1LSXA

Crystal structure of the methylimidazole-bound bjfixl heme domain
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
116
structure length
116
Chain Sequence
DAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRYRTTSDPHIIGIGRIVTGKRRDGTTFPMHLSIGEMQSGGEPYFTGFVRDLTEHQQTQARLQEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure-based mechanism of O2 sensing and ligand discrimination by the FixL heme domain of Bradyrhizobium japonicum
pubmed doi rcsb
source organism Bradyrhizobium japonicum
molecule tags Transferase
molecule keywords Sensor protein FixL
total genus 30
structure length 116
sequence length 116
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2002-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1lsxA00
1JNUA 1P97A 3MXQA 1Y28A 5HDCA 4BBTA 5HWWA 1XJ3A 5HWTA 4HJ3A 3UB6A 2VV7A 4HP9A 4EEPA 1T1AA 1XJ2A 4I3JA 4L9FA 1P0ZA 3GECA 4KUOA 2W0NA 1LSVA 5HD3A 2V0UA 4DJ2A 1LSWA 5J3WA 1F9IA 1OT6A 1S67L 3NOTC 3CWFA 1VB6A 4MN6A 2L1MA 2PYRA 5DKKA 4WL9A 2V1BA 2PDRA 2PR5A 2A24A 2VEAA 3MFXA 3NOPC 5HDSA 2JN7A 1UGUA 3UB7A 2VLGA 2PHYA 1OT9A 4R6LA 4LLOB 3UMDA 3EWKA 2Z6DA 5AVEA 3MR0A 1OTAA 1TS8A 2WKPA 3BY9A 4LRXC 4PKYG 3F1PA 3ULFA 2PD7A 2CMNA 5G4ZA 2KX6A 4MN5A 4BBVA 1XJ6A 1N9OA 3BWLA 1XFQA 4HI4A 3K3CA 4GCZA 5HSQA 2H28A 3UMEA 4R38A 2L4RA 3MJQA 5TBMB 4EXOA 1D06A 1N9NA 5DJTA 4R70A 3KX0X 4I3IA 4EQ1A 3LIDA 5HD5A 4R3AA 4XT2A 4GW9A 5HDDA 4F3LB 1S1ZA 4HJ6A 1KOUA 3SW1A 1MZUA 4JGPA 3LIFA 3K3DA 4NXEA 2B02A 3H7WA 2ZOIA 4WUJA 3RTYA 4B9OA 1DP6A 4KQDA 4JGRA 3ZQ5A 3D72A 4I38A 3A0VA 1S66L 4I5SA 4KUKA 3FG8A 2VV8A 4HH2A 2YKHA 5AVFA 4HOIA 4E04A 5J7EA 2K7SA 4NXBA 4HJ4A 3A0RA 1OTDA 3P7NA 3F1OA 3MQOA 4EEUA 3HJIA 3EEHA 5F69A 4HNBA 2WKQA 3E4QA 3H9WA 3F1PB 5A8BA 5HZHA 4WLAA 2V9AA 2QWSA 4HQAA 3B33A 3CLOA 1GSVA 2YKFA 1OTIA 2QKPA 1DRMA 1TS0A 3E4PA 3ICYA 2M1CA 5F68A 2Z6CA 3H82B 4L9EA 2P7JA 1T1BA 3E4OA 2PD8A 1S4RA 3LI9A 2OWJA 1LT0A 3PYPA 3NOUC 4YWZA 2QHKA 1DP8A 3LIEA 5HWVA 4WN5A 3VOLA 3C8CA 3PHYA 4JGQA 1G28A 1GSXA 3H82A 2A24B 2JHEA 2PR6A 3CAXA 3GDIA 4PKYA 5I5LA 4M4XA 1S1YA 2D02A 3LIBA 3FC7A 2QJ5A 1F98A 5G4YA 2ZOHA 4NXGA 3A0SA 4I3AA 1LL8A 4K08A 1T18A 5DKLA 4LRYC 1XJ4A 3VE3A 2D01A 4DJ3A 2I9VA 4NXFA 5IS1A 3G6OA 4EERA 4HIAA 4HHDA 3IS2A 3NHQA 4GS9A 2KDKA 1T1CA 4EETB 4HH3A 4HY8A 4LPZA 5KIZA 4GHIA 2V1AA 1X0OA 3T50A 1GSWA 1EW0A 4EESA 1ODVA 1DP9A 2GJ3A 1S4SA 1V9ZA 2R78A 3LICA 3OLOA 1TS7A 2INWA 2L0WA 5IU1A 3F1OB 3UB9A 3F1NB 4I39A 3VE4A 1OJ5A 2WKRA 4L9GA 3UE6A 1T19A 2QJ7A 1OJGA 3LI8A 5DJUA 1XFNA 2VV6A 3C2WA 3MQQA 4H6JA 3LUQA 4H6JB 5TBMA 2J80A 3HJKA 3IS2B 4GS9B 1NWZA 2V0WA 3LIAA 1UWPX 4LRZE 1D7EA 3H7WB 3UB8A 5J4EA 2HV1A 3F1NA 4WF0A 1WA9A 5F6AA 4HP4A 3IBRA 4EW7A 5F5YA 1OTBA 1OTEA 2PYPA 3NJAA 5EFWA 4F3LA 4JGOA 2OOLA 2W27A 3LYXA 1N9LA 4XT2B 2ZBBA 1UWNX 4GHIB 1V9YA 4BBUA 2BASA 2OWHA 1TS6A 3RH8B 1BYWA 1LSXA 2EA9A 3BY8A 4RQ9A
chains in the Genus database with same CATH superfamily
2WGWA 4Y15A 2WK0A 1OT6A 2A24A 3DW0A 4X69A 3SS3A 1WYCA 3LEQA 2VA0A 4RX2A 4UA6A 2BLSA 4Y2FA 1XPBA 2UV0E 5DF9A 4JXVA 3MQ0A 1ONGA 1SDNA 1GCEA 3UNWA 3ZGAB 2YKHA 3TE8A 5KMWA 3MQOA 3EEHA 4CLCE 1PI5A 3V5MA 4XUXA 3T4JA 3BFDA 1Y4OA 5TGFA 1Y54A 1YLTA 2UWXA 5A91A 1BLPA 3FZCA 5C5KA 3G32A 1Q2QA 4I3AA 3KSFA 1T18A 3BLSA 3KYEA 4OVDA 3WWXA 4EESA 3A3DA 3OLOA 3VE4A 3T4OA 1L3LA 1OJ5A 2WKRA 3O87A 1L0GA 4OPZA 3MQQA 3NECA 5HAPA 2XA7M 1OTEA 3TJZC 3FPVA 4WEKA 3B3XA 3Q81A 3ICYA 5F83A 3JVUA 3UB6A 2W0NA 2NUPC 2B18A 1LSWA 5FAPA 3SS4A 5EVIB 3UMDA 4PKYG 4LRXC 3ZG8B 4C75A 1DJBA 5G4ZA 5EE8A 1N9OA 5G18A 1KVMA 1KVLA 4U0XA 4I3IA 2VX8A 1AXBA 4IUHA 5HX9A 4F3LB 4CLCB 1LI0A 3V3RA 3WS1A 4IBRA 4JXWA 2XGNA 1ES5A 3NY4A 1TEMA 2HF6A 1NXYA 3CMZA 2EX6A 5A8BA 2XD1A 2O0YA 1CI9A 3VSKA 1PRQA 2HP5A 1XX2A 4Y13A 5GL9A 1K4FA 1JWPA 3UN7A 1LT0A 1ZKJA 3KSIA 2XH9A 4UA7A 5I5LA 1K55C 2P08A 3V67A 5K5BA 2ZOHA 4Y0OA 2PU2A 4Y0UA 2D01A 1PFLA 2XLNA 3IS2A 3Q07A 3AGFA 4S2IA 4L9GA 1N4OA 1VHMA 1RCJA 3UB8A 1E4DA 5EOOA 3ITBA 3AGDA 5F5YA 3IXBA 1BLCA 5FI6A 1F5MA 1N9LA 5AQ7A 2OLUA 2ZC7A 1PIOA 3VFFA 2H0YA 4EEPA 1PW1A 1S67L 1NJ4A 2PR5A 3MMHA 1A0KA 3GSGA 5AVEA 1P9WA 3CPTA 3R7WB 4UHUA 5FQJA 5GHZA 4E3MA 1Z09A 3E2LA 2KX6A 4N9LA 3ZNTA 3BYDA 3KYQA 4EV4A 3UPPA 1NRFA 1PNEA 4R3AA 5HPIA 4K0WA 2HDUA 2B02A 2ZM8A 3ZQ5A 2W3DA 1ALQA 1N9BA 2IWBA 5A90A 3T1XA 4U3TA 2WKQA 3E4QA 2G2UA 1TD5A 4PMAA 1I5QA 3CLOA 1FCMA 2X71A 4L9EA 2IA2A 3SH7A 3PHYA 4JGQA 5DTTA 2JHEA 2EX9A 5CGSA 4FH4A 4X68A 4K08A 3T1RA 2PBDP 1O7EA 1RGYA 4DJ3A 4KZ9A 1L2SA 3S7PA 1T1CA 3G31A 3FKVA 3A3EA 2R78A 2W1RA 2C6WB 4KG5A 4H6JA 5AJGA 2J80A 2HV1A 3C4PA 4C3QA 3AGEA 1BYWA 1BSGA 3VP2A 3MXQA 2W1TA 1P0ZA 1CEGA 2I72A 2P04A 4S2JA 5CECA 2ZMAA 4BJPA 3CI6A 4BENA 1JTGA 2WKPA 5A93A 1IYOA 1CK3A 1H5XA 4ZAMA 4GD8A 2HZ5A 1BLSA 3ZVWA 3GVBA 1KDSA 2XEPA 5FAOA 3LIDA 4EUVA 4E3NA 3HLGA 4OH0A 4DE3A 2JKGA 4B9OA 4KUKA 1S66L 2V2FF 4D60A 5AVFA 2ZQ7A 2DCFA 3A0RA 3ZNYA 3F1OA 1FSYA 3IHBA 3JYIA 5L07A 3FWLA 5EM1A 3T4LA 1CEFA 4EU0A 1DRMA 4S2NA 1NYYA 1T1BA 1YPRA 3C5AA 3IXDA 3W4QA 3ZVTA 4PKYA 2Z2LB 3VP0A 5EUAA 4UEYA 3HLCA 2Y91A 2WGWB 3M6BA 2MJ6A 3NC8A 4HIAA 3P01A 3CG5A 3DTIA 4KZAA 4S2OA 