1LSXA

Crystal structure of the methylimidazole-bound bjfixl heme domain
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
116
structure length
116
Chain Sequence
DAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRYRTTSDPHIIGIGRIVTGKRRDGTTFPMHLSIGEMQSGGEPYFTGFVRDLTEHQQTQARLQEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure-based mechanism of O2 sensing and ligand discrimination by the FixL heme domain of Bradyrhizobium japonicum
pubmed doi rcsb
source organism Bradyrhizobium japonicum
molecule tags Transferase
molecule keywords Sensor protein FixL
total genus 30
structure length 116
sequence length 116
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2002-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1lsxA00
5J4EA 2V0UA 1TS0A 2JHEA 2PD7A 1OTAA 3H82A 4EEUA 2K7SA 3BY9A 3MR0A 4GW9A 3UB6A 2KX6A 3UMDA 4F3LA 1S66L 1GSWA 1OTDA 1XFNA 2A24A 3FC7A 5HDSA 1GSVA 5DKLA 5HWWA 3C2WA 2W0NA 4BBUA 3LIDA 1DP8A 4JGPA 1V9ZA 3KX0X 5F69A 3E4OA 1OT6A 3F1OA 1V9YA 2WKPA 1DP9A 1D7EA 2V0WA 3LICA 4I38A 5A8BA 2L0WA 4L9EA 3LIBA 2I9VA 4R38A 4B9OA 3E4PA 3GDIA 4R3AA 3PHYA 5HSQA 4L9GA 3NOTC 4EW7A 1OT9A 2PD8A 2QWSA 2VV7A 3RTYA 4GHIA 1S4RA 3UB7A 1UGUA 4BBTA 1OTBA 5F68A 1P97A 2KDKA 2QJ5A 4KUKA 3RH8B 5HWVA 4R70A 1EW0A 1UWPX 2YKFA 2PDRA 3FG8A 2PYPA 3HJKA 4HHDA 4HIAA 3UB9A 2D02A 1S1YA 3A0VA 1G28A 3LI8A 1GSXA 3VE3A 2PHYA 1JNUA 1S4SA 3BWLA 2CMNA 3ZQ5A 4HP9A 2VV8A 3LIEA 4WL9A 4LRZE 2HV1A 4WLAA 3H9WA 4NXBA 1XJ2A 3H82B 2OWJA 1TS7A 2EA9A 2QJ7A 4LRYC 5J3WA 3UE6A 1KOUA 3VE4A 4EXOA 4HI4A 1T1CA 1OTIA 4HJ6A 3LIAA 1NWZA 3BY8A 4R6LA 3GECA 2INWA 2PYRA 3K3DA 4H6JA 4HNBA 1S1ZA 2D01A 3NHQA 2WKRA 4GCZA 4NXEA 4H6JB 4WN5A 3MXQA 4HH2A 1ODVA 1TS6A 3SW1A 3NJAA 4MN5A 1UWNX 2VV6A 3MJQA 3F1NB 4GS9A 5HD3A 2W27A 4JGOA 3ULFA 4DJ2A 4PKYG 2V9AA 4DJ3A 4KQDA 1S67L 1BYWA 4WF0A 5F5YA 3A0SA 4YWZA 2VLGA 1OJGA 4RQ9A 1N9OA 1DRMA 3NOPC 3CAXA 1VB6A 3CWFA 4LRXC 4HP4A 5DJTA 3OLOA 4I39A 1T1AA 5AVEA 4EEPA 4GHIB 4LPZA 4I3AA 4E04A 3LUQA 3MQQA 5G4YA 3EEHA 4LLOB 1N9LA 1LSXA 1LSWA 1OTEA 3B33A 1WA9A 3EWKA 1OJ5A 3HJIA 4JGRA 1X0OA 2ZOHA 4HQAA 2QHKA 3F1PB 4HJ3A 4WUJA 4EESA 3D72A 3IBRA 3P7NA 3A0RA 3F1PA 3H7WB 5DKKA 5IS1A 3LYXA 1XFQA 3PYPA 3F1NA 3LI9A 3H7WA 1D06A 2L1MA 2A24B 2WKQA 4K08A 1F9IA 5HD5A 1Y28A 2Z6CA 2R78A 1LT0A 1XJ3A 3MQOA 5DJUA 2YKHA 1XJ4A 3E4QA 3F1OB 3UMEA 5TBMB 4EETB 2V1AA 5G4ZA 3LIFA 5AVFA 4HJ4A 1T19A 4I3IA 1LL8A 1LSVA 4NXGA 1F98A 1P0ZA 2H28A 3C8CA 5EFWA 2ZBBA 2L4RA 2QKPA 5IU1A 4HY8A 4XT2B 3G6OA 1N9NA 3IS2B 3CLOA 1T1BA 4I3JA 3T50A 4F3LB 2JN7A 4M4XA 4XT2A 2BASA 5HDDA 2J80A 2OOLA 2PR5A 2PR6A 3IS2A 5HDCA 3VOLA 3K3CA 2OWHA 2P7JA 5HZHA 4L9FA 4NXFA 2ZOIA 5HWTA 1T18A 4I5SA 1MZUA 2B02A 4JGQA 5F6AA 4BBVA 2M1CA 3ICYA 5J7EA 4GS9B 2GJ3A 4HOIA 4EERA 4EQ1A 5KIZA 4PKYA 3NOUC 4MN6A 3UB8A 5TBMA 1TS8A 4HH3A 2V1BA 5I5LA 2Z6DA 4KUOA 3MFXA 1XJ6A 1DP6A 2VEAA
chains in the Genus database with same CATH superfamily
1ES5A 1OTAA 3H82A 2ZC6B 4Y2FA 4CLCE 1PNEA 2W3HA 2WKHA 2W1RA 4EW7A 4UAAA 4KUKA 3N7WA 3PBOA 4Y17A 2EWVA 2O0YA 1KGGA 3G35A 4QU3A 3VFHA 4CPKA 2HF6A 3MZEA 2VV8A 1KGEA 3O86A 3H82B 3B47A 1PI4A 1NWZA 4N9LA 4E3MA 1Q2QA 2D01A 3GSGA 3UO9A 4PM7A 4H6JB 4IVIA 2XR0A 4O8GA 2EWWA 3GQZA 1ZC2A 4UQIS 3BQAA 4X25A 2Y59A 1CEFA 3C5AA 4EESA 3C4OA 2W1TA 3VP0A 1PYYA 5AQAA 4JXWA 1NJ4A 4ZJ3A 4BWIA 3DTEA 2Y91A 3FKVA 4RX3A 1EWZA 2ZJ9A 4M4XA 1KVLA 4WZ4A 1LLBA 3MBZA 3IH9A 4JF4A 5CERA 1PI5A 1TS0A 4IBRA 3EQUA 5GLAA 2X02A 4GW9A 4KG6A 1QMEA 3AGDA 4BBUA 3PBTA 3KX0X 2Y8HA 3GDIA 4MLLA 4Q0JA 2PD8A 5GLCA 3IF6C 1WE4A 3RH8B 3BYDA 3S7PA 2YKFA 1BLPA 5FI2A 2K2NA 3UB9A 3IH8A 2XGNA 3RFBA 3GR2A 4N9KA 2WKIA 3OPHA 5CGWA 2WUQA 3VOYA 4OPQA 4KQOA 2PRFA 3LY3A 1PZOA 2HJEA 1KE3A 4C75A 2V8FA 5L09A 1TEMA 3IX3A 4Y0TA 2PYRA 1ZKJA 2PT7A 5FAQA 4GCZA 4R1GA 1ESUA 3MXQA 4EUZA 5FA7A 1Z6FA 4JGOA 1RP5A 4X53A 2V9AA 4UA9A 2VLGA 1BUEA 3CWFA 1O07A 5AVEA 1K6SA 3VOZA 4UHUA 1PIOA 2Q0OA 1FCNA 3F1PA 4K0XA 1KGFA 4QWOA 5GHZA 1L0FA 4S2KA 3SS4A 1SKFA 1AXBA 2DNSA 1ERQA 3IWOA 1XKZA 3DTIA 3V3RA 4IHQA 1F2KA 2BASA 4Y7PA 4OKPA 3SS5A 2B02A 3EGXC 3CMZA 2ZC7A 5HW3A 5TBMA 5E2HA 1XGIA 1ALQA 2V0UA 1BSGA 1BLSA 2KX6A 1SKOA 3TW8A 1YSPA 1K4FA 2WZXA 3NBLA 3TOIA 1DP9A 5A93A 1H0MA 2I9VA 3HUNA 2P9VB 1K0KA 1Y54A 3V50A 3JVUA 3UE0A 2JE5A 2JKTM 5F68A 2KDKA 1L3LA 3CG5A 3BW6A 2B5RA 3WS4A 4JXVA 1ZTUA 4BMWA 2ZMVA 5FATA 4OLDA 4KG2A 3ZDJA 4WBGA 1DY6A 3VE4A 1YLTA 3MZFA 2O9AA 3A3IA 3NULA 1MWUA 4B88A 3VSLA 1FSYA 3VV4A 4JXSA 1CEGA 3ZFZA 3A3DA 1TVFA 1K54A 3C7UA 5G18A 5M19A 4BQMA 3NOPC 1ZG6A 5FAPA 1N9LA 2FZ0A 2J7VA 3B33A 3T1XA 4D2OA 3E2LA 5EECA 2Z2LB 4S2LA 3A0RA 5IS1A 1FCMA 2R9XA 4P6ZS 4WMCD 1P9WA 1NY0A 5EFWA 2Y55A 3FKWA 1T1BA 3IS2A 1MC0A 2PR5A 3K3CA 5FI7A 1P9RA 3FV7A 3OCNA 4ARZB 2Y2JA 3MFXA 1K55C 4ME4A 3CJMA 3RXWA 2DMWA 1S0WA 2HJ9C 4LENA 2QPNA 5E2FA 4ZTKA 3G4PA 5LBRA 4DDYA 3LIBA 5CTNA 3IWQA 1QMFA 3RJUA 5CGXA 3QP5A 4FUWA 4N1HA 3VP2A 2IA2A 3PBNA 3FPWA 2WAEA 2DRWA 1K55A 4LV2A 1YPRA 1TD5A 2XLNA 4WELA 3ZYTA 4MN7A 2Y4AA 1K25A 2GDNA 4Q0IA 2GZAA 4XXRA 1G68A 2H0TA 3T4SA 4JPMA 5GLDA 1GCEA 4MNRA 4DE1A 3O87A 4GB7A 1IFQA 1JWPA 4S2NC 4PKYG 3CPTB 