1BUEA

Nmc-a carbapenemase from enterobacter cloacae
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
265
structure length
265
Chain Sequence
NTKGIDEIKNLETDFNGRIGVYALDTGSGKSFSYRANERFPLCSSFKGFLAAAVLKGSQDNRLNLNQIVNYNTRSLEFHSPITTKYKDNGMSLGDMAAAALQYSDNGATNIILERYIGGPEGMTKFMRSIGDEDFRLDRWELDLNTAIPGDERDTSTPAAVAKSLKTLALGNILSEHEKETYQTWLKGNTTGAARIRASVPSDWVVGDKTGSCGAYGTANDYAVVWPKNRAPLIISVYTTKNEKEAKHEDKVIAEASRIAIDNLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PROTEIN (IMIPENEM-HYDROLYSING BETA-LACTAMASE)
publication title X-ray analysis of the NMC-A beta-lactamase at 1.64-A resolution, a class A carbapenemase with broad substrate specificity.
pubmed doi rcsb
source organism Enterobacter cloacae
total genus 93
structure length 265
sequence length 265
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 1998-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1bueA00
3W4PA 5E2HA 3VFHA 3BFFA 1BT5A 5M19A 3Q7ZA 5CGXA 3HLBA 4N92A 5F82A 1L0FA 1YMSA 1YLJA 3QHYA 5M18A 3Q1FA 5GLDA 4OH0A 1SDEA 2C6WB 3FZCA 1ES2A 4WELA 4ZJ1A 4UHUA 2XK1A 4KG6A 3WS0A 1FOFA 3PBNA 4KG5A 2ZQ7A 1TDLA 4E3NA 2V20A 5CHMA 4K0XA 2XD5A 4IBRA 3ZG8B 4S2PA 3BLSA 1PIOA 1JWZA 2IWCA 5JYPA 4WZ5A 1ZG4A 1PZPA 2Y2OA 4ZTKA 1FQGA 1E3UD 1LL5A 3ZGAB 4S2JA 2JBFA 4X6TA 1MBLA 2P74A 5KZHA 2ZQ9A 2Y2JA 3ZNTA 4BENA 4PM8A 5EVIA 1K56A 2R9XA 3G2YA 3V5MA 5FI6A 1K6SA 4S2OA 4BD1A 3NDGA 3IXGA 1K54A 5AQBA 2EX9A 2J9PA 2ZC4B 3LCEA 1CI8A 3D4FA 3O3VA 4UA7A 5KSCA 4DKIA 1YLWA 3IWQA 4PM5A 2ZQDA 5A91A 2EXBA 3HLWA 1BUEA 1FR6A 1I2SA 2XLNA 5A90A 1JWVA 3Q07A 4MEZA 4RX3A 2XGNA 1S6RA 3CJMA 2WGWA 4JXGA 4EWFA 5E2EA 4OPRA 3A3FA 1NZOA 3SS3A 2V2FF 4LCLA 4C6YA 2HP9A 3PBQA 3EQVA 1YLTA 3IF6C 4E3MA 3UPNA 4OLDA 4WYYA 1PWGA 3IWOA 2J9OA 4LV1A 3TG9A 3UNWA 3HUMA 2HDQA 5GHYA 2Y2KA 2VGJA 3HLGA 3IXDA 3VP1A 5EPHA 4DRTA 1BLSA 3UO9A 4K0WA 1Q2QA 5CTMA 1W8QA 3NC8A 3RXWA 3MXSA 4D2OA 3BRMA 5HAIA 2ZC6B 3VMAA 3GQZA 5AQ9A 1FCOA 3A3EA 4OPQA 3VSKA 1L0DA 3NDEA 4L0LA 5FI7A 4HESA 4MBHA 3G32A 3PAGA 4EBNA 4RYEA 1CEGA 3Q82A 5E43A 3UDIA 2R9WA 3GVBA 4ZJ2A 1KDSA 2ZM8A 4GDNA 5GLCA 1MWUA 4KZ7A 4B4ZA 5CHJA 3V50A 1HZOA 4C3QA 1NY0A 3GV9A 5HFOA 4E3LA 2WZXA 2ZC5B 1BSGA 4CJNA 2ZLYA 3GMWA 1LLBA 3N8RA 5EVIB 5FATA 3ITAA 5FQQA 4B88A 1K55A 2ZC7A 5A92A 1H8YA 4ID4A 3NBLA 3IH9A 1NYMA 5F83A 3NCKA 1G6AA 3HVFA 3N4IA 4OOYA 3IHBA 3MFDA 5L2FA 3MBZA 4KQQA 2WGIA 3LO7A 5FQIA 2ZM2A 3OCLA 3BFGA 4K91A 5FDHA 3EQUA 2XH9A 3V3SA 3WS4A 5J8XA 4U0TA 3SH9A 3W4OA 2OLUA 3ZG9B 1N9BA 4R0QA 3IXHA 3SS4A 1LL9A 2WGWB 1JTGA 2WGVA 1NYYA 3LEZA 3UDXA 5EVID 1K56D 4DE0A 4P85A 1DY6A 3HLCA 3MKFA 2XFSA 3LY3A 4MLLA 1IYOA 2ZQ8A 4P0MA 3N6IA 1XPBA 1YQSA 2BG1A 3CZDA 4UAAA 4WEJA 3ZG0A 3M6BA 2OLVA 3BFEA 3GRJA 3E2KA 1RP5A 4Y0OA 4JF5A 4JKTA 4OPYA 3VP0A 5A93A 4EV4A 1MWSA 5GL9A 1XA1A 4OPZA 5CRFA 2CC1A 1G68A 1IKGA 2BLSA 4DDSA 4KZ8A 2X02A 3V3RA 1BTLA 1EI5A 2Z2MB 2PU4A 3ZG7B 5CEDA 3NY4A 4S2MA 2UWXA 1L2SA 4WZ4A 2DNSA 4R3BA 4S2KA 5EECA 2A49A 4OQHA 2Y2GA 4PM7A 4KQRA 2Q9NA 