4I3JA

Structures of pr1 intermediate of photoactive yellow prtein e46q muntant from time-resolved laue crystallography collected at 14id aps
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAQGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
publication title Volume-conserving trans-cis isomerization pathways in photoactive yellow protein visualized by picosecond X-ray crystallography
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Luminescent protein
total genus 37
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2012-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4i3jA00
2PD8A 5AVFA 4BBTA 4I3IA 3E4PA 3PYPA 4XT2B 4HH2A 5F68A 1TS8A 4L9EA 3ICYA 2VV7A 1BYWA 5DKKA 5HDSA 4HIAA 2KX6A 3A0RA 5EFWA 3F1PA 3ZQ5A 2EA9A 1LT0A 3UB6A 3SW1A 4NXFA 3LICA 5I5LA 3EEHA 5F5YA 3NJAA 4WLAA 1XJ2A 3F1OA 1N9NA 4LRZE 5HD3A 3F1PB 1GSXA 1DP6A 3H82A 1UWPX 1MZUA 1OTIA 1F98A 3FG8A 5TBMB 5HWWA 1XJ4A 3P7NA 1GSWA 4EERA 1KOUA 2V1BA 3BWLA 3H82B 1DRMA 2GJ3A 3NOPC 4KUOA 1OJ5A 1ODVA 4PKYA 5A8BA 1OJGA 2QJ7A 4PKYG 4WN5A 4JGRA 4GW9A 4NXGA 2WKRA 4I3AA 3H7WB 3GDIA 4HHDA 4H6JA 2KDKA 3LIEA 2I9VA 2V1AA 4HJ4A 4B9OA 2K7SA 5IU1A 3KX0X 3UB9A 1X0OA 1XJ6A 3F1NA 3NOUC 3FC7A 2YKHA 1DP8A 4H6JB 1JNUA 4EW7A 2L0WA 4HY8A 3LUQA 3HJKA 1T19A 3GECA 2ZOIA 3D72A 1GSVA 1XFQA 2V9AA 3F1NB 3A0SA 5F6AA 3BY8A 2ZBBA 3IS2B 3G6OA 1LL8A 1NWZA 3ULFA 4I38A 3BY9A 3OLOA 4L9GA 3MFXA 5G4ZA 4HQAA 1D06A 3LYXA 5TBMA 2V0UA 3H9WA 4HP4A 2PYRA 1V9YA 1G28A 2VLGA 3K3DA 3PHYA 1OTAA 2PR5A 2R78A 2JN7A 2CMNA 4R6LA 4MN6A 2PD7A 3MQOA 3UMEA 3CWFA 4BBVA 3K3CA 1S1YA 2D02A 2PYPA 3H7WA 1TS0A 4E04A 4LRYC 3T50A 1P0ZA 3LI8A 4RQ9A 2VV6A 2Z6CA 3NHQA 2L4RA 3C2WA 4EEUA 4K08A 4I5SA 1XJ3A 4EXOA 1OTBA 3NOTC 5J4EA 4HI4A 3LIDA 2PHYA 2YKFA 1N9LA 4LPZA 3HJIA 3UB7A 1OT6A 5HWTA 2PR6A 3E4QA 4I3JA 3B33A 4YWZA 5DJTA 2A24A 5DJUA 1F9IA 2W0NA 3CAXA 1N9OA 4DJ3A 4F3LB 4I39A 2OWHA 1T1CA 1LSWA 3MXQA 3IS2A 1S4RA 1T1BA 4HP9A 2Z6DA 2HV1A 3MJQA 2A24B 4HH3A 3LIBA 1VB6A 2OWJA 1WA9A 3MR0A 1S1ZA 3EWKA 1LSXA 5HDDA 3MQQA 5HZHA 4L9FA 3A0VA 1UWNX 3E4OA 4DJ2A 5HSQA 1Y28A 3IBRA 4NXBA 1EW0A 4WF0A 5J7EA 2WKPA 3LIAA 2J80A 2WKQA 2B02A 4HNBA 5F69A 2ZOHA 3VOLA 1P97A 1OT9A 2M1CA 4WUJA 4EESA 3LI9A 3VE3A 1T18A 5HWVA 1S4SA 4JGPA 3CLOA 2H28A 2QWSA 3UMDA 2OOLA 1D7EA 4MN5A 1V9ZA 4LLOB 5IS1A 3UE6A 2VV8A 3C8CA 1TS7A 3F1OB 4F3LA 4M4XA 1OTDA 4EETB 2P7JA 2QJ5A 4HJ3A 2BASA 4GS9A 4KUKA 2VEAA 2QKPA 1S67L 5HDCA 1LSVA 2PDRA 3RH8B 5AVEA 5J3WA 3LIFA 3VE4A 4KQDA 2W27A 3RTYA 4WL9A 4GHIA 5G4YA 4JGOA 4GS9B 1DP9A 4BBUA 4HJ6A 4R38A 1S66L 4R70A 4GCZA 2V0WA 4R3AA 4EEPA 2L1MA 5HD5A 2D01A 5KIZA 4GHIB 4HOIA 1UGUA 2INWA 1TS6A 1T1AA 1OTEA 4EQ1A 4JGQA 4LRXC 4XT2A 2QHKA 5DKLA 1XFNA 4NXEA 3UB8A 2JHEA
chains in the Genus database with same CATH superfamily
1OPXA 2ZQ8A 1NY0A 2J3TD 5AQBA 1XA1A 5AVFA 3SZTA 2ZC7A 1SCWA 1K4EA 2VJWA 2Y2PA 4GD8A 5M1AA 5F68A 2J9OA 3ICYA 5FQQA 3MQ0A 4LCLA 2VGLM 4HIAA 5M19A 5FI2A 5F1FA 4HEFA 3ZQ5A 2ZQ7A 3UB6A 1LT0A 1H8ZA 3VP4A 3ZHHA 4NXFA 3NJAA 4WLAA 3IH9A 2WUQA 3VP0A 4GOGA 4LRZE 2QMIA 4GB7A 4NETA 4B93A 3PXPA 4RA7A 4UQIM 4DXCA 5J8XA 4YOFA 3S1YA 3H82A 3N6IA 1UWPX 2V1ZA 3T4KA 4N92A 4IBXA 1FILA 2ZL1A 3FG8A 3GRJA 4MBHA 4O7DA 1BUEA 1SDEA 1NLZA 5FATA 4MLLA 4MBFA 1FR6A 3OPLA 4DF6A 3NC8A 4KG2A 1PYYA 1VETA 2BG1A 1K54C 4PKYA 3C38A 3JVVA 1GA0A 4GZBA 4PKYG 1IFQA 4NK3A 3G32A 4GW9A 3VFFA 4S2LA 3IXBA 1IOUA 5GHZA 4HJ4A 3BJNA 4O0PA 2K2NA 1X0OA 4BL2A 1KE4A 4LCMA 2X01A 4FTXA 3JPUA 4E3KA 5CGWA 4H6JB 2ZC4B 2GDNA 5IHVA 3T1XA 2AVXA 4JXVA 3N7WA 3K2NA 2HDRA 4DE1A 5GLDA 1KGFA 1XFQA 4P6BA 2VZWA 2P9VB 2ZJ9A 3FV7A 1H8MA 3WS1A 4S2IA 5FQMA 3BY8A 1FSWA 1NWZA 4P87A 3ULFA 4I38A 1ZHHB 3BY9A 3IH8A 1Z6FA 1H3QA 1E4DA 3T4SA 4EBPA 1IEMA 3VSKA 2PRFA 3TSGA 5EM0A 3PBNA 3PR6A 2RCXA 5KMWA 3KYEA 4H8RA 4Q0IA 4HP4A 4U3TA 4KZ6A 3RXWA 3KO6A 1IKIA 2VLGA 3PHYA 3UE0A 1OTAA 3TE8A 3NULA 5EV0A 4B4ZA 4KG6A 3W4QA 2PD7A 4MN6A 4UA7A 2EFUA 3CWFA 3NDEA 4BBVA 1S1YA 3H7WA 4PPRA 1ERQA 3W4PA 3DBAA 2M7UA 4WEJA 3CI6A 1CF0A 5A91A 1OTBA 4XXRA 4Z1WA 1KGEA 2P08A 2PBYA 5GHYA 1VQQA 4X6TA 2JKRI 3HLCA 1ZG4A 4I3JA 2Y91A 3GV9A 1CI8A 1SZVA 1DY6A 4Y3IA 2XD5A 4DKIA 1F9IA 2OLVA 1O07A 4F3LB 4I39A 3OPHA 1TEMA 3MXQA 2XSSA 1S4RA 3IHBA 2HV1A 3ZG5A 3B42A 3OZHA 1HZOA 4K91A 5GL9A 4KZAA 4S2MA 1F5MA 3HLDA 4X55A 2DCFA 2OWJA 1ES5A 2JE5A 4E3IA 3MSHA 1DJAA 1KDSA 3WS4A 3EWKA 3T1QB 4S2NC 1VEUA 3IXHA 4UHUA 1J3WA 1K4FA 3UN7A 4FCFA 2OLUA 4OOYA 1Q2QA 3PBOA 5FDHA 1UWNX 4DE2A 3G35A 5HSQA 4DJ2A 3BRMA 4DMZA 4NXBA 3BLMA 1CEFA 1FIKA 2W3HA 2WKPA 5FQKA 3A3FA 1MC0A 2WKQA 4QY5A 3CPTA 3IF5A 5EVEA 5F69A 1BULA 4Y13A 3RXXA 2M1CA 3UPPA 3CJMA 5HFOA 3C7UA 5DF8A 3VE3A 1T18A 3ZG8B 3IHAA 1RP5A 1L0GA 4C75A 2E8IA 1Y4OA 2WKHA 3N8LA 4OQ0A 1YAXA 4JF6A 2HJ9C 4MN5A 4LLOB 1V9ZA 4FH2A 2VGLS 3UE6A 5EVIB 3P98A 3C8CA 1CEGA 1ONGA 3V5MA 4KZBA 4EETB 1W8YA 1MWTA 1JWZA 5F1GA 4BMWA 1ONHA 2WAEA 2BASA 2XDMA 3M6HA 3LR0A 3LY4A 2QKPA 4EWFA 3EGDC 2HPBA 2X02A 4R3JA 1WE4A 3SH9A 5AVEA 5J3WA 4UQIS 5DFYA 3VE4A 1VETB 3DAVA 4GS9B 1YSPA 4HJ6A 2EWWA 2W3FA 1K6RA 3R7WA 1S66L 2FH5A 2WKIA 3AGEA 2JKGA 1M6KA 3QP8A 2V0WA 