1LSXA

Crystal structure of the methylimidazole-bound bjfixl heme domain
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
116
structure length
116
Chain Sequence
b'DAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRYRTTSDPHIIGIGRIVTGKRRDGTTFPMHLSIGEMQSGGEPYFTGFVRDLTEHQQTQARLQEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sensor protein FixL
publication title Structure-based mechanism of O2 sensing and ligand discrimination by the FixL heme domain of Bradyrhizobium japonicum
pubmed doi rcsb
source organism Bradyrhizobium japonicum
molecule tags Transferase
total genus 30
structure length 116
sequence length 116
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2002-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1lsxA00
3UB7A 1S4RA 1WA9A 5J4EA 3LI9A 3MQQA 4GS9A 4BBVA 4I3AA 3LUQA 4H6JB 3BY8A 3H82B 4GCZA 4EEUA 3HJKA 1LL8A 1T1AA 4L9FA 2R78A 5AVEA 2PD7A 2Z6CA 5IU1A 4LPZA 2PDRA 2QJ5A 3IS2B 1V9ZA 3UB9A 4B9OA 4R38A 5HZHA 2VV6A 2I9VA 2VV8A 3A0SA 1OTBA 3EWKA 3UB8A 4EEPA 4PKYA 4F3LA 2PR6A 2J80A 5HDCA 5HD5A 1OTEA 3UMDA 2A24A 4HJ6A 5I5LA 5HWVA 2VEAA 2VLGA 4E04A 3F1PB 1VB6A 3BY9A 4HY8A 3VE3A 1XJ4A 4NXGA 4XT2A 1NWZA 5A8BA 4L9EA 5DKLA 3A0VA 4RQ9A 2QWSA 2L4RA 4LRYC 1TS6A 1OTDA 4HI4A 1P0ZA 5F5YA 2WKRA 2VV7A 4KQDA 4EQ1A 2D01A 3LIEA 3LIBA 3MXQA 2PR5A 3LIDA 3F1NA 4HHDA 1OT9A 4NXFA 4GHIA 1OTIA 2GJ3A 3LIFA 1XJ2A 4R3AA 3MQOA 4HJ3A 4M4XA 1GSVA 2YKFA 4HP9A 1TS0A 4I3JA 2ZBBA 3BWLA 1S67L 3P7NA 3H9WA 1N9NA 2INWA 3GECA 4PKYG 1UGUA 3FC7A 2KDKA 1JNUA 1UWNX 3CWFA 4WF0A 4GS9B 5J7EA 1MZUA 1ODVA 4MN6A 4H6JA 4L9GA 5AVFA 2KX6A 3H7WB 1OT6A 1XJ6A 1DP8A 4GW9A 5EFWA 1BYWA 3LYXA 2V0WA 3NHQA 2OWJA 1KOUA 2L1MA 1XJ3A 2QKPA 3E4QA 4EETB 4LLOB 4R6LA 1TS7A 3K3CA 3G6OA 3GDIA 5HWWA 2JN7A 4R70A 1D06A 2Z6DA 4EW7A 2BASA 3HJIA 4HQAA 2W27A 3FG8A 1LT0A 2CMNA 2A24B 4HH2A 1S66L 3F1OB 3T50A 1T1CA 3F1PA 2QHKA 5TBMA 1G28A 1DP9A 5HDSA 5IS1A 1DRMA 3MFXA 4XT2B 3E4OA 5HD3A 5DJUA 4LRZE 5HSQA 4K08A 3ZQ5A 2V1BA 3NOPC 4I38A 1T18A 2D02A 1LSVA 1F98A 4I39A 4LRXC 2B02A 1D7EA 1LSWA 1T19A 3VE4A 4GHIB 1OJGA 2WKPA 2P7JA 3A0RA 2K7SA 4JGRA 5HDDA 3CAXA 1T1BA 3LI8A 1EW0A 4EXOA 5DJTA 2YKHA 3C2WA 4DJ3A 3IBRA 4JGQA 1N9LA 1GSWA 3H82A 4YWZA 4KUOA 1OTAA 5HWTA 2M1CA 5J3WA 3PYPA 5F6AA 3NOUC 4DJ2A 3B33A 4KUKA 1UWPX 3MR0A 2PD8A 4WLAA 3LICA 2WKQA 4HH3A 1P97A 4NXBA 3H7WA 3IS2A 3KX0X 4F3LB 2ZOIA 1TS8A 4BBUA 3VOLA 3LIAA 1N9OA 1V9YA 2H28A 1S4SA 3OLOA 3CLOA 4EESA 4JGOA 2W0NA 1X0OA 2HV1A 1XFQA 1GSXA 3E4PA 4WUJA 2V9AA 3C8CA 3D72A 4HJ4A 2EA9A 2PYRA 2PHYA 2ZOHA 3F1OA 5KIZA 5TBMB 3MJQA 4I5SA 2V0UA 5DKKA 2V1AA 3EEHA 1S1YA 4JGPA 3RTYA 2QJ7A 2JHEA 3PHYA 3UMEA 3UB6A 3NJAA 1LSXA 3F1NB 4HP4A 3NOTC 5G4ZA 3ULFA 3K3DA 4I3IA 4MN5A 1F9IA 1DP6A 3SW1A 1OJ5A 3ICYA 1XFNA 3UE6A 4BBTA 2OWHA 1Y28A 4WN5A 1S1ZA 4HNBA 4WL9A 4NXEA 4HIAA 5G4YA 5F68A 2L0WA 2PYPA 5F69A 4EERA 3RH8B 4HOIA 2OOLA
chains in the Genus database with same CATH superfamily
5KSCA 1CJFA 3UN7A 5EVEA 4DDYA 5J4EA 2PAVP 4UHUA 3G35A 3IF6A 5HX9A 3TG9A 3LUQA 4CLCA 4EEUA 1BLHA 4R0QA 2JC7A 5TFQA 3HJKA 2Z2LB 3ZDJA 4CPKA 3JVUA 4L9FA 4C6YA 5AVEA 4KG6A 1K54A 2Z6CA 1YLJA 4LPZA 1V9ZA 3P01A 4LGWA 3G32A 3BFGA 5HZHA 2VV6A 2Y2GA 3A0SA 2ZJ9A 5DFYA 3IH9A 3T4SA 5HAPA 4MBHA 4PKYA 4FD8A 1GHIA 1SHVA 2UWXA 4EWFA 3QHYA 2J3TC 2WYXA 5HWVA 2VLGA 1VB6A 2V2FF 3BY9A 5CEDA 3BFDA 1YT4A 1K6RA 4WMCD 3Q82A 1VETA 4FUWA 4XT2A 3RXWA 3GVBA 1ZKJA 4GN2A 3IF6C 4E3NA 2UV0E 4DRTA 3IBJA 4CLCC 2B18A 2QWSA 1W79A 4L0LA 1YLZA 3C5AA 1TS6A 5FA7A 3VFHA 1FR6A 2WKRA 3GRJA 2HP9A 4EQ1A 2HDSA 1K54C 3LIEA 5JYOA 2PR5A 2ZMVA 5FI2A 4GHIA 3PBRA 2ZL1A 2BLSA 2EX8A 4QB8A 3LIFA 1YQSA 1TS0A 3W2ZA 3PAEA 3A3JA 3M2JA 3P09A 3BWLA 1S67L 3ZG5A 2HZ5A 4P85A 3N8SA 4II7A 2KDKA 4B4XA 3S7OA 2G2UA 4N9LA 4U3TA 3LR0A 1L3LA 4R3BA 5TGFA 3ISGA 2JKRI 4L9GA 2EX2A 4LV3A 2ZQDA 2Y2IA 4S2KA 4ZDXA 1QMFA 4NETA 4EBLA 3OOVA 2XFTA 4GW9A 3LYXA 3TW8A 2Y2NA 3V3RA 3IF5A 3NHQA 2HP5A 1FILA 4EETB 4R6LA 3JVVA 4PM9A 3I7JA 4C75A 2ZQ8A 3GDIA 3NDEA 4ARZB 2J3TD 2VZWA 4G3VA 2Q0OA 2W27A 4HQAA 1LT0A 2O0YA 2Y8HA 2VJWA 1NLZA 4MBFA 2A24B 3FWLA 3F1OB 2XK1A 3OBFA 1T1CA 2JBFA 1MY8A 3HL9A 4GJ4A 5DTTA 1DP9A 5HDSA 4DN0A 5IS1A 2J8YA 2DRWA 5FATA 3MFXA 2JKGA 3LR3A 3KYZA 3MZFA 4IUHA 5DJUA 2XA7M 3FYZA 4CLCD 4HESA 3IWQA 4Q8IA 4WEJA 3RFBA 3L7HA 3BW6A 3NOPC 4X1MA 2WUQA 2VGJA 5EVLA 3SS5A 2W3HA 2ZM8A 1P9WA 4I39A 4Y0UA 2B02A 2EXAA 3UDFA 3VE4A 3T4TA 4MBKA 2FFFB 3B42A 2JKFA 4G3WA 5F1FA 1JWPA 3A0RA 3IX4A 2Y59A 2K7SA 3SS4A 4XUXA 4Y0TA 2OLUA 3LR4A 1XXMA 4GB7A 3HLEA 3LI8A 3S1YA 3CG5A 5EECA 1Y4OA 1ES2A 5DJTA 3S7PA 1PWCA 3O86A 4CLCB 3HLWA 4OOMA 3SH8A 4JGQA 4NG2A 1GSWA 4OQHA 2WGVA 3LEZA 1OMEA 2W1TA 1OTAA 2M1CA 4WZ5A 5J3WA 2ZQ9A 4NK3A 4Y17A 1H8ZA 5M1AA 4KUKA 2OAQ1 2PD8A 2RCXA 2XD1A 4HH3A 2IA2A 4BD0A 1ESUA 1H5XA 5TJJA 5GHZA 3ZG0A 1S0WA 3ITAA 4IBRA 4KZ6A 4LCMA 4R4SA 4E3MA 4UAAA 4GDBA 3IXDA 1N9OA 2H28A 3CLOA 2W3GA 3OPHA 3KYQA 4EESA 3E4PA 4ZTKA 1XA1A 3C8CA 4RYEA 5HPIA 1YSQA 3UPNA 3UPOA 3G30A 1SZVA 4BENA 3KSHA 2PHYA 3BQAA 4S2JA 3EQUA 4R3JA 1MXOA 1PRQA 5TBMB 2V1AA 4UQIS 1NZUA 4S2IA 2AVXA 4JGPA 2Y4AA 4X55A 4WZ5C 3SH9A 5EVID 