4AFIA 3TE8A 2VZWA 2ZQ8A 1HVBA 5DJTA 3W4OA 5G4YA 4LLOB 3VE3A 3IX4A 5L8MA 3QP2A 4MBFA 4O7DA 3CUEA 3PTEA 3G2ZA 1LI9A 5KSCA 3LGOA 3T1RA 1F9IA 4X1LA 4E6XA 2HP6A 2R78A 1XJ3A 1XJ4A 1YMXA 3D4FA 5F1GA 2ZLYA 3T4KA 4KZ6A 2L4RA 4XT2B 3ZGAB 3S7OA 4BENA 2JKRM 2C6WB 3ZHHA 2P7JA 4BL3A 5FL3A 4U3TA 3W4PA 2V1BA 3EOIA 3JPUA 4PM9A 2Y2QA 3GTCA 3KSGA 2VX8A 3KYEA 2W3FA 5A8BA 2L0WA 4L9EA 2XFSA 1ES4A 3MS6A 5K5BA 4R70A 4RX2A 2WGVA 4HHDA 3JVVA 1S1YA 3B3XA 1ACFA 1K6RA 3EGDC 1H8YA 1IKGA 3CI6A 2Y2OA 4KZ5A 1K38A 2ZQCA 4H6JA 3HREA 3VP1A 4ZRRA 3WRZA 3LR3A 1LL9A 2WK0A 4MN5A 4Y5FA 3MJQA 4FD8A 4L0LA 3T12B 3IWIA 3BM6A 3GV9A 4CLCC 1Q2PA 1ZG4A 2FFFB 4X6TA 4Y13A 3QNBA 5IU1A 3G2YA 3Q1FA 2BG1A 2J9PA 2W1TB 5FQIA 4GKUA 2IWDA 3WS1A 5EM1A 2YKHA 4MBKA 5FI6A 3LY4A 5TBMB 4KZ3A 5M1AA 3VP4A 2JN7A 4KQRA 1J9MA 5GL9A 1K4EA 1OMEA 3PBRA 1K56A 3N8RA 4HOIA 2P9VA 3NDGA 4DE2A 1KVMA 2JHEA 2OSUA 3P09A 1BZAA 4EEUA 4GOGA 4F3LA 3FC7A 1K57A 1YLYA 5F69A 1V9YA 2XF3A 3HVFA 4R3JA 1O7EA 3KSFA 1F5MA 4MBHA 3BFFA 5EVID 4E3OA 4QJGA 1WYCA 2HDUA 4L9GA 3BRMA 2QWSA 1JWZA 3A3EA 1FR6A 3HLGA 2J3WA 4WZ5C 4R0QA 5FEFA 3DTMA 3NCKA 3NECA 3G31A 4S2OA 4WL9A 3H9WA 3QP6A 4FCFA 4NG2A 2OWJA 4LRYC 4P87A 3TG9A 3GECA 4PM5A 4PM8A 2ZM8A 5A92A 2HGVA 1IYQA 4F94A 2VV6A 2W27A 3OC2A 1ONHA 4YWZA 2VGLS 4BLMA 2W3EA 3OZHA 5EVLA 1MWTA 2XK1A 3OBFA 1BTLA 4QB8A 3F1PB 4IEDA 1GHIA 1XFQA 4QY6A 1EI5A 2L1MA 2NUTC 2CC1A 5DJUA 3N6IA 5AVFA 4MMNA 4OPYA 3OPLA 1MWRA 2OWHA 4L9FA 2ZL1B 2VA0A 2EX9A 5EM0A 4BBVA 1I2WA 3PAEA 4EQ1A 4GZBA 1PFLA 3S1YA 1FILA 3WS0A 3L7HA 3Q7ZA 4Y0OA 5M18A 2VGJA 2A3UA 3BLSA 2JC7A 5HL1A 1GSVA 5DKLA 5CEBA 2WGWB 1E4DA 1PWGA 5C5KA 1DJBA 3MMHA 2OAP1 3W8KA 1P97A 3PR6A 2QJ5A 2ZL1A 3Q82A 1MY8A 1BLCA 2CMNA 2JBFA 3IXGA 1GA9A 3SH9A 1LI0A 4NXBA 4OONA 1K56D 1KE0A 1W63M 5TGFA 5F83A 2HZ5A 1H3QA 4QHCA 1I2SA 3NIAA 4OLGA 5HD3A 1HTZA 4KQDA 1TF1A 2Q9MA 1K54C 2Y2KA 4MDZA 2V20A 2XDMA 3GMWA 3ZG5A 4HBTA 4DDSA 2M7VA 5HPFA 1LSWA 2WZZA 3SH8A 4HQAA 1CJFA 3GRJA 1IELA 2XA7S 1NRFA 2OAQ1 5FSRA 3TJZC 2PAVP 5F82A 1LL5A 1PWDA 4Z9QA 2ZQDA 3MSHA 1MKMA 3NDEA 3R7WA 4NXGA 1F98A 1KE4A 3MQ0A 5JYPA 4LCLA 1TDLA 3IS2B 3T50A 3T4OA 3K2NA 2I72A 3PXPA 3W2ZA 5HWTA 3P98A 4ETXA 4EUVA 3ICYA 4EERA 3UB8A 1IEMA 2PD7A 3BFGA 3IQAA 4P0MA 3KO6A 3UMDA 1OTDA 2Y2NA 3WWXA 1JTDA 3HLBA 3C2WA 4JGPA 5CECA 4ESPA 4I38A 4X69A 1JWVA 5HSQA 3OPPA 1OT9A 4G3WA 4EQIA 3M6HA 5FAOA 3WS5A 5JYOA 4PPRA 3HJKA 3KSHA 3BJNA 4S2NA 3ZG9B 1HZOA 2M7UA 3TSGA 1XPBA 4FTXA 2ZM0A 4DF6A 3DWKA 1G5UA 1MXOA 2G2WA 5GLBA 1CQAA 2XD5A 4OP5A 3MKEA 2WAFA 1W7FA 4GS9A 2AVXA 4PMAA 2QZ6A 4G3VA 3QHYA 4LCMA 4QY5A 1E25A 5FQKA 4JKTA 1VEUA 3LCEA 2JKRI 4I3AA 3N4IA 3OCLA 4NETA 1G6AA 2V8CA 2JKTI 3UE3A 4FOFA 4XUZA 4NK3A 5FQ9A 3PBQA 1N4OA 3CITA 3H7WA 2A24B 1MPLA 3MQOA 3OOVA 4KZ9A 3UMEA 1CI9A 1NYYA 5D3OA 4I3JA 3CLOA 5CGSA 4F3LB 2ZQ7A 2PR6A 4KENB 5HZHA 5FQMA 2WYXA 3BLMA 2VGLM 4YOFA 2XRNA 3FZCA 3PBSA 5KIZA 1BULA 5I5LA 4S2PA 4Y15A 1M40A 4KZ8A 2K7SA 5HL6A 3MR0A 5HAIA 4DKIA 2A24A 5HDSA 1OT6A 3DTKA 2PU2A 1W5DA 3CZDA 2VV7A 1S4RA 4ZBEA 3BFCA 4S2MA 4OPZA 1E3UA 3ZCZA 4U0XA 3G34A 2WADA 3S4XA 3QP4A 4X68A 5KSHA 3Q07A 4RYEA 4OPRA 2EA9A 4IUHA 1OTIA 4B4XA 3T1SA 3UPOA 1ODVA 1TS6A 2E8JA 4GNUA 4OQIA 5DTKA 4P85A 1YM1A 2GX5A 1SDEA 4LRXC 4EEPA 3EWKA 5EOOA 5AQ7A 2FH5A 2O99A 4U0TA 3F1OB 2EX2A 1M6KA 1HLUP 3LIFA 1L2SA 3A3JA 2ZBBA 5HARA 4E6WA 4PHTA 4G3KA 2J80A 3O3VA 5CRFA 4LGWA 4C3QA 2WGWA 1CK3A 4EBPA 4PKYA 5GHYA 2RCXA 1Y4OA 1XJ6A 3FG8A 3MZDA 4R23A 4ZJ1A 4EU0A 3EQVA 3MF0A 4WEJA 3HUMA 3S7NA 4MCWA 2XSSA 3F1OA 2V0WA 1D7EA 4OQ0A 2HP5A 1SHVA 1ONGA 3PHYA 5HAQA 4GDBA 2J8YA 4GHIA 3UB7A 2Y2LA 2PU4A 3B42A 4O01A 3IBJA 3SOIA 2UWXA 4OVDA 2PDRA 3ZG0A 1PRQA 5L2FA 3UY6A 4JF5A 4D60A 1GSXA 5TR7A 2PHYA 5EV0A 4KZ4A 4HP9A 4LRZE 1XXMA 1XJ2A 1GHPA 4K91A 1PW8A 2QMIA 3E2KA 1ES3A 2VJWA 2XD1A 4ARZA 3V3SA 3ITBA 4HNBA 3IF5A 1BLHA 4WN5A 3NJAA 5EVIA 4KG5A 1S67L 1XA1A 4OOLA 3IF6A 3CAXA 4I39A 5CHUA 3HBRA 1NZUA 1OJ5A 4LV1A 5BOHA 4WUJA 2ZC4B 2V2FF 5CHJA 4M3KA 1MKIA 2HDRA 1MBLA 1YAXA 4OH0A 3UPNA 4EWFA 3MXSA 3LEQA 1VM1A 4JBFA 3UDXA 1ES2A 2H28A 5DTTA 2J3TC 2Y2GA 1N9NA 3ITAA 5CX7A 4X55A 4CQHA 3IHBA 2M1CA 4E3IA 5IT5A 3V5MA 3ZG8B 3G32A 3NOUC 1DJAA 4X1MA 4HIAA 2NUPC 3FPVA 3HLDA 4P6BA 2H10A 2GNXA 5HWWA 1D1JA 3E4OA 3O5YA 5A90A 4R3BA 3RTYA 3N8SA 1UGUA 3M2KA 4CLCB 2EX6A 4Y3IA 3A0VA 1U60A 2H0YA 4CLCD 1DJCA 1XP4A 2LB9A 3DWZA 1TS7A 4BD1A 3BFEA 3LIAA 2ZMAA 1IYPA 3R4KA 1IYSA 1S1ZA 2WKRA 5DTSA 2VKSA 2JCHA 4CLCA 1YLPA 3SH7A 1N9OA 3U2AA 4H8RA 2LB5A 3UDFA 2Y2IA 1WA9A 2FFYA 3HJIA 1X0OA 2XQZA 4JLFA 3VFFA 3S22A 4MEZA 2ZQ9A 4FSFA 5IHVA 2WKQA 2Z6CA 2G2UA 4X56A 4E3LA 2IWBA 1VETB 1T19A 4IBXA 5DF9A 4DMZA 2ZQAA 1SDNA 2QKPA 1FR1A 2X01A 5HDDA 3ISGA 2OOLA 3MFDA 3T1QB 3TRCA 4CJNA 1OPXA 4DE0A 2BLSA 3M6BA 4QD4A 4WM9A 3ZNYA 4GJ4A 1TS8A 4KUOA 1DP6A 3C7VA 3D9YA 3JYIA 4BJPA 3G30A 3WRTA 1S66L 1XFNA 3Q7VA 1DP8A 4GD8A 3FYZA 2R9WA 3E4PA 3LR5A 3P01A 2ZM2A 3FWLA 1VHMA 3VP3A 1GHMA 4OQGA 2D02A 1G28A 3A3FA 1IYOA 4O0PA 5AQBA 4NEED 1S4SA 3E0YA 1RGZA 5E43A 1L0EA 4WLAA 3SZTA 2XFTA 2EX8A 4HJ6A 3BY8A 3CUEC 3D3OA 3Q7VB 2INWA 3L9KA 3HLFA 1HD8A 2EFXA 4WEKA 1EROA 3VMAA 5EE8A 4JF6A 