4I3JA

Structures of pr1 intermediate of photoactive yellow prtein e46q muntant from time-resolved laue crystallography collected at 14id aps
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAQGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Volume-conserving trans-cis isomerization pathways in photoactive yellow protein visualized by picosecond X-ray crystallography
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Luminescent protein
molecule keywords Photoactive yellow protein
total genus 37
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2012-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4i3jA00
1OT6A 1S66L 2PYPA 3ICYA 3LIFA 2YKFA 1UWPX 3IBRA 1T19A 1G28A 1ODVA 3EEHA 1GSVA 3K3DA 4M4XA 2D01A 2L1MA 2VV8A 4HJ4A 4K08A 2VLGA 5DJTA 4R70A 1T1CA 1Y28A 1F98A 3BY9A 2HV1A 5HD3A 5TBMB 5HWVA 5HSQA 5J4EA 4NXFA 4R38A 2WKQA 1TS8A 3GDIA 1D7EA 3E4PA 3GECA 3MJQA 1N9LA 3CAXA 3F1PA 3MFXA 3MXQA 2OWJA 5IU1A 4I3JA 4MN5A 4BBTA 3LYXA 3RTYA 3F1OB 4NXBA 2W0NA 4HI4A 4HH2A 3F1OA 4KUOA 3UB7A 2KDKA 2A24B 2PD8A 3LIDA 1MZUA 3LUQA 4XT2B 4MN6A 4I38A 3UE6A 2M1CA 3LI8A 2GJ3A 1BYWA 4HY8A 1OTEA 3A0RA 4GW9A 4F3LB 3EWKA 1UGUA 4HJ3A 3C2WA 4HJ6A 5EFWA 3LIAA 4WN5A 1P97A 2QHKA 3A0VA 5J7EA 5TBMA 2H28A 5F68A 5HZHA 1S67L 2V9AA 4EEUA 2L0WA 3NJAA 3F1PB 1EW0A 1JNUA 2ZOIA 1T1AA 3MR0A 2OWHA 2YKHA 4WLAA 4RQ9A 1TS7A 3T50A 5HWWA 1DRMA 1P0ZA 2V1AA 1XJ2A 2WKPA 3IS2B 4HHDA 4HNBA 4WL9A 5G4YA 4LLOB 1OTDA 1T1BA 5A8BA 2I9VA 5HWTA 3UB8A 4HP4A 4EXOA 1T18A 2A24A 3KX0X 4F3LA 1GSXA 1N9OA 4LRZE 2VEAA 4L9EA 1V9ZA 4DJ2A 4EQ1A 5KIZA 5HDCA 1LSVA 3HJIA 1OTAA 4WF0A 5J3WA 2Z6CA 3OLOA 4GS9B 3D72A 3HJKA 2V1BA 1XJ6A 4GS9A 3E4OA 2PHYA 1LSWA 2ZOHA 3F1NB 5F6AA 4H6JB 3BY8A 3LI9A 5DJUA 3A0SA 4I5SA 3NHQA 4H6JA 4HIAA 5AVEA 4R3AA 1KOUA 3VE3A 2K7SA 3G6OA 4L9GA 2PD7A 4HP9A 1N9NA 3SW1A 2QJ5A 1OJGA 2QWSA 1XFQA 3LICA 2PR6A 3NOPC 3NOUC 4PKYA 3ULFA 1OT9A 4EETB 2B02A 2INWA 1S4RA 2L4RA 2ZBBA 3E4QA 1XJ4A 2PYRA 3MQQA 1V9YA 4I39A 1D06A 4XT2A 5HDSA 3CLOA 3K3CA 4R6LA 3B33A 3PHYA 4LRYC 1GSWA 5HDDA 1XJ3A 3F1NA 1X0OA 4YWZA 2OOLA 2W27A 4GHIA 3LIBA 3CWFA 4KUKA 4NXGA 4JGOA 5F5YA 1NWZA 3VE4A 5HD5A 1TS0A 4KQDA 4EESA 4I3IA 4HQAA 1WA9A 2WKRA 1S4SA 2CMNA 5DKKA 2V0WA 2BASA 4EEPA 5I5LA 3IS2A 4GCZA 3RH8B 4EERA 2QKPA 4LPZA 1UWNX 2J80A 1S1ZA 2PDRA 3P7NA 5DKLA 2PR5A 3UMEA 1LT0A 4JGPA 1OJ5A 3NOTC 2V0UA 3H7WA 3UMDA 3VOLA 4BBUA 4DJ3A 3H7WB 5F69A 5IS1A 2JN7A 5G4ZA 3FG8A 4L9FA 1OTIA 1TS6A 4EW7A 4I3AA 2R78A 4E04A 2JHEA 4BBVA 1S1YA 1VB6A 4NXEA 1LL8A 4GHIB 3ZQ5A 4B9OA 1DP6A 2VV6A 3UB6A 3MQOA 4HOIA 4WUJA 4JGRA 2VV7A 2P7JA 5AVFA 3BWLA 3LIEA 1F9IA 3H9WA 4JGQA 4PKYG 1DP9A 1XFNA 1OTBA 1LSXA 2KX6A 3FC7A 3PYPA 4HH3A 3UB9A 2EA9A 2QJ7A 3H82A 2Z6DA 4LRXC 3C8CA 3H82B 1DP8A 2D02A
chains in the Genus database with same CATH superfamily
4MLLA 3LIFA 4L0LA 4ZAMA 2OV5A 4QPRA 5GHZA 3MS6A 4GD8A 5CXWA 5E2EA 4BD1A 3LYXA 4FTXA 5FQJA 4HI4A 2JCHA 2XK1A 3LUQA 4XT2B 4LCMA 4PPRA 2GJ3A 3TW8A 1W79A 1E3UA 4Y3IA 4C75A 3A0VA 3BFCA 3TOIA 1NZUA 4G3VA 1XP4A 4KQOA 4UAAA 3LEQA 3HLEA 4P6ZM 3ZG8B 3IHBA 2LB5A 4WF0A 4EWFA 3D72A 3LY3A 3WS4A 4EV4A 2WAFA 3VP4A 2B95A 2Y2OA 1Z6FA 1MKMA 2CC1A 5U47A 4JF6A 1OT9A 3S1YA 3NDEA 2PYRA 4RYEA 3PR6A 5HDDA 4MMNA 3ZVTA 4C6YA 4GHIA 3O5YA 1ESUA 3CWFA 4OPZA 5A93A 3VP1A 4EERA 5DKLA 3UMEA 1MWRA 1TS6A 3C7VA 5HAQA 3UPPA 2EWVA 2VGJA 1CEGA 3BWLA 3LIEA 4EBLA 3VOYA 4Y0OA 3HUOA 3A3IA 4KZ6A 3EEHA 3E98A 2VV8A 1KE3A 1JWPA 4KQQA 4XXRA 5DF8A 1F2KA 3A3DA 4LFUA 3WS1A 4EETB 1A0KA 4OOYA 3LI8A 2EX2A 3IXGA 2J3WA 2HPBA 1UGUA 4O8GA 1SDNA 3LIAA 1C3BA 4ZJ3A 5HARA 2HP5A 5BOHA 3L7HA 2ZM2A 3B47A 3EQVA 3CJMA 4HP4A 1GSXA 3N7WA 4PM6A 3E4OA 4R3JA 5HW3A 3GSGA 4I5SA 2M7UA 4UA6A 3FV7A 3N8LA 3EEAA 1PNEA 4Q8IA 3T4TA 2ZBBA 5AQAA 1JVJA 4OLDA 2QYBA 5F5YA 4I3IA 4QY6A 4RX2A 1S4SA 3FYZA 4EU0A 2IWDA 1NLYA 1HZOA 1S1ZA 1ZTUA 3M2KA 2JN7A 3QP5A 3LR3A 1WYBA 2ZC5B 3W2ZA 3IWIA 3UB5P 4KZBA 2EA9A 2QJ7A 1DP8A 1OT6A 1YSPA 2EFUA 4YFMA 1J3WA 3G4PA 3OPHA 2XRNA 4M4XA 4HJ4A 3T4LA 2JKGA 4ZTKA 2IA2A 4DE2A 2ZD8A 3MFXA 1DJBA 1RP5A 2M1CA 5AQ9A 3C2WA 3IX8A 4X53A 3G35A 1BLPA 1SCWA 3IS2B 3C5AA 4OONA 4MDZA 1T18A 5TJJA 4ARZB 1N9OA 5EVEA 2XA7S 3BFDA 4WZ5C 5GLDA 2Z6CA 3F1NB 3B3XA 1ZHHB 4WZ5A 1IYPA 4WELA 1TD5A 4HP9A 1P9WA 3KSFA 1FSYA 1O7EA 4I39A 1S4RA 4CJNA 2VX8A 2KLIA 3CLOA 3JPUA 1BULA 3VE4A 4UA9A 4OOMA 2BASA 4ESPA 2PDRA 2J3TC 2HZ5A 2K2NA 3PBTA 4QHCA 2WGIA 2Y91A 4I3AA 3TJZC 3T1XA 1VB6A 4FD8A 1LL8A 2HDRA 3LCEA 3MZEA 2VV6A 3OCNA 1F9IA 1ONGA 4PM5A 3IBRA 4ETXA 2L1MA 5DJTA 5HD3A 2PBYA 5CEBA 1N9LA 3HVFA 3CPTB 4R3BA 1VM1A 5AQBA 1Y4OA 3FZCA 4I38A 4HY8A 1OTEA 1WE4A 4E3MA 5J7EA 2XR0A 3VFHA 4WLAA 1XGJA 1DRMA 1NXYA 3IF6B 4QY5A 4ARZA 1K4FA 3LR0A 1VETB 2IWBA 1K54A 3JYIA 3BEBA 4CLCB 3HUMA 4B93A 2XD5A 5E2HA 1LSVA 5L07A 5J3WA 2Q0OA 2B5RA 5JYPA 4E3IA 4R3AA 3VE3A 2V1ZA 3GRJA 2WADA 2QZ6A 4PKYA 3UE3A 2Z2LB 2L4RA 4ZBEA 5HDSA 3BQAA 3MXRA 1NYYA 4HBUA 4NXGA 3PAEA 5FDSA 2A49A 5CHUA 1NYMA 3Q1FA 1VQQA 4ZRRA 3FPVA 5FEGA 5EVIB 2JKTM 4S2JA 3I7JA 3GV9A 1DY6A 2Y8HA 3N4IA 3BFFA 1EWZA 2FH5A 1IYOA 4QD4A 4N1XA 3NECA 1W5DA 4KG5A 3QNCA 2XEPA 1CQAA 