4B88A

Ancestral (gnca) beta-lactamase class a
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
260
structure length
260
Chain Sequence
QLSEQLAELEKRSGGRLGVAVLDTATGRRIAYRGDERFPMCSTFKALLAAAVLARVDQGKERLDRRITYGKEDLVDYSPVTEKHVGDGMTVAELCEAAITLSDNTAANLLLEALGGPAALTAFLRSIGDEVTRLDRWEPELNEAAPGDPRDTTTPAAMAATLRTLLLGDALSPASRQQLVDWLVANKTGDKRLRAGLPADWRVGDKTGTGGHGTTNDIAVIWPPGRAPIVVTVYLTESQVDADARDAVIAEVGRLVVEAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-LACTAMASE
publication title Hyperstability and Substrate Promiscuity in Laboratory Resurrections of Precambrian Beta-Lactamases.
pubmed doi rcsb
source organism Synthetic construct
total genus 93
structure length 260
sequence length 260
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2012-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4b88A00
2I72A 2Y2JA 4CJNA 2ZC4B 1C3BA 1TDLA 4P6BA 3OPLA 4PM6A 3BEBA 1K6RA 4KG2A 3Q07A 3AGFA 1LHYA 4C75A 1PI4A 1RGZA 1BLCA 3G2YA 4OOLA 3NDGA 3LO7A 4WMCA 5FAQA 3SH7A 1IYSA 4QY5A 1Q2QA 3Q7ZA 4KZ9A 4DE1A 3C7VA 4QB8A 3A3JA 4RYEA 1K56D 1N9BA 2HDRA 3M6BA 3N7WA 3OC2A 3B3XA 1TVFA 2WKHA 2ZQ9A 4OQ0A 3UE3A 1XGIA 3HL9A 3MZFA 2XD5A 4EQIA 3N6IA 5CGXA 5EOOA 5FI6A 2XD1A 4DRTA 4CPKA 1BTLA 2H5SA 1PWGA 3MKEA 4GD8A 4WM9A 3I7JA 3NCKA 1E3UA 4S2LA 2Y2OA 2EX8A 5GHZA 4KZ8A 3VOZA 5A93A 4GDNA 2C6WB 3Q7VA 3IWIA 3FZCA 4X55A 2XDMA 4DKIA 4XUZA 3UPPA 3RJUA 4UA6A 2XR0A 2WKEA 2H10A 2ZC5B 1OMEA 1IYPA 2PU4A 3GR2A 4Y0TA 2DCFA 4WZ4A 4N1XA 4LV2A 2Y2PA 5IHVA 1O7EA 2WZZA 3CZDA 4O7DA 3IXHA 3SS4A 3DW0A 5AQAA 5FA7A 3ZDJA 4DF6A 2E8IA 4UAAA 4B88A 2Y59A 1KGGA 1ZKJA 1XP4A 3ZG5A 1L0GA 1W5DA 5HARA 3O86A 3P09A 1DJAA 5FSRA 2XK1A 2JE5A 4N9LA 4Z9QA 3Q81A 1WYCA 1JWZA 5F83A 3IHAA 1ES4A 5DTSA 1CEGA 4XXRA 3PBNA 1N4OA 4S2JA 1J9MA 2XH9A 5EVIA 3HBRA 4R3BA 3JYIA 1GA0A 2ZQ7A 5TGFA 4NK3A 4QD4A 2WGWA 4GD6A 1L0EA 1KE3A 2BG1A 2ZC6B 4OLGA 5FQJA 3OPHA 4GB7A 2Y2QA 4YINA 4K91A 2WAEA 2ZJ9A 2WADA 2WUQA 1W79A 2WZXA 5F1FA 1BT5A 5EVIB 3PBTA 4UA7A 3IWQA 5M19A 3QNBA 1AXBA 3ISGA 3W4QA 4GNUA 5GLDA 1KE4A 2WK0A 2ZC3B 3UNWA 1NZOA 2CC1A 5FDHA 4WYYA 1KGFA 1VM1A 5JYOA 4EBLA 2Y2IA 4QU3A 4EV4A 2ZQAA 3NIAA 4OONA 1ERMA 2OLUA 3NI9A 4S2MA 5DF9A 3PBQA 2Y2HA 4B4ZA 3DWKA 4MNRA 5CGWA 4N1HA 5EOEA 3HLWA 3TSGA 3SS3A 1MWTA 4KZBA 1K4EA 4E3OA 1EWZA 3FV7A 3BLMA 4P85A 4PM7A 1MBLA 3IHBA 3VMAA 1S0WA 2X71A 3HLDA 5DVAA 3FWLA 3W8KA 1YT4A 4N92A 1L0DA 2XF3A 4QY6A 5FQIA 2V20A 3A3FA 1I5QA 2HDSA 3BRMA 5GHXA 1DJCA 3LY4A 1XA7A 3MZEA 2J9PA 2BLSA 4S2NA 3VP0A 1NY0A 1RCJA 3EQUA 2IWCA 3ZNTA 3SH9A 4KQRA 5CEDA 5FATA 1S6RA 2XQZA 1E25A 2ZQ8A 3ZGAB 2EX9A 1GHMA 2EFUA 3IF6A 4Y0OA 5L2FA 4WZ5A 4ZJ1A 3BFCA 1ESIA 2Y2NA 1MY8A 1LI9A 3VP3A 1BZAA 1IEMA 1YLTA 2C5WB 1NZUA 3GRJA 3IWOA 4FCFA 2X01A 2ZD8A 1FCNA 3IT9A 3E2KA 3WS2A 4BL2A 3IF6B 5E43A 3NY4A 4K0WA 4R1GA 4XUXA 3V5MA 5A92A 1JTDA 3AGEA 2JBFA 5DTKA 1YMSA 4IEDA 2ZC7A 3M2KA 5FAOA 3MBZA 3ZCZA 2Q9NA 3QNCA 1HTZA 1XA1A 2HDQA 3HLBA 1QMFA 4B4XA 1LL5A 3G2ZA 4FH4A 4H8RA 3LEZA 4S2PA 4OOYA 3BFEA 5FASA 2EFXA 1LI0A 5EUAA 3RXXA 3HLGA 3HREA 1FOFA 4HBUA 2XEPA 1H8YA 4Y7PA 4FSFA 1EROA 4DE3A 2JCHA 3EQVA 1Q2PA 4RX3A 2GDNA 5EVID 1DJBA 1NYYA 1NXYA 2Z2LB 1JVJA 1YLJA 1PWCA 3A3EA 1FSYA 4EBNA 4R23A 4S2IA 1ALQA 3ZG8B 2ZMAA 4HESA 2OSUA 4X68A 4E3JA 4PM9A 3M6HA 1PW1A 3BLSA 1GA9A 4WEJA 4WEKA 5FI2A 5FQ9A 3C7UA 4KZ4A 2ZQDA 1K55C 1MPLA 1KVLA 2WGVA 3V3RA 4JKTA 4MBKA 1K57A 3N4IA 5FQQA 2A3UA 3MXRA 3GVBA 5TFQA 3A3DA 3M2JA 5GLCA 4BENA 1BSGA 3Q7VB 3WS5A 1WE4A 3BM6A 3ZG9B 2J9OA 4S2KA 2HDUA 3OPPA 1FSWA 1YMXA 1ESUA 2WGIA 4P87A 5U47A 3UDFA 4GZBA 2OV5A 2XLNA 4OKPA 4JXVA 2EXBA 3G35A 4MBHA 3GTCA 3G31A 3HUMA 3RXWA 2ZLYA 1IKIA 3ITBA 4ZJ2A 1K4FA 1YQSA 3D4FA 4IBRA 4JXSA 3N8LA 3HUNA 4PM5A 2QMIA 1IYOA 1JTGA 3IXDA 3CMZA 5CHUA 5CTMA 1K25A 5D3OA 1BUEA 3S22A 3V50A 2OLVA 5JYPA 1BLPA 3NDEA 1HZOA 2IWBA 3IH8A 5E2FA 1GHPA 4BL3A 2Z2MB 3PBOA 3UE0A 3WS0A 5CRFA 3ZNYA 2IWDA 1K56A 1BULA 4IVKA 5F82A 1K54C 3O3VA 1MWSA 5EECA 1ES3A 2P9VA 3FYZA 3BFDA 4HBTA 4S2OA 5A90A 4LV3A 4X69A 2WGWB 3LCEA 5FAPA 4PPRA 4D2OA 1E4DA 2HPBA 4LCLA 5CERA 1GHIA 5F1GA 1FR1A 2ZM8A 1O07A 4OH0A 4WMCD 5KSHA 1FR6A 4OP5A 3UO9A 5BOHA 3IXBA 2H0TA 4ZAMA 3HLCA 2HP5A 4WBGA 4C3QA 4WELA 3C5AA 4HEFA 4U0TA 4OPZA 4BJPA 1PZOA 1LL9A 1SKFA 4U0XA 5TR7A 3VFHA 3MZDA 1L0FA 1YLYA 4ZJ3A 3WRZA 5A91A 1SCWA 2Y4AA 1MWUA 5FQMA 4LV1A 4OQHA 3VFFA 2UWXA 5CHMA 3ITAA 2XFTA 5HL1A 1IKGA 1E3UD 2H0YA 4OOMA 1G68A 3HVFA 2Y2KA 1MWRA 5KMWA 4GKUA 4RVAA 3VSKA 2B5RA 4IVIA 1H5XA 4X56A 3N8SA 5CHJA 3CJMA 4ZTKA 2Y2MA 1BLSA 4KQOA 3WS4A 2V2FF 5KZHA 1SDEA 5GHYA 4PMAA 1W8QA 1GCEA 3FKWA 4JF4A 4RX2A 3PAGA 5FI7A 3TOIA 4OPRA 3UPNA 4EUZA 5CEBA 3BFGA 4EWFA 1PIOA 3IQAA 1XGJA 3W4OA 3A3IA 5HAQA 3VOYA 1Z6FA 4ID4A 4KZAA 1HD8A 5HAPA 3ZFZA 4MBFA 3P98A 4ZDXA 3DWZA 4DE2A 5J8XA 5CXWA 1I2WA 3S4XA 2G2UA 3OCLA 3IH9A 3WWXA 5I94A 5AQ7A 3MKFA 3UDXA 5M1AA 4KZ3A 4QHCA 4OVDA 4GOGA 2J7VA 3IXGA 5EVIC 3Q82A 2Y55A 5E2GA 4UHUA 3MXSA 3G32A 1ES2A 2ZM2A 3G30A 4E3NA 3TG9A 1PI5A 2XFSA 2ZM0A 4E3LA 4X6TA 2QZ6A 3CG5A 1K6SA 3HUOA 1RP5A 4DDYA 4JLFA 4E3MA 3MFDA 1CI8A 5KSCA 1YLPA 3C4PA 3AGDA 1CK3A 1RGYA 2Y2GA 3HLFA 3W4PA 5GL9A 3UPOA 3OPRA 2J8YA 4KQQA 3BFFA 4LCMA 4DDSA 2ZQCA 2EX2A 4IBXA 1PYYA 4K0XA 3SH8A 1ONGA 2PU2A 2QPNA 4KZ5A 1IELA 4FD8A 3QHYA 3V39A 1TDGA 4OLDA 1L2SA 1IYQA 1W7FA 3O87A 4DXBA 2RL3A 4PM8A 5EVLA 4OP8A 3UN7A 4C6YA 1ZG4A 5EPHA 3IF5A 2WKIA 4KG6A 3PBRA 1BLHA 1NJ4A 4Y0UA 1MKIA 5HFOA 4DE0A 1U60A 2V1ZA 4E6WA 4F94A 4Q8IA 2PBYA 2HP9A 4A5RA 1SHVA 1YLWA 3GSGA 1I2SA 3G4PA 1DY6A 5EE8A 2WYXA 1K38A 3VP4A 2G2WA 1XPBA 1ES5A 3PBSA 1ZC2A 3GMWA 5E2EA 4X53A 4GN2A 1G6AA 1HVBA 1YLZA 4R4RA 2DRWA 2R9XA 1FCMA 3PTEA 3VSLA 4S2NC 4BD1A 5HX9A 4OPQA 3ZVWA 4KZ6A 2HP6A 2P74A 1WYBA 3WRTA 3E2LA 1XX2A 4LV0A 3IF6C 4E3KA 4EBPA 4L0LA 3OZHA 5DTTA 4JBFA 1QMEA 1PZPA 4JF6A 5CTNA 3OCNA 2Q9MA 4WZ5C 1M40A 2R9WA 5CECA 4RA7A 4JF5A 2WAFA 1NYMA 3ZHHA 3GV9A 1LLBA 5GLAA 1XKZA 1KVMA 3BYDA 3ZG0A 1KE0A 4KG5A 5HAIA 4KENB 3UY6A 2VGKA 1W8YA 4R4SA 3WS1A 3V3SA 1JWVA 1M6KA 1FQGA 2P9VB 4FH2A 1MXOA 4QJGA 3NC8A 1ONHA 2XGNA 5CGSA 3G34A 3N8RA 1VQQA 4YFMA 3HLEA 1K55A 4JXGA 4MLLA 4P0MA 1PW8A 5GLBA 1Y54A 5HW3A 4GDBA 1FCOA 4R0QA 4BD0A 3NBLA 4OQGA 4M3KA 1JWPA 3C4OA 5DF7A 4JPMA 3DTMA 4OQIA 1ZG6A 4ZBEA 5AQBA 1YM1A 5G18A 4U3TA 1KDSA 3UE1A 2A49A 4LENA 1CEFA 2RCXA 2Y2LA 5DF8A 4R3JA 3LY3A 4E3IA 5FQKA 1KDWA 1TEMA 2EX6A 3PAEA 2JC7A 2FFYA 4N9KA 4UA9A 4DXCA 1EI5A 3FKVA 1K57C 3SOIA 3VP1A 1KGEA 5M18A 3O88A 3S1YA 2Y91A 1XXMA 2VGJA 1SDNA 3ZG7B 2X02A 1ERQA 3GQZA 5E2HA 3SS5A 2FFFB 4BLMA 4OPYA 1H8ZA 3VP2A 5AQ9A 4JXWA 4E6XA 1NRFA 4KZ7A 3ZVTA 2EXAA 1CI9A 3BECA 4MEZA 3UDIA 4BQMA 4NETA 3Q1FA 1K54A 1PWDA 2DNSA
chains in the Genus database with same CATH superfamily