3G30A 3WWXA 2EX6A 3CG5A 5CHUA 4XUZA 1KE3A 4KZ6A 2Y59A 2Y2MA 4RX2A 5GLBA 5FSRA 3HBRA 1FR1A 2ZJ9A 2Y2NA 2FFYA 3RXXA 3Q81A 4KZ9A 4LENA 5HW3A 2QPNA 2XR0A 2ZC3B 4DE3A 1AXBA 3W4QA 3WRZA 2ZMAA 2WAEA 3IHAA 3AGFA 5EE8A 4R23A 1MWTA 3UY6A 3WRTA 3UE1A 5BOHA 1MWRA 3M2JA 4NETA 3ZHHA 3HUOA 3ISGA 3IQAA 3NI9A 5HAPA 3PTEA 3ZVWA 4A5RA 1IEMA 2PU2A 4E3JA 2HDUA 1PI5A 3LY4A 3OPRA 1SCWA 3G35A 1BULA 2WADA 5D3OA 4KQOA 4KZ4A 3C7UA 4BD0A 1XX2A 1PWCA 3PBTA 4DE1A 4FD8A 3JYIA 1JTDA 3TSGA 4FH2A 1FCMA 2EFXA 3GR2A 3A3DA 1NRFA 3DWKA 4S2NA 2JE5A 1L0EA 5DF8A 4N1HA 4O7DA 2WKIA 3DTMA 1KE4A 3VP2A 1XA7A 1Z6FA 1ES5A 1K57A 2WZZA 1IYSA 2V1ZA 5GHZA 3G34A 4WZ5C 5F1GA 2A3UA 5IHVA 5HARA 4IVIA 1KVLA 1GA0A 3IF5A 3SH7A 1ZKJA 1O07A 1HTZA 4FSFA 3WS1A 3PBRA 1ERMA 4Y0TA 4X69A 5AQAA 5EVIC 3ZG5A 3ZNYA 2ZQAA 4UA6A 1GHIA 1NJ4A 1K38A 2WYXA 4EUZA 2Y2PA 3N8LA 1K54C 4H8RA 5HAQA 5TGFA 1FCNA 2HP5A 4JXWA 4QHCA 4BL3A 4KZAA 2Y2QA 3OPLA 1PZOA 3MZEA 4QB8A 4Y7PA 1E25A 1KDWA 3VOZA 1U60A 3IH8A 4Y0UA 2XF3A 4JLFA 4DXBA 1LHYA 3BFDA 4GNUA 4DF6A 5FQMA 1ESUA 5CEBA 1H5XA 3BEBA 4JF6A 3CMZA 4GB7A 4FH4A 1LI0A 3O86A 4UA9A 5DTSA 5GLAA 2JC7A 5HL1A 4Z9QA 3OC2A 4Q8IA 3FKWA 2DCFA 1ES3A 5CTNA 3VOYA 4DXCA 1S0WA 2EXAA 4KZBA 1XKZA 1IYQA 2E8IA 3B3XA 5M1AA 3VP3A 1K4EA 1SDNA 1ERQA 2Y2HA 4N9KA 3M6HA 3AGEA 1NXYA 3QNCA 3ZVTA 3P09A 3I7JA 1YLPA 4E3IA 3OCNA 5E2FA 3SS5A 4BQMA 4E6XA 2GDNA 3RJUA 3OZHA 1CEFA 4RVAA 1PI4A 4ZAMA 1MPLA 3WS2A 4JF4A 1ALQA 5FQKA 4M3KA 4R4RA 3HREA 3VFFA 3PBSA 3ITBA 1WYBA 3BM6A 2WAFA 2WKHA 5FA7A 3OPPA 5DTTA 1GHMA 5KSHA 3E2LA 3VSLA 3SOIA 4QY5A 2WKEA 2XEPA 4GKUA 4EBLA 5FQ9A 5F1FA 3ZCZA 2XFTA 5FQJA 4F94A 4OOMA 5EUAA 1WE4A 4FCFA 4QU3A 2ZQCA 1K25A 1K4FA 3C7VA 5KMWA 1YT4A 4HBTA 3G4PA 1BLPA 2VGKA 3UDFA 1MY8A 4HEFA 1ONGA 2QMIA 2HDRA 1K55C 4C75A 5HX9A 4GOGA 2H0YA 5EOEA 4MBFA 1TVFA 2I72A 3O88A 4LV2A 3DWZA 1EROA 2QZ6A 4LCMA 2Y4AA 3IT9A 3OPHA 4GN2A 5U47A 1KGEA 3IXBA 1W5DA 4R3JA 1RCJA 3UE0A 2RCXA 4XUXA 3IF6A 3MZDA 1Q2PA 4P87A 3C4PA 3HLEA 2WUQA 2H5SA 4X68A 1M40A 4GDBA 4S2LA 3MKEA 4R4SA 4WM9A 3P98A 2H10A 3S22A 4CPKA 4OOLA 4U0XA 2ZM0A 4HBUA 5CGSA 5FAOA 4EQIA 1RGZA 4MNRA 3UE3A 4E6WA 5I94A 5FI2A 1M6KA 2EX8A 3Q7VA 1QMEA 4OLGA 3ZFZA 3BFCA 4GD6A 1DJAA 1ZG6A 4P6BA 2PBYA 3S4XA 3UN7A 1MKIA 2ZD8A 4BJPA 5CECA 4IVKA 4R1GA 3QNBA 4WMCA 2HDSA 4OVDA 4BL2A 1K6RA 5DVAA 1PW1A 2X01A 1YLYA 4ZJ3A 1CK3A 4X56A 5FASA 3MZFA 3N7WA 2OV5A 1GCEA 5EOOA 5EVLA 4N9LA 1IKIA 1PWDA 1W8YA 1GA9A 1FSYA 1J9MA 1RGYA 2J7VA 4GD8A 4IEDA 1CI9A 2XQZA 3FKVA 2JCHA 3ZDJA 1KVMA 4OONA 1GHPA 4EBPA 1QMFA 1KGGA 1L0GA 1YM1A 2G2WA 2P9VB 2Y91A 5CERA 1W7FA 1I2WA 4OQGA 3AGDA 1PYYA 2XDMA 3GTCA 3O87A 2IWBA 1KE0A 3UPPA 3V39A 1IELA 4QD4A 2H0TA 3A3IA 5CGWA 3G2ZA 2B5RA 1ZC2A 5JYOA 2FFFB 5TFQA 4X55A 5AQ7A 1LI9A 1JVJA 4XXRA 1I5QA 3HLFA 1XGJA 4OP5A 3IF6B 1E3UA 3HL9A 4N1XA 4JXVA 1DJBA 3BECA 1W79A 4WEKA 4OQIA 3A3JA 4NK3A 4PM9A 4JPMA 4ZDXA 4DE2A 2Z2LB 4PM6A 1XXMA 2Q9MA 4LV0A 3BLMA 3BYDA 3HLDA 3GSGA 4X53A 1ONHA 5DF9A 4PMAA 3M2KA 2RL3A 4KZ5A 3C4OA 