4PHTA 4RX3A 1V9ZA 3WRTA 1WE4A 1E25A 3HUMA 4QY5A 4HEFA 3WS2A 1ONHA 3IWOA 4HP4A 1FQGA 4H8RA 2OOLA 1IOUA 1V9YA 1J9MA 2OWHA 1LSXA 4X6TA 3NCKA 4RA7A 5GLDA 5FDSA 4ME4A 2EWWA 1YLZA 2BG1A 3VMAA 3EQUA 2J3TD 1K0KA 3NOTC 5FAQA 2OAP1 4N9KA 4BL3A 4R3JA 2JBFA 3MKFA 2RCXA 4DKIA 5E2HA 5J8XA 5GLCA 2ZLYA 3ULFA 2PD7A 1VQQA 3OPRA 2IWCA 1KGEA 1PZOA 1K56A 3DTEA 3NDEA 4S2NC 3O86A 3SZTA 2Y8HA 1QMFA 3LY4A 4DMZA 1W7FA 4MMNA 1JWVA 3G4PA 4HH2A 4DN0A 4PM6A 3LCEA 4FTXA 3G2YA 4HNBA 4OPYA 4JLFA 2HJ9C 2W3HA 1TS0A 4WM9A 1YMXA 1K6SA 4YFMA 4JXSA 2A2LA 4ZJ1A 3KYZA 2Y2OA 5DFYA 1U60A 3H82A 2A49A 3FC7A 3FYZA 2ZC6B 4UA9A 3P98A 1XGJA 4Q8IA 2WAEA 4OQHA 3UB5P 2I9VA 3BM6A 3QP5A 3NHQA 4IBXA 5FQIA 2ZMVA 1XA7A 2EX2A 3FV7A 3W4PA 2J8YA 4GDBA 1TS7A 5EVID 3HLWA 1PZPA 4WZ4A 1IYQA 1YSQA 3H7WB 1DY6A 2J9OA 2ZM0A 3ZG9B 1UWNX 5HAQA 1P97A 1PI4A 3HLDA 1FILA 3ZFZA 5DF7A 4L9FA 4BMWA 3DAVA 4MN6A 3O88A 5L8MA 3D4FA 3FKWA 1UGUA 2BTFP 5I94A 2PHYA 1K54C 1XP4A 4LLOB 3OPPA 4GLQA 3SH9A 1TS8A 4R23A 4IUKA 5HW3A 3BJNA 3IF5A 5F1FA 5HSQA 4FUWA 1YLYA 5BOHA 1BZAA 5IHVA 5M1AA 4R3BA 1J3WA 1SKOB 4JGRA 4I38A 4ID4A 3T4QA 5CHUA 3NIAA 3IX3A 3OCNA 1OTDA 1NYMA 2HGVA 3QP1A 1W8YA 2Y2PA 4WLAA 2V9AA 3HLEA 1HVBA 3EOIA 1K57A 3ZDJA 2CC1A 1NZOA 2Q9NA 4B93A 4P6BA 3LIEA 2ZJ9A 3C8CA 1VETB 4Z1WA 2PR6A 2OSUA 2QJ5A 3S7NA 3VP3A 5G4YA 1XJ4A 4QPRA 4P6ZS 3W2ZA 4IEDA 1NLZA 1HTZA 1YLJA 2XDMA 2GJ3A 1DP9A 5IU1A 5F1GA 4RVAA 5DFXA 3QP6A 3LIAA 1UWPX 5HAIA 5JYPA 3WRZA 4ZJ2A 2XK1A 4LGWA 3LYXA 2B95A 2JKRI 4KZ6A 5FQMA 5CX7A 3WS5A 3S1YA 5FL3A 2FFYA 3T4SA 2HDQA 2DMWA 3IF6C 1EWZA 1LSVA 5AQ9A 5CERA 2FH5A 3MFXA 3R4KA 2VEAA 1VETA 1SZVA 2LB9A 1SHVA 3MR0A 3PR6A 1ZTUA 2PU4A 4NKPA 4GCZA 3BEBA 4R38A 4O0PA 3M2KA 3ZG7B 1XA1A 4R70A 5HD5A 3MF0A 1MZUA 3NI9A 2XA7S 2EXBA 2Y4AA 1DP6A 1PYYA 3C30A 1GHIA 3A0VA 5CHJA 4E04A 2ZQ8A 4L0LA 3VOYA 2Y2LA 4ZJ3A 3V50A 4BQMA 3OCLA 3E4PA 5F68A 3H82B 5CGXA 3UPNA 1KE3A 3PYPA 4Y7PA 3NOUC 5CEDA 1DP8A 3DTMA 1MKMA 4G3VA 4P6ZM 1IYPA 3EGXC 1F98A 4FD8A 4ZRRA 1M40A 4Y0TA 5DKLA 1YM1A 4GS9A 4E3OA 2VGLS 3IH9A 5L10A 5KIZA 3T50A 2INWA 1KGGA 5EOEA 4PM7A 1HZOA 4N1HA 1SCWA 3LUQA 2KOIA 1EROA 1ESIA 1NWZA 4DXCA 4PM5A 3F1NA 1I2WA 2HP9A 3IBRA 5FATA 1OTBA 1MWUA 4KG6A 4MNRA 4R6LA 2WKEA 3G35A 3SS5A 2M7UA 5HD3A 4HBUA 5CTMA 4X1LA 3CWFA 1ZG4A 2WADA 3BECA 1FIKA 5L2FA 3HCYA 3BFGA 4N92A 4HBTA 3LR4A 1W63M 3EEAA 1LL9A 4WBGA 4NK3A 4MN5A 4HI4A 4JBFA 2L4RA 4CJNA 4JXGA 2Q9MA 4RYEA 1IKIA 5GHYA 2B5RA 2EFUA 2VGKA 3GMWA 3QHYA 1ZG6A 2VV8A 1Q2PA 3HREA 3W4OA 3MFDA 1MY8A 5EV0A 4E6XA 5GLBA 4C6YA 1G68A 4CLCD 1OTIA 2WUQA 4S2KA 3CITA 3EGDC 3PTEA 4KG2A 5FI2A 3UO9A 3WS4A 1S4RA 2OWJA 4Y5FA 3JVVA 5GHXA 2QMIA 5HWVA 1CQAA 2JC7A 3A3IA 4QWOA 5AQBA 4KQQA 2HDRA 3A3JA 5FQQA 1LI9A 2ZC5B 4E3LA 3JPUA 4OOMA 5U47A 4K0XA 4BD1A 3MXRA 4OLDA 1LL8A 2ZQAA 4LV0A 1PWDA 4IHQA 4EETB 1H8YA 2WZZA 1X0OA 5FASA 3N6IA 3TOIA 3T4KA 4I39A 4IVIA 1CJFA 2QJ7A 4E3JA 4WF0A 2WYXA 2J7VA 2X02A 4LCMA 1NY0A 1TS6A 3RH8B 1BTLA 1JNUA 3LR5A 3UDFA 1NLYA 2VV7A 1XXMA 1XJ2A 4KUOA 2V8FA 3G30A 2XQZA 2JKTI 5DKKA 1ZHHB 2L1MA 1PW8A 2ZC3B 2JN7A 1TVFA 2OV5A 3OBFA 4LV3A 4R0QA 1XGIA 3Q7VB 2ZL1B 4N1XA 1DJCA 3MS6A 1MPLA 4P0MA 3LGOA 3M6HA 3E0YA 5L09A 3MJQA 1K38A 3C7VA 1BULA 4X25A 3KX0X 3MBZA 1SKOA 2OAQ1 5HARA 3LIFA 1L0EA 1ERQA 4JF4A 3VP4A 3TSGA 1K54A 4HJ4A 3OOVA 4IVKA 5F69A 3H9WA 5HL1A 4II7A 3MXSA 2E8JA 3U2AA 5E43A 3VP1A 5KSHA 2V1ZA 3PAGA 2Y79A 1K56D 4WN5A 4WMCA 4EBPA 3SW1A 4NG2A 3CZDA 2D02A 3N7WA 3TRCA 2X01A 4B4XA 3IT9A 2V8CA 4NXFA 5EM0A 4KZ3A 4LPZA 4GHIA 2ZQCA 1ODVA 4U0TA 2VGJA 3F1NB 4WYYA 3D3OA 2M7VA 4H6JB 5DF8A 1S0WA 2AVXA 2IWDA 4S2PA 3R7WA 2DRWA 4XT2B 2ZBBA 3K2NA 1ZC2A 1W5DA 1XJ3A 3BQAA 4Q0JA 4WELA 4BL2A 4O01A 2WZXA 3HL9A 2V0UA 1MKIA 4DJ2A 5EVIA 4CQHA 1KE0A 1C3BA 2PDRA 5JYOA 5E2GA 2Z6DA 2VGLM 3T4TA 3F1PA 1K55A 5HL6A 3C38A 1XJ6A 3K3CA 4DRTA 4GDNA 3ITAA 1BUEA 3IQAA 1PWGA 3K3DA 4PPRA 5J7EA 1MWTA 2W3FA 3S22A 4MBFA 3Q7VA 3EQVA 3OPLA 2QKPA 2P7JA 1MXOA 3LI9A 2JKTM 5TR7A 3CPTB 5EVLA 2GZAA 1HLUP 3A3FA 4PAUA 4GB7A 3GQZA 1GSXA 3CAXA 3GDIA 3PAEA 1HD8A 5FEGA 4Z9QA 1FR1A 1GA9A 4NETA 3MZEA 4CLCC 5FQ9A 2XD5A 5MC7A 2KDKA 2Y2IA 3BW6A 4P85A 3V3SA 1BT5A 4CLCA 1GA0A 1OJGA 2VV6A 3C2WA 4EBNA 5M18A 3BFEA 5J4EA 4GNUA 3N8RA 2WAFA 2W27A 4ETZA 2W3GA 3PBTA 3OC2A 1Y28A 5HWWA 3QP4A 1EI5A 5HWTA 2VKSA 1MWRA 1FOFA 1ERMA 3B47A 3B42A 4JPMA 3PBNA 5J3WA 3UE1A 5DTKA 2EX8A 3NOPC 3IXHA 1OT9A 1OTAA 4WZ5A 4QB8A 3MZFA 3IX4A 3IH8A 2H28A 3UMEA 3QP2A 1N9NA 5LBRA 4BLMA 1YQSA 1VEUB 4Y17A 1IELA 4KQDA 4I5SA 2J9PA 2XRNA 4EEUA 1K25A 3KSGA 3S7QA 2JKRM 5EVIC 4CPKA 1G5UA 4MEZA 3IF6A 5CXWA 2M1CA 4E3KA 2O9AA 4OPQA 4ZDXA 5DTSA 4WZ5C 3ZHHA 2G2WA 3O5YA 1AWIA 3OZHA 4KQOA 3UPOA 4KZ8A 3LFVA 4R1GA 1WYBA 3PBRA 3C4OA 5CRFA 4R4SA 2Y2GA 3S4XA 3UB9A 3F1OB 1D1JA 4Y3IA 2ZD8A 1T19A 3LI8A 5DJUA 3HJKA 4GS9B 4QU3A 3NJAA 2H5SA 4BBUA 2BASA 4PM8A 4X1MA 5HDCA 4HP9A 4OP8A 2W3EA 4MBKA 4LCLA 4JF5A 2QZ6A 1ESUA 1F9IA 1KDWA 5EECA 5F82A 1FCNA 4OOLA 4Q0HA 4GN2A 4BBVA 1MC0A 2R9XA 5DJTA 3UDIA 2O9BA 1YMSA 5CEBA 4ARZB 4KZ7A 2J3TC 4UAAA 4NXBA 3ZYTA 4DXBA 4HQAA 2YKFA 5KSCA 4OLGA 4KQRA 3GTCA 2DNSA 3E4OA 2PD8A 2C5WB 4YWZA 2QHKA 1YLWA 1ACFA 2JCHA 