2I72A 2O99A 1TDLA 2OOLA 2VLGA 5F69A 3G2YA 3SH7A 3BY9A 4QB8A 3A3JA 4RYEA 5DJTA 3R4KA 1P9RA 3N7WA 4YNRA 2ZQ9A 1XGIA 3HL9A 1L3LA 5HD3A 5EOOA 1F5MA 2Y2OA 4KZ8A 3VOZA 5A93A 1OTEA 4X55A 3IWIA 5FL3A 4XUZA 3UPPA 3RJUA 2PAVP 2WKEA 5L07A 1ODVA 2ZC5B 2O0YA 3SW1A 2W3EA 4LV2A 2GJ3A 2Y2PA 1O7EA 2WZZA 3OOVA 3IXHA 3LR4A 2E8IA 4UAAA 1TS8A 1XP4A 3ZG5A 1W5DA 5HARA 3R7WB 2XK1A 3Q81A 3F1PB 1ES4A 1CEGA 2V1BA 1GA0A 3JYIA 2ZQ7A 4Y2FA 2WGWA 3CPTB 2ZC6B 4OLGA 4E04A 4YINA 2WAEA 3L7HA 1W79A 1BT5A 5EVIB 3QNBA 4HI4A 1AXBA 4BBTA 1KE4A 2ZC3B 5FDHA 5DJUA 4G3VA 2NUPC 4EV4A 4OONA 1ERMA 5DF9A 4KZBA 1EWZA 5HPFA 1CQAA 1HLUP 3EWKA 3W8KA 1YT4A 2XF3A 1FILA 5GHXA 1I5QA 5EM0A 1XA7A 2BLSA 2HGVA 4MN5A 5CEDA 1KOUA 2XQZA 2ZQ8A 4K08A 2EX9A 2EFUA 3FPWA 2J80A 3LIEA 1NZUA 3GRJA 3E2KA 4UQIS 3WS2A 4BL2A 2PBDP 4XUXA 3AGEA 1F9IA 2JBFA 5DTKA 2ZC7A 3MBZA 2Q9NA 2FH5A 5CX7A 3BW6A 4WN5A 1H8YA 2GDNA 1DJBA 1VEUA 1YLJA 2Z2LB 1FSYA 4R23A 4S2IA 4X68A 4PM9A 4ARZA 3T1SA 1MPLA 1UWPX 1KVLA 3T1QB 3E98A 5G4ZA 4MBKA 3N4IA 5FQQA 3MXRA 2QYBA 4EQ1A 3F1OB 3ZG9B 4S2KA 3OPPA 4Y5FA 2R78A 1N9NA 2EXBA 1NWZA 3RXWA 3A0RA 4IBRA 3N8LA 3IXDA 3CMZA 5CHUA 2A24A 5EM1A 1BLPA 1GHPA 3ZNYA 1K56A 1BULA 5A8BA 2Y8HA 2YKHA 1ES3A 2P9VA 3FYZA 3BFDA 4S2OA 2WGWB 4MDZA 1GSWA 1XJ3A 1FR1A 2ZM8A 4R38A 1OTBA 4ZAMA 4CLCA 1PZOA 1GSVA 2OWHA 3NOTC 2D02A 4NG2A 1NLYA 1MWUA 4LV1A 3QP1A 5CHMA 5HL1A 2XFTA 3A0VA 1E3UD 4KUKA 1X0OA 1PFLA 2KX6A 3VSKA 3LGOA 4ZTKA 4X1MA 4PKYG 1GCEA 4L9EA 4HH3A 3LIAA 1OT6A 4KZAA 3ZFZA 1ZHHB 4ZDXA 1T1BA 3KYEA 5CXWA 3S4XA 2G2UA 3WWXA 5I94A 3MKFA 3UDXA 3KO6A 1YAXA 4KZ3A 4QHCA 3ULFA 3NOUC 1CJFA 2J7VA 4MMNA 3G30A 4E3NA 4EW7A 1PI5A 2Y79A 2QZ6A 3CG5A 1DP8A 3KSIA 3VV4A 4R70A 1VEUB 1RGYA 2Y2GA 3OPRA 2ZQCA 4KZ5A 4OLDA 1L2SA 3O87A 2JKFA 2RL3A 5EVLA 1P97A 1ZG4A 2WKIA 4E6WA 4F94A 4Q8IA 3MQQA 3GDIA 1XJ2A 1K38A 2GNXA 2G2WA 2A2LA 4HQAA 2GZAA 1TS0A 4KQDA 2JKRM 3MQ0A 5E2EA 1SZVA 4GN2A 3PTEA 1S1ZA 2DRWA 3VSLA 4BD1A 4S2NC 3KYQA 4OPQA 1YPRA 3WRTA 4M4XA 1P0ZA 3IF6C 4EBPA 5DTTA 3OZHA 1QMEA 1PZPA 3KSHA 5CECA 3OCNA 2Q9MA 3K3DA 3LUQA 2A24B 4D60A 2OWJA 3ZG0A 4KG5A 4GS9A 3LR0A 3WS1A 3V3SA 2P9VB 3C8CA 1H3QA 3MSHA 4MLLA 4AFIA 5HW3A 4M3KA 3C4OA 4H6JA 3DTMA 4OQIA 4ZBEA 1YM1A 4CLCB 1XFQA 1IOUA 2A49A 5HPIA 4R3JA 3ZYTA 3F1NA 2JC7A 3IX3A 3CHWP 4IHQA 1K57C 4I39A 1S67L 5EVEA 5M18A 3C38A 1SDNA 2QKPA 1ERQA 1N9LA 4O0PA 1H8ZA 3VP2A 5AQ9A 1NRFA 4KZ7A 4NEED 4EESA 1PWDA 2DNSA 3BJNA 1MC0A 3MQOA 1C3BA 5HDDA 4PM6A 3H9WA 1G28A 4IUHA 3NDGA 3D72A 5FAQA 1IYSA 5DFYA 4JGRA 1N9BA 2HDRA 3OC2A 4YWZA 2WKHA 1OTAA 2QJ7A 2WKPA 4OQ0A 2XD5A 5CGXA 2V8FA 1DP9A 4XT2A 4DRTA 2XD1A 4CPKA 2H5SA 2HZ5A 4S2LA 4WF0A 5GHZA 4HIAA 2WKQA 2C6WB 3LIFA 2ACGA 2ZOHA 2PU4A 3R7WA 1Y4OA 5HDCA 3T4OA 5IHVA 4DJ3A 4Q0IA 4O7DA 4B88A 3MS6A 2Y59A 1L0GA 3P09A 1DJAA 2JE5A 3HJIA 4Y15A 1Y28A 4HJ3A 4XXRA 4S2JA 1J9MA 4EUVA 2XH9A 5EVIA 4R3BA 2VGLS 4NK3A 2BG1A 2L0WA 3IX8A 2W1RA 4GB7A 2ZJ9A 2WUQA 5F1FA 3IWQA 5M19A 4GS9B 2CC1A 4WYYA 5AVFA 5DFXA 2OLUA 2V8CA 4MNRA 3B47A 5EOEA 3OLOA 1MWTA 4E3OA 3K3CA 2VV6A 3VMAA 5L09A 4GHIB 1S0WA 2X71A 5DVAA 1GSXA 4N92A 1L0DA 5FQIA 4IUKA 1OPXA 3A3FA 3LY4A 3MZEA 2J9PA 3F1NB 4Y3IA 1S6RA 4I3AA 2VGLM 2B95A 3OBFA 4WZ5A 3L9KA 1MY8A 5IS1A 5IT5A 2KLIA 1YLTA 5FEFA 2EWWA 4FCFA 2X01A 1FCNA 3IT9A 5HL6A 3LIBA 4K0WA 3DBAA 3ZCZA 1HTZA 1XA1A 2O9CA 3HLBA 1QMFA 2HJ9C 1LL5A 1S4RA 3G2ZA 4H8RA 4OOYA 3MFXA 2EFXA 4NXBA 3KX0X 5EUAA 3HLGA 4DE3A 4FSFA 1EROA 3EQVA 5HZHA 4RX3A 5EVID 1NYYA 1JVJA 1PWCA 3LIDA 2NUTC 1ALQA 3NJAA 3ZG8B 4E3JA 4LLOB 1ACFA 1GA9A 4WEJA 3F1OA 4Y17A 4XT2B 2K7SA 4JKTA 2P04A 2A3UA 2M7VA 5GLCA 3EEAA 3JVVA 3WS5A 3H82A 2V0WA 1WE4A 3E0YA 5HWTA 2J9OA 3T4QA 1YMXA 4JXVA 2I9VA 1IKIA 5CTMA 1K25A 5KIZA 3S22A 3V50A 1NLZA 3NDEA 1HZOA 4BL3A 3WS0A 4HP4A 5EV0A 1MWSA 5EECA 5A90A 4Y13A 4PPRA 4D2OA 4LCLA 5CERA 5KSHA 3E4PA 1FR6A 3EEHA 4QWOA 2H0TA 2PD8A 2HP5A 4WELA 3C5AA 4U0TA 3NOPC 4BJPA 4DN0A 3VFHA 1G5UA 1XJ6A 3MZDA 4ZRRA 5HD5A 3EOIA 3WRZA 4BBUA 4NXGA 2UWXA 3T4TA 3D3OA 2H0YA 2LB9A 1G68A 2Y2KA 3LFVA 1MWRA 5J3WA 4CLCE 4LRXC 2B5RA 4IVIA 4X56A 1BLSA 4KQOA 5KZHA 4HJ4A 5GHYA 4PMAA 3FKWA 4JF4A 4F3LB 4UEYA 3NHQA 3UPNA 3BFGA 2W1TA 3IBJA 3D9YA 3VOYA 2VEAA 3MR0A 2B02A 3DWZA 1F98A 4DE2A 4BBVA 2K2NA 4ETZA 5AQ7A 5M1AA 3O5YA 4GOGA 3Q82A 3RTYA 5E2GA 4UHUA 3G32A 5FDSA 2UV0E 2XFSA 1RP5A 1A0KA 1OTDA 1CI8A 3CWFA 5KSCA 1W63Q 1CK3A 3HLFA 5GL9A 5HDSA 3DTIA 2EX2A 3RFBA 4K0XA 1W63M 3SH8A 1ONGA 2QPNA 2PR6A 1IELA 3TW8A 3UB8A 3NECA 2JKRI 2XA7S 3CITA 4UQIM 2KOIA 1YLWA 3GSGA 3H82B 1WA9A 1I2SA 1DY6A 4JGPA 4Z1WA 3VP4A 1XPBA 1ZC2A 1S4SA 5K5BA 2Q0OA 5F68A 1XX2A 4L0LA 4HHDA 5CTNA 4RA7A 1F2KA 2VJWA 3MMHA 3ZHHA 3QP8A 1LLBA 4LFUA 5HAIA 3UY6A 1W8YA 4FH2A 1MXOA 2PYRA 3NC8A 3G34A 1K55A 4JXGA 4GW9A 1PW8A 3QP6A 3S7QA 1FCOA 3GECA 3IBRA 3P01A 3PYPA 4R0QA 2XA7M 3NBLA 4OQGA 5DF7A 3U2AA 4JPMA 3VE3A 1ZG6A 1VETA 1KDSA 4EU0A 3UE1A 1MKMA 4LENA 1CEFA 2RCXA 5DF8A 3LY3A 1VHMA 4E3IA 2PRFA 2KDKA 1KDWA 3PAEA 5HWVA 2FFYA 4DXCA 3JVUA 1EW0A 3S1YA 2INWA 3ZG7B 3SS5A 1XFNA 2M1CA 4JXWA 4E6XA 3DTKA 4PKYA 2EXAA 4BQMA 3CLOA 4NETA 3Q1FA 4IJGA 1K54A 2W1TB 2QJ5A 2WKRA 4CJNA 4P6BA 3BEBA 1K6RA 4KG2A 3DTEA 2JKTM 3Q07A 3AGFA 1LHYA 1TF1A 4C75A 4OOLA 2GX5A 3LO7A 4WMCA 1Q2QA 3T12B 4KZ9A 2LB5A 1K56D 3MZFA 2OAP1 4EQIA 4HY8A 5FI6A 5TJJA 4X1LA 3MKEA 1PWGA 3I7JA 3PXPA 4YOFA 2EX8A 1LSXA 3FZCA 4CLCC 4CLCD 4UA6A 2XR0A 4MCWA 2H10A 1OMEA 1IYPA 3GR2A 4WZ4A 1SKOA 5FA7A 3ZDJA 1DRMA 1KGGA 1JWZA 4ETXA 5DTSA 5J4EA 3PBNA 1N4OA 1TS7A 5TGFA 4QD4A 4EEPA 4GD6A 4R3AA 3LYXA 3T1RA 2VV8A 2WADA 4L9FA 4EETB 1D7EA 1S1YA 3ISGA 5GLDA 3UNWA 1VM1A 5JYOA 2ZMFA 2Y2IA 1IFQA 3NULA 4GHIA 2ZQAA 3B33A 3NI9A 4S2MA 4B4ZA 3DWKA 5CGWA 4N1HA 3TSGA 3FV7A 1VETB 3T4LA 3HLDA 2Z6DA 3ZQ5A 3QP4A 4QY6A 2V20A 2HDSA 2XRNA 1DJCA 3CAXA 3ICYA 5L8MA 3EQUA 2IWCA 3ZNTA 2ZMVA 3SH9A 4KQRA 5TBMA 1PNEA 4FOFA 1E25A 3ZGAB 1GHMA 5L2FA 3T50A 2Y2NA 1LI9A 3VP3A 4GJ4A 1IEMA 2C5WB 4CQHA 3IWOA 2ZD8A 2W0NA 3IF6B 5E43A 4R1GA 3V5MA 5A92A 4FTXA 1JTDA 3M2KA 5FAOA 3QNCA 2HDQA 4B4XA 2V0UA 3LEZA 3H7WA 3RXXA 3HREA 4HBUA 1FOFA 2XEPA 2PD7A 2JCHA 1Q2PA 1NXYA 3A3EA 4EBNA 4PAUA 1N9OA 2ZMAA 4HESA 2OSUA 4JGOA 3UB9A 1PW1A 3BLSA 2VX8A 3EGXC 4WEKA 5FI2A 5FQ9A 5I5LA 2D01A 4KZ4A 2HJEA 5TFQA 3M2JA 4BENA 4DJ2A 3C2WA 2HDUA 1FSWA 1ESUA 4GZBA 2XLNA 1SKOB 3BWLA 4B93A 2M7UA 5AVEA 2ZLYA 4ZJ2A 1FIKA 1YQSA 2XSSA 4PM5A 1IYOA 2VV7A 3TRCA 1JTGA 2DMWA 2PT7A 2IWBA 3IH8A 5E2FA 2VZWA 2Z2MB 3PBOA 5CRFA 2IWDA 4IVKA 2W3HA 4HBTA 5DKKA 1V9ZA 4X69A 5FAPA 1XJ4A 3BQ8A 1E4DA 1GHIA 5F1GA 1O07A 4OP5A 5BOHA 3IXBA 5F6AA 4WBGA 1T1CA 1LL9A 4WL9A 3S7PA 1L0FA 4ZJ3A 5A91A 1SCWA 2Y4AA 4OQHA 3VFFA 4F3LA 1IKGA 3HVFA 1T1AA 5KMWA 3KSFA 1H5XA 3CJMA 3WS4A 2V2FF 1SDEA 3PAGA 5FI7A 3T4SA 3TOIA 4LRYC 5TBMB 4OPRA 5CEBA 5HSQA 3IQAA 1XGJA 3W4OA 2O9BA 3A3IA 5HAQA 2ZBBA 5AJGA 4EERA 5HAPA 4MBFA 3P98A 5J8XA 2FZ0A 3IX4A 1S66L 3KSGA 3FC7A 3MXQA 1YSQA 2PYPA 2ZL1B 5EVIC 2Y55A 3MXSA 2AVXA 3T1XA 1ES2A 4E3LA 3H7WB 3UB5P 1K6SA 4Q0JA 3JPUA 4JLFA 3W2ZA 4E3MA 3KYZA 3C4PA 1UWNX 3W4PA 4KQQA 3BFFA 2BASA 2W3DA 2HV1A 2PU2A 4FD8A 3QHYA 3V39A 1TDGA 5MC7A 2W3GA 4EXOA 1W7FA 3K2NA 4C6YA 3E4QA 4KG6A 1BLHA 1NJ4A 5HFOA 1MKIA 