4QJGA 1ESIA 3IWIA 5E2GA 1WYCA 4KG2A 1SHVA 3MXRA 2G2UA 2C5WB 2J8YA 3NIAA 4S2IA 3FV7A 2Y2IA 1Y54A 2Y55A 4QY6A 4OP8A 1N4OA 3Q7VB 3FWLA 1O7EA 4U3TA 3PBOA 4S2NC 4B4XA 1BLCA 1XP4A 5GHXA 4IBXA 1H8ZA 1VQQA 4KZ3A 4OKPA 2HP6A 3WS5A 3N8SA 1FSWA 1VM1A 4LV3A 4JXSA 5CXWA 5G18A 2EX2A 2WK0A 3C5AA 4E3OA 4GZBA 1K57C 1OMEA 1EWZA 1HD8A 5FAQA 4JBFA 5DF7A 1JWPA 4KENB 4E3KA 3DW0A 3UPOA 1BZAA 1KGFA 4YFMA 1DJCA 1IYPA 1PW8A 2IWDA 1ES4A 4OQ0A 1HVBA 3TOIA 5TR7A 4DDYA 3FYZA 1NZUA 4MBKA 5FAPA 4BLMA 4PPRA 4WBGA 1SKFA 1C3BA 4RA7A 1XGIA 2EFUA 4ZBEA 3PAEA 4WMCD 1TEMA 2HPBA 2P9VA 3HUNA 3G31A 3W8KA 5DTKA 1YLZA 2DRWA 3S1YA 4YINA 1MXOA 1BLHA 2XD1A 2OSUA 2Y2LA 3SH8A 3VP4A 1YMXA 1E4DA 2X71A 1TDGA
chains in the Genus database with same CATH superfamily
1K0KA 3DAVA 2QJ5A 2W1TB 3Q7ZA 3HLBA 5M18A 3QHYA 5HD5A 3T1RA 4OH0A 3PBNA 4KG5A 5CHMA 2IWCA 4WZ5A 1ZG4A 4S2JA 4X6TA 5HDCA 1MBLA 2Y2JA 3ZNTA 3MQOA 4BENA 5EVIA 3G2YA 4S2OA 2BASA 1HLUP 2INWA 3IXGA 2UV0E 4E04A 2J9PA 3O3VA 2IA2A 3T12B 2JKRI 3HLWA 1BUEA 4NXEA 4MEZA 1GSVA 2W3HA 3CJMA 2WGWA 4JXGA 5TBMA 5L10A 3A3FA 4EQ1A 1F98A 3EQVA 5HWTA 1P9RA 4E3MA 3UPNA 3JVVA 1CF0A 4WYYA 2KDKA 2J9OA 3TG9A 2HDQA 2Y2KA 3VP1A 5EPHA 4DRTA 2VA0A 3UO9A 1Q2QA 3NC8A 4I3JA 3GQZA 1L0DA 4L0LA 3K2NA 3JVUA 4EXOA 3GVBA 1MWUA 3NECA 1ZHHB 1JNUA 3A0SA 2WZXA 2ZC5B 4CJNA 2ZLYA 2W27A 3U2AA 5EVIB 5FQQA 4B88A 2ZC7A 3NBLA 4R38A 1NYMA 5L2FA 3MBZA 3LO7A 4K91A 5FDHA 2XH9A 2PD8A 2OLUA 3IXHA 2WGWB 5TBMB 1JTGA 2L4RA 1XFNA 1IYOA 3N6IA 1XPBA 5HSQA 4GW9A 3R7WA 1YSQA 5HD3A 3E4OA 2FH5A 4JF5A 3VP0A 1VB6A 4X1LA 2NUPC 2CC1A 4HOIA 4KZ8A 2X02A 2PR6A 4BWIA 2OWHA 2PU4A 3ZG7B 4S2MA 2DNSA 4R3BA 5EECA 2A49A 2Y2GA 4KQRA 2G7UA 3SW1A 3LR4A 2FFYA 2WKPA 4I3AA 4LENA 2XR0A 4Y3IA 2ZC3B 4DE3A 3WRZA 5DKLA 4R23A 2VV7A 2W3DA 3UE1A 3M2JA 3T1QB 3ISGA 3NI9A 5HAPA 4GLQA 4A5RA 1IEMA 4E3JA 1MKMA 2HDUA 5EM1A 4B9OA 3OPRA 2ZBBA 1F2KA 3E4QA 3C7UA 4DE1A 2XA7S 1JTDA 2L1MA 2VX8A 2KX6A 3R7WB 5DJUA 2QYBA 3GR2A 1NRFA 1KE4A 3VP2A 1XA7A 3LIEA 1IYSA 2V1ZA 4DN0A 5GHZA 2A3UA 5HARA 4IVIA 1KVLA 3CPTA 3SH7A 1O07A 3CAXA 4FSFA 4BBTA 3ZG5A 3ZNYA 4EUZA 1GHIA 4G3WA 4H8RA 3T4QA 4X1MA 4LGWA 5KIZA 4KQDA 3IH8A 5F5YA 4JLFA 4DF6A 2BTFP 2HGVA 1H5XA 3BEBA 4GB7A 1IYQA 2E8IA 3VP3A 1SDNA 1ERQA 3M6HA 2W3EA 3I7JA 1YLPA 4BQMA 3C2WA 1CEFA 1MPLA 3PYPA 1ALQA 1D1JA 4M3KA 4EERA 3HREA 3VFFA 3PBSA 5FA7A 3KSIA 3OPPA 4Q0IA 1XJ6A 3SOIA 4HQAA 4GKUA 2XFTA 5A8BA 5FQJA 5EUAA 1WE4A 4QU3A 5J3WA 3CPTB 3L9KA 5KMWA 1PFLA 5AJGA 1TVFA 2I72A 2M1CA 3DWZA 3S7NA 1DP9A 3IT9A 4PHTA 3IXBA 1W5DA 2JN7A 1RCJA 1S66L 2RCXA 4QWOA 3C4PA 3KYEA 3HLEA 1M40A 4GDBA 4Q0JA 3S22A 4CPKA 2XA7M 2ZM0A 4HBUA 5CGSA 5FAOA 1FIKA 4E6WA 3Q7VA 4OLGA 3ZFZA 3BFCA 1DJAA 1ZG6A 4P6BA 3KYZA 4BJPA 3KYQA 4MDZA 2HDSA 3OBFA 2V8CA 4NKPA 4H6JA 1CK3A 2OV5A 2J80A 3F1NA 1PWDA 1FSYA 1RGYA 2J7VA 4GD8A 1CI9A 2XQZA 2JCHA 1UGUA 1GHPA 4EBPA 2B18A 4OQGA 1PYYA 4MMNA 3O87A 4HJ6A 1KE0A 1Y4OA 2IWBA 3V39A 3MXQA 4QD4A 4P6ZS 4L9GA 2V1BA 4O0PA 2XROA 1E3UA 3LR3A 4WEKA 4LFUA 1EW0A 2HZ5A 