2FFFB 3L7HA 3MZFA 1YLZA 4KQQA 2D01A 3N8SA 3QP2A 4N9KA 1IKGA 1YLYA 3FKWA 5BOHA 1H0MA 3PTEA 4N9LA 3VP1A 4EQ1A 3P01A 3Q7VA 1A0KA 4C3QA 4G3WA 1YLJA 3UB8A 3L9KA 1XA7A 3GQZA 3IT9A 2JHEA 4D60A 2PD8A 3LO7A 2FZ0A 1ZC2A 4BBTA 5D3OA 4I3IA 3E4PA 4XT2B 4HH2A 2P74A 4L9EA 2GNXA 3NBLA 3EGXC 3KSIA 3F1PA 2CC1A 4GN2A 2EA9A 5FA7A 3LICA 4BLMA 1MKMA 2IWCA 4DRTA 2PBDP 3G2ZA 4IJGA 1EWZA 3Q82A 1I2WA 1TVFA 1GSXA 4KZ4A 2G7UA 5EECA 4O01A 1NZOA 1ZG6A 5L10A 4JPMA 4MBKA 2EXBA 4EERA 2XK1A 2V1BA 4U0XA 3MZEA 3TG9A 4YNRA 2GJ3A 4KUOA 1ODVA 2HF6A 4P6ZM 3ZDJA 2KLIA 5FAPA 2EFXA 1BLSA 2QJ7A 4YFMA 1XP4A 3QP6A 1XX2A 3PBQA 1NXYA 2WKRA 1AWIA 3H7WB 3CMZA 3R4KA 2IA2A 2V1AA 4B9OA 4BL3A 5AQ9A 2ZM8A 3UB9A 3PBRA 3A3DA 1XJ6A 4OQIA 1FSYA 2QYBA 5CGXA 1XXMA 3OPRA 4OPRA 4P85A 4HESA 3F1NA 5CECA 3FC7A 1KDWA 3E2LA 1DP8A 3KSFA 5EVIC 4CJNA 1YMXA 4QPRA 4EW7A 4HY8A 3LUQA 3HJKA 2Y79A 3D72A 3TOIA 4M3KA 4ZJ3A 5EUAA 4R1GA 1GHMA 3ZNYA 5E2GA 2WZZA 2H10A 2V9AA 3GR2A 4IUHA 5HAQA 2ZC3B 1K25A 3UDFA 3ITBA 1PZOA 1FCNA 4R4SA 1C3BA 5FSRA 3MFXA 3A3JA 2Z2MB 2BTFP 1BLPA 2WGWB 3V67A 4HQAA 3UY6A 5CRFA 3MMHA 2V8CA 1ES2A 1G6OA 2ZQDA 3H9WA 2W1TB 3BYDA 1VEUB 4KG5A 4Y15A 2O9CA 3IQAA 4OQHA 1G28A 3K3DA 4LV0A 3T4OA 4A5RA 2XFSA 2PR5A 2R78A 3M2JA 2JN7A 4CLCC 3G31A 5FEGA 4R6LA 5CGSA 2K31A 5HARA 1XGJA 3IF6A 4Y0TA 2D02A 1DJBA 3BM6A 3CPTB 3NY4A 3T50A 1FCMA 2W3EA 4RQ9A 3OCLA 1PNEA 2Z6CA 2L4RA 2XF3A 3CUEC 2Y4AA 4EXOA 4MN7A 3NOTC 1TD5A 3LIDA 4HI4A 2V8FA 2JKRM 3QP1A 1LL9A 3ZG0A 2XLNA 2YKFA 5I94A 3HUMA 1N9LA 4CLCE 3UB7A 4R23A 2PR6A 3V3SA 3B33A 2JKFA 1D1JA 1G6AA 5DJTA 1QMFA 2LB9A 2A24A 3PAEA 3E98A 4QWOA 3QP5A 4ZAMA 1N9OA 3OOVA 1PFLA 1T1CA 4E6XA 4Z9QA 2XGNA 2A2LA 4ZDXA 2Y2MA 4ARZA 3IS2A 3IWQA 3M2KA 1W63Q 4HP9A 2XR0A 1H8YA 3MKEA 3MJQA 4UAAA 5DTTA 3MZDA 1O7EA 1YPRA 3LEZA 3NDGA 4OKPA 3AGFA 1GHPA 1KVLA 1EI5A 1K55A 1WA9A 2IWDA 3MR0A 2QPNA 3DWKA 1K54A 2DNSA 5DF7A 4Q0JA 4IVIA 4DE3A 3C5AA 5HDDA 4OPYA 4GDNA 3NCKA 3MQQA 4X56A 4OVDA 2LB5A 1W63M 4IEDA 4JF4A 3T4LA 3OPPA 3BLSA 5AJGA 2GX5A 3IWOA 3BEBA 3G4PA 1L0DA 5L8MA 4WM9A 3D4FA 2Y2LA 2MJ6A 1XPBA 3S7OA 2WAFA 2Y2IA 4NG2A 1LL5A 4CQHA 4HNBA 4DN0A 2ZOHA 3CHWP 3VOLA 2HP5A 1MXOA 1OT9A 1RGYA 1QMEA 4GKUA 4EESA 3FKVA 3B3XA 2QZ6A 3HLFA 1PW8A 3NECA 4NEED 3S22A 1RGZA 1D7EA 4DE0A 1PI4A 5E2FA 3VOZA 4WZ5C 2RL3A 3BFEA 5FI6A 4E3LA 1SKOB 1TS7A 2VKSA 5CHMA 5G18A 3ITAA 4P0MA 2B95A 4HJ3A 3HLWA 2OV5A 2J3TC 3PAGA 4KUKA 3O87A 3SS3A 2XA7M 1LSVA 3BW6A 1FR1A 5M18A 1I5QA 1FQGA 2PDRA 3RH8B 3D9YA 3LIFA 3E0YA 2W27A 3QNBA 3FZCA 4Y7PA 4EU0A 4WL9A 4GHIA 4IVKA 4JGOA 2XEPA 4QHCA 4WEKA 4R38A 3PBTA 5FDSA 3RJUA 4X25A 2J9PA 3HL9A 3LY3A 3WS0A 5A90A 3SH7A 3KYZA 2L1MA 2HDQA 1ERMA 3ZG9B 4UEYA 3O88A 4P6ZS 2Y2HA 4WZ4A 3T12B 5E43A 2QHKA 4GJ4A 1XFNA 3ISGA 3VMAA 3DWZA 3OC2A 4FUWA 4OP8A 4Y2FA 2H0YA 4ETZA 3QP4A 1TDLA 3PYPA 1YMSA 4G3VA 1TS8A 2WGIA 4RX3A 5JYPA 2VV7A 1BYWA 5HDSA 2KX6A 5E2HA 5EFWA 3BFCA 4JXWA 4JXSA 2IWBA 5E2EA 5GLAA 5L09A 3C4OA 3SW1A 1YLPA 2Y8HA 2C6WB 3N8RA 4MMNA 2EX9A 1W7FA 1CK3A 3IBJA 1Y54A 5FQIA 1TF1A 5HL6A 2HJEA 2H5SA 1PWCA 3SOIA 1N9NA 3DTKA 3VP3A 3N4IA 3UO9A 3UE1A 5IT5A 5HD3A 1DP6A 1MZUA 1NZUA 1OTIA 1F98A 2HP9A 1K57C 4X69A 1YT4A 1ACFA 1XJ4A 3VOYA 3O86A 5GLCA 1GSWA 2WGVA 1PIOA 2R9WA 3BWLA 4S2NA 3H82B 1DRMA 4GLQA 4KZ5A 2BLSA 4EBNA 5A8BA 2ZL1B 4FH4A 1OJGA 1PWGA 5DTKA 5DTSA 4RYEA 3IF6B 4MNRA 3OBFA 1H5XA 1BZAA 2OAP1 4HHDA 4H6JA 2KDKA 3I7JA 3LIEA 4JKTA 2I9VA 4E3JA 4K0XA 5GHXA 4IUKA 1IYOA 3T4TA 2EX6A 5IU1A 3KX0X 1F2KA 2JBFA 1E3UD 5EOEA 4O8GA 1YSQA 1MY8A 3S7NA 1L3LA 2B18A 4QJGA 2G2UA 2YKHA 1VHMA 2P04A 4PM7A 1JNUA 3MXRA 1XKZA 1ES4A 2J3WA 4WBGA 1T19A 4CLCD 2W1RA 1GSVA 3EOIA 4LV2A 2ZM2A 4EQIA 4PM6A 5F6AA 5HAIA 1LHYA 4E3NA 3WS2A 5TGFA 4N1HA 3IS2B 2XQZA 3KSGA 3HLGA 3G6OA 5LBRA 4B4XA 1LL8A 1MBLA 3BFFA 4KQOA 5L2FA 3ZG7B 4EUZA 2XROA 3OLOA 1L2SA 3W4OA 2Q0OA 5CXWA 4QD4A 5FI7A 5FEFA 1D06A 3KYQA 3LYXA 5TBMA 3T1RA 1CJFA 1P9RA 5KSCA 3EQVA 2WADA 5HAPA 1JWVA 1V9YA 3WWXA 3V3RA 3EEAA 3BECA 4X68A 1KE3A 2J8YA 3UPOA 2ZMFA 2W3DA 4K0WA 3WS5A 4E3OA 4ZBEA 5F83A 3NIAA 4E3MA 4DXBA 3UMEA 2KOIA 2PYPA 3HBRA 1TS0A 3OCNA 1STZA 4E04A 2OAQ1 1P0ZA 5CTNA 2Q9MA 4DDYA 3C2WA 5DFXA 4EEUA 3ZVWA 4I5SA 1XJ3A 5DF9A 5J4EA 3Q81A 1VM1A 2PHYA 2EX2A 4ID4A 4FOFA 4XUZA 4OONA 3LFVA 2ZC5B 1IYPA 4R3BA 5K5BA 1J9MA 2VA0A 2JCHA 4DJ3A 2OWHA 1LSWA 3G30A 2O99A 2Y2OA 4WMCD 1GHIA 1T1BA 1JTDA 2ZQAA 2VK3A 3T4QA 3JYIA 2R9XA 4KENB 3HLEA 1JTGA 2G2WA 3O3VA 4MDZA 1PI5A 3TJZC 4JBFA 3BFGA 2XA7S 2V2FF 3IF6C 4FSFA 2DMWA 1S6RA 3ZVTA 1LI0A 3U4LP 5FAQA 1KVMA 4OPZA 5EM1A 4KZ8A 5FAOA 5HZHA 3CG5A 1ALQA 3C4PA 2ZMAA 3A0VA 5A92A 3FWLA 1Z09A 4IHQA 5CX7A 3UE3A 3W2ZA 1MWUA 5TFQA 3UB5P 3LIAA 1K56D 2VGJA 2JKTI 5KZHA 2VGKA 4WUJA 3HREA 2HGVA 5AQ7A 5EVIA 2UV0E 3LGOA 1S4SA 4JGPA 2QWSA 3V50A 2Y2GA 4OLGA 3Q07A 4PM8A 4DDSA 3AGDA 2OOLA 5TR7A 5IS1A 3IX4A 2NUPC 4II7A 1SKFA 1S0WA 3S7QA 2VV8A 1MPLA 2WKEA 5CEBA 2XRNA 1K55C 5CHJA 4YINA 4M4XA 3O5YA 1OTDA 3HLBA 3KSHA 1BLCA 4GS9A 3Q1FA 2VEAA 2Y2QA 3BQAA 3HCYA 1JWPA 5EOOA 1S67L 1IELA 3UDXA 5FQ9A 4IBRA 1ZKJA 4OH0A 3IWIA 1E3UA 4PAUA 4OQGA 4HBUA 5HL1A 1U60A 4KZ9A 1DP9A 1PRQA 1NRFA 3PBSA 