1LSXA

Crystal structure of the methylimidazole-bound bjfixl heme domain
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
116
structure length
116
Chain Sequence
DAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRYRTTSDPHIIGIGRIVTGKRRDGTTFPMHLSIGEMQSGGEPYFTGFVRDLTEHQQTQARLQEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sensor protein FixL
publication title Structure-based mechanism of O2 sensing and ligand discrimination by the FixL heme domain of Bradyrhizobium japonicum
pubmed doi rcsb
source organism Bradyrhizobium japonicum
molecule tags Transferase
total genus 30
structure length 116
sequence length 116
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2002-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1lsxA00
3C2WA 2L0WA 3GECA 2PHYA 3T50A 4L9GA 4HQAA 2PYPA 1S1YA 3BWLA 1TS8A 3PHYA 5KIZA 1DP9A 1OJGA 3LIBA 3LICA 2BASA 1LL8A 2VV8A 1DRMA 4EETB 4EERA 1LSXA 1LT0A 4KQDA 3E4PA 2A24A 5HDDA 5TBMB 1S4RA 3VE3A 2VEAA 3E4QA 4I3JA 1OT9A 4WUJA 2J80A 3CAXA 4I3AA 5J4EA 1UWNX 3K3DA 5HDSA 2WKQA 3VE4A 4XT2B 1P0ZA 3F1PB 3RTYA 2VV6A 5HD5A 3PYPA 3MQQA 3VOLA 2INWA 3LIDA 4HH2A 4GCZA 1MZUA 2WKRA 4GHIA 1NWZA 1DP6A 4LRZE 4I38A 4NXGA 2OWJA 1D7EA 2W0NA 2YKHA 4K08A 2VLGA 4L9EA 3IBRA 2QJ5A 3EWKA 1T18A 3NOUC 4M4XA 2QWSA 1GSWA 2V0UA 2M1CA 3MR0A 3UB7A 4R38A 1UWPX 1P97A 2QKPA 3IS2A 1UGUA 4KUKA 3ZQ5A 1F9IA 3CWFA 3LUQA 5A8BA 5HDCA 4B9OA 3A0RA 4HNBA 4BBVA 3FC7A 4LRXC 3ULFA 1T1AA 2PDRA 2D01A 1KOUA 1BYWA 4H6JB 4HI4A 3LIAA 1OTEA 1N9NA 2B02A 4JGRA 5F68A 1JNUA 5HWVA 3UB8A 4EEPA 1N9LA 3H82B 4E04A 2OWHA 4PKYA 1X0OA 2WKPA 2PYRA 4BBTA 3A0VA 2OOLA 3HJIA 4F3LA 5F5YA 4NXBA 2L1MA 3H7WB 2I9VA 1TS7A 3MFXA 3MXQA 1OTDA 4HY8A 4WLAA 4PKYG 4KUOA 4BBUA 5I5LA 2VV7A 4GS9B 3SW1A 3B33A 5EFWA 4DJ2A 4LPZA 4MN6A 4GW9A 5J7EA 1V9ZA 3F1NA 2ZOIA 1OTIA 2H28A 4HP4A 4LRYC 1XFQA 3ICYA 1S1ZA 2ZOHA 1N9OA 4HHDA 1S4SA 2QHKA 3LIFA 1S67L 2A24B 1T1BA 4WN5A 3LI8A 3UB6A 1V9YA 4LLOB 3LIEA 3UE6A 4DJ3A 5F69A 2Z6DA 5HWTA 4RQ9A 4EEUA 4WF0A 5AVEA 1EW0A 1F98A 2V9AA 1XJ6A 1LSVA 3P7NA 4GHIB 5DJUA 4HIAA 4YWZA 4JGOA 4NXFA 3F1OA 2PR5A 1XJ3A 5G4ZA 4EXOA 5F6AA 3MJQA 2GJ3A 5DKLA 3H82A 4HOIA 4NXEA 1D06A 2JHEA 1ODVA 3MQOA 4HP9A 2P7JA 3E4OA 2PD8A 2L4RA 5TBMA 1OTBA 1GSVA 3LI9A 1XJ4A 3BY8A 3UMDA 5HD3A 1XJ2A 1T1CA 4GS9A 1S66L 2QJ7A 3H9WA 1G28A 1OTAA 4EQ1A 2R78A 5IU1A 2EA9A 4EW7A 4XT2A 1WA9A 2PD7A 3F1PA 4HJ3A 4I5SA 3NHQA 5IS1A 4HJ4A 2Z6CA 3GDIA 5HWWA 4F3LB 3CLOA 4HJ6A 5AVFA 4WL9A 1OJ5A 1LSWA 2V1BA 3HJKA 1OT6A 2K7SA 1Y28A 3NOTC 3K3CA 2YKFA 4HH3A 3KX0X 3RH8B 3FG8A 2KDKA 5HZHA 2CMNA 4MN5A 4I3IA 1TS0A 5J3WA 5HSQA 2V1AA 3F1NB 4L9FA 1T19A 2ZBBA 3A0SA 1TS6A 5DKKA 2V0WA 1VB6A 3UB9A 3NJAA 4R6LA 3D72A 2JN7A 3EEHA 4H6JA 2HV1A 2PR6A 4R70A 5DJTA 1XFNA 4I39A 3NOPC 4JGPA 3OLOA 3UMEA 3C8CA 2W27A 4EESA 2KX6A 3BY9A 3LYXA 3G6OA 2D02A 3IS2B 3H7WA 5G4YA 4R3AA 3F1OB 4JGQA 1GSXA 1DP8A
chains in the Genus database with same CATH superfamily
3KSFA 3C2WA 1JTDA 2PHYA 4HEFA 2K2NA 2PBYA 3PHYA 4ZJ3A 5CTMA 1MWRA 1DP9A 2HGVA 3UB5P 4IBXA 1OJGA 3LIBA 2VZWA 4Y13A 2ZQ9A 2BASA 1LL8A 4Y2FA 3DTIA 1K56D 2HJEA 2GNXA 2ZJ9A 3EGXC 4EERA 2V2FF 1LSXA 2P9VA 1LT0A 5CXWA 1S4RA 3HCYA 4U0TA 4I3JA 5FI7A 5EVID 3T4QA 3KSIA 1OT9A 4IUKA 3VP1A 2WK0A 3FKWA 2J80A 3CAXA 3Q1FA 3S22A 5J4EA 3VSLA 3K3DA 4QB8A 3VV4A 2ZD8A 2WKQA 3WS5A 4XT2B 1P0ZA 2B5RA 2VV6A 5HD5A 3MQQA 5FA7A 2HP6A 4O8GA 2INWA 4S2NA 1PFLA 3CG5A 1MZUA 3HLBA 4OLGA 3HL9A 1DJAA 4QWOA 3JVVA 2X01A 3BFGA 1D7EA 1IYOA 5CEDA 1BLPA 3GVBA 1T18A 3QP5A 4BL2A 3M6BA 3JYIA 3NULA 3MR0A 5KSHA 1K6SA 4R23A 2VA0A 4U0XA 3LFVA 4G3VA 1LLBA 4ZJ2A 4E3JA 1U60A 4KUKA 4S2KA 5A8BA 5GLCA 3WS0A 5HDCA 1P9WA 2Y2KA 3FC7A 1Y4OA 4DKIA 4DE3A 2DCFA 2D01A 4K0WA 1S0WA 3SS5A 3D4FA 1SDNA 1YLWA 1XA7A 5F83A 2Q0OA 1JNUA 1K55C 5CTNA 2ZQCA 1RGZA 3BYDA 3C4OA 1K57C 3RFBA 4R3BA 2PYRA 3A0VA 3BLSA 2OOLA 4LCLA 3IXDA 4F94A 5F5YA 2DNSA 3PTEA 3H7WB 1LL9A 4IUHA 1JWZA 1QMFA 1GHPA 3FZCA 2PU4A 4HY8A 4ETXA 3T4SA 3CPTB 4EBLA 5FAPA 2WZZA 5FQMA 2W3EA 3SW1A 5EFWA 4LPZA 5C5KA 3EOIA 4WYYA 1FQGA 2HJ9C 3E2LA 2ZOIA 4BL3A 4LFUA 1XXMA 2EX6A 3BFEA 3W2ZA 5A90A 2E8JA 4HHDA 2ZC6B 2QHKA 1CI9A 4LV0A 2A24B 2HDSA 4Y15A 3UB6A 1ESIA 2Y2IA 4K0XA 4S2NC 3DTMA 1KE4A 5F69A 1VHMA 4MCWA 2XGNA 2V8CA 3KYQA 1CK3A 1A0KA 3C30A 2V9AA 5HAQA 4G3KA 3P7NA 4FH2A 4OPQA 5DJUA 2HP5A 4JGOA 4Y0TA 1CQAA 1XJ3A 2A2LA 3IHAA 5GLDA 3S7QA 3SH9A 5G4ZA 3LEQA 2VGJA 3MJQA 2XD5A 2PRFA 4NXEA 4FSFA 1XP4A 1Z6FA 4WZ4A 2JHEA 3MKEA 1XA1A 1ODVA 1K56A 2XSSA 3IXBA 5GHXA 3ITBA 1SKOB 3S7PA 3FPVA 3E4OA 1C3BA 3IWQA 2ZLYA 4A5RA 1K6RA 5TBMA 3Q07A 2Y2MA 3LI9A 4BENA 3PBOA 3UMDA 1M40A 1XJ2A 4GS9A 3D3OA 3TRCA 2HF6A 2GX5A 4S2MA 1G28A 3SS3A 4DE1A 4GD6A 5EM1A 3L7HA 4EW7A 4OPZA 5EE8A 4HJ3A 2GZAA 2LB9A 4WZ5A 3GSGA 5IHVA 4EUZA 3S7OA 5HWWA 5EVIB 4OQGA 1XGIA 4XUZA 3LY4A 1TDGA 4WL9A 1OJ5A 4LCMA 1L3LA 2V1BA 3ZG5A 2B18A 1PWGA 5CERA 5HPIA 3HJKA 1IEMA 3IF6B 4D60A 5E2HA 4HH3A 3BFFA 1I2WA 4QJGA 1PNEA 4BMWA 2EWVA 4ARZA 2WZXA 3VP3A 4CLCA 3TE8A 5KZHA 1TD5A 4Y7PA 1LI0A 1YAXA 4PHTA 4L0LA 1YLZA 3W4OA 2ZBBA 2V0WA 1PZPA 2ZM0A 1PI5A 3D72A 2O9BA 2JN7A 3IWOA 2WGWB 1YMXA 1BTLA 4GDBA 