4DJ2A 3AGEA 3UPPA 4RQ9A 3IXHA 1NYMA 5KMWA 1VB6A 2IWCA 1G6OA 4DXBA 5DF8A 2QHKA 2VK3A 3H7WB 1D06A 1Y28A 3IXDA 4ETZA 3NI9A 4EETB 3E4QA 2UV0E 1H8MA 4UEYA 4I3IA 4IJGA 2P08A 1NZOA 3BFDA 3ZNTA 4KZBA 1W63Q 1PWCA 5J7EA 3Q81A 1SZVA 1VQQA 4YFMA 4HEFA 1YQSA 1E3UD 5J4EA 4LFUA 3BY9A 3C4PA 1CF0A 2ACGA 5KZHA 1GSWA 2W0NA 2EXAA 2WKPA 1PW1A 1NLYA 1WYBA 4Z1WA 2EFUA 3AGFA 2P04A 4ID4A 4BBTA 1OTBA 1YSQA 4UA6A 4FH4A 4WZ5A 4UA7A 3UDIA 2JKFA 4ZDXA 4HBUA 5EVIB 4GLQA 5EOEA 4S2IA 3NY4A 4R4RA 5J3WA 3UE6A 1XA7A 1KOUA 4B93A 2ZMFA 4HI4A 4S2JA 4WYYA 1NLZA 5DF7A 4RA7A 2ZD8A 2V1ZA 2H5SA 4QPRA 1CI8A 1UWNX 1W79A 2K31A 2Y2PA 3MXRA 5E2EA 4DJ3A 4NKPA 4OP8A 5EUAA 4B4ZA 2E8IA 2Q9NA 4DN0A 1T1AA 4LPZA 3SW1A 3LUQA 1YLWA 1OTEA 2A49A 5DFXA 1STZA 3ZVTA 1TDGA 2XEPA 3W4QA 3F1NA 3LI9A 3UE1A 1LT0A 3NC8A 2HDSA 1GA0A 4GN2A 3S7QA 1YT4A 2XA7M 1LSVA 4OOMA 3UB5P 3HLEA 2PBDP 4HY8A 3VOLA 2XH9A 5AJGA 5HDCA 2ZOIA 4JGQA 3PAGA 3CHWP 4MN6A 1I5QA 5HX9A 4C6YA 5CXWA 5CEDA 4LV0A 4Q8IA 3LIDA 3VSKA 3T4JA 3V39A 3T4QA 2A2LA 3NOTC 5CHMA 5FQJA 1J3WA 3R7WB 1UWPX 1ESIA 4A5RA 2J9OA 3LI8A 1FOFA 1JNUA 3QP1A 2PBYA 2XROA 1LHYA 1A0KA 5L10A 4K0WA 3U4LP 2QYBA 2HPBA 3K3DA 5DFYA 4NXEA 1KDWA 1BYWA 4WF0A 3A0SA 4LV3A 3IF6B 2BTFP 2B18A 3LFVA 1AWIA 1DRMA 1NXYA 1C3BA 3BQ8A 3LR0A 2ZOHA 5L07A 3IBRA 5HPIA 4PM6A 3WS2A 4BL2A 4N92A 3M2JA 3HUOA 3GVBA 3N8LA 2V1AA 4UQIM 1H8ZA 1LL8A 3KYZA 4ZAMA 3G6OA 3MKFA 1YLZA 5AQ9A 2OV5A 4NXFA 1MZUA 1ZHHB 5F6AA 4GS9B 2GJ3A 1KDSA 5FQQA 4ZJ2A 4DRTA 2Z6DA 3UN7A 3LO7A 3C38A 4BD0A 1W8YA 1YKDA 3RXXA 1VEUB 5FEGA 3T4LA 3OPRA 2OLUA 3C30A 1H5XA 2G7UA 4R38A 2KOIA 3HCYA 3QP8A 1ERMA 4HESA 1EW0A 2W3DA 2PYPA 2C5WB 3ZQ5A 3V67A 3LIEA 5TJJA 4E3NA 1BT5A 1FCOA 2HV1A 4DE3A 2RL3A 2QJ7A 1FSWA 3EEAA 4KQQA 1L0GA 3HLCA 5FDSA 2OLVA 2O9BA 5F5YA 5FASA 1OJGA 1Z09A 3E98A 2Z2MB 5GHXA 2X71A 2VGKA 3QNCA 1LSXA 3D72A 3P7NA 2WGIA 5DKKA 3PYPA 4IVKA 4FH2A 4EBLA 1RCJA 1VETA 3O88A 5EVIC 5FDHA 1PZPA 5DVAA 4OOYA 2DCFA 2WKEA 4EBNA 1RGYA 2MJ6A 5A91A 3UNWA 1T18A 4I5SA 1IOUA 2KLIA 2P74A 3HLWA 5I94A 3ZG7B 2VEAA 2HDQA 3LEZA 3KYQA 1JVJA 4KZ7A 3UB6A 4XUXA 4E3JA 1YMSA 3DBAA 3T4TA 5J8XA 2ZC3B 1V9ZA 3LICA 2ZC5B 4B9OA 4R3AA 3DAVA 4KZAA 5HAPA 5EPHA 1XGJA 4IUKA 5HWVA 1FIKA 5MC7A 2Y2MA 1SKOB 1MWSA 4Y0UA 1YLJA 5HFOA 4N1XA 3LR4A 3BWLA 4OQHA 5CTMA 3DW0A 1IKIA 1SCWA 4EXOA 1T1CA 3BECA 2Y2HA 4R6LA 2Y79A 1FQGA 3NHQA 4JXGA 2JKGA 4HH2A 3IX8A 2B95A 5E2GA 1NRJA 1W8QA 3F1NB 3ULFA 4PAUA 1N9BA 1S6RA 1XX2A 3SS3A 2J3TD 3CPTA 3HL9A 4YNRA 4R4SA 2O9CA 4HP4A 3ZVWA 3OLOA 4GDNA 3IT9A 4GHIB 4E04A 3MQQA 3EEHA 4JGRA 4HJ3A 1K57C 3I7JA 3LYXA 3IXBA 3BEBA 5HD5A 4K08A 4GD6A 4EV4A 5G4ZA 4HJ4A 1P0ZA 3C8CA 4Q0HA 5EVEA 4YINA 4XT2A 2W3GA 2EXBA 2HP9A 4WMCA 5F1FA 5U47A 3IHAA 4RVAA 5TFQA 1JTGA 3KSIA 4P6ZM 4E3KA 4DXCA 4II7A 4HH3A 1L0DA
chains in the Genus database with same CATH topology
5J4EA 1OTAA 3H82A 2K7SA 3BY9A 5HL6A 3MR0A 1GSWA 4Y2FA 2A24A 5HDSA 3KSGA 2VX8A 2W0NA 2W3FA 4CLCE 1OT6A 2WKPA 5A8BA 1NLYA 2L0WA 4L9EA 4Z1WA 2W3HA 2W1RA 4EW7A 5K5BA 2P04A 2VV7A 1S4RA 4BBTA 1OTBA 1YSQA 4KUKA 4R70A 3PBOA 2EWVA 2O0YA 4HHDA 3JVVA 1S1YA 5KSHA 2HF6A 4GLQA 2VV8A 3EGDC 3H82B 3CI6A 2EA9A 3B47A 5J3WA 3UE6A 1KOUA 4B93A 2ZMFA 4HI4A 4IUHA 1OTIA 1NWZA 1NLZA 4H6JA 2D01A 4QPRA 4ZRRA 4H6JB 1ODVA 1TS6A 3LR3A 4MN5A 1UWNX 4Y5FA 3MJQA 2K31A 4L0LA 4DJ3A 4NKPA 4CLCC 4O8GA 2EWWA 2GX5A 4LRXC 4UQIS 4DN0A 1T1AA 4EEPA 4LPZA 3SW1A 3BQAA 3LUQA 1OTEA 5IU1A 3EWKA 5DFXA 1STZA 4EESA 2W1TB 2FH5A 2W1TA 3F1NA 3LI9A 2O99A 1LT0A 4BWIA 2YKHA 3F1OB 5TBMB 3LIFA 3S7QA 2XA7M 1LSVA 4OOMA 2ZBBA 4HY8A 4PHTA 4G3KA 2JN7A 4M4XA 3VOLA 2J80A 5AJGA 5HDCA 3PBRA 2ZOIA 4JGQA 4HOIA 4PKYA 4MN6A 3FG8A 1XJ6A 4EU0A 1TS0A 2JHEA 3EQUA 3EQVA 3MF0A 4EEUA 4WEJA 4GW9A 4F3LA 3FC7A 4BBUA 3LIDA 3S7NA 3PBTA 3KX0X 4MCWA 5F69A 3T4JA 2XSSA 3F1OA 1V9YA 2V0WA 1D7EA 3T4QA 3KSFA 2A2LA 1F5MA 2Y8HA 3GDIA 3PHYA 4L9GA 3NOTC 4Q0JA 2PD8A 2QWSA 4GHIA 3UB7A 4O01A 3B42A 3IBJA 3RH8B 3R7WB 3S7PA 1UWPX 2YKFA 2PDRA 2J3WA 2K2NA 3UB9A 3LI8A 1GSXA 3RFBA 2PHYA 1JNUA 4HP9A 4WL9A 4KQOA 4LRZE 2XROA 3H9WA 1XJ2A 2OWJA 2HJEA 4LRYC 2QYBA 2VJWA 4ARZA 3GECA 4HNBA 2PYRA 3K3DA 2PT7A 5DFYA 4GCZA 4NXEA 2HGVA 4WN5A 3MXQA 3NJAA 2VV6A 2W27A 3OC2A 4JGOA 2V9AA 1S67L 1BYWA 4WF0A 4YWZA 2VGLS 3A0SA 2VLGA 2B18A 3LFVA 4OOLA 1DRMA 2W3EA 3CAXA 3CWFA 3OBFA 5AVEA 3BQ8A 4I39A 3LR0A 1OJ5A 2ZOHA 3F1PB 4WUJA 3IBRA 3F1PA 1XFQA 1YAXA 5HPIA 2L1MA 2NUTC 5DJUA 2V1AA 4UQIM 5AVFA 1LL8A 2H28A 3KYZA 2J3TC 4MMNA 3G6OA 1N9NA 4IHQA 5CX7A 2BASA 2OWHA 4CQHA 4L9FA 4NXFA 2VA0A 1MZUA 2B02A 3EGXC 1ZHHB 5F6AA 4BBVA 2M1CA 4GS9B 2GJ3A 4EQ1A 5IT5A 3NOUC 5TBMA 2Z6DA 4HIAA 2NUPC 3FPVA 3C38A 2V0UA 1YKDA 2KX6A 2GNXA 3TW8A 1YSPA 3T4LA 1GSVA 5DKLA 5HWWA 3C30A 3E4OA 2G7UA 1DP9A 3O5YA 2I9VA 4R38A 2KOIA 3HCYA 3JVUA 5C5KA 3MMHA 3RTYA 2OAP1 1UGUA 4CLCB 2JKTM 5F68A 1P97A 3PR6A 2KDKA 2QJ5A 3BW6A 1EW0A 2W3DA 2PYPA 4Y3IA 1ZTUA 3A0VA 4BMWA 2ZMVA 4CLCD 2CMNA 3ZQ5A 3V67A 3LIEA 5TJJA 2LB9A 2HV1A 4NXBA 1TS7A 2QJ7A 3VE4A 1W63M 3EEAA 3LIAA 2O9AA 3R4KA 1S1ZA 2WKRA 1H3QA 3VV4A 2VKSA 5HD3A 4KQDA 1TF1A 2O9BA 5F5YA 4CLCA 1OJGA 1N9OA 3U2AA 4MDZA 3E98A 3NOPC 2LB5A 2M7VA 1N9LA 1LSXA 