2WZZA 4O7DA 3HUMA 2ZM0A 3CUEA 5EM0A 3FPVA 5A92A 1BZAA 3DTMA 3K3DA 3S22A 2WAEA 4MDZA 5AQAA 4PMAA 3G31A 1F9IA 1S6RA 3MF0A 1GA0A 2EX9A 3ICYA 4MNRA 3V50A 4CQHA 3VV4A 2P74A 1KE0A 4QY5A 1S1ZA 1YLTA 3ZG9B 3N7WA 3M2KA 4OLGA 1PW1A 5F69A 4EERA 3NIAA 1WA9A 1VM1A 4I3AA 3BY8A 3H82B 1CF0A 1KVLA 4KENB 3C30A 1Q2QA 4B88A 5EVIB 1A0KA 3G34A 3GQZA 1T1AA 4GD6A 5L8MA 3N4IA 1PYYA 3UE3A 4LCLA 3RJUA 3CJMA 5M18A 1J9MA 1SDEA 1RGZA 4X56A 2J9OA 2E8IA 5IU1A 4BL3A 5E2FA 3UB9A 4OP5A 1IFQA 4B9OA 3Q81A 3FKWA 3HCYA 3UB5P 4A5RA 4OP8A 4GD8A 1OTBA 3CUEC 5CTMA 1YLWA 1KGEA 4EEPA 4F3LA 1YAXA 4MMNA 5GHXA 3FPWA 4HBTA 2PR6A 2WADA 2HF6A 4D2OA 3ZCZA 3BLSA 4ARZA 2VK3A 1H3QA 4QPRA 5FAQA 2A24A 4HJ6A 5FQJA 4P87A 2VEAA 3R7WA 3Q1FA 3ZVTA 1XJ4A 2W1RA 4P6ZS 4BD1A 5A8BA 3WRZA 5DKLA 1PW8A 4RQ9A 1HLUP 4O8GA 5CHUA 2QMIA 4LRYC 1OTDA 4OPYA 3U2AA 4EUVA 4HI4A 1DJBA 1TD5A 1BLCA 5FAPA 4JLFA 3PBSA 2VV7A 2J7VA 3MXQA 3MKFA 1XGIA 2ZC7A 1IYSA 4ZBEA 1OT9A 5AQBA 3U4LP 1NJ4A 2GJ3A 2V1ZA 3G2ZA 1W63Q 4M4XA 1GSVA 4E6XA 4HP9A 1W8QA 3IWOA 4X1LA 1LHYA 3P7NA 2EWWA 3T1QB 1DY6A 2INWA 3GECA 3ZYTA 1IKGA 1SDNA 4DF6A 3NECA 1JNUA 3CWFA 5CEBA 4OPZA 2W1TB 5J7EA 2PT7A 2JKTI 5AQ7A 4GLQA 3GR2A 4P6BA 3BYDA 4E6WA 3AGDA 1AWIA 4X53A 5D3OA 4XXRA 2ZMAA 3DAVA 4JF4A 3ZG7B 1OT6A 4RX3A 2OLVA 5DFXA 4KZ3A 5EFWA 1IKIA 4S2PA 3N8RA 2V0WA 3ZNYA 5J8XA 2Z2MB 2L1MA 1XJ3A 2XLNA 1G6OA 3VOZA 3E4QA 2Y2OA 3W4PA 4K0WA 4X25A 3K3CA 1WE4A 1LLBA 5GL9A 2O99A 2Y2MA 2JN7A 1ZC2A 3HJIA 3FG8A 3W4OA 2A2LA 2QYBA 1O07A 4QJGA 4XUZA 3BRMA 4OQIA 4DE3A 1BSGA 4O01A 4NEED 4FSFA 3MBZA 4IHQA 2QHKA 5TBMA 1K38A 3E4OA 3PBNA 3HLFA 2IWDA 3QNCA 5GLBA 5EPHA 2H0TA 4LRZE 1NRJA 3ZQ5A 2GDNA 5FQ9A 4RX2A 2H0YA 4Y2FA 2WKIA 2Y91A 4LV0A 3K2NA 3OZHA 4PHTA 1LSVA 3ZHHA 4QWOA 1XKZA 3WS1A 2O9CA 1D7EA 2GX5A 4KZBA 5U47A 5CECA 3O88A 2WKPA 1IELA 4DKIA 1MKMA 3N6IA 2ZQCA 4OOLA 3M6HA 4WELA 3C38A 5HARA 2ZM2A 3Q07A 3CAXA 4UQIM 5EOOA 1EW0A 3DTIA 4EXOA 1I5QA 1RCJA 1FCOA 5CX7A 3C2WA 3VP4A 3O3VA 3ZNTA 4P0MA 1K4FA 1IEMA 2Y2KA 1N9LA 3H82A 1K4EA 3UY6A 1L0EA 4KUOA 3MSHA 5HWTA 5EVIA 3PYPA 5HFOA 3NOUC 5GHYA 3EGXC 3B33A 3IXHA 3NY4A 3ITBA 4X68A 2WKQA 3GTCA 2K2NA 1P97A 3B3XA 4YFMA 3H7WA 1MWRA 2V8FA 1IYOA 4HEFA 4F3LB 2P08A 1V9YA 3CHWP 1K57A 1S4SA 2VA0A 2W0NA 2HV1A 4B93A 1ESIA 3OCNA 3L9KA 1VEUB 3R7WB 5EE8A 3KSGA 3C7UA 2WK0A 2J9PA 3BM6A 3ZVWA 4JXSA 5KIZA 3FV7A 2V0UA 4I5SA 3RXXA 5A91A 3V39A 1EROA 3EEHA 3ZG8B 3KYEA 2QJ7A 2FH5A 2X71A 1PNEA 3ZFZA 3HLGA 4FOFA 4KZ7A 2JHEA 3PHYA 5EVIC 1NZOA 3UMEA 2Y2HA 3E2LA 1QMEA 5M19A 3NJAA 4ZRRA 3MXSA 2ACGA 1ES4A 4ME4A 3IWIA 5DF9A 3BFFA 3HUOA 4S2LA 2K31A 3TE8A 3FKVA 4WEKA 5TR7A 5A90A 4ZAMA 5CGSA 2OWHA 1SCWA 1Y28A 1K55A 4HNBA 1O7EA 4P6ZM 1K57C 3E2KA 4WL9A 3S7QA 3RH8B 5GLAA 2OOLA 3T4KA 3UB7A 3T1RA 1PWGA 3MQQA 4BBVA 3MMHA 2XEPA 2HDRA 1BT5A 4ZJ1A 2XDMA 4GCZA 3PTEA 5A93A 3HLDA 3HREA 5L09A 4IVKA 2G2WA 3NC8A 4N9KA 1LL8A 1XX2A 4Y13A 2IWBA 5F1GA 4F94A 5FI6A 2VGLS 5HAQA 2PD7A 5FQIA 2HJ9C 5F82A 2DMWA 4OKPA 2PDRA 2QJ5A 2HDQA 5FSRA 4JXGA 3OC2A 4R38A 3UDIA 1FR1A 2I9VA 2ZC3B 3WRTA 3UB8A 4BL2A 5HDCA 3G4PA 4HBUA 3KSFA 5HD5A 1OTEA 4QD4A 2EWVA 2ZMFA 4E04A 2DNSA 1K55C 4PPRA 3A3DA 4BQMA 3VE3A 1MBLA 4IEDA 3TOIA 4NXGA 3Q7ZA 1K56A 1NWZA 4IVIA 3M6BA 2XROA 5E2EA 2C5WB 3QP6A 2XD5A 5LBRA 3A0VA 2Y2LA 3MS6A 1KDWA 1NY0A 4KQQA 1G68A 2L4RA 2XR0A 4PM6A 3A3IA 1EWZA 2X01A 3DTEA 5CHJA 1MWUA 1YSPA 3T4QA 1SKFA 2X02A 4DE2A 2D01A 2H10A 4N1HA 2H5SA 1ACFA 2EXBA 1ES5A 4PM8A 1MPLA 2Y2QA 4NXFA 4S2OA 5EUAA 1KDSA 1FSWA 1J3WA 4R3AA 4OLDA 3MQOA 2WGWB 4WBGA 5DTKA 3SOIA 2XSSA 1N9NA 3DW0A 5K5BA 2PU2A 3P98A 4JKTA 3EOIA 1UWNX 2LB5A 1L0GA 3G2YA 5CHMA 4GS9B 3IX8A 3W8KA 1MZUA 4CJNA 1CEFA 1G5UA 4OQGA 2P04A 4KQOA 4H6JA 4QY6A 1IOUA 4Y5FA 5DTSA 4OH0A 1ERQA 2WKHA 4IUKA 1MWSA 5E2HA 2KOIA 3H7WB 1ZTUA 4C3QA 1JTGA 3EGDC 3PAGA 3VP2A 5CXWA 2OWJA 5FQKA 1KOUA 2R9XA 3IXBA 4X6TA 2BTFP 1Q2PA 2XH9A 3T4LA 3VP0A 2Y2PA 4R70A 2Z6DA 4LFUA 4U0TA 2BASA 1VEUA 5CTNA 1TF1A 4PM7A 2CMNA 2P9VA 4HH2A 1Z09A 4S2NA 5G18A 5AQ9A 1KGGA 4E3JA 3F1PA 1FCNA 5DVAA 1G28A 1PI4A 1JWZA 4WZ4A 1H8YA 5HAIA 3TJZC 4E3KA 3VOYA 2G7UA 5HD3A 4UEYA 3UDXA 5DF8A 1KE3A 1W5DA 4H8RA 4Z9QA 3WS5A 4IJGA 4JBFA 2OV5A 3JPUA 5BOHA 2V1BA 3LCEA 4I38A 2O9AA 1T18A 4KZ5A 5CERA 3CITA 2R9WA 2D02A 4DXBA 1Y54A 1F98A 4FH4A 3QP8A 4LRXC 2NUTC 3SS3A 1LSWA 1YKDA 1T19A 3DWZA 1YPRA 3LGOA 1OJGA 2W3EA 2Y79A 1C3BA 4OPQA 3T12B 3MKEA 2WZXA 1E4DA 4JGRA 1K6SA 3BQ8A 5FI7A 5CGWA 3CZDA 2XGNA 3SH7A 4DJ3A 1CK3A 3IBRA 2PBYA 4YWZA 4ZJ3A 4R23A 4S2NC 4X69A 3HUNA 1K56D 4O0PA 3VFFA 5F6AA 4EQIA 3CPTB 1UWPX 3MR0A 2EFXA 3C4OA 4UA9A 3LFVA 4KZ9A 1TDLA 3QP1A 4K0XA 3PBQA 4JF6A 4NXBA 1WYCA 5E2GA 3ZGAB 4JXVA 4YINA 1MC0A 3W4QA 3S4XA 3T1SA 4OONA 1W8YA 1FIKA 4BBUA 3VOLA 4DE0A 1XP4A 1YLYA 5EOEA 4QU3A 2QPNA 3OPRA 4DXCA 4E3IA 1RGYA 4YOFA 1PFLA 2WAFA 4GKUA 4JGOA 1X0OA 1GCEA 4WUJA 3O87A 5CRFA 3D72A 2ZQ7A 3KSIA 2EA9A 3Q7VA 2PYRA 3NULA 1TDGA 5HW3A 2I72A 3S7NA 3IXGA 3VP1A 4BWIA 1YMSA 2ZOHA 5DKKA 1Z6FA 3E98A 4KZ8A 1NYMA 2VGLM 2JE5A 4GZBA 4DMZA 3QP4A 4KG5A 1PI5A 2RL3A 1JWVA 3OCLA 2XRNA 4Q0IA 2Q9NA 4N1XA 5GLCA 1LSXA 1OPXA 3NOTC 3ULFA 3LY3A 4I3IA 4Q0HA 4E3OA 3WWXA 3HLCA 4MN5A 3O5YA 