3TJZC 2HP9A 3G4PA 3U4LP 1ES5A 4GLQA 4X53A 1G6AA 1HVBA 1YLZA 2W27A 4MN7A 5J7EA 3T4JA 3UB7A 2HP6A 2E8JA 1ZTUA 3BQAA 1WYBA 3E2LA 3LICA 4LV0A 4JBFA 4JF6A 4WZ5C 4JF5A 2V9AA 2WAFA 4LRZE 2W3FA 4O8GA 1KVMA 3UE6A 4HOIA 1Z09A 2VGKA 1M6KA 1FQGA 1G6OA 3N8RA 1VQQA 4FUWA 3MF0A 1T18A 4YFMA 1H0MA 1Y54A 4JGQA 1DP6A 1JWPA 5EFWA 1YSPA 5G18A 4U3TA 1NRJA 2Y2LA 1MZUA 2QHKA 5FQKA 1TEMA 1EI5A 1TD5A 1LL8A 3FKVA 3SOIA 5L10A 3VP1A 5FEGA 2VGJA 3GQZA 2FFFB 4NXFA 4BLMA 1LSWA 4OPYA 3ZVTA 2JKTI 2VKSA 1CI9A 3BECA 4MEZA 2Z6CA 3CUEA 2ZM2A 2J3TD 2J3TC 2Y2JA 2ZC4B 3OPLA 2L4RA 1PI4A 1RGZA 1BLCA 3PR6A 2MJ6A 4QY5A 3Q7ZA 4DE1A 2JHEA 3C7VA 3M6BA 3B3XA 1TVFA 3UE3A 2J3WA 3N6IA 1V9YA 1BTLA 4GD8A 4WM9A 4HH2A 4HJ6A 3NCKA 1E3UA 4NXEA 1OT9A 4GDNA 3Q7VA 2XDMA 4DKIA 4ME4A 4Y0TA 2DCFA 4N1XA 4EEUA 3BY8A 3CZDA 3SS4A 3DW0A 5AQAA 4DF6A 1ZKJA 3UMDA 1D06A 3O86A 5FSRA 4N9LA 4Z9QA 1WYCA 5F83A 3IHAA 5IU1A 4LGWA 3HBRA 3MJQA 4B9OA 1L0EA 1KE3A 5FQJA 3T4KA 4I3JA 3OPHA 4O01A 2Y2QA 1BYWA 4K91A 2WZXA 3CUEC 3PBTA 1LT0A 4UA7A 4L9GA 1K0KA 3UMEA 3W4QA 4GNUA 2WK0A 1NZOA 4P6ZS 1KGFA 4EBLA 4QU3A 3NIAA 3PBQA 2Y2HA 2VK3A 3HLWA 3SS3A 1K4EA 4P85A 3BLMA 4PM7A 1MBLA 4ESPA 3IHBA 1OJGA 3FWLA 4I38A 1YKDA 2EA9A 3BRMA 4II7A 5G4YA 4S2NA 3VP0A 1NY0A 1RCJA 5LBRA 5FATA 5C5KA 2ZOIA 1JNUA 3IF6A 4Y0OA 1TS6A 4ZJ1A 3BFCA 1ESIA 1BZAA 1PRQA 4LPZA 3NY4A 3FPVA 3E4OA 4P6ZM 1YMSA 3PHYA 4IEDA 2JN7A 4BWIA 4S2PA 3BFEA 5FASA 1LI0A 3VOLA 4Y7PA 3SZTA 3EGDC 2VA0A 3M6HA 3C7UA 3CI6A 2ZQDA 1K55C 3VE4A 2WGVA 3LR5A 2O9AA 3V3RA 4G3WA 2HF6A 1K57A 3GVBA 2CMNA 3A3DA 4ARZB 1BSGA 4G3KA 3Q7VB 3BM6A 5HWWA 3V67A 2WGIA 4P87A 5U47A 3UDFA 2OV5A 2V1AA 1P9WA 4OKPA 3G35A 4MBHA 3S7NA 3GTCA 3G31A 3HUMA 3QP5A 3P7NA 3ITBA 3HCYA 1K4FA 3D4FA 4JXSA 2K31A 3HUNA 2P7JA 2QMIA 5D3OA 1BUEA 2OLVA 5JYPA 4I5SA 1VB6A 3UE0A 5F82A 1K54C 3O3VA 2IA2A 4LV3A 3LCEA 2BTFP 2HPBA 2XROA 2YKFA 4BMWA 4OH0A 4WMCD 3UO9A 2QWSA 3HLCA 4C3QA 4HEFA 4KUOA 4OPZA 4U0XA 1SKFA 5TR7A 3RH8B 1YLYA 3HJKA 4I3IA 5FQMA 4R6LA 3IS2A 3ITAA 3LI8A 4OOMA 4GKUA 4RVAA 3N8SA 5CHJA 2Y2MA 4NKPA 1W8QA 4RX2A 4EUZA 4EWFA 1PIOA 4RQ9A 1CF0A 1OJ5A 1Z6FA 4ID4A 3UB6A 3LI9A 2ZL1A 1HD8A 2L1MA 1I2WA 3OCLA 3IH9A 4OVDA 3IXGA 3B42A 3TG9A 2ZM0A 4X6TA 3HUOA 4DDYA 1D1JA 3MFDA 3A0SA 1YLPA 4DMZA 4WLAA 3AGDA 3UPOA 2J8YA 4LCMA 4DDSA 4IBXA 1PYYA 2EWVA 3DAVA 4PHTA 1IYQA 4DXBA 4PM8A 3UN7A 4GCZA 4OP8A 5EPHA 3IF5A 4Q0HA 3PBRA 3S7OA 4DE0A 4Y0UA 1U60A 2V1ZA 2PBYA 4A5RA 1SHVA 1J3WA 3TE8A 3C30A 5EE8A 2WYXA 3PBSA 4HP9A 3GMWA 4X25A 3QP2A 4R4RA 2JKGA 1FCMA 2R9XA 3F1PA 2B18A 5HX9A 3ZVWA 4KZ6A 3LR3A 2P74A 3LEQA 4WUJA 4E3KA 3CPTA 1H8MA 1M40A 2R9WA 4MN6A 1NYMA 3GV9A 1UGUA 1XKZA 3BYDA 4HNBA 1KE0A 4KENB 4R4SA 1JWVA 4QJGA 2PHYA 1ONHA 2XGNA 5CGSA 2PR5A 3HLEA 4P0MA 3G6OA 5GLBA 4GDBA 2G7UA 1LSVA 4BD0A 1OTIA 5AQBA 2PDRA 1AWIA 2P08A 2EX6A 2OAQ1 4H6JB 4N9KA 4UA9A 2H28A 3IS2B 1KGEA 3O88A 2Y91A 1T19A 1XXMA 2X02A 5E2HA 5F5YA 1STZA 5DKLA 4QPRA 3FG8A 3UDIA 5GLAA 4FH4A
chains in the Genus database with same CATH topology
2I72A 2Y2JA 4CJNA 2ZC4B 1C3BA 1TDLA 4P6BA 3OPLA 4PM6A 3BEBA 1K6RA 4KG2A 3Q07A 3AGFA 1LHYA 4C75A 1PI4A 1RGZA 1BLCA 3G2YA 4OOLA 3NDGA 3LO7A 4WMCA 5FAQA 3SH7A 1IYSA 4QY5A 1Q2QA 3Q7ZA 4KZ9A 4DE1A 3C7VA 4QB8A 3A3JA 4RYEA 1K56D 1N9BA 2HDRA 3M6BA 3N7WA 3OC2A 3B3XA 1TVFA 2WKHA 2ZQ9A 4OQ0A 3UE3A 1XGIA 3HL9A 3MZFA 2XD5A 4EQIA 3N6IA 5CGXA 5EOOA 5FI6A 2XD1A 4DRTA 4CPKA 1BTLA 2H5SA 1PWGA 3MKEA 4GD8A 4WM9A 3I7JA 3NCKA 1E3UA 4S2LA 2Y2OA 2EX8A 5GHZA 4KZ8A 3VOZA 5A93A 4GDNA 2C6WB 3Q7VA 3IWIA 3FZCA 4X55A 2XDMA 4DKIA 4XUZA 3UPPA 3RJUA 4UA6A 2XR0A 2WKEA 2H10A 2ZC5B 1OMEA 1IYPA 2PU4A 3GR2A 4Y0TA 2DCFA 4WZ4A 4N1XA 4LV2A 2Y2PA 5IHVA 1O7EA 2WZZA 3CZDA 4O7DA 3IXHA 3SS4A 3DW0A 5AQAA 5FA7A 3ZDJA 4DF6A 2E8IA 4UAAA 4B88A 2Y59A 1KGGA 1ZKJA 1XP4A 3ZG5A 1L0GA 1W5DA 5HARA 3O86A 3P09A 1DJAA 5FSRA 2XK1A 2JE5A 4N9LA 4Z9QA 3Q81A 1WYCA 1JWZA 5F83A 3IHAA 1ES4A 5DTSA 1CEGA 4XXRA 3PBNA 1N4OA 4S2JA 1J9MA 2XH9A 5EVIA 3HBRA 4R3BA 3JYIA 1GA0A 2ZQ7A 5TGFA 4NK3A 4QD4A 2WGWA 4GD6A 1L0EA 1KE3A 2BG1A 2ZC6B 4OLGA 5FQJA 3OPHA 4GB7A 2Y2QA 4YINA 4K91A 2WAEA 2ZJ9A 2WADA 2WUQA 1W79A 2WZXA 5F1FA 1BT5A 5EVIB 3PBTA 4UA7A 3IWQA 5M19A 3QNBA 1AXBA 3ISGA 3W4QA 4GNUA 5GLDA 1KE4A 2WK0A 2ZC3B 3UNWA 1NZOA 2CC1A 5FDHA 4WYYA 1KGFA 1VM1A 5JYOA 4EBLA 2Y2IA 4QU3A 4EV4A 2ZQAA 3NIAA 4OONA 1ERMA 2OLUA 3NI9A 4S2MA 5DF9A 3PBQA 2Y2HA 4B4ZA 3DWKA 4MNRA 5CGWA 4N1HA 5EOEA 3HLWA 3TSGA 3SS3A 1MWTA 4KZBA 1K4EA 4E3OA 1EWZA 3FV7A 3BLMA 4P85A 4PM7A 1MBLA 3IHBA 3VMAA 1S0WA 2X71A 3HLDA 5DVAA 3FWLA 3W8KA 1YT4A 4N92A 1L0DA 2XF3A 4QY6A 5FQIA 2V20A 3A3FA 1I5QA 2HDSA 3BRMA 5GHXA 1DJCA 3LY4A 1XA7A 3MZEA 2J9PA 2BLSA 4S2NA 3VP0A 1NY0A 1RCJA 3EQUA 2IWCA 3ZNTA 3SH9A 4KQRA 5CEDA 5FATA 1S6RA 2XQZA 1E25A 2ZQ8A 3ZGAB 2EX9A 1GHMA 2EFUA 3IF6A 4Y0OA 5L2FA 4WZ5A 4ZJ1A 3BFCA 1ESIA 2Y2NA 1MY8A 1LI9A 3VP3A 1BZAA 1IEMA 1YLTA 2C5WB 1NZUA 3GRJA 3IWOA 4FCFA 2X01A 2ZD8A 1FCNA 3IT9A 3E2KA 3WS2A 4BL2A 3IF6B 5E43A 3NY4A 4K0WA 4R1GA 4XUXA 3V5MA 5A92A 1JTDA 3AGEA 2JBFA 5DTKA 1YMSA 4IEDA 2ZC7A 3M2KA 5FAOA 3MBZA 3ZCZA 2Q9NA 3QNCA 1HTZA 1XA1A 2HDQA 3HLBA 1QMFA 4B4XA 1LL5A 3G2ZA 4FH4A 4H8RA 3LEZA 4S2PA 4OOYA 3BFEA 5FASA 2EFXA 1LI0A 5EUAA 3RXXA 3HLGA 3HREA 1FOFA 4HBUA 2XEPA 1H8YA 4Y7PA 4FSFA 1EROA 4DE3A 2JCHA 3EQVA 1Q2PA 4RX3A 2GDNA 5EVID 1DJBA 1NYYA 1NXYA 2Z2LB 1JVJA 1YLJA 1PWCA 3A3EA 1FSYA 4EBNA 4R23A 4S2IA 1ALQA 3ZG8B 2ZMAA 4HESA 2OSUA 4X68A 4E3JA 4PM9A 3M6HA 1PW1A 3BLSA 1GA9A 4WEJA 4WEKA 5FI2A 5FQ9A 3C7UA 4KZ4A 2ZQDA 1K55C 1MPLA 1KVLA 2WGVA 3V3RA 4JKTA 4MBKA 1K57A 3N4IA 5FQQA 2A3UA 3MXRA 3GVBA 5TFQA 3A3DA 3M2JA 5GLCA 4BENA 1BSGA 3Q7VB 3WS5A 1WE4A 3BM6A 3ZG9B 2J9OA 4S2KA 2HDUA 3OPPA 1FSWA 1YMXA 1ESUA 2WGIA 4P87A 5U47A 3UDFA 4GZBA 2OV5A 2XLNA 4OKPA 4JXVA 2EXBA 3G35A 4MBHA 3GTCA 3G31A 3HUMA 3RXWA 2ZLYA 1IKIA 3ITBA 4ZJ2A 1K4FA 1YQSA 3D4FA 4IBRA 4JXSA 3N8LA 3HUNA 4PM5A 2QMIA 1IYOA 1JTGA 3IXDA 3CMZA 5CHUA 5CTMA 1K25A 5D3OA 1BUEA 3S22A 3V50A 2OLVA 5JYPA 1BLPA 3NDEA 1HZOA 2IWBA 3IH8A 5E2FA 1GHPA 4BL3A 2Z2MB 3PBOA 3UE0A 3WS0A 5CRFA 3ZNYA 2IWDA 1K56A 1BULA 4IVKA 5F82A 1K54C 3O3VA 1MWSA 5EECA 1ES3A 2P9VA 3FYZA 3BFDA 4HBTA 4S2OA 5A90A 4LV3A 4X69A 2WGWB 3LCEA 5FAPA 4PPRA 4D2OA 1E4DA 2HPBA 4LCLA 5CERA 1GHIA 5F1GA 1FR1A 2ZM8A 1O07A 4OH0A 4WMCD 5KSHA 1FR6A 4OP5A 3UO9A 5BOHA 3IXBA 2H0TA 4ZAMA 3HLCA 2HP5A 4WBGA 4C3QA 4WELA 3C5AA 4HEFA 4U0TA 4OPZA 4BJPA 1PZOA 1LL9A 1SKFA 4U0XA 5TR7A 3VFHA 3MZDA 1L0FA 1YLYA 4ZJ3A 3WRZA 5A91A 1SCWA 2Y4AA 1MWUA 5FQMA 4LV1A 4OQHA 3VFFA 2UWXA 5CHMA 3ITAA 2XFTA 5HL1A 1IKGA 1E3UD 2H0YA 4OOMA 1G68A 3HVFA 2Y2KA 1MWRA 5KMWA 4GKUA 4RVAA 3VSKA 2B5RA 4IVIA 1H5XA 4X56A 3N8SA 5CHJA 3CJMA 4ZTKA 2Y2MA 1BLSA 4KQOA 3WS4A 2V2FF 5KZHA 1SDEA 5GHYA 4PMAA 1W8QA 1GCEA 3FKWA 4JF4A 4RX2A 3PAGA 5FI7A 3TOIA 4OPRA 3UPNA 4EUZA 5CEBA 3BFGA 4EWFA 1PIOA 3IQAA 1XGJA 3W4OA 3A3IA 5HAQA 3VOYA 1Z6FA 4ID4A 4KZAA 1HD8A 5HAPA 3ZFZA 4MBFA 3P98A 4ZDXA 3DWZA 4DE2A 