A;  3MJQ A;  3A0V A;  1V9Z A;  1N4O A;  2JC7 A;  3KYZ A;  1W7F A;  4Y3I A;  5TFQ A;  3M6B A;  3VOY A;  1OJ5 A;  4JXS A;  4Z1W A;  3IWO A;  1ONH A;  3CI6 A;  2E8J A;  5EV0 A;  2DMW A;  2HDS A;  2WAD A;  4I5S A;  4MBK A;  4B4X A;  3C38 A;  3IS2 A;  5DTK A;  4KZA A;  3LY4 A;  4BQM A;  1KGE A;  3OZH A;  2ZLY A;  4OOY A;  2NUT C;  2M7U A;  4NK3 A;  4Q0H A;  2VV7 A;  2XGN A;  3FKW A;  4EUV A;  2W1R A;  4ETX A;  1TD5 A;  3KSH A;  2ZJ9 A;  3W4P A;  1KVM A;  4WYY A;  1NZO A;  2P7J A;  4KZ6 A;  3DTE A;  3PBQ A;  3EQV A;  3T4Q A;  1MKM A;  4LEN A;  1JTG A;  4KG6 A;  3ZDJ A;  3LUQ A;  1OTI A;  1IYQ A;  2KX6 A;  2V1A A;  3TRC A;  1K4F A;  2ZQ7 A;  1FIL A;  1MY8 A;  2JKT M;  1TS6 A;  1H8Y A;  1OTE A;  3OOV A;  3UE6 A;  2P74 A;  3UE1 A;  5GLC A;  3CG5 A;  1FCN A;  1NYM A;  2GNX A;  4MBF A;  3S7O A;  4NKP A;  3LR4 A;  3VSK A;  2BAS A;  3PBN A;  5F6A A;  2GJ3 A;  2W1T B;  1MBL A;  3WRT A;  2W3E A;  4D2O A;  5HW3 A;  3T1R A;  4LCM A;  3Q7V B;  4IVI A;  1TS8 A;  4M4X A;  3IH9 A;  1T18 A;  1L0D A;  1KDW A;  4N1H A;  4HOI A;  1DP8 A;  4BD1 A;  1PZP A;  3QP2 A;  3VP1 A;  1SKO B;  4PAU A;  4EU0 A;  4ZRR A;  4HY8 A;  3C5A A;  3QHY A;  4PM7 A;  4OQI A;  3S7N A;  3GVB A;  1WYC A;  3LEQ A;  2HDR A;  3JVU A;  4L9G A;  2HP5 A;  5HAI A;  4CLC E;  2B18 A;  2O9A A;  1IFQ A;  4HI4 A;  1O7E A;  1LSX A;  3BY8 A;  3P7N A;  2DCF A;  1ZC2 A;  5I94 A;  2IWD A;  2QMI A;  3IXH A;  2EWW A;  1U60 A;  3WWX A;  3NOP C;  4P85 A;  4ESP A;  2WKE A;  3BWL A;  4IED A;  4R38 A;  4EW7 A;  2Q9N A;  4JF4 A;  3SS5 A;  4E3L A;  3BQ8 A;  1YM1 A;  2WAF A;  2O0Y A;  1ZHH B;  1YSQ A;  3Q81 A;  5FI2 A;  5EOO A;  5HWW A;  2J9O A;  3CUE C;  4WF0 A;  4KZ5 A;  1LL5 A;  3LR3 A;  3F1P B;  3VSL A;  2A49 A;  5A93 A;  4E3J A;  4EES A;  4PM8 A;  2VKS A;  1NXY A;  5CED A;  4KUO A;  4KZ9 A;  1DJB A;  3NBL A;  4RQ9 A;  2L1M A;  3O86 A;  2L0W A;  4I39 A;  1JVJ A;  1YLT A;  3TSG A;  4CLC C;  5J4E A;  2FZ0 A;  1G6A A;  3HLD A;  1O07 A;  3H7W A;  4WL9 A;  1DJC A;  1I5Q A;  1XFQ A;  2Y55 A;  3P98 A;  5FDH A;  1E3U A;  3L7H A;  2HPB A;  1ESU A;  3KO6 A;  3M6H A;  2ZL1 A;  1H3Q A;  1ACF A;  3N7W