3SW1A 5EM1A 1OJ5A 1EI5A 4D60A 1XFNA 1STZA 3UE6A 4BBTA 2WGWA 3OPPA 1CQAA 1TEMA 3A3EA 4NXEA 3UE1A 4RA7A 2JKRM 5F68A 5G4YA 2PYPA 3QP2A 1NYYA 1W7FA 4FCFA 2B5RA 3V3SA 2XQZA 2PRFA 1LL9A 1S4RA 3LI9A 2OAP1 4GS9A 4ZJ2A 2PU4A 4H6JB 3JYIA 3NDGA 4Y15A 4GNUA 5KSHA 1M40A 1E25A 1GHMA 3WS2A 1W63M 1I2WA 4JPMA 2R78A 1ZHHB 4QHCA 2VX8A 3VSKA 1ES3A 1M6KA 5DF7A 3DTKA 1F5MA 3IS2B 1L0DA 2B95A 4WM9A 1H0MA 3VMAA 4E3LA 1GA9A 2VV8A 2EX6A 3OPLA 3EWKA 2HPBA 5KZHA 1I2SA 2QZ6A 5F83A 2J80A 1NXYA 2V8CA 1E3UA 2P9VB 3BLMA 3PBTA 5FQQA 2C6WB 3UMDA 1PZOA 3MZEA 5I5LA 4BMWA 1BUEA 1FOFA 3F1PB 1N9BA 4YNRA 1H8MA 4HY8A 1BULA 2Y55A 4AFIA 2GZAA 1CI9A 3GV9A 4UA7A 4R1GA 4L9EA 5MC7A 4Y0OA 1BLSA 2EFUA 2OSUA 1AXBA 5L2FA 2FFYA 4KG2A 1BLPA 2M7VA 4PAUA 1P0ZA 4Y3IA 5F5YA 5HPFA 3NI9A 4GOGA 1PZPA 4G3KA 4KQDA 4N92A 3LIBA 3LIDA 1ZG4A 3F1NA 1U60A 4HHDA 1SKOA 3VP3A 4CLCE 4JXWA 1OTIA 1HZOA 5AJGA 3CI6A 4KZ4A 5HL6A 1DJAA 4FTXA 1KE4A 1XJ2A 5FEGA 2WKEA 4HJ3A 4EV4A 2VKSA 2YKFA 3EQVA 2ZC4B 1ALQA 3D3OA 1HVBA 3B47A 4I3JA 4UA6A 2ZBBA 3H9WA 3D9YA 5FDSA 2A49A 4R4RA 4PKYG 1UGUA 2A3UA 3FC7A 3NBLA 2E8JA 2LB9A 4LV2A 4WF0A 3WS0A 4MEZA 3IF6B 3D4FA 2JCHA 4OVDA 4B4ZA 5FASA 1ODVA 4MN6A 3MXRA 1JVJA 1VQQA 2KLIA 3CPTA 5AVFA 3SZTA 3N8LA 2KX6A 4BJPA 1LL5A 1XJ6A 4LENA 1DP8A 1TVFA 5FEFA 1BYWA 3UO9A 1D1JA 1XGJA 4DDSA 2QKPA 3AGEA 4LLOB 1TS7A 3EEAA 1PIOA 3G6OA 1ERMA 5HWWA 3TSGA 3IHBA 5EV0A 1D06A 4U0XA 4KZAA 1G6AA 3VSLA 4DE1A 4EW7A 4Y7PA 3Q7VB 4GDNA 3V5MA 1F2KA 3IQAA 3IHAA 2HDUA 1YM1A 3UPPA 1S66L 1XA7A 3T50A 3QNBA 3PR6A 3A3FA 1DRMA 1VETB 4XT2B 1KGFA 3BJNA 2HP6A 2HGVA 5C5KA 5HSQA 4OQ0A 4ID4A 1YMXA 4K08A 1WYBA 2CC1A 5I94A 3NCKA 3LR5A 5L07A 3PXPA 1JTDA 5KMWA 5IT5A 1L0FA 3HLBA 1GHPA 2M7UA 3BECA 4WYYA 4MCWA 1IYPA 5CGXA 3LEQA 3LY4A 4M3KA 4EBPA 4GHIB 2ZQAA 5L10A 2ZL1B 3TRCA 3DBAA 4OPRA 3T1XA 1L2SA 2BG1A 2Y2JA 2P7JA 3DWKA 1FQGA 1K0KA 5JYPA 1FSYA 2ZC6B 5E43A 5FQMA 5HL1A 1E3UD 1MKIA 4KQRA 5HDDA 1T1BA 4EBNA 2J3WA 5IHVA 3GMWA 3MFDA 4WMCA 2YKHA 4BLMA 1NRFA 2HJEA 1LI9A 4K91A 3BFEA 1ONGA 3T4OA 4IBXA 3IH8A 2XF3A 4DJ2A 2ZD8A 1P9RA 4Q0JA 4WLAA 3LICA 5FAOA 1BTLA 1KVMA 2XFSA 2VGKA 2XA7S 3C4PA 2ZLYA 3IS2A 3KO6A 2FZ0A 4S2MA 3KX0X 2WGIA 1TS8A 2ZOIA 1RP5A 3LIAA 3PBOA 3IX3A 3V67A 1YLPA 4Z1WA 3MZDA 1LI0A 3GSGA 3OLOA 2MJ6A 2Q9MA 3BEBA 2NUPC 1XFQA 4JF5A 1GSXA 2ZC5B 3MQ0A 1CI8A 2V9AA 4HJ4A 5FDHA 2GNXA 4FH2A 4MN7A 3IT9A 4RVAA 4ESPA 3C7VA 5GLDA 4PM5A 3F1OA 1NLYA 2DCFA 3MJQA 5FL3A 1N4OA 1IYQA 1S1YA 1DJCA 3E0YA 3R4KA 3RTYA 3WS4A 3UE0A 3UNWA 4EUZA 1ZG6A 3UB6A 3FZCA 2W3DA 4NKPA 3T4JA 3F1NB 4HP4A 5G4ZA 1MWTA 1HTZA 1SKOB 1VHMA 4MLLA 4ETZA 1K25A 3CMZA 1FCMA 1DP6A 2O9BA 3AGFA 2W3FA 4EU0A 2V20A 3QP5A 1XPBA 4WN5A 3LO7A 2IWCA 2PBDP 2JKTM 1CEGA 1PWDA 4HIAA 4ETXA 4LV1A 3BFCA 2L0WA 3HBRA 4OOYA 1ONHA 1HD8A 4HOIA 3HVFA
chains in the Genus database with same CATH topology
3UB7A 1S4RA 1WA9A 5J4EA 3LI9A 2OAP1 3MQQA 4GS9A 4BBVA 3MMHA 4I3AA 3LUQA 4H6JB 3BY8A 3H82B 4GCZA 4CLCA 5KSHA 4EEUA 3C30A 3HJKA 1W63M 1LL8A 1T1AA 3JVUA 5L8MA 4L9FA 2R78A 3UE3A 5AVEA 1ZHHB 2VX8A 2VGLS 2PD7A 2HJ9C 2Z6CA 5IU1A 2DMWA 4LPZA 1F5MA 2PDRA 2QJ5A 3IS2B 1V9ZA 3P01A 3UB9A 1IFQA 4B9OA 3HCYA 3OC2A 4R38A 5HZHA 2VV6A 2I9VA 2VV8A 3A0SA 1OTBA 3CUEC 5DFYA 3EWKA 3T4SA 3UB8A 4EEPA 4PKYA 4F3LA 1YAXA 4MMNA 3FPWA 2PR6A 2J80A 2HF6A 5HDCA 3KSFA 5HD5A 4ARZA 1OTEA 3PBTA 1H3QA 4QPRA 3UMDA 2EWVA 2J3TC 2A24A 4HJ6A 5I5LA 4BMWA 5HWVA 2ZMFA 2VEAA 2VLGA 4E04A 3R7WA 3F1PB 1VB6A 3BY9A 4YNRA 1H8MA 4HY8A 3VE3A 1XJ4A 2W1RA 4P6ZS 4NXGA 4XT2A 4AFIA 1NWZA 5A8BA 2GZAA 2XROA 4L9EA 5MC7A 5DKLA 5LBRA 3A0VA 3IBJA 4RQ9A 4CLCC 2B18A 2QWSA 4O8GA 4L0LA 2L4RA 4LRYC 2M7VA 4PAUA 1TS6A 1OTDA 3U2AA 4EUVA 4HI4A 1P0ZA 4Y3IA 1TD5A 5F5YA 5HPFA 2WKRA 3PBSA 4G3KA 2VV7A 4KQDA 1YSPA 4EQ1A 3T4QA 2D01A 3LIEA 3LIBA 3MXQA 2PR5A 3LIDA 3F1NA 4HHDA 2ZMVA 1OT9A 4NXFA 4GHIA 4CLCE 3PBRA 1OTIA 5AJGA 2GJ3A 1W63Q 3CI6A 5HL6A 3LIFA 1XJ2A 4R3AA 3MQOA 4HJ3A 4M4XA 1GSVA 2VKSA 2YKFA 4HP9A 1TS0A 3EQVA 3W2ZA 3D3OA 3B47A 4I3JA 2ZBBA 3BWLA 1S67L 3P7NA 3H9WA 2EWWA 2XSSA 1N9NA 2INWA 3GECA 3ZYTA 4PKYG 1UGUA 3FC7A 5K5BA 4II7A 3EOIA 2KDKA 1JNUA 2LB9A 3S7OA 1UWNX 2LB5A 3CWFA 4WF0A 4GS9B 3LR0A 2W1TB 5J7EA 2PT7A 1MZUA 1ODVA 2JKTI 2P04A 4KQOA 4GLQA 4MN6A 2JKRI 4H6JA 4L9GA 1IOUA 4Y5FA 2KLIA 4IUKA 5AVFA 2KX6A 2KOIA 4BJPA 3H7WB 1OT6A 1XJ6A 1ZTUA 1DP8A 3OOVA 5DFXA 4GW9A 5EFWA 1BYWA 3LYXA 3EGDC 3TW8A 2V0WA 3NHQA 2OWJA 1KOUA 2L1MA 1XJ3A 1G6OA 2QKPA 3E4QA 4EETB 4LLOB 4R6LA 1TS7A 3EEAA 3JVVA 3K3CA 3T4LA 3G6OA 2O99A 3GDIA 5HWWA 2JN7A 4R70A 1D06A 2Z6DA 4EW7A 2BASA 4ARZB 2J3TD 2VZWA 3HJIA 4G3VA 2W27A 3FG8A 4HQAA 2A2LA 1LT0A 1TF1A 2Y8HA 2O0YA 2VJWA 1NLZA 2CMNA 2QYBA 2A24B 4HH2A 1S66L 3F1OB 3T50A 3OBFA 1T1CA 4O01A 3PR6A 4NEED 4FSFA 4IHQA 3F1PA 2QHKA 4GJ4A 1G28A 5TBMA 1DP9A 5HDSA 4DN0A 5IS1A 3TJZC 1DRMA 3MFXA 4XT2B 2G7UA 3E4OA 5HD3A 4UEYA 3LR3A 3BJNA 3KYZA 3PBNA 4IUHA 5DJUA 2XA7M 4IJGA 2HGVA 4CLCD 5C5KA 4LRZE 1NRJA 5HSQA 4K08A 3ZQ5A 4WEJA 2V1BA 3RFBA 3BW6A 3NOPC 3LR5A 4I38A 2O9AA 1T18A 4Y2FA 3PXPA 3K2NA 3CITA 4PHTA 5IT5A 2D02A 2M7UA 1LSVA 1F98A 2W3HA 4MCWA 1P9WA 4I39A 4LRXC 2B02A 2O9CA 2NUTC 1D7EA 1LSWA 2GX5A 