3DAVA 4K08A 5HPFA 5TBMB 3OC2A 3VMAA 5EVIC 1Z09A 3CPTA 4MN5A 3ITBA 4KG2A 3ZGAB 3F1OA 4JLFA 1FR6A 4UEYA 3SS5A 1I5QA 2W1RA 3A0RA 1E25A 5CHJA 5EM0A 2ZC3B 3UDXA 1VHMA 5CTNA 4EEUA 3NJAA 1BLHA 4G3KA 3IXBA 4RQ9A 5HWWA 1EI5A 1YMXA 1XJ2A 4QJGA 4GJ4A 3S7PA 4GOGA 2A24A 1BUEA 4P87A 4DMZA 2WKEA 3TG9A 5D3OA 1ESIA 3G6OA 5DTTA 1LL9A 3GR2A 3KSGA 1I2WA 3JVVA 2VA0A 3GTCA 3KO6A 3CITA 2Z2MB 3NBLA 3UN7A 2R9WA 2O9AA 4LENA 4LPZA 1I2SA 3P7NA 1LT0A 1L3LA 3H7WA 4Y7PA 5DVAA 2GX5A 4CLCA 4L9FA 1K55C 1KGFA 3ISGA 1MC0A 3UB6A 4R0QA 3BLSA 3IX4A 3ICYA 4WBGA 2Y2IA 1GSVA 4KZ9A 1FCMA 1MWUA 2PT7A 5J8XA 1HTZA 1TDGA 4R38A 3UDFA 3GDIA 3MJQA 5CRFA 4O7DA 5CGWA 1S6RA 5M1AA 4MCWA 1K0KA 4BBTA 4MEZA 4YINA 2ZQAA 1ERMA 2W0NA 1KGGA 1LI9A 2JBFA 3T1RA 3A3EA 2QHKA 1YQSA 4BWIA 5FATA 3N6IA 1YMSA 4HNBA 1YLZA 3VOZA 5JYOA 2HF6A 4EXOA 4N9KA 2Q9MA 3BM6A 1ALQA 4DE0A 1LSWA 1XPBA 2VJWA 3CMZA 1LI0A 4DE1A 3ZCZA 3ULFA 5FSRA 2EXBA 2B02A 3TE8A 3UE0A 4OVDA 2P9VA 3HLCA 2GNXA 4R6LA 4WYYA 4ME4A 1X0OA 1XX2A 1N9BA 4X68A 2V0WA 4EEPA 4II7A 5I5LA 1UWNX 2J80A 4P0MA 2X71A 2HJEA 3MBZA 3V3SA 3HREA 2VZWA 4RVAA 3H7WB 4H8RA 4E04A 4S2NC 3T4JA 2XH9A 1AWIA 3DWKA 5M18A 1DJCA 3R4KA 2GDNA 1CEFA 5CTMA 2PAVP 2YKFA 2ZM0A 3TRCA 4KZ8A 3NI9A 4R70A 3WRZA 2R9XA 2PRFA 1K57C 2VGLM 2JC7A 2O99A 1YPRA 3RFBA 2JKFA 4X1MA 1QMEA 3QP2A 3T4SA 2A24B 2XQZA 4Q0JA 4BL2A 4HJ6A 3CG5A 4OOLA 2J3TD 4UHUA 5CERA 2H28A 1WYCA 3BJNA 2GZAA 4KZ7A 4BENA 2YKHA 4OLGA 3VSKA 2WKPA 3U2AA 3IH8A 5A8BA 4NKPA 4P6BA 1PWDA 2OAP1 4OP8A 4MBHA 4JXVA 1OTAA 3G30A 2E8JA 3BY8A 3FKWA 5AVEA 4X6TA 4HESA 1N9NA 2XLNA 4U3TA 2V8CA 4E3NA 4MNRA 1GA9A 3FKVA 1L0EA 1IFQA 3WS0A 2Y2MA 3V50A 5HSQA 3T1QB 2XDMA 4P85A 3NIAA 3NY4A 2WGWB 4EESA 1YSQA 3V67A 3TSGA 2XF3A 3VOLA 1SZVA 2HDUA 5IS1A 3VP3A 1GCEA 2RCXA 4WM9A 4K0XA 3EQUA 1S1YA 2K31A 4DDYA 2P7JA 3NC8A 2DNSA 1TVFA 4KUOA 2D02A 3LO7A 4F94A 4LV0A 4FH4A 4N9LA 1IYQA 5GHXA 4D60A 1MY8A 4GZBA 1PI4A 1PIOA 3LGOA 3BY9A 2HV1A 3FPWA 1STZA 5G18A 2WKQA 3ZNYA 5EUAA 4IVIA 5IU1A 4I3JA 1CK3A 3MMHA 1SKFA 3BLMA 2KDKA 4OPRA 2G2UA 4Y2FA 3LIDA 2BG1A 2BTFP 4F3LB 1K57A 4S2LA 2P08A 3OPRA 4CQHA 3ZNTA 5F68A 5A90A 1HLUP 3F1PB 4OQHA 3EOIA 4FOFA 4JPMA 2E8IA 4RA7A 1PRQA 3Q07A 1CJFA 4U0XA 1EROA 3A3FA 5FQIA 3UB8A 3KX0X 3M2JA 4L9EA 2ZMFA 4DN0A 3OLOA 3Q81A 4PAUA 3HJKA 3V5MA 2V1BA 1XJ6A 5DFXA 2K7SA 3D4FA 3Q7ZA 2PR6A 3SH8A 2Y2PA 1D06A 2W3DA 1H3QA 4MBKA 1G6AA 2ACGA 1ES4A 4LGWA 1XXMA 1G68A 2O0YA 2WGVA 4BMWA 3WRTA 4X25A 2V0UA 3IBJA 3PBSA 4B9OA 4U0TA 3SS3A 3N8SA 2VV7A 5AVFA 5I94A 3SOIA 4JGQA 1OTBA 3FC7A 1W63M 1K4EA 2Z6DA 2DRWA 5EVID 5CGXA 1ERQA 3K3DA 2XD1A 2VLGA 4FCFA 1L0FA 3HL9A 5HWVA 2VKSA 1FCOA 2OAQ1 4JF5A 4X55A 2WUQA 4WEKA 1RGYA 3M6BA 5E2FA 2J9PA 1N4OA 2ZQ7A 1BLCA 1BYWA 4MBFA 1G5UA 2BLSA 1Q2QA 1HD8A 5C5KA 1CF0A 1ES3A 1LL5A 4DF6A 2OWHA 3T50A 5CX7A 1P0ZA 1XA1A 2C5WB 2Y79A 3NULA 4EBNA 2Y2LA 2ZMAA 3G32A 3VFFA 3ZHHA 2W3FA 2HP9A 4GLQA 4GS9B 3E2LA 2X02A 5EOOA 1IKGA 4LCLA 1ES5A 3ZG5A 3E4QA 1XJ4A 1V9YA 1YKDA 2UV0E 4OQIA 4Z9QA 3K3CA 1GSWA 4YWZA 4D2OA 1K54C 1NWZA 5HD5A 1IOUA 5FAQA 1E4DA 4XUXA 2ZQDA 4GN2A 3HLBA 4R1GA 2W1TA 3IHAA 1MKIA 5GLBA 4DRTA 3CHWP 5A91A 3UMDA 3KYEA 5FL3A 5G4ZA 5CEDA 4IEDA 3C30A 4NXEA 1F5MA 3ZQ5A 1KGEA 3ZG7B 3MFDA 4IHQA 4HOIA 3HLDA 5HPIA 1LHYA 2B18A 1M40A 3V3RA 2KX6A 3HBRA 4NETA 3UY6A 3IH9A 3C8CA 2Q9NA 3C38A 3O88A 4ID4A 4B4ZA 4JXWA 5CECA 3W8KA 1KE0A 1L2SA 2QPNA 4B4XA 3F1PA 3MXQA 1K55A 5FDHA 3S7OA 1IKIA 2Y2KA 5M19A 4JBFA 4S2IA 3C4PA 1P97A 1IELA 3W4OA 1JNUA 2IWCA 3MSHA 1TS7A 2V1AA 4WL9A 5G4YA 5GLAA 1T1BA 3G34A 2HP6A 4E6XA 3GQZA 2I72A 2EXAA 3RXWA 4GS9A 2H0YA 2PHYA 1S0WA 2JKRI 5DFYA 4LV2A 5FAOA 2INWA 3NOTC 4GNUA 4ZJ1A 4IJGA 3Q7VA 5FQQA 4CLCE 1FIKA 3BECA 3DWZA 3IS2A 1NJ4A 1RGZA 2LB9A 5TGFA 2EFXA 3MXSA 3S7QA 3ZG9B 2KOIA 5K5BA 4OPQA 3BRMA 1MWTA 4NG2A 3K2NA 3LR5A 1DP9A 4S2OA 2W3HA 2QMIA 5FQMA 2PYPA 4X69A 5EE8A 1UWPX 2JKTI 1G28A 5E2GA 4EUZA 2Y2QA 5AQ7A 1T1CA 1Y28A 3EGDC 4Y13A 2G7UA 1GHMA 1PWGA 4CLCD 4P6ZS 3OPPA 4FH2A 1MZUA 4MN6A 1CI8A 3KSHA 1GHIA 3U4LP 4CPKA 2V8FA 3AGDA 4Y15A 4ETZA 3LEZA 4KZ4A 1T1AA 3DTMA 4K0WA 3QP8A 4FSFA 2WKIA 2RL3A 2ZMVA 4LLOB 1YLYA 2Y2GA 5DTKA 1YLJA 4IVKA 2M7VA 3PBQA 4EQ1A 5KIZA 3SZTA 5EVLA 3HJIA 4PM8A 5KZHA 4PMAA 5F6AA 2EWWA 5DJUA 1H0MA 5HFOA 5TR7A 3WS5A 1P9RA 3OOVA 3MQ0A 4PM7A 3HCYA 2J7VA 3NOPC 1GHPA 3MR0A 4M3KA 2ZLYA 4E3JA 4BBVA 1VETA 2P9VB 3PHYA 3F1NA 2OOLA 4DE3A 4JGOA 2Y2HA 3ZYTA 2XA7M 5DF7A 3RXXA 3B42A 4OQ0A 3R7WB 5GHYA 2PR5A 3EGXC 5EV0A 4JF4A 2VGLS 3FG8A 1BZAA 2WK0A 3BQ8A 4LV3A 4O0PA 2ZQCA 4OQGA 3T4OA 1H5XA 4GHIB 3KSIA 4E3KA 2W1TB 1ZG4A 4PKYG 3AGEA 5EVIA 4KENB 4JXSA 2FFFB 1PZPA 1T19A 3E0YA 5FQ9A 5GL9A 2W3GA 3T4KA 5J4EA 2FFYA 1TS8A 1Q2PA 1MXOA 3GECA 3S4XA 3CAXA 4BLMA 3RTYA 2ZL1B 3LR4A 3JVUA 3UB7A 2V2FF 1PYYA 4UA7A 3AGFA 5EFWA 4CLCC 3D3OA 4UQIM 2X01A 2V9AA 1BTLA 3CUEA 1PFLA 4X56A 1H8ZA 1JWZA 3OZHA 4WMCD 2EX9A 4R23A 1KDSA 5L2FA 1W7FA 3DW0A 4GDBA 4DJ2A 2NUPC 2PU2A 3PBOA 2Y59A 2ZOHA 4Y0TA 4H6JB 1QMFA 1FOFA 1Y54A 2QWSA 3LICA 1XFQA 2WAEA 4QB8A 1J9MA 1K6RA 1W63Q 1IYSA 1YAXA 4WEJA 2PBDP 1VEUB 1BLSA 3UNWA 2ZC6B 3ZVWA 4YNRA 5HAIA 3C7UA 3NCKA 4Q0HA 2Y4AA 3D9YA 1JTGA 