A;  4S2J A;  2VV8 A;  4LV1 A;  2HGV A;  1LSW A;  2ZC4 B;  4JF5 A;  4CPK A;  2O99 A;  2HZ5 A;  3R7W A;  2UWX A;  2QYB A;  2OOL A;  3IX8 A;  2C6W B;  1N9O A;  2KDK A;  4YIN A;  3V50 A;  4H8R A;  3PTE A;  2H0T A;  3BLM A;  2OV5 A;  4IBR A;  1GHP A;  2ZOH A;  3BEC A;  2JN7 A;  1KOU A;  3IF5 A;  2J80 A;  3EGD C;  4S2I A;  3PBT A;  4MN5 A;  5G4Z A;  4R1G A;  3GR2 A;  4IUH A;  3QP6 A;  2RL3 A;  3OPL A;  4S2N C;  1BLS A;  4OP5 A;  3H9W A;  2HF6 A;  2ZBB A;  2VLG A;  4H6J A;  4ZAM A;  4U0X A;  3UME A;  2PAV P;  5EVE A;  4S2L A;  4R4R A;  2XQZ A;  1YT4 A;  2PR5 A;  3LID A;  4OLG A;  2H10 A;  3FZC A;  2JCH A;  2WKQ A;  1XJ6 A;  5BOH A;  4OPQ A;  2K2N A;  4JGQ A;  2R9W A;  4S2N A;  4E3M A;  2DNS A;  1SZV A;  4JLF A;  5IT5 A;  3K2N A;  3QP4 A;  1YLP A;  3PXP A;  3NJA A;  5A8B A;  3BRM A;  4E3N A;  2PYR A;  3B47 A;  1JWP A;  4IUK A;  3U4L P;  3B33 A;  3BY9 A;  2Y2Q A;  3MXQ A;  1PZO A;  2YKF A;  1OTB A;  2H28 A;  1STZ A;  3GSG A;  4JF6 A;  3G2Y A;  2M1C A;  1FSY A;  3EWK A;  2WUQ A;  2XR0 A;  3NI9 A;  4U0T A;  3LIC A;  1ONG A;  1SHV A;  5EE8 A;  1P0Z A;  5EVI A;  1T19 A;  1NJ4 A;  3SH8 A;  2HV1 A;  3UN7 A;  3UMD A;  3IXD A;  4LLO B;  1NRJ A;  3LR0 A;  4II7 A;  4P6B A;  4JGO A;  2AVX A;  2QWS A;  3MS6 A;  1W8Y A;  2ZM0 A;  1WE4 A;  2EFU A;  3B3X A;  3DWZ A;  2Y59 A;  2Q0O A;  5DJT A;  3UDI A;  4DE3 A;  1S0W A;  3CAX A;  2Q9M A;  2ZQC A;  3AGD A;  4D60 A;  2BG1 A;  1D7E A;  2G2U A;  1XJ4 A;  4GCZ A;  4GDN A;  4XUX A;  4NXF A;  3HL9 A;  3MBZ A;  4IVK A;  1XKZ A;  3T4O A;  2W1T A;  4DDY A;  2PBD P;  5L09 A;  3NUL A;  2OWJ A;  4Q8I A;  3BFG A;  4DF6 A;  3CJM A;  1MC0 A;  4OPZ A;  3GV9 A;  3Q7V A;  4PKY A;  5DTT A;  3CLO A;  1E25 A;  4UQI M;  2W3D A;  3O3V A;  3FWL A;  4FOF A;  4RYE A;  2X02 A;  4KZ8 A;  4OON A;  4KG2 A;  3UPN A;  3I7J A;  5KSH A;  3UDX A;  1SKO A;  4KQO A;  4UAA A;  5AVE A;  3BW6 A;  5F1G A;  4QY5 A;  3A3D A;  5E2G A;  1J9M A;  3NEC A;  4A5R A;  4HHD A;  4OVD A;  2IWB A;  5AQA A;  3E0Y A;  4ID4 A;  3ZVT A;  1P97 A;  4CLC B;  1G6O A;  4C75 A;  1PI4 A;  1S1Z A;  3F1O B;  1CF0 A;  2LB9 A;  4I3J A;  4JGP A;  3IWQ A;  1NY0 A;  