4FH2A 5D3OA 3QNBA 3UE3A 2Y2QA 1S1YA 4O8GA 4GOGA 3VE3A 4QHCA 5IS1A 4S2MA 3TG9A 3IF6B 4X56A 3BRMA 4X55A 2V1AA 1JTDA 1GSWA 1EW0A 4MCWA 1SDEA 4DE0A 5FA7A 1WA9A 2HJEA 4G3KA 3I7JA 2PYPA 4NEED 5IT5A 4DE2A 1FR6A 3BQ8A 1MBLA 3UY6A 2XSSA 4HJ3A 4I3JA 3GECA 3NBLA 1OPXA 1TDLA 3NDGA 4R4RA 4DDYA 3ZG0A 1IYSA 3MZDA 2ZQ9A 5M19A 2ZQDA 3BWLA 2K31A 3N4IA 1L0DA 2R9WA 3CUEC 4MBHA 3M2JA 4ESPA 3C7UA 4NXEA 3RTYA 3RFBA 3IWQA 1GHMA 3BFFA 4ARZA 1GHPA 3HJIA 5DVAA 3F1PB 2RL3A 3LR0A 3B33A 2H0TA 2Z6CA 1ES2A 4B4ZA 1G6AA 4YOFA 3PBQA 4EWFA 3IWIA 2GNXA 2E8IA 2XFTA 4MLLA 3VOLA 4P87A 1YKDA 3TW8A 3LIBA 1LHYA 3SOIA 2XF3A 4OPRA 4EBLA 1CF0A 3RXWA 3VSLA 4OQGA 3VFHA 1Z6FA 1H3QA 2Y55A 4ETXA 2PT7A 1KGFA 4G3WA 3BLMA 1VM1A 3IX8A 3LICA 2WGVA 1S4SA 1NZUA 4DE1A 2ZC4B 3HLFA 2OLVA 3HBRA 4DDSA 3PBSA 4WMCD 1JWZA 3ISGA 3DWKA 1QMEA 5EFWA 4F3LA 3BFCA 5GLAA 3T12B 3DWZA 1TDGA 5CHMA 3W8KA 3BY8A 4HOIA 4RQ9A 4GJ4A 1TF1A 4OONA 1L0FA 3UDXA 1JVJA 3UE0A 3O3VA 4FCFA 4GD6A 3MSHA 4S2LA 2PBYA 3UB7A 2O9CA 2VLGA 1FCOA 2ZM2A 2CMNA 1F2KA 1XFQA 5TBMB 4XT2A 4A5RA 5HDDA 2KLIA 1S1ZA 4JF6A 4MDZA 5FEFA 3KSHA 2QYBA 3ZCZA 4QY6A 2P9VB 3H7WA 3KO6A 1YSPA 3D72A 3FG8A 3T1QB 2K7SA 3L7HA 1VEUA 3GR2A 4WEJA 3CHWP 2Q0OA 3P7NA 4IJGA 3QP8A 5HZHA 1O07A 5TFQA 1IFQA 1H0MA 1G6OA 4E3IA 2ACGA 4M4XA 3WS0A 1W8QA 1YT4A 4MN7A 4B88A 2HP6A 4EERA 2J3WA 2WKIA 4HESA 4EW7A 2O99A 4PM9A 1IEMA 3UE6A 3S7OA 4K91A 4FOFA 5TBMA 3ZG5A 4LENA 2LB5A 4BD0A 4BWIA 1D7EA 1RGZA 5KZHA 2PAVP 3HLBA 2XR0A 3L9KA 4OQ0A 2V20A 1RP5A 2EA9A 5F6AA 4KZBA 1K57C 3E98A 3IBJA 1K6RA 3HUOA 3HUNA 4YINA 2PYRA 4WL9A 1FSWA 1H8MA 2EWVA 2V1BA 2FZ0A 2HPBA 3EWKA 4O7DA 3D9YA 2XROA 1M6KA 4XXRA 4EQ1A 1NRJA 4GW9A 2GX5A 1ES4A 2FFFB 4HJ6A 3U4LP 1KOUA 4JGPA 4WUJA 4YNRA 2ZMFA 3PBOA 5AQAA 1XKZA 4QJGA 1IKGA 4XUZA 1P9RA 2A3UA 2P9VA 1H8ZA 5CTNA 1W63Q 1CI8A 3N8LA 2H10A 4ZTKA 3CUEA 4JKTA 2W1TB 4DF6A 1SKFA 2Y59A 2QPNA 5A92A 5FI7A 2JE5A 4LRYC 3FPWA 5EVEA 3G6OA 3DBAA 4GZBA 4HH3A 4HY8A 4FSFA 3T1SA 2K2NA 2Z2MB 1W79A 2VZWA 2WGIA 3RXXA 4AFIA 1K4EA 1LL5A 5EPHA 4OQIA 5FSRA 3LY3A 4KENB 4LRZE 1YLPA 4E6WA 1I2SA 3CJMA 4JGOA 3GRJA 4GHIB 2Y2KA 1MWSA 3Q82A 4BBTA 4OOYA 2Y2MA 1T1AA 1ES3A 4UQIS 3Q1FA 1VB6A 2G7UA 5HDSA 4KZ4A 3IHAA 3BY9A 3DTKA 4QD4A 2Y2JA 4EQIA 2VJWA 4X53A 1STZA 3N8SA 4EXOA 3SH8A 1D06A 1E3UD 2HDSA 5TJJA 2XFSA 2GDNA 4GKUA 2ZOIA 3RJUA 4Q0IA 2EFXA 2NUTC 3GV9A 2VK3A 5HFOA 4LFUA 3LO7A 2QWSA 4OKPA 1GSVA 5FQKA 1YAXA 2PRFA 4EUZA 5FDHA 2Y2HA 2ZL1A 3VOZA 5E2EA 1G28A 3OPHA 5E2FA 2A24B 4LV1A 1LLBA 3IXGA 3HVFA 2JKFA 4NXGA 3A0SA 1PWCA 3QNCA 2Y2NA 4M3KA 4HHDA 3LEZA 3P09A 4ZBEA 4D2OA 3PXPA 3E2KA 5HPFA 1DJAA 4F94A 1KE4A 2L0WA 1BLHA 3Q7ZA 4KZ5A 3VV4A 1XFNA 3G2ZA 3NULA 3IS2B 2V0WA 1E3UA 3MKEA 4OP5A 5CGWA 3V39A 2WKHA 4LV2A 1S6RA 4UQIM 2EXAA 3LR3A 2P74A 1OMEA 3G34A
chains in the Genus database with same CATH topology
1JNUA 3BQ8A 3LR5A 2XSSA 4HJ3A 1NLYA 2VV7A 1XJ2A 4I3JA 2EWWA 4ME4A 3GECA 4KUOA 2JKTI 3EQUA 1OPXA 2J3TD 1OT6A 5DKKA 1ZHHB 3NOTC 2L1MA 2A24A 2JN7A 2OAP1 3OBFA 3ULFA 2PD7A 3BWLA 2K31A 2VA0A 3CUEC 3E0YA 3MJQA 4Y2FA 3KX0X 5DF9A 2OAQ1 3MQ0A 2Y8HA 3LIFA 4NXEA 3RTYA 3RFBA 4DMZA 4MMNA 4HH2A 4DN0A 2YKHA 3TE8A 4ARZA 4HJ4A 3OOVA 3MQOA 3HJIA 3EEHA 5F69A 4CLCE 4HNBA 3H9WA 3F1PB 3LR0A 4II7A 2HJ9C 3B33A 3U2AA 3T4JA 2W3HA 1TS0A 2Z6CA 5KSHA 4YOFA 3PBQA 2Y79A 2GNXA 2A2LA 3KYZA 4WN5A 3VOLA 5DFYA 3H82A 3SW1A 1YKDA 5C5KA 2D02A 3LIBA 3FC7A 3TW8A 3TRCA 4I3AA 3KSFA 1T18A 1H3QA 4ETXA 2I9VA 4NXFA 2PT7A 4G3WA 3NHQA 4LPZA 2ZMVA 4GHIA 4EESA 1ODVA 3LICA 1S4SA 3OLOA 1TS7A 3VE4A 3T4OA 3F1NB 1OJ5A 2WKRA 3D3OA 2M7VA 3MQQA 3PBSA 4H6JB 1YSQA 3H7WB 2XA7M 5EFWA 1OTEA 3TJZC 4F3LA 3R7WA 3FPVA 4XT2B 2ZBBA 1UWNX 4WEKA 3K2NA 3ICYA 3BY8A 4HOIA 4RQ9A 1P97A 4GJ4A 3JVUA 1XJ3A 1TF1A 3UB6A 3BQAA 4Q0JA 4WELA 4L9FA 4O01A 4BMWA 2W0NA 2NUPC 2B18A 2V0UA 1LSWA 4DJ2A 4CQHA 4MN6A 2PDRA 5L8MA 1UGUA 3UB7A 2O9CA 2PHYA 2VLGA 3UMDA 4LLOB 2Z6DA 2VGLM 4GLQA 1TS8A 4PKYG 4LRXC 3T4TA 3F1PA 4IUKA 2CMNA 5G4ZA 5HL6A 3C38A 1XJ6A 1N9OA 3BJNA 1XFQA 3K3CA 5HSQA 5TBMB 4I3IA 2VX8A 4XT2A 4IUHA 5HDDA 2KLIA 1S1ZA 4MDZA 4CLCB 4F3LB 3KSHA 2QYBA 3K3DA 3H7WA 3KO6A 1YSPA 4JGRA 3D72A 4I38A 3T4QA 3FG8A 5J7EA 2K7SA 3OCNA 2W3FA 4WEJA 2HF6A 1OTDA 3P7NA 4IJGA 5A8BA 5HZHA 2HGVA 2O0YA 3EQVA 1IFQA 4WLAA 2V9AA 2QKPA 3EOIA 2P7JA 1G6OA 3LI9A 2JKTM 1LT0A 4B93A 3LIEA 3KSIA 2GZAA 4PAUA 3C8CA 4Z1WA 1GSXA 5I5LA 2PR6A 3CAXA 3GDIA 4M4XA 2P08A 2QJ5A 3V67A 5K5BA 3S7NA 5G4YA 2ZOHA 1XJ4A 4QPRA 4P6ZS 2D01A 4MN7A 3W2ZA 4EERA 4CLCC 1NLZA 2J3WA 5MC7A 3IS2A 2KDKA 3BW6A 2GJ3A 1DP9A 5IU1A 4EW7A 2O99A 4L9GA 3UE6A 4CLCA 3S7OA 1OJGA 2VV6A 3C2WA 5DFXA 4FOFA 5TBMA 1VHMA 4BWIA 2LB5A 3LIAA 1UWPX 3UB8A 1D7EA 5J4EA 5F5YA 1F5MA 2W27A 1N9LA 3LYXA 4ETZA 2W3GA 3PBTA 2JKRI 3OC2A 2EA9A 5F6AA 5CX7A 1Y28A 5HWWA 5FL3A 3T4SA 5HWTA 2VKSA 3E98A 3IBJA 4EEPA 2DMWA 1LSVA 3B47A 3B42A 3PBNA 5J3WA 2FH5A 1S67L 2PYRA 4WL9A 1H8MA 2EWVA 2V1BA 3MFXA 2PR5A 2VEAA 3NOPC 3MMHA 3R4KA 2FZ0A 1OT9A 2LB9A 3EWKA 5AVEA 3MR0A 1P9WA 1OTAA 3R7WB 3PR6A 1ZTUA 2KX6A 2XROA 4NKPA 4GCZA 2H28A 3UMEA 4R38A 4O0PA 3KYQA 1N9NA 5LBRA 4R70A 4EQ1A 1NRJA 5HD5A 4R3AA 5HPIA 4GW9A 2GX5A 3MF0A 4HJ6A 