4JGPA 1OJ5A 2AVXA 3NDGA 5FAPA 4EW7A 2P74A 1U60A 3FWLA 2WGWA 3UPOA 1NLZA 4FUWA 4HH3A 3UB9A 3ZG0A 4LRXC 1TDLA 3H82B 3QP1A 2WZZA 2WKHA 5F1GA 3PAGA 2ZJ9A 3HUNA 4AFIA 4S2MA 4OKPA 1F98A 1FCNA 4KZ3A 4IUHA 1D7EA 3KYQA 4OH0A 1KE4A 3IF6A 3HLFA 3P01A 4NXBA 4Y17A 5F83A 3VSLA 3UE6A 2ZQ9A 4GW9A 3EWKA 5FI6A 4KZ5A 1S67L 2MJ6A 2ZL1A 1PW1A 3DBAA 4Y5FA 3V39A 3HLGA 2C6WB 4F3LA 3C4OA 3QNBA 1V9ZA 4UQIS 1L0GA 4EQIA 2W3EA 5F82A 1YT4A 5FI7A 4E3LA 3A0SA 3IQAA 4N92A 4L9GA 1XKZA 3BYDA 1YLTA 2QJ5A 4DXCA 1OJGA 3P09A 1SDEA 3NOUC 1K56D 3IXDA 1K25A 3B33A 3O86A 3RH8B 4KUKA 4JKTA 2J9OA 1MWSA 2CMNA 3OBFA 5DKKA 3VP0A 1DJAA 3UE1A 3R7WA 3CI6A 1O07A 3PBNA 4S2KA 2WZXA 4NK3A 1NZOA 5L8MA 4E3OA 3S22A 5KSHA 3UO9A 3IWOA 3P98A 5TFQA 2Y2JA 4WUJA 2O9CA 5GLCA 3ITAA 3H9WA 1GA0A 3UDIA 1L0DA 2V20A 2XFSA 3GVBA 2J8YA 1ODVA 3BFGA 1D1JA 1ZKJA 3E2KA 3IF6C 1PWCA 1YLWA 1KVMA 2OWJA 3DTIA 4Q0IA 4HH2A 1CI9A 2ZM8A 2XGNA 4GB7A 3MZFA 2Y2NA 4HBTA 3MKEA 2HGVA 1W8YA 1OTDA 5HWTA 4DKIA 2VEAA 4BQMA 1XGIA 4S2PA 1ZG6A 1VEUA 2OLUA 3NHQA 4H6JA 1KOUA 3PBRA 2PD7A 2NUTC 4YOFA 1JWVA 5L09A 2G2WA 4Y0UA 5HDCA 1W8QA 3RJUA 2JE5A 4XT2A 1HVBA 1G6OA 3QP6A 2A2LA 3OCLA 4LRYC 3IF5A 1XJ3A 1BT5A 5E43A 4OP5A 1TS0A 4KQDA 1TEMA 3A3JA 2HJ9C 4GCZA 1OPXA 5MC7A 3IT9A 1M6KA 1FQGA 5EM1A 5HL6A 1MPLA 2JHEA 1NY0A 5AJGA 3BFEA 1DP6A 4OPYA 3MQOA 4JGRA 1E3UD 1XFNA 3PYPA 3H82A 4HEFA 1ZC2A 1S66L 1H8MA 5KSCA 1AXBA 3SH9A 3LY4A 1BSGA 2D01A 3KYZA 4E6WA 1ONHA 1SKOB 2VGKA 4XUZA 4R4SA 3SS4A 2XSSA 4C3QA 2Y55A 2XFTA 4IUKA 2PD8A 3HLWA 1PZOA 1K6SA 4B88A 3IWQA 4A5RA 4HJ3A 4PM9A 1LLBA 3VV4A 5HZHA 2L0WA 4QWOA 1EW0A 2O9BA 2ZOIA 2XROA 2OLVA 3L9KA 4HHDA 3ZDJA 1FILA 2I9VA 1XA7A 4JXGA 2HDQA 2PU4A 3OPLA 1YM1A 3ZFZA 4IBXA 5HX9A 5IT5A 3G31A 4KQRA 3LI9A 4HIAA 3SW1A 4PHTA 4O01A 5EOEA 2WYXA 2OSUA 3Q7VB 3PXPA 2VK3A 1PW8A 2W27A 3LIBA 4EUVA 3CZDA 2P04A 3IX3A 5L10A 2WKRA 4LV1A 3WS2A 5LBRA 4BL3A 2EX6A 2QKPA 3CUEC 5EECA 5FI2A 3BW6A 3W4PA 5KMWA 4DJ3A 5F69A 1ACFA 2EX8A 4G3WA 1KDWA 2ZC4B 3MKFA 3MF0A 1LSXA 1PI5A 4BD0A 5EPHA 4DXBA 4LRZE 2FZ0A 4RX3A 4DDSA 3IXHA 2HDSA 4KZAA 4GKUA 4Z1WA 1KVLA 1SKOA 4NXFA 3DTKA 2JKRM 3O87A 3E4PA 5FASA 3MZDA 2UWXA 4WMCA 4ZDXA 3F1OB 5FQKA 3PTEA 3T1SA 3O3VA 3DTEA 1ES2A 1NRJA 4BJPA 5DTSA 4K91A 4WN5A 5TBMA 2ZQ8A 4NEED 4KG6A 2DMWA 3VP2A 5HL1A 4ZJ2A 4S2NA 4X1LA 5DF9A 1H8YA 2A3UA 4EBPA 1FR1A 3S7NA 3Q82A 3T4QA 1NRFA 2ZC7A 1YLPA 3N8RA 1OMEA 5HAPA 1IEMA 5CHMA 5IHVA 3MQQA 1FSWA 3WWXA 3T12B 3G2ZA 5CGSA 4WZ4A 4BBUA 1SHVA 4GDNA 5A92A 5F1FA 4R4RA 4MN7A 3G2YA 4GD6A 5FEFA 3W4QA 4IBRA 2H10A 4HQAA 1WA9A 3UPNA 4N1HA 3LFVA 1JTDA 1K38A 1K56A 3QHYA 2H0TA 1MBLA 1OTIA 1RCJA 1TF1A 4QU3A 2DCFA 2R78A 5FA7A 3SH7A 2H5SA 3QP4A 3M6HA 3GMWA
chains in the Genus database with same CATH topology
3LIFA 4L0LA 3K3DA 4K08A 4AFIA 2VLGA 4QPRA 5HPFA 1F98A 5TBMB 5HWVA 4IUHA 2VKSA 1D7EA 3OC2A 2OAQ1 3KYQA 4WEKA 4MN5A 3LYXA 3P01A 4NXBA 4HI4A 3F1OA 3UE6A 3LUQA 4XT2B 4UEYA 1BYWA 2GJ3A 2W1RA 3TW8A 3A0RA 4GW9A 3EWKA 4Y3IA 3A0VA 5C5KA 1VHMA 1S67L 4EEUA 3NJAA 4G3VA 4G3KA 2MJ6A 2OWHA 4RQ9A 3T50A 5HWWA 3DBAA 5CX7A 1P0ZA 1XJ2A 4Y5FA 4GJ4A 4KQOA 3S7PA 2Y79A 2A24A 4F3LA 4P6ZM 1V9ZA 2W3FA 4UQIS 2LB5A 4WF0A 4DMZA 4GLQA 4GS9B 2W3EA 3D72A 3A0SA 3G6OA 4L9GA 1MKMA 2QJ5A 1OJGA 3NOUC 1OT9A 3KSGA 3E4QA 1XJ4A 2PYRA 1V9YA 3JVVA 1YKDA 2VA0A 3PR6A 3KO6A 3K3CA 3B33A 3CITA 5HDDA 1GSWA 4MMNA 4YWZA 3RH8B 4GHIA 3O5YA 4KUKA 3CWFA 1NWZA 5HD5A 1IOUA 2CMNA 3OBFA 5DKKA 2W1TA 2O9AA 3R7WA 3CI6A 4EERA 4LPZA 3PBNA 3P7NA 5DKLA 3UMEA 1LT0A 3H7WA 5L8MA 3UMDA 5FL3A 4CLCA 2GX5A 5G4ZA 4L9FA 1TS6A 5KSHA 3C30A 4NXEA 2EWVA 1F5MA 1MC0A 3ZQ5A 3UB6A 4IHQA 4HOIA 5HPIA 4WUJA 2O9CA 3BWLA 3LIEA 2B18A 3H9WA 2KX6A 3C8CA 3ICYA 3C38A 1ODVA 3EEHA 1GSVA 3E98A 2VV8A 2PT7A 4R38A 3GDIA 3MJQA 4MCWA 3F1PA 3MXQA 2OWJA 4BBTA 2W0NA 4Q0IA 3S7OA 4HH2A 4EETB 3LI8A 2J3WA 1UGUA 4O8GA 3LIAA 1P97A 2QHKA 4BWIA 1JNUA 1TS7A 2V1AA 4HNBA 3B47A 2HGVA 4WL9A 3EQVA 5G4YA 1OTDA 1T1BA 5HWTA 2HF6A 4HP4A 4EXOA 1GSXA 2VEAA 4GS9A 3E4OA 2PHYA 1LSWA 4I5SA 2VJWA 3NHQA 4H6JA 1KOUA 2M7UA 3PBRA 2JKRI 2NUTC 2PD7A 4YOFA 3EEAA 5DFYA 3ULFA 3T4TA 3TE8A 2B02A 2INWA 3NOTC 5HDCA 2ZBBA 4XT2A 1G6OA 2GNXA 4IJGA 4R6LA 2A2LA 3OCLA 4LRYC 1XJ3A 4ME4A 1X0OA 2QYBA 5F5YA 4CLCE 1TS0A 4KQDA 4I3IA 1S4SA 2HJ9C 2V0WA 4EEPA 4II7A 4EU0A 5I5LA 3IS2A 4GCZA 1NLYA 1UWNX 2J80A 1S1ZA 1OPXA 5MC7A 2LB9A 1ZTUA 2HJEA 3S7QA 2VZWA 3H7WB 2JN7A 2KOIA 5K5BA 3LR3A 4E04A 5HL6A 2JHEA 5AJGA 3T4JA 1DP6A 3MQOA 4JGRA 3W2ZA 3K2NA 3LR5A 1DP9A 1XFNA 3PYPA 2EA9A 2QJ7A 3H82A 2W3HA 3R4KA 1DP8A 1OT6A 1S66L 1H8MA 1YSPA 2PYPA 3TRCA 2YKFA 1UWPX 2JKTI 2XRNA 1G28A 4M4XA 2D01A 3KYZA 4HJ4A 4R70A 1T1CA 1Y28A 3T4LA 3EGDC 2IA2A 2G7UA 2VGLM 2O99A 4CLCD 3MFXA 4P6ZS 3RFBA 2XSSA 3T4SA 4IUKA 2A24B 2PD8A 1MZUA 4Q0JA 4MN6A 2M1CA 3KSHA 4HJ3A 3C2WA 4HJ6A 3VV4A 4OOLA 4ETZA 2J3TD 2H28A 5HZHA 2L0WA 3BJNA 2GZAA 1EW0A 2O9BA 2ZOIA 1T1AA 2XROA 2YKHA 4FSFA 4HHDA 2WKPA 3IS2B 3U2AA 2ZMVA 4LLOB 5A8BA 4MDZA 2I9VA 4NKPA 1T18A 2OAP1 5TJJA 3PBQA 2M7VA 4ARZB 1N9OA 4EQ1A 2XA7S 5KIZA 3HJIA 1OTAA 2Z6CA 5IT5A 5F6AA 3F1NB 3BY8A 2EWWA 3LI9A 5DJUA 1ZHHB 4HIAA 5AVEA 1P9RA 4WELA 1TD5A 