1YKDA 1T19A 3VE4A 4GHIB 3T4TA 1OJGA 2W3EA 3TRCA 3DBAA 3B42A 2WKPA 2Y79A 4G3WA 2P7JA 1MKMA 3A0RA 4OOLA 4WELA 2K7SA 3C38A 3LR4A 4JGRA 5HDDA 3CAXA 1T1BA 3BQ8A 3LI8A 4UQIM 2J3WA 1EW0A 4EXOA 5CX7A 5DJTA 2YKHA 3S7PA 3C2WA 4CLCB 4OOMA 4DJ3A 3IBRA 4JGQA 2HJEA 1N9LA 1GSWA 3H82A 4YWZA 4KUOA 2W1TA 1OTAA 5HWTA 2M1CA 5J3WA 3PYPA 4O0PA 3T4OA 5F6AA 3NOUC 3EGXC 4DJ2A 3B33A 4KUKA 1UWPX 2OAQ1 1P9RA 2PD8A 3MR0A 4Q0JA 4WLAA 3LICA 2WKQA 3LFVA 2K2NA 4HH3A 2XA7S 2IA2A 1P97A 3PBQA 4NXBA 5TJJA 3H7WA 3IS2A 3KO6A 2FZ0A 1MC0A 3KX0X 4F3LB 2ZOIA 1TS8A 4BBUA 3VOLA 2P08A 3LIAA 1N9OA 3PBOA 1V9YA 3V67A 2H28A 4Z1WA 1S4SA 3OLOA 2MJ6A 3CLOA 2W3GA 4YOFA 3KYQA 2VA0A 2NUPC 4EESA 4JGOA 2W0NA 1X0OA 2HV1A 4B93A 1XFQA 3OCNA 1GSXA 3E4PA 3MQ0A 4WUJA 2V9AA 3C8CA 3D72A 4HJ4A 3R7WB 3KSIA 2GNXA 3KSGA 4MN7A 5HPIA 1YSQA 2EA9A 2PYRA 3S7NA 3KSHA 4BWIA 2PHYA 3BQAA 2ZOHA 3F1OA 1NLYA 3EQUA 5KIZA 5TBMB 3MJQA 4I5SA 2V0UA 5DKKA 2V1AA 3E98A 5FL3A 4UQIS 3EEHA 2VGLM 1S1YA 4JGPA 3E0YA 3R4KA 4DMZA 3RTYA 2QJ7A 2FH5A 3OCLA 2XRNA 4FOFA 2JHEA 4Q0IA 3PHYA 3UMEA 3UB6A 3NJAA 2W3DA 4NKPA 3T4JA 1LSXA 1OPXA 3F1NB 4HP4A 3NOTC 4ZRRA 5G4ZA 3CUEA 3FPVA 3ULFA 3K3DA 1VHMA 4ME4A 4ETZA 4I3IA 4Q0HA 5DF9A 4MDZA 4MN5A 2K31A 1F9IA 3TE8A 4WEKA 1DP6A 3MF0A 2O9BA 3O5YA 3SW1A 1OJ5A 3ICYA 1XFNA 2W3FA 4EU0A 4CQHA 1STZA 3UE6A 3VV4A 4BBTA 2OWHA 1Y28A 4WN5A 1S1ZA 4HNBA 4P6ZM 2JKTM 4WL9A 4NXEA 4HIAA 4ETXA 2JKRM 5F68A 5G4YA 2L0WA 2PYPA 3S7QA 5F69A 4EERA 3RH8B 4HOIA 2OOLA 3T4KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UB7 A;  1S4R A;  1WA9 A;  5J4E A;  3LI9 A;  3MQQ A;  4GS9 A;  4BBV A;  4I3A A;  3LUQ A;  4H6J B;  3BY8 A;  3H82 B;  4GCZ A;  4EEU A;  3HJK A;  1LL8 A;  1T1A A;  4L9F A;  2R78 A;  5AVE A;  2PD7 A;  2Z6C A;  5IU1 A;  4LPZ A;  2PDR A;  2QJ5 A;  3IS2 B;  1V9Z A;  3UB9 A;  4B9O A;  4R38 A;  5HZH A;  2VV6 A;  2I9V A;  2VV8 A;  3A0S A;  1OTB A;  3EWK A;  3UB8 A;  4EEP A;  4PKY A;  4F3L A;  2PR6 A;  2J80 A;  5HDC A;  5HD5 A;  1OTE A;  3UMD A;  2A24 A;  4HJ6 A;  5I5L A;  5HWV A;  2VEA A;  2VLG A;  4E04 A;  3F1P B;  1VB6 A;  3BY9 A;  4HY8 A;  3VE3 A;  1XJ4 A;  4NXG A;  4XT2 A;  1NWZ A;  5A8B A;  4L9E A;  5DKL A;  3A0V A;  4RQ9 A;  2QWS A;  2L4R A;  4LRY C;  1TS6 A;  1OTD A;  4HI4 A;  1P0Z A;  5F5Y A;  2WKR A;  2VV7 A;  4KQD A;  4EQ1 A;  2D01 A;  3LIE A;  3LIB A;  3MXQ A;  2PR5 A;  3LID A;  3F1N A;  4HHD A;  1OT9 A;  4NXF A;  4GHI A;  1OTI A;  2GJ3 A;  3LIF A;  1XJ2 A;  4R3A A;  3MQO A;  4HJ3 A;  4M4X A;  1GSV A;  2YKF A;  4HP9 A;  1TS0 A;  4I3J A;  2ZBB A;  3BWL A;  1S67 L;  3P7N A;  3H9W A;  1N9N A;  2INW A;  3GEC A;  4PKY G;  1UGU A;  3FC7 A;  2KDK A;  1JNU A;  1UWN X;  3CWF A;  4WF0 A;  4GS9 B;  5J7E A;  1MZU A;  1ODV A;  4MN6 A;  4H6J A;  4L9G A;  5AVF A;  2KX6 A;  3H7W B;  1OT6 A;  1XJ6 A;  1DP8 A;  4GW9 A;  5EFW A;  1BYW A;  3LYX A;  2V0W A;  3NHQ A;  2OWJ A;  1KOU A;  2L1M A;  1XJ3 A;  2QKP A;  3E4Q A;  4EET B;  4LLO B;  4R6L A;  1TS7 A;  3K3C A;  3G6O A;  3GDI A;  5HWW A;  2JN7 A;  4R70 A;  1D06 A;  2Z6D A;  4EW7 A;  2BAS A;  3HJI A;  4HQA A;  2W27 A;  3FG8 A;  1LT0 A;  2CMN A;  2A24 B;  4HH2 A;  1S66 L;  3F1O B;  3T50 A;  1T1C A;  3F1P A;  2QHK A;  5TBM A;  1G28 A;  1DP9 A;  5HDS A;  5IS1 A;  1DRM A;  3MFX A;  4XT2 B;  3E4O A;  5HD3 A;  5DJU A;  4LRZ E;  5HSQ A;  4K08 A;  3ZQ5 A;  2V1B A;  3NOP C;  4I38 A;  1T18 A;  2D02 A;  1LSV A;  1F98 A;  4I39 A;  4LRX C;  2B02 A;  1D7E A;  1LSW A;  1T19 A;  3VE4 A;  4GHI B;  1OJG A;  2WKP A;  2P7J A;  3A0R A;  2K7S A;  4JGR A;  5HDD A;  3CAX A;  1T1B A;  3LI8 A;  1EW0 A;  4EXO A;  5DJT A;  2YKH A;  3C2W A;  4DJ3 A;  3IBR A;  4JGQ A;  1N9L A;  1GSW A;  3H82 A;  4YWZ A;  4KUO A;  1OTA A;  5HWT A;  2M1C A;  5J3W A;  3PYP A;  5F6A A;  3NOU C;  4DJ2 A;  3B33 A;  4KUK A;  1UWP X;  3MR0 A;  2PD8 A;  4WLA A;  3LIC A;  2WKQ A;  4HH3 A;  1P97 A;  4NXB A;  3H7W A;  3IS2 A;  3KX0 X;  4F3L B;  2ZOI A;  1TS8 A;  4BBU A;  3VOL A;  3LIA A;  1N9O A;  1V9Y A;  2H28 A;  1S4S A;  3OLO A;  3CLO A;  4EES A;  4JGO A;  2W0N A;  1X0O A;  2HV1 A;  1XFQ A;  1GSX A;  3E4P A;  4WUJ A;  2V9A A;  3C8C A;  3D72 A;  4HJ4 A;  2EA9 A;  2PYR A;  2PHY A;  2ZOH A;  3F1O A;  5KIZ A;  5TBM B;  3MJQ A;  4I5S A;  2V0U A;  5DKK A;  2V1A A;  3EEH A;  1S1Y A;  4JGP A;  3RTY A;  2QJ7 A;  2JHE A;  3PHY A;  3UME A;  3UB6 A;  3NJA A;  1LSX A;  3F1N B;  4HP4 A;  3NOT C;  5G4Z A;  3ULF A;  3K3D A;  4I3I A;  4MN5 A;  1F9I A;  1DP6 A;  3SW1 A;  1OJ5 A;  3ICY A;  1XFN A;  3UE6 A;  4BBT A;  2OWH A;  1Y28 A;  4WN5 A;  1S1Z A;  4HNB A;  4WL9 A;  4NXE A;  4HIA A;  5G4Y A;  5F68 A;  2L0W A;  2PYP A;  5F69 A;  4EER A;  3RH8 B;  4HOI A;  2OOL A; 
#chains in the Genus database with same CATH topology