4PM9A 2Q9MA 1GSWA 3BYDA 1ONHA 4D60A 1WYCA 2FZ0A 1SHVA 1H8MA 2Y2IA 1S1YA 3SZTA 5HPIA 3DTIA 2PR5A 3Q7VB 1VQQA 4OKPA 1KOUA 4JXSA 1BYWA 2EX2A 1K57C 1HD8A 5F68A 1OTEA 3LYXA 4H6JB 4E3KA 3UPOA 1YAXA 4YFMA 1IYPA 3UB5P 3F1NB 2JKTM 3KSGA 5FAPA 4BLMA 4NXGA 1SKFA 4AFIA 2ZMFA 2PRFA 3G31A 1YLZA 3B47A 4HI4A 4YINA 1BLHA 3SH8A 3VP4A 1YMXA 4DJ2A 1NWZA 3PR6A 4N92A 4MN5A 5F82A 1L0FA 1YMSA 1XFQA 5GLDA 3UE6A 2B02A 4WELA 4FUWA 4UHUA 3WS0A 1TDLA 2V20A 1ACFA 4IBRA 3ZG8B 4S2PA 3VOLA 1PIOA 3S7QA 1PZPA 2Y2OA 4ZTKA 1FQGA 3ZGAB 2ZQ9A 3V5MA 5AQBA 2VLGA 1V9ZA 4DKIA 3IWQA 4PM5A 2ZQDA 5A91A 4KUOA 2EXBA 2QHKA 2JKFA 2QKPA 1Y28A 5E2EA 2CMNA 2V2FF 4P6ZM 2HP9A 3PBQA 4II7A 4ME4A 2HJ9C 3MF0A 1YLTA 3MFXA 4OLDA 3IWOA 3UNWA 4HNBA 5K5BA 3QP1A 2O9CA 3JPUA 2QJ7A 3BRMA 5HAIA 5AQ9A 1FCOA 3A3EA 2PHYA 4WN5A 1W63M 4HESA 3NOPC 1CEGA 2GJ3A 2K31A 3UDIA 4NEED 4ZJ2A 1HZOA 3BY9A 4E3LA 3T4KA 1LLBA 3N8RA 3ITAA 1SZVA 3FG8A 4OOYA 5EV0A 1LSVA 3MFDA 4KQQA 3OCLA 3BFGA 3EQUA 3W4OA 4R0QA 2WGVA 3S7OA 5EVID 4DE0A 1DY6A 4EUVA 2BG1A 3ICYA 4UAAA 3OLOA 4WEJA 5HL6A 3ZG0A 4HP9A 3QP6A 3TRCA 4RQ9A 2L0WA 1RP5A 1XJ4A 3C8CA 4JKTA 5A93A 1MWSA 1CQAA 3MR0A 3LR5A 2GX5A 2W3GA 1G68A 1IKGA 5I5LA 3V3RA 1BTLA 2Z2MB 2OAP1 4HH3A 4PM7A 2Q9NA 3G30A 1KE3A 3T4SA 4RX2A 3A0RA 5GLBA 2ZJ9A 3RXXA 4HJ4A 4KZ9A 2ACGA 2QPNA 5FEGA 3QP2A 4I3IA 5EE8A 3WRTA 3H82A 5BOHA 3EGDC 3T50A 3LIBA 3LEQA 3KO6A 3D3OA 3T1XA 5HDDA 5J7EA 4JGPA 4KZ4A 4PAUA 4DMZA 3TW8A 3T4TA 4NXBA 1H3QA 4Y2FA 2JE5A 3F1PA 2GNXA 1ODVA 1ES5A 1K57A 3IX8A 5F1GA 5IHVA 1ZKJA 3WS1A 4X69A 4UA6A 2ZQAA 1NJ4A 1K38A 1K54C 5HAQA 5TGFA 1FCNA 2HP5A 4JXWA 1OT6A 2Y2QA 1PZOA 4QB8A 4HH2A 4Y7PA 4EU0A 1U60A 2XF3A 3LICA 1ESUA 3H82B 3CMZA 3MQ0A 3HJKA 1LI0A 5DTSA 1STZA 4UA9A 5HL1A 4Z9QA 3FKWA 2DCFA 1ES3A 2LB5A 2V0UA 4KZBA 1K4EA 3QNCA 4CLCE 4E3IA 3P7NA 2J3TC 3SS5A 2GDNA 4MCWA 3RJUA 4RVAA 4ZAMA 3LGOA 5FQKA 4R4RA 3BM6A 1P97A 1GHMA 2Z6CA 2KOIA 3E2LA 3VSLA 3F1PB 4EW7A 4QY5A 5CX7A 3IX3A 2ZQCA 4G3KA 4LRZE 3FPVA 1VHMA 2VGKA 4PKYG 2HDRA 1K55C 4C75A 5HX9A 2H0YA 3CHWP 1VETA 2K7SA 3VV4A 1EROA 2QZ6A 1H0MA 2Y4AA 3R4KA 3QP5A 5FL3A 1AWIA 3LIDA 1Q2PA 3NOTC 2J3WA 3BY8A 2ZMVA 2D02A 4R4SA 3VE4A 1T1CA 3L7HA 1RGZA 3LIFA 4MNRA 3UE3A 1QMEA 3S4XA 3MMHA 2A24A 3QNBA 4IVKA 4R1GA 4Y13A 4OVDA 3A0VA 1PW1A 4WLAA 1YLYA 4ZJ3A 3MZFA 2PYRA 3N7WA 5EOOA 4N9LA 1J9MA 3FKVA 1KVMA 1QMFA 1KGGA 2P9VB 3MS6A 2XDMA 3MQQA 3OOVA 3UPPA 1IELA 1VETB 4EETB 2WKRA 3VE3A 1ZC2A 4XXRA 1XGJA 3BECA 4OQIA 4ZDXA 1OT9A 4PM6A 1XXMA 2H28A 4LV0A 2KLIA 3HLDA 3GSGA 3LR0A 5DF9A 4PMAA 4Y5FA 4QJGA 1IOUA 3GDIA 2G2UA 2C5WB 2J8YA 3NIAA 4ETXA 1Y54A 3PHYA 1O7EA 3PBOA 4B4XA 1BLCA 1XP4A 2I9VA 2OOLA 2HP6A 4GCZA 2A24B 3C5AA 1OMEA 5HZHA 5FAQA 2JKGA 1P9WA 1KGFA 1DJCA 2IWDA 4OQ0A 3TOIA 1ES4A 5TR7A 3FYZA 1DP6A 3KSFA 1XGIA 2EFUA 3ULFA 3W8KA 5DTKA 2DRWA 1OTBA 4UQIS 1MXOA 1LSXA 1E4DA 3UMDA 2X71A 4OPQA 1GSXA 3W4PA 3VFHA 3BFFA 1BT5A 4IJGA 3O5YA 5CGXA 4LRYC 3Q1FA 1ES2A 3F1OA 2XK1A 4KG6A 4E3NA 2ZQ7A 2P7JA 2XD5A 4HIAA 1UWPX 4KUKA 5L07A 