1Q2QA 1FSWA 2DMWA 3W8KA 4RVAA 3TSGA 4CJNA 1LHYA 4DDYA 2PR6A 3D9YA 5DFXA 3OOVA 1W63M 4I39A 5CX7A 5HW3A 4KZ3A 1AWIA 2KX6A 2Y8HA 5L10A 3PAGA 4IEDA 5DFYA 4OP8A 2C6WB 3ZCZA 2XFTA 1L0FA 5FQJA 1GCEA 4M3KA 2FZ0A 3F1OB 1DP8A 5JYOA 5M1AA 5DTSA 3IX3A 2L0WA 3GECA 3R7WA 3P98A 3OBFA 3BWLA 3SH8A 1TS8A 4JF5A 2ZMFA 1K4EA 3T4TA 1N9BA 3HBRA 2VV8A 3EQVA 1DRMA 1XX2A 4IVKA 5E2EA 4GOGA 3ZDJA 4E3OA 5HDDA 3DAVA 3HLFA 4X55A 2VEAA 3E4QA 4KZ6A 5AQ7A 4BQMA 5J8XA 3U4LP 4WZ5C 4WUJA 3BLMA 3OCLA 4R4RA 3WS4A 5FEFA 2VKSA 1W79A 1VEUA 2IWDA 3AGDA 3BQ8A 3GV9A 2Y59A 5HFOA 4X1LA 1JWPA 2XQZA 3F1PB 3RTYA 1DY6A 3VOLA 1L2SA 4MBFA 3HLDA 2XEPA 3V67A 2XROA 4GHIA 5HARA 2CC1A 4KZ4A 5F82A 3VP2A 3HUNA 2KLIA 1FCNA 4LRZE 3B3XA 4YFMA 5EPHA 3AGFA 4CLCC 3FV7A 4CPKA 4QY5A 2YKHA 4IJGA 5GL9A 2VX8A 3M2JA 3DTEA 4X68A 2JKRI 3QP4A 3DWZA 4M4XA 4N92A 5GLBA 1MKIA 2IA2A 1PW8A 3T4OA 3BFCA 4FUWA 1ES3A 5L2FA 2QKPA 5CGXA 4JKTA 5FAQA 1GA9A 3TW8A 3IS2A 5KMWA 1FCMA 5L8MA 1KVLA 3P01A 3ZQ5A 4MDZA 3LGOA 1W5DA 3A3JA 4RX2A 3TOIA 1H5XA 3A0RA 3IF5A 2ZL1A 1P9RA 4WEJA 5AQAA 1BLCA 1G6OA 1TF1A 3ULFA 4C3QA 1KOUA 4IBRA 1L0GA 1FR1A 4DMZA 4HI4A 4R0QA 1O07A 3T1RA 1OTEA 4KZAA 2B02A 1ALQA 2EFXA 5F68A 1OPXA 4EEPA 2FFYA 2OWHA 4ZDXA 3O5YA 3V39A 4PKYA 5K5BA 2WKPA 4JXWA 4B88A 5DVAA 2OSUA 3HJIA 2P74A 4F3LA 1HVBA 4NXBA 4S2PA 5EM0A 2L1MA 1MPLA 3IBJA 3OPRA 2H5SA 3MFXA 3MXQA 5AJGA 4DE2A 1O7EA 1OTDA 4GB7A 1WYCA 3QNCA 2H0YA 2FFFB 1EROA 2OAQ1 1XKZA 2ZM8A 4EQIA 3KYZA 3QP1A 4EWFA 1PWDA 2W3FA 4DJ2A 4MN6A 4GW9A 2V1ZA 1ES5A 3F1NA 1PZOA 2QZ6A 4HP4A 3C38A 1ZKJA 4N1XA 5FEGA 2X71A 4KZBA 1S1ZA 1N9OA 2P9VB 4XUXA 1S67L 1IKGA 4X1MA 4ZRRA 1V9YA 2ZC4B 5DF7A 2EFUA 4OVDA 3PBTA 4DJ3A 3Q7ZA 1IYQA 3EGDC 4S2OA 3OC2A 5AVEA 1EI5A 1EW0A 1YKDA 4QD4A 1F98A 3T4LA 1XJ6A 1IELA 1LSVA 4X56A 4LV1A 5FI2A 4P85A 3VOZA 4BLMA 4JXVA 3V50A 3CITA 4CLCD 2IWBA 1MY8A 5IT5A 1FSYA 1SDEA 4NXFA 1KDWA 5HL6A 5HX9A 4EXOA 1DJBA 5F6AA 1YLJA 3OPPA 5CHJA 5HAIA 4HOIA 2NUTC 2P08A 5DTTA 1D06A 1ZG4A 4R1GA 4HP9A 2P7JA 4DXBA 3JPUA 1BT5A 1ESUA 2Z2MB 4PMAA 3E98A 1ERMA 3NC8A 4UA9A 2A49A 1OTBA 2R9XA 4ME4A 1T1CA 4KG6A 3T1QB 1S66L 3ZVWA 1BZAA 4OLDA 3VP4A 2QJ7A 3H9WA 3NDGA 1OTAA 5IU1A 4DF6A 3ISGA 1H3QA 5EVLA 4DDSA 3ZNYA 3UDIA 4QPRA 1YQSA 5I94A 1HZOA 1LL5A 3Q7VA 2PD7A 1FR6A 2ZC5B 2OAP1 3IH9A 4NKPA 1L0EA 2Z6CA 2WAFA 3G34A 4HJ6A 1DJCA 3OPLA 1YLPA 4OP5A 3IXHA 1LSWA 2XFSA 2OLUA 3PBSA 4MNRA 2WKEA 1YLTA 1Q2PA 3FWLA 2YKFA 2J7VA 3KX0X 2VJWA 4WMCD 1ONHA 1ACFA 2KDKA 3FG8A 4HBUA 2CMNA 3LO7A 4X25A 4MN5A 2XLNA 4I3IA 5CEBA 1TS0A 5D3OA 4MBKA 3M2KA 1F2KA 1W7FA 2ZMAA 4KG2A 4AFIA 2QMIA 3RJUA 3RXWA 3UB9A 5A93A 3VOYA 1TEMA 4B4XA 4H6JA 4RYEA 1JVJA 1WE4A 1VM1A 3LR5A 3MBZA 2OLVA 1RP5A 1S6RA 4Y0UA 1W63Q 4DRTA 2Z2LB 5DJTA 2WGIA 1XFNA 3NOPC 4JGPA 4BD1A 5FAOA 3G32A 1JTGA 3V5MA 1E3UA 1H8ZA 4D2OA 1CJFA 2Y4AA 4EESA 2G7UA 3HUOA 3M6HA 5F1GA 1JWVA 4OPYA 3LYXA 3BFDA 1NLYA 5MC7A 3NECA 4OOMA 4E3KA 4R3AA 4BWIA 5FSRA 2V8FA 4OOYA 3MXSA 5FQKA 3DWKA 3HVFA 3T50A 1GA0A 2RL3A 3GRJA 4HQAA 4O7DA 1TDLA 2PYPA 1ZG6A 3ZFZA 1NRFA 3NIAA 3LCEA 3Q81A 4GKUA 4U3TA 2PT7A 4EETB 1KDSA 3E4PA 5TBMB 2JKTM 4CLCE 2M7UA 3VE3A 1ONGA 5TFQA 2WKIA 5CGSA 3N8SA 3QNBA 1I5QA 1NYYA 3NY4A 5A92A 4KQOA 3PBRA 3MZFA 1KGFA 5GHZA 4MBHA 4I3AA 4ZBEA 1MWTA 2W1TA 1MWSA 5EOOA 5HDSA 4JF6A 4XXRA 5FASA 2H0TA 3DBAA 4K91A 3PYPA 4GCZA 1FCOA 2WKRA 1NWZA 3JVUA 4DXCA 1KE0A 4I38A 5E2FA 2OWJA 2XA7M 3WRZA 3IT9A 2W0NA 5FI6A 3MKFA 4L9EA 4FCFA 2XH9A 2QJ5A 3EWKA 3NOUC 3O87A 1E25A 4JXGA 2QWSA 1GSWA 2V0UA 2HDQA 3UB7A 2Q9MA 4R38A 4ARZB 1UWPX 4R3JA 2C5WB 1J9MA 1PI4A 3ZHHA 5G18A 2HPBA 3CWFA 1W8YA 2MJ6A 3GQZA 4FOFA 4N9LA 3HLEA 4HNBA 4RA7A 4LRXC 4KENB 4OQIA 5GHYA 2PDRA 2JKGA 1BYWA 4CQHA 4EBNA 1YPRA 3CMZA 3LIAA 5DF8A 4KZ8A 4E3MA 5HWVA 4EV4A 3UB8A 3V3RA 3H82B 4QHCA 3A3DA 2KOIA 3ZGAB 2WAEA 1IKIA 2ZQAA 3HLCA 1PYYA 5E2GA 4GDNA 3CZDA 4PPRA 1VETA 3R4KA 4BBTA 1NLZA 3RXXA 4JLFA 1ES4A 2XRNA 4II7A 3UPOA 3B42A 3A3FA 2I9VA 4WMCA 4EU0A 4WLAA 4PKYG 4KUOA 4GNUA 4BJPA 1XPBA 3MF0A 5I5LA 4KZ5A 2VV7A 2V20A 4JF4A 4QU3A 3IWIA 4GN2A 3LY3A 3TG9A 4Y3IA 3IQAA 5LBRA 3IHBA 2H28A 2ZMVA 4WM9A 1CF0A 3OZHA 4MMNA 3G2ZA 1TVFA 4LRYC 4Q0IA 3G30A 3AGEA 2JKFA 2ZOHA 3NBLA 5DF9A 1S4SA 3LIFA 3N4IA 3KSHA 4HESA 4YINA 1T1BA 3LI8A 2P04A 1QMEA 4LLOB 3LIEA 3HLGA 4KG5A 4OH0A 2Z6DA 5HWTA 1W8QA 2O9CA 4RQ9A 4LGWA 4WF0A 1H0MA 1VEUB 5HL1A 4P87A 4KQQA 3Q82A 1K0KA 4X53A 2R9WA 4JPMA 3WS2A 4GHIB 4Z1WA 4KZ7A 5L07A 1YT4A 4OQ0A 3UDXA 1YM1A 2Y2HA 2GDNA 2UV0E 1N4OA 2XR0A 2PR5A 1LI9A 4B4ZA 1SZVA 5FDHA 5CHMA 1BULA 2GJ3A 5DKLA 4Q0JA 2ACGA 3KO6A 4E6XA 4E3LA 3O3VA 4DN0A 3T1SA 4UA7A 3GTCA 2EX9A 3B47A 1PIOA 4PAUA 5FQQA 2EXAA 3N8LA 2XDMA 2XF3A 2JCHA 2Y2NA 3PR6A 1E3UD 2EX8A 2ZL1B 1XJ4A 2ZC7A 5HAPA 1K38A 5HD3A 1ZHHB 2G2UA 4P6ZM 3VFFA 1KVMA 3EQUA 2Y2QA 4PM5A 5M18A 4EQ1A 2J9OA 4Q8IA 1SKFA 1L0DA 4QY6A 4S2JA 2EA9A 2VGLM 3EEAA 4XT2A 4I5SA 5IS1A 4HJ4A 2Q9NA 3T1XA 3U2AA 1K54A 3GDIA 1GHMA 4Y0OA 4F3LB 1BLSA 1IYSA 4RX3A 3V3SA 2WKHA 4Z9QA 3N7WA 2J9PA 2PU2A 1HD8A 2K7SA 2OV5A 3NOTC 3K3CA 3UPPA 2DRWA 2ZQ7A 1IOUA 4UEYA 2XA7S 5HZHA 4NEED 1NY0A 5HSQA 1EWZA 3F1NB 3IX8A 1NRJA 1T19A 3A0SA 1TS6A 5DKKA 4ID4A 1VB6A 