1LSXA

Crystal structure of the methylimidazole-bound bjfixl heme domain
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
116
structure length
116
Chain Sequence
DAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRYRTTSDPHIIGIGRIVTGKRRDGTTFPMHLSIGEMQSGGEPYFTGFVRDLTEHQQTQARLQEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Sensor protein FixL
publication title Structure-based mechanism of O2 sensing and ligand discrimination by the FixL heme domain of Bradyrhizobium japonicum
pubmed doi rcsb
source organism Bradyrhizobium japonicum
total genus 30
structure length 116
sequence length 116
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2002-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1lsxA00
3MQQA 2ZOIA 1Y28A 2PDRA 1F98A 3P7NA 4R3AA 1S1YA 4I3IA 5AVEA 3T50A 3LIEA 1UGUA 3HJIA 4RQ9A 2VEAA 5HD5A 1DP8A 5TBMB 4L9GA 1F9IA 3MQOA 1OT6A 2YKHA 3CWFA 5HSQA 3LUQA 3RH8B 4I39A 1D06A 3CLOA 1GSWA 1TS7A 1P0ZA 2JN7A 4R38A 1VB6A 2PD8A 3VE3A 3MFXA 3F1PB 4M4XA 1T18A 5HZHA 4I38A 1EW0A 1XFQA 4HNBA 5J4EA 4WF0A 2L4RA 5HDSA 4EETB 1X0OA 3K3CA 1LSXA 4JGOA 4GHIA 4NXEA 1JNUA 4NXBA 2WKRA 2HV1A 4GS9B 2PYPA 4BBUA 2WKQA 3UMDA 2K7SA 1LSWA 3F1OA 4XT2B 4HP4A 2R78A 2QJ7A 2VLGA 4B9OA 3FG8A 1OTEA 1V9ZA 4R6LA 2W27A 3UMEA 3PHYA 2QWSA 2CMNA 2WKPA 2Z6DA 4F3LA 4EEPA 2PD7A 3C8CA 1P97A 3B33A 3BWLA 5HWWA 1N9NA 2M1CA 2A24A 2L0WA 5G4ZA 2Z6CA 3LICA 1XFNA 4LRXC 4HQAA 4WL9A 1T1CA 5HDCA 1T1AA 4HP9A 1MZUA 2D01A 1OJ5A 1KOUA 1OJGA 1NWZA 1S4SA 4WLAA 3H82B 5HDDA 3F1NA 4EESA 4HJ6A 3G6OA 3LIDA 4L9EA 4MN5A 3KX0X 1V9YA 3EEHA 1OTDA 3IS2B 3PYPA 4PKYG 1TS8A 1T1BA 2P7JA 2PR5A 5F68A 4NXGA 2H28A 2PHYA 3MXQA 4LLOB 2JHEA 2KDKA 3EWKA 4HI4A 1BYWA 1OTAA 1WA9A 2PR6A 3ZQ5A 4EQ1A 5DKLA 1XJ3A 3BY9A 3VOLA 5I5LA 3LI9A 4YWZA 4LPZA 1OTIA 4JGQA 4K08A 2YKFA 3LIFA 2QHKA 3OLOA 4E04A 2L1MA 1LSVA 5HWTA 1N9OA 1GSVA 2OOLA 4KUOA 3GECA 4HJ4A 3NOUC 4DJ3A 2QJ5A 5J7EA 3H7WA 1TS0A 2INWA 1TS6A 5KIZA 3LIAA 2QKPA 1ODVA 5A8BA 3E4QA 3UB9A 4EERA 3NOPC 1UWPX 5EFWA 2V1BA 5IU1A 5TBMA 3LIBA 1LL8A 2V9AA 4HJ3A 4R70A 3A0RA 1LT0A 3NHQA 3VE4A 2V0WA 4HH3A 2W0NA 4GHIB 5HWVA 4DJ2A 3E4OA 1DP6A 3H9WA 4HOIA 4KUKA 3F1PA 3F1OB 3UE6A 1S1ZA 1N9LA 2PYRA 4KQDA 4HH2A 3A0VA 2OWJA 4LRZE 3UB8A 4HY8A 1DP9A 4EW7A 1S66L 4NXFA 1OTBA 4HHDA 2VV7A 4GS9A 4H6JB 4F3LB 5DJTA 5J3WA 3ICYA 3K3DA 5HD3A 4XT2A 2A24B 2B02A 4JGRA 3C2WA 1GSXA 3A0SA 3MJQA 3UB6A 2GJ3A 4BBTA 3F1NB 1T19A 2J80A 4L9FA 4HIAA 2ZBBA 4BBVA 3MR0A 5DJUA 1XJ4A 2VV8A 1UWNX 3HJKA 4MN6A 3H82A 4GW9A 2V0UA 3FC7A 1OT9A 3D72A 1XJ6A 4WUJA 4WN5A 4I5SA 4I3JA 3IBRA 4EEUA 3NJAA 3LI8A 2BASA 1G28A 4I3AA 3IS2A 1DRMA 3UB7A 3LYXA 2D02A 3E4PA 5F69A 2KX6A 2OWHA 3CAXA 3SW1A 4H6JA 5F6AA 3GDIA 2I9VA 4GCZA 2EA9A 4JGPA 1S4RA 5G4YA 3RTYA 3ULFA 1D7EA 2VV6A 5AVFA 4LRYC 4PKYA 3BY8A 2ZOHA 5IS1A 3NOTC 3H7WB 5DKKA 5F5YA 1XJ2A 4EXOA 2V1AA 1S67L
chains in the Genus database with same CATH superfamily
4S2OA 3TOIA 1M6KA 1Y28A 4OQHA 4S2JA 1H8YA 1F98A 3OPPA 3T1RA 3T4LA 3P7NA 2ZMVA 4I3IA 1MPLA 3T50A 1C3BA 4UQIM 2Y2NA 2KLIA 3LIEA 5HPIA 4E6WA 5M18A 3HLGA 4BLMA 1CJFA 4JF5A 3L7HA 3DWZA 3O87A 2Y2GA 2WKHA 2YKHA 2HGVA 5DVAA 1I2WA 3VP4A 1XXMA 1YT4A 1D06A 1TD5A 1P0ZA 3JVVA 3Q81A 4ARZB 2WAFA 1STZA 5HL6A 3NI9A 4MDZA 3VE3A 3MFXA 1BUEA 3F1PB 4M4XA 4QY5A 1XFQA 4HNBA 5J4EA 4WF0A 3OPHA 1X0OA 2OLUA 3K3CA 3BFEA 4NXBA 3PXPA 4Y0TA 4KG5A 3UMDA 1LSWA 3F1OA 2ZQCA 4XT2B 4HP4A 2ZC7A 2R78A 1QMEA 2V20A 1PFLA 4G3KA 4Y2FA 3FG8A 1YPRA 1OTEA 4R3JA 3NECA 4IEDA 3AGDA 4WZ4A 2Z6DA 4UA6A 4JKTA 2JKRI 1P97A 3BWLA 2MJ6A 3UDIA 5KMWA 2A24A 2L0WA 3Q82A 5FQ9A 3LR0A 4LRXC 4IUKA 4WL9A 3HLBA 1T1AA 2W3HA 2Y8HA 2ZC5B 2PU2A 3GMWA 4Q0IA 3WRTA 4Y0OA 2P08A 1W8QA 5EVIC 2QMIA 1BLPA 4HJ6A 3G6OA 5A93A 3LIDA 1YMSA 3QP4A 3BFCA 4CLCD 1K0KA 4S2LA 3MMHA 4P6ZS 5F68A 3QNBA 2O0YA 4ME4A 1XKZA 2ZMFA 5TJJA 3ZNTA 5E2FA 1ZTUA 2JHEA 2Y2MA 5CECA 4XXRA 3E2LA 4YNRA 3ZG0A 3EWKA 5EVIB 3FPWA 4ID4A 3JYIA 2V1ZA 4IBRA 3BY9A 5EVID 1KVMA 3VV4A 3SS4A 2A49A 4YWZA 4RA7A 3C30A 3TSGA 4JXSA 1MY8A 2YKFA 2QHKA 4PPRA 1JVJA 2L1MA 1N9OA 1DY6A 3N7WA 1J9MA 2IWDA 2XA7S 2QJ5A 4IBXA 4LCLA 2INWA 5A8BA 2ZC6B 4WEKA 5FASA 2JCHA 4EERA 3IF5A 5TGFA 3WWXA 1UWPX 2Y2QA 1VETB 3WS5A 2WUQA 1NXYA 2ZMAA 1HVBA 4R1GA 1M40A 3ZVWA 5IU1A 1LL8A 3T4KA 3ZYTA 4E3MA 1K6SA 2XDMA 2Y4AA 3A0RA 3SZTA 1LT0A 3VE4A 4ETXA 4AFIA 5CGWA 2K31A 3EGXC 2JKRM 2ACGA 1DP6A 1H8MA 5CEBA 1JWPA 2H0YA 4G3VA 4Q8IA 3VMAA 2EXAA 4PM8A 4HOIA 3KSGA 5AQ7A 1XA1A 2EX9A 3IF6C 3OCNA 2ZC4B 5FQKA 3UE6A 1YQSA 1S0WA 1S1ZA 1N9LA 3CPTA 2OWJA 3UB8A 5FAQA 4XUZA 5DJTA 5J3WA 3UPPA 5FSRA 4X1LA 2HP9A 2WADA 5LBRA 3MXRA 4Y0UA 3D3OA 4FD8A 1ERQA 2B02A 4CPKA 4UA9A 3V50A 4RX2A 4S2NC 4DXBA 1BTLA 3DW0A 3C2WA 3IF6B 3MJQA 2GJ3A 4FTXA 4DKIA 4BQMA 1T19A 2I72A 4X69A 4Z1WA 2Y91A 2E8IA 3BM6A 3CJMA 4NG2A 2ZQ7A 4KZ7A 3KYEA 4P87A 3DBAA 3G4PA 3GR2A 4ZRRA 4BBVA 1XJ4A 3BYDA 3A3DA 4R4SA 2VX8A 3PBQA 1ZKJA 4GZBA 4E3LA 3ZG9B 3O88A 2XLNA 2V0UA 3A3JA 1FR1A 4KZBA 1PIOA 4CLCE 4OONA 2XEPA 1XJ6A 3BFGA 4PAUA 5M1AA 3IBRA 5L8MA 3GSGA 1KDSA 4HEFA 3LI8A 1G28A 3B3XA 5F83A 3TE8A 1ZG6A 4DN0A 3UB7A 4UA7A 5FI6A 5F69A 2KX6A 2CC1A 4E3OA 1I5QA 