3OOVA 3MQ0A 4HP9A 1N9NA 3SW1A 1P9WA 4PHTA 3KSFA 4O01A 3HCYA 3NOPC 3MR0A 4I39A 1S4RA 4BBVA 2VX8A 2KLIA 3CLOA 3PXPA 1IFQA 3PHYA 3F1NA 5HSQA 2OOLA 2W27A 3LIBA 3VE4A 4EUVA 4JGOA 4OOMA 2P04A 3ZYTA 4EESA 2XA7M 1YSQA 2WKRA 2BASA 3B42A 5LBRA 2QKPA 3CUEC 3R7WB 3V67A 2PDRA 2PR5A 2J3TC 3BW6A 3EGXC 3VOLA 4DJ3A 5F69A 5IS1A 2VGLS 2K2NA 3FG8A 3PBTA 4G3WA 4I3AA 3BQ8A 3TJZC 4O0PA 3EQUA 1S1YA 1VB6A 3T4OA 1LL8A 4GHIB 2K31A 3KSIA 2VV6A 3OCNA 2W1TB 2P7JA 1F9IA 4PKYG 3MF0A 1LSXA 4LRZE 4KUOA 2D02A 2FZ0A 3IBRA 4ETXA 1T19A 3E0YA 2L1MA 5DJTA 3T4KA 2W3GA 2HV1A 3BY9A 5HD3A 4Z1WA 3FPWA 5J4EA 4NXFA 1STZA 2WKQA 1TS8A 2JKRM 3E4PA 3GECA 1N9LA 3CAXA 5IU1A 4I3JA 3RTYA 3MMHA 3F1OB 3LR4A 3JVUA 3UB7A 2KDKA 4Y2FA 3LIDA 4I38A 4HY8A 1OTEA 1NRJA 4F3LB 4BJPA 2P08A 5EFWA 4CLCC 3D3OA 4UQIM 4WN5A 5J7EA 4CQHA 5TBMA 5F68A 2V9AA 4NEED 3F1PB 3CUEA 3EOIA 4FOFA 4WLAA 2DMWA 1DRMA 5DF9A 4ARZA 3UB8A 3LR0A 3KX0X 4DJ2A 4L9EA 2ZMFA 4CLCB 4B93A 1LSVA 2NUPC 4DN0A 3S7NA 3PBOA 5J3WA 3OLOA 4PAUA 3T4QA 3HJKA 2V1BA 1XJ6A 2ZOHA 4H6JB 5DFXA 4R3AA 3VE3A 2K7SA 2QWSA 3LICA 1XFQA 2PR6A 4PKYA 3UE3A 2L4RA 5HDSA 3MQQA 3BQAA 1D06A 2W3DA 1H3QA 1W63Q 4BBUA 1YAXA 4NXGA 4WEJA 4MN7A 4YNRA 4HQAA 1WA9A 4Q0HA 2O0YA 4BMWA 3LFVA 4ZRRA 3FPVA 4JGPA 1OJ5A 2V0UA 2JKTM 1OTIA 1TF1A 4EW7A 2R78A 2Y8HA 3IBJA 3PBSA 2FH5A 4B9OA 2VV7A 5AVFA 1NLZA 4JGQA 1OTBA 3FC7A 4HH3A 3UB9A 1W63M 2Z6DA 4LRXC 3H82B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OT6 A;  1S66 L;  2PYP A;  3ICY A;  3LIF A;  2YKF A;  1UWP X;  3IBR A;  1T19 A;  1G28 A;  1ODV A;  3EEH A;  1GSV A;  3K3D A;  4M4X A;  2D01 A;  2L1M A;  2VV8 A;  4HJ4 A;  4K08 A;  2VLG A;  5DJT A;  4R70 A;  1T1C A;  1Y28 A;  1F98 A;  3BY9 A;  2HV1 A;  5HD3 A;  5TBM B;  5HWV A;  5HSQ A;  5J4E A;  4NXF A;  4R38 A;  2WKQ A;  1TS8 A;  3GDI A;  1D7E A;  3E4P A;  3GEC A;  3MJQ A;  1N9L A;  3CAX A;  3F1P A;  3MFX A;  3MXQ A;  2OWJ A;  5IU1 A;  4I3J A;  4MN5 A;  4BBT A;  3LYX A;  3RTY A;  3F1O B;  4NXB A;  2W0N A;  4HI4 A;  4HH2 A;  3F1O A;  4KUO A;  3UB7 A;  2KDK A;  2A24 B;  2PD8 A;  3LID A;  1MZU A;  3LUQ A;  4XT2 B;  4MN6 A;  4I38 A;  3UE6 A;  2M1C A;  3LI8 A;  2GJ3 A;  1BYW A;  4HY8 A;  1OTE A;  3A0R A;  4GW9 A;  4F3L B;  3EWK A;  1UGU A;  4HJ3 A;  3C2W A;  4HJ6 A;  5EFW A;  3LIA A;  4WN5 A;  1P97 A;  2QHK A;  3A0V A;  5J7E A;  5TBM A;  2H28 A;  5F68 A;  5HZH A;  1S67 L;  2V9A A;  4EEU A;  2L0W A;  3NJA A;  3F1P B;  1EW0 A;  1JNU A;  2ZOI A;  1T1A A;  3MR0 A;  2OWH A;  2YKH A;  4WLA A;  4RQ9 A;  1TS7 A;  3T50 A;  5HWW A;  1DRM A;  1P0Z A;  2V1A A;  1XJ2 A;  2WKP A;  3IS2 B;  4HHD A;  4HNB A;  4WL9 A;  5G4Y A;  4LLO B;  1OTD A;  1T1B A;  5A8B A;  2I9V A;  5HWT A;  3UB8 A;  4HP4 A;  4EXO A;  1T18 A;  2A24 A;  3KX0 X;  4F3L A;  1GSX A;  1N9O A;  4LRZ E;  2VEA A;  4L9E A;  1V9Z A;  4DJ2 A;  4EQ1 A;  5KIZ A;  5HDC A;  1LSV A;  3HJI A;  1OTA A;  4WF0 A;  5J3W A;  2Z6C A;  3OLO A;  4GS9 B;  3D72 A;  3HJK A;  2V1B A;  1XJ6 A;  4GS9 A;  3E4O A;  2PHY A;  1LSW A;  2ZOH A;  3F1N B;  5F6A A;  4H6J B;  3BY8 A;  3LI9 A;  5DJU A;  3A0S A;  4I5S A;  3NHQ A;  4H6J A;  4HIA A;  5AVE A;  4R3A A;  1KOU A;  3VE3 A;  2K7S A;  3G6O A;  4L9G A;  2PD7 A;  4HP9 A;  1N9N A;  3SW1 A;  2QJ5 A;  1OJG A;  2QWS A;  1XFQ A;  3LIC A;  2PR6 A;  3NOP C;  3NOU C;  4PKY A;  3ULF A;  1OT9 A;  4EET B;  2B02 A;  2INW A;  1S4R A;  2L4R A;  2ZBB A;  3E4Q A;  1XJ4 A;  2PYR A;  3MQQ A;  1V9Y A;  4I39 A;  1D06 A;  4XT2 A;  5HDS A;  3CLO A;  3K3C A;  4R6L A;  3B33 A;  3PHY A;  4LRY C;  1GSW A;  5HDD A;  1XJ3 A;  3F1N A;  1X0O A;  4YWZ A;  2OOL A;  2W27 A;  4GHI A;  3LIB A;  3CWF A;  4KUK A;  4NXG A;  4JGO A;  5F5Y A;  1NWZ A;  3VE4 A;  5HD5 A;  1TS0 A;  4KQD A;  4EES A;  4I3I A;  4HQA A;  1WA9 A;  2WKR A;  1S4S A;  2CMN A;  5DKK A;  2V0W A;  2BAS A;  4EEP A;  5I5L A;  3IS2 A;  4GCZ A;  3RH8 B;  4EER A;  2QKP A;  4LPZ A;  1UWN X;  2J80 A;  1S1Z A;  2PDR A;  3P7N A;  5DKL A;  2PR5 A;  3UME A;  1LT0 A;  4JGP A;  1OJ5 A;  3NOT C;  2V0U A;  3H7W A;  3UMD A;  3VOL A;  4BBU A;  4DJ3 A;  3H7W B;  5F69 A;  5IS1 A;  2JN7 A;  5G4Z A;  3FG8 A;  4L9F A;  1OTI A;  1TS6 A;  4EW7 A;  4I3A A;  2R78 A;  4E04 A;  2JHE A;  4BBV A;  1S1Y A;  1VB6 A;  4NXE A;  1LL8 A;  4GHI B;  3ZQ5 A;  4B9O A;  1DP6 A;  2VV6 A;  3UB6 A;  3MQO A;  4HOI A;  4WUJ A;  4JGR A;  2VV7 A;  2P7J A;  5AVF A;  3BWL A;  3LIE A;  1F9I A;  3H9W A;  4JGQ A;  4PKY G;  1DP9 A;  1XFN A;  1OTB A;  1LSX A;  2KX6 A;  3FC7 A;  3PYP A;  4HH3 A;  3UB9 A;  2EA9 A;  2QJ7 A;  3H82 A;  2Z6D A;  4LRX C;  3C8C A;  3H82 B;  1DP8 A;  2D02 A; 
#chains in the Genus database with same CATH topology