1YSPA 3NJAA 3G35A 4KZ9A 2Y55A 1RGYA 2PAVP 4ZAMA 5EVEA 4Y17A 1FIKA 3EEHA 3MMHA 1Z09A 2HV1A 2RCXA 4X69A 2JC7A 1NZOA 2UWXA 3UMEA 2W3GA 2W27A 2WGVA 3BY9A 3A3IA 4S2LA 4UQIM 3G6OA 3UPNA 2X02A 2D02A 3H7WA 3C7UA 5G4YA 1NZUA 1MXOA 3VFHA 3BM6A 3L9KA 4JGQA 1GSXA 3OCNA 4E3IA 3CPTA 4E04A 1YMSA 4L9GA 5FDSA 5TR7A 4GLQA 3TJZC 3LR4A 1I2SA 4C75A 1S1YA 3P09A 2Y2LA 3GR2A 4MEZA 4HBTA 5KIZA 3SZTA 3LICA 4JXSA 3UY6A 2E8IA 2WYXA 3DW0A 2B95A 3UN7A 4KQRA 4KQDA 2A24A 3IXGA 1J3WA 5CHUA 5CRFA 1MBLA 1VQQA 1H8YA 2K31A 1K54C 3CUEA 4NETA 2IWCA 3C4PA 3W4PA 1OMEA 3ZG8B 4PM9A 1UWNX 2HDRA 3VE4A 3Q7VB 5FQ9A 3HLWA 3LIDA 4HH2A 3MS6A 4IVIA 4PM8A 5CECA 4ZTKA 5AQ9A 3G31A 1CI8A 1DP6A 2Y2OA 4NK3A 2AVXA 3FKVA 4NXGA 3SOIA 3WWXA 4K08A 3WRTA 2VLGA 3IBRA 3VMAA 1SHVA 5F1FA 2W3DA 4EBPA 1ERQA 1WYBA 4PM7A 2Y2GA 2M1CA 2XD1A 3UE1A 4LV2A 1SKOA 3HREA 2I72A 2BTFP 3O88A 1P97A 3T4KA 2ZC3B 1AXBA 1YLYA 1UGUA 2BG1A 2QPNA 5KSCA 1F9IA 3LUQA 2M7VA 3QP8A 4S2IA 3CHWP 4B9OA 4BBVA 3C5AA 4E6WA 1G68A 1T1AA 3S4XA 5TGFA 2O9AA 1KGEA 4H6JB 2J3WA 4JBFA 5EOEA 4B93A 3WS1A 1N9NA 4DE0A 3MFDA 4JGRA 2W1RA 3SH7A 5E43A 4MLLA 3E0YA 1N9LA 4P6ZS 2Y79A 3IH8A 3BECA 1X0OA 3UE3A 3LR0A 3KSGA 1NXYA 2H10A 4OONA 2Y2PA 5EVIA 4UHUA 2VGLS 3ZVTA 4N1HA 1TS7A 3IF6A 2JE5A 4GJ4A 4WEKA 4R4SA 1HTZA 1MKMA 4BBUA 3UO9A 4ETZA 4GS9B 1Y54A 3B33A 1KGGA 3IX4A 4OPRA 5J7EA 1V9ZA 3ZG0A 5JYPA 1NJ4A 1F5MA 5AQBA 1OTIA 3MXRA 3NI9A 3QP2A 3CUEC 2EX2A 1XFQA 1BLHA 3ICYA 1STZA 3OPHA 2Y2JA 2PBDP 2WGWA 2VK3A 1K25A 4UA6A 2BLSA 4WN5A 3BW6A 3FYZA 2HP9A 5BOHA 3S1YA 3UE6A 2O99A 5CGWA 3MSHA 4EEUA 3UNWA 4NG2A 1E4DA 3N8RA 4LV3A 1NYMA 3GMWA 2W1TB 3MQ0A 4OQHA 4E3NA 2HDUA 4FTXA 2ZM2A 5A91A 4CLCB 1FILA 2J3TC 4P0MA 1SCWA 3MZDA 3ZG9B 3QHYA 4HIAA 2QYBA 4YWZA 2J8YA 1XGJA 5TJJA 5DTKA 1PWCA 3UE0A 3F1OA 4UQIS 2JKRM 1YSQA 3BRMA 3H82A 3QP6A 3UDFA 1ES2A 4IHQA 2VGKA 2LB5A 1K4FA 4BD0A 2ZQ8A 3MQOA 3NCKA 4MN7A 3BEBA 3N6IA 2Y91A 2FH5A 3PXPA 4GD8A 4WBGA 4EUVA 3C7VA 3K2NA 1D1JA 4PM6A 2EWWA 2PD8A 4X6TA 2L4RA 1GSVA 3BY8A 2XK1A 3G2YA 4G3WA 2JKTI 2WADA 3O86A 4O01A 3MZEA 4YNRA 3G4PA 3PBQA 4N9KA 5EVIC 4LENA 5EUAA 4P6BA 2R78A 4ZJ1A 3ITAA 4GZBA 4OOLA 1WA9A 3R7WB 3F1PA 1ZTUA 3IF6C 3LEZA 3NHQA 3HUMA 1VETB 1M6KA 3CJMA 3CLOA 3DTKA 2O0YA 5AVFA 4FH4A 4H8RA 5EV0A 3LR3A 1PW1A 1OT6A 3ZG7B 1Y28A 1RCJA 3CI6A 3BJNA 5GLAA 4Y5FA 1MC0A 3T4JA 3RH8B 1MWUA 1BUEA 5FL3A 2HZ5A 2JBFA 5U47A 3SS4A 1GHIA 1HLUP 1IYPA 1KE3A 5M19A 3FPWA 5J3WA 2V1AA 2G2WA 4L9FA 5HPFA 4UAAA 4YOFA 1ZC2A 3E2KA 4C6YA 3PBNA 3PAEA 3I7JA 3A3EA 1PRQA 2EXBA 4R6LA 4Q0HA 5L09A 3T12B 4OKPA 3VSKA 3ZYTA 3W4QA 2ZQDA 5FQIA 1FOFA 5FATA 4R70A 3OLOA 2WUQA 3C8CA 2W3HA 5EECA 1IFQA 2J3TD 3KYEA 3VP0A 1H8MA 4O0PA 1G6AA 4FD8A 4WELA 1K55A 3IS2B 3ZNTA 2NUPC 1CEFA 3NDEA 1CEGA 1G5UA 2A3UA 1K57A 3BQAA 4ESPA 1BSGA 3S7NA
chains in the Genus database with same CATH topology
3KSFA 3C2WA 2L0WA 3GECA 2PHYA 3T50A 4L9GA 3R7WA 4HQAA 2PYPA 2K2NA 4GLQA 3TJZC 3LR4A 3OBFA 1S1YA 3BWLA 1TS8A 3PHYA 2ZMFA 5KIZA 1DP9A 2HGVA 1OJGA 3LIBA 3LICA 2VZWA 3T4TA 4Y2FA 2BASA 1LL8A 2VV8A 3EQVA 2HJEA 2PT7A 2GNXA 1DRMA 4EETB 3EGXC 4EERA 1LSXA 1LT0A 4KQDA 3E4PA 2A24A 5HDDA 5TBMB 2JKTM 1S4RA 3HCYA 4CLCE 2M7UA 3VE3A 2VEAA 3E4QA 2K31A 4I3JA 3T4QA 3KSIA 3CUEA 4KQOA 1OT9A 3PBRA 4WUJA 3OCLA 4IUKA 2J80A 3CAXA 4I3AA 5J4EA 2VKSA 2W1TA 1UWNX 3K3DA 5HDSA 3VV4A 3BQ8A 2WKQA 3VE4A 4XT2B 1P0ZA 3F1PB 3RTYA 2VV6A 3DBAA 5HD5A 3PYPA 3MQQA 3VOLA 4O8GA 2INWA 3LIDA 4HH2A 4GCZA 3V67A 2XROA 1MZUA 2WKRA 4GHIA 1NWZA 3JVUA 3JVVA 1DP6A 2KLIA 4LRZE 4I38A 4NXGA 4CLCC 2OWJA 2XA7M 1D7EA 2W0NA 2YKHA 4K08A 2VLGA 4IJGA 4L9EA 3IBRA 2QJ5A 2VX8A 3EWKA 1T18A 2W3DA 2JKRI 3NOUC 4M4XA 2QWSA 1GSWA 2V0UA 2IA2A 2M1CA 3MR0A 3T4OA 5KSHA 3UB7A 4R38A 4ARZB 2VA0A 1UWPX 1P97A 2QKPA 3T4KA 3TW8A 3LFVA 3IS2A 4G3VA 5L8MA 1UGUA 4KUKA 3P01A 3ZQ5A 4MDZA 1F9IA 3CWFA 3LUQA 2M7VA 2MJ6A 4FOFA 5A8BA 5HDCA 4B9OA 1P9WA 3A0RA 4HNBA 4BBVA 1P9RA 3FC7A 4LRXC 4WEJA 1TF1A 1G6OA 3ULFA 1T1AA 2PDRA 2D01A 1KOUA 1BYWA 2O9AA 4CQHA 4H6JB 2J3WA 4DMZA 4HI4A 4B93A 3LIAA 1OTEA 1N9NA 2B02A 4JGRA 5F68A 1JNUA 5HWVA 2W1RA 3UB8A 1OPXA 3E0YA 4EEPA 1N9LA 3H82B 4E04A 2OWHA 2KOIA 4P6ZS 2Y79A 3O5YA 4PKYA 1X0OA 5K5BA 2WKPA 3RFBA 3UE3A 3LR0A 3KSGA 3R4KA 2PYRA 4BBTA 3A0VA 1NLZA 2OOLA 3HJIA 4F3LA 5F5YA 2VGLS 4NXBA 2XRNA 4II7A 3B42A 2L1MA 3H7WB 3IBJA 4IUHA 2I9VA 1TS7A 3MFXA 3MXQA 5AJGA 4EU0A 1OTDA 4HY8A 4ETXA 4WLAA 3T4SA 4GJ4A 4PKYG 4WEKA 4KUOA 2OAQ1 4BJPA 1MKMA 4BBUA 3MF0A 5I5LA 2VV7A 2W3EA 4ETZA 4GS9B 3KYZA 3SW1A 3B33A 2W3FA 5EFWA 4DJ2A 4LPZA 4MN6A 4GW9A 5J7EA 5C5KA 3EOIA 1V9ZA 4Y3IA 1F5MA 3F1NA 5LBRA 2HJ9C 2ZOIA 1OTIA 2H28A 2ZMVA 4HP4A 3C38A 3CUEC 4MMNA 3W2ZA 4LRYC 4Q0IA 1XFQA 3ICYA 1S1ZA 2ZOHA 1N9OA 4HHDA 1S4SA 5DF9A 1STZA 2QHKA 3LIFA 3KSHA 1S67L 2A24B 1T1BA 4WN5A 3LI8A 3BW6A 2P04A 3UB6A 4ZRRA 1V9YA 4LLOB 3LIEA 3UE6A 2O99A 3PBTA 4DJ3A 3EGDC 5F69A 2Z6DA 1VHMA 5HWTA 4RQ9A 2O9CA 4EEUA 4MCWA 3OC2A 3KYQA 2W1TB 4WF0A 5AVEA 3MQ0A 1EW0A 1YKDA 1F98A 3C30A 3T4LA 2V9AA 4CLCB 2J3TC 1XJ6A 1LSVA 4G3KA 3P7NA 4GHIB 4Z1WA 5DJUA 4HIAA 2QYBA 4YWZA 4JGOA 3CITA 4CLCD 5TJJA 5IT5A 4NXFA 3F1OA 2PR5A 1XJ3A 5HL6A 2A2LA 4UQIS 3S7QA 5G4ZA 