1KOUA 1MZUA 4JGPA 2XA7S 4WUJA 2B02A 1DP6A 2ZMFA 4KQDA 3C30A 3PBOA 4YNRA 4I5SA 3ZQ5A 3A0VA 2W3DA 4E04A 1P9RA 2XRNA 4L0LA 4EEUA 2WKQA 3E4QA 1TD5A 3KSGA 3S7QA 2JKRM 1W63Q 3CLOA 3OCLA 3E4PA 5F68A 2M1CA 3H82B 4L9EA 2IA2A 3PYPA 3NOUC 1DP8A 2O9AA 3CUEA 1MKMA 4G3VA 2W1TB 3PHYA 4P6ZM 4JGQA 2JHEA 3EGXC 1F98A 4ZRRA 3O5YA 4K08A 5DKLA 4LRYC 3FPWA 4DJ3A 3G6OA 3DBAA 4GS9A 4KQOA 3S7PA 1T1CA 4HH3A 2VGLS 4HY8A 5KIZA 4FSFA 3T50A 3LFVA 2K2NA 3PBRA 2R78A 2VZWA 2INWA 3UB9A 3F1OB 2W1RA 4Y3IA 1T19A 3LI8A 5DJUA 4AFIA 4H6JA 3LUQA 5AJGA 2J80A 3HJKA 4GS9B 2KOIA 1NWZA 4LRZE 2HV1A 3F1NA 3IBRA 1OTBA 3NJAA 4JGOA 4GHIB 4BBUA 2BASA 1BYWA 4R6LA 4BBTA 3MXQA 5HDCA 2W1TA 4HP9A 2M7UA 1T1AA 2W3EA 1P0ZA 4UQIS 5HD3A 1F9IA 3CWFA 1VB6A 2P04A 2G7UA 5HDSA 4BJPA 3CI6A 3HCYA 3LR4A 1W63M 3BY9A 2WKPA 3EEAA 4OOLA 4Q0HA 4MN5A 4BBVA 4HI4A 1MC0A 2VJWA 2L4RA 1STZA 4EXOA 1D06A 5DJTA 4EUVA 3LIDA 5TJJA 2O9BA 4B9OA 2ZOIA 4ARZB 4Q0IA 2J3TC 4KUKA 1S66L 2VV8A 5AVFA 4NXBA 2NUTC 3A0RA 3F1OA 3ZYTA 2QWSA 4CLCD 4HQAA 3T4LA 1GSVA 2YKFA 1YAXA 4EU0A 1OTIA 1DRMA 3CITA 3EGDC 1T1BA 3E4OA 2PD8A 1S4RA 2OWJA 4Y5FA 3JVVA 4YWZA 2QHKA 5HWVA 1G28A 3UE3A 2A24B 4PKYA 1S1YA 4OOMA 4UEYA 4NXGA 3A0SA 4O8GA 1LL8A 2MJ6A 3VE3A 5IS1A 4HIAA 4HHDA 3P01A 4IHQA 4EETB 3PXPA 2V1AA 1X0OA 5HPFA 1GSWA 1EW0A 4MCWA 4PHTA 1V9ZA 2L0WA 3T4KA 4I39A 2QJ7A 3VV4A 1XFNA 3IS2B 2V0WA 4WF0A 1WA9A 2HJEA 4G3KA 4HP4A 2PYPA 4NEED 5IT5A 2OOLA 1IOUA 4UQIM 1V9YA 3LR3A 2OWHA 1TS6A 3RH8B 1LSXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JNU A;  1P97 A;  3MXQ A;  1Y28 A;  5HDC A;  4BBT A;  5HWW A;  1XJ3 A;  5HWT A;  4HJ3 A;  3UB6 A;  2VV7 A;  4HP9 A;  4EEP A;  1T1A A;  1XJ2 A;  4I3J A;  4L9F A;  1P0Z A;  3GEC A;  4KUO A;  2W0N A;  1LSV A;  5HD3 A;  2V0U A;  4DJ2 A;  1LSW A;  5J3W A;  1F9I A;  1OT6 A;  1S67 L;  3NOT C;  3CWF A;  1VB6 A;  4MN6 A;  2L1M A;  2PYR A;  5DKK A;  4WL9 A;  2V1B A;  2PDR A;  2PR5 A;  2A24 A;  2VEA A;  3MFX A;  3NOP C;  5HDS A;  2JN7 A;  1UGU A;  3UB7 A;  2VLG A;  2PHY A;  1OT9 A;  4R6L A;  4LLO B;  3UMD A;  3EWK A;  2Z6D A;  5AVE A;  3MR0 A;  1OTA A;  1TS8 A;  2WKP A;  3BY9 A;  4LRX C;  4PKY G;  3F1P A;  3ULF A;  2PD7 A;  2CMN A;  5G4Z A;  2KX6 A;  4MN5 A;  4BBV A;  1XJ6 A;  1N9O A;  3BWL A;  1XFQ A;  4HI4 A;  3K3C A;  4GCZ A;  5HSQ A;  2H28 A;  3UME A;  4R38 A;  2L4R A;  3MJQ A;  5TBM B;  4EXO A;  1D06 A;  1N9N A;  5DJT A;  4R70 A;  3KX0 X;  4I3I A;  4EQ1 A;  3LID A;  5HD5 A;  4R3A A;  4XT2 A;  4GW9 A;  5HDD A;  4F3L B;  1S1Z A;  4HJ6 A;  1KOU A;  3SW1 A;  1MZU A;  4JGP A;  3LIF A;  3K3D A;  4NXE A;  2B02 A;  3H7W A;  2ZOI A;  4WUJ A;  3RTY A;  4B9O A;  1DP6 A;  4KQD A;  4JGR A;  3ZQ5 A;  3D72 A;  4I38 A;  3A0V A;  1S66 L;  4I5S A;  4KUK A;  3FG8 A;  2VV8 A;  4HH2 A;  2YKH A;  5AVF A;  4HOI A;  4E04 A;  5J7E A;  2K7S A;  4NXB A;  4HJ4 A;  3A0R A;  1OTD A;  3P7N A;  3F1O A;  3MQO A;  4EEU A;  3HJI A;  3EEH A;  5F69 A;  4HNB A;  2WKQ A;  3E4Q A;  3H9W A;  3F1P B;  5A8B A;  5HZH A;  4WLA A;  2V9A A;  2QWS A;  4HQA A;  3B33 A;  3CLO A;  1GSV A;  2YKF A;  1OTI A;  2QKP A;  1DRM A;  1TS0 A;  3E4P A;  3ICY A;  2M1C A;  5F68 A;  2Z6C A;  3H82 B;  4L9E A;  2P7J A;  1T1B A;  3E4O A;  2PD8 A;  1S4R A;  3LI9 A;  2OWJ A;  1LT0 A;  3PYP A;  3NOU C;  4YWZ A;  2QHK A;  1DP8 A;  3LIE A;  5HWV A;  4WN5 A;  3VOL A;  3C8C A;  3PHY A;  4JGQ A;  1G28 A;  1GSX A;  3H82 A;  2A24 B;  2JHE A;  2PR6 A;  3CAX A;  3GDI A;  4PKY A;  5I5L A;  4M4X A;  1S1Y A;  2D02 A;  3LIB A;  3FC7 A;  2QJ5 A;  1F98 A;  5G4Y A;  2ZOH A;  4NXG A;  3A0S A;  4I3A A;  1LL8 A;  4K08 A;  1T18 A;  5DKL A;  4LRY C;  1XJ4 A;  3VE3 A;  2D01 A;  4DJ3 A;  2I9V A;  4NXF A;  5IS1 A;  3G6O A;  4EER A;  4HIA A;  4HHD A;  3IS2 A;  3NHQ A;  4GS9 A;  2KDK A;  1T1C A;  4EET B;  4HH3 A;  4HY8 A;  4LPZ A;  5KIZ A;  4GHI A;  2V1A A;  1X0O A;  3T50 A;  1GSW A;  1EW0 A;  4EES A;  1ODV A;  1DP9 A;  2GJ3 A;  1S4S A;  1V9Z A;  2R78 A;  3LIC A;  3OLO A;  1TS7 A;  2INW A;  2L0W A;  5IU1 A;  3F1O B;  3UB9 A;  3F1N B;  4I39 A;  3VE4 A;  1OJ5 A;  2WKR A;  4L9G A;  3UE6 A;  1T19 A;  2QJ7 A;  1OJG A;  3LI8 A;  5DJU A;  1XFN A;  2VV6 A;  3C2W A;  3MQQ A;  4H6J A;  3LUQ A;  4H6J B;  5TBM A;  2J80 A;  3HJK A;  3IS2 B;  4GS9 B;  1NWZ A;  2V0W A;  3LIA A;  1UWP X;  4LRZ E;  1D7E A;  3H7W B;  3UB8 A;  5J4E A;  2HV1 A;  3F1N A;  4WF0 A;  1WA9 A;  5F6A A;  4HP4 A;  3IBR A;  4EW7 A;  5F5Y A;  1OTB A;  1OTE A;  2PYP A;  3NJA A;  5EFW A;  4F3L A;  4JGO A;  2OOL A;  2W27 A;  3LYX A;  1N9L A;  4XT2 B;  2ZBB A;  1UWN X;  4GHI B;  1V9Y A;  4BBU A;  2BAS A;  2OWH A;  1TS6 A;  3RH8 B;  1BYW A;  1LSX A;  2EA9 A;  3BY8 A;  4RQ9 A; 
#chains in the Genus database with same CATH topology