 4MLL A;  3LIF A;  4L0L A;  4ZAM A;  2OV5 A;  4QPR A;  5GHZ A;  3MS6 A;  4GD8 A;  5CXW A;  5E2E A;  4BD1 A;  3LYX A;  4FTX A;  5FQJ A;  4HI4 A;  2JCH A;  2XK1 A;  3LUQ A;  4XT2 B;  4LCM A;  4PPR A;  2GJ3 A;  3TW8 A;  1W79 A;  1E3U A;  4Y3I A;  4C75 A;  3A0V A;  3BFC A;  3TOI A;  1NZU A;  4G3V A;  1XP4 A;  4KQO A;  4UAA A;  3LEQ A;  3HLE A;  4P6Z M;  3ZG8 B;  3IHB A;  2LB5 A;  4WF0 A;  4EWF A;  3D72 A;  3LY3 A;  3WS4 A;  4EV4 A;  2WAF A;  3VP4 A;  2B95 A;  2Y2O A;  1Z6F A;  1MKM A;  2CC1 A;  5U47 A;  4JF6 A;  1OT9 A;  3S1Y A;  3NDE A;  2PYR A;  4RYE A;  3PR6 A;  5HDD A;  4MMN A;  3ZVT A;  4C6Y A;  4GHI A;  3O5Y A;  1ESU A;  3CWF A;  4OPZ A;  5A93 A;  3VP1 A;  4EER A;  5DKL A;  3UME A;  1MWR A;  1TS6 A;  3C7V A;  5HAQ A;  3UPP A;  2EWV A;  2VGJ A;  1CEG A;  3BWL A;  3LIE A;  4EBL A;  3VOY A;  4Y0O A;  3HUO A;  3A3I A;  4KZ6 A;  3EEH A;  3E98 A;  2VV8 A;  1KE3 A;  1JWP A;  4KQQ A;  4XXR A;  5DF8 A;  1F2K A;  3A3D A;  4LFU A;  3WS1 A;  4EET B;  1A0K A;  4OOY A;  3LI8 A;  2EX2 A;  3IXG A;  2J3W A;  2HPB A;  1UGU A;  4O8G A;  1SDN A;  3LIA A;  1C3B A;  4ZJ3 A;  5HAR A;  2HP5 A;  5BOH A;  3L7H A;  2ZM2 A;  3B47 A;  3EQV A;  3CJM A;  4HP4 A;  1GSX A;  3N7W A;  4PM6 A;  3E4O A;  4R3J A;  5HW3 A;  3GSG A;  4I5S A;  2M7U A;  4UA6 A;  3FV7 A;  3N8L A;  3EEA A;  1PNE A;  4Q8I A;  3T4T A;  2ZBB A;  5AQA A;  1JVJ A;  4OLD A;  2QYB A;  5F5Y A;  4I3I A;  4QY6 A;  4RX2 A;  1S4S A;  3FYZ A;  4EU0 A;  2IWD A;  1NLY A;  1HZO A;  1S1Z A;  1ZTU A;  3M2K A;  2JN7 A;  3QP5 A;  3LR3 A;  1WYB A;  2ZC5 B;  3W2Z A;  3IWI A;  3UB5 P;  4KZB A;  2EA9 A;  2QJ7 A;  1DP8 A;  1OT6 A;  1YSP A;  2EFU A;  4YFM A;  1J3W A;  3G4P A;  3OPH A;  2XRN A;  4M4X A;  4HJ4 A;  3T4L A;  2JKG A;  4ZTK A;  2IA2 A;  4DE2 A;  2ZD8 A;  3MFX A;  1DJB A;  1RP5 A;  2M1C A;  5AQ9 A;  3C2W A;  3IX8 A;  4X53 A;  3G35 A;  1BLP A;  1SCW A;  3IS2 B;  3C5A A;  4OON A;  4MDZ A;  1T18 A;  5TJJ A;  4ARZ B;  1N9O A;  5EVE A;  2XA7 S;  3BFD A;  4WZ5 C;  5GLD A;  2Z6C A;  3F1N B;  3B3X A;  1ZHH B;  4WZ5 A;  1IYP A;  4WEL A;  1TD5 A;  4HP9 A;  1P9W A;  3KSF A;  1FSY A;  1O7E A;  4I39 A;  1S4R A;  4CJN A;  2VX8 A;  2KLI A;  3CLO A;  3JPU A;  1BUL A;  3VE4 A;  4UA9 A;  4OOM A;  2BAS A;  4ESP A;  2PDR A;  2J3T C;  2HZ5 A;  2K2N A;  3PBT A;  4QHC A;  2WGI A;  2Y91 A;  4I3A A;  3TJZ C;  3T1X A;  1VB6 A;  4FD8 A;  1LL8 A;  2HDR A;  3LCE A;  3MZE A;  2VV6 A;  3OCN A;  1F9I A;  1ONG A;  4PM5 A;  3IBR A;  4ETX A;  2L1M A;  5DJT A;  5HD3 A;  2PBY A;  5CEB A;  1N9L A;  3HVF A;  3CPT B;  4R3B A;  1VM1 A;  5AQB A;  1Y4O A;  3FZC A;  4I38 A;  4HY8 A;  1OTE A;  1WE4 A;  4E3M A;  5J7E A;  2XR0 A;  3VFH A;  4WLA A;  1XGJ A;  1DRM A;  1NXY A;  3IF6 B;  4QY5 A;  4ARZ A;  1K4F A;  3LR0 A;  1VET B;  2IWB A;  1K54 A;  3JYI A;  3BEB A;  4CLC B;  3HUM A;  4B93 A;  2XD5 A;  5E2H A;  1LSV A;  5L07 A;  5J3W A;  2Q0O A;  2B5R A;  5JYP A;  4E3I A;  4R3A A;  3VE3 A;  2V1Z A;  3GRJ A;  2WAD A;  2QZ6 A;  4PKY A;  3UE3 A;  2Z2L B;  2L4R A;  4ZBE A;  5HDS A;  3BQA A;  3MXR A;  1NYY A;  4HBU A;  4NXG A;  3PAE A;  5FDS A;  2A49 A;  5CHU A;  1NYM A;  3Q1F A;  1VQQ A;  4ZRR A;  3FPV A;  5FEG A;  5EVI B;  2JKT M;  4S2J A;  3I7J A;  3GV9 A;  1DY6 A;  2Y8H A;  3N4I A;  3BFF A;  1EWZ A;  2FH5 A;  1IYO A;  4QD4 A;  4N1X A;  3NEC A;  1W5D A;  4KG5 A;  3QNC A;  2XEP A;  1CQA A;  3DAV A;  4K08 A;  5HPF A;  5TBM B;  3OC2 A;  3VMA A;  5EVI C;  1Z09 A;  3CPT A;  4MN5 A;  3ITB A;  4KG2 A;  3ZGA B;  3F1O A;  4JLF A;  1FR6 A;  4UEY A;  3SS5 A;  1I5Q A;  2W1R A;  3A0R A;  1E25 A;  5CHJ A;  5EM0 A;  2ZC3 B;  3UDX A;  1VHM A;  5CTN A;  4EEU A;  3NJA A;  1BLH A;  4G3K A;  3IXB A;  4RQ9 A;  5HWW A;  1EI5 A;  1YMX A;  1XJ2 A;  4QJG A;  4GJ4 A;  3S7P A;  4GOG A;  2A24 A;  1BUE A;  4P87 A;  4DMZ A;  2WKE A;  3TG9 A;  5D3O A;  1ESI A;  3G6O A;  5DTT A;  1LL9 A;  3GR2 A;  3KSG A;  1I2W A;  3JVV A;  2VA0 A;  3GTC A;  3KO6 A;  3CIT A;  2Z2M B;  3NBL A;  3UN7 A;  2R9W A;  2O9A A;  4LEN A;  4LPZ A;  1I2S A;  3P7N A;  1LT0 A;  1L3L A;  3H7W A;  4Y7P A;  5DVA A;  2GX5 A;  4CLC A;  4L9F A;  1K55 C;  1KGF A;  3ISG A;  1MC0 A;  3UB6 A;  4R0Q A;  3BLS A;  3IX4 A;  3ICY A;  4WBG A;  2Y2I A;  1GSV A;  4KZ9 A;  1FCM A;  1MWU A;  2PT7 A;  5J8X A;  1HTZ A;  1TDG A;  4R38 A;  3UDF A;  3GDI A;  3MJQ A;  5CRF A;  4O7D A;  5CGW A;  1S6R A;  5M1A A;  4MCW A;  1K0K A;  4BBT A;  4MEZ A;  4YIN A;  2ZQA A;  1ERM A;  2W0N A;  1KGG A;  1LI9 A;  2JBF A;  3T1R A;  3A3E A;  2QHK A;  1YQS A;  4BWI A;  5FAT A;  3N6I A;  1YMS A;  4HNB A;  1YLZ A;  3VOZ A;  5JYO A;  2HF6 A;  4EXO A;  4N9K A;  2Q9M A;  3BM6 A;  1ALQ A;  4DE0 A;  1LSW A;  1XPB A;  2VJW A;  3CMZ A;  1LI0 A;  4DE1 A;  3ZCZ A;  3ULF A;  5FSR A;  2EXB A;  2B02 A;  3TE8 A;  3UE0 A;  4OVD A;  2P9V A;  3HLC A;  2GNX A;  4R6L A;  4WYY A;  4ME4 A;  1X0O A;  1XX2 A;  1N9B A;  4X68 A;  2V0W A;  4EEP A;  4II7 A;  5I5L A;  1UWN X;  2J80 A;  4P0M A;  2X71 A;  2HJE A;  3MBZ A;  3V3S A;  3HRE A;  2VZW A;  4RVA A;  3H7W B;  4H8R A;  4E04 A;  4S2N C;  3T4J A;  2XH9 A;  1AWI A;  3DWK A;  5M18 A;  1DJC A;  3R4K A;  2GDN A;  1CEF A;  5CTM A;  2PAV P;  2YKF A;  2ZM0 A;  3TRC A;  4KZ8 A;  3NI9 A;  4R70 A;  3WRZ A;  2R9X A;  2PRF A;  1K57 C;  2VGL M;  2JC7 A;  2O99 A;  1YPR A;  3RFB A;  2JKF A;  4X1M A;  1QME A;  3QP2 A;  3T4S A;  2A24 B;  2XQZ A;  4Q0J A;  4BL2 A;  4HJ6 A;  3CG5 A;  4OOL A;  2J3T D;  4UHU A;  5CER A;  2H28 A;  1WYC A;  3BJN A;  2GZA A;  4KZ7 A;  