5J8XA 5CXWA 1I2WA 3S4XA 2G2UA 3OCLA 3IH9A 3WWXA 5I94A 5AQ7A 3MKFA 3UDXA 5M1AA 4KZ3A 4QHCA 4OVDA 4GOGA 2J7VA 3IXGA 5EVIC 3Q82A 2Y55A 5E2GA 4UHUA 3MXSA 3G32A 1ES2A 2ZM2A 3G30A 4E3NA 3TG9A 1PI5A 2XFSA 2ZM0A 4E3LA 4X6TA 2QZ6A 3CG5A 1K6SA 3HUOA 1RP5A 4DDYA 4JLFA 4E3MA 3MFDA 1CI8A 5KSCA 1YLPA 3C4PA 3AGDA 1CK3A 1RGYA 2Y2GA 3HLFA 3W4PA 5GL9A 3UPOA 3OPRA 2J8YA 4KQQA 3BFFA 4LCMA 4DDSA 2ZQCA 2EX2A 4IBXA 1PYYA 4K0XA 3SH8A 1ONGA 2PU2A 2QPNA 4KZ5A 1IELA 4FD8A 3QHYA 3V39A 1TDGA 4OLDA 1L2SA 1IYQA 1W7FA 3O87A 4DXBA 2RL3A 4PM8A 5EVLA 4OP8A 3UN7A 4C6YA 1ZG4A 5EPHA 3IF5A 2WKIA 4KG6A 3PBRA 1BLHA 1NJ4A 4Y0UA 1MKIA 5HFOA 4DE0A 1U60A 2V1ZA 4E6WA 4F94A 4Q8IA 2PBYA 2HP9A 4A5RA 1SHVA 1YLWA 3GSGA 1I2SA 3G4PA 1DY6A 5EE8A 2WYXA 1K38A 3VP4A 2G2WA 1XPBA 1ES5A 3PBSA 1ZC2A 3GMWA 5E2EA 4X53A 4GN2A 1G6AA 1HVBA 1YLZA 4R4RA 2DRWA 2R9XA 1FCMA 3PTEA 3VSLA 4S2NC 4BD1A 5HX9A 4OPQA 3ZVWA 4KZ6A 2HP6A 2P74A 1WYBA 3WRTA 3E2LA 1XX2A 4LV0A 3IF6C 4E3KA 4EBPA 4L0LA 3OZHA 5DTTA 4JBFA 1QMEA 1PZPA 4JF6A 5CTNA 3OCNA 2Q9MA 4WZ5C 1M40A 2R9WA 5CECA 4RA7A 4JF5A 2WAFA 1NYMA 3ZHHA 3GV9A 1LLBA 5GLAA 1XKZA 1KVMA 3BYDA 3ZG0A 1KE0A 4KG5A 5HAIA 4KENB 3UY6A 2VGKA 1W8YA 4R4SA 3WS1A 3V3SA 1JWVA 1M6KA 1FQGA 2P9VB 4FH2A 1MXOA 4QJGA 3NC8A 1ONHA 2XGNA 5CGSA 3G34A 3N8RA 1VQQA 4YFMA 3HLEA 1K55A 4JXGA 4MLLA 4P0MA 1PW8A 5GLBA 1Y54A 5HW3A 4GDBA 1FCOA 4R0QA 4BD0A 3NBLA 4OQGA 4M3KA 1JWPA 3C4OA 5DF7A 4JPMA 3DTMA 4OQIA 1ZG6A 4ZBEA 5AQBA 1YM1A 5G18A 4U3TA 1KDSA 3UE1A 2A49A 4LENA 1CEFA 2RCXA 2Y2LA 5DF8A 4R3JA 3LY3A 4E3IA 5FQKA 1KDWA 1TEMA 2EX6A 3PAEA 2JC7A 2FFYA 4N9KA 4UA9A 4DXCA 1EI5A 3FKVA 1K57C 3SOIA 3VP1A 1KGEA 5M18A 3O88A 3S1YA 2Y91A 1XXMA 2VGJA 1SDNA 3ZG7B 2X02A 1ERQA 3GQZA 5E2HA 3SS5A 2FFFB 4BLMA 4OPYA 1H8ZA 3VP2A 5AQ9A 4JXWA 4E6XA 1NRFA 4KZ7A 3ZVTA 2EXAA 1CI9A 3BECA 4MEZA 3UDIA 4BQMA 4NETA 3Q1FA 1K54A 1PWDA 2DNSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I72 A;  2Y2J A;  4CJN A;  2ZC4 B;  1C3B A;  1TDL A;  4P6B A;  3OPL A;  4PM6 A;  3BEB A;  1K6R A;  4KG2 A;  3Q07 A;  3AGF A;  1LHY A;  4C75 A;  1PI4 A;  1RGZ A;  1BLC A;  3G2Y A;  4OOL A;  3NDG A;  3LO7 A;  4WMC A;  5FAQ A;  3SH7 A;  1IYS A;  4QY5 A;  1Q2Q A;  3Q7Z A;  4KZ9 A;  4DE1 A;  3C7V A;  4QB8 A;  3A3J A;  4RYE A;  1K56 D;  1N9B A;  2HDR A;  3M6B A;  3N7W A;  3OC2 A;  3B3X A;  1TVF A;  2WKH A;  2ZQ9 A;  4OQ0 A;  3UE3 A;  1XGI A;  3HL9 A;  3MZF A;  2XD5 A;  4EQI A;  3N6I A;  5CGX A;  5EOO A;  5FI6 A;  2XD1 A;  4DRT A;  4CPK A;  1BTL A;  2H5S A;  1PWG A;  3MKE A;  4GD8 A;  4WM9 A;  3I7J A;  3NCK A;  1E3U A;  4S2L A;  2Y2O A;  2EX8 A;  5GHZ A;  4KZ8 A;  3VOZ A;  5A93 A;  4GDN A;  2C6W B;  3Q7V A;  3IWI A;  3FZC A;  4X55 A;  2XDM A;  4DKI A;  4XUZ A;  3UPP A;  3RJU A;  4UA6 A;  2XR0 A;  2WKE A;  2H10 A;  2ZC5 B;  1OME A;  1IYP A;  2PU4 A;  3GR2 A;  4Y0T A;  2DCF A;  4WZ4 A;  4N1X A;  4LV2 A;  2Y2P A;  5IHV A;  1O7E A;  2WZZ A;  3CZD A;  4O7D A;  3IXH A;  3SS4 A;  3DW0 A;  5AQA A;  5FA7 A;  3ZDJ A;  4DF6 A;  2E8I A;  4UAA A;  4B88 A;  2Y59 A;  1KGG A;  1ZKJ A;  1XP4 A;  3ZG5 A;  1L0G A;  1W5D A;  5HAR A;  3O86 A;  3P09 A;  1DJA A;  5FSR A;  2XK1 A;  2JE5 A;  4N9L A;  4Z9Q A;  3Q81 A;  1WYC A;  1JWZ A;  5F83 A;  3IHA A;  1ES4 A;  5DTS A;  1CEG A;  4XXR A;  3PBN A;  1N4O A;  4S2J A;  1J9M A;  2XH9 A;  5EVI A;  3HBR A;  4R3B A;  3JYI A;  1GA0 A;  2ZQ7 A;  5TGF A;  4NK3 A;  4QD4 A;  2WGW A;  4GD6 A;  1L0E A;  1KE3 A;  2BG1 A;  2ZC6 B;  4OLG A;  5FQJ A;  3OPH A;  4GB7 A;  2Y2Q A;  4YIN A;  4K91 A;  2WAE A;  2ZJ9 A;  2WAD A;  2WUQ A;  1W79 A;  2WZX A;  5F1F A;  1BT5 A;  5EVI B;  3PBT A;  4UA7 A;  3IWQ A;  5M19 A;  3QNB A;  1AXB A;  3ISG A;  3W4Q A;  4GNU A;  5GLD A;  1KE4 A;  2WK0 A;  2ZC3 B;  3UNW A;  1NZO A;  2CC1 A;  5FDH A;  4WYY A;  1KGF A;  1VM1 A;  5JYO A;  4EBL A;  2Y2I A;  4QU3 A;  4EV4 A;  2ZQA A;  3NIA A;  4OON A;  1ERM A;  2OLU A;  3NI9 A;  4S2M A;  5DF9 A;  3PBQ A;  2Y2H A;  4B4Z A;  3DWK A;  4MNR A;  5CGW A;  4N1H A;  5EOE A;  3HLW A;  3TSG A;  3SS3 A;  1MWT A;  4KZB A;  1K4E A;  4E3O A;  1EWZ A;  3FV7 A;  3BLM A;  4P85 A;  4PM7 A;  1MBL A;  3IHB A;  3VMA A;  1S0W A;  2X71 A;  3HLD A;  5DVA A;  3FWL A;  3W8K A;  1YT4 A;  4N92 A;  1L0D A;  2XF3 A;  4QY6 A;  5FQI A;  2V20 A;  3A3F A;  1I5Q A;  2HDS A;  3BRM A;  5GHX A;  1DJC A;  3LY4 A;  1XA7 A;  3MZE A;  2J9P A;  2BLS A;  4S2N A;  3VP0 A;  1NY0 A;  1RCJ A;  3EQU A;  2IWC A;  3ZNT A;  3SH9 A;  4KQR A;  5CED A;  5FAT A;  1S6R A;  2XQZ A;  1E25 A;  2ZQ8 A;  3ZGA B;  2EX9 A;  1GHM A;  2EFU A;  3IF6 A;  4Y0O A;  5L2F A;  4WZ5 A;  4ZJ1 A;  3BFC A;  1ESI A;  2Y2N A;  1MY8 A;  1LI9 A;  3VP3 A;  1BZA A;  1IEM A;  1YLT A;  2C5W B;  1NZU A;  3GRJ A;  3IWO A;  4FCF A;  2X01 A;  2ZD8 A;  1FCN A;  3IT9 A;  3E2K A;  3WS2 A;  4BL2 A;  3IF6 B;  5E43 A;  3NY4 A;  4K0W A;  4R1G A;  4XUX A;  3V5M A;  5A92 A;  1JTD A;  3AGE A;  2JBF A;  5DTK A;  1YMS A;  4IED A;  2ZC7 A;  3M2K A;  5FAO A;  3MBZ A;  3ZCZ A;  2Q9N A;  3QNC A;  1HTZ A;  1XA1 A;  2HDQ A;  3HLB A;  1QMF A;  4B4X A;  1LL5 A;  3G2Z A;  4FH4 A;  4H8R A;  3LEZ A;  4S2P A;  4OOY A;  3BFE A;  5FAS A;  2EFX A;  1LI0 A;  5EUA A;  3RXX A;  3HLG A;  3HRE A;  1FOF A;  4HBU A;  2XEP A;  1H8Y A;  4Y7P A;  4FSF A;  1ERO A;  4DE3 A;  2JCH A;  3EQV A;  1Q2P A;  4RX3 A;  2GDN A;  5EVI D;  1DJB A;  1NYY A;  1NXY A;  2Z2L B;  1JVJ A;  1YLJ A;  1PWC A;  3A3E A;  1FSY A;  4EBN A;  4R23 A;  4S2I A;  1ALQ A;  3ZG8 B;  2ZMA A;  4HES A;  2OSU A;  4X68 A;  4E3J A;  4PM9 A;  3M6H A;  1PW1 A;  3BLS A;  1GA9 A;  4WEJ A;  4WEK A;  5FI2 A;  5FQ9 A;  3C7U A;  4KZ4 A;  2ZQD A;  1K55 C;  1MPL A;  1KVL A;  2WGV A;  3V3R A;  4JKT A;  4MBK A;  1K57 A;  3N4I A;  5FQQ A;  2A3U A;  3MXR A;  3GVB A;  5TFQ A;  3A3D A;  3M2J A;  5GLC A;  4BEN A;  1BSG A;  3Q7V B;  3WS5 A;  1WE4 A;  3BM6 A;  3ZG9 B;  2J9O A;  4S2K A;  2HDU A;  3OPP A;  1FSW A;  1YMX A;  1ESU A;  2WGI A;  4P87 A;  5U47 A;  3UDF A;  4GZB A;  2OV5 A;  2XLN A;  4OKP A;  4JXV A;  2EXB A;  3G35 A;  4MBH A;  3GTC A;  3G31 A;  3HUM A;  3RXW A;  2ZLY A;  1IKI A;  3ITB A;  4ZJ2 A;  1K4F A;  1YQS A;  3D4F A;  4IBR A;  4JXS A;  3N8L A;  3HUN A;  4PM5 A;  2QMI A;  1IYO A;  1JTG A;  3IXD A;  3CMZ A;  5CHU A;  5CTM A;  1K25 A;  5D3O A;  1BUE A;  3S22 A;  3V50 A;  2OLV A;  5JYP A;  1BLP A;  3NDE A;  1HZO A;  2IWB A;  3IH8 A;  5E2F A;  1GHP A;  4BL3 A;  2Z2M B;  3PBO A;  3UE0 A;  3WS0 A;  5CRF A;  3ZNY A;  2IWD A;  1K56 A;  1BUL A;  4IVK A;  5F82 A;  1K54 C;  3O3V A;  1MWS A;  5EEC A;  1ES3 A;  2P9V A;  3FYZ A;  3BFD A;  4HBT A;  4S2O A;  5A90 A;  4LV3 A;  4X69 A;  2WGW B;  3LCE A;  5FAP A;  4PPR A;  4D2O A;  1E4D A;  2HPB A;  4LCL A;  5CER A;  1GHI A;  5F1G A;  1FR1 A;  2ZM8 A;  1O07 A;  4OH0 A;  4WMC D;  5KSH A;  1FR6 A;  4OP5 A;  3UO9 A;  5BOH A;  3IXB A;  2H0T A;  4ZAM A;  3HLC A;  2HP5 A;  4WBG A;  