 2WGW A;  4Y15 A;  2WK0 A;  1OT6 A;  2A24 A;  3DW0 A;  4X69 A;  3SS3 A;  1WYC A;  3LEQ A;  2VA0 A;  4RX2 A;  4UA6 A;  2BLS A;  4Y2F A;  1XPB A;  2UV0 E;  5DF9 A;  4JXV A;  3MQ0 A;  1ONG A;  1SDN A;  1GCE A;  3UNW A;  3ZGA B;  2YKH A;  3TE8 A;  5KMW A;  3MQO A;  3EEH A;  4CLC E;  1PI5 A;  3V5M A;  4XUX A;  3T4J A;  3BFD A;  1Y4O A;  5TGF A;  1Y54 A;  1YLT A;  2UWX A;  5A91 A;  1BLP A;  3FZC A;  5C5K A;  3G32 A;  1Q2Q A;  4I3A A;  3KSF A;  1T18 A;  3BLS A;  3KYE A;  4OVD A;  3WWX A;  4EES A;  3A3D A;  3OLO A;  3VE4 A;  3T4O A;  1L3L A;  1OJ5 A;  2WKR A;  3O87 A;  1L0G A;  4OPZ A;  3MQQ A;  3NEC A;  5HAP A;  2XA7 M;  1OTE A;  3TJZ C;  3FPV A;  4WEK A;  3B3X A;  3Q81 A;  3ICY A;  5F83 A;  3JVU A;  3UB6 A;  2W0N A;  2NUP C;  2B18 A;  1LSW A;  5FAP A;  3SS4 A;  5EVI B;  3UMD A;  4PKY G;  4LRX C;  3ZG8 B;  4C75 A;  1DJB A;  5G4Z A;  5EE8 A;  1N9O A;  5G18 A;  1KVM A;  1KVL A;  4U0X A;  4I3I A;  2VX8 A;  1AXB A;  4IUH A;  5HX9 A;  4F3L B;  4CLC B;  1LI0 A;  3V3R A;  3WS1 A;  4IBR A;  4JXW A;  2XGN A;  1ES5 A;  3NY4 A;  1TEM A;  2HF6 A;  1NXY A;  3CMZ A;  2EX6 A;  5A8B A;  2XD1 A;  2O0Y A;  1CI9 A;  3VSK A;  1PRQ A;  2HP5 A;  1XX2 A;  4Y13 A;  5GL9 A;  1K4F A;  1JWP A;  3UN7 A;  1LT0 A;  1ZKJ A;  3KSI A;  2XH9 A;  4UA7 A;  5I5L A;  1K55 C;  2P08 A;  3V67 A;  5K5B A;  2ZOH A;  4Y0O A;  2PU2 A;  4Y0U A;  2D01 A;  1PFL A;  2XLN A;  3IS2 A;  3Q07 A;  3AGF A;  4S2I A;  4L9G A;  1N4O A;  1VHM A;  1RCJ A;  3UB8 A;  1E4D A;  5EOO A;  3ITB A;  3AGD A;  5F5Y A;  3IXB A;  1BLC A;  5FI6 A;  1F5M A;  1N9L A;  5AQ7 A;  2OLU A;  2ZC7 A;  1PIO A;  3VFF A;  2H0Y A;  4EEP A;  1PW1 A;  1S67 L;  1NJ4 A;  2PR5 A;  3MMH A;  1A0K A;  3GSG A;  5AVE A;  1P9W A;  3CPT A;  3R7W B;  4UHU A;  5FQJ A;  5GHZ A;  4E3M A;  1Z09 A;  3E2L A;  2KX6 A;  4N9L A;  3ZNT A;  3BYD A;  3KYQ A;  4EV4 A;  3UPP A;  1NRF A;  1PNE A;  4R3A A;  5HPI A;  4K0W A;  2HDU A;  2B02 A;  2ZM8 A;  3ZQ5 A;  2W3D A;  1ALQ A;  1N9B A;  2IWB A;  5A90 A;  3T1X A;  4U3T A;  2WKQ A;  3E4Q A;  2G2U A;  1TD5 A;  4PMA A;  1I5Q A;  3CLO A;  1FCM A;  2X71 A;  4L9E A;  2IA2 A;  3SH7 A;  3PHY A;  4JGQ A;  5DTT A;  2JHE A;  2EX9 A;  5CGS A;  4FH4 A;  4X68 A;  4K08 A;  3T1R A;  2PBD P;  1O7E A;  1RGY A;  4DJ3 A;  4KZ9 A;  1L2S A;  3S7P A;  1T1C A;  3G31 A;  3FKV A;  3A3E A;  2R78 A;  2W1R A;  2C6W B;  4KG5 A;  4H6J A;  5AJG A;  2J80 A;  2HV1 A;  3C4P A;  4C3Q A;  3AGE A;  1BYW A;  1BSG A;  3VP2 A;  3MXQ A;  2W1T A;  1P0Z A;  1CEG A;  2I72 A;  2P04 A;  4S2J A;  5CEC A;  2ZMA A;  4BJP A;  3CI6 A;  4BEN A;  1JTG A;  2WKP A;  5A93 A;  1IYO A;  1CK3 A;  1H5X A;  4ZAM A;  4GD8 A;  2HZ5 A;  1BLS A;  3ZVW A;  3GVB A;  1KDS A;  2XEP A;  5FAO A;  3LID A;  4EUV A;  4E3N A;  3HLG A;  4OH0 A;  4DE3 A;  2JKG A;  4B9O A;  4KUK A;  1S66 L;  2V2F F;  4D60 A;  5AVF A;  2ZQ7 A;  2DCF A;  3A0R A;  3ZNY A;  3F1O A;  1FSY A;  3IHB A;  3JYI A;  5L07 A;  3FWL A;  5EM1 A;  3T4L A;  1CEF A;  4EU0 A;  1DRM A;  4S2N A;  1NYY A;  1T1B A;  1YPR A;  3C5A A;  3IXD A;  3W4Q A;  3ZVT A;  4PKY A;  2Z2L B;  3VP0 A;  5EUA A;  4UEY A;  3HLC A;  2Y91 A;  2WGW B;  3M6B A;  2MJ6 A;  3NC8 A;  4HIA A;  3P01 A;  3CG5 A;  3DTI A;  4KZA A;  4S2O A;  4PHT A;  4RX3 A;  1V9Z A;  3WRT A;  1WE4 A;  1E25 A;  3HUM A;  4QY5 A;  4HEF A;  3WS2 A;  1ONH A;  3IWO A;  4HP4 A;  1FQG A;  4H8R A;  2OOL A;  1IOU A;  1V9Y A;  1J9M A;  2OWH A;  1LSX A;  4X6T A;  3NCK A;  4RA7 A;  5GLD A;  5FDS A;  4ME4 A;  2EWW A;  1YLZ A;  2BG1 A;  3VMA A;  3EQU A;  2J3T D;  1K0K A;  3NOT C;  5FAQ A;  2OAP 1;  4N9K A;  4BL3 A;  4R3J A;  2JBF A;  3MKF A;  2RCX A;  4DKI A;  5E2H A;  5J8X A;  5GLC A;  2ZLY A;  3ULF A;  2PD7 A;  1VQQ A;  3OPR A;  2IWC A;  1KGE A;  1PZO A;  1K56 A;  3DTE A;  3NDE A;  4S2N C;  3O86 A;  3SZT A;  2Y8H A;  1QMF A;  3LY4 A;  4DMZ A;  1W7F A;  4MMN A;  1JWV A;  3G4P A;  4HH2 A;  4DN0 A;  4PM6 A;  3LCE A;  4FTX A;  3G2Y A;  4HNB A;  4OPY A;  4JLF A;  2HJ9 C;  2W3H A;  1TS0 A;  4WM9 A;  1YMX A;  1K6S A;  4YFM A;  4JXS A;  2A2L A;  4ZJ1 A;  3KYZ A;  2Y2O A;  5DFY A;  1U60 A;  3H82 A;  2A49 A;  3FC7 A;  3FYZ A;  2ZC6 B;  4UA9 A;  3P98 A;  1XGJ A;  4Q8I A;  2WAE A;  4OQH A;  3UB5 P;  2I9V A;  3BM6 A;  3QP5 A;  3NHQ A;  4IBX A;  5FQI A;  2ZMV A;  1XA7 A;  2EX2 A;  3FV7 A;  3W4P A;  2J8Y A;  4GDB A;  1TS7 A;  5EVI D;  3HLW A;  1PZP A;  4WZ4 A;  1IYQ A;  1YSQ A;  3H7W B;  1DY6 A;  2J9O A;  2ZM0 A;  3ZG9 B;  1UWN X;  5HAQ A;  1P97 A;  1PI4 A;  3HLD A;  1FIL A;  3ZFZ A;  5DF7 A;  4L9F A;  4BMW A;  3DAV A;  4MN6 A;  3O88 A;  5L8M A;  3D4F A;  3FKW A;  1UGU A;  2BTF P;  5I94 A;  2PHY A;  1K54 C;  1XP4 A;  4LLO B;  3OPP A;  4GLQ A;  3SH9 A;  1TS8 A;  4R23 A;  4IUK A;  5HW3 A;  3BJN A;  3IF5 A;  5F1F A;  5HSQ A;  4FUW A;  1YLY A;  5BOH A;  1BZA A;  5IHV A;  5M1A A;  4R3B A;  1J3W A;  1SKO B;  4JGR A;  4I38 A;  4ID4 A;  3T4Q A;  5CHU A;  3NIA A;  3IX3 A;  3OCN A;  1OTD A;  1NYM A;  2HGV A;  3QP1 A;  1W8Y A;  2Y2P A;  4WLA A;  2V9A A;  3HLE A;  1HVB A;  3EOI A;  1K57 A;  3ZDJ A;  2CC1 A;  1NZO A;  2Q9N A;  4B93 A;  4P6B A;  3LIE A;  2ZJ9 A;  3C8C A;  1VET B;  4Z1W A;  2PR6 A;  2OSU A;  2QJ5 A;  3S7N A;  3VP3 A;  5G4Y A;  1XJ4 A;  4QPR A;  4P6Z S;  3W2Z A;  4IED A;  1NLZ A;  1HTZ A;  1YLJ A;  2XDM A;  2GJ3 A;  1DP9 A;  5IU1 A;  5F1G A;  4RVA A;  5DFX A;  3QP6 A;  3LIA A;  1UWP X;  5HAI A;  5JYP A;  3WRZ A;  4ZJ2 A;  2XK1 A;  4LGW A;  3LYX A;  2B95 A;  