4BEN A;  2YKH A;  4OLG A;  3VSK A;  2WKP A;  3U2A A;  3IH8 A;  5A8B A;  4NKP A;  4P6B A;  1PWD A;  2OAP 1;  4OP8 A;  4MBH A;  4JXV A;  1OTA A;  3G30 A;  2E8J A;  3BY8 A;  3FKW A;  5AVE A;  4X6T A;  4HES A;  1N9N A;  2XLN A;  4U3T A;  2V8C A;  4E3N A;  4MNR A;  1GA9 A;  3FKV A;  1L0E A;  1IFQ A;  3WS0 A;  2Y2M A;  3V50 A;  5HSQ A;  3T1Q B;  2XDM A;  4P85 A;  3NIA A;  3NY4 A;  2WGW B;  4EES A;  1YSQ A;  3V67 A;  3TSG A;  2XF3 A;  3VOL A;  1SZV A;  2HDU A;  5IS1 A;  3VP3 A;  1GCE A;  2RCX A;  4WM9 A;  4K0X A;  3EQU A;  1S1Y A;  2K31 A;  4DDY A;  2P7J A;  3NC8 A;  2DNS A;  1TVF A;  4KUO A;  2D02 A;  3LO7 A;  4F94 A;  4LV0 A;  4FH4 A;  4N9L A;  1IYQ A;  5GHX A;  4D60 A;  1MY8 A;  4GZB A;  1PI4 A;  1PIO A;  3LGO A;  3BY9 A;  2HV1 A;  3FPW A;  1STZ A;  5G18 A;  2WKQ A;  3ZNY A;  5EUA A;  4IVI A;  5IU1 A;  4I3J A;  1CK3 A;  3MMH A;  1SKF A;  3BLM A;  2KDK A;  4OPR A;  2G2U A;  4Y2F A;  3LID A;  2BG1 A;  2BTF P;  4F3L B;  1K57 A;  4S2L A;  2P08 A;  3OPR A;  4CQH A;  3ZNT A;  5F68 A;  5A90 A;  1HLU P;  3F1P B;  4OQH A;  3EOI A;  4FOF A;  4JPM A;  2E8I A;  4RA7 A;  1PRQ A;  3Q07 A;  1CJF A;  4U0X A;  1ERO A;  3A3F A;  5FQI A;  3UB8 A;  3KX0 X;  3M2J A;  4L9E A;  2ZMF A;  4DN0 A;  3OLO A;  3Q81 A;  4PAU A;  3HJK A;  3V5M A;  2V1B A;  1XJ6 A;  5DFX A;  2K7S A;  3D4F A;  3Q7Z A;  2PR6 A;  3SH8 A;  2Y2P A;  1D06 A;  2W3D A;  1H3Q A;  4MBK A;  1G6A A;  2ACG A;  1ES4 A;  4LGW A;  1XXM A;  1G68 A;  2O0Y A;  2WGV A;  4BMW A;  3WRT A;  4X25 A;  2V0U A;  3IBJ A;  3PBS A;  4B9O A;  4U0T A;  3SS3 A;  3N8S A;  2VV7 A;  5AVF A;  5I94 A;  3SOI A;  4JGQ A;  1OTB A;  3FC7 A;  1W63 M;  1K4E A;  2Z6D A;  2DRW A;  5EVI D;  5CGX A;  1ERQ A;  3K3D A;  2XD1 A;  2VLG A;  4FCF A;  1L0F A;  3HL9 A;  5HWV A;  2VKS A;  1FCO A;  2OAQ 1;  4JF5 A;  4X55 A;  2WUQ A;  4WEK A;  1RGY A;  3M6B A;  5E2F A;  2J9P A;  1N4O A;  2ZQ7 A;  1BLC A;  1BYW A;  4MBF A;  1G5U A;  2BLS A;  1Q2Q A;  1HD8 A;  5C5K A;  1CF0 A;  1ES3 A;  1LL5 A;  4DF6 A;  2OWH A;  3T50 A;  5CX7 A;  1P0Z A;  1XA1 A;  2C5W B;  2Y79 A;  3NUL A;  4EBN A;  2Y2L A;  2ZMA A;  3G32 A;  3VFF A;  3ZHH A;  2W3F A;  2HP9 A;  4GLQ A;  4GS9 B;  3E2L A;  2X02 A;  5EOO A;  1IKG A;  4LCL A;  1ES5 A;  3ZG5 A;  3E4Q A;  1XJ4 A;  1V9Y A;  1YKD A;  2UV0 E;  4OQI A;  4Z9Q A;  3K3C A;  1GSW A;  4YWZ A;  4D2O A;  1K54 C;  1NWZ A;  5HD5 A;  1IOU A;  5FAQ A;  1E4D A;  4XUX A;  2ZQD A;  4GN2 A;  3HLB A;  4R1G A;  2W1T A;  3IHA A;  1MKI A;  5GLB A;  4DRT A;  3CHW P;  5A91 A;  3UMD A;  3KYE A;  5FL3 A;  5G4Z A;  5CED A;  4IED A;  3C30 A;  4NXE A;  1F5M A;  3ZQ5 A;  1KGE A;  3ZG7 B;  3MFD A;  4IHQ A;  4HOI A;  3HLD A;  5HPI A;  1LHY A;  2B18 A;  1M40 A;  3V3R A;  2KX6 A;  3HBR A;  4NET A;  3UY6 A;  3IH9 A;  3C8C A;  2Q9N A;  3C38 A;  3O88 A;  4ID4 A;  4B4Z A;  4JXW A;  5CEC A;  3W8K A;  1KE0 A;  1L2S A;  2QPN A;  4B4X A;  3F1P A;  3MXQ A;  1K55 A;  5FDH A;  3S7O A;  1IKI A;  2Y2K A;  5M19 A;  4JBF A;  4S2I A;  3C4P A;  1P97 A;  1IEL A;  3W4O A;  1JNU A;  2IWC A;  3MSH A;  1TS7 A;  2V1A A;  4WL9 A;  5G4Y A;  5GLA A;  1T1B A;  3G34 A;  2HP6 A;  4E6X A;  3GQZ A;  2I72 A;  2EXA A;  3RXW A;  4GS9 A;  2H0Y A;  2PHY A;  1S0W A;  2JKR I;  5DFY A;  4LV2 A;  5FAO A;  2INW A;  3NOT C;  4GNU A;  4ZJ1 A;  4IJG A;  3Q7V A;  5FQQ A;  4CLC E;  1FIK A;  3BEC A;  3DWZ A;  3IS2 A;  1NJ4 A;  1RGZ A;  2LB9 A;  5TGF A;  2EFX A;  3MXS A;  3S7Q A;  3ZG9 B;  2KOI A;  5K5B A;  4OPQ A;  3BRM A;  1MWT A;  4NG2 A;  3K2N A;  3LR5 A;  1DP9 A;  4S2O A;  2W3H A;  2QMI A;  5FQM A;  2PYP A;  4X69 A;  5EE8 A;  1UWP X;  2JKT I;  1G28 A;  5E2G A;  4EUZ A;  2Y2Q A;  5AQ7 A;  1T1C A;  1Y28 A;  3EGD C;  4Y13 A;  2G7U A;  1GHM A;  1PWG A;  4CLC D;  4P6Z S;  3OPP A;  4FH2 A;  1MZU A;  4MN6 A;  1CI8 A;  3KSH A;  1GHI A;  3U4L P;  4CPK A;  2V8F A;  3AGD A;  4Y15 A;  4ETZ A;  3LEZ A;  4KZ4 A;  1T1A A;  3DTM A;  4K0W A;  3QP8 A;  4FSF A;  2WKI A;  2RL3 A;  2ZMV A;  4LLO B;  1YLY A;  2Y2G A;  5DTK A;  1YLJ A;  4IVK A;  2M7V A;  3PBQ A;  4EQ1 A;  5KIZ A;  3SZT A;  5EVL A;  3HJI A;  4PM8 A;  5KZH A;  4PMA A;  5F6A A;  2EWW A;  5DJU A;  1H0M A;  5HFO A;  5TR7 A;  3WS5 A;  1P9R A;  3OOV A;  3MQ0 A;  4PM7 A;  3HCY A;  2J7V A;  3NOP C;  1GHP A;  3MR0 A;  4M3K A;  2ZLY A;  4E3J A;  4BBV A;  1VET A;  2P9V B;  3PHY A;  3F1N A;  2OOL A;  4DE3 A;  4JGO A;  2Y2H A;  3ZYT A;  2XA7 M;  5DF7 A;  3RXX A;  3B42 A;  4OQ0 A;  3R7W B;  5GHY A;  2PR5 A;  3EGX C;  5EV0 A;  4JF4 A;  2VGL S;  3FG8 A;  1BZA A;  2WK0 A;  3BQ8 A;  4LV3 A;  4O0P A;  2ZQC A;  4OQG A;  3T4O A;  1H5X A;  4GHI B;  3KSI A;  4E3K A;  2W1T B;  1ZG4 A;  4PKY G;  3AGE A;  5EVI A;  4KEN B;  4JXS A;  2FFF B;  1PZP A;  1T19 A;  3E0Y A;  5FQ9 A;  5GL9 A;  2W3G A;  3T4K A;  5J4E A;  2FFY A;  1TS8 A;  1Q2P A;  1MXO A;  3GEC A;  3S4X A;  3CAX A;  4BLM A;  3RTY A;  2ZL1 B;  3LR4 A;  3JVU A;  3UB7 A;  2V2F F;  1PYY A;  4UA7 A;  3AGF A;  5EFW A;  4CLC C;  3D3O A;  4UQI M;  2X01 A;  2V9A A;  1BTL A;  3CUE A;  1PFL A;  4X56 A;  1H8Z A;  1JWZ A;  3OZH A;  