3SS5A 3GDIA 3T4OA 4Y17A 1VEUA 4O7DA 4R3BA 4GCZA 3LY4A 4KZ3A 2EA9A 2PU4A 5JYOA 3RTYA 3ULFA 1D7EA 1LI0A 3KSIA 3VP1A 2PAVP 2UWXA 1K56D 5IS1A 2NUTC 2J7VA 5F5YA 3LEZA 3MQQA 2ZOIA 3M6BA 2DMWA 2PDRA 2GX5A 2WGVA 3ITAA 1S1YA 5DFYA 5AVEA 1ZHHB 5HAPA 5FEGA 4KQOA 3KSFA 2Y2PA 1TEMA 3ZG5A 1U60A 5L07A 1WYCA 1FCMA 4KG2A 5TBMB 4L9GA 4PHTA 4QHCA 4OOMA 1N4OA 1F9IA 3MQOA 2ZM2A 4KZ6A 1MC0A 3T1SA 4Y15A 3N6IA 3EGDC 2E8JA 1LL5A 3RH8B 1GA9A 2O99A 2ZL1B 4OPZA 4JPMA 2JN7A 2EWVA 3CUEC 1HD8A 3UE3A 1ONHA 3PBOA 5CGSA 4H8RA 4LV1A 4E3NA 3G32A 5HZHA 2XRNA 2PT7A 1EW0A 3FV7A 5HDSA 3PBTA 1SKOB 4EETB 1BZAA 3FYZA 3PAGA 4KZAA 4OP8A 1JNUA 1RCJA 3OC2A 2WKRA 1E25A 3D4FA 2HV1A 1K54A 1K6RA 3MQ0A 3HLFA 4GS9B 1YLZA 2J9PA 1FSWA 3CI6A 4KENB 4DE0A 3NCKA 4DE3A 2QJ7A 5TFQA 3BLSA 2HDQA 2VGKA 3TRCA 4C6YA 4B9OA 4M3KA 1V9ZA 2W27A 3UY6A 1IYQA 2Y59A 4F3LA 5CEDA 2PD7A 1IEMA 1FQGA 3HUMA 1TVFA 5AJGA 5HWWA 4GNUA 3ZGAB 2M1CA 5GHZA 4WZ5A 3T1XA 2WZZA 5G4ZA 2Z6CA 3LICA 1L0FA 4WELA 1VHMA 2NUPC 5CX7A 5E2EA 4HQAA 5HDCA 3VOYA 1SDEA 4O8GA 3S4XA 2D01A 1NRFA 1OJ5A 1KOUA 1Y54A 3LEQA 1VM1A 4HBTA 4WLAA 3H82B 4P0MA 3F1NA 1MKIA 3LO7A 2XR0A 5GLAA 1L3LA 2IA2A 3V3SA 4PM5A 1YKDA 4PKYG 1T1BA 2QPNA 3HLWA 4PM9A 4LV3A 5CHJA 5A91A 4GB7A 5FDHA 3FZCA 2PHYA 3GVBA 4L0LA 3SH7A 3V5MA 3FKVA 5HPFA 1I2SA 3IX4A 2HJEA 4WBGA 3R4KA 4BL3A 1TDGA 5FDSA 2Y2KA 1WA9A 2EX8A 2B5RA 3ZQ5A 4DE1A 3B42A 5DKLA 1XJ3A 4WYYA 3GTCA 3LI9A 3NC8A 1P9WA 3IQAA 3SOIA 4JGQA 3W4PA 2FZ0A 3IXGA 4E04A 3KYZA 3AGFA 3IHAA 2ZLYA 4FCFA 4MNRA 2OOLA 4MBHA 2EX2A 4HJ4A 4QB8A 3U2AA 4DJ3A 3N4IA 2Y79A 4GD8A 1IYSA 4Y13A 4XUXA 2VGJA 3CG5A 2QKPA 5AQ9A 1RP5A 3E4QA 2ZM8A 3V67A 4DDYA 1ESIA 1CF0A 4CLCA 5FEFA 2Y2OA 3T1QB 1PZPA 2O9CA 4S2KA 2V1BA 3BEBA 3LCEA 3MZEA 1ZG4A 4HJ3A 3R7WB 4KG6A 2XD1A 2WGWA 2O9BA 1NLYA 2V0WA 3IH8A 4Q0HA 1XGJA 5E2HA 3MFDA 2BLSA 5F1FA 4C75A 1NYYA 4DJ2A 3QP6A 3DAVA 3CITA 3H9WA 2RCXA 4D2OA 3KSHA 3F1OB 3QNCA 3OCLA 2OV5A 3WS0A 5EECA 1OPXA 3A3FA 4KQDA 3ISGA 3NDGA 2XF3A 4HY8A 4BJPA 4BL2A 4EBNA 1CEFA 3K3DA 4B4ZA 4S2IA 2A24B 5CHMA 3VSLA 2HP6A 1AXBA 4MN7A 4BMWA 4JGRA 2EWWA 2VJWA 3HL9A 3S7NA 1GSXA 5AQAA 4WEJA 3TJZC 5L09A 3A0SA 5FAOA 3UB6A 4N92A 1CI9A 1EI5A 2Y2IA 4RX3A 3BLMA 2J80A 1LHYA 2GZAA 1G6OA 2J3WA 4HIAA 2XH9A 3BW6A 1FSYA 2ZBBA 5EUAA 2Q9NA 5F1GA 4OOYA 4MMNA 4DDSA 3G34A 3FC7A 2IWCA 4LGWA 2VGLM 2FH5A 2QZ6A 3D72A 2G7UA 2PRFA 4U0TA 2HDUA 2J9OA 3P98A 4EEUA 3NJAA 4B93A 2H0TA 1DJBA 3IS2A 4C3QA 1DRMA 4E3IA 3O3VA 3CAXA 5EM0A 5F6AA 1ALQA 3IH9A 2I9VA 3MF0A 3O5YA 4YINA 4OLDA 4ZAMA 1BSGA 5G4YA 3GRJA 5FATA 3UO9A 4LRYC 2M7VA 4FSFA 4JF4A 3HLEA 1PWGA 3BY8A 4BD0A 1PZOA 2ZOHA 3BFDA 3DTKA 5DF9A 3U4LP 3NOTC 3Q7VA 3QP1A 1XJ2A 3OBFA 4EXOA 2V1AA 5FA7A 5EE8A 4UQIS 4K91A 4JXVA 1NZUA 5IT5A 4R3AA 4NEED 3TG9A 2WKIA 1FOFA 1PYYA 2LB9A 3T12B 4ESPA 2QYBA 3QHYA 3HJIA 3EQUA 3MSHA 4LV0A 3UE1A 1ZC2A 2HPBA 4R4RA 1FIKA 3UDFA 3CWFA 1XPBA 4N1XA 2HJ9C 4PM6A 3CLOA 3ZHHA 1GSWA 1TS7A 2JKFA 3G2ZA 3IWIA 1EWZA 2DRWA 4R38A 1VB6A 3BRMA 4GN2A 3CHWP 3T4SA 2C5WB 5L10A 2W1TB 5KSHA 5JYPA 3LR4A 1KGEA 5GLBA 1T18A 2JBFA 2L4RA 1IELA 2WGIA 4OPQA 3CPTB 5U47A 1LSXA 3DTIA 4GHIA 4NXEA 3P01A 4KZ5A 3D9YA 1K56A 1BT5A 1G6AA 2WYXA 1W7FA 4BBUA 2WKQA 3OZHA 3DTMA 3HLDA 2VK3A 4OPRA 3Q7ZA 4IVKA 1W63M 2VLGA 1W5DA 2XK1A 4X53A 1CI8A 4GJ4A 4R6LA 3UMEA 4U0XA 2QWSA 1KGGA 2JKTI 4JBFA 3VFHA 3RXWA 1IYPA 2HF6A 5CGXA 5I94A 1N9NA 5HX9A 1JTDA 1O07A 4DF6A 3QP8A 1H5XA 3LR3A 4Q0JA 2H5SA 1J3WA 4UAAA 1T1CA 5M19A 2VKSA 2J8YA 4MEZA 2ZL1A 4OQIA 4ZJ3A 2XROA 3BJNA 3C7UA 3C38A 4JXGA 5HDDA 4CQHA 3UDXA 4Y7PA 4EESA 1PWDA 3ZNYA 4WMCD 4ZJ2A 1E3UD 4WM9A 5CTMA 1H8ZA 2PBDP 2Y2JA 3W4QA 1V9YA 3EEHA 1KVLA 2P9VA 2G2UA 2EFXA 3PYPA 2Q0OA 3MZDA 1TS8A 2W3DA 2HP5A 3EEAA 3C4PA 1YLPA 3ZDJA 4PM7A 1QMFA 2H28A 2Z2LB 4P6ZM 2XFSA 4LLOB 3ZCZA 2KDKA 1NRJA 1YMXA 4HI4A 1OTAA 3CUEA 2ZC3B 4EQ1A 4PMAA 1MWTA 4FH4A 3WS2A 3VOLA 5J8XA 1CK3A 1K55C 3K2NA 3PBRA 5I5LA 1OTIA 5FI2A 1JWVA 4OOLA 5FI7A 4GLQA 3VP3A 4K08A 3HUNA 5L2FA 3LIFA 3IX3A 3FWLA 1K57C 3OLOA 5BOHA 3PBSA 1ERMA 4IVIA 1H3QA 3VP0A 3SH9A 4KUOA 4LCMA 4DRTA 2V8FA 3H7WA 1TS6A 2XA7M 2EX6A 4JF6A 1OMEA 3LIAA 1NJ4A 1XA7A 1ODVA 2JE5A 3WS4A 3ZFZA 4E3JA 3UB9A 1MKMA 2W1RA 1Q2PA 5GHXA 1YLYA 4OQGA 4X55A 1PW1A 3DTEA 4N1HA 3UB5P 2GDNA 3W8KA 4MBKA 1WYBA 1PI5A 4OLGA 4HBUA 4HESA 3N8SA 4ZBEA 2GNXA 5GL9A 3JVUA 3LGOA 2WAEA 3A3EA 3JPUA 4RVAA 2W0NA 4O01A 3NY4A 3E98A 4S2PA 3G35A 2JKTM 2HDSA 4ARZA 4Z9QA 5EVEA 5EOOA 1ONGA 1CQAA 1ES3A 4DMZA 3F1PA 3IXHA 3SS3A 1FCOA 3HLCA 4A5RA 4ZDXA 2V2FF 2PYRA 3FPVA 2R9XA 3S22A 1L2SA 3V39A 4EW7A 1DP9A 1S66L 4NXFA 3C4OA 1OTBA 5KZHA 4HHDA 3HUOA 4LENA 2VV7A 1AWIA 3PTEA 1A0KA 4FUWA 4H6JB 4F3LB 1YLTA 2X71A 5FAPA 5CXWA 5HD3A 4XT2A 3MBZA 1LI9A 3BQ8A 2ZD8A 3EQVA 1FR6A 4BENA 1K4EA 1DJCA 1S6RA 1Q2QA 3N8LA 4Y5FA 4B4XA 2ZJ9A 3MS6A 3DWKA 2W3EA 4D60A 3VOZA 4BBTA 1WE4A 3F1NB 2VZWA 4KQQA 1YLWA 1GHMA 3W2ZA 2EFUA 1NZOA 3HBRA 5DTTA 3R7WA 1K38A 5FQJA 3RJUA 2DNSA 2O9AA 5FQQA 3NIAA 4KQRA 1TF1A 4MN6A 1YAXA 4EWFA 1ES4A 3RXXA 3M2KA 3V3RA 5G18A 3G31A 4QJGA 3SH8A 1L0DA 3IWOA 4I3JA 5DF8A 5IHVA 2BASA 2A3UA 5DTSA 2A2LA 1TDLA 1VQQA 1W8YA 3LYXA 4QWOA 2R9WA 4CLCC 5A92A 