 5KSC A;  1CJF A;  3UN7 A;  5EVE A;  4DDY A;  5J4E A;  2PAV P;  4UHU A;  3G35 A;  3IF6 A;  5HX9 A;  3TG9 A;  3LUQ A;  4CLC A;  4EEU A;  1BLH A;  4R0Q A;  2JC7 A;  5TFQ A;  3HJK A;  2Z2L B;  3ZDJ A;  4CPK A;  3JVU A;  4L9F A;  4C6Y A;  5AVE A;  4KG6 A;  1K54 A;  2Z6C A;  1YLJ A;  4LPZ A;  1V9Z A;  3P01 A;  4LGW A;  3G32 A;  3BFG A;  5HZH A;  2VV6 A;  2Y2G A;  3A0S A;  2ZJ9 A;  5DFY A;  3IH9 A;  3T4S A;  5HAP A;  4MBH A;  4PKY A;  4FD8 A;  1GHI A;  1SHV A;  2UWX A;  4EWF A;  3QHY A;  2J3T C;  2WYX A;  5HWV A;  2VLG A;  1VB6 A;  2V2F F;  3BY9 A;  5CED A;  3BFD A;  1YT4 A;  1K6R A;  4WMC D;  3Q82 A;  1VET A;  4FUW A;  4XT2 A;  3RXW A;  3GVB A;  1ZKJ A;  4GN2 A;  3IF6 C;  4E3N A;  2UV0 E;  4DRT A;  3IBJ A;  4CLC C;  2B18 A;  2QWS A;  1W79 A;  4L0L A;  1YLZ A;  3C5A A;  1TS6 A;  5FA7 A;  3VFH A;  1FR6 A;  2WKR A;  3GRJ A;  2HP9 A;  4EQ1 A;  2HDS A;  1K54 C;  3LIE A;  5JYO A;  2PR5 A;  2ZMV A;  5FI2 A;  4GHI A;  3PBR A;  2ZL1 A;  2BLS A;  2EX8 A;  4QB8 A;  3LIF A;  1YQS A;  1TS0 A;  3W2Z A;  3PAE A;  3A3J A;  3M2J A;  3P09 A;  3BWL A;  1S67 L;  3ZG5 A;  2HZ5 A;  4P85 A;  3N8S A;  4II7 A;  2KDK A;  4B4X A;  3S7O A;  2G2U A;  4N9L A;  4U3T A;  3LR0 A;  1L3L A;  4R3B A;  5TGF A;  3ISG A;  2JKR I;  4L9G A;  2EX2 A;  4LV3 A;  2ZQD A;  2Y2I A;  4S2K A;  4ZDX A;  1QMF A;  4NET A;  4EBL A;  3OOV A;  2XFT A;  4GW9 A;  3LYX A;  3TW8 A;  2Y2N A;  3V3R A;  3IF5 A;  3NHQ A;  2HP5 A;  1FIL A;  4EET B;  4R6L A;  3JVV A;  4PM9 A;  3I7J A;  4C75 A;  2ZQ8 A;  3GDI A;  3NDE A;  4ARZ B;  2J3T D;  2VZW A;  4G3V A;  2Q0O A;  2W27 A;  4HQA A;  1LT0 A;  2O0Y A;  2Y8H A;  2VJW A;  1NLZ A;  4MBF A;  2A24 B;  3FWL A;  3F1O B;  2XK1 A;  3OBF A;  1T1C A;  2JBF A;  1MY8 A;  3HL9 A;  4GJ4 A;  5DTT A;  1DP9 A;  5HDS A;  4DN0 A;  5IS1 A;  2J8Y A;  2DRW A;  5FAT A;  3MFX A;  2JKG A;  3LR3 A;  3KYZ A;  3MZF A;  4IUH A;  5DJU A;  2XA7 M;  3FYZ A;  4CLC D;  4HES A;  3IWQ A;  4Q8I A;  4WEJ A;  3RFB A;  3L7H A;  3BW6 A;  3NOP C;  4X1M A;  2WUQ A;  2VGJ A;  5EVL A;  3SS5 A;  2W3H A;  2ZM8 A;  1P9W A;  4I39 A;  4Y0U A;  2B02 A;  2EXA A;  3UDF A;  3VE4 A;  3T4T A;  4MBK A;  2FFF B;  3B42 A;  2JKF A;  4G3W A;  5F1F A;  1JWP A;  3A0R A;  3IX4 A;  2Y59 A;  2K7S A;  3SS4 A;  4XUX A;  4Y0T A;  2OLU A;  3LR4 A;  1XXM A;  4GB7 A;  3HLE A;  3LI8 A;  3S1Y A;  3CG5 A;  5EEC A;  1Y4O A;  1ES2 A;  5DJT A;  3S7P A;  1PWC A;  3O86 A;  4CLC B;  3HLW A;  4OOM A;  3SH8 A;  4JGQ A;  4NG2 A;  1GSW A;  4OQH A;  2WGV A;  3LEZ A;  1OME A;  2W1T A;  1OTA A;  2M1C A;  4WZ5 A;  5J3W A;  2ZQ9 A;  4NK3 A;  4Y17 A;  1H8Z A;  5M1A A;  4KUK A;  2OAQ 1;  2PD8 A;  2RCX A;  2XD1 A;  4HH3 A;  2IA2 A;  4BD0 A;  1ESU A;  1H5X A;  5TJJ A;  5GHZ A;  3ZG0 A;  1S0W A;  3ITA A;  4IBR A;  4KZ6 A;  4LCM A;  4R4S A;  4E3M A;  4UAA A;  4GDB A;  3IXD A;  1N9O A;  2H28 A;  3CLO A;  2W3G A;  3OPH A;  3KYQ A;  4EES A;  3E4P A;  4ZTK A;  1XA1 A;  3C8C A;  4RYE A;  5HPI A;  1YSQ A;  3UPN A;  3UPO A;  3G30 A;  1SZV A;  4BEN A;  3KSH A;  2PHY A;  3BQA A;  4S2J A;  3EQU A;  4R3J A;  1MXO A;  1PRQ A;  5TBM B;  2V1A A;  4UQI S;  1NZU A;  4S2I A;  2AVX A;  4JGP A;  2Y4A A;  4X55 A;  4WZ5 C;  3SH9 A;  5EVI D;  2WZZ A;  4O7D A;  3HUM A;  2ZM0 A;  3CUE A;  5EM0 A;  3FPV A;  5A92 A;  1BZA A;  3DTM A;  3K3D A;  3S22 A;  2WAE A;  4MDZ A;  5AQA A;  4PMA A;  3G31 A;  1F9I A;  1S6R A;  3MF0 A;  1GA0 A;  2EX9 A;  3ICY A;  4MNR A;  3V50 A;  4CQH A;  3VV4 A;  2P74 A;  1KE0 A;  4QY5 A;  1S1Z A;  1YLT A;  3ZG9 B;  3N7W A;  3M2K A;  4OLG A;  1PW1 A;  5F69 A;  4EER A;  3NIA A;  1WA9 A;  1VM1 A;  4I3A A;  3BY8 A;  3H82 B;  1CF0 A;  1KVL A;  4KEN B;  3C30 A;  1Q2Q A;  4B88 A;  5EVI B;  1A0K A;  3G34 A;  3GQZ A;  1T1A A;  4GD6 A;  5L8M A;  3N4I A;  1PYY A;  3UE3 A;  4LCL A;  3RJU A;  3CJM A;  5M18 A;  1J9M A;  1SDE A;  1RGZ A;  4X56 A;  2J9O A;  2E8I A;  5IU1 A;  4BL3 A;  5E2F A;  3UB9 A;  4OP5 A;  1IFQ A;  4B9O A;  3Q81 A;  3FKW A;  3HCY A;  3UB5 P;  4A5R A;  4OP8 A;  4GD8 A;  1OTB A;  3CUE C;  5CTM A;  1YLW A;  1KGE A;  4EEP A;  4F3L A;  1YAX A;  4MMN A;  5GHX A;  3FPW A;  4HBT A;  2PR6 A;  2WAD A;  2HF6 A;  4D2O A;  3ZCZ A;  3BLS A;  4ARZ A;  2VK3 A;  1H3Q A;  4QPR A;  5FAQ A;  2A24 A;  4HJ6 A;  5FQJ A;  4P87 A;  2VEA A;  3R7W A;  3Q1F A;  3ZVT A;  1XJ4 A;  2W1R A;  4P6Z S;  4BD1 A;  5A8B A;  3WRZ A;  5DKL A;  1PW8 A;  4RQ9 A;  1HLU P;  4O8G A;  5CHU A;  2QMI A;  4LRY C;  1OTD A;  4OPY A;  3U2A A;  4EUV A;  4HI4 A;  1DJB A;  1TD5 A;  1BLC A;  5FAP A;  4JLF A;  3PBS A;  2VV7 A;  2J7V A;  3MXQ A;  3MKF A;  1XGI A;  2ZC7 A;  1IYS A;  4ZBE A;  1OT9 A;  5AQB A;  3U4L P;  1NJ4 A;  2GJ3 A;  2V1Z A;  3G2Z A;  1W63 Q;  4M4X A;  1GSV A;  4E6X A;  4HP9 A;  1W8Q A;  3IWO A;  4X1L A;  1LHY A;  3P7N A;  2EWW A;  3T1Q B;  1DY6 A;  2INW A;  3GEC A;  3ZYT A;  1IKG A;  1SDN A;  4DF6 A;  3NEC A;  1JNU A;  3CWF A;  5CEB A;  4OPZ A;  2W1T B;  5J7E A;  2PT7 A;  2JKT I;  5AQ7 A;  4GLQ A;  3GR2 A;  4P6B A;  3BYD A;  4E6W A;  3AGD A;  1AWI A;  4X53 A;  5D3O A;  4XXR A;  2ZMA A;  3DAV A;  4JF4 A;  3ZG7 B;  1OT6 A;  4RX3 A;  2OLV A;  5DFX A;  4KZ3 A;  5EFW A;  1IKI A;  4S2P A;  3N8R A;  2V0W A;  3ZNY A;  5J8X A;  2Z2M B;  2L1M A;  1XJ3 A;  2XLN A;  1G6O A;  3VOZ A;  3E4Q A;  2Y2O A;  3W4P A;  4K0W A;  4X25 A;  3K3C A;  1WE4 A;  1LLB A;  5GL9 A;  2O99 A;  2Y2M A;  2JN7 A;  1ZC2 A;  3HJI A;  3FG8 A;  3W4O A;  2A2L A;  2QYB A;  1O07 A;  4QJG A;  