4WMC D;  2EX9 A;  4R23 A;  1KDS A;  5L2F A;  1W7F A;  3DW0 A;  4GDB A;  4DJ2 A;  2NUP C;  2PU2 A;  3PBO A;  2Y59 A;  2ZOH A;  4Y0T A;  4H6J B;  1QMF A;  1FOF A;  1Y54 A;  2QWS A;  3LIC A;  1XFQ A;  2WAE A;  4QB8 A;  1J9M A;  1K6R A;  1W63 Q;  1IYS A;  1YAX A;  4WEJ A;  2PBD P;  1VEU B;  1BLS A;  3UNW A;  2ZC6 B;  3ZVW A;  4YNR A;  5HAI A;  3C7U A;  3NCK A;  4Q0H A;  2Y4A A;  3D9Y A;  1JTG A;  4JGP A;  1OJ5 A;  2AVX A;  3NDG A;  5FAP A;  4EW7 A;  2P74 A;  1U60 A;  3FWL A;  2WGW A;  3UPO A;  1NLZ A;  4FUW A;  4HH3 A;  3UB9 A;  3ZG0 A;  4LRX C;  1TDL A;  3H82 B;  3QP1 A;  2WZZ A;  2WKH A;  5F1G A;  3PAG A;  2ZJ9 A;  3HUN A;  4AFI A;  4S2M A;  4OKP A;  1F98 A;  1FCN A;  4KZ3 A;  4IUH A;  1D7E A;  3KYQ A;  4OH0 A;  1KE4 A;  3IF6 A;  3HLF A;  3P01 A;  4NXB A;  4Y17 A;  5F83 A;  3VSL A;  3UE6 A;  2ZQ9 A;  4GW9 A;  3EWK A;  5FI6 A;  4KZ5 A;  1S67 L;  2MJ6 A;  2ZL1 A;  1PW1 A;  3DBA A;  4Y5F A;  3V39 A;  3HLG A;  2C6W B;  4F3L A;  3C4O A;  3QNB A;  1V9Z A;  4UQI S;  1L0G A;  4EQI A;  2W3E A;  5F82 A;  1YT4 A;  5FI7 A;  4E3L A;  3A0S A;  3IQA A;  4N92 A;  4L9G A;  1XKZ A;  3BYD A;  1YLT A;  2QJ5 A;  4DXC A;  1OJG A;  3P09 A;  1SDE A;  3NOU C;  1K56 D;  3IXD A;  1K25 A;  3B33 A;  3O86 A;  3RH8 B;  4KUK A;  4JKT A;  2J9O A;  1MWS A;  2CMN A;  3OBF A;  5DKK A;  3VP0 A;  1DJA A;  3UE1 A;  3R7W A;  3CI6 A;  1O07 A;  3PBN A;  4S2K A;  2WZX A;  4NK3 A;  1NZO A;  5L8M A;  4E3O A;  3S22 A;  5KSH A;  3UO9 A;  3IWO A;  3P98 A;  5TFQ A;  2Y2J A;  4WUJ A;  2O9C A;  5GLC A;  3ITA A;  3H9W A;  1GA0 A;  3UDI A;  1L0D A;  2V20 A;  2XFS A;  3GVB A;  2J8Y A;  1ODV A;  3BFG A;  1D1J A;  1ZKJ A;  3E2K A;  3IF6 C;  1PWC A;  1YLW A;  1KVM A;  2OWJ A;  3DTI A;  4Q0I A;  4HH2 A;  1CI9 A;  2ZM8 A;  2XGN A;  4GB7 A;  3MZF A;  2Y2N A;  4HBT A;  3MKE A;  2HGV A;  1W8Y A;  1OTD A;  5HWT A;  4DKI A;  2VEA A;  4BQM A;  1XGI A;  4S2P A;  1ZG6 A;  1VEU A;  2OLU A;  3NHQ A;  4H6J A;  1KOU A;  3PBR A;  2PD7 A;  2NUT C;  4YOF A;  1JWV A;  5L09 A;  2G2W A;  4Y0U A;  5HDC A;  1W8Q A;  3RJU A;  2JE5 A;  4XT2 A;  1HVB A;  1G6O A;  3QP6 A;  2A2L A;  3OCL A;  4LRY C;  3IF5 A;  1XJ3 A;  1BT5 A;  5E43 A;  4OP5 A;  1TS0 A;  4KQD A;  1TEM A;  3A3J A;  2HJ9 C;  4GCZ A;  1OPX A;  5MC7 A;  3IT9 A;  1M6K A;  1FQG A;  5EM1 A;  5HL6 A;  1MPL A;  2JHE A;  1NY0 A;  5AJG A;  3BFE A;  1DP6 A;  4OPY A;  3MQO A;  4JGR A;  1E3U D;  1XFN A;  3PYP A;  3H82 A;  4HEF A;  1ZC2 A;  1S66 L;  1H8M A;  5KSC A;  1AXB A;  3SH9 A;  3LY4 A;  1BSG A;  2D01 A;  3KYZ A;  4E6W A;  1ONH A;  1SKO B;  2VGK A;  4XUZ A;  4R4S A;  3SS4 A;  2XSS A;  4C3Q A;  2Y55 A;  2XFT A;  4IUK A;  2PD8 A;  3HLW A;  1PZO A;  1K6S A;  4B88 A;  3IWQ A;  4A5R A;  4HJ3 A;  4PM9 A;  1LLB A;  3VV4 A;  5HZH A;  2L0W A;  4QWO A;  1EW0 A;  2O9B A;  2ZOI A;  2XRO A;  2OLV A;  3L9K A;  4HHD A;  3ZDJ A;  1FIL A;  2I9V A;  1XA7 A;  4JXG A;  2HDQ A;  2PU4 A;  3OPL A;  1YM1 A;  3ZFZ A;  4IBX A;  5HX9 A;  5IT5 A;  3G31 A;  4KQR A;  3LI9 A;  4HIA A;  3SW1 A;  4PHT A;  4O01 A;  5EOE A;  2WYX A;  2OSU A;  3Q7V B;  3PXP A;  2VK3 A;  1PW8 A;  2W27 A;  3LIB A;  4EUV A;  3CZD A;  2P04 A;  3IX3 A;  5L10 A;  2WKR A;  4LV1 A;  3WS2 A;  5LBR A;  4BL3 A;  2EX6 A;  2QKP A;  3CUE C;  5EEC A;  5FI2 A;  3BW6 A;  3W4P A;  5KMW A;  4DJ3 A;  5F69 A;  1ACF A;  2EX8 A;  4G3W A;  1KDW A;  2ZC4 B;  3MKF A;  3MF0 A;  1LSX A;  1PI5 A;  4BD0 A;  5EPH A;  4DXB A;  4LRZ E;  2FZ0 A;  4RX3 A;  4DDS A;  3IXH A;  2HDS A;  4KZA A;  4GKU A;  4Z1W A;  1KVL A;  1SKO A;  4NXF A;  3DTK A;  2JKR M;  3O87 A;  3E4P A;  5FAS A;  3MZD A;  2UWX A;  4WMC A;  4ZDX A;  3F1O B;  5FQK A;  3PTE A;  3T1S A;  3O3V A;  3DTE A;  1ES2 A;  1NRJ A;  4BJP A;  5DTS A;  4K91 A;  4WN5 A;  5TBM A;  2ZQ8 A;  4NEE D;  4KG6 A;  2DMW A;  3VP2 A;  5HL1 A;  4ZJ2 A;  4S2N A;  4X1L A;  5DF9 A;  1H8Y A;  2A3U A;  4EBP A;  1FR1 A;  3S7N A;  3Q82 A;  3T4Q A;  1NRF A;  2ZC7 A;  1YLP A;  3N8R A;  1OME A;  5HAP A;  1IEM A;  5CHM A;  5IHV A;  3MQQ A;  1FSW A;  3WWX A;  3T12 B;  3G2Z A;  5CGS A;  4WZ4 A;  4BBU A;  1SHV A;  4GDN A;  5A92 A;  5F1F A;  4R4R A;  4MN7 A;  3G2Y A;  4GD6 A;  5FEF A;  3W4Q A;  4IBR A;  2H10 A;  4HQA A;  1WA9 A;  3UPN A;  4N1H A;  3LFV A;  1JTD A;  1K38 A;  1K56 A;  3QHY A;  2H0T A;  1MBL A;  1OTI A;  1RCJ A;  1TF1 A;  4QU3 A;  2DCF A;  2R78 A;  5FA7 A;  3SH7 A;  2H5S A;  3QP4 A;  3M6H A;  3GMW A; 
#chains in the Genus database with same CATH homology