3LUQA 3PXPA 1E3UD 2K2NA 4PM8A 1K56A 2R9XA 3DTEA 5FI6A 1K6SA 2V1AA 1K54A 2EX9A 3LCEA 3D4FA 5KSCA 5AVEA 1YLWA 3LIAA 1FR6A 2XLNA 4RX3A 1S6RA 3G6OA 4EWFA 2EWWA 1TD5A 2HJEA 4EEPA 5DFXA 1PWGA 1N9LA 3HUMA 1NLYA 5GHYA 3HLGA 3IXDA 4X25A 1IFQA 1BLSA 4K0WA 1Z09A 1DRMA 5CTMA 4L9FA 3RXWA 4D2OA 2QWSA 1PNEA 2EA9A 3F1OB 3G32A 4EBNA 1OTDA 4RYEA 5E43A 3Q82A 2R9WA 2ZM8A 4GDNA 1OTAA 2HV1A 5CHJA 1T1BA 4C3QA 4ARZB 2V9AA 1BSGA 5FATA 1K55A 1H8YA 4CLCA 5F83A 3NCKA 3IHBA 3UB8A 2WGIA 5FQIA 1S1ZA 3K3DA 3WS4A 5J8XA 3ZG9B 3SH9A 1N9BA 4O8GA 3SS4A 4UQIM 3CUEC 3HLCA 3LY3A 4MLLA 1YQSA 1T18A 3FPWA 2OLVA 1OTIA 3GRJA 4UEYA 3E2KA 4Y0OA 4OPYA 5GL9A 1XA1A 4OPZA 1S4RA 4JGQA 4BMWA 2BLSA 4DDSA 3NY4A 3BQ8A 3IBJA 3MJQA 4CQHA 1L2SA 2E8JA 2EWVA 4S2KA 4R3AA 2EX6A 3CG5A 4KZ6A 2Y59A 3HBRA 1FR1A 2Y2NA 3Q81A 5HW3A 1AXBA 4CLCB 2WAEA 3AGFA 3K3CA 1T1AA 1N9NA 1MWTA 3EEAA 3UY6A 4BBVA 1TS0A 1MWRA 3HUOA 5L8MA 2O9BA 3MSHA 3DBAA 3ZVWA 3UB6A 1PI5A 1S67L 3EOIA 3G35A 2WADA 5D3OA 4KQOA 4BD0A 2O0YA 1XX2A 3PBTA 5EFWA 1A0KA 1TS7A 4FD8A 3C38A 3JYIA 3TSGA 3QP8A 1FCMA 3LI9A 3A3DA 4N1HA 4O7DA 2WKIA 3DTMA 3LI8A 4GJ4A 3G34A 3BWLA 3EEHA 1HTZA 3PBRA 4Y0TA 1OJ5A 2WYXA 2Y2PA 3N8LA 2R78A 4IHQA 4QHCA 4KZAA 4EEUA 2O99A 3MZEA 3BJNA 1E25A 1G5UA 1KDWA 3VOZA 4LLOB 4DXBA 1LHYA 4GNUA 1TS6A 5FQMA 5CEBA 2V0WA 4JF6A 3IX4A 2PBDP 4FH4A 3O86A 5GLAA 5CTNA 4DXCA 1S0WA 4R6LA 3B3XA 5LBRA 4N9KA 3ZVTA 3AGEA 4MN7A 1FILA 3OCNA 5E2FA 3OZHA 1PI4A 4JF4A 5F6AA 3ITBA 1WYBA 2WAFA 2A2LA 2WKEA 5FQ9A 5F1FA 3ZCZA 3FC7A 4OOMA 1D7EA 4FCFA 1K25A 5FDSA 1YT4A 3BW6A 2LB9A 3G4PA 1BLPA 4MN6A 4HEFA 1ONGA 2QMIA 2P04A 2VZWA 5EOEA 3O88A 4LV2A 4LCMA 5U47A 4R70A 1KGEA 3UE0A 3MZDA 3NJAA 1SKOA 3T1SA 2WUQA 2H5SA 4X68A 4S2LA 4YOFA 2WKQA 3P98A 4WM9A 5DKKA 1LL8A 4Z1WA 5HWWA 2JKTI 5I94A 3CWFA 3V67A 2Q0OA 4GD6A 3UN7A 2PBYA 2ZD8A 4HHDA 4WMCA 4NG2A 3B42A 4BL2A 1VEUA 1K6RA 5DVAA 5FASA 4Y15A 5EVLA 1LT0A 2OAQ1 2D01A 4IUHA 1GA9A 3NULA 4IEDA 3ZDJA 1D06A 3CITA 3RTYA 1L0GA 4O01A 2VV8A 5G4ZA 5CERA 1I2WA 3AGDA 2H0TA 3G2ZA 2B5RA 3CUEA 1JVJA 3UB9A 1I5QA 3HL9A 4JXVA 1SKOB 3A3JA 4NK3A 4JGRA 4XT2A 2Z2LB 3DTKA 2JHEA 2RL3A 3T4JA 2PD7A 1ESIA 5E2GA 4KG2A 2Y55A 4OP8A 1N4OA 3FWLA 4S2NC 4IBXA 4KZ3A 1FSWA 1VM1A 5G18A 5AVFA 3ZQ5A 3HJIA 1VEUB 1MC0A 1EWZA 1JWPA 4KENB 1BZAA 1V9YA 1PW8A 1HVBA 4DDYA 1WA9A 2HPBA 2P9VA 4I38A 3S1YA 1MZUA 2XD1A 2OSUA 2Y2LA 4CLCC 1CI8A 1TDGA 2W3FA 5E2HA 5M19A 1PRQA 4F3LA 4ZRRA 2M7UA 3C30A 4XT2B 1YLJA 1YKDA 1SDEA 2C6WB 3FZCA 4ZJ1A 1FOFA 4K0XA 4ESPA 3BLSA 1JWZA 4HY8A 5DJTA 5JYPA 2VEAA 1LL5A 2JBFA 5FEFA 2P74A 1F5MA 5KZHA 2Y8HA 4HJ3A 4BD1A 3NDGA 2ZC4B 4UA7A 4WL9A 1I2SA 5A90A 1JWVA 3Q07A 2XGNA 1OJGA 4OPRA 1NZOA 3SS3A 5IS1A 4LCLA 4C6YA 2VGLS 5IU1A 3IF6C 5C5KA 3E0YA 4WUJA 4LV1A 2PDRA 2ZL1A 2VGJA 5HWVA 4F3LB 3H7WA 1W8QA 3MXSA 2ZC6B 3VMAA 3VSKA 4GHIA 3NDEA 5FI7A 4MBHA 3NOUC 3PAGA 1OPXA 2PAVP 1W63Q 1KDSA 5GLCA 4KZ7A 4B4ZA 3V50A 3E4PA 1NY0A 3GV9A 5HFOA 1XJ2A 3GMWA 3U4LP 5A92A 3EGXC 4ID4A 2OWJA 3IH9A 1G6AA 3HVFA 3N4IA 4LRXC 2ZM2A 