4EXOA 5F6AA 3MJQA 2GJ3A 4Q0JA 5DKLA 2JKRM 1YSQA 3H82A 3KO6A 4HOIA 2NUTC 2P08A 4NXEA 4FSFA 1D06A 4IHQA 2LB5A 4DN0A 2JHEA 1ODVA 3MQOA 2XSSA 4MN7A 3B47A 4HP9A 4PAUA 3S7PA 2FH5A 2P7JA 3PXPA 3FPVA 3E4OA 4EUVA 3K2NA 3E98A 2EWWA 2PD8A 2L4RA 3PR6A 5TBMA 1OTBA 4ME4A 1GSVA 3LI9A 1XJ4A 3PBOA 3BY8A 3UMDA 5HD3A 4G3WA 4O01A 1XJ2A 1ZHHB 2JKTI 4YNRA 4P6ZM 1T1CA 4GS9A 3PBQA 3D3OA 3TRCA 3EQUA 1S66L 2HF6A 2GX5A 2QJ7A 3H9WA 1G28A 1OTAA 4EQ1A 2R78A 5IU1A 1H3QA 2EA9A 2VGLM 4OOLA 4QPRA 3EEAA 4EW7A 4XT2A 1WA9A 3R7WB 2PD7A 1ZTUA 3F1PA 4HJ3A 4I5SA 3NHQA 5IS1A 4HJ4A 2OAP1 2GZAA 3U2AA 2LB9A 4NKPA 2Z6CA 3GDIA 3S7OA 4F3LB 5HWWA 3CLOA 4HJ6A 2O0YA 5AVFA 4WL9A 1OJ5A 1LSWA 3LR3A 2V1BA 2B18A 3PBSA 5HPIA 3HJKA 1OT6A 2K7SA 1Y28A 3NOTC 3CI6A 3K3CA 3BJNA 2YKFA 4HH3A 4Y5FA 1MC0A 3T4JA 3KX0X 3RH8B 2VJWA 1IOUA 5FL3A 4UEYA 4BMWA 2EWVA 2XA7S 3FG8A 2KDKA 5HZHA 4ARZA 4NEED 2CMNA 4CLCA 3FPWA 4MN5A 3TE8A 4I3IA 1TS0A 5J3WA 5HSQA 2V1AA 1TD5A 4AFIA 3F1NB 4L9FA 5HPFA 1NRJA 1YAXA 4PHTA 4YOFA 4L0LA 1T19A 3PBNA 2ZBBA 3A0SA 1TS6A 5DKKA 2V0WA 1VB6A 1YSPA 3UB9A 3NJAA 4R6LA 3D72A 2O9BA 4Q0HA 2JN7A 3EEHA 3MMHA 4H6JA 2DMWA 3ZYTA 3LR5A 2HV1A 1W63Q 2PR6A 5DFXA 3OOVA 4R70A 5DJTA 1W63M 1XFNA 4I39A 3NOPC 4JGPA 3OLOA 3UMEA 2W3GA 5CX7A 3C8CA 2W27A 4EESA 2W3HA 1IFQA 2G7UA 2KX6A 2Y8HA 3BY9A 2J3TD 5DFYA 1H8MA 4O0PA 3LYXA 4UQIM 1NLYA 3G6OA 5MC7A 4WELA 2D02A 3IS2B 3H7WA 2NUPC 4OOMA 5G4YA 3BQAA 4R3AA 4BWIA 2FZ0A 3F1OB 4JGQA 1GSXA 3OCNA 3S7NA 1DP8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C2W A;  2L0W A;  3GEC A;  2PHY A;  3T50 A;  4L9G A;  4HQA A;  2PYP A;  1S1Y A;  3BWL A;  1TS8 A;  3PHY A;  5KIZ A;  1DP9 A;  1OJG A;  3LIB A;  3LIC A;  2BAS A;  1LL8 A;  2VV8 A;  1DRM A;  4EET B;  4EER A;  1LSX A;  1LT0 A;  4KQD A;  3E4P A;  2A24 A;  5HDD A;  5TBM B;  1S4R A;  3VE3 A;  2VEA A;  3E4Q A;  4I3J A;  1OT9 A;  4WUJ A;  2J80 A;  3CAX A;  4I3A A;  5J4E A;  1UWN X;  3K3D A;  5HDS A;  2WKQ A;  3VE4 A;  4XT2 B;  1P0Z A;  3F1P B;  3RTY A;  2VV6 A;  5HD5 A;  3PYP A;  3MQQ A;  3VOL A;  2INW A;  3LID A;  4HH2 A;  4GCZ A;  1MZU A;  2WKR A;  4GHI A;  1NWZ A;  1DP6 A;  4LRZ E;  4I38 A;  4NXG A;  2OWJ A;  1D7E A;  2W0N A;  2YKH A;  4K08 A;  2VLG A;  4L9E A;  3IBR A;  2QJ5 A;  3EWK A;  1T18 A;  3NOU C;  4M4X A;  2QWS A;  1GSW A;  2V0U A;  2M1C A;  3MR0 A;  3UB7 A;  4R38 A;  1UWP X;  1P97 A;  2QKP A;  3IS2 A;  1UGU A;  4KUK A;  3ZQ5 A;  1F9I A;  3CWF A;  3LUQ A;  5A8B A;  5HDC A;  4B9O A;  3A0R A;  4HNB A;  4BBV A;  3FC7 A;  4LRX C;  3ULF A;  1T1A A;  2PDR A;  2D01 A;  1KOU A;  1BYW A;  4H6J B;  4HI4 A;  3LIA A;  1OTE A;  1N9N A;  2B02 A;  4JGR A;  5F68 A;  1JNU A;  5HWV A;  3UB8 A;  4EEP A;  1N9L A;  3H82 B;  4E04 A;  2OWH A;  4PKY A;  1X0O A;  2WKP A;  2PYR A;  4BBT A;  3A0V A;  2OOL A;  3HJI A;  4F3L A;  5F5Y A;  4NXB A;  2L1M A;  3H7W B;  2I9V A;  1TS7 A;  3MFX A;  3MXQ A;  1OTD A;  4HY8 A;  4WLA A;  4PKY G;  4KUO A;  4BBU A;  5I5L A;  2VV7 A;  4GS9 B;  3SW1 A;  3B33 A;  5EFW A;  4DJ2 A;  4LPZ A;  4MN6 A;  4GW9 A;  5J7E A;  1V9Z A;  3F1N A;  2ZOI A;  1OTI A;  2H28 A;  4HP4 A;  4LRY C;  1XFQ A;  3ICY A;  1S1Z A;  2ZOH A;  1N9O A;  4HHD A;  1S4S A;  2QHK A;  3LIF A;  1S67 L;  2A24 B;  1T1B A;  4WN5 A;  3LI8 A;  3UB6 A;  1V9Y A;  4LLO B;  3LIE A;  3UE6 A;  4DJ3 A;  5F69 A;  2Z6D A;  5HWT A;  4RQ9 A;  4EEU A;  4WF0 A;  5AVE A;  1EW0 A;  1F98 A;  2V9A A;  1XJ6 A;  1LSV A;  3P7N A;  4GHI B;  5DJU A;  4HIA A;  4YWZ A;  4JGO A;  4NXF A;  3F1O A;  2PR5 A;  1XJ3 A;  5G4Z A;  4EXO A;  5F6A A;  3MJQ A;  2GJ3 A;  5DKL A;  3H82 A;  4HOI A;  4NXE A;  1D06 A;  2JHE A;  1ODV A;  3MQO A;  4HP9 A;  2P7J A;  3E4O A;  2PD8 A;  2L4R A;  5TBM A;  1OTB A;  1GSV A;  3LI9 A;  1XJ4 A;  3BY8 A;  3UMD A;  5HD3 A;  1XJ2 A;  1T1C A;  4GS9 A;  1S66 L;  2QJ7 A;  3H9W A;  1G28 A;  1OTA A;  4EQ1 A;  2R78 A;  5IU1 A;  2EA9 A;  4EW7 A;  4XT2 A;  1WA9 A;  2PD7 A;  3F1P A;  4HJ3 A;  4I5S A;  3NHQ A;  5IS1 A;  4HJ4 A;  2Z6C A;  3GDI A;  5HWW A;  4F3L B;  3CLO A;  4HJ6 A;  5AVF A;  4WL9 A;  1OJ5 A;  1LSW A;  2V1B A;  3HJK A;  1OT6 A;  2K7S A;  1Y28 A;  3NOT C;  3K3C A;  2YKF A;  4HH3 A;  3KX0 X;  3RH8 B;  3FG8 A;  2KDK A;  5HZH A;  2CMN A;  4MN5 A;  4I3I A;  1TS0 A;  5J3W A;  5HSQ A;  2V1A A;  3F1N B;  4L9F A;  1T19 A;  2ZBB A;  3A0S A;  1TS6 A;  5DKK A;  2V0W A;  1VB6 A;  3UB9 A;  3NJA A;  4R6L A;  3D72 A;  2JN7 A;  3EEH A;  4H6J A;  2HV1 A;  2PR6 A;  4R70 A;  5DJT A;  1XFN A;  4I39 A;  3NOP C;  4JGP A;  3OLO A;  3UME A;  3C8C A;  2W27 A;  4EES A;  2KX6 A;  3BY9 A;  3LYX A;  3G6O A;  2D02 A;  3IS2 B;  3H7W A;  5G4Y A;  4R3A A;  3F1O B;  4JGQ A;  1GSX A;  1DP8 A; 
#chains in the Genus database with same CATH topology