3V67 A;  2JKF A;  3GQZ A;  3AGE A;  4LCL A;  4QU3 A;  3UB8 A;  1M6K A;  2Z2M B;  1MPL A;  5HD3 A;  5HFO A;  4QJG A;  1NWZ A;  2W3H A;  1J3W A;  5CEB A;  5HAP A;  3ULF A;  4NG2 A;  3H82 B;  1NZU A;  2Y8H A;  5HSQ A;  1X0O A;  3PHY A;  4DRT A;  1CEF A;  4HP4 A;  2CC1 A;  3AGF A;  3BYD A;  4DE2 A;  1K38 A;  4Y0U A;  4GN2 A;  3C7U A;  2E8I A;  3UB9 A;  2OLV A;  2XK1 A;  2W27 A;  1BSG A;  3MQO A;  3N4I A;  2VZW A;  4MBH A;  3JVV A;  2I72 A;  4ZBE A;  1EW0 A;  1BT5 A;  2K7S A;  3F1P A;  2VX8 A;  2JHE A;  2PU2 A;  1SDN A;  2B95 A;  5CHM A;  3VOZ A;  2HDQ A;  2JBF A;  3A3J A;  3MKF A;  5FA7 A;  1OPX A;  5AQB A;  3HCY A;  1T1C A;  2YKH A;  4WM9 A;  1CK3 A;  2V0W A;  3UE0 A;  4QB8 A;  3O5Y A;  4P0M A;  4KZB A;  4DN0 A;  5J7E A;  3MZD A;  1Y28 A;  2Y2L A;  1YSP A;  3VP2 A;  2Z6C A;  5J8X A;  2HDU A;  3C8C A;  5E2E A;  1K25 A;  4G3W A;  1DJA A;  4OPY A;  4DDS A;  1MZU A;  2ZMV A;  1Y54 A;  3UO9 A;  2RCX A;  5M19 A;  1DY6 A;  3OC2 A;  3TOI A;  2X71 A;  2FFF B;  3HBR A;  2XRO A;  5M18 A;  1W8Q A;  3DTK A;  4GOG A;  3PBR A;  1K6S A;  2ZM2 A;  4NXB A;  5AVF A;  2CMN A;  3E4O A;  4WZ5 C;  3GTC A;  1XXM A;  4ZDX A;  1Q2Q A;  3ZNT A;  5EVL A;  4KZ3 A;  1KDS A;  2JE5 A;  2P9V B;  1C3B A;  2D01 A;  4JXV A;  5HDS A;  3E4Q A;  4IJG A;  3BFD A;  3NC8 A;  4HH2 A;  4EET B;  3CPT B;  2P04 A;  4IBX A;  5LBR A;  5AQ9 A;  3SW1 A;  2ZC5 B;  4OQG A;  3HJI A;  4WZ5 A;  3ZHH A;  5D3O A;  2WGW B;  4GS9 B;  4RX2 A;  2HJ9 C;  4YOF A;  3TE8 A;  4EBL A;  1TDG A;  3P01 A;  4U3T A;  3Q07 A;  3VFF A;  2EXB A;  2FH5 A;  3HLF A;  3N8S A;  1LI0 A;  2H0Y A;  4B93 A;  2ZC3 B;  1PWC A;  2XA7 M;  4UA9 A;  1OT6 A;  4ARZ B;  5F69 A;  1MWU A;  5K5B A;  4EXO A;  3W4O A;  4L9E A;  2Y2H A;  4NEE D;  3LIA A;  3C4P A;  3W2Z A;  1K0K A;  3M2J A;  4R4S A;  4BMW A;  5CXW A;  5CER A;  5FQI A;  3EOI A;  3CZD A;  1XA1 A;  4NXE A;  4R6L A;  4M3K A;  2QHK A;  4WEL A;  3VMA A;  5CEC A;  2VGL M;  4I3I A;  5F82 A;  4BBU A;  4R3B A;  5GLD A;  3IF6 C;  3ZVW A;  3OPH A;  3LIE A;  1NLY A;  4HQA A;  3IXG A;  4GZB A;  1K57 C;  1RGZ A;  5FAS A;  5DF7 A;  1JNU A;  4FD8 A;  4ZJ3 A;  4EWF A;  