4XUZ A;  3BRM A;  4OQI A;  4DE3 A;  1BSG A;  4O01 A;  4NEE D;  4FSF A;  3MBZ A;  4IHQ A;  2QHK A;  5TBM A;  1K38 A;  3E4O A;  3PBN A;  3HLF A;  2IWD A;  3QNC A;  5GLB A;  5EPH A;  2H0T A;  4LRZ E;  1NRJ A;  3ZQ5 A;  2GDN A;  5FQ9 A;  4RX2 A;  2H0Y A;  4Y2F A;  2WKI A;  2Y91 A;  4LV0 A;  3K2N A;  3OZH A;  4PHT A;  1LSV A;  3ZHH A;  4QWO A;  1XKZ A;  3WS1 A;  2O9C A;  1D7E A;  2GX5 A;  4KZB A;  5U47 A;  5CEC A;  3O88 A;  2WKP A;  1IEL A;  4DKI A;  1MKM A;  3N6I A;  2ZQC A;  4OOL A;  3M6H A;  4WEL A;  3C38 A;  5HAR A;  2ZM2 A;  3Q07 A;  3CAX A;  4UQI M;  5EOO A;  1EW0 A;  3DTI A;  4EXO A;  1I5Q A;  1RCJ A;  1FCO A;  5CX7 A;  3C2W A;  3VP4 A;  3O3V A;  3ZNT A;  4P0M A;  1K4F A;  1IEM A;  2Y2K A;  1N9L A;  3H82 A;  1K4E A;  3UY6 A;  1L0E A;  4KUO A;  3MSH A;  5HWT A;  5EVI A;  3PYP A;  5HFO A;  3NOU C;  5GHY A;  3EGX C;  3B33 A;  3IXH A;  3NY4 A;  3ITB A;  4X68 A;  2WKQ A;  3GTC A;  2K2N A;  1P97 A;  3B3X A;  4YFM A;  3H7W A;  1MWR A;  2V8F A;  1IYO A;  4HEF A;  4F3L B;  2P08 A;  1V9Y A;  3CHW P;  1K57 A;  1S4S A;  2VA0 A;  2W0N A;  2HV1 A;  4B93 A;  1ESI A;  3OCN A;  3L9K A;  1VEU B;  3R7W B;  5EE8 A;  3KSG A;  3C7U A;  2WK0 A;  2J9P A;  3BM6 A;  3ZVW A;  4JXS A;  5KIZ A;  3FV7 A;  2V0U A;  4I5S A;  3RXX A;  5A91 A;  3V39 A;  1ERO A;  3EEH A;  3ZG8 B;  3KYE A;  2QJ7 A;  2FH5 A;  2X71 A;  1PNE A;  3ZFZ A;  3HLG A;  4FOF A;  4KZ7 A;  2JHE A;  3PHY A;  5EVI C;  1NZO A;  3UME A;  2Y2H A;  3E2L A;  1QME A;  5M19 A;  3NJA A;  4ZRR A;  3MXS A;  2ACG A;  1ES4 A;  4ME4 A;  3IWI A;  5DF9 A;  3BFF A;  3HUO A;  4S2L A;  2K31 A;  3TE8 A;  3FKV A;  4WEK A;  5TR7 A;  5A90 A;  4ZAM A;  5CGS A;  2OWH A;  1SCW A;  1Y28 A;  1K55 A;  4HNB A;  1O7E A;  4P6Z M;  1K57 C;  3E2K A;  4WL9 A;  3S7Q A;  3RH8 B;  5GLA A;  2OOL A;  3T4K A;  3UB7 A;  3T1R A;  1PWG A;  3MQQ A;  4BBV A;  3MMH A;  2XEP A;  2HDR A;  1BT5 A;  4ZJ1 A;  2XDM A;  4GCZ A;  3PTE A;  5A93 A;  3HLD A;  3HRE A;  5L09 A;  4IVK A;  2G2W A;  3NC8 A;  4N9K A;  1LL8 A;  1XX2 A;  4Y13 A;  2IWB A;  5F1G A;  4F94 A;  5FI6 A;  2VGL S;  5HAQ A;  2PD7 A;  5FQI A;  2HJ9 C;  5F82 A;  2DMW A;  4OKP A;  2PDR A;  2QJ5 A;  2HDQ A;  5FSR A;  4JXG A;  3OC2 A;  4R38 A;  3UDI A;  1FR1 A;  2I9V A;  2ZC3 B;  3WRT A;  3UB8 A;  4BL2 A;  5HDC A;  3G4P A;  4HBU A;  3KSF A;  5HD5 A;  1OTE A;  4QD4 A;  2EWV A;  2ZMF A;  4E04 A;  2DNS A;  1K55 C;  4PPR A;  3A3D A;  4BQM A;  3VE3 A;  1MBL A;  4IED A;  3TOI A;  4NXG A;  3Q7Z A;  1K56 A;  1NWZ A;  4IVI A;  3M6B A;  2XRO A;  5E2E A;  2C5W B;  3QP6 A;  2XD5 A;  5LBR A;  3A0V A;  2Y2L A;  3MS6 A;  1KDW A;  1NY0 A;  4KQQ A;  1G68 A;  2L4R A;  2XR0 A;  4PM6 A;  3A3I A;  1EWZ A;  2X01 A;  3DTE A;  5CHJ A;  1MWU A;  1YSP A;  3T4Q A;  1SKF A;  2X02 A;  4DE2 A;  2D01 A;  2H10 A;  4N1H A;  2H5S A;  1ACF A;  2EXB A;  1ES5 A;  4PM8 A;  1MPL A;  2Y2Q A;  4NXF A;  4S2O A;  5EUA A;  1KDS A;  1FSW A;  1J3W A;  4R3A A;  4OLD A;  3MQO A;  2WGW B;  4WBG A;  5DTK A;  3SOI A;  2XSS A;  1N9N A;  3DW0 A;  5K5B A;  2PU2 A;  3P98 A;  4JKT A;  3EOI A;  1UWN X;  2LB5 A;  1L0G A;  3G2Y A;  5CHM A;  4GS9 B;  3IX8 A;  3W8K A;  1MZU A;  4CJN A;  1CEF A;  1G5U A;  4OQG A;  2P04 A;  4KQO A;  4H6J A;  4QY6 A;  1IOU A;  4Y5F A;  5DTS A;  4OH0 A;  1ERQ A;  2WKH A;  4IUK A;  1MWS A;  5E2H A;  2KOI A;  3H7W B;  1ZTU A;  4C3Q A;  1JTG A;  3EGD C;  3PAG A;  3VP2 A;  5CXW A;  2OWJ A;  5FQK A;  1KOU A;  2R9X A;  3IXB A;  4X6T A;  2BTF P;  1Q2P A;  2XH9 A;  3T4L A;  3VP0 A;  2Y2P A;  4R70 A;  2Z6D A;  4LFU A;  4U0T A;  2BAS A;  1VEU A;  5CTN A;  1TF1 A;  4PM7 A;  2CMN A;  2P9V A;  4HH2 A;  1Z09 A;  4S2N A;  5G18 A;  5AQ9 A;  1KGG A;  4E3J A;  3F1P A;  1FCN A;  5DVA A;  1G28 A;  1PI4 A;  1JWZ A;  4WZ4 A;  1H8Y A;  5HAI A;  3TJZ C;  4E3K A;  3VOY A;  2G7U A;  5HD3 A;  4UEY A;  3UDX A;  5DF8 A;  1KE3 A;  1W5D A;  4H8R A;  4Z9Q A;  3WS5 A;  4IJG A;  4JBF A;  2OV5 A;  3JPU A;  5BOH A;  2V1B A;  3LCE A;  4I38 A;  2O9A A;  1T18 A;  4KZ5 A;  5CER A;  3CIT A;  2R9W A;  2D02 A;  4DXB A;  1Y54 A;  1F98 A;  4FH4 A;  3QP8 A;  4LRX C;  2NUT C;  3SS3 A;  1LSW A;  1YKD A;  1T19 A;  3DWZ A;  1YPR A;  3LGO A;  1OJG A;  2W3E A;  2Y79 A;  1C3B A;  4OPQ A;  3T12 B;  3MKE A;  2WZX A;  1E4D A;  4JGR A;  1K6S A;  3BQ8 A;  5FI7 A;  5CGW A;  3CZD A;  2XGN A;  3SH7 A;  4DJ3 A;  1CK3 A;  3IBR A;  2PBY A;  4YWZ A;  4ZJ3 A;  4R23 A;  4S2N C;  4X69 A;  3HUN A;  1K56 D;  4O0P A;  3VFF A;  5F6A A;  4EQI A;  3CPT B;  1UWP X;  3MR0 A;  2EFX A;  3C4O A;  4UA9 A;  3LFV A;  4KZ9 A;  1TDL A;  3QP1 A;  4K0X A;  3PBQ A;  4JF6 A;  4NXB A;  1WYC A;  5E2G A;  3ZGA B;  4JXV A;  4YIN A;  1MC0 A;  3W4Q A;  3S4X A;  3T1S A;  4OON A;  1W8Y A;  1FIK A;  4BBU A;  3VOL A;  4DE0 A;  1XP4 A;  1YLY A;  5EOE A;  4QU3 A;  2QPN A;  3OPR A;  4DXC A;  4E3I A;  1RGY A;  4YOF A;  1PFL A;  2WAF A;  4GKU A;  4JGO A;  1X0O A;  1GCE A;  4WUJ A;  3O87 A;  5CRF A;  3D72 A;  2ZQ7 A;  3KSI A;  2EA9 A;  3Q7V A;  2PYR A;  3NUL A;  1TDG A;  5HW3 A;  2I72 A;  3S7N A;  3IXG A;  3VP1 A;  4BWI A;  1YMS A;  2ZOH