5FQIA 3NBLA 4RYEA 4EBPA 1PW8A 2H10A 2X02A 4KZ8A 1IYOA 1MBLA 3UE0A 1Z09A 1S4RA 2VV6A 2HDRA 3I7JA 1BLHA 4PKYA 5EVIA 3IXDA 1L0EA 3IHBA 2RL3A 3UN7A 1BULA 5DKKA 4ZJ1A 1S67L 5FQMA 4OVDA 4QD4A 2AVXA 5F82A 2OAQ1 5HW3A 2C6WB 5AQBA 4FOFA 1XP4A 4II7A 4CLCB 2OLVA 2EXBA 4IHQA 3HCYA 5DF7A 1UGUA 3A3IA 5GLCA 4RQ9A 2VEAA 3AGEA 5HD5A 1D1JA 1DP8A 3BQAA 3ZVTA 4IUHA 3UNWA 1ES2A 1GHPA 4EV4A 1ES5A 3S1YA 1KE3A 1PNEA 1OT6A 5HSQA 2Z2MB 3LUQA 2WGWB 4I39A 4GDBA 4NK3A 4UEYA 3GQZA 2P04A 2OAP1 4R23A 1VETA 2XGNA 2Y2LA 3IXBA 1N9BA 2ZQ9A 2PD8A 1GCEA 3KO6A 1NY0A 4I38A 1NLZA 3PBNA 5CRFA 4G3WA 5HL1A 5EVLA 4JGOA 3NDEA 3LR5A 3G2YA 2PYPA 4P6BA 3T4QA 1SDNA 2FFYA 5GHYA 2K7SA 1JWZA 3T4TA 4KZ4A 1JTGA 4E3KA 4JLFA 3HVFA 3PHYA 4R0QA 1SCWA 2CMNA 1MWUA 2WKPA 5DFXA 3B47A 1K25A 2K2NA 2LB5A 4QY6A 4EEPA 3IWQA 5EOEA 5HFOA 3C8CA 3B33A 2ZQAA 3IX8A 1Y4OA 1HTZA 1GHIA 1FILA 4X68A 4UHUA 1XFNA 1IKGA 3PAEA 4N9KA 4X56A 3VP2A 4OH0A 4K0XA 2ZQDA 4HP9A 3EOIA 1MZUA 4OPYA 3LY3A 5D3OA 1OJGA 1NWZA 1S4SA 3IF6A 1YLJA 4Y3IA 1YSPA 4QU3A 4DE2A 4O0PA 1HZOA 2FFFB 3IT9A 1RGZA 2W1TA 3BFFA 3CMZA 1GA0A 4L9EA 4MN5A 4P85A 3KX0X 1OTDA 2J3TC 2ZQ8A 3IS2B 5CTNA 2P7JA 2OSUA 2PR5A 4LFUA 4NXGA 1SKFA 3OOVA 1LLBA 4X6TA 1MXOA 3MXQA 4EUZA 4S2NA 2Y2HA 1XX2A 4LV2A 1IFQA 5HAQA 3ITBA 5FL3A 3GV9A 1G5UA 1MWRA 3OPRA 1BYWA 2B18A 4E6XA 5CERA 1XGIA 2PR6A 3C7VA 5TR7A 1ACFA 3N8RA 3Q7VB 3TW8A 4IJGA 4LPZA 1F5MA 1DJAA 4EU0A 1H0MA 4NETA 3S7OA 3M2JA 5E2GA 1SZVA 1YSQA 1LSVA 5HWTA 3VFFA 3BECA 1P9RA 2J3TD 1GSVA 3E2KA 3S7QA 3GECA 3NOUC 5J7EA 3W4OA 1TS0A 3C5AA 4WMCA 5KIZA 1E3UA 3VSKA 3UPOA 3CZDA 5EV0A 4K0WA 1EROA 3NOPC 2KOIA 1PI4A 3QP5A 2JC7A 5EFWA 5HAIA 3NULA 1SHVA 5TBMA 3IBJA 3LIBA 2DCFA 1MWSA 2V9AA 2W3GA 3MZFA 4R70A 1PWCA 4EUVA 4ZTKA 1ESUA 3NHQA 3MXSA 4HH3A 5CHUA 5A90A 5KSCA 3S7PA 1Z6FA 4GHIB 3RFBA 1BLSA 5HWVA 3E4OA 3M6HA 2Y55A 4QPRA 4KUKA 1E4DA 4DXCA 1NYMA 1KE0A 2X01A 1K4FA 1FCNA 2IWBA 1O7EA 1SKOA 5EM1A 4OP5A 4HH2A 4JXWA 3A0VA 4FH2A 4LRZE 4OQ0A 3WS1A 4MLLA 3Q07A 4X25A 4GS9A 3OPLA 1KGFA 4YOFA 3LFVA 1VEUB 3ICYA 1IKIA 2PBYA 4GD6A 3QP2A 2XSSA 2XQZA 4OKPA 3T4JA 1W63Q 4U3TA 4GKUA 1YM1A 2Q9MA 2M7UA 2JKGA 5GLDA 2UV0E 2BTFP 1F2KA 3O86A 1K55A 1PRQA 4GDNA 2BG1A 4S2MA 4BD1A 1KE4A 3FKWA 3UPNA 1LL9A 4EQIA 4X1MA 4L9FA 1K57A 1CEGA 3MKFA 2V8CA 5MC7A 4N9LA 5C5KA 1RGYA 4MCWA 3MR0A 5DJUA 2WZXA 2VV8A 2P9VB 2XD5A 4KZ9A 5E43A 1UWNX 3ZG8B 3HJKA 3H82A 2VGLS 5HARA 1K54C 4GW9A 4YFMA 5DTKA 2VA0A 2XFTA 1W79A 2ZM0A 4MBFA 1OT9A 1L0GA 4WUJA 2P74A 4WN5A 4I5SA 4ETZA 1HLUP 2G2WA 4BWIA 3P09A 4I3AA 1G68A 4F94A 2D02A 3E4PA 3ZG7B 2OWHA 3SW1A 4H6JA 3E0YA 3Q1FA 4NKPA 3WRZA 2WKEA 4WZ5C 2WK0A 1BLCA 3HREA 4JGPA 5EPHA 3PR6A 4B88A 4GOGA 5AVFA 3KYQA 4EBLA 1KDWA 2HZ5A 1IOUA 4CJNA 3G30A 3L9KA 3MKEA 2B95A 2W3FA 3H7WB 5K5BA
chains in the Genus database with same CATH topology
3MQQA 2ZOIA 4UQIS 5IT5A 1Y28A 2DMWA 2PDRA 1F98A 2GX5A 3T4LA 3P7NA 4R3AA 4NEED 1S1YA 2ZMVA 2OAQ1 1ZHHB 4I3IA 5DFYA 5AVEA 3T50A 4FOFA 4UQIM 4KQOA 4II7A 2KLIA 3KSFA 4CLCB 3LIEA 4IHQA 2LB9A 5HPIA 3HCYA 2QYBA 1UGUA 3HJIA 4RQ9A 3EQUA 2VEAA 5HD5A 1DP8A 3BQAA 4IUHA 5TBMB 4L9GA 4PHTA 4OOMA 1F9IA 3MQOA 1MC0A 1OT6A 2YKHA 2HGVA 3CWFA 5HSQA 3EGDC 3LUQA 3RH8B 4I39A 2O99A 2HJ9C 1D06A 3CLOA 1GSWA 1TD5A 4UEYA 1TS7A 2P04A 2OAP1 1P0ZA 3JVVA 2JN7A 4R38A 2EWVA 1VB6A 3CUEC 4ARZB 3UE3A 1STZA 2PD8A 3PBOA 5HL6A 3T4SA 2W1TB 5KSHA 4MDZA 3VE3A 3LR4A 3KO6A 3MFXA 3F1PB 4M4XA 1T18A 5HZHA 2XRNA 2PT7A 1EW0A 4I38A 1NLZA 3PBNA 1XFQA 4G3WA 4HNBA 5J4EA 4WF0A 2L4RA 5HDSA 3PBTA 4EETB 1X0OA 3K3CA 1LSXA 4JGOA 4GHIA 4NXEA 1JNUA 3OC2A 3P01A 2WKRA 3PXPA 4NXBA 2HV1A 3LR5A 3MQ0A 4GS9B 2PYPA 4BBUA 2WKQA 3T4QA 3UMDA 2K7SA 3CI6A 1LSWA 3T4TA 3F1OA 4XT2B 4HP4A 2R78A 2QJ7A 4G3KA 1W63M 2VLGA 3TRCA 4B9OA 4Y2FA 3FG8A 1OTEA 1V9ZA 4R6LA 2W27A 4GJ4A 3UMEA 3PHYA 2QWSA 2CMNA 2WKPA 2JKTI 3B47A 2K2NA 2LB5A 5DFXA 2Z6DA 4F3LA 2HF6A 4EEPA 2PD7A 2JKRI 3C8CA 1P97A 3B33A 3BWLA 2MJ6A 5AJGA 5HWWA 1N9NA 2M1CA 2A24A 2L0WA 5G4ZA 3LR3A 4Q0JA 3LR0A 2Z6CA 3LICA 4WELA 1VHMA 1XFNA 4LRXC 2NUPC 5CX7A 4IUKA 4HQAA 4WL9A 1T1CA 5HDCA 1T1AA 2W3HA 4O8GA 2VKSA 4HP9A 2Y8HA 3EOIA 1MZUA 2D01A 4Q0IA 1OJ5A 1KOUA 1OJGA 1NWZA 1S4SA 2XROA 3BJNA 1YSPA 4Y3IA 3C38A 2P08A 4WLAA 3H82B 5HDDA 3F1NA 4CQHA 4EESA 4O0PA 4HJ6A 3G6OA 3LIDA 2W1TA 4L9EA 4MN5A 2IA2A 3KX0X 1V9YA 3EEHA 1OTDA 4CLCD 1YKDA 2J3TC 3IS2B 3PYPA 4PKYG 1TS8A 1T1BA 2W3DA 3EEAA 2P7JA 2PR5A 3MMHA 4P6ZS 5F68A 4NXGA 3OOVA 2H28A 2O0YA 2PHYA 3MXQA 4ME4A 4P6ZM 2ZMFA 4L0LA 5TJJA 4LLOB 1ZTUA 2JHEA 1IFQA 2KDKA 5HPFA 5FL3A 1NRJA 4YNRA 2HJEA 3R4KA 3EWKA 4HI4A 1BYWA 1OTAA 2B18A 3CUEA 3FPWA 1WA9A 2PR6A 3ZQ5A 4EQ1A 3B42A 5DKLA 1XJ3A 3BY9A 3VOLA 3K2NA 3PBRA 3VV4A 5I5LA 3LI9A 4YWZA 1P9WA 4IJGA 4LPZA 1F5MA 1OTIA 3C30A 3TW8A 4EU0A 4JGQA 3S7OA 4OOLA 4GLQA 4K08A 2YKFA 3LIFA 2FZ0A 2QHKA 3OLOA 4E04A 3KYZA 1YSQA 3PBSA 2L1MA 1LSVA 1H3QA 5HWTA 1N9OA 1P9RA 2J3TD 1GSVA 2OOLA 4KUOA 3S7QA 2XA7S 3GECA 4HJ4A 3U2AA 3NOUC 4DJ3A 2QJ5A 5J7EA 3H7WA 1TS0A 2INWA 1TS6A 2XA7M 2Y79A 5KIZA 3LIAA 2QKPA 1ODVA 5A8BA 3E4QA 4WEKA 3UB9A 3V67A 4EERA 1MKMA 2W1RA 3NOPC 2KOIA 4CLCA 1UWPX 2O9CA 5EFWA 2V1BA 5IU1A 5TBMA 3IBJA 