3M2K A;  4JGR A;  4YWZ A;  4E3K A;  4UQI S;  1N9B A;  1HLU P;  3MSH A;  1EWZ A;  1YQS A;  3ZFZ A;  2B02 A;  1BUL A;  3HVF A;  2PT7 A;  1TDL A;  4F94 A;  1JWZ A;  4NXG A;  4DE0 A;  4RVA A;  4X69 A;  3SS3 A;  5IS1 A;  4X1M A;  5L8M A;  1D06 A;  1YKD A;  2LB5 A;  4WZ4 A;  1PYY A;  2J8Y A;  4IHQ A;  2A2L A;  3LI9 A;  4PM9 A;  1FCM A;  3NY4 A;  1P9W A;  3C4O A;  1XP4 A;  3PR6 A;  5FAO A;  2Y2K A;  1W63 M;  3T1X A;  4R3J A;  2PR6 A;  1D1J A;  4WLA A;  5EFW A;  1YMS A;  1K6R A;  3LCE A;  2R78 A;  3KX0 X;  3A0S A;  2V0U A;  3MFD A;  5KIZ A;  4HJ6 A;  3CUE A;  1OTA A;  4X68 A;  3LI8 A;  2ZOI A;  5AJG A;  4CJN A;  4FTX A;  2ZQD A;  3W4Q A;  4FH4 A;  1H0M A;  2GDN A;  3IX3 A;  3UPP A;  4K0X A;  4QY6 A;  5A92 A;  4X6T A;  3U2A A;  3EEH A;  4CLC A;  5FAQ A;  5KMW A;  1ERQ A;  3F1O A;  1ERO A;  5E2F A;  1LI9 A;  1ERM A;  4AFI A;  4N9K A;  2WGI A;  3ISG A;  4YFM A;  1ES3 A;  1PW1 A;  3V5M A;  4DXC A;  4Z9Q A;  3MR0 A;  3CMZ A;  4P87 A;  5GHX A;  1N9L A;  1IKI A;  1NYY A;  2INW A;  3TW8 A;  1K56 A;  1ES4 A;  5FSR A;  4KQR A;  1W5D A;  5CHJ A;  1ZG4 A;  4FSF A;  3KYE A;  3FYZ A;  3H82 A;  2EWV A;  5DVA A;  4BEN A;  3BQA A;  1XFN A;  3LGO A;  5CTN A;  3VFH A;  3LR5 A;  5L10 A;  4WN5 A;  5FQM A;  4X56 A;  1TS7 A;  1PWG A;  1Y4O A;  1XPB A;  3BLS A;  1VM1 A;  2V1B A;  4B88 A;  4X55 A;  1M40 A;  3PAG A;  3UB7 A;  1H5X A;  2G2W A;  3ZG0 A;  1TS0 A;  2Y2O A;  4OQH A;  3RH8 B;  4P6Z M;  2WGV A;  4LV0 A;  5TJJ A;  2X01 A;  1VET B;  1SKF A;  4GD6 A;  1ODV A;  1IEL A;  2FFY A;  5M1A A;  5DFY A;  5HZH A;  3NCK A;  3ZG9 B;  4N92 A;  4QD4 A;  3A3E A;  1L0G A;  3VP0 A;  2J3T D;  4WMC A;  1IYO A;  3VP4 A;  5FI7 A;  3ITB A;  1I2W A;  1SDE A;  5C5K A;  2EX2 A;  3R4K A;  2PU4 A;  2V8F A;  1L2S A;  2P08 A;  5DKL A;  1ES2 A;  3K3D A;  4OLD A;  5JYP A;  2OAP 1;  3EGX C;  1AWI A;  3V39 A;  1KE3 A;  1BLH A;  5DFX A;  3MMH A;  3WS5 A;  4GLQ A;  2OSU A;  3RTY A;  3LIF A;  2MJ6 A;  4LRY C;  5CHU A;  3O88 A;  3HLC A;  2WKH A;  2P9V A;  1YMX A;  1I2S A;  1KVL A;  4K91 A;  3IF6 B;  1DRM A;  2KOI A;  4DMZ A;  2Y91 A;  5CRF A;  2UV0 E;  4EEU A;  3CPT A;  3VP3 A;  