2JKR I;  4KZ6 A;  5FQM A;  5CX7 A;  3WS5 A;  3S1Y A;  5FL3 A;  2FFY A;  3T4S A;  2HDQ A;  2DMW A;  3IF6 C;  1EWZ A;  1LSV A;  5AQ9 A;  5CER A;  2FH5 A;  3MFX A;  3R4K A;  2VEA A;  1VET A;  1SZV A;  2LB9 A;  1SHV A;  3MR0 A;  3PR6 A;  1ZTU A;  2PU4 A;  4NKP A;  4GCZ A;  3BEB A;  4R38 A;  4O0P A;  3M2K A;  3ZG7 B;  1XA1 A;  4R70 A;  5HD5 A;  3MF0 A;  1MZU A;  3NI9 A;  2XA7 S;  2EXB A;  2Y4A A;  1DP6 A;  1PYY A;  3C30 A;  1GHI A;  3A0V A;  5CHJ A;  4E04 A;  2ZQ8 A;  4L0L A;  3VOY A;  2Y2L A;  4ZJ3 A;  3V50 A;  4BQM A;  3OCL A;  3E4P A;  5F68 A;  3H82 B;  5CGX A;  3UPN A;  1KE3 A;  3PYP A;  4Y7P A;  3NOU C;  5CED A;  1DP8 A;  3DTM A;  1MKM A;  4G3V A;  4P6Z M;  1IYP A;  3EGX C;  1F98 A;  4FD8 A;  4ZRR A;  1M40 A;  4Y0T A;  5DKL A;  1YM1 A;  4GS9 A;  4E3O A;  2VGL S;  3IH9 A;  5L10 A;  5KIZ A;  3T50 A;  2INW A;  1KGG A;  5EOE A;  4PM7 A;  1HZO A;  4N1H A;  1SCW A;  3LUQ A;  2KOI A;  1ERO A;  1ESI A;  1NWZ A;  4DXC A;  4PM5 A;  3F1N A;  1I2W A;  2HP9 A;  3IBR A;  5FAT A;  1OTB A;  1MWU A;  4KG6 A;  4MNR A;  4R6L A;  2WKE A;  3G35 A;  3SS5 A;  2M7U A;  5HD3 A;  4HBU A;  5CTM A;  4X1L A;  3CWF A;  1ZG4 A;  2WAD A;  3BEC A;  1FIK A;  5L2F A;  3HCY A;  3BFG A;  4N92 A;  4HBT A;  3LR4 A;  1W63 M;  3EEA A;  1LL9 A;  4WBG A;  4NK3 A;  4MN5 A;  4HI4 A;  4JBF A;  2L4R A;  4CJN A;  4JXG A;  2Q9M A;  4RYE A;  1IKI A;  5GHY A;  2B5R A;  2EFU A;  2VGK A;  3GMW A;  3QHY A;  1ZG6 A;  2VV8 A;  1Q2P A;  3HRE A;  3W4O A;  3MFD A;  1MY8 A;  5EV0 A;  4E6X A;  5GLB A;  4C6Y A;  1G68 A;  4CLC D;  1OTI A;  2WUQ A;  4S2K A;  3CIT A;  3EGD C;  3PTE A;  4KG2 A;  5FI2 A;  3UO9 A;  3WS4 A;  1S4R A;  2OWJ A;  4Y5F A;  3JVV A;  5GHX A;  2QMI A;  5HWV A;  1CQA A;  2JC7 A;  3A3I A;  4QWO A;  5AQB A;  4KQQ A;  2HDR A;  3A3J A;  5FQQ A;  1LI9 A;  2ZC5 B;  4E3L A;  3JPU A;  4OOM A;  5U47 A;  4K0X A;  4BD1 A;  3MXR A;  4OLD A;  1LL8 A;  2ZQA A;  4LV0 A;  1PWD A;  4IHQ A;  4EET B;  1H8Y A;  2WZZ A;  1X0O A;  5FAS A;  3N6I A;  3TOI A;  3T4K A;  4I39 A;  4IVI A;  1CJF A;  2QJ7 A;  4E3J A;  4WF0 A;  2WYX A;  2J7V A;  2X02 A;  4LCM A;  1NY0 A;  1TS6 A;  3RH8 B;  1BTL A;  1JNU A;  3LR5 A;  3UDF A;  1NLY A;  2VV7 A;  1XXM A;  1XJ2 A;  4KUO A;  2V8F A;  3G30 A;  2XQZ A;  2JKT I;  5DKK A;  1ZHH B;  2L1M A;  1PW8 A;  2ZC3 B;  2JN7 A;  1TVF A;  2OV5 A;  3OBF A;  4LV3 A;  4R0Q A;  1XGI A;  3Q7V B;  2ZL1 B;  4N1X A;  1DJC A;  3MS6 A;  1MPL A;  4P0M A;  3LGO A;  3M6H A;  3E0Y A;  5L09 A;  3MJQ A;  1K38 A;  3C7V A;  1BUL A;  4X25 A;  3KX0 X;  3MBZ A;  1SKO A;  2OAQ 1;  5HAR A;  3LIF A;  1L0E A;  1ERQ A;  4JF4 A;  3VP4 A;  3TSG A;  1K54 A;  4HJ4 A;  3OOV A;  4IVK A;  5F69 A;  3H9W A;  5HL1 A;  4II7 A;  3MXS A;  2E8J A;  3U2A A;  5E43 A;  3VP1 A;  5KSH A;  2V1Z A;  3PAG A;  2Y79 A;  1K56 D;  4WN5 A;  4WMC A;  4EBP A;  3SW1 A;  4NG2 A;  3CZD A;  2D02 A;  3N7W A;  3TRC A;  2X01 A;  4B4X A;  3IT9 A;  2V8C A;  4NXF A;  5EM0 A;  4KZ3 A;  4LPZ A;  4GHI A;  2ZQC A;  1ODV A;  4U0T A;  2VGJ A;  3F1N B;  4WYY A;  3D3O A;  2M7V A;  4H6J B;  5DF8 A;  1S0W A;  2AVX A;  2IWD A;  4S2P A;  3R7W A;  2DRW A;  4XT2 B;  2ZBB A;  3K2N A;  1ZC2 A;  1W5D A;  1XJ3 A;  3BQA A;  4Q0J A;  4WEL A;  4BL2 A;  4O01 A;  2WZX A;  3HL9 A;  2V0U A;  1MKI A;  4DJ2 A;  5EVI A;  4CQH A;  1KE0 A;  1C3B A;  2PDR A;  5JYO A;  5E2G A;  2Z6D A;  2VGL M;  3T4T A;  3F1P A;  1K55 A;  5HL6 A;  3C38 A;  1XJ6 A;  3K3C A;  4DRT A;  4GDN A;  3ITA A;  1BUE A;  3IQA A;  1PWG A;  3K3D A;  4PPR A;  5J7E A;  1MWT A;  2W3F A;  3S22 A;  4MBF A;  3Q7V A;  3EQV A;  3OPL A;  2QKP A;  2P7J A;  1MXO A;  3LI9 A;  2JKT M;  5TR7 A;  3CPT B;  5EVL A;  2GZA A;  1HLU P;  3A3F A;  4PAU A;  4GB7 A;  3GQZ A;  1GSX A;  3CAX A;  3GDI A;  3PAE A;  1HD8 A;  5FEG A;  4Z9Q A;  1FR1 A;  1GA9 A;  4NET A;  3MZE A;  4CLC C;  5FQ9 A;  2XD5 A;  5MC7 A;  2KDK A;  2Y2I A;  3BW6 A;  4P85 A;  3V3S A;  1BT5 A;  4CLC A;  1GA0 A;  1OJG A;  2VV6 A;  3C2W A;  4EBN A;  5M18 A;  3BFE A;  5J4E A;  4GNU A;  3N8R A;  2WAF A;  2W27 A;  4ETZ A;  2W3G A;  3PBT A;  3OC2 A;  1Y28 A;  5HWW A;  3QP4 A;  1EI5 A;  5HWT A;  2VKS A;  1MWR A;  1FOF A;  1ERM A;  3B47 A;  3B42 A;  4JPM A;  3PBN A;  5J3W A;  3UE1 A;  5DTK A;  2EX8 A;  3NOP C;  3IXH A;  1OT9 A;  1OTA A;  4WZ5 A;  4QB8 A;  3MZF A;  3IX4 A;  3IH8 A;  2H28 A;  3UME A;  3QP2 A;  1N9N A;  5LBR A;  4BLM A;  1YQS A;  1VEU B;  4Y17 A;  1IEL A;  4KQD A;  4I5S A;  2J9P A;  2XRN A;  4EEU A;  1K25 A;  3KSG A;  3S7Q A;  2JKR M;  5EVI C;  4CPK A;  1G5U A;  4MEZ A;  3IF6 A;  5CXW A;  2M1C A;  4E3K A;  2O9A A;  4OPQ A;  4ZDX A;  5DTS A;  4WZ5 C;  3ZHH A;  2G2W A;  3O5Y A;  1AWI A;  3OZH A;  4KQO A;  3UPO A;  4KZ8 A;  3LFV A;  4R1G A;  1WYB A;  3PBR A;  3C4O A;  5CRF A;  4R4S A;  2Y2G A;  3S4X A;  3UB9 A;  3F1O B;  1D1J A;  4Y3I A;  2ZD8 A;  1T19 A;  3LI8 A;  5DJU A;  3HJK A;  4GS9 B;  4QU3 A;  3NJA A;  2H5S A;  4BBU A;  2BAS A;  4PM8 A;  4X1M A;  5HDC A;  4HP9 A;  4OP8 A;  2W3E A;  4MBK A;  4LCL A;  4JF5 A;  2QZ6 A;  1ESU A;  1F9I A;  1KDW A;  5EEC A;  5F82 A;  1FCN