3LIBA 1LL8A 2V9AA 2W3GA 3T4KA 4HJ3A 3ZYTA 3R7WB 4R70A 2GNXA 3A0RA 4EUVA 2O9BA 3JVUA 1LT0A 1NLYA 3NHQA 3VE4A 4ETXA 2V0WA 4HH3A 4AFIA 4Q0HA 2W0NA 4O01A 3E98A 2K31A 3S7PA 2JKTM 3EGXC 4GHIB 3RFBA 5HWVA 4ARZA 4DJ2A 3E4OA 2JKRM 1DP6A 1H8MA 3CITA 4G3VA 3H9WA 4QPRA 4HOIA 3KSGA 4KUKA 4DMZA 3KSHA 3F1PA 3OCNA 3F1OB 3OCLA 3UE6A 1S1ZA 1OPXA 1N9LA 2PYRA 3FPVA 4KQDA 4HH2A 3A0VA 2OWJA 4LRZE 3UB8A 4HY8A 1DP9A 4EW7A 1S66L 4BJPA 4NXFA 1OTBA 4HHDA 2VV7A 4GS9A 4YOFA 3LFVA 4H6JB 4F3LB 5DJTA 5J3WA 3ICYA 3K3DA 5HD3A 4XT2A 3BQ8A 2XSSA 3EQVA 2A24B 5LBRA 3T4JA 1W63Q 4MN7A 3D3OA 4BMWA 2B02A 4JGRA 2EWWA 2VJWA 2M7UA 3S7NA 3C2WA 4Y5FA 1GSXA 4WEJA 3TJZC 2W3EA 3A0SA 3MJQA 3UB6A 2GJ3A 4BBTA 3F1NB 2VZWA 1T19A 3W2ZA 2J80A 4L9FA 4Z1WA 2GZAA 1G6OA 2J3WA 4HIAA 3R7WA 5MC7A 3BW6A 5C5KA 2ZBBA 4MCWA 3DBAA 3MR0A 4ZRRA 5DJUA 2O9AA 4BBVA 1XJ4A 2VV8A 2VX8A 4MMNA 1UWNX 1TF1A 3HJKA 4MN6A 3H82A 2VGLS 1YAXA 3PBQA 4GW9A 2VA0A 2V0UA 3FC7A 2VGLM 2FH5A 4CLCE 1OT9A 3D72A 2G7UA 1XJ6A 4WUJA 4WN5A 4I5SA 4ETZA 4PAUA 4I3JA 3IBRA 5L8MA 4EEUA 3NJAA 4BWIA 4B93A 3LI8A 2BASA 1G28A 3TE8A 4I3AA 3IS2A 1DRMA 2A2LA 4DN0A 3UB7A 3LYXA 2D02A 3E4PA 5F69A 4CLCC 2KX6A 2OWHA 3CAXA 3SW1A 4H6JA 3E0YA 5F6AA 3GDIA 3T4OA 2I9VA 4NKPA 3MF0A 4GCZA 3O5YA 2EA9A 4JGPA 3PR6A 1S4RA 5G4YA 3RTYA 3ULFA 1D7EA 2VV6A 5AVFA 4LRYC 2M7VA 4FSFA 4PKYA 3KYQA 3BY8A 3KSIA 1IOUA 2ZOHA 5DF9A 5IS1A 2NUTC 3NOTC 2W3FA 3H7WB 5DKKA 5F5YA 1XJ2A 3OBFA 4EXOA 2V1AA 1S67L 5K5BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MQQ A;  2ZOI A;  1Y28 A;  2PDR A;  1F98 A;  3P7N A;  4R3A A;  1S1Y A;  4I3I A;  5AVE A;  3T50 A;  3LIE A;  1UGU A;  3HJI A;  4RQ9 A;  2VEA A;  5HD5 A;  1DP8 A;  5TBM B;  4L9G A;  1F9I A;  3MQO A;  1OT6 A;  2YKH A;  3CWF A;  5HSQ A;  3LUQ A;  3RH8 B;  4I39 A;  1D06 A;  3CLO A;  1GSW A;  1TS7 A;  1P0Z A;  2JN7 A;  4R38 A;  1VB6 A;  2PD8 A;  3VE3 A;  3MFX A;  3F1P B;  4M4X A;  1T18 A;  5HZH A;  4I38 A;  1EW0 A;  1XFQ A;  4HNB A;  5J4E A;  4WF0 A;  2L4R A;  5HDS A;  4EET B;  1X0O A;  3K3C A;  1LSX A;  4JGO A;  4GHI A;  4NXE A;  1JNU A;  4NXB A;  2WKR A;  2HV1 A;  4GS9 B;  2PYP A;  4BBU A;  2WKQ A;  3UMD A;  2K7S A;  1LSW A;  3F1O A;  4XT2 B;  4HP4 A;  2R78 A;  2QJ7 A;  2VLG A;  4B9O A;  3FG8 A;  1OTE A;  1V9Z A;  4R6L A;  2W27 A;  3UME A;  3PHY A;  2QWS A;  2CMN A;  2WKP A;  2Z6D A;  4F3L A;  4EEP A;  2PD7 A;  3C8C A;  1P97 A;  3B33 A;  3BWL A;  5HWW A;  1N9N A;  2M1C A;  2A24 A;  2L0W A;  5G4Z A;  2Z6C A;  3LIC A;  1XFN A;  4LRX C;  4HQA A;  4WL9 A;  1T1C A;  5HDC A;  1T1A A;  4HP9 A;  1MZU A;  2D01 A;  1OJ5 A;  1KOU A;  1OJG A;  1NWZ A;  1S4S A;  4WLA A;  3H82 B;  5HDD A;  3F1N A;  4EES A;  4HJ6 A;  3G6O A;  3LID A;  4L9E A;  4MN5 A;  3KX0 X;  1V9Y A;  3EEH A;  1OTD A;  3IS2 B;  3PYP A;  4PKY G;  1TS8 A;  1T1B A;  2P7J A;  2PR5 A;  5F68 A;  4NXG A;  2H28 A;  2PHY A;  3MXQ A;  4LLO B;  2JHE A;  2KDK A;  3EWK A;  4HI4 A;  1BYW A;  1OTA A;  1WA9 A;  2PR6 A;  3ZQ5 A;  4EQ1 A;  5DKL A;  1XJ3 A;  3BY9 A;  3VOL A;  5I5L A;  3LI9 A;  4YWZ A;  4LPZ A;  1OTI A;  4JGQ A;  4K08 A;  2YKF A;  3LIF A;  2QHK A;  3OLO A;  4E04 A;  2L1M A;  1LSV A;  5HWT A;  1N9O A;  1GSV A;  2OOL A;  4KUO A;  3GEC A;  4HJ4 A;  3NOU C;  4DJ3 A;  2QJ5 A;  5J7E A;  3H7W A;  1TS0 A;  2INW A;  1TS6 A;  5KIZ A;  3LIA A;  2QKP A;  1ODV A;  5A8B A;  3E4Q A;  3UB9 A;  4EER A;  3NOP C;  1UWP X;  5EFW A;  2V1B A;  5IU1 A;  5TBM A;  3LIB A;  1LL8 A;  2V9A A;  4HJ3 A;  4R70 A;  3A0R A;  1LT0 A;  3NHQ A;  3VE4 A;  2V0W A;  4HH3 A;  2W0N A;  4GHI B;  5HWV A;  4DJ2 A;  3E4O A;  1DP6 A;  3H9W A;  4HOI A;  4KUK A;  3F1P A;  3F1O B;  3UE6 A;  1S1Z A;  1N9L A;  2PYR A;  4KQD A;  4HH2 A;  3A0V A;  2OWJ A;  4LRZ E;  3UB8 A;  4HY8 A;  1DP9 A;  4EW7 A;  1S66 L;  4NXF A;  1OTB A;  4HHD A;  2VV7 A;  4GS9 A;  4H6J B;  4F3L B;  5DJT A;  5J3W A;  3ICY A;  3K3D A;  5HD3 A;  4XT2 A;  2A24 B;  2B02 A;  4JGR A;  3C2W A;  1GSX A;  3A0S A;  3MJQ A;  3UB6 A;  2GJ3 A;  4BBT A;  3F1N B;  1T19 A;  2J80 A;  4L9F A;  4HIA A;  2ZBB A;  4BBV A;  3MR0 A;  5DJU A;  1XJ4 A;  2VV8 A;  1UWN X;  3HJK A;  4MN6 A;  3H82 A;  4GW9 A;  2V0U A;  3FC7 A;  1OT9 A;  3D72 A;  1XJ6 A;  4WUJ A;  4WN5 A;  4I5S A;  4I3J A;  3IBR A;  4EEU A;  3NJA A;  3LI8 A;  2BAS A;  1G28 A;  4I3A A;  3IS2 A;  1DRM A;  3UB7 A;  3LYX A;  2D02 A;  3E4P A;  5F69 A;  2KX6 A;  2OWH A;  3CAX A;  3SW1 A;  4H6J A;  5F6A A;  3GDI A;  2I9V A;  4GCZ A;  2EA9 A;  4JGP A;  1S4R A;  5G4Y A;  3RTY A;  3ULF A;  1D7E A;  2VV6 A;  5AVF A;  4LRY C;  4PKY A;  3BY8 A;  2ZOH A;  5IS1 A;  3NOT C;  3H7W B;  5DKK A;  5F5Y A;  1XJ2 A;  4EXO A;  2V1A A;  1S67 L; 
#chains in the Genus database with same CATH topology