1LSWA 2FZ0A 3B33A 1WA9A 3HJIA 5HPFA 1X0OA 4HQAA 3D72A 2XA7S 3P7NA 3A0RA 5DKKA 5IS1A 3PYPA 4FSFA 2WKQA 2OAQ1 3TJZC 2Z6CA 4P6ZS 1MKMA 1P9WA 1T19A 5DF9A 4NXGA 3R7WA 4DMZA 1F98A 5EFWA 3MQ0A 2QKPA 3IS2B 1T1BA 3T50A 3T4OA 5HDDA 2OOLA 1MC0A 2MJ6A 2PR5A 3IS2A 3K2NA 3K3CA 3PXPA 3TRCA 3W2ZA 5HWTA 1OPXA 1P9RA 1T18A 4I5SA 3OCNA 4ETXA 4EUVA 1IOUA 3ICYA 2KLIA 4EERA 3UB8A 4GJ4A 1TS8A 4ARZB 4KUOA 3MFXA 1DP6A 2VEAA 4ME4A 2PD7A 4BJPA 3KYQA 2DMWA 3KO6A 3UB6A 3UMDA 1S66L 1OTDA 1XFNA 2HJ9C 3DBAA 3T4TA 3C2WA 1DP8A 4JGPA 1V9ZA 3LICA 4I38A 5LBRA 4B9OA 3LIBA 3E4PA 4R3AA 3LR5A 5HSQA 3P01A 1OT9A 4G3WA 2IA2A 1VHMA 3PBNA 4IUKA 5HWVA 3FPWA 3HJKA 5MC7A 3KSHA 3BJNA 2M7UA 2D02A 1G28A 1TD5A 4O0PA 4WELA 4NEED 1S4SA 3BWLA 3E0YA 3LR4A 3ZYTA 4MN7A 4WLAA 4Q0IA 4EXOA 2GZAA 1T1CA 4HJ6A 4R6LA 3BY8A 3CUEC 3D3OA 3T4SA 2INWA 2Y79A 3NHQA 4WEKA 4HH2A 1NRJA 1IFQA 3F1NB 4GS9A 3ULFA 4PAUA 4DJ2A 4PKYG 4RQ9A 3TE8A 4AFIA 2VZWA 2J3TD 4G3VA 4YNRA 2O9CA 1VB6A 4HP4A 5DJTA 3OLOA 2JKRI 4GHIB 4E04A 4I3AA 3MQQA 5G4YA 3EEHA 4LLOB 3VE3A 1G6OA 3OCLA 5L8MA 4JGRA 2QHKA 4HJ3A 3CUEA 2JKTI 3UE3A 4FOFA 3H7WB 3LYXA 3PBQA 3CITA 3H7WA 1D06A 5HD5A 2A24B 4K08A 1F9IA 1Y28A 2R78A 1XJ3A 3MQOA 4ETZA 3OOVA 1XJ4A 3E4QA 3UMEA 4EETB 5G4ZA 1H8MA 4UEYA 4HJ4A 4I3IA 4IJGA 1P0ZA 3C8CA 3T4KA 2L4RA 4Q0HA 4XT2B 2P08A 4I3JA 3CLOA 3S7OA 4F3LB 2JKRM 4XT2A 2W3GA 2PR6A 2P7JA 5HZHA 1W63Q 5FL3A 5J7EA 2VGLM 4YOFA 3KSIA 2XRNA 3PBSA 4P6ZM 5KIZA 4II7A 4HH3A 5I5LA 2V1BA 3EOIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J4E A;  2V0U A;  1TS0 A;  2JHE A;  2PD7 A;  1OTA A;  3H82 A;  4EEU A;  2K7S A;  3BY9 A;  3MR0 A;  4GW9 A;  3UB6 A;  2KX6 A;  3UMD A;  4F3L A;  1S66 L;  1GSW A;  1OTD A;  1XFN A;  2A24 A;  3FC7 A;  5HDS A;  1GSV A;  5DKL A;  5HWW A;  3C2W A;  2W0N A;  4BBU A;  3LID A;  1DP8 A;  4JGP A;  1V9Z A;  3KX0 X;  5F69 A;  3E4O A;  1OT6 A;  3F1O A;  1V9Y A;  2WKP A;  1DP9 A;  1D7E A;  2V0W A;  3LIC A;  4I38 A;  5A8B A;  2L0W A;  4L9E A;  3LIB A;  2I9V A;  4R38 A;  4B9O A;  3E4P A;  3GDI A;  4R3A A;  3PHY A;  5HSQ A;  4L9G A;  3NOT C;  4EW7 A;  1OT9 A;  2PD8 A;  2QWS A;  2VV7 A;  3RTY A;  4GHI A;  1S4R A;  3UB7 A;  1UGU A;  4BBT A;  1OTB A;  5F68 A;  1P97 A;  2KDK A;  2QJ5 A;  4KUK A;  3RH8 B;  5HWV A;  4R70 A;  1EW0 A;  1UWP X;  2YKF A;  2PDR A;  3FG8 A;  2PYP A;  3HJK A;  4HHD A;  4HIA A;  3UB9 A;  2D02 A;  1S1Y A;  3A0V A;  1G28 A;  3LI8 A;  1GSX A;  3VE3 A;  2PHY A;  1JNU A;  1S4S A;  3BWL A;  2CMN A;  3ZQ5 A;  4HP9 A;  2VV8 A;  3LIE A;  4WL9 A;  4LRZ E;  2HV1 A;  4WLA A;  3H9W A;  4NXB A;  1XJ2 A;  3H82 B;  2OWJ A;  1TS7 A;  2EA9 A;  2QJ7 A;  4LRY C;  5J3W A;  3UE6 A;  1KOU A;  3VE4 A;  4EXO A;  4HI4 A;  1T1C A;  1OTI A;  4HJ6 A;  3LIA A;  1NWZ A;  3BY8 A;  4R6L A;  3GEC A;  2INW A;  2PYR A;  3K3D A;  4H6J A;  4HNB A;  1S1Z A;  2D01 A;  3NHQ A;  2WKR A;  4GCZ A;  4NXE A;  4H6J B;  4WN5 A;  3MXQ A;  4HH2 A;  1ODV A;  1TS6 A;  3SW1 A;  3NJA A;  4MN5 A;  1UWN X;  2VV6 A;  3MJQ A;  3F1N B;  4GS9 A;  5HD3 A;  2W27 A;  4JGO A;  3ULF A;  4DJ2 A;  4PKY G;  2V9A A;  4DJ3 A;  4KQD A;  1S67 L;  1BYW A;  4WF0 A;  5F5Y A;  3A0S A;  4YWZ A;  2VLG A;  1OJG A;  4RQ9 A;  1N9O A;  1DRM A;  3NOP C;  3CAX A;  1VB6 A;  3CWF A;  4LRX C;  4HP4 A;  5DJT A;  3OLO A;  4I39 A;  1T1A A;  5AVE A;  4EEP A;  4GHI B;  4LPZ A;  4I3A A;  4E04 A;  3LUQ A;  3MQQ A;  5G4Y A;  3EEH A;  4LLO B;  1N9L A;  1LSX A;  1LSW A;  1OTE A;  3B33 A;  1WA9 A;  3EWK A;  1OJ5 A;  3HJI A;  4JGR A;  1X0O A;  2ZOH A;  4HQA A;  2QHK A;  3F1P B;  4HJ3 A;  4WUJ A;  4EES A;  3D72 A;  3IBR A;  3P7N A;  3A0R A;  3F1P A;  3H7W B;  5DKK A;  5IS1 A;  3LYX A;  1XFQ A;  3PYP A;  3F1N A;  3LI9 A;  3H7W A;  1D06 A;  2L1M A;  2A24 B;  2WKQ A;  4K08 A;  1F9I A;  5HD5 A;  1Y28 A;  2Z6C A;  2R78 A;  1LT0 A;  1XJ3 A;  3MQO A;  5DJU A;  2YKH A;  1XJ4 A;  3E4Q A;  3F1O B;  3UME A;  5TBM B;  4EET B;  2V1A A;  5G4Z A;  3LIF A;  5AVF A;  4HJ4 A;  1T19 A;  4I3I A;  1LL8 A;  1LSV A;  4NXG A;  1F98 A;  1P0Z A;  2H28 A;  3C8C A;  5EFW A;  2ZBB A;  2L4R A;  2QKP A;  5IU1 A;  4HY8 A;  4XT2 B;  3G6O A;  1N9N A;  3IS2 B;  3CLO A;  1T1B A;  4I3J A;  3T50 A;  4F3L B;  2JN7 A;  4M4X A;  4XT2 A;  2BAS A;  5HDD A;  2J80 A;  2OOL A;  2PR5 A;  2PR6 A;  3IS2 A;  5HDC A;  3VOL A;  3K3C A;  2OWH A;  2P7J A;  5HZH A;  4L9F A;  4NXF A;  2ZOI A;  5HWT A;  1T18 A;  4I5S A;  1MZU A;  2B02 A;  4JGQ A;  5F6A A;  4BBV A;  2M1C A;  3ICY A;  5J7E A;  4GS9 B;  2GJ3 A;  4HOI A;  4EER A;  4EQ1 A;  5KIZ A;  4PKY A;  3NOU C;  4MN6 A;  3UB8 A;  5TBM A;  1TS8 A;  4HH3 A;  2V1B A;  5I5L A;  2Z6D A;  4KUO A;  3MFX A;  1XJ6 A;  1DP6 A;  2VEA A; 
#chains in the Genus database with same CATH topology