A;  5DKK A;  1Z6F A;  3E98 A;  4KZ8 A;  1NYM A;  2VGL M;  2JE5 A;  4GZB A;  4DMZ A;  3QP4 A;  4KG5 A;  1PI5 A;  2RL3 A;  1JWV A;  3OCL A;  2XRN A;  4Q0I A;  2Q9N A;  4N1X A;  5GLC A;  1LSX A;  1OPX A;  3NOT C;  3ULF A;  3LY3 A;  4I3I A;  4Q0H A;  4E3O A;  3WWX A;  3HLC A;  4MN5 A;  3O5Y A;  3SW1 A;  5EM1 A;  1OJ5 A;  1EI5 A;  4D60 A;  1XFN A;  1STZ A;  3UE6 A;  4BBT A;  2WGW A;  3OPP A;  1CQA A;  1TEM A;  3A3E A;  4NXE A;  3UE1 A;  4RA7 A;  2JKR M;  5F68 A;  5G4Y A;  2PYP A;  3QP2 A;  1NYY A;  1W7F A;  4FCF A;  2B5R A;  3V3S A;  2XQZ A;  2PRF A;  1LL9 A;  1S4R A;  3LI9 A;  2OAP 1;  4GS9 A;  4ZJ2 A;  2PU4 A;  4H6J B;  3JYI A;  3NDG A;  4Y15 A;  4GNU A;  5KSH A;  1M40 A;  1E25 A;  1GHM A;  3WS2 A;  1W63 M;  1I2W A;  4JPM A;  2R78 A;  1ZHH B;  4QHC A;  2VX8 A;  3VSK A;  1ES3 A;  1M6K A;  5DF7 A;  3DTK A;  1F5M A;  3IS2 B;  1L0D A;  2B95 A;  4WM9 A;  1H0M A;  3VMA A;  4E3L A;  1GA9 A;  2VV8 A;  2EX6 A;  3OPL A;  3EWK A;  2HPB A;  5KZH A;  1I2S A;  2QZ6 A;  5F83 A;  2J80 A;  1NXY A;  2V8C A;  1E3U A;  2P9V B;  3BLM A;  3PBT A;  5FQQ A;  2C6W B;  3UMD A;  1PZO A;  3MZE A;  5I5L A;  4BMW A;  1BUE A;  1FOF A;  3F1P B;  1N9B A;  4YNR A;  1H8M A;  4HY8 A;  1BUL A;  2Y55 A;  4AFI A;  2GZA A;  1CI9 A;  3GV9 A;  4UA7 A;  4R1G A;  4L9E A;  5MC7 A;  4Y0O A;  1BLS A;  2EFU A;  2OSU A;  1AXB A;  5L2F A;  2FFY A;  4KG2 A;  1BLP A;  2M7V A;  4PAU A;  1P0Z A;  4Y3I A;  5F5Y A;  5HPF A;  3NI9 A;  4GOG A;  1PZP A;  4G3K A;  4KQD A;  4N92 A;  3LIB A;  3LID A;  1ZG4 A;  3F1N A;  1U60 A;  4HHD A;  1SKO A;  3VP3 A;  4CLC E;  4JXW A;  1OTI A;  1HZO A;  5AJG A;  3CI6 A;  4KZ4 A;  5HL6 A;  1DJA A;  4FTX A;  1KE4 A;  1XJ2 A;  5FEG A;  2WKE A;  4HJ3 A;  4EV4 A;  2VKS A;  2YKF A;  3EQV A;  2ZC4 B;  1ALQ A;  3D3O A;  1HVB A;  3B47 A;  4I3J A;  4UA6 A;  2ZBB A;  3H9W A;  3D9Y A;  5FDS A;  2A49 A;  4R4R A;  4PKY G;  1UGU A;  2A3U A;  3FC7 A;  3NBL A;  2E8J A;  2LB9 A;  4LV2 A;  4WF0 A;  3WS0 A;  4MEZ A;  3IF6 B;  3D4F A;  2JCH A;  4OVD A;  4B4Z A;  5FAS A;  1ODV A;  4MN6 A;  3MXR A;  1JVJ A;  1VQQ A;  2KLI A;  3CPT A;  5AVF A;  3SZT A;  3N8L A;  2KX6 A;  4BJP A;  1LL5 A;  1XJ6 A;  4LEN A;  1DP8 A;  1TVF A;  5FEF A;  1BYW A;  3UO9 A;  1D1J A;  1XGJ A;  4DDS A;  2QKP A;  3AGE A;  4LLO B;  1TS7 A;  3EEA A;  1PIO A;  3G6O A;  1ERM A;  5HWW A;  3TSG A;  3IHB A;  5EV0 A;  1D06 A;  4U0X A;  4KZA A;  1G6A A;  3VSL A;  4DE1 A;  4EW7 A;  4Y7P A;  3Q7V B;  4GDN A;  3V5M A;  1F2K A;  3IQA A;  3IHA A;  2HDU A;  1YM1 A;  3UPP A;  1S66 L;  1XA7 A;  3T50 A;  3QNB A;  3PR6 A;  3A3F A;  1DRM A;  1VET B;  4XT2 B;  1KGF A;  3BJN A;  2HP6 A;  2HGV A;  5C5K A;  5HSQ A;  4OQ0 A;  4ID4 A;  1YMX A;  4K08 A;  1WYB A;  2CC1 A;  5I94 A;  3NCK A;  3LR5 A;  5L07 A;  3PXP A;  1JTD A;  5KMW A;  5IT5 A;  1L0F A;  3HLB A;  1GHP A;  2M7U A;  3BEC A;  4WYY A;  4MCW A;  1IYP A;  5CGX A;  3LEQ A;  3LY4 A;  4M3K A;  4EBP A;  4GHI B;  2ZQA A;  5L10 A;  2ZL1 B;  3TRC A;  3DBA A;  4OPR A;  3T1X A;  1L2S A;  2BG1 A;  2Y2J A;  2P7J A;  3DWK A;  1FQG A;  1K0K A;  5JYP A;  1FSY A;  2ZC6 B;  5E43 A;  5FQM A;  5HL1 A;  1E3U D;  1MKI A;  4KQR A;  5HDD A;  1T1B A;  4EBN A;  2J3W A;  5IHV A;  3GMW A;  3MFD A;  4WMC A;  2YKH A;  4BLM A;  1NRF A;  2HJE A;  1LI9 A;  4K91 A;  3BFE A;  1ONG A;  3T4O A;  4IBX A;  3IH8 A;  2XF3 A;  4DJ2 A;  2ZD8 A;  1P9R A;  4Q0J A;  4WLA A;  3LIC A;  5FAO A;  1BTL A;  1KVM A;  2XFS A;  2VGK A;  2XA7 S;  3C4P A;  2ZLY A;  3IS2 A;  3KO6 A;  2FZ0 A;  4S2M A;  3KX0 X;  2WGI A;  1TS8 A;  2ZOI A;  1RP5 A;  3LIA A;  3PBO A;  3IX3 A;  3V67 A;  1YLP A;  4Z1W A;  3MZD A;  1LI0 A;  3GSG A;  3OLO A;  2MJ6 A;  2Q9M A;  3BEB A;  2NUP C;  1XFQ A;  4JF5 A;  1GSX A;  2ZC5 B;  3MQ0 A;  1CI8 A;  2V9A A;  4HJ4 A;  5FDH A;  2GNX A;  4FH2 A;  4MN7 A;  3IT9 A;  4RVA A;  4ESP A;  3C7V A;  5GLD A;  4PM5 A;  3F1O A;  1NLY A;  2DCF A;  3MJQ A;  5FL3 A;  1N4O A;  1IYQ A;  1S1Y A;  1DJC A;  3E0Y A;  3R4K A;  3RTY A;  3WS4 A;  3UE0 A;  3UNW A;  4EUZ A;  1ZG6 A;  3UB6 A;  3FZC A;  2W3D A;  4NKP A;  3T4J A;  3F1N B;  4HP4 A;  5G4Z A;  1MWT A;  1HTZ A;  1SKO B;  1VHM A;  4MLL A;  4ETZ A;  1K25 A;  3CMZ A;  1FCM A;  1DP6 A;  2O9B A;  3AGF A;  2W3F A;  4EU0 A;  2V20 A;  3QP5 A;  1XPB A;  4WN5 A;  3LO7 A;  2IWC A;  2PBD P;  2JKT M;  1CEG A;  1PWD A;  4HIA A;  4ETX A;  4LV1 A;  3BFC A;  2L0W A;  3HBR A;  4OOY A;  1ONH A;  1HD8 A;  4HOI A;  3HVF A; 
#chains in the Genus database with same CATH homology