 3KSF A;  3C2W A;  1JTD A;  2PHY A;  4HEF A;  2K2N A;  2PBY A;  3PHY A;  4ZJ3 A;  5CTM A;  1MWR A;  1DP9 A;  2HGV A;  3UB5 P;  4IBX A;  1OJG A;  3LIB A;  2VZW A;  4Y13 A;  2ZQ9 A;  2BAS A;  1LL8 A;  4Y2F A;  3DTI A;  1K56 D;  2HJE A;  2GNX A;  2ZJ9 A;  3EGX C;  4EER A;  2V2F F;  1LSX A;  2P9V A;  1LT0 A;  5CXW A;  1S4R A;  3HCY A;  4U0T A;  4I3J A;  5FI7 A;  5EVI D;  3T4Q A;  3KSI A;  1OT9 A;  4IUK A;  3VP1 A;  2WK0 A;  3FKW A;  2J80 A;  3CAX A;  3Q1F A;  3S22 A;  5J4E A;  3VSL A;  3K3D A;  4QB8 A;  3VV4 A;  2ZD8 A;  2WKQ A;  3WS5 A;  4XT2 B;  1P0Z A;  2B5R A;  2VV6 A;  5HD5 A;  3MQQ A;  5FA7 A;  2HP6 A;  4O8G A;  2INW A;  4S2N A;  1PFL A;  3CG5 A;  1MZU A;  3HLB A;  4OLG A;  3HL9 A;  1DJA A;  4QWO A;  3JVV A;  2X01 A;  3BFG A;  1D7E A;  1IYO A;  5CED A;  1BLP A;  3GVB A;  1T18 A;  3QP5 A;  4BL2 A;  3M6B A;  3JYI A;  3NUL A;  3MR0 A;  5KSH A;  1K6S A;  4R23 A;  2VA0 A;  4U0X A;  3LFV A;  4G3V A;  1LLB A;  4ZJ2 A;  4E3J A;  1U60 A;  4KUK A;  4S2K A;  5A8B A;  5GLC A;  3WS0 A;  5HDC A;  1P9W A;  2Y2K A;  3FC7 A;  1Y4O A;  4DKI A;  4DE3 A;  2DCF A;  2D01 A;  4K0W A;  1S0W A;  3SS5 A;  3D4F A;  1SDN A;  1YLW A;  1XA7 A;  5F83 A;  2Q0O A;  1JNU A;  1K55 C;  5CTN A;  2ZQC A;  1RGZ A;  3BYD A;  3C4O A;  1K57 C;  3RFB A;  4R3B A;  2PYR A;  3A0V A;  3BLS A;  2OOL A;  4LCL A;  3IXD A;  4F94 A;  5F5Y A;  2DNS A;  3PTE A;  3H7W B;  1LL9 A;  4IUH A;  1JWZ A;  1QMF A;  1GHP A;  3FZC A;  2PU4 A;  4HY8 A;  4ETX A;  3T4S A;  3CPT B;  4EBL A;  5FAP A;  2WZZ A;  5FQM A;  2W3E A;  3SW1 A;  5EFW A;  4LPZ A;  5C5K A;  3EOI A;  4WYY A;  1FQG A;  2HJ9 C;  3E2L A;  2ZOI A;  4BL3 A;  4LFU A;  1XXM A;  2EX6 A;  3BFE A;  3W2Z A;  5A90 A;  2E8J A;  4HHD A;  2ZC6 B;  2QHK A;  1CI9 A;  4LV0 A;  2A24 B;  2HDS A;  4Y15 A;  3UB6 A;  1ESI A;  2Y2I A;  4K0X A;  4S2N C;  3DTM A;  1KE4 A;  5F69 A;  1VHM A;  4MCW A;  2XGN A;  2V8C A;  3KYQ A;  1CK3 A;  1A0K A;  3C30 A;  2V9A A;  5HAQ A;  4G3K A;  3P7N A;  4FH2 A;  4OPQ A;  5DJU A;  2HP5 A;  4JGO A;  4Y0T A;  1CQA A;  1XJ3 A;  2A2L A;  3IHA A;  5GLD A;  3S7Q A;  3SH9 A;  5G4Z A;  3LEQ A;  2VGJ A;  3MJQ A;  2XD5 A;  2PRF A;  4NXE A;  4FSF A;  1XP4 A;  1Z6F A;  4WZ4 A;  2JHE A;  3MKE A;  1XA1 A;  1ODV A;  1K56 A;  2XSS A;  3IXB A;  5GHX A;  3ITB A;  1SKO B;  3S7P A;  3FPV A;  3E4O A;  1C3B A;  3IWQ A;  2ZLY A;  4A5R A;  1K6R A;  5TBM A;  3Q07 A;  2Y2M A;  3LI9 A;  4BEN A;  3PBO A;  3UMD A;  1M40 A;  1XJ2 A;  4GS9 A;  3D3O A;  3TRC A;  2HF6 A;  2GX5 A;  4S2M A;  1G28 A;  3SS3 A;  4DE1 A;  4GD6 A;  5EM1 A;  3L7H A;  4EW7 A;  4OPZ A;  5EE8 A;  4HJ3 A;  2GZA A;  2LB9 A;  4WZ5 A;  3GSG A;  5IHV A;  4EUZ A;  3S7O A;  5HWW A;  5EVI B;  4OQG A;  1XGI A;  4XUZ A;  3LY4 A;  1TDG A;  4WL9 A;  1OJ5 A;  4LCM A;  1L3L A;  2V1B A;  3ZG5 A;  2B18 A;  1PWG A;  5CER A;  5HPI A;  3HJK A;  1IEM A;  3IF6 B;  4D60 A;  5E2H A;  4HH3 A;  3BFF A;  1I2W A;  4QJG A;  1PNE A;  4BMW A;  2EWV A;  4ARZ A;  2WZX A;  3VP3 A;  4CLC A;  3TE8 A;  5KZH A;  1TD5 A;  4Y7P A;  1LI0 A;  1YAX A;  4PHT A;  4L0L A;  1YLZ A;  3W4O A;  2ZBB A;  2V0W A;  1PZP A;  2ZM0 A;  1PI5 A;  3D72 A;  2O9B A;  2JN7 A;  3IWO A;  2WGW B;  1YMX A;  1BTL A;  4GDB A;  1Q2Q A;  1FSW A;  2DMW A;  3W8K A;  4RVA A;  3TSG A;  4CJN A;  1LHY A;  4DDY A;  2PR6 A;  3D9Y A;  5DFX A;  3OOV A;  1W63 M;  4I39 A;  5CX7 A;  5HW3 A;  4KZ3 A;  1AWI A;  2KX6 A;  2Y8H A;  5L10 A;  3PAG A;  4IED A;  5DFY A;  4OP8 A;  2C6W B;  3ZCZ A;  2XFT A;  1L0F A;  5FQJ A;  1GCE A;  4M3K A;  2FZ0 A;  3F1O B;  1DP8 A;  5JYO A;  5M1A A;  5DTS A;  3IX3 A;  2L0W A;  3GEC A;  3R7W A;  3P98 A;  3OBF A;  3BWL A;  3SH8 A;  1TS8 A;  4JF5 A;  2ZMF A;  1K4E A;  3T4T A;  1N9B A;  3HBR A;  2VV8 A;  3EQV A;  1DRM A;  1XX2 A;  4IVK A;  5E2E A;  4GOG A;  3ZDJ A;  4E3O A;  5HDD A;  3DAV A;  3HLF A;  4X55 A;  2VEA A;  3E4Q A;  4KZ6 A;  5AQ7 A;  4BQM A;  5J8X A;  3U4L P;  4WZ5 C;  4WUJ A;  3BLM A;  3OCL A;  4R4R A;  3WS4 A;  5FEF A;  2VKS A;  1W79 A;  1VEU A;  2IWD A;  3AGD A;  3BQ8 A;  3GV9 A;  2Y59 A;  5HFO A;  4X1L A;  1JWP A;  2XQZ A;  3F1P B;  3RTY A;  1DY6 A;  3VOL A;  1L2S A;  4MBF A;  3HLD A;  2XEP A;  3V67 A;  2XRO A;  4GHI A;  5HAR A;  2CC1 A;  4KZ4 A;  5F82 A;  3VP2 A;  3HUN A;  2KLI A;  1FCN A;  4LRZ E;  3B3X A;  4YFM A;  5EPH A;  3AGF A;  4CLC C;  3FV7 A;  4CPK A;  4QY5 A;  2YKH A;  4IJG A;  5GL9 A;  2VX8 A;  3M2J A;  3DTE A;  4X68 A;  2JKR I;  3QP4 A;  3DWZ A;  4M4X A;  4N92 A;  5GLB A;  1MKI A;  2IA2 A;  1PW8 A;  3T4O A;  3BFC A;  4FUW A;  1ES3 A;  5L2F A;  2QKP A;  5CGX A;  4JKT A;  5FAQ A;  1GA9 A;  3TW8 A;  3IS2 A;  5KMW A;  1FCM A;  5L8M A;  1KVL A;  3P01 A;  3ZQ5 A;  4MDZ A;  3LGO A;  1W5D A;  3A3J A;  4RX2 A;  3TOI A;  1H5X A;  3A0R A;  3IF5 A;  2ZL1 A;  1P9R A;  4WEJ A;  5AQA A;  1BLC A;  1G6O A;  1TF1 A;  3ULF A;  4C3Q A;  1KOU A;  4IBR A;  1L0G A;  1FR1 A;  4DMZ A;  4HI4 A;  4R0Q A;  1O07 A;  3T1R A;  1OTE A;  4KZA A;  2B02 A;  1ALQ A;  2EFX A;  5F68 A;  1OPX A;  4EEP A;  2FFY A;  2OWH A;  4ZDX A;  3O5Y A;  3V39 A;  4PKY A;  5K5B A;  2WKP A;  4JXW A;  4B88 A;  5DVA A;  2OSU A;  3HJI A;  2P74 A;  4F3L A;  1HVB A;  4NXB A;  4S2P A;  5EM0 A;  2L1M A;  1MPL A;  3IBJ A;  3OPR A;  2H5S A;  3MFX A;  3MXQ A;  5AJG A;  4DE2 A;  1O7E A;  1OTD A;  4GB7 A;  1WYC A;  3QNC A;  2H0Y A;  2FFF B;  1ERO A;  2OAQ 1;  1XKZ A;  2ZM8 A;  4EQI A;  3KYZ A;  3QP1 A;  4EWF A;  1PWD A;  2W3F A;  4DJ2 A;  