 4S2O A;  3TOI A;  1M6K A;  1Y28 A;  4OQH A;  4S2J A;  1H8Y A;  1F98 A;  3OPP A;  3T1R A;  3T4L A;  3P7N A;  2ZMV A;  4I3I A;  1MPL A;  3T50 A;  1C3B A;  4UQI M;  2Y2N A;  2KLI A;  3LIE A;  5HPI A;  4E6W A;  5M18 A;  3HLG A;  4BLM A;  1CJF A;  4JF5 A;  3L7H A;  3DWZ A;  3O87 A;  2Y2G A;  2WKH A;  2YKH A;  2HGV A;  5DVA A;  1I2W A;  3VP4 A;  1XXM A;  1YT4 A;  1D06 A;  1TD5 A;  1P0Z A;  3JVV A;  3Q81 A;  4ARZ B;  2WAF A;  1STZ A;  5HL6 A;  3NI9 A;  4MDZ A;  3VE3 A;  3MFX A;  1BUE A;  3F1P B;  4M4X A;  4QY5 A;  1XFQ A;  4HNB A;  5J4E A;  4WF0 A;  3OPH A;  1X0O A;  2OLU A;  3K3C A;  3BFE A;  4NXB A;  3PXP A;  4Y0T A;  4KG5 A;  3UMD A;  1LSW A;  3F1O A;  2ZQC A;  4XT2 B;  4HP4 A;  2ZC7 A;  2R78 A;  1QME A;  2V20 A;  1PFL A;  4G3K A;  4Y2F A;  3FG8 A;  1YPR A;  1OTE A;  4R3J A;  3NEC A;  4IED A;  3AGD A;  4WZ4 A;  2Z6D A;  4UA6 A;  4JKT A;  2JKR I;  1P97 A;  3BWL A;  2MJ6 A;  3UDI A;  5KMW A;  2A24 A;  2L0W A;  3Q82 A;  5FQ9 A;  3LR0 A;  4LRX C;  4IUK A;  4WL9 A;  3HLB A;  1T1A A;  2W3H A;  2Y8H A;  2ZC5 B;  2PU2 A;  3GMW A;  4Q0I A;  3WRT A;  4Y0O A;  2P08 A;  1W8Q A;  5EVI C;  2QMI A;  1BLP A;  4HJ6 A;  3G6O A;  5A93 A;  3LID A;  1YMS A;  3QP4 A;  3BFC A;  4CLC D;  1K0K A;  4S2L A;  3MMH A;  4P6Z S;  5F68 A;  3QNB A;  2O0Y A;  4ME4 A;  1XKZ A;  2ZMF A;  5TJJ A;  3ZNT A;  5E2F A;  1ZTU A;  2JHE A;  2Y2M A;  5CEC A;  4XXR A;  3E2L A;  4YNR A;  3ZG0 A;  3EWK A;  5EVI B;  3FPW A;  4ID4 A;  3JYI A;  2V1Z A;  4IBR A;  3BY9 A;  5EVI D;  1KVM A;  3VV4 A;  3SS4 A;  2A49 A;  4YWZ A;  4RA7 A;  3C30 A;  3TSG A;  4JXS A;  1MY8 A;  2YKF A;  2QHK A;  4PPR A;  1JVJ A;  2L1M A;  1N9O A;  1DY6 A;  3N7W A;  1J9M A;  2IWD A;  2XA7 S;  2QJ5 A;  4IBX A;  4LCL A;  2INW A;  5A8B A;  2ZC6 B;  4WEK A;  5FAS A;  2JCH A;  4EER A;  3IF5 A;  5TGF A;  3WWX A;  1UWP X;  2Y2Q A;  1VET B;  3WS5 A;  2WUQ A;  1NXY A;  2ZMA A;  1HVB A;  4R1G A;  1M40 A;  3ZVW A;  5IU1 A;  1LL8 A;  3T4K A;  3ZYT A;  4E3M A;  1K6S A;  2XDM A;  2Y4A A;  3A0R A;  3SZT A;  1LT0 A;  3VE4 A;  4ETX A;  4AFI A;  5CGW A;  2K31 A;  3EGX C;  2JKR M;  2ACG A;  1DP6 A;  1H8M A;  5CEB A;  1JWP A;  2H0Y A;  4G3V A;  4Q8I A;  3VMA A;  2EXA A;  4PM8 A;  4HOI A;  3KSG A;  5AQ7 A;  1XA1 A;  2EX9 A;  3IF6 C;  3OCN A;  2ZC4 B;  5FQK A;  3UE6 A;  1YQS A;  1S0W A;  1S1Z A;  1N9L A;  3CPT A;  2OWJ A;  3UB8 A;  5FAQ A;  4XUZ A;  5DJT A;  5J3W A;  3UPP A;  5FSR A;  4X1L A;  2HP9 A;  2WAD A;  5LBR A;  3MXR A;  4Y0U A;  3D3O A;  4FD8 A;  1ERQ A;  2B02 A;  4CPK A;  4UA9 A;  3V50 A;  4RX2 A;  4S2N C;  4DXB A;  1BTL A;  3DW0 A;  3C2W A;  3IF6 B;  3MJQ A;  2GJ3 A;  4FTX A;  4DKI A;  4BQM A;  1T19 A;  2I72 A;  4X69 A;  4Z1W A;  2Y91 A;  2E8I A;  3BM6 A;  3CJM A;  4NG2 A;  2ZQ7 A;  4KZ7 A;  3KYE A;  4P87 A;  3DBA A;  3G4P A;  3GR2 A;  4ZRR A;  4BBV A;  1XJ4 A;  3BYD A;  3A3D A;  4R4S A;  2VX8 A;  3PBQ A;  1ZKJ A;  4GZB A;  4E3L A;  3ZG9 B;  3O88 A;  2XLN A;  2V0U A;  3A3J A;  1FR1 A;  4KZB A;  1PIO A;  4CLC E;  4OON A;  2XEP A;  1XJ6 A;  3BFG A;  4PAU A;  5M1A A;  3IBR A;  5L8M A;  3GSG A;  1KDS A;  4HEF A;  3LI8 A;  1G28 A;  3B3X A;  5F83 A;  3TE8 A;  1ZG6 A;  4DN0 A;  3UB7 A;  4UA7 A;  5FI6 A;  5F69 A;  2KX6 A;  2CC1 A;  4E3O A;  1I5Q A;  3SS5 A;  3GDI A;  3T4O A;  4Y17 A;  1VEU A;  4O7D A;  4R3B A;  4GCZ A;  3LY4 A;  4KZ3 A;  2EA9 A;  2PU4 A;  5JYO A;  3RTY A;  3ULF A;  1D7E A;  1LI0 A;  3KSI A;  3VP1 A;  2PAV P;  2UWX A;  1K56 D;  5IS1 A;  2NUT C;  2J7V A;  5F5Y A;  3LEZ A;  3MQQ A;  2ZOI A;  3M6B A;  2DMW A;  2PDR A;  2GX5 A;  2WGV A;  3ITA A;  1S1Y A;  5DFY A;  5AVE A;  1ZHH B;  5HAP A;  5FEG A;  4KQO A;  3KSF A;  2Y2P A;  1TEM A;  3ZG5 A;  1U60 A;  5L07 A;  1WYC A;  1FCM A;  4KG2 A;  5TBM B;  4L9G A;  4PHT A;  4QHC A;  4OOM A;  1N4O A;  1F9I A;  3MQO A;  2ZM2 A;  4KZ6 A;  1MC0 A;  3T1S A;  4Y15 A;  3N6I A;  3EGD C;  2E8J A;  1LL5 A;  3RH8 B;  1GA9 A;  2O99 A;  2ZL1 B;  4OPZ A;  4JPM A;  2JN7 A;  2EWV A;  3CUE C;  1HD8 A;  3UE3 A;  1ONH A;  3PBO A;  5CGS A;  4H8R A;  4LV1 A;  4E3N A;  3G32 A;  5HZH A;  2XRN A;  2PT7 A;  1EW0 A;  3FV7 A;  5HDS A;  3PBT A;  1SKO B;  4EET B;  1BZA A;  3FYZ A;  3PAG A;  4KZA A;  4OP8 A;  1JNU A;  1RCJ A;  3OC2 A;  2WKR A;  1E25 A;  3D4F A;  2HV1 A;  1K54 A;  1K6R A;  3MQ0 A;  3HLF A;  4GS9 B;  1YLZ A;  2J9P A;  1FSW A;  3CI6 A;  4KEN B;  4DE0 A;  3NCK A;  4DE3 A;  2QJ7 A;  5TFQ A;  3BLS A;  2HDQ A;  2VGK A;  3TRC A;  4C6Y A;  4B9O A;  4M3K A;  1V9Z A;  2W27 A;  3UY6 A;  1IYQ A;  2Y59 A;  4F3L A;  5CED A;  2PD7 A;  1IEM A;  1FQG A;  3HUM A;  1TVF A;  5AJG A;  5HWW A;  4GNU A;  3ZGA B;  2M1C A;  5GHZ A;  4WZ5 A;  3T1X A;  2WZZ A;  5G4Z A;  2Z6C A;  3LIC A;  1L0F A;  4WEL A;  1VHM A;  2NUP C;  5CX7 A;  5E2E A;  4HQA A;  5HDC A;  3VOY A;  1SDE A;  4O8G A;  3S4X A;  2D01 A;  1NRF A;  1OJ5 A;  1KOU A;  1Y54 A;  3LEQ A;  1VM1 A;  4HBT A;  4WLA A;  3H82 B;  4P0M A;  3F1N A;  1MKI A;  3LO7 A;  2XR0 A;  5GLA A;  1L3L A;  2IA2 A;  3V3S A;  4PM5 A;  1YKD A;  4PKY G;  1T1B A;  2QPN A;  3HLW A;  4PM9 A;  4LV3 A;  5CHJ A;  5A91 A;  4GB7 A;  5FDH A;  3FZC A;  2PHY A;  3GVB A;  4L0L A;  3SH7 A;  3V5M A;  3FKV A;  5HPF A;  1I2S A;  3IX4 A;  2HJE A;  4WBG A;  3R4K A;  4BL3 A;  1TDG A;  5FDS A;  2Y2K A;  1WA9 A;  2EX8 A;  2B5R A;  3ZQ5 A;  4DE1 A;  3B42 A;  5DKL A;  1XJ3 A;  4WYY A;  3GTC A;  3LI9 A;  3NC8 A;  1P9W A;  3IQA A;  3SOI A;  4JGQ A;  3W4P A;  2FZ0 A;  3IXG A;  4E04 A;  