4OOMA 4BBUA 2O0YA 4R70A 3CZDA 4GCZA 3VP2A 4R3AA 4F94A 4ME4A 4PM5A 4CLCA 3MXSA 3TW8A 4BWIA 5KIZA 5KSHA 1W8QA 1UGUA 1OTEA 4JGQA 3R7WB 4XT2A 4S2OA 4NXEA 3V39A 2E8JA 4WYYA 2WYXA 4OP5A 1L0FA 3CUEA 5EPHA 1K38A 3MBZA 3JVUA 2C5WB 3P09A 4EBLA 4S2KA 1YLWA 3Q7VB 2H0TA 1P9WA 5DKKA 3A0RA 2EWVA 3GVBA 1LLBA 2UWXA 4BQMA 3E2KA 1PW1A 5I5LA 1E25A 2ZD8A 3EEHA 5TJJA 5F5YA 1XJ2A 3F1OA 1CQAA 3F1PB 5JYOA 2PT7A 3HUNA 2FFYA 3LEQA 3QHYA 3GTCA 3ZFZA 3DTEA 5TBMB 5HWWA 4EV4A 3U2AA 2PAVP 1SDNA 1YKDA 1BSGA 3S7PA 3P7NA 3LR5A 4GNUA 1KOUA 2M7VA 4MCWA 3C7VA 2J7VA 2PU2A 3NOPC 1OJ5A 4BD0A 3SH8A 4JF5A 4BD1A 1KE0A 1NJ4A 4BJPA 4WN5A 4JGRA 1Q2PA 2XD1A 4NXGA 4I3AA 4QU3A 3GDIA 2WZXA 1HD8A 3MF0A 4R4RA 4L0LA 3LCEA 3IXDA 1I2SA 2K7SA 1MWRA 4AFIA 4WMCA 3VV4A 4LV3A 4WELA 2ZQCA 3IXGA 5HW3A 1JVJA 1NYMA 2A49A 3NOUC 4Y0OA 3G34A 4LENA 4KQRA 3A3IA 2EX8A 1YQSA 3MKFA 2L0WA 4XUXA 1BT5A 5DVAA 3GECA 2ZOIA 1YLTA 2W3GA 3DTIA 4ZRRA 3BFDA 3F1NB 3A0SA 4ETXA 4WZ5A 1TDGA 4R0QA 3SS5A 1G68A 4OPQA 2ZBBA 2ZQ9A 1NRJA 2WGWA 4JLFA 4S2PA 2Y55A 4PM9A 1KGGA 3FYZA 5CHUA 4MEZA 2W1TA 3QNCA 4LFUA 4L9GA 1PWDA 4OOLA 4D2OA 2Y59A 5G4ZA 4ZJ1A 4GDBA 3HUOA 5EVLA 1K56A 3M6BA 2XH9A 2V0UA 2EXAA 2ZC6B 2PYRA 2HDSA 5HX9A 2O9BA 5EVID 1L0EA 4BENA 4GD6A 4EUVA 1OMEA 2A3UA 2CMNA 3MQOA 1GA9A 5AQAA 5U47A 3K3CA 1ESUA 4LRYC 1MKIA 3LI8A 1BTLA 2VX8A 2VV6A 4Y5FA 3NHQA 1FCOA 3ZNTA 4K08A 1M40A 4E6WA 3DTMA 2ZLYA 1RCJA 5CEDA 4LPZA 3HJIA 1OT6A 5HWTA 4U0TA 3MFDA 3E4QA 4NKPA 4PHTA 3WRZA 4YWZA 5F82A 3MS6A 1WYCA 3D3OA 4QY6A 5DJUA 2W0NA 3IX3A 3CAXA 3ZGAB 2P9VA 3FPWA 3HVFA 3UDIA 5FL3A 3IX8A 1XGIA 5HPFA 3GMWA 4X1LA 4Y17A 2Z6DA 1CI9A 5MC7A 2A24B 1K6SA 4HH3A 4S2JA 3A3EA 3Q7ZA 2PU4A 3LIBA 1VB6A 4UA9A 1EROA 1K57A 1YM1A 2HP6A 5L07A 1N9BA 2WK0A 3UNWA 4ARZB 3FPVA 4X1MA 1IYSA 3LR3A 4PMAA 1S1ZA 3NI9A 1LSXA 1G5UA 1N4OA 4ZTKA 4ZJ2A 3ZCZA 4CLCB 4HBTA 5FQJA 4L9FA 4Y0UA 2Y2NA 1ES3A 4LV1A 4QB8A 2X71A 2HDUA 3C30A 3E4OA 2JKTM 1Y28A 3IBRA 5GLBA 4LGWA 2Q9NA 1EW0A 4WF0A 4RVAA 4UA6A 5J7EA 2ZMVA 2J80A 3VFHA 1K0KA 3B47A 2B02A 4N1XA 2NUTC 3T1SA 3GSGA 3UPNA 1P97A 3W8KA 4Q8IA 2OSUA 4B88A 5FASA 1W79A 1MWSA 1ZTUA 3LI9A 1SKOA 2I72A 2ZM0A 4CPKA 5HWVA 1ESIA 2Z2LB 2Y2JA 3CLOA 2H28A 3UMDA 3RFBA 4KZ7A 4ESPA 2JC7A 4FD8A 1IYQA 4X53A 4RX2A 3VSLA 2ACGA 3F1OB 4F3LA 1BLHA 2P7JA 2QJ5A 3EQUA 1FOFA 4G3KA 2B5RA 4C6YA 1HTZA 1GCEA 2Y2KA 5HPIA 5EE8A 1PZPA 1AXBA 5HDCA 5C5KA 4KZ3A 2V20A 4KQDA 1LI9A 2GZAA 3SS4A 3RTYA 5G4YA 1W5DA 1NLYA 3WRTA 5CERA 1DJCA 2HZ5A 1SHVA 3T4JA 3CITA 3TRCA 4JXGA 3G2YA 3DW0A 3S4XA 4EEPA 5HD5A 4GHIB 4HOIA 2INWA 5CTMA 1TS6A 4Q0HA 2XFTA 1T1AA 4LRXC 3BQ8A 5DKLA 2O9AA 1HLUP 4OLDA 2DRWA 1HVBA 3LR4A 3ZYTA 5A93A 1WYBA 1NYYA
chains in the Genus database with same CATH topology
2PD8A 1OPXA 2FZ0A 2J3TD 5AVFA 3JVUA 4BBTA 2VJWA 4I3IA 3E4PA 3PYPA 4XT2B 4G3VA 4HH2A 5F68A 1TS8A 4L9EA 3ICYA 2GNXA 2VV7A 1P9WA 3MQ0A 1BYWA 3EGXC 5DKKA 3KSIA 5HDSA 2VGLM 4HIAA 2KX6A 3A0RA 5EFWA 2EWVA 3F1PA 3ZQ5A 2EA9A 1LT0A 3UB6A 3SW1A 4NXFA 2Y8HA 3LICA 5I5LA 4MMNA 1MKMA 3EEHA 5TJJA 5F5YA 3NJAA 4WLAA 3IBJA 4IJGA 1TF1A 5HL6A 2HJEA 1XJ2A 3F1OA 1N9NA 4LRZE 4B93A 3PXPA 5IT5A 5HD3A 3F1PB 1GSXA 2PT7A 4UQIM 1DP6A 4YOFA 3H82A 1UWPX 2G7UA 3T4KA 1MZUA 1OTIA 4O01A 1F98A 3FG8A 5TBMB 5HWWA 3U2AA 1XJ4A 1YKDA 1NLZA 3S7PA 3P7NA 1GSWA 3LR5A 4EERA 1KOUA 2M7VA 4MCWA 2V1BA 3BWLA 4YNRA 3H82B 1DRMA 2GJ3A 3NOPC 4GLQA 4KUOA 1OJ5A 1ODVA 4PKYA 5A8BA 2HF6A 1OJGA 4P6ZM 3C38A 2KLIA 3JVVA 2QJ7A 4BJPA 4PKYG 1IFQA 4WN5A 4JGRA 4GW9A 4NXGA 3PBQA 2WKRA 3OBFA 4I3AA 3H7WB 3GDIA 2OAP1 1IOUA 4HHDA 4H6JA 2KDKA 3LIEA 2I9VA 3MF0A 3R4KA 2IA2A 2V1AA 4HJ4A 4B9OA 4L0LA 4IUKA 3BJNA 2K7SA 4O0PA 2K2NA 5IU1A 3T4TA 3KX0X 3UB9A 3PBRA 1X0OA 1XJ6A 4AFIA 3VV4A 4O8GA 2QYBA 1YSQA 4WELA 3F1NA 3S7NA 3NOUC 2B18A 3FC7A 2YKHA 1VHMA 1DP8A 3KSFA 4H6JB 2P04A 4QPRA 1JNUA 4EW7A 2L0WA 4HY8A 3LUQA 2J3WA 3HJKA 1T19A 4CLCD 2Y79A 3GECA 2ZOIA 3D72A 3K2NA 2W1RA 2W3GA 1GSVA 3EOIA 4ZRRA 1XFQA 2V9AA 3F1NB 2VZWA 3A0SA 4ETXA 4IUHA 5F6AA 1H8MA 3BY8A 2ZBBA 1NRJA 3IS2B 3KSGA 5LBRA 3G6OA 1LL8A 1NWZA 3ULFA 4KQOA 4I38A 1ZHHB 3BY9A 2W1TA 2XROA 1H3QA 3OLOA 3T4SA 4L9GA 3MFXA 4OOLA 5G4ZA 3V67A 3PBNA 4HQAA 3PR6A 1D06A 3KYQA 3LYXA 5TBMA 3MMHA 1P9RA 3EQVA 2V0UA 1G6OA 4Q0IA 3H9WA 4HP4A 2PYRA 2W1TB 2O9BA 2O9CA 4ETZA 1V9YA 3EEAA 3KO6A 1G28A 2VLGA 3K3DA 3PHYA 3T4OA 1OTAA 2ZMFA 2W3DA 3TE8A 2PR5A 2R78A 2JN7A 4CLCC 4EUVA 2CMNA 4R6LA 2PD7A 3MQOA 4MN6A 2K31A 3UMEA 2KOIA 3CWFA 4BBVA 3K3CA 1S1YA 2D02A 2PYPA 3H7WA 1TS0A 3OCNA 1STZA 4E04A 4LRYC 2OAQ1 3T50A 1P0ZA 2W3EA 3DBAA 2M7UA 4WEJA 3LI8A 4RQ9A 2VX8A 2VV6A 3CI6A 4Y5FA 3OCLA 2Z6CA 3NHQA 2L4RA 3C2WA 5DFXA 3CUEC 4EEUA 4K08A 4I5SA 1XJ3A 5DF9A 1OTBA 4EXOA 4MN7A 3NOTC 5J4EA 1TD5A 3LIDA 4HI4A 4Z1WA 2PHYA 2JKRM 4FOFA 2P08A 2YKFA 1N9LA 4LPZA 3HJIA 4CLCE 2JKRI 1OT6A 3UB7A 5HWTA 2PR6A 3LFVA 4NKPA 3E4QA 4I3JA 3B33A 4PHTA 4YWZA 5K5BA 2VA0A 5DJTA 2LB9A 2A24A 4Y3IA 3D3OA 3E98A 5DJUA 1F9IA 2W0NA 3CAXA 1N9OA 4DJ3A 4F3LB 4I39A 3OOVA 2OWHA 1T1CA 2A2LA 1LSWA 3FPWA 2O99A 5FL3A 3MXQA 4ARZA 2XSSA 1S4RA 3IS2A 1T1BA 5HPFA 1W63Q 4HP9A 2Z6DA 2HV1A 3MJQA 3T4QA 3B42A 5MC7A 2A24B 4HH3A 3LIBA 