4BWI A;  3HJK A;  3WS1 A;  5FEF A;  1K54 C;  1HZO A;  5FAP A;  2WGW A;  4RX3 A;  4GS9 A;  1ALQ A;  4XXR A;  4OPR A;  3CHW P;  1LL9 A;  4HIA A;  3FPV A;  5DF8 A;  4WEJ A;  3DBA A;  3Q82 A;  1LSV A;  5U47 A;  3S4X A;  5DJU A;  4LV3 A;  5EVI D;  3MXR A;  4E3O A;  2HP9 A;  4EUZ A;  4X1L A;  4CQH A;  4ARZ A;  1ZKJ A;  1V9Y A;  2GX5 A;  1K54 A;  3KSF A;  3K3C A;  1VB6 A;  3DWK A;  1ESI A;  1G28 A;  3N6I A;  1Z09 A;  5GLA A;  3BJN A;  4HEF A;  4X53 A;  1PRQ A;  1IKG A;  4HBT A;  4K0W A;  3E2K A;  3D4F A;  2ZL1 B;  4DKI A;  1XJ3 A;  3FV7 A;  2WYX A;  1OJG A;  1UWP X;  4BD0 A;  4KQD A;  3GMW A;  3R7W B;  3FG8 A;  4MDZ A;  1LL8 A;  2ZQA A;  2W0N A;  1S4R A;  4PPR A;  5TBM B;  4BLM A;  4YNR A;  4S2M A;  3KYQ A;  4O0P A;  1FIK A;  4B4Z A;  4EEP A;  5L07 A;  2D02 A;  1E4D A;  1JWV A;  1EI5 A;  2R9X A;  4DXB A;  4Y0T A;  3JYI A;  3VV4 A;  4R70 A;  3G32 A;  4LV2 A;  3Q1F A;  4Y15 A;  3C30 A;  4E6X A;  3RXW A;  4K08 A;  3T4K A;  3GRJ A;  4HJ3 A;  4ETZ A;  3GDI A;  2IA2 A;  2Y2M A;  2ZD8 A;  4XT2 B;  5EPH A;  5GL9 A;  3T12 B;  3IWI A;  2O9C A;  1T1B A;  1CI9 A;  1ZG6 A;  1MWS A;  2VEA A;  5FQK A;  5KSC A;  1W63 Q;  1GHM A;  4GHI B;  5A90 A;  4N1X A;  3WS0 A;  3WS4 A;  1FQG A;  3UE3 A;  2WKI A;  5KZH A;  4KQQ A;  4UHU A;  4OKP A;  1G68 A;  3CWF A;  3HLG A;  4LRZ E;  4R23 A;  1FCO A;  2C5W B;  4I38 A;  5EOE A;  5FEG A;  5HX9 A;  2HP6 A;  5AQ7 A;  3SH7 A;  2A3U A;  2NUP C;  2ZMF A;  2XFT A;  3FKV A;  4S2O A;  4WBG A;  3NDG A;  2EFX A;  1ES5 A;  3T50 A;  3RXX A;  4MNR A;  1PIO A;  3HUO A;  1UWN X;  3A0R A;  4MCW A;  1YLZ A;  4KZ4 A;  5FAT A;  3LO7 A;  2XF3 A;  4NET A;  1HVB A;  4WEK A;  3QNB A;  5EEC A;  3QP8 A;  1Z6F A;  1NLZ A;  2V20 A;  5EVI B;  3VE4 A;  1OT9 A;  1P9R A;  2H5S A;  4P6Z S;  3PAE A;  1YLW A;  5DTS A;  4MN6 A;  4OOM A;  5FQJ A;  3G6O A;  5CX7 A;  5F5Y A;  3NIA A;  5G4Y A;  2I9V A;  3GEC A;  3PYP A;  1MWT A;  4GW9 A;  2WZX A;  3DTI A;  2QJ5 A;  1S66 L;  1WYB A;  1IYP A;  1GSV A;  4WUJ A;  1NRF A;  3IBJ A;  4F3L B;  2Y2G A;  2EX8 A;  2VA0 A;  1IEM A;  5HAR A;  1YLY A;  4LFU A;  3S1Y A;  1SCW A;  5EM0 A;  3D9Y A;  4HNB A;  5HDC