3KYZ A;  3AGF A;  3IHA A;  2ZLY A;  4FCF A;  4MNR A;  2OOL A;  4MBH A;  2EX2 A;  4HJ4 A;  4QB8 A;  3U2A A;  4DJ3 A;  3N4I A;  2Y79 A;  4GD8 A;  1IYS A;  4Y13 A;  4XUX A;  2VGJ A;  3CG5 A;  2QKP A;  5AQ9 A;  1RP5 A;  3E4Q A;  2ZM8 A;  3V67 A;  4DDY A;  1ESI A;  1CF0 A;  4CLC A;  5FEF A;  2Y2O A;  3T1Q B;  1PZP A;  2O9C A;  4S2K A;  2V1B A;  3BEB A;  3LCE A;  3MZE A;  1ZG4 A;  4HJ3 A;  3R7W B;  4KG6 A;  2XD1 A;  2WGW A;  2O9B A;  1NLY A;  2V0W A;  3IH8 A;  4Q0H A;  1XGJ A;  5E2H A;  3MFD A;  2BLS A;  5F1F A;  4C75 A;  1NYY A;  4DJ2 A;  3QP6 A;  3DAV A;  3CIT A;  3H9W A;  2RCX A;  4D2O A;  3KSH A;  3F1O B;  3QNC A;  3OCL A;  2OV5 A;  3WS0 A;  5EEC A;  1OPX A;  3A3F A;  4KQD A;  3ISG A;  3NDG A;  2XF3 A;  4HY8 A;  4BJP A;  4BL2 A;  4EBN A;  1CEF A;  3K3D A;  4B4Z A;  4S2I A;  2A24 B;  5CHM A;  3VSL A;  2HP6 A;  1AXB A;  4MN7 A;  4BMW A;  4JGR A;  2EWW A;  2VJW A;  3HL9 A;  3S7N A;  1GSX A;  5AQA A;  4WEJ A;  3TJZ C;  5L09 A;  3A0S A;  5FAO A;  3UB6 A;  4N92 A;  1CI9 A;  1EI5 A;  2Y2I A;  4RX3 A;  3BLM A;  2J80 A;  1LHY A;  2GZA A;  1G6O A;  2J3W A;  4HIA A;  2XH9 A;  3BW6 A;  1FSY A;  2ZBB A;  5EUA A;  2Q9N A;  5F1G A;  4OOY A;  4MMN A;  4DDS A;  3G34 A;  3FC7 A;  2IWC A;  4LGW A;  2VGL M;  2FH5 A;  2QZ6 A;  3D72 A;  2G7U A;  2PRF A;  4U0T A;  2HDU A;  2J9O A;  3P98 A;  4EEU A;  3NJA A;  4B93 A;  2H0T A;  1DJB A;  3IS2 A;  4C3Q A;  1DRM A;  4E3I A;  3O3V A;  3CAX A;  5EM0 A;  5F6A A;  1ALQ A;  3IH9 A;  2I9V A;  3MF0 A;  3O5Y A;  4YIN A;  4OLD A;  4ZAM A;  1BSG A;  5G4Y A;  3GRJ A;  5FAT A;  3UO9 A;  4LRY C;  2M7V A;  4FSF A;  4JF4 A;  3HLE A;  1PWG A;  3BY8 A;  4BD0 A;  1PZO A;  2ZOH A;  3BFD A;  3DTK A;  5DF9 A;  3U4L P;  3NOT C;  3Q7V A;  3QP1 A;  1XJ2 A;  3OBF A;  4EXO A;  2V1A A;  5FA7 A;  5EE8 A;  4UQI S;  4K91 A;  4JXV A;  1NZU A;  5IT5 A;  4R3A A;  4NEE D;  3TG9 A;  2WKI A;  1FOF A;  1PYY A;  2LB9 A;  3T12 B;  4ESP A;  2QYB A;  3QHY A;  3HJI A;  3EQU A;  3MSH A;  4LV0 A;  3UE1 A;  1ZC2 A;  2HPB A;  4R4R A;  1FIK A;  3UDF A;  3CWF A;  1XPB A;  4N1X A;  2HJ9 C;  4PM6 A;  3CLO A;  3ZHH A;  1GSW A;  1TS7 A;  2JKF A;  3G2Z A;  3IWI A;  1EWZ A;  2DRW A;  4R38 A;  1VB6 A;  3BRM A;  4GN2 A;  3CHW P;  3T4S A;  2C5W B;  5L10 A;  2W1T B;  5KSH A;  5JYP A;  3LR4 A;  1KGE A;  5GLB A;  1T18 A;  2JBF A;  2L4R A;  1IEL A;  2WGI A;  4OPQ A;  3CPT B;  5U47 A;  1LSX A;  3DTI A;  4GHI A;  4NXE A;  3P01 A;  4KZ5 A;  3D9Y A;  1K56 A;  1BT5 A;  1G6A A;  2WYX A;  1W7F A;  4BBU A;  2WKQ A;  3OZH A;  3DTM A;  3HLD A;  2VK3 A;  4OPR A;  3Q7Z A;  4IVK A;  1W63 M;  2VLG A;  1W5D A;  2XK1 A;  4X53 A;  1CI8 A;  4GJ4 A;  4R6L A;  3UME A;  4U0X A;  2QWS A;  1KGG A;  2JKT I;  4JBF A;  3VFH A;  3RXW A;  1IYP A;  2HF6 A;  5CGX A;  5I94 A;  1N9N A;  5HX9 A;  1JTD A;  1O07 A;  4DF6 A;  3QP8 A;  1H5X A;  3LR3 A;  4Q0J A;  2H5S A;  1J3W A;  4UAA A;  1T1C A;  5M19 A;  2VKS A;  2J8Y A;  4MEZ A;  2ZL1 A;  4OQI A;  4ZJ3 A;  2XRO A;  3BJN A;  3C7U A;  3C38 A;  4JXG A;  5HDD A;  4CQH A;  3UDX A;  4Y7P A;  4EES A;  1PWD A;  3ZNY A;  4WMC D;  4ZJ2 A;  1E3U D;  4WM9 A;  5CTM A;  1H8Z A;  2PBD P;  2Y2J A;  3W4Q A;  1V9Y A;  3EEH A;  1KVL A;  2P9V A;  2G2U A;  2EFX A;  3PYP A;  2Q0O A;  3MZD A;  1TS8 A;  2W3D A;  2HP5 A;  3EEA A;  3C4P A;  1YLP A;  3ZDJ A;  4PM7 A;  1QMF A;  2H28 A;  2Z2L B;  4P6Z M;  2XFS A;  4LLO B;  3ZCZ A;  2KDK A;  1NRJ A;  1YMX A;  4HI4 A;  1OTA A;  3CUE A;  2ZC3 B;  4EQ1 A;  4PMA A;  1MWT A;  4FH4 A;  3WS2 A;  3VOL A;  5J8X A;  1CK3 A;  1K55 C;  3K2N A;  3PBR A;  5I5L A;  1OTI A;  5FI2 A;  1JWV A;  4OOL A;  5FI7 A;  4GLQ A;  3VP3 A;  4K08 A;  3HUN A;  5L2F A;  3LIF A;  3IX3 A;  3FWL A;  1K57 C;  3OLO A;  5BOH A;  3PBS A;  1ERM A;  4IVI A;  1H3Q A;  3VP0 A;  3SH9 A;  4KUO A;  4LCM A;  4DRT A;  2V8F A;  3H7W A;  1TS6 A;  2XA7 M;  2EX6 A;  4JF6 A;  1OME A;  3LIA A;  1NJ4 A;  1XA7 A;  1ODV A;  2JE5 A;  3WS4 A;  3ZFZ A;  4E3J A;  3UB9 A;  1MKM A;  2W1R A;  1Q2P A;  5GHX A;  1YLY A;  4OQG A;  4X55 A;  1PW1 A;  3DTE A;  4N1H A;  3UB5 P;  2GDN A;  3W8K A;  4MBK A;  1WYB A;  1PI5 A;  4OLG A;  4HBU A;  4HES A;  3N8S A;  4ZBE A;  2GNX A;  5GL9 A;  3JVU A;  3LGO A;  2WAE A;  3A3E A;  3JPU A;  4RVA A;  2W0N A;  4O01 A;  3NY4 A;  3E98 A;  4S2P A;  3G35 A;  2JKT M;  2HDS A;  4ARZ A;  4Z9Q A;  5EVE A;  5EOO A;  1ONG A;  1CQA A;  1ES3 A;  4DMZ A;  3F1P A;  3IXH A;  3SS3 A;  1FCO A;  3HLC A;  4A5R A;  4ZDX A;  2V2F F;  2PYR A;  3FPV A;  2R9X A;  3S22 A;  1L2S A;  3V39 A;  4EW7 A;  1DP9 A;  1S66 L;  4NXF A;  3C4O A;  1OTB A;  5KZH A;  4HHD A;  3HUO A;  4LEN A;  2VV7 A;  1AWI A;  3PTE A;  1A0K A;  4FUW A;  4H6J B;  4F3L B;  1YLT A;  2X71 A;  5FAP A;  5CXW A;  5HD3 A;  4XT2 A;  3MBZ A;  1LI9 A;  3BQ8 A;  2ZD8 A;  3EQV A;  1FR6 A;  4BEN A;  1K4E A;  1DJC A;  1S6R A;  1Q2Q A;  3N8L A;  4Y5F A;  4B4X A;  2ZJ9 A;  3MS6 A;  3DWK A;  2W3E A;  4D60 A;  3VOZ A;  4BBT A;  1WE4 A;  3F1N B;  2VZW A;  4KQQ A;  1YLW A;  1GHM A;  3W2Z A;  2EFU A;  1NZO A;  3HBR A;  5DTT A;  3R7W A;  1K38 A;  5FQJ A;  3RJU