1VB6A 4MDZA 1F5MA 3TJZC 2OWJA 4ARZB 1WA9A 3FPVA 2XA7S 3MR0A 3LR3A 4FSFA 2DMWA 1S1ZA 3EWKA 4Q0JA 1LSXA 5HDDA 3MQQA 4CLCB 2LB5A 1W63M 3T4LA 5AJGA 5HZHA 4L9FA 2GX5A 3PBOA 3A0VA 5L8MA 4IHQA 2MJ6A 1UWNX 3S7OA 5CX7A 3UE3A 3W2ZA 3C30A 3E4OA 4DJ2A 5HSQA 4DMZA 2JKTM 1Y28A 3IBRA 4NXBA 1EW0A 4WF0A 5J7EA 3LIAA 2W3HA 2WKPA 2J80A 2ZMVA 1MC0A 2JKTI 2WKQA 3B47A 2B02A 4HNBA 4CQHA 4DN0A 2NUTC 2ZOHA 5F69A 3VOLA 1P97A 1OT9A 2M1CA 4WUJA 2HGVA 1ZTUA 4EESA 3LI9A 3VE3A 1T18A 5HWVA 1S4SA 4JGPA 3CLOA 2H28A 2QWSA 3UMDA 3RFBA 2OOLA 4NEED 1YAXA 1D7EA 2HJ9C 4MN5A 1V9ZA 4LLOB 2NUPC 5IS1A 4II7A 2VGLS 3S7QA 3UE6A 2VV8A 3C8CA 1TS7A 2VKSA 3F1OB 2XRNA 4F3LA 4M4XA 3O5YA 1OTDA 4EETB 3KSHA 2P7JA 2QJ5A 4BMWA 4HJ3A 2J3TC 3EQUA 2BASA 4G3KA 4GS9A 4KUKA 2VEAA 3BQAA 3HCYA 3LR0A 5HPIA 2QKPA 1S67L 3EGDC 2XA7M 5HDCA 1LSVA 3BW6A 5C5KA 2PDRA 3RH8B 5AVEA 5J3WA 4UQIS 3LIFA 5DFYA 3E0YA 3VE4A 4KQDA 2GZAA 2W27A 4EU0A 3RTYA 4PAUA 4WL9A 4GHIA 5G4YA 1NLYA 4JGOA 4GS9B 1DP9A 1YSPA 3PBSA 4HJ6A 4OOMA 4WEKA 4BBUA 2EWWA 4R38A 3PBTA 2W3FA 2O0YA 3R7WA 1S66L 2FH5A 4R70A 4GCZA 3T4JA 3CITA 3TRCA 2V0WA 4R3AA 4ME4A 3KYZA 4CLCA 4EEPA 2L1MA 5HD5A 2D01A 3TW8A 4BWIA 5KIZA 5KSHA 4GHIB 4HOIA 4UEYA 1UGUA 2INWA 1TS6A 4P6ZS 4Q0HA 1T1AA 1OTEA 4EQ1A 4JGQA 4LRXC 3R7WB 3P01A 4XT2A 2QHKA 4GJ4A 3BQ8A 5DKLA 1XFNA 4NXEA 2O9AA 3OC2A 4G3WA 3UB8A 4Y2FA 3LR4A 3CUEA 3ZYTA 2JHEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PD8 A;  5AVF A;  4BBT A;  4I3I A;  3E4P A;  3PYP A;  4XT2 B;  4HH2 A;  5F68 A;  1TS8 A;  4L9E A;  3ICY A;  2VV7 A;  1BYW A;  5DKK A;  5HDS A;  4HIA A;  2KX6 A;  3A0R A;  5EFW A;  3F1P A;  3ZQ5 A;  2EA9 A;  1LT0 A;  3UB6 A;  3SW1 A;  4NXF A;  3LIC A;  5I5L A;  3EEH A;  5F5Y A;  3NJA A;  4WLA A;  1XJ2 A;  3F1O A;  1N9N A;  4LRZ E;  5HD3 A;  3F1P B;  1GSX A;  1DP6 A;  3H82 A;  1UWP X;  1MZU A;  1OTI A;  1F98 A;  3FG8 A;  5TBM B;  5HWW A;  1XJ4 A;  3P7N A;  1GSW A;  4EER A;  1KOU A;  2V1B A;  3BWL A;  3H82 B;  1DRM A;  2GJ3 A;  3NOP C;  4KUO A;  1OJ5 A;  1ODV A;  4PKY A;  5A8B A;  1OJG A;  2QJ7 A;  4PKY G;  4WN5 A;  4JGR A;  4GW9 A;  4NXG A;  2WKR A;  4I3A A;  3H7W B;  3GDI A;  4HHD A;  4H6J A;  2KDK A;  3LIE A;  2I9V A;  2V1A A;  4HJ4 A;  4B9O A;  2K7S A;  5IU1 A;  3KX0 X;  3UB9 A;  1X0O A;  1XJ6 A;  3F1N A;  3NOU C;  3FC7 A;  2YKH A;  1DP8 A;  4H6J B;  1JNU A;  4EW7 A;  2L0W A;  4HY8 A;  3LUQ A;  3HJK A;  1T19 A;  3GEC A;  2ZOI A;  3D72 A;  1GSV A;  1XFQ A;  2V9A A;  3F1N B;  3A0S A;  5F6A A;  3BY8 A;  2ZBB A;  3IS2 B;  3G6O A;  1LL8 A;  1NWZ A;  3ULF A;  4I38 A;  3BY9 A;  3OLO A;  4L9G A;  3MFX A;  5G4Z A;  4HQA A;  1D06 A;  3LYX A;  5TBM A;  2V0U A;  3H9W A;  4HP4 A;  2PYR A;  1V9Y A;  1G28 A;  2VLG A;  3K3D A;  3PHY A;  1OTA A;  2PR5 A;  2R78 A;  2JN7 A;  2CMN A;  4R6L A;  4MN6 A;  2PD7 A;  3MQO A;  3UME A;  3CWF A;  4BBV A;  3K3C A;  1S1Y A;  2D02 A;  2PYP A;  3H7W A;  1TS0 A;  4E04 A;  4LRY C;  3T50 A;  1P0Z A;  3LI8 A;  4RQ9 A;  2VV6 A;  2Z6C A;  3NHQ A;  2L4R A;  3C2W A;  4EEU A;  4K08 A;  4I5S A;  1XJ3 A;  4EXO A;  1OTB A;  3NOT C;  5J4E A;  4HI4 A;  3LID A;  2PHY A;  2YKF A;  1N9L A;  4LPZ A;  3HJI A;  3UB7 A;  1OT6 A;  5HWT A;  2PR6 A;  3E4Q A;  4I3J A;  3B33 A;  4YWZ A;  5DJT A;  2A24 A;  5DJU A;  1F9I A;  2W0N A;  3CAX A;  1N9O A;  4DJ3 A;  4F3L B;  4I39 A;  2OWH A;  1T1C A;  1LSW A;  3MXQ A;  3IS2 A;  1S4R A;  1T1B A;  4HP9 A;  2Z6D A;  2HV1 A;  3MJQ A;  2A24 B;  4HH3 A;  3LIB A;  1VB6 A;  2OWJ A;  1WA9 A;  3MR0 A;  1S1Z A;  3EWK A;  1LSX A;  5HDD A;  3MQQ A;  5HZH A;  4L9F A;  3A0V A;  1UWN X;  3E4O A;  4DJ2 A;  5HSQ A;  1Y28 A;  3IBR A;  4NXB A;  1EW0 A;  4WF0 A;  5J7E A;  2WKP A;  3LIA A;  2J80 A;  2WKQ A;  2B02 A;  4HNB A;  5F69 A;  2ZOH A;  3VOL A;  1P97 A;  1OT9 A;  2M1C A;  4WUJ A;  4EES A;  3LI9 A;  3VE3 A;  1T18 A;  5HWV A;  1S4S A;  4JGP A;  3CLO A;  2H28 A;  2QWS A;  3UMD A;  2OOL A;  1D7E A;  4MN5 A;  1V9Z A;  4LLO B;  5IS1 A;  3UE6 A;  2VV8 A;  3C8C A;  1TS7 A;  3F1O B;  4F3L A;  4M4X A;  1OTD A;  4EET B;  2P7J A;  2QJ5 A;  4HJ3 A;  2BAS A;  4GS9 A;  4KUK A;  2VEA A;  2QKP A;  1S67 L;  5HDC A;  1LSV A;  2PDR A;  3RH8 B;  5AVE A;  5J3W A;  3LIF A;  3VE4 A;  4KQD A;  2W27 A;  3RTY A;  4WL9 A;  4GHI A;  5G4Y A;  4JGO A;  4GS9 B;  1DP9 A;  4BBU A;  4HJ6 A;  4R38 A;  1S66 L;  4R70 A;  4GCZ A;  2V0W A;  4R3A A;  4EEP A;  2L1M A;  5HD5 A;  2D01 A;  5KIZ A;  4GHI B;  4HOI A;  1UGU A;  2INW A;  1TS6 A;  1T1A A;  1OTE A;  4EQ1 A;  4JGQ A;  4LRX C;  4XT2 A;  2QHK A;  5DKL A;  1XFN A;  4NXE A;  3UB8 A;  2JHE A; 
#chains in the Genus database with same CATH topology