4MN6 A;  4GW9 A;  2V1Z A;  1ES5 A;  3F1N A;  1PZO A;  2QZ6 A;  4HP4 A;  3C38 A;  1ZKJ A;  4N1X A;  5FEG A;  2X71 A;  4KZB A;  1S1Z A;  1N9O A;  2P9V B;  4XUX A;  1S67 L;  1IKG A;  4X1M A;  4ZRR A;  1V9Y A;  2ZC4 B;  5DF7 A;  2EFU A;  4OVD A;  3PBT A;  4DJ3 A;  3Q7Z A;  1IYQ A;  3EGD C;  4S2O A;  3OC2 A;  5AVE A;  1EI5 A;  1EW0 A;  1YKD A;  4QD4 A;  1F98 A;  3T4L A;  1XJ6 A;  1IEL A;  1LSV A;  4X56 A;  4LV1 A;  5FI2 A;  4P85 A;  3VOZ A;  4BLM A;  4JXV A;  3V50 A;  3CIT A;  4CLC D;  2IWB A;  1MY8 A;  5IT5 A;  1FSY A;  1SDE A;  4NXF A;  1KDW A;  5HL6 A;  5HX9 A;  4EXO A;  1DJB A;  5F6A A;  1YLJ A;  3OPP A;  5CHJ A;  5HAI A;  4HOI A;  2NUT C;  2P08 A;  5DTT A;  1D06 A;  1ZG4 A;  4R1G A;  4HP9 A;  2P7J A;  4DXB A;  3JPU A;  1BT5 A;  1ESU A;  2Z2M B;  4PMA A;  3E98 A;  1ERM A;  3NC8 A;  4UA9 A;  2A49 A;  1OTB A;  2R9X A;  4ME4 A;  1T1C A;  4KG6 A;  3T1Q B;  1S66 L;  3ZVW A;  1BZA A;  4OLD A;  3VP4 A;  2QJ7 A;  3H9W A;  3NDG A;  1OTA A;  5IU1 A;  4DF6 A;  3ISG A;  1H3Q A;  5EVL A;  4DDS A;  3ZNY A;  3UDI A;  4QPR A;  1YQS A;  5I94 A;  1HZO A;  1LL5 A;  3Q7V A;  2PD7 A;  1FR6 A;  2ZC5 B;  2OAP 1;  3IH9 A;  4NKP A;  1L0E A;  2Z6C A;  2WAF A;  3G34 A;  4HJ6 A;  1DJC A;  3OPL A;  1YLP A;  4OP5 A;  3IXH A;  1LSW A;  2XFS A;  2OLU A;  3PBS A;  4MNR A;  2WKE A;  1YLT A;  1Q2P A;  3FWL A;  2YKF A;  2J7V A;  3KX0 X;  2VJW A;  4WMC D;  1ONH A;  1ACF A;  2KDK A;  3FG8 A;  4HBU A;  2CMN A;  3LO7 A;  4X25 A;  4MN5 A;  2XLN A;  4I3I A;  5CEB A;  1TS0 A;  5D3O A;  4MBK A;  3M2K A;  1F2K A;  1W7F A;  2ZMA A;  4KG2 A;  4AFI A;  2QMI A;  3RJU A;  3RXW A;  3UB9 A;  5A93 A;  3VOY A;  1TEM A;  4B4X A;  4H6J A;  4RYE A;  1JVJ A;  1WE4 A;  1VM1 A;  3LR5 A;  3MBZ A;  2OLV A;  1RP5 A;  1S6R A;  4Y0U A;  1W63 Q;  4DRT A;  2Z2L B;  5DJT A;  2WGI A;  1XFN A;  3NOP C;  4JGP A;  4BD1 A;  5FAO A;  3G32 A;  1JTG A;  3V5M A;  1E3U A;  1H8Z A;  4D2O A;  1CJF A;  2Y4A A;  4EES A;  2G7U A;  3HUO A;  3M6H A;  5F1G A;  1JWV A;  4OPY A;  3LYX A;  3BFD A;  1NLY A;  5MC7 A;  3NEC A;  4OOM A;  4E3K A;  4R3A A;  4BWI A;  5FSR A;  2V8F A;  4OOY A;  3MXS A;  5FQK A;  3DWK A;  3HVF A;  3T50 A;  1GA0 A;  2RL3 A;  3GRJ A;  4HQA A;  4O7D A;  1TDL A;  2PYP A;  1ZG6 A;  3ZFZ A;  1NRF A;  3NIA A;  3LCE A;  3Q81 A;  4GKU A;  4U3T A;  2PT7 A;  4EET B;  1KDS A;  3E4P A;  5TBM B;  2JKT M;  4CLC E;  2M7U A;  3VE3 A;  1ONG A;  5TFQ A;  2WKI A;  5CGS A;  3N8S A;  3QNB A;  1I5Q A;  1NYY A;  3NY4 A;  5A92 A;  4KQO A;  3PBR A;  3MZF A;  1KGF A;  5GHZ A;  4MBH A;  4I3A A;  4ZBE A;  1MWT A;  2W1T A;  1MWS A;  5EOO A;  5HDS A;  4JF6 A;  4XXR A;  5FAS A;  2H0T A;  3DBA A;  4K91 A;  3PYP A;  4GCZ A;  1FCO A;  2WKR A;  1NWZ A;  3JVU A;  4DXC A;  1KE0 A;  4I38 A;  5E2F A;  2OWJ A;  2XA7 M;  3WRZ A;  3IT9 A;  2W0N A;  5FI6 A;  3MKF A;  4L9E A;  4FCF A;  2XH9 A;  2QJ5 A;  3EWK A;  3NOU C;  3O87 A;  1E25 A;  4JXG A;  2QWS A;  1GSW A;  2V0U A;  2HDQ A;  3UB7 A;  2Q9M A;  4R38 A;  4ARZ B;  1UWP X;  4R3J A;  2C5W B;  1J9M A;  1PI4 A;  3ZHH A;  5G18 A;  2HPB A;  3CWF A;  1W8Y A;  2MJ6 A;  3GQZ A;  4FOF A;  4N9L A;  3HLE A;  4HNB A;  4RA7 A;  4LRX C;  4KEN B;  4OQI A;  5GHY A;  2PDR A;  2JKG A;  1BYW A;  4CQH A;  4EBN A;  1YPR A;  3CMZ A;  3LIA A;  5DF8 A;  4KZ8 A;  4E3M A;  5HWV A;  4EV4 A;  3UB8 A;  3V3R A;  3H82 B;  4QHC A;  3A3D A;  2KOI A;  3ZGA B;  2WAE A;  1IKI A;  2ZQA A;  3HLC A;  1PYY A;  5E2G A;  4GDN A;  3CZD A;  4PPR A;  1VET A;  3R4K A;  4BBT A;  1NLZ A;  3RXX A;  4JLF A;  1ES4 A;  2XRN A;  4II7 A;  3UPO A;  3B42 A;  3A3F A;  2I9V A;  4WMC A;  4EU0 A;  4WLA A;  4PKY G;  4KUO A;  4GNU A;  4BJP A;  1XPB A;  3MF0 A;  5I5L A;  4KZ5 A;  2VV7 A;  2V20 A;  4JF4 A;  4QU3 A;  3IWI A;  4GN2 A;  3LY3 A;  3TG9 A;  4Y3I A;  3IQA A;  5LBR A;  3IHB A;  2H28 A;  2ZMV A;  4WM9 A;  1CF0 A;  3OZH A;  4MMN A;  3G2Z A;  1TVF A;  4LRY C;  4Q0I A;  3G30 A;  3AGE A;  2JKF A;  2ZOH A;  3NBL A;  5DF9 A;  1S4S A;  3LIF A;  3N4I A;  3KSH A;  4HES A;  4YIN A;  1T1B A;  3LI8 A;  2P04 A;  1QME A;  4LLO B;  3LIE A;  3HLG A;  4KG5 A;  4OH0 A;  2Z6D A;  5HWT A;  1W8Q A;  2O9C A;  4RQ9 A;  4LGW A;  4WF0 A;  1H0M A;  1VEU B;  5HL1 A;  4P87 A;  4KQQ A;  3Q82 A;  1K0K A;  4X53 A;  2R9W A;  4JPM A;  3WS2 A;  4GHI B;  4Z1W A;  4KZ7 A;  5L07 A;  1YT4 A;  4OQ0 A;  3UDX A;  1YM1 A;  2Y2H A;  2GDN A;  2UV0 E;  1N4O A;  2XR0 A;  2PR5 A;  1LI9 A;  4B4Z A;  1SZV A;  5FDH A;  5CHM A;  1BUL A;  2GJ3 A;  5DKL A;  4Q0J A;  2ACG A;  3KO6 A;  4E6X A;  4E3L A;  3O3V A;  4DN0 A;  3T1S A;  4UA7 A;  3GTC A;  2EX9 A;  3B47 A;  1PIO A;  4PAU A;  5FQQ A;  2EXA A;  3N8L A;  2XDM A;  2XF3 A;  2JCH A;  2Y2N A;  3PR6 A;  1E3U D;  2EX8 A;  2ZL1 B;  1XJ4 A;  2ZC7 A;  5HAP A;  1K38 A;  5HD3 A;  1ZHH B;  2G2U A;  4P6Z M;  3VFF A;  1KVM A;  3EQU A;  2Y2Q A;  4PM5 A;  5M18 A;  4EQ1 A;  2J9O A;  4Q8I A;  1SKF A;  1L0D A;  4QY6 A;  4S2J A;  2EA9 A;  2VGL M;  3EEA A;  4XT2 A;  4I5S A;  5IS1 A;  4HJ4 A;  2Q9N A;  3T1X A;  3U2A A;  1K54 A;  3GDI A;  1GHM A;  4Y0O A;  4F3L B;  1BLS A;  1IYS