4C3Q A;  4WEL A;  3C5A A;  4HEF A;  4U0T A;  4OPZ A;  4BJP A;  1PZO A;  1LL9 A;  1SKF A;  4U0X A;  5TR7 A;  3VFH A;  3MZD A;  1L0F A;  1YLY A;  4ZJ3 A;  3WRZ A;  5A91 A;  1SCW A;  2Y4A A;  1MWU A;  5FQM A;  4LV1 A;  4OQH A;  3VFF A;  2UWX A;  5CHM A;  3ITA A;  2XFT A;  5HL1 A;  1IKG A;  1E3U D;  2H0Y A;  4OOM A;  1G68 A;  3HVF A;  2Y2K A;  1MWR A;  5KMW A;  4GKU A;  4RVA A;  3VSK A;  2B5R A;  4IVI A;  1H5X A;  4X56 A;  3N8S A;  5CHJ A;  3CJM A;  4ZTK A;  2Y2M A;  1BLS A;  4KQO A;  3WS4 A;  2V2F F;  5KZH A;  1SDE A;  5GHY A;  4PMA A;  1W8Q A;  1GCE A;  3FKW A;  4JF4 A;  4RX2 A;  3PAG A;  5FI7 A;  3TOI A;  4OPR A;  3UPN A;  4EUZ A;  5CEB A;  3BFG A;  4EWF A;  1PIO A;  3IQA A;  1XGJ A;  3W4O A;  3A3I A;  5HAQ A;  3VOY A;  1Z6F A;  4ID4 A;  4KZA A;  1HD8 A;  5HAP A;  3ZFZ A;  4MBF A;  3P98 A;  4ZDX A;  3DWZ A;  4DE2 A;  5J8X A;  5CXW A;  1I2W A;  3S4X A;  2G2U A;  3OCL A;  3IH9 A;  3WWX A;  5I94 A;  5AQ7 A;  3MKF A;  3UDX A;  5M1A A;  4KZ3 A;  4QHC A;  4OVD A;  4GOG A;  2J7V A;  3IXG A;  5EVI C;  3Q82 A;  2Y55 A;  5E2G A;  4UHU A;  3MXS A;  3G32 A;  1ES2 A;  2ZM2 A;  3G30 A;  4E3N A;  3TG9 A;  1PI5 A;  2XFS A;  2ZM0 A;  4E3L A;  4X6T A;  2QZ6 A;  3CG5 A;  1K6S A;  3HUO A;  1RP5 A;  4DDY A;  4JLF A;  4E3M A;  3MFD A;  1CI8 A;  5KSC A;  1YLP A;  3C4P A;  3AGD A;  1CK3 A;  1RGY A;  2Y2G A;  3HLF A;  3W4P A;  5GL9 A;  3UPO A;  3OPR A;  2J8Y A;  4KQQ A;  3BFF A;  4LCM A;  4DDS A;  2ZQC A;  2EX2 A;  4IBX A;  1PYY A;  4K0X A;  3SH8 A;  1ONG A;  2PU2 A;  2QPN A;  4KZ5 A;  1IEL A;  4FD8 A;  3QHY A;  3V39 A;  1TDG A;  4OLD A;  1L2S A;  1IYQ A;  1W7F A;  3O87 A;  4DXB A;  2RL3 A;  4PM8 A;  5EVL A;  4OP8 A;  3UN7 A;  4C6Y A;  1ZG4 A;  5EPH A;  3IF5 A;  2WKI A;  4KG6 A;  3PBR A;  1BLH A;  1NJ4 A;  4Y0U A;  1MKI A;  5HFO A;  4DE0 A;  1U60 A;  2V1Z A;  4E6W A;  4F94 A;  4Q8I A;  2PBY A;  2HP9 A;  4A5R A;  1SHV A;  1YLW A;  3GSG A;  1I2S A;  3G4P A;  1DY6 A;  5EE8 A;  2WYX A;  1K38 A;  3VP4 A;  2G2W A;  1XPB A;  1ES5 A;  3PBS A;  1ZC2 A;  3GMW A;  5E2E A;  4X53 A;  4GN2 A;  1G6A A;  1HVB A;  1YLZ A;  4R4R A;  2DRW A;  2R9X A;  1FCM A;  3PTE A;  3VSL A;  4S2N C;  4BD1 A;  5HX9 A;  4OPQ A;  3ZVW A;  4KZ6 A;  2HP6 A;  2P74 A;  1WYB A;  3WRT A;  3E2L A;  1XX2 A;  4LV0 A;  3IF6 C;  4E3K A;  4EBP A;  4L0L A;  3OZH A;  5DTT A;  4JBF A;  1QME A;  1PZP A;  4JF6 A;  5CTN A;  3OCN A;  2Q9M A;  4WZ5 C;  1M40 A;  2R9W A;  5CEC A;  4RA7 A;  4JF5 A;  2WAF A;  1NYM A;  3ZHH A;  3GV9 A;  1LLB A;  5GLA A;  1XKZ A;  1KVM A;  3BYD A;  3ZG0 A;  1KE0 A;  4KG5 A;  5HAI A;  4KEN B;  3UY6 A;  2VGK A;  1W8Y A;  4R4S A;  3WS1 A;  3V3S A;  1JWV A;  1M6K A;  1FQG A;  2P9V B;  4FH2 A;  1MXO A;  4QJG A;  3NC8 A;  1ONH A;  2XGN A;  5CGS A;  3G34 A;  3N8R A;  1VQQ A;  4YFM A;  3HLE A;  1K55 A;  4JXG A;  4MLL A;  4P0M A;  1PW8 A;  5GLB A;  1Y54 A;  5HW3 A;  4GDB A;  1FCO A;  4R0Q A;  4BD0 A;  3NBL A;  4OQG A;  4M3K A;  1JWP A;  3C4O A;  5DF7 A;  4JPM A;  3DTM A;  4OQI A;  1ZG6 A;  4ZBE A;  5AQB A;  1YM1 A;  5G18 A;  4U3T A;  1KDS A;  3UE1 A;  2A49 A;  4LEN A;  1CEF A;  2RCX A;  2Y2L A;  5DF8 A;  4R3J A;  3LY3 A;  4E3I A;  5FQK A;  1KDW A;  1TEM A;  2EX6 A;  3PAE A;  2JC7 A;  2FFY A;  4N9K A;  4UA9 A;  4DXC A;  1EI5 A;  3FKV A;  1K57 C;  3SOI A;  3VP1 A;  1KGE A;  5M18 A;  3O88 A;  3S1Y A;  2Y91 A;  1XXM A;  2VGJ A;  1SDN A;  3ZG7 B;  2X02 A;  1ERQ A;  3GQZ A;  5E2H A;  3SS5 A;  2FFF B;  4BLM A;  4OPY A;  1H8Z A;  3VP2 A;  5AQ9 A;  4JXW A;  4E6X A;  1NRF A;  4KZ7 A;  3ZVT A;  2EXA A;  1CI9 A;  3BEC A;  4MEZ A;  3UDI A;  4BQM A;  4NET A;  3Q1F A;  1K54 A;  1PWD A;  2DNS A; 
#chains in the Genus database with same CATH topology
 2I72 A;  2O99 A;  1TDL A;  2OOL A;  2VLG A;  5F69 A;  3G2Y A;  3SH7 A;  3BY9 A;  4QB8 A;  3A3J A;  4RYE A;  5DJT A;  3R4K A;  1P9R A;  3N7W A;  4YNR A;  2ZQ9 A;  1XGI A;  3HL9 A;  1L3L A;  5HD3 A;  5EOO A;  1F5M A;  2Y2O A;  4KZ8 A;  3VOZ A;  5A93 A;  1OTE A;  4X55 A;  3IWI A;  5FL3 A;  4XUZ A;  3UPP A;  3RJU A;  2PAV P;  2WKE A;  5L07 A;  1ODV A;  2ZC5 B;  2O0Y A;  3SW1 A;  2W3E A;  4LV2 A;  2GJ3 A;  2Y2P A;  1O7E A;  2WZZ A;  3OOV A;  3IXH A;  3LR4 A;  2E8I A;  4UAA A;  1TS8 A;  1XP4 A;  3ZG5 A;  1W5D A;  5HAR A;  3R7W B;  2XK1 A;  3Q81 A;  3F1P B;  1ES4 A;  1CEG A;  2V1B A;  1GA0 A;  3JYI A;  2ZQ7 A;  4Y2F A;  2WGW A;  3CPT B;  2ZC6 B;  4OLG A;  4E04 A;  4YIN A;  2WAE A;  3L7H A;  1W79 A;  1BT5 A;  5EVI B;  3QNB A;  4HI4 A;  1AXB A;  4BBT A;  1KE4 A;  2ZC3 B;  5FDH A;  5DJU A;  4G3V A;  2NUP C;  4EV4 A;  4OON A;  1ERM A;  5DF9 A;  4KZB A;  1EWZ A;  5HPF A;  1CQA A;  1HLU P;  3EWK A;  3W8K A;  1YT4 A;  2XF3 A;  1FIL A;  5GHX A;  1I5Q A;  5EM0 A;  1XA7 A;  2BLS A;  2HGV A;  4MN5 A;  5CED A;  1KOU A;  2XQZ A;  2ZQ8 A;  4K08 A;  2EX9 A;  2EFU A;  3FPW A;  2J80 A;  3LIE A;  1NZU A;  3GRJ A;  3E2K A;  4UQI S;  3WS2 A;  4BL2 A;  2PBD P;  4XUX A;  3AGE A;  1F9I A;  2JBF A;  5DTK A;  2ZC7 A;  3MBZ A;  2Q9N A;  2FH5 A;  5CX7 A;  3BW6 A;  4WN5 A;  1H8Y A;  2GDN A;  1DJB A;  1VEU A;  1YLJ A;  2Z2L B;  1FSY A;  4R23 A;  4S2I A;  4X68 A;  4PM9 A;  4ARZ A;  3T1S A;  1MPL A;  1UWP X;  1KVL A;  3T1Q B;  3E98 A;  5G4Z A;  4MBK A;  3N4I A;  5FQQ A;  3MXR A;  2QYB A;  4EQ1 A;  3F1O B;  3ZG9 B;  4S2K A;  3OPP A;  4Y5F A;  2R78 A;  1N9N A;  2EXB A;  1NWZ A;  3RXW A;  3A0R A;  4IBR A;  3N8L A;  3IXD A;  3CMZ A;  5CHU A;  2A24 A;  5EM1 A;  1BLP A;  1GHP A;  3ZNY A;  1K56 A;  1BUL A;  5A8B A;  2Y8H A;  2YKH A;  1ES3 A;  2P9V A;  3FYZ A;  3BFD A;  4S2O A;  2WGW B;  4MDZ A;  1GSW A;  1XJ3 A;  1FR1 A;  2ZM8 A;  4R38 A;  1OTB A;  4ZAM A;  4CLC A;  1PZO A;  1GSV A;  2OWH A;  3NOT C;  2D02 A;  4NG2 A;  1NLY A;  1MWU A;  4LV1 A;  3QP1 A;  5CHM A;  5HL1 A;  2XFT A;  3A0V A;  1E3U D;  4KUK A;  1X0O A;  1PFL A;  2KX6 A;  3VSK A;  3LGO A;  4ZTK A;  4X1M A;  4PKY G;  1GCE A;  4L9E A;  4HH3 A;  3LIA A;  1OT6 A;  4KZA A;  3ZFZ A;  1ZHH B;  4ZDX A;  1T1B A;  3KYE A;  5CXW A;  3S4X A;  2G2U A;  3WWX A;  5I94 A;  3MKF A;  3UDX A;  3KO6 A;  1YAX A;  4KZ3 A;  4QHC A;  3ULF A;  3NOU C;  1CJF A;  2J7V A;  4MMN A;  3G30 A;  4E3N A;  4EW7 A;  1PI5 A;  2Y79 A;  2QZ6 A;  3CG5 A;  1DP8 A;  3KSI A;  3VV4 A;  4R70 A;  1VEU B;  1RGY A;  2Y2G A;  3OPR A;  2ZQC A;  4KZ5 A;  4OLD A;  1L2S A;  3O87 A;  2JKF A;  2RL3 A;  5EVL A;  1P97 A;  1ZG4 A;  2WKI A;  4E6W A;  4F94 A;  4Q8I A;  3MQQ A;  3GDI A;  1XJ2 A;  1K38 A;  2GNX A;  2G2W A;  2A2L A;  4HQA A;  2GZA A;  1TS0 A;  4KQD A;  2JKR M;  3MQ0 A;  5E2E A;  1SZV A;  4GN2 A;  3PTE A;  1S1Z A;  2DRW A;  3VSL A;  4BD1 A;  4S2N C;  3KYQ A;  4OPQ A;  1YPR A;  3WRT A;  4M4X A;  1P0Z A;  3IF6 C;  4EBP A;  5DTT A;  3OZH A;  1QME A;  1PZP A;  3KSH A;  5CEC A;  3OCN A;  2Q9M A;  3K3D A;  3LUQ A;  2A24 B;  4D60 A;  2OWJ A;  3ZG0 A;  4KG5 A;  4GS9 A;  