3V3SA 3KX0X 4QPRA 4U0TA 5HPFA 1LL9A 4YWZA 1NYYA 3LEZA 4FOFA 3UDXA 1K56D 4P85A 1TS8A 4PKYA 3MKFA 2XFSA 2ZQ8A 4P0MA 3CZDA 4NXFA 2PT7A 2XRNA 1NRJA 3M6BA 3BFEA 2ZL1B 3LFVA 4EV4A 3H7WB 2VKSA 3KSHA 5CRFA 4JGOA 1EI5A 2PYPA 4GHIB 4ETZA 5CEDA 3P01A 2UWXA 4WZ4A 4OQHA 3QP4A 3WWXA 4XUZA 1UWNX 3GECA 2Y2MA 2J3TD 5FSRA 3IBRA 2O9AA 4ARZA 1P0ZA 4L9EA 1TF1A 3W4QA 2ZMAA 3IHAA 1G28A 5EVEA 4NETA 3ZHHA 2YKHA 3IQAA 2VGLM 3PTEA 2PU2A 3D9YA 3LY4A 3T4OA 1SCWA 1J3WA 1BULA 4CLCD 1PWCA 1F9IA 4FH2A 1XJ3A 2EFXA 3DWKA 4S2NA 1L0EA 5DF8A 5DFYA 1Z6FA 2WZZA 3EWKA 4WZ5C 2GZAA 5F69A 1GA0A 3IF5A 1ERMA 5AQAA 5EVIC 4Y17A 2W0NA 3T4LA 4DJ3A 2P08A 4BL3A 2V8FA 3OPLA 4M4XA 1G6OA 3ZYTA 4K08A 3B33A 4Y0UA 2YKFA 3BFDA 4GS9A 3CI6A 4WF0A 2Y79A 2VJWA 4I39A 2JC7A 3OC2A 1YPRA 4Q8IA 3IS2A 3VOYA 2EXAA 4G3VA 1XKZA 5M1AA 2Y2HA 1NXYA 3P09A 2XSSA 4E6XA 3WS2A 1L3LA 2WKHA 2JKRM 5DTTA 5KSHA 4EBLA 2XEPA 1CJFA 4F94A 2Z6DA 4YNRA 1K4FA 4LPZA 3C7VA 4HBTA 4EESA 3UDFA 1MY8A 3CLOA 4GOGA 4MBFA 4GN2A 3OPHA 3TE8A 4R3JA 4XUXA 2M7VA 3IF6A 4FTXA 4P87A 2VV6A 4GS9B 4HP4A 3MKEA 2W1RA 3RH8B 1X0OA 2H10A 3IS2B 4OOLA 3TJZC 4I5SA 4U0XA 1ZTUA 4EQIA 5FI2A 1M6KA 5G4YA 2EX8A 3E98A 1MKIA 5CECA 3UB7A 5J4EA 2X01A 2DMWA 5IT5A 1N9OA 4X56A 2NUTC 1GCEA 1IKIA 1W8YA 4BBUA 5EM0A 5HDSA 3W2ZA 4OONA 3HCYA 1YM1A 2G2WA 2Y91A 1W7FA 3GTCA 2B95A 1DP8A 3A3IA 5CGWA 5JYOA 5MC7A 2FFFB 5TFQA 4X55A 5AQ7A 1LI9A 1LSWA 1T19A 2VK3A 3HLFA 2W1TA 4OP5A 3IF6B 4N1XA 5L09A 1DJBA 1S4SA 1W79A 4JPMA 4DE2A 2MJ6A 1NLZA 3BLMA 4B93A 4X53A 3M2KA 4KZ5A 3C4OA 3IWIA 2HF6A 3MXRA 4S2IA 3FV7A 4QY6A 4U3TA 5GHXA 1H8ZA 3WS5A 3N8SA 4LV3A 5CXWA 3UMEA 3NHQA 2WK0A 4E3OA 4GZBA 3H9WA 2ZOIA 4JBFA 3RFBA 5DF7A 3DW0A 3D72A 4IUKA 1NZUA 3BQAA 4MBKA 5TJJA 4PPRA 4WBGA 2ZOHA 1C3BA 4RA7A 4ZBEA 3PAEA 4WMCD 1TEMA 3HUNA 1YSPA 4Q0HA 2AVXA 3S7PA 5CHUA
chains in the Genus database with same CATH topology
3W4PA 5E2HA 3VFHA 3BFFA 1BT5A 5M19A 3Q7ZA 5CGXA 3HLBA 4N92A 5F82A 1L0FA 1YMSA 1YLJA 3QHYA 5M18A 3Q1FA 5GLDA 4OH0A 1SDEA 2C6WB 3FZCA 1ES2A 4WELA 4ZJ1A 4UHUA 2XK1A 4KG6A 3WS0A 1FOFA 3PBNA 4KG5A 2ZQ7A 1TDLA 4E3NA 2V20A 5CHMA 4K0XA 2XD5A 4IBRA 3ZG8B 4S2PA 3BLSA 1PIOA 1JWZA 2IWCA 5JYPA 4WZ5A 1ZG4A 1PZPA 2Y2OA 4ZTKA 1FQGA 1E3UD 1LL5A 3ZGAB 4S2JA 2JBFA 4X6TA 1MBLA 2P74A 5KZHA 2ZQ9A 2Y2JA 3ZNTA 4BENA 4PM8A 5EVIA 1K56A 2R9XA 3G2YA 3V5MA 5FI6A 1K6SA 4S2OA 4BD1A 3NDGA 3IXGA 1K54A 5AQBA 2EX9A 2J9PA 2ZC4B 3LCEA 1CI8A 3D4FA 3O3VA 4UA7A 5KSCA 4DKIA 1YLWA 3IWQA 4PM5A 2ZQDA 5A91A 2EXBA 3HLWA 1BUEA 1FR6A 1I2SA 2XLNA 5A90A 1JWVA 3Q07A 4MEZA 4RX3A 2XGNA 1S6RA 3CJMA 2WGWA 4JXGA 4EWFA 5E2EA 4OPRA 3A3FA 1NZOA 3SS3A 2V2FF 4LCLA 4C6YA 2HP9A 3PBQA 3EQVA 1YLTA 3IF6C 4E3MA 3UPNA 4OLDA 4WYYA 1PWGA 3IWOA 2J9OA 4LV1A 3TG9A 3UNWA 3HUMA 2HDQA 5GHYA 2Y2KA 2VGJA 3HLGA 3IXDA 3VP1A 5EPHA 4DRTA 1BLSA 3UO9A 4K0WA 1Q2QA 5CTMA 1W8QA 3NC8A 3RXWA 3MXSA 4D2OA 3BRMA 5HAIA 2ZC6B 3VMAA 3GQZA 5AQ9A 1FCOA 3A3EA 4OPQA 3VSKA 1L0DA 3NDEA 4L0LA 5FI7A 4HESA 4MBHA 3G32A 3PAGA 4EBNA 4RYEA 1CEGA 