A;  4RX3 A;  3V3S A;  2WKH A;  4Z9Q A;  3N7W A;  2J9P A;  2PU2 A;  1HD8 A;  2K7S A;  2OV5 A;  3NOT C;  3K3C A;  3UPP A;  2DRW A;  2ZQ7 A;  1IOU A;  4UEY A;  2XA7 S;  5HZH A;  4NEE D;  1NY0 A;  5HSQ A;  1EWZ A;  3F1N B;  3IX8 A;  1NRJ A;  1T19 A;  3A0S A;  1TS6 A;  5DKK A;  4ID4 A;  1VB6 A;  1YSP A;  3NJA A;  3G35 A;  4KZ9 A;  2Y55 A;  1RGY A;  2PAV P;  4ZAM A;  5EVE A;  4Y17 A;  1FIK A;  3EEH A;  3MMH A;  1Z09 A;  2HV1 A;  2RCX A;  4X69 A;  2JC7 A;  1NZO A;  2UWX A;  3UME A;  2W3G A;  2W27 A;  2WGV A;  3BY9 A;  3A3I A;  4S2L A;  4UQI M;  3G6O A;  3UPN A;  2X02 A;  2D02 A;  3H7W A;  3C7U A;  5G4Y A;  1NZU A;  1MXO A;  3VFH A;  3BM6 A;  3L9K A;  4JGQ A;  1GSX A;  3OCN A;  4E3I A;  3CPT A;  4E04 A;  1YMS A;  4L9G A;  5FDS A;  5TR7 A;  4GLQ A;  3TJZ C;  3LR4 A;  1I2S A;  4C75 A;  1S1Y A;  3P09 A;  2Y2L A;  3GR2 A;  4MEZ A;  4HBT A;  5KIZ A;  3SZT A;  3LIC A;  4JXS A;  3UY6 A;  2E8I A;  2WYX A;  3DW0 A;  2B95 A;  3UN7 A;  4KQR A;  4KQD A;  2A24 A;  3IXG A;  1J3W A;  5CHU A;  5CRF A;  1MBL A;  1VQQ A;  1H8Y A;  2K31 A;  1K54 C;  3CUE A;  4NET A;  2IWC A;  3C4P A;  3W4P A;  1OME A;  3ZG8 B;  4PM9 A;  1UWN X;  2HDR A;  3VE4 A;  3Q7V B;  5FQ9 A;  3HLW A;  3LID A;  4HH2 A;  3MS6 A;  4IVI A;  4PM8 A;  5CEC A;  4ZTK A;  5AQ9 A;  3G31 A;  1CI8 A;  1DP6 A;  2Y2O A;  4NK3 A;  2AVX A;  3FKV A;  4NXG A;  3SOI A;  3WWX A;  4K08 A;  3WRT A;  2VLG A;  3IBR A;  3VMA A;  1SHV A;  5F1F A;  2W3D A;  4EBP A;  1ERQ A;  1WYB A;  4PM7 A;  2Y2G A;  2M1C A;  2XD1 A;  3UE1 A;  4LV2 A;  1SKO A;  3HRE A;  2I72 A;  2BTF P;  3O88 A;  1P97 A;  3T4K A;  2ZC3 B;  1AXB A;  1YLY A;  1UGU A;  2BG1 A;  2QPN A;  5KSC A;  1F9I A;  3LUQ A;  2M7V A;  3QP8 A;  4S2I A;  3CHW P;  4B9O A;  4BBV A;  3C5A A;  4E6W A;  1G68 A;  1T1A A;  3S4X A;  5TGF A;  2O9A A;  1KGE A;  4H6J B;  2J3W A;  4JBF A;  5EOE A;  4B93 A;  3WS1 A;  1N9N A;  4DE0 A;  3MFD A;  4JGR A;  2W1R A;  3SH7 A;  5E43 A;  4MLL A;  3E0Y A;  1N9L A;  4P6Z S;  2Y79 A;  3IH8 A;  3BEC A;  1X0O A;  3UE3 A;  3LR0 A;  3KSG A;  1NXY A;  2H10 A;  4OON A;  2Y2P A;  5EVI A;  4UHU A;  2VGL S;  3ZVT A;  4N1H A;  1TS7 A;  3IF6 A;  2JE5 A;  4GJ4 A;  4WEK A;  4R4S A;  1HTZ A;  1MKM A;  4BBU A;  3UO9 A;  4ETZ A;  4GS9 B;  1Y54 A;  3B33 A;  1KGG A;  3IX4 A;  4OPR A;  5J7E A;  1V9Z A;  3ZG0 A;  5JYP A;  1NJ4 A;  1F5M A;  5AQB A;  1OTI A;  3MXR A;  3NI9 A;  3QP2 A;  3CUE C;  2EX2 A;  1XFQ A;  1BLH A;  3ICY A;  1STZ A;  3OPH A;  2Y2J A;  2PBD P;  2WGW A;  2VK3 A;  1K25 A;  4UA6 A;  2BLS A;  4WN5 A;  3BW6 A;  3FYZ A;  2HP9 A;  5BOH A;  3S1Y A;  3UE6 A;  2O99 A;  5CGW A;  3MSH A;  4EEU A;  3UNW A;  4NG2 A;  1E4D A;  3N8R A;  4LV3 A;  1NYM A;  3GMW A;  2W1T B;  3MQ0 A;  4OQH A;  4E3N A;  2HDU A;  4FTX A;  2ZM2 A;  5A91 A;  4CLC B;  1FIL A;  2J3T C;  4P0M A;  1SCW A;  3MZD A;  3ZG9 B;  3QHY A;  4HIA A;  2QYB A;  4YWZ A;  2J8Y A;  1XGJ A;  5TJJ A;  5DTK A;  1PWC A;  3UE0 A;  3F1O A;  4UQI S;  2JKR M;  1YSQ A;  3BRM A;  3H82 A;  3QP6 A;  3UDF A;  1ES2 A;  4IHQ A;  2VGK A;  2LB5 A;  1K4F A;  4BD0 A;  2ZQ8 A;  3MQO A;  3NCK A;  4MN7 A;  3BEB A;  3N6I A;  2Y91 A;  2FH5 A;  3PXP A;  4GD8 A;  4WBG A;  4EUV A;  3C7V A;  3K2N A;  1D1J A;  4PM6 A;  2EWW A;  2PD8 A;  4X6T A;  2L4R A;  1GSV A;  3BY8 A;  2XK1 A;  3G2Y A;  4G3W A;  2JKT I;  2WAD A;  3O86 A;  4O01 A;  3MZE A;  4YNR A;  3G4P A;  3PBQ A;  4N9K A;  5EVI C;  4LEN A;  5EUA A;  4P6B A;  2R78 A;  4ZJ1 A;  3ITA A;  4GZB A;  4OOL A;  1WA9 A;  3R7W B;  3F1P A;  1ZTU A;  3IF6 C;  3LEZ A;  3NHQ A;  3HUM A;  1VET B;  1M6K A;  3CJM A;  3CLO A;  3DTK A;  2O0Y A;  5AVF A;  4FH4 A;  4H8R A;  5EV0 A;  3LR3 A;  1PW1 A;  1OT6 A;  3ZG7 B;  1Y28 A;  1RCJ A;  3CI6 A;  3BJN A;  5GLA A;  4Y5F A;  1MC0 A;  3T4J A;  3RH8 B;  1MWU A;  1BUE A;  5FL3 A;  2HZ5 A;  2JBF A;  5U47 A;  3SS4 A;  1GHI A;  1HLU P;  1IYP A;  1KE3 A;  5M19 A;  3FPW A;  5J3W A;  2V1A A;  2G2W A;  4L9F A;  5HPF A;  4UAA A;  4YOF A;  1ZC2 A;  3E2K A;  4C6Y A;  3PBN A;  3PAE A;  3I7J A;  3A3E A;  1PRQ A;  2EXB A;  4R6L A;  4Q0H A;  5L09 A;  3T12 B;  4OKP A;  3VSK A;  3ZYT A;  3W4Q A;  2ZQD A;  5FQI A;  1FOF A;  5FAT A;  4R70 A;  3OLO A;  2WUQ A;  3C8C A;  2W3H A;  5EEC A;  1IFQ A;  2J3T D;  3KYE A;  3VP0 A;  1H8M A;  4O0P A;  1G6A A;  4FD8 A;  4WEL A;  1K55 A;  3IS2 B;  3ZNT A;  2NUP C;  1CEF A;  3NDE A;  1CEG A;  1G5U A;  2A3U A;  1K57 A;  3BQA A;  4ESP A;  1BSG A;  3S7N A; 
#chains in the Genus database with same CATH homology