3LR0 A;  3WS1 A;  3V3S A;  2P9V B;  3C8C A;  1H3Q A;  3MSH A;  4MLL A;  4AFI A;  5HW3 A;  4M3K A;  3C4O A;  4H6J A;  3DTM A;  4OQI A;  4ZBE A;  1YM1 A;  4CLC B;  1XFQ A;  1IOU A;  2A49 A;  5HPI A;  4R3J A;  3ZYT A;  3F1N A;  2JC7 A;  3IX3 A;  3CHW P;  4IHQ A;  1K57 C;  4I39 A;  1S67 L;  5EVE A;  5M18 A;  3C38 A;  1SDN A;  2QKP A;  1ERQ A;  1N9L A;  4O0P A;  1H8Z A;  3VP2 A;  5AQ9 A;  1NRF A;  4KZ7 A;  4NEE D;  4EES A;  1PWD A;  2DNS A;  3BJN A;  1MC0 A;  3MQO A;  1C3B A;  5HDD A;  4PM6 A;  3H9W A;  1G28 A;  4IUH A;  3NDG A;  3D72 A;  5FAQ A;  1IYS A;  5DFY A;  4JGR A;  1N9B A;  2HDR A;  3OC2 A;  4YWZ A;  2WKH A;  1OTA A;  2QJ7 A;  2WKP A;  4OQ0 A;  2XD5 A;  5CGX A;  2V8F A;  1DP9 A;  4XT2 A;  4DRT A;  2XD1 A;  4CPK A;  2H5S A;  2HZ5 A;  4S2L A;  4WF0 A;  5GHZ A;  4HIA A;  2WKQ A;  2C6W B;  3LIF A;  2ACG A;  2ZOH A;  2PU4 A;  3R7W A;  1Y4O A;  5HDC A;  3T4O A;  5IHV A;  4DJ3 A;  4Q0I A;  4O7D A;  4B88 A;  3MS6 A;  2Y59 A;  1L0G A;  3P09 A;  1DJA A;  2JE5 A;  3HJI A;  4Y15 A;  1Y28 A;  4HJ3 A;  4XXR A;  4S2J A;  1J9M A;  4EUV A;  2XH9 A;  5EVI A;  4R3B A;  2VGL S;  4NK3 A;  2BG1 A;  2L0W A;  3IX8 A;  2W1R A;  4GB7 A;  2ZJ9 A;  2WUQ A;  5F1F A;  3IWQ A;  5M19 A;  4GS9 B;  2CC1 A;  4WYY A;  5AVF A;  5DFX A;  2OLU A;  2V8C A;  4MNR A;  3B47 A;  5EOE A;  3OLO A;  1MWT A;  4E3O A;  3K3C A;  2VV6 A;  3VMA A;  5L09 A;  4GHI B;  1S0W A;  2X71 A;  5DVA A;  1GSX A;  4N92 A;  1L0D A;  5FQI A;  4IUK A;  1OPX A;  3A3F A;  3LY4 A;  3MZE A;  2J9P A;  3F1N B;  4Y3I A;  1S6R A;  4I3A A;  2VGL M;  2B95 A;  3OBF A;  4WZ5 A;  3L9K A;  1MY8 A;  5IS1 A;  5IT5 A;  2KLI A;  1YLT A;  5FEF A;  2EWW A;  4FCF A;  2X01 A;  1FCN A;  3IT9 A;  5HL6 A;  3LIB A;  4K0W A;  3DBA A;  3ZCZ A;  1HTZ A;  1XA1 A;  2O9C A;  3HLB A;  1QMF A;  2HJ9 C;  1LL5 A;  1S4R A;  3G2Z A;  4H8R A;  4OOY A;  3MFX A;  2EFX A;  4NXB A;  3KX0 X;  5EUA A;  3HLG A;  4DE3 A;  4FSF A;  1ERO A;  3EQV A;  5HZH A;  4RX3 A;  5EVI D;  1NYY A;  1JVJ A;  1PWC A;  3LID A;  2NUT C;  1ALQ A;  3NJA A;  3ZG8 B;  4E3J A;  4LLO B;  1ACF A;  1GA9 A;  4WEJ A;  3F1O A;  4Y17 A;  4XT2 B;  2K7S A;  4JKT A;  2P04 A;  2A3U A;  2M7V A;  5GLC A;  3EEA A;  3JVV A;  3WS5 A;  3H82 A;  2V0W A;  1WE4 A;  3E0Y A;  5HWT A;  2J9O A;  3T4Q A;  1YMX A;  4JXV A;  2I9V A;  1IKI A;  5CTM A;  1K25 A;  5KIZ A;  3S22 A;  3V50 A;  1NLZ A;  3NDE A;  1HZO A;  4BL3 A;  3WS0 A;  4HP4 A;  5EV0 A;  1MWS A;  5EEC A;  5A90 A;  4Y13 A;  4PPR A;  4D2O A;  4LCL A;  5CER A;  5KSH A;  3E4P A;  1FR6 A;  3EEH A;  4QWO A;  2H0T A;  2PD8 A;  2HP5 A;  4WEL A;  3C5A A;  4U0T A;  3NOP C;  4BJP A;  4DN0 A;  3VFH A;  1G5U A;  1XJ6 A;  3MZD A;  4ZRR A;  5HD5 A;  3EOI A;  3WRZ A;  4BBU A;  4NXG A;  2UWX A;  3T4T A;  3D3O A;  2H0Y A;  2LB9 A;  1G68 A;  2Y2K A;  3LFV A;  1MWR A;  5J3W A;  4CLC E;  4LRX C;  2B5R A;  4IVI A;  4X56 A;  1BLS A;  4KQO A;  5KZH A;  4HJ4 A;  5GHY A;  4PMA A;  3FKW A;  4JF4 A;  4F3L B;  4UEY A;  3NHQ A;  3UPN A;  3BFG A;  2W1T A;  3IBJ A;  3D9Y A;  3VOY A;  2VEA A;  3MR0 A;  2B02 A;  3DWZ A;  1F98 A;  4DE2 A;  4BBV A;  2K2N A;  4ETZ A;  5AQ7 A;  5M1A A;  3O5Y A;  4GOG A;  3Q82 A;  3RTY A;  5E2G A;  4UHU A;  3G32 A;  5FDS A;  2UV0 E;  2XFS A;  1RP5 A;  1A0K A;  1OTD A;  1CI8 A;  3CWF A;  5KSC A;  1W63 Q;  1CK3 A;  3HLF A;  5GL9 A;  5HDS A;  3DTI A;  2EX2 A;  3RFB A;  4K0X A;  1W63 M;  3SH8 A;  1ONG A;  2QPN A;  2PR6 A;  1IEL A;  3TW8 A;  3UB8 A;  3NEC A;  2JKR I;  2XA7 S;  3CIT A;  4UQI M;  2KOI A;  1YLW A;  3GSG A;  3H82 B;  1WA9 A;  1I2S A;  1DY6 A;  4JGP A;  4Z1W A;  3VP4 A;  1XPB A;  1ZC2 A;  1S4S A;  5K5B A;  2Q0O A;  5F68 A;  1XX2 A;  4L0L A;  4HHD A;  5CTN A;  4RA7 A;  1F2K A;  2VJW A;  3MMH A;  3ZHH A;  3QP8 A;  1LLB A;  4LFU A;  5HAI A;  3UY6 A;  1W8Y A;  4FH2 A;  1MXO A;  2PYR A;  3NC8 A;  3G34 A;  1K55 A;  4JXG A;  4GW9 A;  1PW8 A;  3QP6 A;  3S7Q A;  1FCO A;  3GEC A;  3IBR A;  3P01 A;  3PYP A;  4R0Q A;  2XA7 M;  3NBL A;  4OQG A;  5DF7 A;  3U2A A;  4JPM A;  3VE3 A;  1ZG6 A;  1VET A;  1KDS A;  4EU0 A;  3UE1 A;  1MKM A;  4LEN A;  1CEF A;  2RCX A;  5DF8 A;  3LY3 A;  1VHM A;  4E3I A;  2PRF A;  2KDK A;  1KDW A;  3PAE A;  5HWV A;  2FFY A;  4DXC A;  3JVU A;  1EW0 A;  3S1Y A;  2INW A;  3ZG7 B;  3SS5 A;  1XFN A;  2M1C A;  4JXW A;  4E6X A;  3DTK A;  4PKY A;  2EXA A;  4BQM A;  3CLO A;  4NET A;  3Q1F A;  4IJG A;  1K54 A;  2W1T B;  2QJ5 A;  2WKR A;  4CJN A;  4P6B A;  3BEB A;  1K6R A;  4KG2 A;  3DTE A;  2JKT M;  3Q07 A;  3AGF A;  1LHY A;  1TF1 A;  4C75 A;  4OOL A;  2GX5 A;  3LO7 A;  4WMC A;  1Q2Q A;  3T12 B;  4KZ9 A;  2LB5 A;  1K56 D;  3MZF A;  2OAP 1;  4EQI A;  4HY8 A;  5FI6 A;  5TJJ A;  4X1L A;  3MKE A;  1PWG A;  3I7J A;  3PXP A;  4YOF A;  2EX8 A;  1LSX A;  3FZC A;  4CLC C;  4CLC D;  4UA6 A;  2XR0 A;  4MCW A;  2H10 A;  1OME A;  1IYP A;  3GR2 A;  4WZ4 A;  1SKO A;  5FA7 A;  3ZDJ A;  1DRM A;  1KGG A;  1JWZ A;  4ETX A;  5DTS A;  5J4E A;  3PBN A;  1N4O A;  1TS7 A;  5TGF A;  4QD4 A;  4EEP A;  4GD6 A;  4R3A A;  3LYX A;  3T1R A;  2VV8 A;  2WAD A;  4L9F A;  4EET B;  1D7E A;  1S1Y A;  3ISG A;  5GLD A;  3UNW A;  1VM1 A;  5JYO A;  2ZMF A;  2Y2I A;  1IFQ A;  3NUL A;  4GHI A;  2ZQA A;  3B33 A;  3NI9 A;  4S2M A;  4B4Z A;  3DWK A;  5CGW A;  4N1H A;  3TSG A;  3FV7 A;  1VET B;  3T4L A;  3HLD A;  2Z6D A;  3ZQ5 A;  3QP4 A;  4QY6 A;  2V20 A;  2HDS A;  2XRN A;  1DJC A;  3CAX A;  3ICY A;  5L8M A;  3EQU A;  2IWC A;  3ZNT A;  2ZMV A;  3SH9 A;  4KQR A;  5TBM A;  1PNE A;  4FOF A;  1E25 A;  3ZGA B;  1GHM A;  5L2F A;  3T50 A;  2Y2N A;  1LI9 A;  3VP3 A;  4GJ4 A;  1IEM A;  2C5W B;  4CQH A;  3IWO A;  2ZD8 A;  2W0N A;  3IF6 B;  5E43 A;  4R1G A;  3V5M A;  5A92 A;  4FTX A;  1JTD A;  3M2K A;  5FAO A;  3QNC A;  2HDQ A;  4B4X A;  2V0U A;  3LEZ A;  3H7W A;  3RXX A;  3HRE A;  4HBU A;  1FOF A;  2XEP A;  2PD7 A;  2JCH A;  1Q2P A;  1NXY A;  3A3E A;  4EBN A;  4PAU A;  1N9O A;  2ZMA A;  4HES A;  2OSU A;  4JGO A;  3UB9 A;  1PW1 A;  3BLS A;  2VX8 A;  3EGX C;  4WEK A;  5FI2 A;  5FQ9 A;  5I5L A;  2D01 A;  4KZ4 A;  2HJE A;  5TFQ A;  3M2J A;  4BEN A;  4DJ2 A;  3C2W A;  2HDU A;  1FSW A;  1ESU A;  4GZB A;  2XLN A;  1SKO B;  3BWL A;  4B93 A;  2M7U A;  5AVE A;  2ZLY A;  4ZJ2 A;  1FIK A;  1YQS A;  2XSS A;  4PM5 A;  1IYO A;  2VV7 A;  3TRC A;  1JTG A;  2DMW A;  2PT7 A;  2IWB A;  3IH8 A;  5E2F A;  2VZW A;  2Z2M B;  3PBO A;  5CRF A;  2IWD A;  4IVK A;  2W3H A;  4HBT A;  5DKK A;  1V9Z A;  4X69 A;  5FAP A;  1XJ4 A;  3BQ8 A;  1E4D A;  1GHI A;  5F1G A;  1O07 A;  4OP5 A;  5BOH A;  3IXB A;  5F6A A;  4WBG A;  1T1C A;  1LL9 A;  4WL9 A;  3S7P A;  1L0F A;  4ZJ3 A;  5A91 A;  1SCW A;  2Y4A A;  4OQH A;  3VFF A;  4F3L A;  1IKG A;  3HVF A;  1T1A A;  5KMW A;  3KSF A;  1H5X A;  3CJM A;  3WS4 A;  2V2F F;  1SDE A;  3PAG A;  5FI7 A;  3T4S A;  3TOI A;  4LRY C;  5TBM B;  4OPR A;  5CEB