A;  4OOL A;  4Q0H A;  4GN2 A;  4BBV A;  1MC0 A;  2R9X A;  5DJT A;  3UDI A;  2O9B A;  1YMS A;  5CEB A;  4ARZ B;  4KZ7 A;  2J3T C;  4UAA A;  4NXB A;  3ZYT A;  4DXB A;  4HQA A;  2YKF A;  5KSC A;  4OLG A;  4KQR A;  3GTC A;  2DNS A;  3E4O A;  2PD8 A;  2C5W B;  4YWZ A;  2QHK A;  1YLW A;  1ACF A;  2JCH A;  4FH2 A;  5D3O A;  3QNB A;  3UE3 A;  2Y2Q A;  1S1Y A;  4O8G A;  4GOG A;  3VE3 A;  4QHC A;  5IS1 A;  4S2M A;  3TG9 A;  3IF6 B;  4X56 A;  3BRM A;  4X55 A;  2V1A A;  1JTD A;  1GSW A;  1EW0 A;  4MCW A;  1SDE A;  4DE0 A;  5FA7 A;  1WA9 A;  2HJE A;  4G3K A;  3I7J A;  2PYP A;  4NEE D;  5IT5 A;  4DE2 A;  1FR6 A;  3BQ8 A;  1MBL A;  3UY6 A;  2XSS A;  4HJ3 A;  4I3J A;  3GEC A;  3NBL A;  1OPX A;  1TDL A;  3NDG A;  4R4R A;  4DDY A;  3ZG0 A;  1IYS A;  3MZD A;  2ZQ9 A;  5M19 A;  2ZQD A;  3BWL A;  2K31 A;  3N4I A;  1L0D A;  2R9W A;  3CUE C;  4MBH A;  3M2J A;  4ESP A;  3C7U A;  4NXE A;  3RTY A;  3RFB A;  3IWQ A;  1GHM A;  3BFF A;  4ARZ A;  1GHP A;  3HJI A;  5DVA A;  3F1P B;  2RL3 A;  3LR0 A;  3B33 A;  2H0T A;  2Z6C A;  1ES2 A;  4B4Z A;  1G6A A;  4YOF A;  3PBQ A;  4EWF A;  3IWI A;  2GNX A;  2E8I A;  2XFT A;  4MLL A;  3VOL A;  4P87 A;  1YKD A;  3TW8 A;  3LIB A;  1LHY A;  3SOI A;  2XF3 A;  4OPR A;  4EBL A;  1CF0 A;  3RXW A;  3VSL A;  4OQG A;  3VFH A;  1Z6F A;  1H3Q A;  2Y55 A;  4ETX A;  2PT7 A;  1KGF A;  4G3W A;  3BLM A;  1VM1 A;  3IX8 A;  3LIC A;  2WGV A;  1S4S A;  1NZU A;  4DE1 A;  2ZC4 B;  3HLF A;  2OLV A;  3HBR A;  4DDS A;  3PBS A;  4WMC D;  1JWZ A;  3ISG A;  3DWK A;  1QME A;  5EFW A;  4F3L A;  3BFC A;  5GLA A;  3T12 B;  3DWZ A;  1TDG A;  5CHM A;  3W8K A;  3BY8 A;  4HOI A;  4RQ9 A;  4GJ4 A;  1TF1 A;  4OON A;  1L0F A;  3UDX A;  1JVJ A;  3UE0 A;  3O3V A;  4FCF A;  4GD6 A;  3MSH A;  4S2L A;  2PBY A;  3UB7 A;  2O9C A;  2VLG A;  1FCO A;  2ZM2 A;  2CMN A;  1F2K A;  1XFQ A;  5TBM B;  4XT2 A;  4A5R A;  5HDD A;  2KLI A;  1S1Z A;  4JF6 A;  4MDZ A;  5FEF A;  3KSH A;  2QYB A;  3ZCZ A;  4QY6 A;  2P9V B;  3H7W A;  3KO6 A;  1YSP A;  3D72 A;  3FG8 A;  3T1Q B;  2K7S A;  3L7H A;  1VEU A;  3GR2 A;  4WEJ A;  3CHW P;  2Q0O A;  3P7N A;  4IJG A;  3QP8 A;  5HZH A;  1O07 A;  5TFQ A;  1IFQ A;  1H0M A;  1G6O A;  4E3I A;  2ACG A;  4M4X A;  3WS0 A;  1W8Q A;  1YT4 A;  4MN7 A;  4B88 A;  2HP6 A;  4EER A;  2J3W A;  2WKI A;  4HES A;  4EW7 A;  2O99 A;  4PM9 A;  1IEM A;  3UE6 A;  3S7O A;  4K91 A;  4FOF A;  5TBM A;  3ZG5 A;  4LEN A;  2LB5 A;  4BD0 A;  4BWI A;  1D7E A;  1RGZ A;  5KZH A;  2PAV P;  3HLB A;  2XR0 A;  3L9K A;  4OQ0 A;  2V20 A;  1RP5 A;  2EA9 A;  5F6A A;  4KZB A;  1K57 C;  3E98 A;  3IBJ A;  1K6R A;  3HUO A;  3HUN A;  4YIN A;  2PYR A;  4WL9 A;  1FSW A;  1H8M A;  2EWV A;  2V1B A;  2FZ0 A;  2HPB A;  3EWK A;  4O7D A;  3D9Y A;  2XRO A;  1M6K A;  4XXR A;  4EQ1 A;  1NRJ A;  4GW9 A;  2GX5 A;  1ES4 A;  2FFF B;  4HJ6 A;  3U4L P;  1KOU A;  4JGP A;  4WUJ A;  4YNR A;  2ZMF A;  3PBO A;  5AQA A;  1XKZ A;  4QJG A;  1IKG A;  4XUZ A;  1P9R A;  2A3U A;  2P9V A;  1H8Z A;  5CTN A;  1W63 Q;  1CI8 A;  3N8L A;  2H10 A;  4ZTK A;  3CUE A;  4JKT A;  2W1T B;  4DF6 A;  1SKF A;  2Y59 A;  2QPN A;  5A92 A;  5FI7 A;  2JE5 A;  4LRY C;  3FPW A;  5EVE A;  3G6O A;  3DBA A;  4GZB A;  4HH3 A;  4HY8 A;  4FSF A;  3T1S A;  2K2N A;  2Z2M B;  1W79 A;  2VZW A;  2WGI A;  3RXX A;  4AFI A;  1K4E A;  1LL5 A;  5EPH A;  4OQI A;  5FSR A;  3LY3 A;  4KEN B;  4LRZ E;  1YLP A;  4E6W A;  1I2S A;  3CJM A;  4JGO A;  3GRJ A;  4GHI B;  2Y2K A;  1MWS A;  3Q82 A;  4BBT A;  4OOY A;  2Y2M A;  1T1A A;  1ES3 A;  4UQI S;  3Q1F A;  1VB6 A;  2G7U A;  5HDS A;  4KZ4 A;  3IHA A;  3BY9 A;  3DTK A;  4QD4 A;  2Y2J A;  4EQI A;  2VJW A;  4X53 A;  1STZ A;  3N8S A;  4EXO A;  3SH8 A;  1D06 A;  1E3U D;  2HDS A;  5TJJ A;  2XFS A;  2GDN A;  4GKU A;  2ZOI A;  3RJU A;  4Q0I A;  2EFX A;  2NUT C;  3GV9 A;  2VK3 A;  5HFO A;  4LFU A;  3LO7 A;  2QWS A;  4OKP A;  1GSV A;  5FQK A;  1YAX A;  2PRF A;  4EUZ A;  5FDH A;  2Y2H A;  2ZL1 A;  3VOZ A;  5E2E A;  1G28 A;  3OPH A;  5E2F A;  2A24 B;  4LV1 A;  1LLB A;  3IXG A;  3HVF A;  2JKF A;  4NXG A;  3A0S A;  1PWC A;  3QNC A;  2Y2N A;  4M3K A;  4HHD A;  3LEZ A;  3P09 A;  4ZBE A;  4D2O A;  3PXP A;  3E2K A;  5HPF A;  1DJA A;  4F94 A;  1KE4 A;  2L0W A;  1BLH A;  3Q7Z A;  4KZ5 A;  3VV4 A;  1XFN A;  3G2Z A;  3NUL A;  3IS2 B;  2V0W A;  1E3U A;  3MKE A;  4OP5 A;  5CGW A;  3V39 A;  2WKH A;  4LV2 A;  1S6R A;  4UQI M;  2EXA A;  3LR3 A;  2P74 A;  1OME A;  3G34 A; 
#chains in the Genus database with same CATH homology