 3KSF A;  3C2W A;  2L0W A;  3GEC A;  2PHY A;  3T50 A;  4L9G A;  3R7W A;  4HQA A;  2PYP A;  2K2N A;  4GLQ A;  3TJZ C;  3LR4 A;  3OBF A;  1S1Y A;  3BWL A;  1TS8 A;  3PHY A;  2ZMF A;  5KIZ A;  1DP9 A;  2HGV A;  1OJG A;  3LIB A;  3LIC A;  2VZW A;  3T4T A;  4Y2F A;  2BAS A;  1LL8 A;  2VV8 A;  3EQV A;  2HJE A;  2PT7 A;  2GNX A;  1DRM A;  4EET B;  3EGX C;  4EER A;  1LSX A;  1LT0 A;  4KQD A;  3E4P A;  2A24 A;  5HDD A;  5TBM B;  2JKT M;  1S4R A;  3HCY A;  4CLC E;  2M7U A;  3VE3 A;  2VEA A;  3E4Q A;  2K31 A;  4I3J A;  3T4Q A;  3KSI A;  3CUE A;  4KQO A;  1OT9 A;  3PBR A;  4WUJ A;  3OCL A;  4IUK A;  2J80 A;  3CAX A;  4I3A A;  5J4E A;  2VKS A;  2W1T A;  1UWN X;  3K3D A;  5HDS A;  3VV4 A;  3BQ8 A;  2WKQ A;  3VE4 A;  4XT2 B;  1P0Z A;  3F1P B;  3RTY A;  2VV6 A;  3DBA A;  5HD5 A;  3PYP A;  3MQQ A;  3VOL A;  4O8G A;  2INW A;  3LID A;  4HH2 A;  4GCZ A;  3V67 A;  2XRO A;  1MZU A;  2WKR A;  4GHI A;  1NWZ A;  3JVU A;  3JVV A;  1DP6 A;  2KLI A;  4LRZ E;  4I38 A;  4NXG A;  4CLC C;  2OWJ A;  2XA7 M;  1D7E A;  2W0N A;  2YKH A;  4K08 A;  2VLG A;  4IJG A;  4L9E A;  3IBR A;  2QJ5 A;  2VX8 A;  3EWK A;  1T18 A;  2W3D A;  2JKR I;  3NOU C;  4M4X A;  2QWS A;  1GSW A;  2V0U A;  2IA2 A;  2M1C A;  3MR0 A;  3T4O A;  5KSH A;  3UB7 A;  4R38 A;  4ARZ B;  2VA0 A;  1UWP X;  1P97 A;  2QKP A;  3T4K A;  3TW8 A;  3LFV A;  3IS2 A;  4G3V A;  5L8M A;  1UGU A;  4KUK A;  3P01 A;  3ZQ5 A;  4MDZ A;  1F9I A;  3CWF A;  3LUQ A;  2M7V A;  2MJ6 A;  4FOF A;  5A8B A;  5HDC A;  4B9O A;  1P9W A;  3A0R A;  4HNB A;  4BBV A;  1P9R A;  3FC7 A;  4LRX C;  4WEJ A;  1TF1 A;  1G6O A;  3ULF A;  1T1A A;  2PDR A;  2D01 A;  1KOU A;  1BYW A;  2O9A A;  4CQH A;  4H6J B;  2J3W A;  4DMZ A;  4HI4 A;  4B93 A;  3LIA A;  1OTE A;  1N9N A;  2B02 A;  4JGR A;  5F68 A;  1JNU A;  5HWV A;  2W1R A;  3UB8 A;  1OPX A;  3E0Y A;  4EEP A;  1N9L A;  3H82 B;  4E04 A;  2OWH A;  2KOI A;  4P6Z S;  2Y79 A;  3O5Y A;  4PKY A;  1X0O A;  5K5B A;  2WKP A;  3RFB A;  3UE3 A;  3LR0 A;  3KSG A;  3R4K A;  2PYR A;  4BBT A;  3A0V A;  1NLZ A;  2OOL A;  3HJI A;  4F3L A;  5F5Y A;  2VGL S;  4NXB A;  2XRN A;  4II7 A;  3B42 A;  2L1M A;  3H7W B;  3IBJ A;  4IUH A;  2I9V A;  1TS7 A;  3MFX A;  3MXQ A;  5AJG A;  4EU0 A;  1OTD A;  4HY8 A;  4ETX A;  4WLA A;  3T4S A;  4GJ4 A;  4PKY G;  4WEK A;  4KUO A;  2OAQ 1;  4BJP A;  1MKM A;  4BBU A;  3MF0 A;  5I5L A;  2VV7 A;  2W3E A;  4ETZ A;  4GS9 B;  3KYZ A;  3SW1 A;  3B33 A;  2W3F A;  5EFW A;  4DJ2 A;  4LPZ A;  4MN6 A;  4GW9 A;  5J7E A;  5C5K A;  3EOI A;  1V9Z A;  4Y3I A;  1F5M A;  3F1N A;  5LBR A;  2HJ9 C;  2ZOI A;  1OTI A;  2H28 A;  2ZMV A;  4HP4 A;  3C38 A;  3CUE C;  4MMN A;  3W2Z A;  4LRY C;  4Q0I A;  1XFQ A;  3ICY A;  1S1Z A;  2ZOH A;  1N9O A;  4HHD A;  1S4S A;  5DF9 A;  1STZ A;  2QHK A;  3LIF A;  3KSH A;  1S67 L;  2A24 B;  1T1B A;  4WN5 A;  3LI8 A;  3BW6 A;  2P04 A;  3UB6 A;  4ZRR A;  1V9Y A;  4LLO B;  3LIE A;  3UE6 A;  2O99 A;  3PBT A;  4DJ3 A;  3EGD C;  5F69 A;  2Z6D A;  1VHM A;  5HWT A;  4RQ9 A;  2O9C A;  4EEU A;  4MCW A;  3OC2 A;  3KYQ A;  2W1T B;  4WF0 A;  5AVE A;  3MQ0 A;  1EW0 A;  1YKD A;  1F98 A;  3C30 A;  3T4L A;  2V9A A;  4CLC B;  2J3T C;  1XJ6 A;  1LSV A;  4G3K A;  3P7N A;  4GHI B;  4Z1W A;  5DJU A;  4HIA A;  2QYB A;  4YWZ A;  4JGO A;  3CIT A;  4CLC D;  5TJJ A;  5IT5 A;  4NXF A;  3F1O A;  2PR5 A;  1XJ3 A;  5HL6 A;  2A2L A;  4UQI S;  3S7Q A;  5G4Z A;  4EXO A;  5F6A A;  3MJQ A;  2GJ3 A;  4Q0J A;  5DKL A;  2JKR M;  1YSQ A;  3H82 A;  3KO6 A;  4HOI A;  2NUT C;  2P08 A;  4NXE A;  4FSF A;  1D06 A;  4IHQ A;  2LB5 A;  4DN0 A;  2JHE A;  1ODV A;  3MQO A;  2XSS A;  4MN7 A;  3B47 A;  4HP9 A;  4PAU A;  3S7P A;  2FH5 A;  2P7J A;  3PXP A;  3FPV A;  3E4O A;  4EUV A;  3K2N A;  3E98 A;  2EWW A;  2PD8 A;  2L4R A;  3PR6 A;  5TBM A;  1OTB A;  4ME4 A;  1GSV A;  3LI9 A;  1XJ4 A;  3PBO A;  3BY8 A;  3UMD A;  5HD3 A;  4G3W A;  4O01 A;  1XJ2 A;  1ZHH B;  2JKT I;  4YNR A;  4P6Z M;  1T1C A;  4GS9 A;  3PBQ A;  3D3O A;  3TRC A;  3EQU A;  1S66 L;  2HF6 A;  2GX5 A;  2QJ7 A;  3H9W A;  1G28 A;  1OTA A;  4EQ1 A;  2R78 A;  5IU1 A;  1H3Q A;  2EA9 A;  2VGL M;  4OOL A;  4QPR A;  3EEA A;  4EW7 A;  4XT2 A;  1WA9 A;  3R7W B;  2PD7 A;  1ZTU A;  3F1P A;  4HJ3 A;  4I5S A;  3NHQ A;  5IS1 A;  4HJ4 A;  2OAP 1;  2GZA A;  3U2A A;  2LB9 A;  4NKP A;  2Z6C A;  3GDI A;  3S7O A;  4F3L B;  5HWW A;  3CLO A;  4HJ6 A;  2O0Y A;  5AVF A;  4WL9 A;  1OJ5 A;  1LSW A;  3LR3 A;  2V1B A;  2B18 A;  3PBS A;  5HPI A;  3HJK A;  1OT6 A;  2K7S A;  1Y28 A;  3NOT C;  3CI6 A;  3K3C A;  3BJN A;  2YKF A;  4HH3 A;  4Y5F A;  1MC0 A;  3T4J A;  3KX0 X;  3RH8 B;  2VJW A;  1IOU A;  5FL3 A;  4UEY A;  4BMW A;  2EWV A;  2XA7 S;  3FG8 A;  2KDK A;  5HZH A;  4ARZ A;  4NEE D;  2CMN A;  4CLC A;  3FPW A;  4MN5 A;  3TE8 A;  4I3I A;  1TS0 A;  5J3W A;  5HSQ A;  2V1A A;  1TD5 A;  4AFI A;  3F1N B;  4L9F A;  5HPF A;  1NRJ A;  1YAX A;  4PHT A;  4YOF A;  4L0L A;  1T19 A;  3PBN A;  2ZBB A;  3A0S A;  1TS6 A;  5DKK A;  2V0W A;  1VB6 A;  1YSP A;  3UB9 A;  3NJA A;  4R6L A;  3D72 A;  2O9B A;  4Q0H A;  2JN7 A;  3EEH A;  3MMH A;  4H6J A;  2DMW A;  3ZYT A;  3LR5 A;  2HV1 A;  1W63 Q;  2PR6 A;  5DFX A;  3OOV A;  4R70 A;  5DJT A;  1W63 M;  1XFN A;  4I39 A;  3NOP C;  4JGP A;  3OLO A;  3UME A;  2W3G A;  5CX7 A;  3C8C A;  2W27 A;  4EES A;  2W3H A;  1IFQ A;  2G7U A;  2KX6 A;  2Y8H A;  3BY9 A;  2J3T D;  5DFY A;  1H8M A;  4O0P A;  3LYX A;  4UQI M;  1NLY A;  3G6O A;  5MC7 A;  4WEL A;  2D02 A;  3IS2 B;  3H7W A;  2NUP C;  4OOM A;  5G4Y A;  3BQA A;  4R3A A;  4BWI A;  2FZ0 A;  3F1O B;  4JGQ A;  1GSX A;  3OCN A;  3S7N A;  1DP8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...