3Q82A 5E43A 3UDIA 2R9WA 3GVBA 4ZJ2A 1KDSA 2ZM8A 4GDNA 5GLCA 1MWUA 4KZ7A 4B4ZA 5CHJA 3V50A 1HZOA 4C3QA 1NY0A 3GV9A 5HFOA 4E3LA 2WZXA 2ZC5B 1BSGA 4CJNA 2ZLYA 3GMWA 1LLBA 3N8RA 5EVIB 5FATA 3ITAA 5FQQA 4B88A 1K55A 2ZC7A 5A92A 1H8YA 4ID4A 3NBLA 3IH9A 1NYMA 5F83A 3NCKA 1G6AA 3HVFA 3N4IA 4OOYA 3IHBA 3MFDA 5L2FA 3MBZA 4KQQA 2WGIA 3LO7A 5FQIA 2ZM2A 3OCLA 3BFGA 4K91A 5FDHA 3EQUA 2XH9A 3V3SA 3WS4A 5J8XA 4U0TA 3SH9A 3W4OA 2OLUA 3ZG9B 1N9BA 4R0QA 3IXHA 3SS4A 1LL9A 2WGWB 1JTGA 2WGVA 1NYYA 3LEZA 3UDXA 5EVID 1K56D 4DE0A 4P85A 1DY6A 3HLCA 3MKFA 2XFSA 3LY3A 4MLLA 1IYOA 2ZQ8A 4P0MA 3N6IA 1XPBA 1YQSA 2BG1A 3CZDA 4UAAA 4WEJA 3ZG0A 3M6BA 2OLVA 3BFEA 3GRJA 3E2KA 1RP5A 4Y0OA 4JF5A 4JKTA 4OPYA 3VP0A 5A93A 4EV4A 1MWSA 5GL9A 1XA1A 4OPZA 5CRFA 2CC1A 1G68A 1IKGA 2BLSA 4DDSA 4KZ8A 2X02A 3V3RA 1BTLA 1EI5A 2Z2MB 2PU4A 3ZG7B 5CEDA 3NY4A 4S2MA 2UWXA 1L2SA 4WZ4A 2DNSA 4R3BA 4S2KA 5EECA 2A49A 4OQHA 2Y2GA 4PM7A 4KQRA 2Q9NA 3G30A 3WWXA 2EX6A 3CG5A 5CHUA 4XUZA 1KE3A 4KZ6A 2Y59A 2Y2MA 4RX2A 5GLBA 5FSRA 3HBRA 1FR1A 2ZJ9A 2Y2NA 2FFYA 3RXXA 3Q81A 4KZ9A 4LENA 5HW3A 2QPNA 2XR0A 2ZC3B 4DE3A 1AXBA 3W4QA 3WRZA 2ZMAA 2WAEA 3IHAA 3AGFA 5EE8A 4R23A 1MWTA 3UY6A 3WRTA 3UE1A 5BOHA 1MWRA 3M2JA 4NETA 3ZHHA 3HUOA 3ISGA 3IQAA 3NI9A 5HAPA 3PTEA 3ZVWA 4A5RA 1IEMA 2PU2A 4E3JA 2HDUA 1PI5A 3LY4A 3OPRA 1SCWA 3G35A 1BULA 2WADA 5D3OA 4KQOA 4KZ4A 3C7UA 4BD0A 1XX2A 1PWCA 3PBTA 4DE1A 4FD8A 3JYIA 1JTDA 3TSGA 4FH2A 1FCMA 2EFXA 3GR2A 3A3DA 1NRFA 3DWKA 4S2NA 2JE5A 1L0EA 5DF8A 4N1HA 4O7DA 2WKIA 3DTMA 1KE4A 3VP2A 1XA7A 1Z6FA 1ES5A 1K57A 2WZZA 1IYSA 2V1ZA 5GHZA 3G34A 4WZ5C 5F1GA 2A3UA 5IHVA 5HARA 4IVIA 1KVLA 1GA0A 3IF5A 3SH7A 1ZKJA 1O07A 1HTZA 4FSFA 3WS1A 3PBRA 1ERMA 4Y0TA 4X69A 5AQAA 5EVIC 3ZG5A 3ZNYA 2ZQAA 4UA6A 1GHIA 1NJ4A 1K38A 2WYXA 4EUZA 2Y2PA 3N8LA 1K54C 4H8RA 5HAQA 5TGFA 1FCNA 2HP5A 4JXWA 4QHCA 4BL3A 4KZAA 2Y2QA 3OPLA 1PZOA 3MZEA 4QB8A 4Y7PA 1E25A 1KDWA 3VOZA 1U60A 3IH8A 4Y0UA 2XF3A 4JLFA 4DXBA 1LHYA 3BFDA 4GNUA 4DF6A 5FQMA 1ESUA 5CEBA 1H5XA 3BEBA 4JF6A 3CMZA 4GB7A 4FH4A 1LI0A 3O86A 4UA9A 5DTSA 5GLAA 2JC7A 5HL1A 4Z9QA 3OC2A 4Q8IA 3FKWA 2DCFA 1ES3A 5CTNA 3VOYA 4DXCA 1S0WA 2EXAA 4KZBA 1XKZA 1IYQA 2E8IA 3B3XA 5M1AA 3VP3A 1K4EA 1SDNA 1ERQA 2Y2HA 4N9KA 3M6HA 3AGEA 1NXYA 3QNCA 3ZVTA 3P09A 3I7JA 1YLPA 4E3IA 3OCNA 5E2FA 3SS5A 4BQMA 4E6XA 2GDNA 3RJUA 3OZHA 1CEFA 4RVAA 1PI4A 4ZAMA 1MPLA 3WS2A 4JF4A 1ALQA 5FQKA 4M3KA 4R4RA 3HREA 3VFFA 3PBSA 3ITBA 1WYBA 3BM6A 2WAFA 2WKHA 5FA7A 3OPPA 5DTTA 1GHMA 5KSHA 3E2LA 3VSLA 3SOIA 4QY5A 2WKEA 2XEPA 4GKUA 4EBLA 5FQ9A 5F1FA 3ZCZA 2XFTA 5FQJA 4F94A 4OOMA 5EUAA 1WE4A 4FCFA 4QU3A 2ZQCA 1K25A 1K4FA 3C7VA 5KMWA 1YT4A 4HBTA 3G4PA 1BLPA 2VGKA 3UDFA 1MY8A 4HEFA 1ONGA 2QMIA 2HDRA 1K55C 4C75A 5HX9A 4GOGA 2H0YA 5EOEA 4MBFA 1TVFA 2I72A 3O88A 4LV2A 3DWZA 1EROA 2QZ6A 4LCMA 2Y4AA 3IT9A 3OPHA 4GN2A 5U47A 1KGEA 3IXBA 1W5DA 4R3JA 1RCJA 3UE0A 2RCXA 4XUXA 3IF6A 3MZDA 1Q2PA 4P87A 3C4PA 3HLEA 2WUQA 2H5SA 4X68A 1M40A 4GDBA 4S2LA 3MKEA 4R4SA 4WM9A 3P98A 