 1ES5 A;  1OTA A;  3H82 A;  2ZC6 B;  4Y2F A;  4CLC E;  1PNE A;  2W3H A;  2WKH A;  2W1R A;  4EW7 A;  4UAA A;  4KUK A;  3N7W A;  3PBO A;  4Y17 A;  2EWV A;  2O0Y A;  1KGG A;  3G35 A;  4QU3 A;  3VFH A;  4CPK A;  2HF6 A;  3MZE A;  2VV8 A;  1KGE A;  3O86 A;  3H82 B;  3B47 A;  1PI4 A;  1NWZ A;  4N9L A;  4E3M A;  1Q2Q A;  2D01 A;  3GSG A;  3UO9 A;  4PM7 A;  4H6J B;  4IVI A;  2XR0 A;  4O8G A;  2EWW A;  3GQZ A;  1ZC2 A;  4UQI S;  3BQA A;  4X25 A;  2Y59 A;  1CEF A;  3C5A A;  4EES A;  3C4O A;  2W1T A;  3VP0 A;  1PYY A;  5AQA A;  4JXW A;  1NJ4 A;  4ZJ3 A;  4BWI A;  3DTE A;  2Y91 A;  3FKV A;  4RX3 A;  1EWZ A;  2ZJ9 A;  4M4X A;  1KVL A;  4WZ4 A;  1LLB A;  3MBZ A;  3IH9 A;  4JF4 A;  5CER A;  1PI5 A;  1TS0 A;  4IBR A;  3EQU A;  5GLA A;  2X02 A;  4GW9 A;  4KG6 A;  1QME A;  3AGD A;  4BBU A;  3PBT A;  3KX0 X;  2Y8H A;  3GDI A;  4MLL A;  4Q0J A;  2PD8 A;  5GLC A;  3IF6 C;  1WE4 A;  3RH8 B;  3BYD A;  3S7P A;  2YKF A;  1BLP A;  5FI2 A;  2K2N A;  3UB9 A;  3IH8 A;  2XGN A;  3RFB A;  3GR2 A;  4N9K A;  2WKI A;  3OPH A;  5CGW A;  2WUQ A;  3VOY A;  4OPQ A;  4KQO A;  2PRF A;  3LY3 A;  1PZO A;  2HJE A;  1KE3 A;  4C75 A;  2V8F A;  5L09 A;  1TEM A;  3IX3 A;  4Y0T A;  2PYR A;  1ZKJ A;  2PT7 A;  5FAQ A;  4GCZ A;  4R1G A;  1ESU A;  3MXQ A;  4EUZ A;  5FA7 A;  1Z6F A;  4JGO A;  1RP5 A;  4X53 A;  2V9A A;  4UA9 A;  2VLG A;  1BUE A;  3CWF A;  1O07 A;  5AVE A;  1K6S A;  3VOZ A;  4UHU A;  1PIO A;  2Q0O A;  1FCN A;  3F1P A;  4K0X A;  1KGF A;  4QWO A;  5GHZ A;  1L0F A;  4S2K A;  3SS4 A;  1SKF A;  1AXB A;  2DNS A;  1ERQ A;  3IWO A;  1XKZ A;  3DTI A;  3V3R A;  4IHQ A;  1F2K A;  2BAS A;  4Y7P A;  4OKP A;  3SS5 A;  2B02 A;  3EGX C;  3CMZ A;  2ZC7 A;  5HW3 A;  5TBM A;  5E2H A;  1XGI A;  1ALQ A;  2V0U A;  1BSG A;  1BLS A;  2KX6 A;  1SKO A;  3TW8 A;  1YSP A;  1K4F A;  2WZX A;  3NBL A;  3TOI A;  1DP9 A;  5A93 A;  1H0M A;  2I9V A;  3HUN A;  2P9V B;  1K0K A;  1Y54 A;  3V50 A;  3JVU A;  3UE0 A;  2JE5 A;  2JKT M;  5F68 A;  2KDK A;  1L3L A;  3CG5 A;  3BW6 A;  2B5R A;  3WS4 A;  4JXV A;  1ZTU A;  4BMW A;  2ZMV A;  5FAT A;  4OLD A;  4KG2 A;  3ZDJ A;  4WBG A;  1DY6 A;  3VE4 A;  1YLT A;  3MZF A;  2O9A A;  3A3I A;  3NUL A;  1MWU A;  4B88 A;  3VSL A;  1FSY A;  3VV4 A;  4JXS A;  1CEG A;  3ZFZ A;  3A3D A;  1TVF A;  1K54 A;  3C7U A;  5G18 A;  5M19 A;  4BQM A;  3NOP C;  1ZG6 A;  5FAP A;  1N9L A;  2FZ0 A;  2J7V A;  3B33 A;  3T1X A;  4D2O A;  3E2L A;  5EEC A;  2Z2L B;  4S2L A;  3A0R A;  5IS1 A;  1FCM A;  2R9X A;  4P6Z S;  4WMC D;  1P9W A;  1NY0 A;  5EFW A;  2Y55 A;  3FKW A;  1T1B A;  3IS2 A;  1MC0 A;  2PR5 A;  3K3C A;  5FI7 A;  1P9R A;  3FV7 A;  3OCN A;  4ARZ B;  2Y2J A;  3MFX A;  1K55 C;  4ME4 A;  3CJM A;  3RXW A;  2DMW A;  1S0W A;  2HJ9 C;  4LEN A;  2QPN A;  5E2F A;  4ZTK A;  3G4P A;  5LBR A;  4DDY A;  3LIB A;  5CTN A;  3IWQ A;  1QMF A;  3RJU A;  5CGX A;  3QP5 A;  4FUW A;  4N1H A;  3VP2 A;  2IA2 A;  3PBN A;  3FPW A;  2WAE A;  2DRW A;  1K55 A;  4LV2 A;  1YPR A;  1TD5 A;  2XLN A;  4WEL A;  3ZYT A;  4MN7 A;  2Y4A A;  1K25 A;  2GDN A;  4Q0I A;  2GZA A;  4XXR A;  1G68 A;  2H0T A;  3T4S A;  4JPM A;  5GLD A;  1GCE A;  4MNR A;  4DE1 A;  3O87 A;  4GB7 A;  1IFQ A;  1JWP A;  4S2N C;  4PKY G;  3CPT B;  4AFI A;  3TE8 A;  2VZW A;  2ZQ8 A;  1HVB A;  5DJT A;  3W4O A;  5G4Y A;  4LLO B;  3VE3 A;  3IX4 A;  5L8M A;  3QP2 A;  4MBF A;  4O7D A;  3CUE A;  3PTE A;  3G2Z A;  1LI9 A;  5KSC A;  3LGO A;  3T1R A;  1F9I A;  4X1L A;  4E6X A;  2HP6 A;  2R78 A;  1XJ3 A;  1XJ4 A;  1YMX A;  3D4F A;  5F1G A;  2ZLY A;  3T4K A;  4KZ6 A;  2L4R A;  4XT2 B;  3ZGA B;  3S7O A;  4BEN A;  2JKR M;  2C6W B;  3ZHH A;  2P7J A;  4BL3 A;  5FL3 A;  4U3T A;  3W4P A;  2V1B A;  3EOI A;  3JPU A;  4PM9 A;  2Y2Q A;  3GTC A;  3KSG A;  2VX8 A;  3KYE A;  2W3F A;  5A8B A;  2L0W A;  4L9E A;  2XFS A;  1ES4 A;  3MS6 A;  5K5B A;  4R70 A;  4RX2 A;  2WGV A;  4HHD A;  3JVV A;  1S1Y A;  3B3X A;  1ACF A;  1K6R A;  3EGD C;  1H8Y A;  1IKG A;  3CI6 A;  2Y2O A;  4KZ5 A;  1K38 A;  2ZQC A;  4H6J A;  3HRE A;  3VP1 A;  4ZRR A;  3WRZ A;  3LR3 A;  1LL9 A;  2WK0 A;  4MN5 A;  4Y5F A;  3MJQ A;  4FD8 A;  4L0L A;  3T12 B;  3IWI A;  3BM6 A;  3GV9 A;  4CLC C;  1Q2P A;  1ZG4 A;  2FFF B;  4X6T A;  4Y13 A;  3QNB A;  5IU1 A;  3G2Y A;  3Q1F A;  2BG1 A;  2J9P A;  2W1T B;  5FQI A;  4GKU A;  2IWD A;  3WS1 A;  5EM1 A;  2YKH A;  4MBK A;  5FI6 A;  3LY4 A;  5TBM B;  4KZ3 A;  5M1A A;  3VP4 A;  2JN7 A;  4KQR A;  1J9M A;  5GL9 A;  1K4E A;  1OME A;  3PBR A;  1K56 A;  3N8R A;  4HOI A;  2P9V A;  3NDG A;  4DE2 A;  1KVM A;  2JHE A;  2OSU A;  3P09 A;  1BZA A;  4EEU A;  4GOG A;  4F3L A;  3FC7 A;  1K57 A;  1YLY A;  5F69 A;  1V9Y A;  2XF3 A;  3HVF A;  4R3J A;  1O7E A;  3KSF A;  1F5M A;  4MBH A;  3BFF A;  5EVI D;  4E3O A;  4QJG A;  1WYC A;  2HDU A;  4L9G A;  3BRM A;  2QWS A;  1JWZ A;  3A3E A;  1FR6 A;  3HLG A;  2J3W A;  4WZ5 C;  4R0Q A;  5FEF A;  3DTM A;  3NCK A;  3NEC A;  3G31 A;  4S2O A;  4WL9 A;  3H9W A;  3QP6 A;  4FCF A;  4NG2 A;  2OWJ A;  4LRY C;  4P87 A;  3TG9 A;  3GEC A;  4PM5 A;  4PM8 A;  2ZM8 A;  5A92 A;  2HGV A;  1IYQ A;  4F94 A;  2VV6 A;  2W27 A;  3OC2 A;  1ONH A;  4YWZ A;  2VGL S;  4BLM A;  2W3E A;  3OZH A;  5EVL A;  1MWT A;  2XK1 A;  3OBF A;  1BTL A;  4QB8 A;  3F1P B;  4IED A;  1GHI A;  1XFQ A;  4QY6 A;  1EI5 A;  2L1M A;  2NUT C;  2CC1 A;  5DJU A;  3N6I A;  5AVF A;  4MMN A;  4OPY A;  3OPL A;  1MWR A;  2OWH A;  4L9F A;  2ZL1 B;  2VA0 A;  2EX9 A;  5EM0 A;  4BBV A;  