A;  5HSQ A;  3IQA A;  1XGJ A;  3W4O A;  2O9B A;  3A3I A;  5HAQ A;  2ZBB A;  5AJG A;  4EER A;  5HAP A;  4MBF A;  3P98 A;  5J8X A;  2FZ0 A;  3IX4 A;  1S66 L;  3KSG A;  3FC7 A;  3MXQ A;  1YSQ A;  2PYP A;  2ZL1 B;  5EVI C;  2Y55 A;  3MXS A;  2AVX A;  3T1X A;  1ES2 A;  4E3L A;  3H7W B;  3UB5 P;  1K6S A;  4Q0J A;  3JPU A;  4JLF A;  3W2Z A;  4E3M A;  3KYZ A;  3C4P A;  1UWN X;  3W4P A;  4KQQ A;  3BFF A;  2BAS A;  2W3D A;  2HV1 A;  2PU2 A;  4FD8 A;  3QHY A;  3V39 A;  1TDG A;  5MC7 A;  2W3G A;  4EXO A;  1W7F A;  3K2N A;  4C6Y A;  3E4Q A;  4KG6 A;  1BLH A;  1NJ4 A;  5HFO A;  1MKI A;  3TJZ C;  2HP9 A;  3G4P A;  3U4L P;  1ES5 A;  4GLQ A;  4X53 A;  1G6A A;  1HVB A;  1YLZ A;  2W27 A;  4MN7 A;  5J7E A;  3T4J A;  3UB7 A;  2HP6 A;  2E8J A;  1ZTU A;  3BQA A;  1WYB A;  3E2L A;  3LIC A;  4LV0 A;  4JBF A;  4JF6 A;  4WZ5 C;  4JF5 A;  2V9A A;  2WAF A;  4LRZ E;  2W3F A;  4O8G A;  1KVM A;  3UE6 A;  4HOI A;  1Z09 A;  2VGK A;  1M6K A;  1FQG A;  1G6O A;  3N8R A;  1VQQ A;  4FUW A;  3MF0 A;  1T18 A;  4YFM A;  1H0M A;  1Y54 A;  4JGQ A;  1DP6 A;  1JWP A;  5EFW A;  1YSP A;  5G18 A;  4U3T A;  1NRJ A;  2Y2L A;  1MZU A;  2QHK A;  5FQK A;  1TEM A;  1EI5 A;  1TD5 A;  1LL8 A;  3FKV A;  3SOI A;  5L10 A;  3VP1 A;  5FEG A;  2VGJ A;  3GQZ A;  2FFF B;  4NXF A;  4BLM A;  1LSW A;  4OPY A;  3ZVT A;  2JKT I;  2VKS A;  1CI9 A;  3BEC A;  4MEZ A;  2Z6C A;  3CUE A;  2ZM2 A;  2J3T D;  2J3T C;  2Y2J A;  2ZC4 B;  3OPL A;  2L4R A;  1PI4 A;  1RGZ A;  1BLC A;  3PR6 A;  2MJ6 A;  4QY5 A;  3Q7Z A;  4DE1 A;  2JHE A;  3C7V A;  3M6B A;  3B3X A;  1TVF A;  3UE3 A;  2J3W A;  3N6I A;  1V9Y A;  1BTL A;  4GD8 A;  4WM9 A;  4HH2 A;  4HJ6 A;  3NCK A;  1E3U A;  4NXE A;  1OT9 A;  4GDN A;  3Q7V A;  2XDM A;  4DKI A;  4ME4 A;  4Y0T A;  2DCF A;  4N1X A;  4EEU A;  3BY8 A;  3CZD A;  3SS4 A;  3DW0 A;  5AQA A;  4DF6 A;  1ZKJ A;  3UMD A;  1D06 A;  3O86 A;  5FSR A;  4N9L A;  4Z9Q A;  1WYC A;  5F83 A;  3IHA A;  5IU1 A;  4LGW A;  3HBR A;  3MJQ A;  4B9O A;  1L0E A;  1KE3 A;  5FQJ A;  3T4K A;  4I3J A;  3OPH A;  4O01 A;  2Y2Q A;  1BYW A;  4K91 A;  2WZX A;  3CUE C;  3PBT A;  1LT0 A;  4UA7 A;  4L9G A;  1K0K A;  3UME A;  3W4Q A;  4GNU A;  2WK0 A;  1NZO A;  4P6Z S;  1KGF A;  4EBL A;  4QU3 A;  3NIA A;  3PBQ A;  2Y2H A;  2VK3 A;  3HLW A;  3SS3 A;  1K4E A;  4P85 A;  3BLM A;  4PM7 A;  1MBL A;  4ESP A;  3IHB A;  1OJG A;  3FWL A;  4I38 A;  1YKD A;  2EA9 A;  3BRM A;  4II7 A;  5G4Y A;  4S2N A;  3VP0 A;  1NY0 A;  1RCJ A;  5LBR A;  5FAT A;  5C5K A;  2ZOI A;  1JNU A;  3IF6 A;  4Y0O A;  1TS6 A;  4ZJ1 A;  3BFC A;  1ESI A;  1BZA A;  1PRQ A;  4LPZ A;  3NY4 A;  3FPV A;  3E4O A;  4P6Z M;  1YMS A;  3PHY A;  4IED A;  2JN7 A;  4BWI A;  4S2P A;  3BFE A;  5FAS A;  1LI0 A;  3VOL A;  4Y7P A;  3SZT A;  3EGD C;  2VA0 A;  3M6H A;  3C7U A;  3CI6 A;  2ZQD A;  1K55 C;  3VE4 A;  2WGV A;  3LR5 A;  2O9A A;  3V3R A;  4G3W A;  2HF6 A;  1K57 A;  3GVB A;  2CMN A;  3A3D A;  4ARZ B;  1BSG A;  4G3K A;  3Q7V B;  3BM6 A;  5HWW A;  3V67 A;  2WGI A;  4P87 A;  5U47 A;  3UDF A;  2OV5 A;  2V1A A;  1P9W A;  4OKP A;  3G35 A;  4MBH A;  3S7N A;  3GTC A;  3G31 A;  3HUM A;  3QP5 A;  3P7N A;  3ITB A;  3HCY A;  1K4F A;  3D4F A;  4JXS A;  2K31 A;  3HUN A;  2P7J A;  2QMI A;  5D3O A;  1BUE A;  2OLV A;  5JYP A;  4I5S A;  1VB6 A;  3UE0 A;  5F82 A;  1K54 C;  3O3V A;  2IA2 A;  4LV3 A;  3LCE A;  2BTF P;  2HPB A;  2XRO A;  2YKF A;  4BMW A;  4OH0 A;  4WMC D;  3UO9 A;  2QWS A;  3HLC A;  4C3Q A;  4HEF A;  4KUO A;  4OPZ A;  4U0X A;  1SKF A;  5TR7 A;  3RH8 B;  1YLY A;  3HJK A;  4I3I A;  5FQM A;  4R6L A;  3IS2 A;  3ITA A;  3LI8 A;  4OOM A;  4GKU A;  4RVA A;  3N8S A;  5CHJ A;  2Y2M A;  4NKP A;  1W8Q A;  4RX2 A;  4EUZ A;  4EWF A;  1PIO A;  4RQ9 A;  1CF0 A;  1OJ5 A;  1Z6F A;  4ID4 A;  3UB6 A;  3LI9 A;  2ZL1 A;  1HD8 A;  2L1M A;  1I2W A;  3OCL A;  3IH9 A;  4OVD A;  3IXG A;  3B42 A;  3TG9 A;  2ZM0 A;  4X6T A;  3HUO A;  4DDY A;  1D1J A;  3MFD A;  3A0S A;  1YLP A;  4DMZ A;  4WLA A;  3AGD A;  3UPO A;  2J8Y A;  4LCM A;  4DDS A;  4IBX A;  1PYY A;  2EWV A;  3DAV A;  4PHT A;  1IYQ A;  4DXB A;  4PM8 A;  3UN7 A;  4GCZ A;  4OP8 A;  5EPH A;  3IF5 A;  4Q0H A;  3PBR A;  3S7O A;  4DE0 A;  4Y0U A;  1U60 A;  2V1Z A;  2PBY A;  4A5R A;  1SHV A;  1J3W A;  3TE8 A;  3C30 A;  5EE8 A;  2WYX A;  3PBS A;  4HP9 A;  3GMW A;  4X25 A;  3QP2 A;  4R4R A;  2JKG A;  1FCM A;  2R9X A;  3F1P A;  2B18 A;  5HX9 A;  3ZVW A;  4KZ6 A;  3LR3 A;  2P74 A;  3LEQ A;  4WUJ A;  4E3K A;  3CPT A;  1H8M A;  1M40 A;  2R9W A;  4MN6 A;  1NYM A;  3GV9 A;  1UGU A;  1XKZ A;  3BYD A;  4HNB A;  1KE0 A;  4KEN B;  4R4S A;  1JWV A;  4QJG A;  2PHY A;  1ONH A;  2XGN A;  5CGS A;  2PR5 A;  3HLE A;  4P0M A;  3G6O A;  5GLB A;  4GDB A;  2G7U A;  1LSV A;  4BD0 A;  1OTI A;  5AQB A;  2PDR A;  1AWI A;  2P08 A;  2EX6 A;  2OAQ 1;  4H6J B;  4N9K A;  4UA9 A;  2H28 A;  3IS2 B;  1KGE A;  3O88 A;  2Y91 A;  1T19 A;  1XXM A;  2X02 A;  5E2H A;  5F5Y A;  1STZ A;  5DKL A;  4QPR A;  3FG8 A;  3UDI A;  5GLA A;  4FH4 A; 
#chains in the Genus database with same CATH homology
 2I72 A;  2Y2J A;  4CJN A;  2ZC4 B;  1C3B A;  1TDL A;  4P6B A;  3OPL A;  4PM6 A;  3BEB A;  1K6R A;  4KG2 A;  3Q07 A;  3AGF A;  1LHY A;  4C75 A;  1PI4 A;  1RGZ A;  1BLC A;  3G2Y A;  4OOL A;  3NDG A;  3LO7 A;  4WMC A;  5FAQ A;  3SH7 A;  1IYS A;  4QY5 A;  1Q2Q A;  3Q7Z A;  4KZ9 A;  4DE1 A;  3C7V A;  4QB8 A;  3A3J A;  4RYE A;  1K56 D;  1N9B A;  2HDR A;  3M6B A;  3N7W A;  3OC2 A;  3B3X A;  1TVF A;  2WKH A;  2ZQ9 A;  4OQ0 A;  3UE3 A;  1XGI A;  3HL9 A;  3MZF A;  2XD5 A;  4EQI A;  3N6I A;  5CGX A;  5EOO A;  5FI6 A;  2XD1 A;  4DRT A;  4CPK A;  1BTL A;  2H5S A;  1PWG A;  3MKE A;  4GD8 A;  4WM9 A;  3I7J A;  3NCK A;  1E3U A;  4S2L A;  2Y2O A;  2EX8 A;  5GHZ A;  4KZ8 A;  3VOZ A;  5A93 A;  4GDN A;  2C6W B;  3Q7V A;  3IWI A;  3FZC A;  4X55 A;  2XDM A;  4DKI A;  4XUZ A;  3UPP A;  3RJU A;  4UA6 A;  2XR0 A;  2WKE A;  2H10 A;  2ZC5 B;  1OME A;  1IYP A;  2PU4 A;  3GR2 A;  4Y0T A;  2DCF A;  4WZ4 A;  4N1X A;  4LV2 A;  2Y2P A;  5IHV A;  1O7E A;  2WZZ A;  3CZD A;  4O7D A;  3IXH A;  3SS4 A;  3DW0 A;  5AQA A;  5FA7 A;  3ZDJ A;  4DF6 A;  2E8I A;  4UAA A;  4B88 A;  2Y59 A;  1KGG A;  1ZKJ A;  1XP4 A;  3ZG5 A;  1L0G A;  1W5D A;  5HAR A;  3O86 A;  3P09 A;  1DJA A;  5FSR A;  2XK1 A;  2JE5 A;  4N9L A;  4Z9Q A;  3Q81 A;  1WYC A;  1JWZ A;  5F83 A;  3IHA A;  1ES4 A;  5DTS A;  1CEG A;  4XXR A;  3PBN A;  1N4O A;  4S2J A;  1J9M A;  2XH9 A;  5EVI A;  3HBR A;  4R3B A;  3JYI A;  1GA0 A;  2ZQ7 A;  5TGF A;  4NK3 A;  4QD4 A;  2WGW A;  4GD6 A;  1L0E A;  1KE3 A;  2BG1 A;  2ZC6 B;  4OLG A;  5FQJ A;  3OPH A;  4GB7 A;  2Y2Q A;  4YIN A;  4K91 A;  2WAE A;  2ZJ9 A;  2WAD A;  2WUQ A;  1W79 A;  2WZX A;  5F1F A;  1BT5 A;  5EVI B;  3PBT A;  4UA7 A;  3IWQ A;  5M19 A;  3QNB A;  1AXB A;  3ISG A;  3W4Q A;  4GNU A;  5GLD A;  1KE4 A;  2WK0 A;  