 1OPX A;  2ZQ8 A;  1NY0 A;  2J3T D;  5AQB A;  1XA1 A;  5AVF A;  3SZT A;  2ZC7 A;  1SCW A;  1K4E A;  2VJW A;  2Y2P A;  4GD8 A;  5M1A A;  5F68 A;  2J9O A;  3ICY A;  5FQQ A;  3MQ0 A;  4LCL A;  2VGL M;  4HIA A;  5M19 A;  5FI2 A;  5F1F A;  4HEF A;  3ZQ5 A;  2ZQ7 A;  3UB6 A;  1LT0 A;  1H8Z A;  3VP4 A;  3ZHH A;  4NXF A;  3NJA A;  4WLA A;  3IH9 A;  2WUQ A;  3VP0 A;  4GOG A;  4LRZ E;  2QMI A;  4GB7 A;  4NET A;  4B93 A;  3PXP A;  4RA7 A;  4UQI M;  4DXC A;  5J8X A;  4YOF A;  3S1Y A;  3H82 A;  3N6I A;  1UWP X;  2V1Z A;  3T4K A;  4N92 A;  4IBX A;  1FIL A;  2ZL1 A;  3FG8 A;  3GRJ A;  4MBH A;  4O7D A;  1BUE A;  1SDE A;  1NLZ A;  5FAT A;  4MLL A;  4MBF A;  1FR6 A;  3OPL A;  4DF6 A;  3NC8 A;  4KG2 A;  1PYY A;  1VET A;  2BG1 A;  1K54 C;  4PKY A;  3C38 A;  3JVV A;  1GA0 A;  4GZB A;  4PKY G;  1IFQ A;  4NK3 A;  3G32 A;  4GW9 A;  3VFF A;  4S2L A;  3IXB A;  1IOU A;  5GHZ A;  4HJ4 A;  3BJN A;  4O0P A;  2K2N A;  1X0O A;  4BL2 A;  1KE4 A;  4LCM A;  2X01 A;  4FTX A;  3JPU A;  4E3K A;  5CGW A;  4H6J B;  2ZC4 B;  2GDN A;  5IHV A;  3T1X A;  2AVX A;  4JXV A;  3N7W A;  3K2N A;  2HDR A;  4DE1 A;  5GLD A;  1KGF A;  1XFQ A;  4P6B A;  2VZW A;  2P9V B;  2ZJ9 A;  3FV7 A;  1H8M A;  3WS1 A;  4S2I A;  5FQM A;  3BY8 A;  1FSW A;  1NWZ A;  4P87 A;  3ULF A;  4I38 A;  1ZHH B;  3BY9 A;  3IH8 A;  1Z6F A;  1H3Q A;  1E4D A;  3T4S A;  4EBP A;  1IEM A;  3VSK A;  2PRF A;  3TSG A;  5EM0 A;  3PBN A;  3PR6 A;  2RCX A;  5KMW A;  3KYE A;  4H8R A;  4Q0I A;  4HP4 A;  4U3T A;  4KZ6 A;  3RXW A;  3KO6 A;  1IKI A;  2VLG A;  3PHY A;  3UE0 A;  1OTA A;  3TE8 A;  3NUL A;  5EV0 A;  4B4Z A;  4KG6 A;  3W4Q A;  2PD7 A;  4MN6 A;  4UA7 A;  2EFU A;  3CWF A;  3NDE A;  4BBV A;  1S1Y A;  3H7W A;  4PPR A;  1ERQ A;  3W4P A;  3DBA A;  2M7U A;  4WEJ A;  3CI6 A;  1CF0 A;  5A91 A;  1OTB A;  4XXR A;  4Z1W A;  1KGE A;  2P08 A;  2PBY A;  5GHY A;  1VQQ A;  4X6T A;  2JKR I;  3HLC A;  1ZG4 A;  4I3J A;  2Y91 A;  3GV9 A;  1CI8 A;  1SZV A;  1DY6 A;  4Y3I A;  2XD5 A;  4DKI A;  1F9I A;  2OLV A;  1O07 A;  4F3L B;  4I39 A;  3OPH A;  1TEM A;  3MXQ A;  2XSS A;  1S4R A;  3IHB A;  2HV1 A;  3ZG5 A;  3B42 A;  3OZH A;  1HZO A;  4K91 A;  5GL9 A;  4KZA A;  4S2M A;  1F5M A;  3HLD A;  4X55 A;  2DCF A;  2OWJ A;  1ES5 A;  2JE5 A;  4E3I A;  3MSH A;  1DJA A;  1KDS A;  3WS4 A;  3EWK A;  3T1Q B;  4S2N C;  1VEU A;  3IXH A;  4UHU A;  1J3W A;  1K4F A;  3UN7 A;  4FCF A;  2OLU A;  4OOY A;  1Q2Q A;  3PBO A;  5FDH A;  1UWN X;  4DE2 A;  3G35 A;  5HSQ A;  4DJ2 A;  3BRM A;  4DMZ A;  4NXB A;  3BLM A;  1CEF A;  1FIK A;  2W3H A;  2WKP A;  5FQK A;  3A3F A;  1MC0 A;  2WKQ A;  4QY5 A;  3CPT A;  3IF5 A;  5EVE A;  5F69 A;  1BUL A;  4Y13 A;  3RXX A;  2M1C A;  3UPP A;  3CJM A;  5HFO A;  3C7U A;  5DF8 A;  3VE3 A;  1T18 A;  3ZG8 B;  3IHA A;  1RP5 A;  1L0G A;  4C75 A;  2E8I A;  1Y4O A;  2WKH A;  3N8L A;  4OQ0 A;  1YAX A;  4JF6 A;  2HJ9 C;  4MN5 A;  4LLO B;  1V9Z A;  4FH2 A;  2VGL S;  3UE6 A;  5EVI B;  3P98 A;  3C8C A;  1CEG A;  1ONG A;  3V5M A;  4KZB A;  4EET B;  1W8Y A;  1MWT A;  1JWZ A;  5F1G A;  4BMW A;  1ONH A;  2WAE A;  2BAS A;  2XDM A;  3M6H A;  3LR0 A;  3LY4 A;  2QKP A;  4EWF A;  3EGD C;  2HPB A;  2X02 A;  4R3J A;  1WE4 A;  3SH9 A;  5AVE A;  5J3W A;  4UQI S;  5DFY A;  3VE4 A;  1VET B;  3DAV A;  4GS9 B;  1YSP A;  4HJ6 A;  2EWW A;  2W3F A;  1K6R A;  3R7W A;  1S66 L;  2FH5 A;  2WKI A;  3AGE A;  2JKG A;  1M6K A;  3QP8 A;  2V0W A;  2FFF B;  3L7H A;  3MZF A;  1YLZ A;  4KQQ A;  2D01 A;  3N8S A;  3QP2 A;  4N9K A;  1IKG A;  1YLY A;  3FKW A;  5BOH A;  1H0M A;  3PTE A;  4N9L A;  3VP1 A;  4EQ1 A;  3P01 A;  3Q7V A;  1A0K A;  4C3Q A;  4G3W A;  1YLJ A;  3UB8 A;  3L9K A;  1XA7 A;  3GQZ A;  3IT9 A;  2JHE A;  4D60 A;  2PD8 A;  3LO7 A;  2FZ0 A;  1ZC2 A;  4BBT A;  5D3O A;  4I3I A;  3E4P A;  4XT2 B;  4HH2 A;  2P74 A;  4L9E A;  2GNX A;  3NBL A;  3EGX C;  3KSI A;  3F1P A;  2CC1 A;  4GN2 A;  2EA9 A;  5FA7 A;  3LIC A;  4BLM A;  1MKM A;  2IWC A;  4DRT A;  2PBD P;  3G2Z A;  4IJG A;  1EWZ A;  3Q82 A;  1I2W A;  1TVF A;  1GSX A;  4KZ4 A;  2G7U A;  5EEC A;  4O01 A;  1NZO A;  1ZG6 A;  5L10 A;  4JPM A;  4MBK A;  2EXB A;  4EER A;  2XK1 A;  2V1B A;  4U0X A;  3MZE A;  3TG9 A;  4YNR A;  2GJ3 A;  4KUO A;  1ODV A;  2HF6 A;  4P6Z M;  3ZDJ A;  2KLI A;  5FAP A;  2EFX A;  1BLS A;  2QJ7 A;  4YFM A;  1XP4 A;  3QP6 A;  1XX2 A;  3PBQ A;  1NXY A;  2WKR A;  1AWI A;  3H7W B;  3CMZ A;  3R4K A;  2IA2 A;  2V1A A;  4B9O A;  4BL3 A;  5AQ9 A;  2ZM8 A;  3UB9 A;  3PBR A;  3A3D A;  1XJ6 A;  4OQI A;  1FSY A;  2QYB A;  5CGX A;  1XXM A;  3OPR A;  4OPR A;  4P85 A;  4HES A;  3F1N A;  5CEC A;  3FC7 A;  1KDW A;  3E2L A;  1DP8 A;  3KSF A;  5EVI C;  4CJN A;  1YMX A;  4QPR A;  4EW7 A;  4HY8 A;  3LUQ A;  3HJK A;  2Y79 A;  3D72 A;  3TOI A;  4M3K A;  4ZJ3 A;  5EUA A;  4R1G A;  1GHM A;  3ZNY A;  5E2G A;  2WZZ A;  2H10 A;  2V9A A;  3GR2 A;  4IUH A;  5HAQ A;  2ZC3 B;  1K25 A;  3UDF A;  3ITB A;  1PZO A;  1FCN A;  4R4S A;  1C3B A;  5FSR A;  3MFX A;  3A3J A;  2Z2M B;  2BTF P;  1BLP A;  2WGW B;  3V67 A;  4HQA A;  3UY6 A;  5CRF A;  3MMH A;  2V8C A;  1ES2 A;  1G6O A;  2ZQD A;  3H9W A;  2W1T B;  3BYD A;  1VEU B;  4KG5 A;  4Y15 A;  2O9C A;  3IQA A;  4OQH A;  1G28 A;  3K3D A;  4LV0 A;  3T4O A;  4A5R A;  2XFS A;  2PR5 A;  2R78 A;  3M2J A;  2JN7 A;  4CLC C;  3G31 A;  5FEG A;  4R6L A;  5CGS A;  2K31 A;  5HAR A;  1XGJ A;  3IF6 A;  4Y0T A;  2D02 A;  1DJB A;  3BM6 A;  3CPT B;  3NY4 A;  3T50 A;  1FCM A;  2W3E A;  4RQ9 A;  3OCL A;  1PNE A;  2Z6C A;  2L4R A;  2XF3 A;  