 3LIF A;  4L0L A;  3K3D A;  4K08 A;  4AFI A;  2VLG A;  4QPR A;  5HPF A;  1F98 A;  5TBM B;  5HWV A;  4IUH A;  2VKS A;  1D7E A;  3OC2 A;  2OAQ 1;  3KYQ A;  4WEK A;  4MN5 A;  3LYX A;  3P01 A;  4NXB A;  4HI4 A;  3F1O A;  3UE6 A;  3LUQ A;  4XT2 B;  4UEY A;  1BYW A;  2GJ3 A;  2W1R A;  3TW8 A;  3A0R A;  4GW9 A;  3EWK A;  4Y3I A;  3A0V A;  5C5K A;  1VHM A;  1S67 L;  4EEU A;  3NJA A;  4G3V A;  4G3K A;  2MJ6 A;  2OWH A;  4RQ9 A;  3T50 A;  5HWW A;  3DBA A;  5CX7 A;  1P0Z A;  1XJ2 A;  4Y5F A;  4GJ4 A;  4KQO A;  3S7P A;  2Y79 A;  2A24 A;  4F3L A;  4P6Z M;  1V9Z A;  2W3F A;  4UQI S;  2LB5 A;  4WF0 A;  4DMZ A;  4GLQ A;  4GS9 B;  2W3E A;  3D72 A;  3A0S A;  3G6O A;  4L9G A;  1MKM A;  2QJ5 A;  1OJG A;  3NOU C;  1OT9 A;  3KSG A;  3E4Q A;  1XJ4 A;  2PYR A;  1V9Y A;  3JVV A;  1YKD A;  2VA0 A;  3PR6 A;  3KO6 A;  3K3C A;  3B33 A;  3CIT A;  5HDD A;  1GSW A;  4MMN A;  4YWZ A;  3RH8 B;  4GHI A;  3O5Y A;  4KUK A;  3CWF A;  1NWZ A;  5HD5 A;  1IOU A;  2CMN A;  3OBF A;  5DKK A;  2W1T A;  2O9A A;  3R7W A;  3CI6 A;  4EER A;  4LPZ A;  3PBN A;  3P7N A;  5DKL A;  3UME A;  1LT0 A;  3H7W A;  5L8M A;  3UMD A;  5FL3 A;  4CLC A;  2GX5 A;  5G4Z A;  4L9F A;  1TS6 A;  5KSH A;  3C30 A;  4NXE A;  2EWV A;  1F5M A;  1MC0 A;  3ZQ5 A;  3UB6 A;  4IHQ A;  4HOI A;  5HPI A;  4WUJ A;  2O9C A;  3BWL A;  3LIE A;  2B18 A;  3H9W A;  2KX6 A;  3C8C A;  3ICY A;  3C38 A;  1ODV A;  3EEH A;  1GSV A;  3E98 A;  2VV8 A;  2PT7 A;  4R38 A;  3GDI A;  3MJQ A;  4MCW A;  3F1P A;  3MXQ A;  2OWJ A;  4BBT A;  2W0N A;  4Q0I A;  3S7O A;  4HH2 A;  4EET B;  3LI8 A;  2J3W A;  1UGU A;  4O8G A;  3LIA A;  1P97 A;  2QHK A;  4BWI A;  1JNU A;  1TS7 A;  2V1A A;  4HNB A;  3B47 A;  2HGV A;  4WL9 A;  3EQV A;  5G4Y A;  1OTD A;  1T1B A;  5HWT A;  2HF6 A;  4HP4 A;  4EXO A;  1GSX A;  2VEA A;  4GS9 A;  3E4O A;  2PHY A;  1LSW A;  4I5S A;  2VJW A;  3NHQ A;  4H6J A;  1KOU A;  2M7U A;  3PBR A;  2JKR I;  2NUT C;  2PD7 A;  4YOF A;  3EEA A;  5DFY A;  3ULF A;  3T4T A;  3TE8 A;  2B02 A;  2INW A;  3NOT C;  5HDC A;  2ZBB A;  4XT2 A;  1G6O A;  2GNX A;  4IJG A;  4R6L A;  2A2L A;  3OCL A;  4LRY C;  1XJ3 A;  4ME4 A;  1X0O A;  2QYB A;  5F5Y A;  4CLC E;  1TS0 A;  4KQD A;  4I3I A;  1S4S A;  2HJ9 C;  2V0W A;  4EEP A;  4II7 A;  4EU0 A;  5I5L A;  3IS2 A;  4GCZ A;  1NLY A;  1UWN X;  2J80 A;  1S1Z A;  1OPX A;  5MC7 A;  2LB9 A;  1ZTU A;  2HJE A;  3S7Q A;  2VZW A;  3H7W B;  2JN7 A;  2KOI A;  5K5B A;  3LR3 A;  4E04 A;  5HL6 A;  2JHE A;  5AJG A;  3T4J A;  1DP6 A;  3MQO A;  4JGR A;  3W2Z A;  3K2N A;  3LR5 A;  1DP9 A;  1XFN A;  3PYP A;  2EA9 A;  2QJ7 A;  3H82 A;  2W3H A;  3R4K A;  1DP8 A;  1OT6 A;  1S66 L;  1H8M A;  1YSP A;  2PYP A;  3TRC A;  2YKF A;  1UWP X;  2JKT I;  2XRN A;  1G28 A;  4M4X A;  2D01 A;  3KYZ A;  4HJ4 A;  4R70 A;  1T1C A;  1Y28 A;  3T4L A;  3EGD C;  2IA2 A;  2G7U A;  2VGL M;  2O99 A;  4CLC D;  3MFX A;  4P6Z S;  3RFB A;  2XSS A;  3T4S A;  4IUK A;  2A24 B;  2PD8 A;  1MZU A;  4Q0J A;  4MN6 A;  2M1C A;  3KSH A;  4HJ3 A;  3C2W A;  4HJ6 A;  3VV4 A;  4OOL A;  4ETZ A;  2J3T D;  2H28 A;  5HZH A;  2L0W A;  3BJN A;  2GZA A;  1EW0 A;  2O9B A;  2ZOI A;  1T1A A;  2XRO A;  2YKH A;  4FSF A;  4HHD A;  2WKP A;  3IS2 B;  3U2A A;  2ZMV A;  4LLO B;  5A8B A;  4MDZ A;  2I9V A;  4NKP A;  1T18 A;  2OAP 1;  5TJJ A;  3PBQ A;  2M7V A;  4ARZ B;  1N9O A;  4EQ1 A;  2XA7 S;  5KIZ A;  3HJI A;  1OTA A;  2Z6C A;  5IT5 A;  5F6A A;  3F1N B;  3BY8 A;  2EWW A;  3LI9 A;  5DJU A;  1ZHH B;  4HIA A;  5AVE A;  1P9R A;  4WEL A;  1TD5 A;  3OOV A;  3MQ0 A;  4HP9 A;  1N9N A;  3SW1 A;  1P9W A;  4PHT A;  3KSF A;  4O01 A;  3HCY A;  3NOP C;  3MR0 A;  4I39 A;  1S4R A;  4BBV A;  2VX8 A;  2KLI A;  3CLO A;  3PXP A;  1IFQ A;  3PHY A;  3F1N A;  5HSQ A;  2OOL A;  2W27 A;  3LIB A;  3VE4 A;  4EUV A;  4JGO A;  4OOM A;  2P04 A;  3ZYT A;  4EES A;  2XA7 M;  1YSQ A;  2WKR A;  2BAS A;  3B42 A;  5LBR A;  2QKP A;  3CUE C;  3R7W B;  3V67 A;  2PDR A;  2PR5 A;  2J3T C;  3BW6 A;  3EGX C;  3VOL A;  4DJ3 A;  5F69 A;  5IS1 A;  2VGL S;  2K2N A;  3FG8 A;  3PBT A;  4G3W A;  4I3A A;  3BQ8 A;  3TJZ C;  4O0P A;  3EQU A;  1S1Y A;  1VB6 A;  3T4O A;  1LL8 A;  4GHI B;  2K31 A;  3KSI A;  2VV6 A;  3OCN A;  2W1T B;  2P7J A;  1F9I A;  4PKY G;  3MF0 A;  1LSX A;  4LRZ E;  4KUO A;  2D02 A;  2FZ0 A;  3IBR A;  4ETX A;  1T19 A;  3E0Y A;  2L1M A;  5DJT A;  3T4K A;  2W3G A;  2HV1 A;  3BY9 A;  5HD3 A;  4Z1W A;  3FPW A;  5J4E A;  4NXF A;  1STZ A;  2WKQ A;  1TS8 A;  2JKR M;  3E4P A;  3GEC A;  1N9L A;  3CAX A;  5IU1 A;  4I3J A;  3RTY A;  3MMH A;  3F1O B;  3LR4 A;  3JVU A;  3UB7 A;  2KDK A;  4Y2F A;  3LID A;  4I38 A;  4HY8 A;  1OTE A;  1NRJ A;  4F3L B;  4BJP A;  2P08 A;  5EFW A;  4CLC C;  3D3O A;  4UQI M;  4WN5 A;  5J7E A;  4CQH A;  5TBM A;  5F68 A;  2V9A A;  4NEE D;  3F1P B;  3CUE A;  3EOI A;  4FOF A;  4WLA A;  2DMW A;  1DRM A;  5DF9 A;  4ARZ A;  3UB8 A;  3LR0 A;  3KX0 X;  4DJ2 A;  4L9E A;  2ZMF A;  4CLC B;  4B93 A;  1LSV A;  2NUP C;  4DN0 A;  3S7N A;  3PBO A;  5J3W A;  3OLO A;  4PAU A;  3T4Q A;  3HJK A;  2V1B A;  1XJ6 A;  2ZOH A;  4H6J B;  5DFX A;  4R3A A;  3VE3 A;  2K7S A;  2QWS A;  3LIC A;  1XFQ A;  2PR6 A;  4PKY A;  3UE3 A;  2L4R A;  5HDS A;  3MQQ A;  3BQA A;  1D06 A;  2W3D A;  1H3Q A;  1W63 Q;  4BBU A;  1YAX A;  4NXG A;  4WEJ A;  4MN7 A;  4YNR A;  4HQA A;  1WA9 A;  4Q0H A;  2O0Y A;  4BMW A;  3LFV A;  4ZRR A;  3FPV A;  4JGP A;  1OJ5 A;  2V0U A;  2JKT M;  1OTI A;  1TF1 A;  4EW7 A;  2R78 A;  2Y8H A;  3IBJ A;  3PBS A;  2FH5 A;  4B9O A;  2VV7 A;  5AVF A;  1NLZ A;  4JGQ A;  1OTB A;  3FC7 A;  4HH3 A;  3UB9 A;  1W63 M;  2Z6D A;  4LRX C;  3H82 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...