A;  2PHY A;  3F1N B;  4PKY G;  5IHV A;  4FH2 A;  2PD7 A;  5A91 A;  4QHC A;  5F83 A;  3VE3 A;  3UB6 A;  4Y13 A;  3T4S A;  1F5M A;  4BBT A;  4QWO A;  1MWR A;  5CGW A;  3BFF A;  3ZG8 B;  5FQQ A;  1VET A;  4G3K A;  1IYS A;  4Y5F A;  1KE0 A;  3CIT A;  2VGJ A;  3IXB A;  1YLJ A;  1DP6 A;  1XGJ A;  4XUZ A;  4X25 A;  2VK3 A;  2XSS A;  1H8M A;  4KG5 A;  5HPI A;  1S1Y A;  1PW8 A;  1OME A;  3Q7Z A;  3G34 A;  1PWD A;  1RGY A;  3E2L A;  3ZCZ A;  3NHQ A;  4GKU A;  2BLS A;  2QPN A;  3OPR A;  2WK0 A;  4JPM A;  4BL2 A;  3IH8 A;  3IQA A;  2PRF A;  3SH9 A;  1F2K A;  4R0Q A;  3BFE A;  2XD1 A;  2XLN A;  1OTD A;  4GJ4 A;  5TGF A;  2PBY A;  1XA7 A;  2V1Z A;  4HBU A;  4EQI A;  1BLP A;  1PFL A;  4DJ2 A;  1WA9 A;  3ICY A;  4HES A; 
#chains in the Genus database with same CATH homology
 2W3D A;  2V1B A;  4FOF A;  2VJW A;  1YAX A;  2NUT C;  2M7U A;  3UB7 A;  4Q0H A;  4L9F A;  2VV7 A;  2K31 A;  5KSH A;  4EUV A;  4KQO A;  1TS0 A;  5AVE A;  2W1R A;  3BW6 A;  4ETX A;  3T4L A;  1LT0 A;  2A24 B;  1TD5 A;  1DP9 A;  3RH8 B;  3KSH A;  3E4P A;  4P6Z M;  4HHD A;  3E0Y A;  5TJJ A;  2P7J A;  1P97 A;  4CLC B;  1G6O A;  3PBQ A;  1ODV A;  3EQV A;  3T4Q A;  4DJ3 A;  1S1Z A;  1MKM A;  3F1O B;  3B42 A;  3NOT C;  3LUQ A;  2LB9 A;  4I3J A;  5DFY A;  5HZH A;  4JGP A;  1OTI A;  3V67 A;  2J3T D;  2KX6 A;  2V1A A;  3TRC A;  5C5K A;  3FC7 A;  3R4K A;  2JKT M;  1TS6 A;  5HD5 A;  3UB8 A;  2P08 A;  5DKL A;  1OTE A;  3OOV A;  3K3D A;  3UE6 A;  5HD3 A;  3ZYT A;  1NWZ A;  2OAP 1;  2GNX A;  2W3H A;  3EGX C;  3S7O A;  3ULF A;  4NKP A;  3H82 B;  2PYP A;  3LR4 A;  2Y8H A;  3MMH A;  5DFX A;  4GLQ A;  5HSQ A;  1X0O A;  3RTY A;  2BAS A;  3PBN A;  3PHY A;  5F6A A;  2GJ3 A;  2W1T B;  2W3G A;  1F9I A;  3LIF A;  2W3E A;  1XJ2 A;  2MJ6 A;  2XRN A;  4HP4 A;  4LRY C;  1TS8 A;  4M4X A;  4O8G A;  3IS2 B;  3UB9 A;  1T18 A;  2W27 A;  3MQO A;  2VZW A;  3FPW A;  3TJZ C;  3JVV A;  4HOI A;  2J3T C;  1DP8 A;  1EW0 A;  1DRM A;  3D3O A;  2K7S A;  4PAU A;  3F1P A;  4EU0 A;  2VX8 A;  4HJ4 A;  4ZRR A;  2JHE A;  4LRX C;  4HY8 A;  2KOI A;  4DMZ A;  2OAQ 1;  4B9O A;  4EEU A;  5TBM A;  3NOU C;  4BWI A;  3HJK