3CUE C;  2Y4A A;  4EXO A;  4MN7 A;  3NOT C;  1TD5 A;  3LID A;  4HI4 A;  2V8F A;  2JKR M;  3QP1 A;  1LL9 A;  3ZG0 A;  2XLN A;  2YKF A;  5I94 A;  3HUM A;  1N9L A;  4CLC E;  3UB7 A;  4R23 A;  2PR6 A;  3V3S A;  3B33 A;  2JKF A;  1D1J A;  1G6A A;  5DJT A;  1QMF A;  2LB9 A;  2A24 A;  3PAE A;  3E98 A;  4QWO A;  3QP5 A;  4ZAM A;  1N9O A;  3OOV A;  1PFL A;  1T1C A;  4E6X A;  4Z9Q A;  2XGN A;  2A2L A;  4ZDX A;  2Y2M A;  4ARZ A;  3IS2 A;  3IWQ A;  3M2K A;  1W63 Q;  4HP9 A;  2XR0 A;  1H8Y A;  3MKE A;  3MJQ A;  4UAA A;  5DTT A;  3MZD A;  1O7E A;  1YPR A;  3LEZ A;  3NDG A;  4OKP A;  3AGF A;  1GHP A;  1KVL A;  1EI5 A;  1K55 A;  1WA9 A;  2IWD A;  3MR0 A;  2QPN A;  3DWK A;  1K54 A;  2DNS A;  5DF7 A;  4Q0J A;  4IVI A;  4DE3 A;  3C5A A;  5HDD A;  4OPY A;  4GDN A;  3NCK A;  3MQQ A;  4X56 A;  4OVD A;  2LB5 A;  1W63 M;  4IED A;  4JF4 A;  3T4L A;  3OPP A;  3BLS A;  5AJG A;  2GX5 A;  3IWO A;  3BEB A;  3G4P A;  1L0D A;  5L8M A;  4WM9 A;  3D4F A;  2Y2L A;  2MJ6 A;  1XPB A;  3S7O A;  2WAF A;  2Y2I A;  4NG2 A;  1LL5 A;  4CQH A;  4HNB A;  4DN0 A;  2ZOH A;  3CHW P;  3VOL A;  2HP5 A;  1MXO A;  1OT9 A;  1RGY A;  1QME A;  4GKU A;  4EES A;  3FKV A;  3B3X A;  2QZ6 A;  3HLF A;  1PW8 A;  3NEC A;  4NEE D;  3S22 A;  1RGZ A;  1D7E A;  4DE0 A;  1PI4 A;  5E2F A;  3VOZ A;  4WZ5 C;  2RL3 A;  3BFE A;  5FI6 A;  4E3L A;  1SKO B;  1TS7 A;  2VKS A;  5CHM A;  5G18 A;  3ITA A;  4P0M A;  2B95 A;  4HJ3 A;  3HLW A;  2OV5 A;  2J3T C;  3PAG A;  4KUK A;  3O87 A;  3SS3 A;  2XA7 M;  1LSV A;  3BW6 A;  1FR1 A;  5M18 A;  1I5Q A;  1FQG A;  2PDR A;  3RH8 B;  3D9Y A;  3LIF A;  3E0Y A;  2W27 A;  3QNB A;  3FZC A;  4Y7P A;  4EU0 A;  4WL9 A;  4GHI A;  4IVK A;  4JGO A;  2XEP A;  4QHC A;  4WEK A;  4R38 A;  3PBT A;  5FDS A;  3RJU A;  4X25 A;  2J9P A;  3HL9 A;  3LY3 A;  3WS0 A;  5A90 A;  3SH7 A;  3KYZ A;  2L1M A;  2HDQ A;  1ERM A;  3ZG9 B;  4UEY A;  3O88 A;  4P6Z S;  2Y2H A;  4WZ4 A;  3T12 B;  5E43 A;  2QHK A;  4GJ4 A;  1XFN A;  3ISG A;  3VMA A;  3DWZ A;  3OC2 A;  4FUW A;  4OP8 A;  4Y2F A;  2H0Y A;  4ETZ A;  3QP4 A;  1TDL A;  3PYP A;  1YMS A;  4G3V A;  1TS8 A;  2WGI A;  4RX3 A;  5JYP A;  2VV7 A;  1BYW A;  5HDS A;  2KX6 A;  5E2H A;  5EFW A;  3BFC A;  4JXW A;  4JXS A;  2IWB A;  5E2E A;  5GLA A;  5L09 A;  3C4O A;  3SW1 A;  1YLP A;  2Y8H A;  2C6W B;  3N8R A;  4MMN A;  2EX9 A;  1W7F A;  1CK3 A;  3IBJ A;  1Y54 A;  5FQI A;  1TF1 A;  5HL6 A;  2HJE A;  2H5S A;  1PWC A;  3SOI A;  1N9N A;  3DTK A;  3VP3 A;  3N4I A;  3UO9 A;  3UE1 A;  5IT5 A;  5HD3 A;  1DP6 A;  1MZU A;  1NZU A;  1OTI A;  1F98 A;  2HP9 A;  1K57 C;  4X69 A;  1YT4 A;  1ACF A;  1XJ4 A;  3VOY A;  3O86 A;  5GLC A;  1GSW A;  2WGV A;  1PIO A;  2R9W A;  3BWL A;  4S2N A;  3H82 B;  1DRM A;  4GLQ A;  4KZ5 A;  2BLS A;  4EBN A;  5A8B A;  2ZL1 B;  4FH4 A;  1OJG A;  1PWG A;  5DTK A;  5DTS A;  4RYE A;  3IF6 B;  4MNR A;  3OBF A;  1H5X A;  1BZA A;  2OAP 1;  4HHD A;  4H6J A;  2KDK A;  3I7J A;  3LIE A;  4JKT A;  2I9V A;  4E3J A;  4K0X A;  5GHX A;  4IUK A;  1IYO A;  3T4T A;  2EX6 A;  5IU1 A;  3KX0 X;  1F2K A;  2JBF A;  1E3U D;  5EOE A;  4O8G A;  1YSQ A;  1MY8 A;  3S7N A;  1L3L A;  2B18 A;  4QJG A;  2G2U A;  2YKH A;  1VHM A;  2P04 A;  4PM7 A;  1JNU A;  3MXR A;  1XKZ A;  1ES4 A;  2J3W A;  4WBG A;  1T19 A;  4CLC D;  2W1R A;  1GSV A;  3EOI A;  4LV2 A;  2ZM2 A;  4EQI A;  4PM6 A;  5F6A A;  5HAI A;  1LHY A;  4E3N A;  3WS2 A;  5TGF A;  4N1H A;  3IS2 B;  2XQZ A;  3KSG A;  3HLG A;  3G6O A;  5LBR A;  4B4X A;  1LL8 A;  1MBL A;  3BFF A;  4KQO A;  5L2F A;  3ZG7 B;  4EUZ A;  2XRO A;  3OLO A;  1L2S A;  3W4O A;  2Q0O A;  5CXW A;  4QD4 A;  5FI7 A;  5FEF A;  1D06 A;  3KYQ A;  3LYX A;  5TBM A;  3T1R A;  1CJF A;  1P9R A;  5KSC A;  3EQV A;  2WAD A;  5HAP A;  1JWV A;  1V9Y A;  3WWX A;  3V3R A;  3EEA A;  3BEC A;  4X68 A;  1KE3 A;  2J8Y A;  3UPO A;  2ZMF A;  2W3D A;  4K0W A;  3WS5 A;  4E3O A;  4ZBE A;  5F83 A;  3NIA A;  4E3M A;  4DXB A;  3UME A;  2KOI A;  2PYP A;  3HBR A;  1TS0 A;  3OCN A;  1STZ A;  4E04 A;  2OAQ 1;  1P0Z A;  5CTN A;  2Q9M A;  4DDY A;  3C2W A;  5DFX A;  4EEU A;  3ZVW A;  4I5S A;  1XJ3 A;  5DF9 A;  5J4E A;  3Q81 A;  1VM1 A;  2PHY A;  2EX2 A;  4ID4 A;  4FOF A;  4XUZ A;  4OON A;  3LFV A;  2ZC5 B;  1IYP A;  4R3B A;  5K5B A;  1J9M A;  2VA0 A;  2JCH A;  4DJ3 A;  2OWH A;  1LSW A;  3G30 A;  2O99 A;  2Y2O A;  4WMC D;  1GHI A;  1T1B A;  1JTD A;  2ZQA A;  2VK3 A;  3T4Q A;  3JYI A;  2R9X A;  4KEN B;  3HLE A;  1JTG A;  2G2W A;  3O3V A;  4MDZ A;  1PI5 A;  3TJZ C;  4JBF A;  3BFG A;  2XA7 S;  2V2F F;  3IF6 C;  4FSF A;  2DMW A;  1S6R A;  3ZVT A;  1LI0 A;  3U4L P;  5FAQ A;  1KVM A;  4OPZ A;  5EM1 A;  4KZ8 A;  5FAO A;  5HZH A;  3CG5 A;  1ALQ A;  3C4P A;  2ZMA A;  3A0V A;  5A92 A;  3FWL A;  1Z09 A;  4IHQ A;  5CX7 A;  3UE3 A;  3W2Z A;  1MWU A;  5TFQ A;  3UB5 P;  3LIA A;  1K56 D;  2VGJ A;  2JKT I;  5KZH A;  2VGK A;  4WUJ A;  3HRE A;  2HGV A;  5AQ7 A;  5EVI A;  2UV0 E;  3LGO A;  1S4S A;  4JGP A;  2QWS A;  3V50 A;  2Y2G A;  4OLG A;  3Q07 A;  4PM8 A;  4DDS A;  3AGD A;  2OOL A;  5TR7 A;  5IS1 A;  3IX4 