A;  2DNS A;  2O9A A;  5FQQ A;  3NIA A;  4KQR A;  1TF1 A;  4MN6 A;  1YAX A;  4EWF A;  1ES4 A;  3RXX A;  3M2K A;  3V3R A;  5G18 A;  3G31 A;  4QJG A;  3SH8 A;  1L0D A;  3IWO A;  4I3J A;  5DF8 A;  5IHV A;  2BAS A;  2A3U A;  5DTS A;  2A2L A;  1TDL A;  1VQQ A;  1W8Y A;  3LYX A;  4QWO A;  2R9W A;  4CLC C;  5A92 A;  5FQI A;  3NBL A;  4RYE A;  4EBP A;  1PW8 A;  2H10 A;  2X02 A;  4KZ8 A;  1IYO A;  1MBL A;  3UE0 A;  1Z09 A;  1S4R A;  2VV6 A;  2HDR A;  3I7J A;  1BLH A;  4PKY A;  5EVI A;  3IXD A;  1L0E A;  3IHB A;  2RL3 A;  3UN7 A;  1BUL A;  5DKK A;  4ZJ1 A;  1S67 L;  5FQM A;  4OVD A;  4QD4 A;  2AVX A;  5F82 A;  2OAQ 1;  5HW3 A;  2C6W B;  5AQB A;  4FOF A;  1XP4 A;  4II7 A;  4CLC B;  2OLV A;  2EXB A;  4IHQ A;  3HCY A;  5DF7 A;  1UGU A;  3A3I A;  5GLC A;  4RQ9 A;  2VEA A;  3AGE A;  5HD5 A;  1D1J A;  1DP8 A;  3BQA A;  3ZVT A;  4IUH A;  3UNW A;  1ES2 A;  1GHP A;  4EV4 A;  1ES5 A;  3S1Y A;  1KE3 A;  1PNE A;  1OT6 A;  5HSQ A;  2Z2M B;  3LUQ A;  2WGW B;  4I39 A;  4GDB A;  4NK3 A;  4UEY A;  3GQZ A;  2P04 A;  2OAP 1;  4R23 A;  1VET A;  2XGN A;  2Y2L A;  3IXB A;  1N9B A;  2ZQ9 A;  2PD8 A;  1GCE A;  3KO6 A;  1NY0 A;  4I38 A;  1NLZ A;  3PBN A;  5CRF A;  4G3W A;  5HL1 A;  5EVL A;  4JGO A;  3NDE A;  3LR5 A;  3G2Y A;  2PYP A;  4P6B A;  3T4Q A;  1SDN A;  2FFY A;  5GHY A;  2K7S A;  1JWZ A;  3T4T A;  4KZ4 A;  1JTG A;  4E3K A;  4JLF A;  3HVF A;  3PHY A;  4R0Q A;  1SCW A;  2CMN A;  1MWU A;  2WKP A;  5DFX A;  3B47 A;  1K25 A;  2K2N A;  2LB5 A;  4QY6 A;  4EEP A;  3IWQ A;  5EOE A;  5HFO A;  3C8C A;  3B33 A;  2ZQA A;  3IX8 A;  1Y4O A;  1HTZ A;  1GHI A;  1FIL A;  4X68 A;  4UHU A;  1XFN A;  1IKG A;  3PAE A;  4N9K A;  4X56 A;  3VP2 A;  4OH0 A;  4K0X A;  2ZQD A;  4HP9 A;  3EOI A;  1MZU A;  4OPY A;  3LY3 A;  5D3O A;  1OJG A;  1NWZ A;  1S4S A;  3IF6 A;  1YLJ A;  4Y3I A;  1YSP A;  4QU3 A;  4DE2 A;  4O0P A;  1HZO A;  2FFF B;  3IT9 A;  1RGZ A;  2W1T A;  3BFF A;  3CMZ A;  1GA0 A;  4L9E A;  4MN5 A;  4P85 A;  3KX0 X;  1OTD A;  2J3T C;  2ZQ8 A;  3IS2 B;  5CTN A;  2P7J A;  2OSU A;  2PR5 A;  4LFU A;  4NXG A;  1SKF A;  3OOV A;  1LLB A;  4X6T A;  1MXO A;  3MXQ A;  4EUZ A;  4S2N A;  2Y2H A;  1XX2 A;  4LV2 A;  1IFQ A;  5HAQ A;  3ITB A;  5FL3 A;  3GV9 A;  1G5U A;  1MWR A;  3OPR A;  1BYW A;  2B18 A;  4E6X A;  5CER A;  1XGI A;  2PR6 A;  3C7V A;  5TR7 A;  1ACF A;  3N8R A;  3Q7V B;  3TW8 A;  4IJG A;  4LPZ A;  1F5M A;  1DJA A;  4EU0 A;  1H0M A;  4NET A;  3S7O A;  3M2J A;  5E2G A;  1SZV A;  1YSQ A;  1LSV A;  5HWT A;  3VFF A;  3BEC A;  1P9R A;  2J3T D;  1GSV A;  3E2K A;  3S7Q A;  3GEC A;  3NOU C;  5J7E A;  3W4O A;  1TS0 A;  3C5A A;  4WMC A;  5KIZ A;  1E3U A;  3VSK A;  3UPO A;  3CZD A;  5EV0 A;  4K0W A;  1ERO A;  3NOP C;  2KOI A;  1PI4 A;  3QP5 A;  2JC7 A;  5EFW A;  5HAI A;  3NUL A;  1SHV A;  5TBM A;  3IBJ A;  3LIB A;  2DCF A;  1MWS A;  2V9A A;  2W3G A;  3MZF A;  4R70 A;  1PWC A;  4EUV A;  4ZTK A;  1ESU A;  3NHQ A;  3MXS A;  4HH3 A;  5CHU A;  5A90 A;  5KSC A;  3S7P A;  1Z6F A;  4GHI B;  3RFB A;  1BLS A;  5HWV A;  3E4O A;  3M6H A;  2Y55 A;  4QPR A;  4KUK A;  1E4D A;  4DXC A;  1NYM A;  1KE0 A;  2X01 A;  1K4F A;  1FCN A;  2IWB A;  1O7E A;  1SKO A;  5EM1 A;  4OP5 A;  4HH2 A;  4JXW A;  3A0V A;  4FH2 A;  4LRZ E;  4OQ0 A;  3WS1 A;  4MLL A;  3Q07 A;  4X25 A;  4GS9 A;  3OPL A;  1KGF A;  4YOF A;  3LFV A;  1VEU B;  3ICY A;  1IKI A;  2PBY A;  4GD6 A;  3QP2 A;  2XSS A;  2XQZ A;  4OKP A;  3T4J A;  1W63 Q;  4U3T A;  4GKU A;  1YM1 A;  2Q9M A;  2M7U A;  2JKG A;  5GLD A;  2UV0 E;  2BTF P;  1F2K A;  3O86 A;  1K55 A;  1PRQ A;  4GDN A;  2BG1 A;  4S2M A;  4BD1 A;  1KE4 A;  3FKW A;  3UPN A;  1LL9 A;  4EQI A;  4X1M A;  4L9F A;  1K57 A;  1CEG A;  3MKF A;  2V8C A;  5MC7 A;  4N9L A;  5C5K A;  1RGY A;  4MCW A;  3MR0 A;  5DJU A;  2WZX A;  2VV8 A;  2P9V B;  2XD5 A;  4KZ9 A;  5E43 A;  1UWN X;  3ZG8 B;  3HJK A;  3H82 A;  2VGL S;  5HAR A;  1K54 C;  4GW9 A;  4YFM A;  5DTK A;  2VA0 A;  2XFT A;  1W79 A;  2ZM0 A;  4MBF A;  1OT9 A;  1L0G A;  4WUJ A;  2P74 A;  4WN5 A;  4I5S A;  4ETZ A;  1HLU P;  2G2W A;  4BWI A;  3P09 A;  4I3A A;  1G68 A;  4F94 A;  2D02 A;  3E4P A;  3ZG7 B;  2OWH A;  3SW1 A;  4H6J A;  3E0Y A;  3Q1F A;  4NKP A;  3WRZ A;  2WKE A;  4WZ5 C;  2WK0 A;  1BLC A;  3HRE A;  4JGP A;  5EPH A;  3PR6 A;  4B88 A;  4GOG A;  5AVF A;  3KYQ A;  4EBL A;  1KDW A;  2HZ5 A;  1IOU A;  4CJN A;  3G30 A;  3L9K A;  3MKE A;  2B95 A;  2W3F A;  3H7W B;  5K5B A; 
#chains in the Genus database with same CATH homology