A;  1OPX A;  3S7N A;  2G7U A;  3HCY A;  1T1C A;  3JVU A;  4L9G A;  2YKH A;  5J3W A;  3KSI A;  2V0W A;  3O5Y A;  4CLC E;  4GS9 A;  2B18 A;  3T4J A;  2O9A A;  5FL3 A;  1IFQ A;  4HI4 A;  4DN0 A;  4HIA A;  3EEA A;  3FPV A;  5J7E A;  4WEJ A;  1Y28 A;  1S67 L;  4BJP A;  1YSP A;  2Z6C A;  3DBA A;  1LSX A;  1LSV A;  3BY8 A;  3C8C A;  3P7N A;  2HJE A;  1T1A A;  5DJU A;  2JKR I;  4G3W A;  3VOL A;  1N9N A;  1MZU A;  2PD8 A;  2EWW A;  2ZMV A;  4CQH A;  3NOP C;  4XT2 A;  3OC2 A;  4L0L A;  4ARZ A;  5I5L A;  4CLC D;  3S7Q A;  2GX5 A;  1V9Y A;  3KSF A;  3K3C A;  3RFB A;  1VB6 A;  3KSG A;  3BWL A;  2XRO A;  1G28 A;  4LPZ A;  4R38 A;  4GHI A;  4EW7 A;  3PBR A;  4NXB A;  4EQ1 A;  5AVF A;  3BJN A;  4PHT A;  3LFV A;  5MC7 A;  2CMN A;  3BQ8 A;  4G3V A;  1S4S A;  3E4O A;  1IOU A;  2O0Y A;  1ZHH B;  4Q0I A;  3PBO A;  1YSQ A;  1VHM A;  5HPF A;  2QKP A;  3ZQ5 A;  4QPR A;  1XJ3 A;  4EER A;  5HWW A;  3OCN A;  3CUE C;  4WF0 A;  1OJG A;  1UWP X;  2Y79 A;  2D01 A;  4KQD A;  5HDS A;  3E4Q A;  3R7W B;  3PBS A;  1ZTU A;  4IJG A;  3LR3 A;  3F1P B;  4EES A;  3FG8 A;  4MDZ A;  2VKS A;  4HH2 A;  1LL8 A;  4UEY A;  4EET B;  4KUO A;  2W0N A;  4RQ9 A;  1S4R A;  2P04 A;  2L1M A;  2L0W A;  4I39 A;  5TBM B;  5LBR A;  5J4E A;  4CLC C;  2FZ0 A;  4YNR A;  3SW1 A;  5HDD A;  3HJI A;  3H7W A;  3KYQ A;  4WL9 A;  2Z6D A;  1XFQ A;  4O0P A;  4E04 A;  4MMN A;  4GS9 B;  4EEP A;  3OLO A;  2HJ9 C;  2D02 A;  4YOF A;  3TE8 A;  3D72 A;  4OOL A;  3P01 A;  3KO6 A;  2M7V A;  5HWV A;  3VV4 A;  4R70 A;  3LYX A;  1H3Q A;  4BBV A;  2QJ7 A;  2FH5 A;  2VV8 A;  3C30 A;  2HGV A;  1LSW A;  4K08 A;  2O99 A;  3T4K A;  4HJ3 A;  5DKK A;  3R7W A;  4ETZ A;  4B93 A;  3GDI A;  2XA7 M;  2IA2 A;  2QYB A;  2OOL A;  2XA7 S;  4XT2 B;  1N9O A;  1OT6 A;  4ARZ B;  3E98 A;  2KDK A;  5F69 A;  5K5B A;  4EXO A;  2O9C A;  4L9E A;  1T1B A;  2GZA A;  4KUK A;  2VEA A;  4NEE D;  1W63 Q;  3T4T A;  2ZOH A;  4GHI B;  3LIA A;  2JN7 A;  3W2Z A;  1KOU A;  2J80 A;  4O01 A;  3UE3 A;  4BMW A;  3EGD C;  3EOI A;  3PBT A;  4MN5 A;  5G4Z A;  4R6L A;  4NXE A;  3CWF A;  4LRZ E;  4F3L A;  1GSW A;  2QHK A;  4WEL A;  4IUH A;  2VGL