2ZC3 B;  3UNW A;  1NZO A;  2CC1 A;  5FDH A;  4WYY A;  1KGF A;  1VM1 A;  5JYO A;  4EBL A;  2Y2I A;  4QU3 A;  4EV4 A;  2ZQA A;  3NIA A;  4OON A;  1ERM A;  2OLU A;  3NI9 A;  4S2M A;  5DF9 A;  3PBQ A;  2Y2H A;  4B4Z A;  3DWK A;  4MNR A;  5CGW A;  4N1H A;  5EOE A;  3HLW A;  3TSG A;  3SS3 A;  1MWT A;  4KZB A;  1K4E A;  4E3O A;  1EWZ A;  3FV7 A;  3BLM A;  4P85 A;  4PM7 A;  1MBL A;  3IHB A;  3VMA A;  1S0W A;  2X71 A;  3HLD A;  5DVA A;  3FWL A;  3W8K A;  1YT4 A;  4N92 A;  1L0D A;  2XF3 A;  4QY6 A;  5FQI A;  2V20 A;  3A3F A;  1I5Q A;  2HDS A;  3BRM A;  5GHX A;  1DJC A;  3LY4 A;  1XA7 A;  3MZE A;  2J9P A;  2BLS A;  4S2N A;  3VP0 A;  1NY0 A;  1RCJ A;  3EQU A;  2IWC A;  3ZNT A;  3SH9 A;  4KQR A;  5CED A;  5FAT A;  1S6R A;  2XQZ A;  1E25 A;  2ZQ8 A;  3ZGA B;  2EX9 A;  1GHM A;  2EFU A;  3IF6 A;  4Y0O A;  5L2F A;  4WZ5 A;  4ZJ1 A;  3BFC A;  1ESI A;  2Y2N A;  1MY8 A;  1LI9 A;  3VP3 A;  1BZA A;  1IEM A;  1YLT A;  2C5W B;  1NZU A;  3GRJ A;  3IWO A;  4FCF A;  2X01 A;  2ZD8 A;  1FCN A;  3IT9 A;  3E2K A;  3WS2 A;  4BL2 A;  3IF6 B;  5E43 A;  3NY4 A;  4K0W A;  4R1G A;  4XUX A;  3V5M A;  5A92 A;  1JTD A;  3AGE A;  2JBF A;  5DTK A;  1YMS A;  4IED A;  2ZC7 A;  3M2K A;  5FAO A;  3MBZ A;  3ZCZ A;  2Q9N A;  3QNC A;  1HTZ A;  1XA1 A;  2HDQ A;  3HLB A;  1QMF A;  4B4X A;  1LL5 A;  3G2Z A;  4FH4 A;  4H8R A;  3LEZ A;  4S2P A;  4OOY A;  3BFE A;  5FAS A;  2EFX A;  1LI0 A;  5EUA A;  3RXX A;  3HLG A;  3HRE A;  1FOF A;  4HBU A;  2XEP A;  1H8Y A;  4Y7P A;  4FSF A;  1ERO A;  4DE3 A;  2JCH A;  3EQV A;  1Q2P A;  4RX3 A;  2GDN A;  5EVI D;  1DJB A;  1NYY A;  1NXY A;  2Z2L B;  1JVJ A;  1YLJ A;  1PWC A;  3A3E A;  1FSY A;  4EBN A;  4R23 A;  4S2I A;  1ALQ A;  3ZG8 B;  2ZMA A;  4HES A;  2OSU A;  4X68 A;  4E3J A;  4PM9 A;  3M6H A;  1PW1 A;  3BLS A;  1GA9 A;  4WEJ A;  4WEK A;  5FI2 A;  5FQ9 A;  3C7U A;  4KZ4 A;  2ZQD A;  1K55 C;  1MPL A;  1KVL A;  2WGV A;  3V3R A;  4JKT A;  4MBK A;  1K57 A;  3N4I A;  5FQQ A;  2A3U A;  3MXR A;  3GVB A;  5TFQ A;  3A3D A;  3M2J A;  5GLC A;  4BEN A;  1BSG A;  3Q7V B;  3WS5 A;  1WE4 A;  3BM6 A;  3ZG9 B;  2J9O A;  4S2K A;  2HDU A;  3OPP A;  1FSW A;  1YMX A;  1ESU A;  2WGI A;  4P87 A;  5U47 A;  3UDF A;  4GZB A;  2OV5 A;  2XLN A;  4OKP A;  4JXV A;  2EXB A;  3G35 A;  4MBH A;  3GTC A;  3G31 A;  3HUM A;  3RXW A;  2ZLY A;  1IKI A;  3ITB A;  4ZJ2 A;  1K4F A;  1YQS A;  3D4F A;  4IBR A;  4JXS A;  3N8L A;  3HUN A;  4PM5 A;  2QMI A;  1IYO A;  1JTG A;  3IXD A;  3CMZ A;  5CHU A;  5CTM A;  1K25 A;  5D3O A;  1BUE A;  3S22 A;  3V50 A;  2OLV A;  5JYP A;  1BLP A;  3NDE A;  1HZO A;  2IWB A;  3IH8 A;  5E2F A;  1GHP A;  4BL3 A;  2Z2M B;  3PBO A;  3UE0 A;  3WS0 A;  5CRF A;  3ZNY A;  2IWD A;  1K56 A;  1BUL A;  4IVK A;  5F82 A;  1K54 C;  3O3V A;  1MWS A;  5EEC A;  1ES3 A;  2P9V A;  3FYZ A;  3BFD A;  4HBT A;  4S2O A;  5A90 A;  4LV3 A;  4X69 A;  2WGW B;  3LCE A;  5FAP A;  4PPR A;  4D2O A;  1E4D A;  2HPB A;  4LCL A;  5CER A;  1GHI A;  5F1G A;  1FR1 A;  2ZM8 A;  1O07 A;  4OH0 A;  4WMC D;  5KSH A;  1FR6 A;  4OP5 A;  3UO9 A;  5BOH A;  3IXB A;  2H0T A;  4ZAM A;  3HLC A;  2HP5 A;  4WBG A;  4C3Q A;  4WEL A;  3C5A A;  4HEF A;  4U0T A;  4OPZ A;  4BJP A;  1PZO A;  1LL9 A;  1SKF A;  4U0X A;  5TR7 A;  3VFH A;  3MZD A;  1L0F A;  1YLY A;  4ZJ3 A;  3WRZ A;  5A91 A;  1SCW A;  2Y4A A;  1MWU A;  5FQM A;  4LV1 A;  4OQH A;  3VFF A;  2UWX A;  5CHM A;  3ITA A;  2XFT A;  5HL1 A;  1IKG A;  1E3U D;  2H0Y A;  4OOM A;  1G68 A;  3HVF A;  2Y2K A;  1MWR A;  5KMW A;  4GKU A;  4RVA A;  3VSK A;  2B5R A;  4IVI A;  1H5X A;  4X56 A;  3N8S A;  5CHJ A;  3CJM A;  4ZTK A;  2Y2M A;  1BLS A;  4KQO A;  3WS4 A;  2V2F F;  5KZH A;  1SDE A;  5GHY A;  4PMA A;  1W8Q A;  1GCE A;  3FKW A;  4JF4 A;  4RX2 A;  3PAG A;  5FI7 A;  3TOI A;  4OPR A;  3UPN A;  4EUZ A;  5CEB A;  3BFG A;  4EWF A;  1PIO A;  3IQA A;  1XGJ A;  3W4O A;  3A3I A;  5HAQ A;  3VOY A;  1Z6F A;  4ID4 A;  4KZA A;  1HD8 A;  5HAP A;  3ZFZ A;  4MBF A;  3P98 A;  4ZDX A;  3DWZ A;  4DE2 A;  5J8X A;  5CXW A;  1I2W A;  3S4X A;  2G2U A;  3OCL A;  3IH9 A;  3WWX A;  5I94 A;  5AQ7 A;  3MKF A;  3UDX A;  5M1A A;  4KZ3 A;  4QHC A;  4OVD A;  4GOG A;  2J7V A;  3IXG A;  5EVI C;  3Q82 A;  2Y55 A;  5E2G A;  4UHU A;  3MXS A;  3G32 A;  1ES2 A;  2ZM2 A;  3G30 A;  4E3N A;  3TG9 A;  1PI5 A;  2XFS A;  2ZM0 A;  4E3L A;  4X6T A;  2QZ6 A;  3CG5 A;  1K6S A;  3HUO A;  1RP5 A;  4DDY A;  4JLF A;  4E3M A;  3MFD A;  1CI8 A;  5KSC A;  1YLP A;  3C4P A;  3AGD A;  1CK3 A;  1RGY A;  2Y2G A;  3HLF A;  3W4P A;  5GL9 A;  3UPO A;  3OPR A;  2J8Y A;  4KQQ A;  3BFF A;  4LCM A;  4DDS A;  2ZQC A;  2EX2 A;  4IBX A;  1PYY A;  4K0X A;  3SH8 A;  1ONG A;  2PU2 A;  2QPN A;  4KZ5 A;  1IEL A;  4FD8 A;  3QHY A;  3V39 A;  1TDG A;  4OLD A;  1L2S A;  1IYQ A;  1W7F A;  3O87 A;  4DXB A;  2RL3 A;  4PM8 A;  5EVL A;  4OP8 A;  3UN7 A;  4C6Y A;  1ZG4 A;  5EPH A;  3IF5 A;  2WKI A;  4KG6 A;  3PBR A;  1BLH A;  1NJ4 A;  4Y0U A;  1MKI A;  5HFO A;  4DE0 A;  1U60 A;  2V1Z A;  4E6W A;  4F94 A;  4Q8I A;  2PBY A;  2HP9 A;  4A5R A;  1SHV A;  1YLW A;  3GSG A;  1I2S A;  3G4P A;  1DY6 A;  5EE8 A;  2WYX A;  1K38 A;  3VP4 A;  2G2W A;  1XPB A;  1ES5 A;  3PBS A;  1ZC2 A;  3GMW A;  5E2E A;  4X53 A;  4GN2 A;  1G6A A;  1HVB A;  1YLZ A;  4R4R A;  2DRW A;  2R9X A;  1FCM A;  3PTE A;  3VSL A;  4S2N C;  4BD1 A;  5HX9 A;  4OPQ A;  3ZVW A;  4KZ6 A;  2HP6 A;  2P74 A;  1WYB A;  3WRT A;  3E2L A;  1XX2 A;  4LV0 A;  3IF6 C;  4E3K A;  4EBP A;  4L0L A;  3OZH A;  5DTT A;  4JBF A;  1QME A;  1PZP A;  4JF6 A;  5CTN A;  3OCN A;  2Q9M A;  4WZ5 C;  1M40 A;  2R9W A;  5CEC A;  4RA7 A;  4JF5 A;  2WAF A;  1NYM A;  3ZHH A;  3GV9 A;  1LLB A;  5GLA A;  1XKZ A;  1KVM A;  3BYD A;  3ZG0 A;  1KE0 A;  4KG5 A;  5HAI A;  4KEN B;  3UY6 A;  2VGK A;  1W8Y A;  4R4S A;  3WS1 A;  3V3S A;  1JWV A;  1M6K A;  1FQG A;  2P9V B;  4FH2 A;  1MXO A;  4QJG A;  3NC8 A;  1ONH A;  2XGN A;  5CGS A;  3G34 A;  3N8R A;  1VQQ A;  4YFM A;  3HLE A;  1K55 A;  4JXG A;  4MLL A;  4P0M A;  1PW8 A;  5GLB A;  1Y54 A;  5HW3 A;  4GDB A;  1FCO A;  4R0Q A;  4BD0 A;  3NBL A;  4OQG A;  4M3K A;  1JWP A;  3C4O A;  5DF7 A;  4JPM A;  3DTM A;  4OQI A;  1ZG6 A;  4ZBE A;  5AQB A;  1YM1 A;  5G18 A;  4U3T A;  1KDS A;  3UE1 A;  2A49 A;  4LEN A;  1CEF A;  2RCX A;  2Y2L A;  5DF8 A;  4R3J A;  3LY3 A;  4E3I A;  5FQK A;  1KDW A;  1TEM A;  2EX6 A;  3PAE A;  2JC7 A;  2FFY A;  4N9K A;  4UA9 A;  4DXC A;  1EI5 A;  3FKV A;  1K57 C;  3SOI A;  3VP1 A;  1KGE A;  5M18 A;  3O88 A;  3S1Y A;  2Y91 A;  1XXM A;  2VGJ A;  1SDN A;  3ZG7 B;  2X02 A;  1ERQ A;  3GQZ A;  5E2H A;  3SS5 A;  2FFF B;  4BLM A;  4OPY A;  1H8Z A;  3VP2 A;  5AQ9 A;  4JXW A;  4E6X A;  1NRF A;  4KZ7 A;  3ZVT A;  2EXA A;  1CI9 A;  3BEC A;  4MEZ A;  3UDI A;  4BQM A;  4NET A;  3Q1F A;  1K54 A;  1PWD A;  2DNS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...