A;  2NUP C;  4II7 A;  1SKF A;  1S0W A;  3S7Q A;  2VV8 A;  1MPL A;  2WKE A;  5CEB A;  2XRN A;  1K55 C;  5CHJ A;  4YIN A;  4M4X A;  3O5Y A;  1OTD A;  3HLB A;  3KSH A;  1BLC A;  4GS9 A;  3Q1F A;  2VEA A;  2Y2Q A;  3BQA A;  3HCY A;  1JWP A;  5EOO A;  1S67 L;  1IEL A;  3UDX A;  5FQ9 A;  4IBR A;  1ZKJ A;  4OH0 A;  3IWI A;  1E3U A;  4PAU A;  4OQG A;  4HBU A;  5HL1 A;  1U60 A;  4KZ9 A;  1DP9 A;  1PRQ A;  1NRF A;  3PBS A;  4OOM A;  4BBU A;  2O0Y A;  4R70 A;  3CZD A;  4GCZ A;  3VP2 A;  4R3A A;  4F94 A;  4ME4 A;  4PM5 A;  4CLC A;  3MXS A;  3TW8 A;  4BWI A;  5KIZ A;  5KSH A;  1W8Q A;  1UGU A;  1OTE A;  4JGQ A;  3R7W B;  4XT2 A;  4S2O A;  4NXE A;  3V39 A;  2E8J A;  4WYY A;  2WYX A;  4OP5 A;  1L0F A;  3CUE A;  5EPH A;  1K38 A;  3MBZ A;  3JVU A;  2C5W B;  3P09 A;  4EBL A;  4S2K A;  1YLW A;  3Q7V B;  2H0T A;  1P9W A;  5DKK A;  3A0R A;  2EWV A;  3GVB A;  1LLB A;  2UWX A;  4BQM A;  3E2K A;  1PW1 A;  5I5L A;  1E25 A;  2ZD8 A;  3EEH A;  5TJJ A;  5F5Y A;  1XJ2 A;  3F1O A;  1CQA A;  3F1P B;  5JYO A;  2PT7 A;  3HUN A;  2FFY A;  3LEQ A;  3QHY A;  3GTC A;  3ZFZ A;  3DTE A;  5TBM B;  5HWW A;  4EV4 A;  3U2A A;  2PAV P;  1SDN A;  1YKD A;  1BSG A;  3S7P A;  3P7N A;  3LR5 A;  4GNU A;  1KOU A;  2M7V A;  4MCW A;  3C7V A;  2J7V A;  2PU2 A;  3NOP C;  1OJ5 A;  4BD0 A;  3SH8 A;  4JF5 A;  4BD1 A;  1KE0 A;  1NJ4 A;  4BJP A;  4WN5 A;  4JGR A;  1Q2P A;  2XD1 A;  4NXG A;  4I3A A;  4QU3 A;  3GDI A;  2WZX A;  1HD8 A;  3MF0 A;  4R4R A;  4L0L A;  3LCE A;  3IXD A;  1I2S A;  2K7S A;  1MWR A;  4AFI A;  4WMC A;  3VV4 A;  4LV3 A;  4WEL A;  2ZQC A;  3IXG A;  5HW3 A;  1JVJ A;  1NYM A;  2A49 A;  3NOU C;  4Y0O A;  3G34 A;  4LEN A;  4KQR A;  3A3I A;  2EX8 A;  1YQS A;  3MKF A;  2L0W A;  4XUX A;  1BT5 A;  5DVA A;  3GEC A;  2ZOI A;  1YLT A;  2W3G A;  3DTI A;  4ZRR A;  3BFD A;  3F1N B;  3A0S A;  4ETX A;  4WZ5 A;  1TDG A;  4R0Q A;  3SS5 A;  1G68 A;  4OPQ A;  2ZBB A;  2ZQ9 A;  1NRJ A;  2WGW A;  4JLF A;  4S2P A;  2Y55 A;  4PM9 A;  1KGG A;  3FYZ A;  5CHU A;  4MEZ A;  2W1T A;  3QNC A;  4LFU A;  4L9G A;  1PWD A;  4OOL A;  4D2O A;  2Y59 A;  5G4Z A;  4ZJ1 A;  4GDB A;  3HUO A;  5EVL A;  1K56 A;  3M6B A;  2XH9 A;  2V0U A;  2EXA A;  2ZC6 B;  2PYR A;  2HDS A;  5HX9 A;  2O9B A;  5EVI D;  1L0E A;  4BEN A;  4GD6 A;  4EUV A;  1OME A;  2A3U A;  2CMN A;  3MQO A;  1GA9 A;  5AQA A;  5U47 A;  3K3C A;  1ESU A;  4LRY C;  1MKI A;  3LI8 A;  1BTL A;  2VX8 A;  2VV6 A;  4Y5F A;  3NHQ A;  1FCO A;  3ZNT A;  4K08 A;  1M40 A;  4E6W A;  3DTM A;  2ZLY A;  1RCJ A;  5CED A;  4LPZ A;  3HJI A;  1OT6 A;  5HWT A;  4U0T A;  3MFD A;  3E4Q A;  4NKP A;  4PHT A;  3WRZ A;  4YWZ A;  5F82 A;  3MS6 A;  1WYC A;  3D3O A;  4QY6 A;  5DJU A;  2W0N A;  3IX3 A;  3CAX A;  3ZGA B;  2P9V A;  3FPW A;  3HVF A;  3UDI A;  5FL3 A;  3IX8 A;  1XGI A;  5HPF A;  3GMW A;  4X1L A;  4Y17 A;  2Z6D A;  1CI9 A;  5MC7 A;  2A24 B;  1K6S A;  4HH3 A;  4S2J A;  3A3E A;  3Q7Z A;  2PU4 A;  3LIB A;  1VB6 A;  4UA9 A;  1ERO A;  1K57 A;  1YM1 A;  2HP6 A;  5L07 A;  1N9B A;  2WK0 A;  3UNW A;  4ARZ B;  3FPV A;  4X1M A;  1IYS A;  3LR3 A;  4PMA A;  1S1Z A;  3NI9 A;  1LSX A;  1G5U A;  1N4O A;  4ZTK A;  4ZJ2 A;  3ZCZ A;  4CLC B;  4HBT A;  5FQJ A;  4L9F A;  4Y0U A;  2Y2N A;  1ES3 A;  4LV1 A;  4QB8 A;  2X71 A;  2HDU A;  3C30 A;  3E4O A;  2JKT M;  1Y28 A;  3IBR A;  5GLB A;  4LGW A;  2Q9N A;  1EW0 A;  4WF0 A;  4RVA A;  4UA6 A;  5J7E A;  2ZMV A;  2J80 A;  3VFH A;  1K0K A;  3B47 A;  2B02 A;  4N1X A;  2NUT C;  3T1S A;  3GSG A;  3UPN A;  1P97 A;  3W8K A;  4Q8I A;  2OSU A;  4B88 A;  5FAS A;  1W79 A;  1MWS A;  1ZTU A;  3LI9 A;  1SKO A;  2I72 A;  2ZM0 A;  4CPK A;  5HWV A;  1ESI A;  2Z2L B;  2Y2J A;  3CLO A;  2H28 A;  3UMD A;  3RFB A;  4KZ7 A;  4ESP A;  2JC7 A;  4FD8 A;  1IYQ A;  4X53 A;  4RX2 A;  3VSL A;  2ACG A;  3F1O B;  4F3L A;  1BLH A;  2P7J A;  2QJ5 A;  3EQU A;  1FOF A;  4G3K A;  2B5R A;  4C6Y A;  1HTZ A;  1GCE A;  2Y2K A;  5HPI A;  5EE8 A;  1PZP A;  1AXB A;  5HDC A;  5C5K A;  4KZ3 A;  2V20 A;  4KQD A;  1LI9 A;  2GZA A;  3SS4 A;  3RTY A;  5G4Y A;  1W5D A;  1NLY A;  3WRT A;  5CER A;  1DJC A;  2HZ5 A;  1SHV A;  3T4J A;  3CIT A;  3TRC A;  4JXG A;  3G2Y A;  3DW0 A;  3S4X A;  4EEP A;  5HD5 A;  4GHI B;  4HOI A;  2INW A;  5CTM A;  1TS6 A;  4Q0H A;  2XFT A;  1T1A A;  4LRX C;  3BQ8 A;  5DKL A;  2O9A A;  1HLU P;  4OLD A;  2DRW A;  1HVB A;  3LR4 A;  3ZYT A;  5A93 A;  1WYB A;  1NYY A; 
#chains in the Genus database with same CATH homology