 3UB7 A;  1S4R A;  1WA9 A;  5J4E A;  3LI9 A;  2OAP 1;  3MQQ A;  4GS9 A;  4BBV A;  3MMH A;  4I3A A;  3LUQ A;  4H6J B;  3BY8 A;  3H82 B;  4GCZ A;  4CLC A;  5KSH A;  4EEU A;  3C30 A;  3HJK A;  1W63 M;  1LL8 A;  1T1A A;  3JVU A;  5L8M A;  4L9F A;  2R78 A;  3UE3 A;  5AVE A;  1ZHH B;  2VX8 A;  2VGL S;  2PD7 A;  2HJ9 C;  2Z6C A;  5IU1 A;  2DMW A;  4LPZ A;  1F5M A;  2PDR A;  2QJ5 A;  3IS2 B;  1V9Z A;  3P01 A;  3UB9 A;  1IFQ A;  4B9O A;  3HCY A;  3OC2 A;  4R38 A;  5HZH A;  2VV6 A;  2I9V A;  2VV8 A;  3A0S A;  1OTB A;  3CUE C;  5DFY A;  3EWK A;  3T4S A;  3UB8 A;  4EEP A;  4PKY A;  4F3L A;  1YAX A;  4MMN A;  3FPW A;  2PR6 A;  2J80 A;  2HF6 A;  5HDC A;  3KSF A;  5HD5 A;  4ARZ A;  1OTE A;  3PBT A;  1H3Q A;  4QPR A;  3UMD A;  2EWV A;  2J3T C;  2A24 A;  4HJ6 A;  5I5L A;  4BMW A;  5HWV A;  2ZMF A;  2VEA A;  2VLG A;  4E04 A;  3R7W A;  3F1P B;  1VB6 A;  3BY9 A;  4YNR A;  1H8M A;  4HY8 A;  3VE3 A;  1XJ4 A;  2W1R A;  4P6Z S;  4NXG A;  4XT2 A;  4AFI A;  1NWZ A;  5A8B A;  2GZA A;  2XRO A;  4L9E A;  5MC7 A;  5DKL A;  5LBR A;  3A0V A;  3IBJ A;  4RQ9 A;  4CLC C;  2B18 A;  2QWS A;  4O8G A;  4L0L A;  2L4R A;  4LRY C;  2M7V A;  4PAU A;  1TS6 A;  1OTD A;  3U2A A;  4EUV A;  4HI4 A;  1P0Z A;  4Y3I A;  1TD5 A;  5F5Y A;  5HPF A;  2WKR A;  3PBS A;  4G3K A;  2VV7 A;  4KQD A;  1YSP A;  4EQ1 A;  3T4Q A;  2D01 A;  3LIE A;  3LIB A;  3MXQ A;  2PR5 A;  3LID A;  3F1N A;  4HHD A;  2ZMV A;  1OT9 A;  4NXF A;  4GHI A;  4CLC E;  3PBR A;  1OTI A;  5AJG A;  2GJ3 A;  1W63 Q;  3CI6 A;  5HL6 A;  3LIF A;  1XJ2 A;  4R3A A;  3MQO A;  4HJ3 A;  4M4X A;  1GSV A;  2VKS A;  2YKF A;  4HP9 A;  1TS0 A;  3EQV A;  3W2Z A;  3D3O A;  3B47 A;  4I3J A;  2ZBB A;  3BWL A;  1S67 L;  3P7N A;  3H9W A;  2EWW A;  2XSS A;  1N9N A;  2INW A;  3GEC A;  3ZYT A;  4PKY G;  1UGU A;  3FC7 A;  5K5B A;  4II7 A;  3EOI A;  2KDK A;  1JNU A;  2LB9 A;  3S7O A;  1UWN X;  2LB5 A;  3CWF A;  4WF0 A;  4GS9 B;  3LR0 A;  2W1T B;  5J7E A;  2PT7 A;  1MZU A;  1ODV A;  2JKT I;  2P04 A;  4KQO A;  4GLQ A;  4MN6 A;  2JKR I;  4H6J A;  4L9G A;  1IOU A;  4Y5F A;  2KLI A;  4IUK A;  5AVF A;  2KX6 A;  2KOI A;  4BJP A;  3H7W B;  1OT6 A;  1XJ6 A;  1ZTU A;  1DP8 A;  3OOV A;  5DFX A;  4GW9 A;  5EFW A;  1BYW A;  3LYX A;  3EGD C;  3TW8 A;  2V0W A;  3NHQ A;  2OWJ A;  1KOU A;  2L1M A;  1XJ3 A;  1G6O A;  2QKP A;  3E4Q A;  4EET B;  4LLO B;  4R6L A;  1TS7 A;  3EEA A;  3JVV A;  3K3C A;  3T4L A;  3G6O A;  2O99 A;  3GDI A;  5HWW A;  2JN7 A;  4R70 A;  1D06 A;  2Z6D A;  4EW7 A;  2BAS A;  4ARZ B;  2J3T D;  2VZW A;  3HJI A;  4G3V A;  2W27 A;  3FG8 A;  4HQA A;  2A2L A;  1LT0 A;  1TF1 A;  2Y8H A;  2O0Y A;  2VJW A;  1NLZ A;  2CMN A;  2QYB A;  2A24 B;  4HH2 A;  1S66 L;  3F1O B;  3T50 A;  3OBF A;  1T1C A;  4O01 A;  3PR6 A;  4NEE D;  4FSF A;  4IHQ A;  3F1P A;  2QHK A;  4GJ4 A;  1G28 A;  5TBM A;  1DP9 A;  5HDS A;  4DN0 A;  5IS1 A;  3TJZ C;  1DRM A;  3MFX A;  4XT2 B;  2G7U A;  3E4O A;  5HD3 A;  4UEY A;  3LR3 A;  3BJN A;  3KYZ A;  3PBN A;  4IUH A;  5DJU A;  2XA7 M;  4IJG A;  2HGV A;  4CLC D;  5C5K A;  4LRZ E;  1NRJ A;  5HSQ A;  4K08 A;  3ZQ5 A;  4WEJ A;  2V1B A;  3RFB A;  3BW6 A;  3NOP C;  3LR5 A;  4I38 A;  2O9A A;  1T18 A;  4Y2F A;  3PXP A;  3K2N A;  3CIT A;  4PHT A;  5IT5 A;  2D02 A;  2M7U A;  1LSV A;  1F98 A;  2W3H A;  4MCW A;  1P9W A;  4I39 A;  4LRX C;  2B02 A;  2O9C A;  2NUT C;  1D7E A;  1LSW A;  2GX5 A;  1YKD A;  1T19 A;  3VE4 A;  4GHI B;  3T4T A;  1OJG A;  2W3E A;  3TRC A;  3DBA A;  3B42 A;  2WKP A;  2Y79 A;  4G3W A;  2P7J A;  1MKM A;  3A0R A;  4OOL A;  4WEL A;  2K7S A;  3C38 A;  3LR4 A;  4JGR A;  5HDD A;  3CAX A;  1T1B A;  3BQ8 A;  3LI8 A;  4UQI M;  2J3W A;  1EW0 A;  4EXO A;  5CX7 A;  5DJT A;  2YKH A;  3S7P A;  3C2W A;  4CLC B;  4OOM A;  4DJ3 A;  3IBR A;  4JGQ A;  2HJE A;  1N9L A;  1GSW A;  3H82 A;  4YWZ A;  4KUO A;  2W1T A;  1OTA A;  5HWT A;  2M1C A;  5J3W A;  3PYP A;  4O0P A;  3T4O A;  5F6A A;  3NOU C;  3EGX C;  4DJ2 A;  3B33 A;  4KUK A;  1UWP X;  2OAQ 1;  1P9R A;  2PD8 A;  3MR0 A;  4Q0J A;  4WLA A;  3LIC A;  2WKQ A;  3LFV A;  2K2N A;  4HH3 A;  2XA7 S;  2IA2 A;  1P97 A;  3PBQ A;  4NXB A;  5TJJ A;  3H7W A;  3IS2 A;  3KO6 A;  2FZ0 A;  1MC0 A;  3KX0 X;  4F3L B;  2ZOI A;  1TS8 A;  4BBU A;  3VOL A;  2P08 A;  3LIA A;  1N9O A;  3PBO A;  1V9Y A;  3V67 A;  2H28 A;  4Z1W A;  1S4S A;  3OLO A;  2MJ6 A;  3CLO A;  2W3G A;  4YOF A;  3KYQ A;  2VA0 A;  2NUP C;  4EES A;  4JGO A;  2W0N A;  1X0O A;  2HV1 A;  4B93 A;  1XFQ A;  3OCN A;  1GSX A;  3E4P A;  3MQ0 A;  4WUJ A;  2V9A A;  3C8C A;  3D72 A;  4HJ4 A;  3R7W B;  3KSI A;  2GNX A;  3KSG A;  4MN7 A;  5HPI A;  1YSQ A;  2EA9 A;  2PYR A;  3S7N A;  3KSH A;  4BWI A;  2PHY A;  3BQA A;  2ZOH A;  3F1O A;  1NLY A;  3EQU A;  5KIZ A;  5TBM B;  3MJQ A;  4I5S A;  2V0U A;  5DKK A;  2V1A A;  3E98 A;  5FL3 A;  4UQI S;  3EEH A;  2VGL M;  1S1Y A;  4JGP A;  3E0Y A;  3R4K A;  4DMZ A;  3RTY A;  2QJ7 A;  2FH5 A;  3OCL A;  2XRN A;  4FOF A;  2JHE A;  4Q0I A;  3PHY A;  3UME A;  3UB6 A;  3NJA A;  2W3D A;  4NKP A;  3T4J A;  1LSX A;  1OPX A;  3F1N B;  4HP4 A;  3NOT C;  4ZRR A;  5G4Z A;  3CUE A;  3FPV A;  3ULF A;  3K3D A;  1VHM A;  4ME4 A;  4ETZ A;  4I3I A;  4Q0H A;  5DF9 A;  4MDZ A;  4MN5 A;  2K31 A;  1F9I A;  3TE8 A;  4WEK A;  1DP6 A;  3MF0 A;  2O9B A;  3O5Y A;  3SW1 A;  1OJ5 A;  3ICY A;  1XFN A;  2W3F A;  4EU0 A;  4CQH A;  1STZ A;  3UE6 A;  3VV4 A;  4BBT A;  2OWH A;  1Y28 A;  4WN5 A;  1S1Z A;  4HNB A;  4P6Z M;  2JKT M;  4WL9 A;  4NXE A;  4HIA A;  4ETX A;  2JKR M;  5F68 A;  5G4Y A;  2L0W A;  2PYP A;  3S7Q A;  5F69 A;  4EER A;  3RH8 B;  4HOI A;  2OOL A;  3T4K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...