M;  4I3I A;  4BBU A;  2VGL S;  2O9B A;  3H9W A;  4I38 A;  4MN7 A;  2HF6 A;  1GSX A;  3LIE A;  1NLY A;  4HQA A;  3F1N A;  2ZBB A;  3C2W A;  2VLG A;  4H6J A;  4HP9 A;  3UME A;  2NUP C;  2W3F A;  2ZMF A;  3MF0 A;  1JNU A;  2L4R A;  2PR5 A;  3LID A;  5HL6 A;  4JGR A;  4YWZ A;  3T50 A;  2KLI A;  3H7W B;  4HH3 A;  4UQI S;  1UWN X;  3A0R A;  2WKQ A;  1XJ6 A;  4MCW A;  4ME4 A;  2K2N A;  4JGQ A;  4WEK A;  2B02 A;  2PT7 A;  1NLZ A;  2JKT I;  3OBF A;  4NXG A;  1BYW A;  2V9A A;  5IT5 A;  3K2N A;  3VE4 A;  1OT9 A;  2JKR M;  5IS1 A;  5L8M A;  1P9R A;  1D06 A;  1YKD A;  3PXP A;  4P6Z S;  4R3A A;  2LB5 A;  4MN6 A;  4OOM A;  4IHQ A;  2A2L A;  3G6O A;  5CX7 A;  3NJA A;  5F5Y A;  3LI9 A;  4Q0J A;  5A8B A;  1P9W A;  1F98 A;  2PYR A;  2VV6 A;  2I9V A;  1TF1 A;  3B47 A;  5G4Y A;  3GEC A;  3PYP A;  4IUK A;  3PR6 A;  4GW9 A;  1W63 M;  3B33 A;  3BY9 A;  2QJ5 A;  1S66 L;  3MXQ A;  2PR6 A;  5F68 A;  4WLA A;  5HWT A;  2YKF A;  5EFW A;  1OTB A;  2H28 A;  1UGU A;  2R78 A;  1GSV A;  1STZ A;  3KX0 X;  4WUJ A;  3A0S A;  2V0U A;  2M1C A;  5IU1 A;  3IBJ A;  4F3L B;  5KIZ A;  3EQU A;  4HJ6 A;  3EWK A;  2VA0 A;  3CUE A;  1OTA A;  3MQQ A;  3LIC A;  4HNB A;  5HDC A;  2PHY A;  3F1N B;  4PKY G;  3LI8 A;  2PD7 A;  2ZOI A;  4H6J B;  5AJG A;  2PDR A;  1P0Z A;  2A24 A;  3S7P A;  3VE3 A;  3UB6 A;  1T19 A;  3T4S A;  3MQ0 A;  1F5M A;  2HV1 A;  3UMD A;  4BBT A;  4LLO B;  1NRJ A;  3LR0 A;  5DF9 A;  4II7 A;  2WKR A;  2OWH A;  4JGO A;  4G3K A;  3U2A A;  3EEH A;  4CLC A;  4Y5F A;  2QWS A;  3CIT A;  3F1O A;  4I3A A;  1DP6 A;  4AFI A;  5DJT A;  2EA9 A;  2XSS A;  3CAX A;  1H8M A;  3IBR A;  5HPI A;  1S1Y A;  3MFX A;  4Y2F A;  2WKP A;  3MR0 A;  1N9L A;  1D7E A;  2J3W A;  2INW A;  3OCL A;  1XJ4 A;  3NHQ A;  3TW8 A;  4GCZ A;  3LIB A;  4NXF A;  3MJQ A;  3A0V A;  1V9Z A;  4FSF A;  3H82 A;  2EWV A;  3KYZ A;  4Y3I A;  3BQA A;  1OJ5 A;  1XFN A;  3T4O A;  2W1T A;  4Z1W A;  2OWJ A;  3CI6 A;  3LR5 A;  1OTD A;  4GJ4 A;  1MC0 A;  2DMW A;  4WN5 A;  4I5S A;  4PKY A;  1TS7 A;  3CLO A;  4DJ2 A;  3C38 A;  3IS2 A;  1WA9 A;  3ICY A;  4UQI M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...