1I2W A;  3PAE A;  4EQ1 A;  4GZB A;  1PFL A;  3S1Y A;  1FIL A;  3WS0 A;  3L7H A;  3Q7Z A;  4Y0O A;  5M18 A;  2VGJ A;  2A3U A;  3BLS A;  2JC7 A;  5HL1 A;  1GSV A;  5DKL A;  5CEB A;  2WGW B;  1E4D A;  1PWG A;  5C5K A;  1DJB A;  3MMH A;  2OAP 1;  3W8K A;  1P97 A;  3PR6 A;  2QJ5 A;  2ZL1 A;  3Q82 A;  1MY8 A;  1BLC A;  2CMN A;  2JBF A;  3IXG A;  1GA9 A;  3SH9 A;  1LI0 A;  4NXB A;  4OON A;  1K56 D;  1KE0 A;  1W63 M;  5TGF A;  5F83 A;  2HZ5 A;  1H3Q A;  4QHC A;  1I2S A;  3NIA A;  4OLG A;  5HD3 A;  1HTZ A;  4KQD A;  1TF1 A;  2Q9M A;  1K54 C;  2Y2K A;  4MDZ A;  2V20 A;  2XDM A;  3GMW A;  3ZG5 A;  4HBT A;  4DDS A;  2M7V A;  5HPF A;  1LSW A;  2WZZ A;  3SH8 A;  4HQA A;  1CJF A;  3GRJ A;  1IEL A;  2XA7 S;  1NRF A;  2OAQ 1;  5FSR A;  3TJZ C;  2PAV P;  5F82 A;  1LL5 A;  1PWD A;  4Z9Q A;  2ZQD A;  3MSH A;  1MKM A;  3NDE A;  3R7W A;  4NXG A;  1F98 A;  1KE4 A;  3MQ0 A;  5JYP A;  4LCL A;  1TDL A;  3IS2 B;  3T50 A;  3T4O A;  3K2N A;  2I72 A;  3PXP A;  3W2Z A;  5HWT A;  3P98 A;  4ETX A;  4EUV A;  3ICY A;  4EER A;  3UB8 A;  1IEM A;  2PD7 A;  3BFG A;  3IQA A;  4P0M A;  3KO6 A;  3UMD A;  1OTD A;  2Y2N A;  3WWX A;  1JTD A;  3HLB A;  3C2W A;  4JGP A;  5CEC A;  4ESP A;  4I38 A;  4X69 A;  1JWV A;  5HSQ A;  3OPP A;  1OT9 A;  4G3W A;  4EQI A;  3M6H A;  5FAO A;  3WS5 A;  5JYO A;  4PPR A;  3HJK A;  3KSH A;  3BJN A;  4S2N A;  3ZG9 B;  1HZO A;  2M7U A;  3TSG A;  1XPB A;  4FTX A;  2ZM0 A;  4DF6 A;  3DWK A;  1G5U A;  1MXO A;  2G2W A;  5GLB A;  1CQA A;  2XD5 A;  4OP5 A;  3MKE A;  2WAF A;  1W7F A;  4GS9 A;  2AVX A;  4PMA A;  2QZ6 A;  4G3V A;  3QHY A;  4LCM A;  4QY5 A;  1E25 A;  5FQK A;  4JKT A;  1VEU A;  3LCE A;  2JKR I;  4I3A A;  3N4I A;  3OCL A;  4NET A;  1G6A A;  2V8C A;  2JKT I;  3UE3 A;  4FOF A;  4XUZ A;  4NK3 A;  5FQ9 A;  3PBQ A;  1N4O A;  3CIT A;  3H7W A;  2A24 B;  1MPL A;  3MQO A;  3OOV A;  4KZ9 A;  3UME A;  1CI9 A;  1NYY A;  5D3O A;  4I3J A;  3CLO A;  5CGS A;  4F3L B;  2ZQ7 A;  2PR6 A;  4KEN B;  5HZH A;  5FQM A;  2WYX A;  3BLM A;  2VGL M;  4YOF A;  2XRN A;  3FZC A;  3PBS A;  5KIZ A;  1BUL A;  5I5L A;  4S2P A;  4Y15 A;  1M40 A;  4KZ8 A;  2K7S A;  5HL6 A;  3MR0 A;  5HAI A;  4DKI A;  2A24 A;  5HDS A;  1OT6 A;  3DTK A;  2PU2 A;  1W5D A;  3CZD A;  2VV7 A;  1S4R A;  4ZBE A;  3BFC A;  4S2M A;  4OPZ A;  1E3U A;  3ZCZ A;  4U0X A;  3G34 A;  2WAD A;  3S4X A;  3QP4 A;  4X68 A;  5KSH A;  3Q07 A;  4RYE A;  4OPR A;  2EA9 A;  4IUH A;  1OTI A;  4B4X A;  3T1S A;  3UPO A;  1ODV A;  1TS6 A;  2E8J A;  4GNU A;  4OQI A;  5DTK A;  4P85 A;  1YM1 A;  2GX5 A;  1SDE A;  4LRX C;  4EEP A;  3EWK A;  5EOO A;  5AQ7 A;  2FH5 A;  2O99 A;  4U0T A;  3F1O B;  2EX2 A;  1M6K A;  1HLU P;  3LIF A;  1L2S A;  3A3J A;  2ZBB A;  5HAR A;  4E6W A;  4PHT A;  4G3K A;  2J80 A;  3O3V A;  5CRF A;  4LGW A;  4C3Q A;  2WGW A;  1CK3 A;  4EBP A;  4PKY A;  5GHY A;  2RCX A;  1Y4O A;  1XJ6 A;  3FG8 A;  3MZD A;  4R23 A;  4ZJ1 A;  4EU0 A;  3EQV A;  3MF0 A;  4WEJ A;  3HUM A;  3S7N A;  4MCW A;  2XSS A;  3F1O A;  2V0W A;  1D7E A;  4OQ0 A;  2HP5 A;  1SHV A;  1ONG A;  3PHY A;  5HAQ A;  4GDB A;  2J8Y A;  4GHI A;  3UB7 A;  2Y2L A;  2PU4 A;  3B42 A;  4O01 A;  3IBJ A;  3SOI A;  2UWX A;  4OVD A;  2PDR A;  3ZG0 A;  1PRQ A;  5L2F A;  3UY6 A;  4JF5 A;  4D60 A;  1GSX A;  5TR7 A;  2PHY A;  5EV0 A;  4KZ4 A;  4HP9 A;  4LRZ E;  1XXM A;  1XJ2 A;  1GHP A;  4K91 A;  1PW8 A;  2QMI A;  3E2K A;  1ES3 A;  2VJW A;  2XD1 A;  4ARZ A;  3V3S A;  3ITB A;  4HNB A;  3IF5 A;  1BLH A;  4WN5 A;  3NJA A;  5EVI A;  4KG5 A;  1S67 L;  1XA1 A;  4OOL A;  3IF6 A;  3CAX A;  4I39 A;  5CHU A;  3HBR A;  1NZU A;  1OJ5 A;  4LV1 A;  5BOH A;  4WUJ A;  2ZC4 B;  2V2F F;  5CHJ A;  4M3K A;  1MKI A;  2HDR A;  1MBL A;  1YAX A;  4OH0 A;  3UPN A;  4EWF A;  3MXS A;  3LEQ A;  1VM1 A;  4JBF A;  3UDX A;  1ES2 A;  2H28 A;  5DTT A;  2J3T C;  2Y2G A;  1N9N A;  3ITA A;  5CX7 A;  4X55 A;  4CQH A;  3IHB A;  2M1C A;  4E3I A;  5IT5 A;  3V5M A;  3ZG8 B;  3G32 A;  3NOU C;  1DJA A;  4X1M A;  4HIA A;  2NUP C;  3FPV A;  3HLD A;  4P6B A;  2H10 A;  2GNX A;  5HWW A;  1D1J A;  3E4O A;  3O5Y A;  5A90 A;  4R3B A;  3RTY A;  3N8S A;  1UGU A;  3M2K A;  4CLC B;  2EX6 A;  4Y3I A;  3A0V A;  1U60 A;  2H0Y A;  4CLC D;  1DJC A;  1XP4 A;  2LB9 A;  3DWZ A;  1TS7 A;  4BD1 A;  3BFE A;  3LIA A;  2ZMA A;  1IYP A;  3R4K A;  1IYS A;  1S1Z A;  2WKR A;  5DTS A;  2VKS A;  2JCH A;  4CLC A;  1YLP A;  3SH7 A;  1N9O A;  3U2A A;  4H8R A;  2LB5 A;  3UDF A;  2Y2I A;  1WA9 A;  2FFY A;  3HJI A;  1X0O A;  2XQZ A;  4JLF A;  3VFF A;  3S22 A;  4MEZ A;  2ZQ9 A;  4FSF A;  5IHV A;  2WKQ A;  2Z6C A;  2G2U A;  4X56 A;  4E3L A;  2IWB A;  1VET B;  1T19 A;  4IBX A;  5DF9 A;  4DMZ A;  2ZQA A;  1SDN A;  2QKP A;  1FR1 A;  2X01 A;  5HDD A;  3ISG A;  2OOL A;  3MFD A;  3T1Q B;  3TRC A;  4CJN A;  1OPX A;  4DE0 A;  2BLS A;  3M6B A;  4QD4 A;  4WM9 A;  3ZNY A;  4GJ4 A;  1TS8 A;  4KUO A;  1DP6 A;  3C7V A;  3D9Y A;  3JYI A;  4BJP A;  3G30 A;  3WRT A;  1S66 L;  1XFN A;  3Q7V A;  1DP8 A;  4GD8 A;  3FYZ A;  2R9W A;  3E4P A;  3LR5 A;  3P01 A;  2ZM2 A;  3FWL A;  1VHM A;  3VP3 