 1JNU A;  3BQ8 A;  3LR5 A;  2XSS A;  4HJ3 A;  1NLY A;  2VV7 A;  1XJ2 A;  4I3J A;  2EWW A;  4ME4 A;  3GEC A;  4KUO A;  2JKT I;  3EQU A;  1OPX A;  2J3T D;  1OT6 A;  5DKK A;  1ZHH B;  3NOT C;  2L1M A;  2A24 A;  2JN7 A;  2OAP 1;  3OBF A;  3ULF A;  2PD7 A;  3BWL A;  2K31 A;  2VA0 A;  3CUE C;  3E0Y A;  3MJQ A;  4Y2F A;  3KX0 X;  5DF9 A;  2OAQ 1;  3MQ0 A;  2Y8H A;  3LIF A;  4NXE A;  3RTY A;  3RFB A;  4DMZ A;  4MMN A;  4HH2 A;  4DN0 A;  2YKH A;  3TE8 A;  4ARZ A;  4HJ4 A;  3OOV A;  3MQO A;  3HJI A;  3EEH A;  5F69 A;  4CLC E;  4HNB A;  3H9W A;  3F1P B;  3LR0 A;  4II7 A;  2HJ9 C;  3B33 A;  3U2A A;  3T4J A;  2W3H A;  1TS0 A;  2Z6C A;  5KSH A;  4YOF A;  3PBQ A;  2Y79 A;  2GNX A;  2A2L A;  3KYZ A;  4WN5 A;  3VOL A;  5DFY A;  3H82 A;  3SW1 A;  1YKD A;  5C5K A;  2D02 A;  3LIB A;  3FC7 A;  3TW8 A;  3TRC A;  4I3A A;  3KSF A;  1T18 A;  1H3Q A;  4ETX A;  2I9V A;  4NXF A;  2PT7 A;  4G3W A;  3NHQ A;  4LPZ A;  2ZMV A;  4GHI A;  4EES A;  1ODV A;  3LIC A;  1S4S A;  3OLO A;  1TS7 A;  3VE4 A;  3T4O A;  3F1N B;  1OJ5 A;  2WKR A;  3D3O A;  2M7V A;  3MQQ A;  3PBS A;  4H6J B;  1YSQ A;  3H7W B;  2XA7 M;  5EFW A;  1OTE A;  3TJZ C;  4F3L A;  3R7W A;  3FPV A;  4XT2 B;  2ZBB A;  1UWN X;  4WEK A;  3K2N A;  3ICY A;  3BY8 A;  4HOI A;  4RQ9 A;  1P97 A;  4GJ4 A;  3JVU A;  1XJ3 A;  1TF1 A;  3UB6 A;  3BQA A;  4Q0J A;  4WEL A;  4L9F A;  4O01 A;  4BMW A;  2W0N A;  2NUP C;  2B18 A;  2V0U A;  1LSW A;  4DJ2 A;  4CQH A;  4MN6 A;  2PDR A;  5L8M A;  1UGU A;  3UB7 A;  2O9C A;  2PHY A;  2VLG A;  3UMD A;  4LLO B;  2Z6D A;  2VGL M;  4GLQ A;  1TS8 A;  4PKY G;  4LRX C;  3T4T A;  3F1P A;  4IUK A;  2CMN A;  5G4Z A;  5HL6 A;  3C38 A;  1XJ6 A;  1N9O A;  3BJN A;  1XFQ A;  3K3C A;  5HSQ A;  5TBM B;  4I3I A;  2VX8 A;  4XT2 A;  4IUH A;  5HDD A;  2KLI A;  1S1Z A;  4MDZ A;  4CLC B;  4F3L B;  3KSH A;  2QYB A;  3K3D A;  3H7W A;  3KO6 A;  1YSP A;  4JGR A;  3D72 A;  4I38 A;  3T4Q A;  3FG8 A;  5J7E A;  2K7S A;  3OCN A;  2W3F A;  4WEJ A;  2HF6 A;  1OTD A;  3P7N A;  4IJG A;  5A8B A;  5HZH A;  2HGV A;  2O0Y A;  3EQV A;  1IFQ A;  4WLA A;  2V9A A;  2QKP A;  3EOI A;  2P7J A;  1G6O A;  3LI9 A;  2JKT M;  1LT0 A;  4B93 A;  3LIE A;  3KSI A;  2GZA A;  4PAU A;  3C8C A;  4Z1W A;  1GSX A;  5I5L A;  2PR6 A;  3CAX A;  3GDI A;  4M4X A;  2P08 A;  2QJ5 A;  3V67 A;  5K5B A;  3S7N A;  5G4Y A;  2ZOH A;  1XJ4 A;  4QPR A;  4P6Z S;  2D01 A;  4MN7 A;  3W2Z A;  4EER A;  4CLC C;  1NLZ A;  2J3W A;  5MC7 A;  3IS2 A;  2KDK A;  3BW6 A;  2GJ3 A;  1DP9 A;  5IU1 A;  4EW7 A;  2O99 A;  4L9G A;  3UE6 A;  4CLC A;  3S7O A;  1OJG A;  2VV6 A;  3C2W A;  5DFX A;  4FOF A;  5TBM A;  1VHM A;  4BWI A;  2LB5 A;  3LIA A;  1UWP X;  3UB8 A;  1D7E A;  5J4E A;  5F5Y A;  1F5M A;  2W27 A;  1N9L A;  3LYX A;  4ETZ A;  2W3G A;  3PBT A;  2JKR I;  3OC2 A;  2EA9 A;  5F6A A;  5CX7 A;  1Y28 A;  5HWW A;  5FL3 A;  3T4S A;  5HWT A;  2VKS A;  3E98 A;  3IBJ A;  4EEP A;  2DMW A;  1LSV A;  3B47 A;  3B42 A;  3PBN A;  5J3W A;  2FH5 A;  1S67 L;  2PYR A;  4WL9 A;  1H8M A;  2EWV A;  2V1B A;  3MFX A;  2PR5 A;  2VEA A;  3NOP C;  3MMH A;  3R4K A;  2FZ0 A;  1OT9 A;  2LB9 A;  3EWK A;  5AVE A;  3MR0 A;  1P9W A;  1OTA A;  3R7W B;  3PR6 A;  1ZTU A;  2KX6 A;  2XRO A;  4NKP A;  4GCZ A;  2H28 A;  3UME A;  4R38 A;  4O0P A;  3KYQ A;  1N9N A;  5LBR A;  4R70 A;  4EQ1 A;  1NRJ A;  5HD5 A;  4R3A A;  5HPI A;  4GW9 A;  2GX5 A;  3MF0 A;  4HJ6 A;  1KOU A;  1MZU A;  4JGP A;  2XA7 S;  4WUJ A;  2B02 A;  1DP6 A;  2ZMF A;  4KQD A;  3C30 A;  3PBO A;  4YNR A;  4I5S A;  3ZQ5 A;  3A0V A;  2W3D A;  4E04 A;  1P9R A;  2XRN A;  4L0L A;  4EEU A;  2WKQ A;  3E4Q A;  1TD5 A;  3KSG A;  3S7Q A;  2JKR M;  1W63 Q;  3CLO A;  3OCL A;  3E4P A;  5F68 A;  2M1C A;  3H82 B;  4L9E A;  2IA2 A;  3PYP A;  3NOU C;  1DP8 A;  2O9A A;  3CUE A;  1MKM A;  4G3V A;  2W1T B;  3PHY A;  4P6Z M;  4JGQ A;  2JHE A;  3EGX C;  1F98 A;  4ZRR A;  3O5Y A;  4K08 A;  5DKL A;  4LRY C;  3FPW A;  4DJ3 A;  3G6O A;  3DBA A;  4GS9 A;  4KQO A;  3S7P A;  1T1C A;  4HH3 A;  2VGL S;  4HY8 A;  5KIZ A;  4FSF A;  3T50 A;  3LFV A;  2K2N A;  3PBR A;  2R78 A;  2VZW A;  2INW A;  3UB9 A;  3F1O B;  2W1R A;  4Y3I A;  1T19 A;  3LI8 A;  5DJU A;  4AFI A;  4H6J A;  3LUQ A;  5AJG A;  2J80 A;  3HJK A;  4GS9 B;  2KOI A;  1NWZ A;  4LRZ E;  2HV1 A;  3F1N A;  3IBR A;  1OTB A;  3NJA A;  4JGO A;  4GHI B;  4BBU A;  2BAS A;  1BYW A;  4R6L A;  4BBT A;  3MXQ A;  5HDC A;  2W1T A;  4HP9 A;  2M7U A;  1T1A A;  2W3E A;  1P0Z A;  4UQI S;  5HD3 A;  1F9I A;  3CWF A;  1VB6 A;  2P04 A;  2G7U A;  5HDS A;  4BJP A;  3CI6 A;  3HCY A;  3LR4 A;  1W63 M;  3BY9 A;  2WKP A;  3EEA A;  4OOL A;  4Q0H A;  4MN5 A;  4BBV A;  4HI4 A;  1MC0 A;  2VJW A;  2L4R A;  1STZ A;  4EXO A;  1D06 A;  5DJT A;  4EUV A;  3LID A;  5TJJ A;  2O9B A;  4B9O A;  2ZOI A;  4ARZ B;  4Q0I A;  2J3T C;  4KUK A;  1S66 L;  2VV8 A;  5AVF A;  4NXB A;  2NUT C;  3A0R A;  3F1O A;  3ZYT A;  2QWS A;  4CLC D;  4HQA A;  3T4L A;  1GSV A;  2YKF A;  1YAX A;  4EU0 A;  1OTI A;  1DRM A;  3CIT A;  3EGD C;  1T1B A;  3E4O A;  2PD8 A;  1S4R A;  2OWJ A;  4Y5F A;  3JVV A;  4YWZ A;  2QHK A;  5HWV A;  1G28 A;  3UE3 A;  2A24 B;  4PKY A;  1S1Y A;  4OOM A;  4UEY A;  4NXG A;  3A0S A;  4O8G A;  1LL8 A;  2MJ6 A;  3VE3 A;  5IS1 A;  4HIA A;  4HHD A;  3P01 A;  4IHQ A;  4EET B;  3PXP A;  2V1A A;  1X0O A;  5HPF A;  1GSW A;  1EW0 A;  4MCW A;  4PHT A;  1V9Z A;  2L0W A;  3T4K A;  4I39 A;  2QJ7 A;  3VV4 A;  1XFN A;  3IS2 B;  2V0W A;  4WF0 A;  1WA9 A;  2HJE A;  4G3K A;  4HP4 A;  2PYP A;  4NEE D;  5IT5 A;  2OOL A;  1IOU A;  4UQI M;  1V9Y A;  3LR3 A;  2OWH A;  1TS6 A;  3RH8 B;  1LSX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...