 3MQQ A;  2ZOI A;  4UQI S;  5IT5 A;  1Y28 A;  2DMW A;  2PDR A;  1F98 A;  2GX5 A;  3T4L A;  3P7N A;  4R3A A;  4NEE D;  1S1Y A;  2ZMV A;  2OAQ 1;  1ZHH B;  4I3I A;  5DFY A;  5AVE A;  3T50 A;  4FOF A;  4UQI M;  4KQO A;  4II7 A;  2KLI A;  3KSF A;  4CLC B;  3LIE A;  4IHQ A;  2LB9 A;  5HPI A;  3HCY A;  2QYB A;  1UGU A;  3HJI A;  4RQ9 A;  3EQU A;  2VEA A;  5HD5 A;  1DP8 A;  3BQA A;  4IUH A;  5TBM B;  4L9G A;  4PHT A;  4OOM A;  1F9I A;  3MQO A;  1MC0 A;  1OT6 A;  2YKH A;  2HGV A;  3CWF A;  5HSQ A;  3EGD C;  3LUQ A;  3RH8 B;  4I39 A;  2O99 A;  2HJ9 C;  1D06 A;  3CLO A;  1GSW A;  1TD5 A;  4UEY A;  1TS7 A;  2P04 A;  2OAP 1;  1P0Z A;  3JVV A;  2JN7 A;  4R38 A;  2EWV A;  1VB6 A;  3CUE C;  4ARZ B;  3UE3 A;  1STZ A;  2PD8 A;  3PBO A;  5HL6 A;  3T4S A;  2W1T B;  5KSH A;  4MDZ A;  3VE3 A;  3LR4 A;  3KO6 A;  3MFX A;  3F1P B;  4M4X A;  1T18 A;  5HZH A;  2XRN A;  2PT7 A;  1EW0 A;  4I38 A;  1NLZ A;  3PBN A;  1XFQ A;  4G3W A;  4HNB A;  5J4E A;  4WF0 A;  2L4R A;  5HDS A;  3PBT A;  4EET B;  1X0O A;  3K3C A;  1LSX A;  4JGO A;  4GHI A;  4NXE A;  1JNU A;  3OC2 A;  3P01 A;  2WKR A;  3PXP A;  4NXB A;  2HV1 A;  3LR5 A;  3MQ0 A;  4GS9 B;  2PYP A;  4BBU A;  2WKQ A;  3T4Q A;  3UMD A;  2K7S A;  3CI6 A;  1LSW A;  3T4T A;  3F1O A;  4XT2 B;  4HP4 A;  2R78 A;  2QJ7 A;  4G3K A;  1W63 M;  2VLG A;  3TRC A;  4B9O A;  4Y2F A;  3FG8 A;  1OTE A;  1V9Z A;  4R6L A;  2W27 A;  4GJ4 A;  3UME A;  3PHY A;  2QWS A;  2CMN A;  2WKP A;  2JKT I;  3B47 A;  2K2N A;  2LB5 A;  5DFX A;  2Z6D A;  4F3L A;  2HF6 A;  4EEP A;  2PD7 A;  2JKR I;  3C8C A;  1P97 A;  3B33 A;  3BWL A;  2MJ6 A;  5AJG A;  5HWW A;  1N9N A;  2M1C A;  2A24 A;  2L0W A;  5G4Z A;  3LR3 A;  4Q0J A;  3LR0 A;  2Z6C A;  3LIC A;  4WEL A;  1VHM A;  1XFN A;  4LRX C;  2NUP C;  5CX7 A;  4IUK A;  4HQA A;  4WL9 A;  1T1C A;  5HDC A;  1T1A A;  2W3H A;  4O8G A;  2VKS A;  4HP9 A;  2Y8H A;  3EOI A;  1MZU A;  2D01 A;  4Q0I A;  1OJ5 A;  1KOU A;  1OJG A;  1NWZ A;  1S4S A;  2XRO A;  3BJN A;  1YSP A;  4Y3I A;  3C38 A;  2P08 A;  4WLA A;  3H82 B;  5HDD A;  3F1N A;  4CQH A;  4EES A;  4O0P A;  4HJ6 A;  3G6O A;  3LID A;  2W1T A;  4L9E A;  4MN5 A;  2IA2 A;  3KX0 X;  1V9Y A;  3EEH A;  1OTD A;  4CLC D;  1YKD A;  2J3T C;  3IS2 B;  3PYP A;  4PKY G;  1TS8 A;  1T1B A;  2W3D A;  3EEA A;  2P7J A;  2PR5 A;  3MMH A;  4P6Z S;  5F68 A;  4NXG A;  3OOV A;  2H28 A;  2O0Y A;  2PHY A;  3MXQ A;  4ME4 A;  4P6Z M;  2ZMF A;  4L0L A;  5TJJ A;  4LLO B;  1ZTU A;  2JHE A;  1IFQ A;  2KDK A;  5HPF A;  5FL3 A;  1NRJ A;  4YNR A;  2HJE A;  3R4K A;  3EWK A;  4HI4 A;  1BYW A;  1OTA A;  2B18 A;  3CUE A;  3FPW A;  1WA9 A;  2PR6 A;  3ZQ5 A;  4EQ1 A;  3B42 A;  5DKL A;  1XJ3 A;  3BY9 A;  3VOL A;  3K2N A;  3PBR A;  3VV4 A;  5I5L A;  3LI9 A;  4YWZ A;  1P9W A;  4IJG A;  4LPZ A;  1F5M A;  1OTI A;  3C30 A;  3TW8 A;  4EU0 A;  4JGQ A;  3S7O A;  4OOL A;  4GLQ A;  4K08 A;  2YKF A;  3LIF A;  2FZ0 A;  2QHK A;  3OLO A;  4E04 A;  3KYZ A;  1YSQ A;  3PBS A;  2L1M A;  1LSV A;  1H3Q A;  5HWT A;  1N9O A;  1P9R A;  2J3T D;  1GSV A;  2OOL A;  4KUO A;  3S7Q A;  2XA7 S;  3GEC A;  4HJ4 A;  3U2A A;  3NOU C;  4DJ3 A;  2QJ5 A;  5J7E A;  3H7W A;  1TS0 A;  2INW A;  1TS6 A;  2XA7 M;  2Y79 A;  5KIZ A;  3LIA A;  2QKP A;  1ODV A;  5A8B A;  3E4Q A;  4WEK A;  3UB9 A;  3V67 A;  4EER A;  1MKM A;  2W1R A;  3NOP C;  2KOI A;  4CLC A;  1UWP X;  2O9C A;  5EFW A;  2V1B A;  5IU1 A;  5TBM A;  3IBJ A;  3LIB A;  1LL8 A;  2V9A A;  2W3G A;  3T4K A;  4HJ3 A;  3ZYT A;  3R7W B;  4R70 A;  2GNX A;  3A0R A;  4EUV A;  2O9B A;  3JVU A;  1LT0 A;  1NLY A;  3NHQ A;  3VE4 A;  4ETX A;  2V0W A;  4HH3 A;  4AFI A;  4Q0H A;  2W0N A;  4O01 A;  3E98 A;  2K31 A;  3S7P A;  2JKT M;  3EGX C;  4GHI B;  3RFB A;  5HWV A;  4ARZ A;  4DJ2 A;  3E4O A;  2JKR M;  1DP6 A;  1H8M A;  3CIT A;  4G3V A;  3H9W A;  4QPR A;  4HOI A;  3KSG A;  4KUK A;  4DMZ A;  3KSH A;  3F1P A;  3OCN A;  3F1O B;  3OCL A;  3UE6 A;  1S1Z A;  1OPX A;  1N9L A;  2PYR A;  3FPV A;  4KQD A;  4HH2 A;  3A0V A;  2OWJ A;  4LRZ E;  3UB8 A;  4HY8 A;  1DP9 A;  4EW7 A;  1S66 L;  4BJP A;  4NXF A;  1OTB A;  4HHD A;  2VV7 A;  4GS9 A;  4YOF A;  3LFV A;  4H6J B;  4F3L B;  5DJT A;  5J3W A;  3ICY A;  3K3D A;  5HD3 A;  4XT2 A;  3BQ8 A;  2XSS A;  3EQV A;  2A24 B;  5LBR A;  3T4J A;  1W63 Q;  4MN7 A;  3D3O A;  4BMW A;  2B02 A;  4JGR A;  2EWW A;  2VJW A;  2M7U A;  3S7N A;  3C2W A;  4Y5F A;  1GSX A;  4WEJ A;  3TJZ C;  2W3E A;  3A0S A;  3MJQ A;  3UB6 A;  2GJ3 A;  4BBT A;  3F1N B;  2VZW A;  1T19 A;  3W2Z A;  2J80 A;  4L9F A;  4Z1W A;  2GZA A;  1G6O A;  2J3W A;  4HIA A;  3R7W A;  5MC7 A;  3BW6 A;  5C5K A;  2ZBB A;  4MCW A;  3DBA A;  3MR0 A;  4ZRR A;  5DJU A;  2O9A A;  4BBV A;  1XJ4 A;  2VV8 A;  2VX8 A;  4MMN A;  1UWN X;  1TF1 A;  3HJK A;  4MN6 A;  3H82 A;  2VGL S;  1YAX A;  3PBQ A;  4GW9 A;  2VA0 A;  2V0U A;  3FC7 A;  2VGL M;  2FH5 A;  4CLC E;  1OT9 A;  3D72 A;  2G7U A;  1XJ6 A;  4WUJ A;  4WN5 A;  4I5S A;  4ETZ A;  4PAU A;  4I3J A;  3IBR A;  5L8M A;  4EEU A;  3NJA A;  4BWI A;  4B93 A;  3LI8 A;  2BAS A;  1G28 A;  3TE8 A;  4I3A A;  3IS2 A;  1DRM A;  2A2L A;  4DN0 A;  3UB7 A;  3LYX A;  2D02 A;  3E4P A;  5F69 A;  4CLC C;  2KX6 A;  2OWH A;  3CAX A;  3SW1 A;  4H6J A;  3E0Y A;  5F6A A;  3GDI A;  3T4O A;  2I9V A;  4NKP A;  3MF0 A;  4GCZ A;  3O5Y A;  2EA9 A;  4JGP A;  3PR6 A;  1S4R A;  5G4Y A;  3RTY A;  3ULF A;  1D7E A;  2VV6 A;  5AVF A;  4LRY C;  2M7V A;  4FSF A;  4PKY A;  3KYQ A;  3BY8 A;  3KSI A;  1IOU A;  2ZOH A;  5DF9 A;  5IS1 A;  2NUT C;  3NOT C;  2W3F A;  3H7W B;  5DKK A;  5F5Y A;  1XJ2 A;  3OBF A;  4EXO A;  2V1A A;  1S67 L;  5K5B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...