A;  1GHM A;  4OQG A;  2D02 A;  1G28 A;  3A3F A;  1IYO A;  4O0P A;  5AQB A;  4NEE D;  1S4S A;  3E0Y A;  1RGZ A;  5E43 A;  1L0E A;  4WLA A;  3SZT A;  2XFT A;  2EX8 A;  4HJ6 A;  3BY8 A;  3CUE C;  3D3O A;  3Q7V B;  2INW A;  3L9K A;  3HLF A;  1HD8 A;  2EFX A;  4WEK A;  1ERO A;  3VMA A;  5EE8 A;  4JF6 A;  4DJ2 A;  3AGE A;  3UPP A;  4RQ9 A;  3IXH A;  1NYM A;  5KMW A;  1VB6 A;  2IWC A;  1G6O A;  4DXB A;  5DF8 A;  2QHK A;  2VK3 A;  3H7W B;  1D06 A;  1Y28 A;  3IXD A;  4ETZ A;  3NI9 A;  4EET B;  3E4Q A;  2UV0 E;  1H8M A;  4UEY A;  4I3I A;  4IJG A;  2P08 A;  1NZO A;  3BFD A;  3ZNT A;  4KZB A;  1W63 Q;  1PWC A;  5J7E A;  3Q81 A;  1SZV A;  1VQQ A;  4YFM A;  4HEF A;  1YQS A;  1E3U D;  5J4E A;  4LFU A;  3BY9 A;  3C4P A;  1CF0 A;  2ACG A;  5KZH A;  1GSW A;  2W0N A;  2EXA A;  2WKP A;  1PW1 A;  1NLY A;  1WYB A;  4Z1W A;  2EFU A;  3AGF A;  2P04 A;  4ID4 A;  4BBT A;  1OTB A;  1YSQ A;  4UA6 A;  4FH4 A;  4WZ5 A;  4UA7 A;  3UDI A;  2JKF A;  4ZDX A;  4HBU A;  5EVI B;  4GLQ A;  5EOE A;  4S2I A;  3NY4 A;  4R4R A;  5J3W A;  3UE6 A;  1XA7 A;  1KOU A;  4B93 A;  2ZMF A;  4HI4 A;  4S2J A;  4WYY A;  1NLZ A;  5DF7 A;  4RA7 A;  2ZD8 A;  2V1Z A;  2H5S A;  4QPR A;  1CI8 A;  1UWN X;  1W79 A;  2K31 A;  2Y2P A;  3MXR A;  5E2E A;  4DJ3 A;  4NKP A;  4OP8 A;  5EUA A;  4B4Z A;  2E8I A;  2Q9N A;  4DN0 A;  1T1A A;  4LPZ A;  3SW1 A;  3LUQ A;  1YLW A;  1OTE A;  2A49 A;  5DFX A;  1STZ A;  3ZVT A;  1TDG A;  2XEP A;  3W4Q A;  3F1N A;  3LI9 A;  3UE1 A;  1LT0 A;  3NC8 A;  2HDS A;  1GA0 A;  4GN2 A;  3S7Q A;  1YT4 A;  2XA7 M;  1LSV A;  4OOM A;  3UB5 P;  3HLE A;  2PBD P;  4HY8 A;  3VOL A;  2XH9 A;  5AJG A;  5HDC A;  2ZOI A;  4JGQ A;  3PAG A;  3CHW P;  4MN6 A;  1I5Q A;  5HX9 A;  4C6Y A;  5CXW A;  5CED A;  4LV0 A;  4Q8I A;  3LID A;  3VSK A;  3T4J A;  3V39 A;  3T4Q A;  2A2L A;  3NOT C;  5CHM A;  5FQJ A;  1J3W A;  3R7W B;  1UWP X;  1ESI A;  4A5R A;  2J9O A;  3LI8 A;  1FOF A;  1JNU A;  3QP1 A;  2PBY A;  2XRO A;  1LHY A;  1A0K A;  5L10 A;  4K0W A;  3U4L P;  2QYB A;  2HPB A;  3K3D A;  5DFY A;  4NXE A;  1KDW A;  1BYW A;  4WF0 A;  3A0S A;  4LV3 A;  3IF6 B;  2BTF P;  2B18 A;  3LFV A;  1AWI A;  1DRM A;  1NXY A;  1C3B A;  3BQ8 A;  3LR0 A;  2ZOH A;  5L07 A;  3IBR A;  5HPI A;  4PM6 A;  3WS2 A;  4BL2 A;  4N92 A;  3M2J A;  3HUO A;  3GVB A;  3N8L A;  2V1A A;  4UQI M;  1H8Z A;  1LL8 A;  3KYZ A;  4ZAM A;  3G6O A;  3MKF A;  1YLZ A;  5AQ9 A;  2OV5 A;  4NXF A;  1MZU A;  1ZHH B;  5F6A A;  4GS9 B;  2GJ3 A;  1KDS A;  5FQQ A;  4ZJ2 A;  4DRT A;  2Z6D A;  3UN7 A;  3LO7 A;  3C38 A;  4BD0 A;  1W8Y A;  1YKD A;  3RXX A;  1VEU B;  5FEG A;  3T4L A;  3OPR A;  2OLU A;  3C30 A;  1H5X A;  2G7U A;  4R38 A;  2KOI A;  3HCY A;  3QP8 A;  1ERM A;  4HES A;  1EW0 A;  2W3D A;  2PYP A;  2C5W B;  3ZQ5 A;  3V67 A;  3LIE A;  5TJJ A;  4E3N A;  1BT5 A;  1FCO A;  2HV1 A;  4DE3 A;  2RL3 A;  2QJ7 A;  1FSW A;  3EEA A;  4KQQ A;  1L0G A;  3HLC A;  5FDS A;  2OLV A;  2O9B A;  5F5Y A;  5FAS A;  1OJG A;  1Z09 A;  3E98 A;  2Z2M B;  5GHX A;  2X71 A;  2VGK A;  3QNC A;  1LSX A;  3D72 A;  3P7N A;  2WGI A;  5DKK A;  3PYP A;  4IVK A;  4FH2 A;  4EBL A;  1RCJ A;  1VET A;  3O88 A;  5EVI C;  5FDH A;  1PZP A;  5DVA A;  4OOY A;  2DCF A;  2WKE A;  4EBN A;  1RGY A;  2MJ6 A;  5A91 A;  3UNW A;  1T18 A;  4I5S A;  1IOU A;  2KLI A;  2P74 A;  3HLW A;  5I94 A;  3ZG7 B;  2VEA A;  2HDQ A;  3LEZ A;  3KYQ A;  1JVJ A;  4KZ7 A;  3UB6 A;  4XUX A;  4E3J A;  1YMS A;  3DBA A;  3T4T A;  5J8X A;  2ZC3 B;  1V9Z A;  3LIC A;  2ZC5 B;  4B9O A;  4R3A A;  3DAV A;  4KZA A;  5HAP A;  5EPH A;  1XGJ A;  4IUK A;  5HWV A;  1FIK A;  5MC7 A;  2Y2M A;  1SKO B;  1MWS A;  4Y0U A;  1YLJ A;  5HFO A;  4N1X A;  3LR4 A;  3BWL A;  4OQH A;  5CTM A;  3DW0 A;  1IKI A;  1SCW A;  4EXO A;  1T1C A;  3BEC A;  2Y2H A;  4R6L A;  2Y79 A;  1FQG A;  3NHQ A;  4JXG A;  2JKG A;  4HH2 A;  3IX8 A;  2B95 A;  5E2G A;  1NRJ A;  1W8Q A;  3F1N B;  3ULF A;  4PAU A;  1N9B A;  1S6R A;  1XX2 A;  3SS3 A;  2J3T D;  3CPT A;  3HL9 A;  4YNR A;  4R4S A;  2O9C A;  4HP4 A;  3ZVW A;  3OLO A;  4GDN A;  3IT9 A;  4GHI B;  4E04 A;  3MQQ A;  3EEH A;  4JGR A;  4HJ3 A;  1K57 C;  3I7J A;  3LYX A;  3IXB A;  3BEB A;  5HD5 A;  4K08 A;  4GD6 A;  4EV4 A;  5G4Z A;  4HJ4 A;  1P0Z A;  3C8C A;  4Q0H A;  5EVE A;  4YIN A;  4XT2 A;  2W3G A;  2EXB A;  2HP9 A;  4WMC A;  5F1F A;  5U47 A;  3IHA A;  4RVA A;  5TFQ A;  1JTG A;  3KSI A;  4P6Z M;  4E3K A;  4DXC A;  4II7 A;  4HH3 A;  1L0D A; 
#chains in the Genus database with same CATH homology