 2PD8 A;  1OPX A;  2FZ0 A;  2J3T D;  5AVF A;  3JVU A;  4BBT A;  2VJW A;  4I3I A;  3E4P A;  3PYP A;  4XT2 B;  4G3V A;  4HH2 A;  5F68 A;  1TS8 A;  4L9E A;  3ICY A;  2GNX A;  2VV7 A;  1P9W A;  3MQ0 A;  1BYW A;  3EGX C;  5DKK A;  3KSI A;  5HDS A;  2VGL M;  4HIA A;  2KX6 A;  3A0R A;  5EFW A;  2EWV A;  3F1P A;  3ZQ5 A;  2EA9 A;  1LT0 A;  3UB6 A;  3SW1 A;  4NXF A;  2Y8H A;  3LIC A;  5I5L A;  4MMN A;  1MKM A;  3EEH A;  5TJJ A;  5F5Y A;  3NJA A;  4WLA A;  3IBJ A;  4IJG A;  1TF1 A;  5HL6 A;  2HJE A;  1XJ2 A;  3F1O A;  1N9N A;  4LRZ E;  4B93 A;  3PXP A;  5IT5 A;  5HD3 A;  3F1P B;  1GSX A;  2PT7 A;  4UQI M;  1DP6 A;  4YOF A;  3H82 A;  1UWP X;  2G7U A;  3T4K A;  1MZU A;  1OTI A;  4O01 A;  1F98 A;  3FG8 A;  5TBM B;  5HWW A;  3U2A A;  1XJ4 A;  1YKD A;  1NLZ A;  3S7P A;  3P7N A;  1GSW A;  3LR5 A;  4EER A;  1KOU A;  2M7V A;  4MCW A;  2V1B A;  3BWL A;  4YNR A;  3H82 B;  1DRM A;  2GJ3 A;  3NOP C;  4GLQ A;  4KUO A;  1OJ5 A;  1ODV A;  4PKY A;  5A8B A;  2HF6 A;  1OJG A;  4P6Z M;  3C38 A;  2KLI A;  3JVV A;  2QJ7 A;  4BJP A;  4PKY G;  1IFQ A;  4WN5 A;  4JGR A;  4GW9 A;  4NXG A;  3PBQ A;  2WKR A;  3OBF A;  4I3A A;  3H7W B;  3GDI A;  2OAP 1;  1IOU A;  4HHD A;  4H6J A;  2KDK A;  3LIE A;  2I9V A;  3MF0 A;  3R4K A;  2IA2 A;  2V1A A;  4HJ4 A;  4B9O A;  4L0L A;  4IUK A;  3BJN A;  2K7S A;  4O0P A;  2K2N A;  5IU1 A;  3T4T A;  3KX0 X;  3UB9 A;  3PBR A;  1X0O A;  1XJ6 A;  4AFI A;  3VV4 A;  4O8G A;  2QYB A;  1YSQ A;  4WEL A;  3F1N A;  3S7N A;  3NOU C;  2B18 A;  3FC7 A;  2YKH A;  1VHM A;  1DP8 A;  3KSF A;  4H6J B;  2P04 A;  4QPR A;  1JNU A;  4EW7 A;  2L0W A;  4HY8 A;  3LUQ A;  2J3W A;  3HJK A;  1T19 A;  4CLC D;  2Y79 A;  3GEC A;  2ZOI A;  3D72 A;  3K2N A;  2W1R A;  2W3G A;  1GSV A;  3EOI A;  4ZRR A;  1XFQ A;  2V9A A;  3F1N B;  2VZW A;  3A0S A;  4ETX A;  4IUH A;  5F6A A;  1H8M A;  3BY8 A;  2ZBB A;  1NRJ A;  3IS2 B;  3KSG A;  5LBR A;  3G6O A;  1LL8 A;  1NWZ A;  3ULF A;  4KQO A;  4I38 A;  1ZHH B;  3BY9 A;  2W1T A;  2XRO A;  1H3Q A;  3OLO A;  3T4S A;  4L9G A;  3MFX A;  4OOL A;  5G4Z A;  3V67 A;  3PBN A;  4HQA A;  3PR6 A;  1D06 A;  3KYQ A;  3LYX A;  5TBM A;  3MMH A;  1P9R A;  3EQV A;  2V0U A;  1G6O A;  4Q0I A;  3H9W A;  4HP4 A;  2PYR A;  2W1T B;  2O9B A;  2O9C A;  4ETZ A;  1V9Y A;  3EEA A;  3KO6 A;  1G28 A;  2VLG A;  3K3D A;  3PHY A;  3T4O A;  1OTA A;  2ZMF A;  2W3D A;  3TE8 A;  2PR5 A;  2R78 A;  2JN7 A;  4CLC C;  4EUV A;  2CMN A;  4R6L A;  2PD7 A;  3MQO A;  4MN6 A;  2K31 A;  3UME A;  2KOI A;  3CWF A;  4BBV A;  3K3C A;  1S1Y A;  2D02 A;  2PYP A;  3H7W A;  1TS0 A;  3OCN A;  1STZ A;  4E04 A;  4LRY C;  2OAQ 1;  3T50 A;  1P0Z A;  2W3E A;  3DBA A;  2M7U A;  4WEJ A;  3LI8 A;  4RQ9 A;  2VX8 A;  2VV6 A;  3CI6 A;  4Y5F A;  3OCL A;  2Z6C A;  3NHQ A;  2L4R A;  3C2W A;  5DFX A;  3CUE C;  4EEU A;  4K08 A;  4I5S A;  1XJ3 A;  5DF9 A;  1OTB A;  4EXO A;  4MN7 A;  3NOT C;  5J4E A;  1TD5 A;  3LID A;  4HI4 A;  4Z1W A;  2PHY A;  2JKR M;  4FOF A;  2P08 A;  2YKF A;  1N9L A;  4LPZ A;  3HJI A;  4CLC E;  2JKR I;  1OT6 A;  3UB7 A;  5HWT A;  2PR6 A;  3LFV A;  4NKP A;  3E4Q A;  4I3J A;  3B33 A;  4PHT A;  4YWZ A;  5K5B A;  2VA0 A;  5DJT A;  2LB9 A;  2A24 A;  4Y3I A;  3D3O A;  3E98 A;  5DJU A;  1F9I A;  2W0N A;  3CAX A;  1N9O A;  4DJ3 A;  4F3L B;  4I39 A;  3OOV A;  2OWH A;  1T1C A;  2A2L A;  1LSW A;  3FPW A;  2O99 A;  5FL3 A;  3MXQ A;  4ARZ A;  2XSS A;  1S4R A;  3IS2 A;  1T1B A;  5HPF A;  1W63 Q;  4HP9 A;  2Z6D A;  2HV1 A;  3MJQ A;  3T4Q A;  3B42 A;  5MC7 A;  2A24 B;  4HH3 A;  3LIB A;  1VB6 A;  4MDZ A;  1F5M A;  3TJZ C;  2OWJ A;  4ARZ B;  1WA9 A;  3FPV A;  2XA7 S;  3MR0 A;  3LR3 A;  4FSF A;  2DMW A;  1S1Z A;  3EWK A;  4Q0J A;  1LSX A;  5HDD A;  3MQQ A;  4CLC B;  2LB5 A;  1W63 M;  3T4L A;  5AJG A;  5HZH A;  4L9F A;  2GX5 A;  3PBO A;  3A0V A;  5L8M A;  4IHQ A;  2MJ6 A;  1UWN X;  3S7O A;  5CX7 A;  3UE3 A;  3W2Z A;  3C30 A;  3E4O A;  4DJ2 A;  5HSQ A;  4DMZ A;  2JKT M;  1Y28 A;  3IBR A;  4NXB A;  1EW0 A;  4WF0 A;  5J7E A;  3LIA A;  2W3H A;  2WKP A;  2J80 A;  2ZMV A;  1MC0 A;  2JKT I;  2WKQ A;  3B47 A;  2B02 A;  4HNB A;  4CQH A;  4DN0 A;  2NUT C;  2ZOH A;  5F69 A;  3VOL A;  1P97 A;  1OT9 A;  2M1C A;  4WUJ A;  2HGV A;  1ZTU A;  4EES A;  3LI9 A;  3VE3 A;  1T18 A;  5HWV A;  1S4S A;  4JGP A;  3CLO A;  2H28 A;  2QWS A;  3UMD A;  3RFB A;  2OOL A;  4NEE D;  1YAX A;  1D7E A;  2HJ9 C;  4MN5 A;  1V9Z A;  4LLO B;  2NUP C;  5IS1 A;  4II7 A;  2VGL S;  3S7Q A;  3UE6 A;  2VV8 A;  3C8C A;  1TS7 A;  2VKS A;  3F1O B;  2XRN A;  4F3L A;  4M4X A;  3O5Y A;  1OTD A;  4EET B;  3KSH A;  2P7J A;  2QJ5 A;  4BMW A;  4HJ3 A;  2J3T C;  3EQU A;  2BAS A;  4G3K A;  4GS9 A;  4KUK A;  2VEA A;  3BQA A;  3HCY A;  3LR0 A;  5HPI A;  2QKP A;  1S67 L;  3EGD C;  2XA7 M;  5HDC A;  1LSV A;  3BW6 A;  5C5K A;  2PDR A;  3RH8 B;  5AVE A;  5J3W A;  4UQI S;  3LIF A;  5DFY A;  3E0Y A;  3VE4 A;  4KQD A;  2GZA A;  2W27 A;  4EU0 A;  3RTY A;  4PAU A;  4WL9 A;  4GHI A;  5G4Y A;  1NLY A;  4JGO A;  4GS9 B;  1DP9 A;  1YSP A;  3PBS A;  4HJ6 A;  4OOM A;  4WEK A;  4BBU A;  2EWW A;  4R38 A;  3PBT A;  2W3F A;  2O0Y A;  3R7W A;  1S66 L;  2FH5 A;  4R70 A;  4GCZ A;  3T4J A;  3CIT A;  3TRC A;  2V0W A;  4R3A A;  4ME4 A;  3KYZ A;  4CLC A;  4EEP A;  2L1M A;  5HD5 A;  2D01 A;  3TW8 A;  4BWI A;  5KIZ A;  5KSH A;  4GHI B;  4HOI A;  4UEY A;  1UGU A;  2INW A;  1TS6 A;  4P6Z S;  4Q0H A;  1T1A A;  1OTE A;  4EQ1 A;  4JGQ A;  4LRX C;  3R7W B;  3P01 A;  4XT2 A;  2QHK A;  4GJ4 A;  3BQ8 A;  5DKL A;  1XFN A;  4NXE A;  2O9A A;  3OC2 A;  4G3W A;  3UB8 A;  4Y2F A;  3LR4 A;  3CUE A;  3ZYT A;  2JHE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...