 5J4E A;  1OTA A;  3H82 A;  2K7S A;  3BY9 A;  5HL6 A;  3MR0 A;  1GSW A;  4Y2F A;  2A24 A;  5HDS A;  3KSG A;  2VX8 A;  2W0N A;  2W3F A;  4CLC E;  1OT6 A;  2WKP A;  5A8B A;  1NLY A;  2L0W A;  4L9E A;  4Z1W A;  2W3H A;  2W1R A;  4EW7 A;  5K5B A;  2P04 A;  2VV7 A;  1S4R A;  4BBT A;  1OTB A;  1YSQ A;  4KUK A;  4R70 A;  3PBO A;  2EWV A;  2O0Y A;  4HHD A;  3JVV A;  1S1Y A;  5KSH A;  2HF6 A;  4GLQ A;  2VV8 A;  3EGD C;  3H82 B;  3CI6 A;  2EA9 A;  3B47 A;  5J3W A;  3UE6 A;  1KOU A;  4B93 A;  2ZMF A;  4HI4 A;  4IUH A;  1OTI A;  1NWZ A;  1NLZ A;  4H6J A;  2D01 A;  4QPR A;  4ZRR A;  4H6J B;  1ODV A;  1TS6 A;  3LR3 A;  4MN5 A;  1UWN X;  4Y5F A;  3MJQ A;  2K31 A;  4L0L A;  4DJ3 A;  4NKP A;  4CLC C;  4O8G A;  2EWW A;  2GX5 A;  4LRX C;  4UQI S;  4DN0 A;  1T1A A;  4EEP A;  4LPZ A;  3SW1 A;  3BQA A;  3LUQ A;  1OTE A;  5IU1 A;  3EWK A;  5DFX A;  1STZ A;  4EES A;  2W1T B;  2FH5 A;  2W1T A;  3F1N A;  3LI9 A;  2O99 A;  1LT0 A;  4BWI A;  2YKH A;  3F1O B;  5TBM B;  3LIF A;  3S7Q A;  2XA7 M;  1LSV A;  4OOM A;  2ZBB A;  4HY8 A;  4PHT A;  4G3K A;  2JN7 A;  4M4X A;  3VOL A;  2J80 A;  5AJG A;  5HDC A;  3PBR A;  2ZOI A;  4JGQ A;  4HOI A;  4PKY A;  4MN6 A;  3FG8 A;  1XJ6 A;  4EU0 A;  1TS0 A;  2JHE A;  3EQU A;  3EQV A;  3MF0 A;  4EEU A;  4WEJ A;  4GW9 A;  4F3L A;  3FC7 A;  4BBU A;  3LID A;  3S7N A;  3PBT A;  3KX0 X;  4MCW A;  5F69 A;  3T4J A;  2XSS A;  3F1O A;  1V9Y A;  2V0W A;  1D7E A;  3T4Q A;  3KSF A;  2A2L A;  1F5M A;  2Y8H A;  3GDI A;  3PHY A;  4L9G A;  3NOT C;  4Q0J A;  2PD8 A;  2QWS A;  4GHI A;  3UB7 A;  4O01 A;  3B42 A;  3IBJ A;  3RH8 B;  3R7W B;  3S7P A;  1UWP X;  2YKF A;  2PDR A;  2J3W A;  2K2N A;  3UB9 A;  3LI8 A;  1GSX A;  3RFB A;  2PHY A;  1JNU A;  4HP9 A;  4WL9 A;  4KQO A;  4LRZ E;  2XRO A;  3H9W A;  1XJ2 A;  2OWJ A;  2HJE A;  4LRY C;  2QYB A;  2VJW A;  4ARZ A;  3GEC A;  4HNB A;  2PYR A;  3K3D A;  2PT7 A;  5DFY A;  4GCZ A;  4NXE A;  2HGV A;  4WN5 A;  3MXQ A;  3NJA A;  2VV6 A;  2W27 A;  3OC2 A;  4JGO A;  2V9A A;  1S67 L;  1BYW A;  4WF0 A;  4YWZ A;  2VGL S;  3A0S A;  2VLG A;  2B18 A;  3LFV A;  4OOL A;  1DRM A;  2W3E A;  3CAX A;  3CWF A;  3OBF A;  5AVE A;  3BQ8 A;  4I39 A;  3LR0 A;  1OJ5 A;  2ZOH A;  3F1P B;  4WUJ A;  3IBR A;  3F1P A;  1XFQ A;  1YAX A;  5HPI A;  2L1M A;  2NUT C;  5DJU A;  2V1A A;  4UQI M;  5AVF A;  1LL8 A;  2H28 A;  3KYZ A;  2J3T C;  4MMN A;  3G6O A;  1N9N A;  4IHQ A;  5CX7 A;  2BAS A;  2OWH A;  4CQH A;  4L9F A;  4NXF A;  2VA0 A;  1MZU A;  2B02 A;  3EGX C;  1ZHH B;  5F6A A;  4BBV A;  2M1C A;  4GS9 B;  2GJ3 A;  4EQ1 A;  5IT5 A;  3NOU C;  5TBM A;  2Z6D A;  4HIA A;  2NUP C;  3FPV A;  3C38 A;  2V0U A;  1YKD A;  2KX6 A;  2GNX A;  3TW8 A;  1YSP A;  3T4L A;  1GSV A;  5DKL A;  5HWW A;  3C30 A;  3E4O A;  2G7U A;  1DP9 A;  3O5Y A;  2I9V A;  4R38 A;  2KOI A;  3HCY A;  3JVU A;  5C5K A;  3MMH A;  3RTY A;  2OAP 1;  1UGU A;  4CLC B;  2JKT M;  5F68 A;  1P97 A;  3PR6 A;  2KDK A;  2QJ5 A;  3BW6 A;  1EW0 A;  2W3D A;  2PYP A;  4Y3I A;  1ZTU A;  3A0V A;  4BMW A;  2ZMV A;  4CLC D;  2CMN A;  3ZQ5 A;  3V67 A;  3LIE A;  5TJJ A;  2LB9 A;  2HV1 A;  4NXB A;  1TS7 A;  2QJ7 A;  3VE4 A;  1W63 M;  3EEA A;  3LIA A;  2O9A A;  3R4K A;  1S1Z A;  2WKR A;  1H3Q A;  3VV4 A;  2VKS A;  5HD3 A;  4KQD A;  1TF1 A;  2O9B A;  5F5Y A;  4CLC A;  1OJG A;  1N9O A;  3U2A A;  4MDZ A;  3E98 A;  3NOP C;  2LB5 A;  2M7V A;  1N9L A;  1LSX A;  1LSW A;  2FZ0 A;  3B33 A;  1WA9 A;  3HJI A;  5HPF A;  1X0O A;  4HQA A;  3D72 A;  2XA7 S;  3P7N A;  3A0R A;  5DKK A;  5IS1 A;  3PYP A;  4FSF A;  2WKQ A;  2OAQ 1;  3TJZ C;  2Z6C A;  4P6Z S;  1MKM A;  1P9W A;  1T19 A;  5DF9 A;  4NXG A;  3R7W A;  4DMZ A;  1F98 A;  5EFW A;  3MQ0 A;  2QKP A;  3IS2 B;  1T1B A;  3T50 A;  3T4O A;  5HDD A;  2OOL A;  1MC0 A;  2MJ6 A;  2PR5 A;  3IS2 A;  3K2N A;  3K3C A;  3PXP A;  3TRC A;  3W2Z A;  5HWT A;  1OPX A;  1P9R A;  1T18 A;  4I5S A;  3OCN A;  4ETX A;  4EUV A;  1IOU A;  3ICY A;  2KLI A;  4EER A;  3UB8 A;  4GJ4 A;  1TS8 A;  4ARZ B;  4KUO A;  3MFX A;  1DP6 A;  2VEA A;  4ME4 A;  2PD7 A;  4BJP A;  3KYQ A;  2DMW A;  3KO6 A;  3UB6 A;  3UMD A;  1S66 L;  1OTD A;  1XFN A;  2HJ9 C;  3DBA A;  3T4T A;  3C2W A;  1DP8 A;  4JGP A;  1V9Z A;  3LIC A;  4I38 A;  5LBR A;  4B9O A;  3LIB A;  3E4P A;  4R3A A;  3LR5 A;  5HSQ A;  3P01 A;  1OT9 A;  4G3W A;  2IA2 A;  1VHM A;  3PBN A;  4IUK A;  5HWV A;  3FPW A;  3HJK A;  5MC7 A;  3KSH A;  3BJN A;  2M7U A;  2D02 A;  1G28 A;  1TD5 A;  4O0P A;  4WEL A;  4NEE D;  1S4S A;  3BWL A;  3E0Y A;  3LR4 A;  3ZYT A;  4MN7 A;  4WLA A;  4Q0I A;  4EXO A;  2GZA A;  1T1C A;  4HJ6 A;  4R6L A;  3BY8 A;  3CUE C;  3D3O A;  3T4S A;  2INW A;  2Y79 A;  3NHQ A;  4WEK A;  4HH2 A;  1NRJ A;  1IFQ A;  3F1N B;  4GS9 A;  3ULF A;  4PAU A;  4DJ2 A;  4PKY G;  4RQ9 A;  3TE8 A;  4AFI A;  2VZW A;  2J3T D;  4G3V A;  4YNR A;  2O9C A;  1VB6 A;  4HP4 A;  5DJT A;  3OLO A;  2JKR I;  4GHI B;  4E04 A;  4I3A A;  3MQQ A;  5G4Y A;  3EEH A;  4LLO B;  3VE3 A;  1G6O A;  3OCL A;  5L8M A;  4JGR A;  2QHK A;  4HJ3 A;  3CUE A;  2JKT I;  3UE3 A;  4FOF A;  3H7W B;  3LYX A;  3PBQ A;  3CIT A;  3H7W A;  1D06 A;  5HD5 A;  2A24 B;  4K08 A;  1F9I A;  1Y28 A;  2R78 A;  1XJ3 A;  3MQO A;  4ETZ A;  3OOV A;  1XJ4 A;  3E4Q A;  3UME A;  4EET B;  5G4Z A;  1H8M A;  4UEY A;  4HJ4 A;  4I3I A;  4IJG A;  1P0Z A;  3C8C A;  3T4K A;  2L4R A;  4Q0H A;  4XT2 B;  2P08 A;  4I3J A;  3CLO A;  3S7O A;  4F3L B;  2JKR M;  4XT2 A;  2W3G A;  2PR6 A;  2P7J A;  5HZH A;  1W63 Q;  5FL3 A;  5J7E A;  2VGL M;  4YOF A;  3KSI A;  2XRN A;  3PBS A;  4P6Z M;  5KIZ A;  4II7 A;  4HH3 A;  5I5L A;  2V1B A;  3EOI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...