2H10A 3S22A 4CPKA 4OOLA 4U0XA 2ZM0A 4HBUA 5CGSA 5FAOA 4EQIA 1RGZA 4MNRA 3UE3A 4E6WA 5I94A 5FI2A 1M6KA 2EX8A 3Q7VA 1QMEA 4OLGA 3ZFZA 3BFCA 4GD6A 1DJAA 1ZG6A 4P6BA 2PBYA 3S4XA 3UN7A 1MKIA 2ZD8A 4BJPA 5CECA 4IVKA 4R1GA 3QNBA 4WMCA 2HDSA 4OVDA 4BL2A 1K6RA 5DVAA 1PW1A 2X01A 1YLYA 4ZJ3A 1CK3A 4X56A 5FASA 3MZFA 3N7WA 2OV5A 1GCEA 5EOOA 5EVLA 4N9LA 1IKIA 1PWDA 1W8YA 1GA9A 1FSYA 1J9MA 1RGYA 2J7VA 4GD8A 4IEDA 1CI9A 2XQZA 3FKVA 2JCHA 3ZDJA 1KVMA 4OONA 1GHPA 4EBPA 1QMFA 1KGGA 1L0GA 1YM1A 2G2WA 2P9VB 2Y91A 5CERA 1W7FA 1I2WA 4OQGA 3AGDA 1PYYA 2XDMA 3GTCA 3O87A 2IWBA 1KE0A 3UPPA 3V39A 1IELA 4QD4A 2H0TA 3A3IA 5CGWA 3G2ZA 2B5RA 1ZC2A 5JYOA 2FFFB 5TFQA 4X55A 5AQ7A 1LI9A 1JVJA 4XXRA 1I5QA 3HLFA 1XGJA 4OP5A 3IF6B 1E3UA 3HL9A 4N1XA 4JXVA 1DJBA 3BECA 1W79A 4WEKA 4OQIA 3A3JA 4NK3A 4PM9A 4JPMA 4ZDXA 4DE2A 2Z2LB 4PM6A 1XXMA 2Q9MA 4LV0A 3BLMA 3BYDA 3HLDA 3GSGA 4X53A 1ONHA 5DF9A 4PMAA 3M2KA 2RL3A 4KZ5A 3C4OA 4QJGA 1ESIA 3IWIA 5E2GA 1WYCA 4KG2A 1SHVA 3MXRA 2G2UA 2C5WB 2J8YA 3NIAA 4S2IA 3FV7A 2Y2IA 1Y54A 2Y55A 4QY6A 4OP8A 1N4OA 3Q7VB 3FWLA 1O7EA 4U3TA 3PBOA 4S2NC 4B4XA 1BLCA 1XP4A 5GHXA 4IBXA 1H8ZA 1VQQA 4KZ3A 4OKPA 2HP6A 3WS5A 3N8SA 1FSWA 1VM1A 4LV3A 4JXSA 5CXWA 5G18A 2EX2A 2WK0A 3C5AA 4E3OA 4GZBA 1K57C 1OMEA 1EWZA 1HD8A 5FAQA 4JBFA 5DF7A 1JWPA 4KENB 4E3KA 3DW0A 3UPOA 1BZAA 1KGFA 4YFMA 1DJCA 1IYPA 1PW8A 2IWDA 1ES4A 4OQ0A 1HVBA 3TOIA 5TR7A 4DDYA 3FYZA 1NZUA 4MBKA 5FAPA 4BLMA 4PPRA 4WBGA 1SKFA 1C3BA 4RA7A 1XGIA 2EFUA 4ZBEA 3PAEA 4WMCD 1TEMA 2HPBA 2P9VA 3HUNA 3G31A 3W8KA 5DTKA 1YLZA 2DRWA 3S1YA 4YINA 1MXOA 1BLHA 2XD1A 2OSUA 2Y2LA 3SH8A 3VP4A 1YMXA 1E4DA 2X71A 1TDGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W4P A;  5E2H A;  3VFH A;  3BFF A;  1BT5 A;  5M19 A;  3Q7Z A;  5CGX A;  3HLB A;  4N92 A;  5F82 A;  1L0F A;  1YMS A;  1YLJ A;  3QHY A;  5M18 A;  3Q1F A;  5GLD A;  4OH0 A;  1SDE A;  2C6W B;  3FZC A;  1ES2 A;  4WEL A;  4ZJ1 A;  4UHU A;  2XK1 A;  4KG6 A;  3WS0 A;  1FOF A;  3PBN A;  4KG5 A;  2ZQ7 A;  1TDL A;  4E3N A;  2V20 A;  5CHM A;  4K0X A;  2XD5 A;  4IBR A;  3ZG8 B;  4S2P A;  3BLS A;  1PIO A;  1JWZ A;  2IWC A;  5JYP A;  4WZ5 A;  1ZG4 A;  1PZP A;  2Y2O A;  4ZTK A;  1FQG A;  1E3U D;  1LL5 A;  3ZGA B;  4S2J A;  2JBF A;  4X6T A;  1MBL A;  2P74 A;  5KZH A;  2ZQ9 A;  2Y2J A;  3ZNT A;  4BEN A;  4PM8 A;  5EVI A;  1K56 A;  2R9X A;  3G2Y A;  3V5M A;  5FI6 A;  1K6S A;  4S2O A;  4BD1 A;  3NDG A;  3IXG A;  1K54 A;  5AQB A;  2EX9 A;  2J9P A;  2ZC4 B;  3LCE A;  1CI8 A;  3D4F A;  3O3V A;  4UA7 A;  5KSC A;  4DKI A;  1YLW A;  3IWQ A;  4PM5 A;  2ZQD A;  5A91 A;  2EXB A;  3HLW A;  1BUE A;  1FR6 A;  1I2S A;  2XLN A;  5A90 A;  1JWV A;  3Q07 A;  4MEZ A;  4RX3 A;  2XGN A;  1S6R A;  3CJM A;  2WGW A;  4JXG A;  4EWF A;  5E2E A;  4OPR A;  3A3F A;  1NZO A;  3SS3 A;  2V2F F;  4LCL A;  4C6Y A;  2HP9 A;  3PBQ A;  3EQV A;  1YLT A;  3IF6 C;  4E3M A;  3UPN A;  4OLD A;  4WYY A;  1PWG A;  3IWO A;  2J9O A;  4LV1 A;  3TG9 A;  3UNW A;  3HUM A;  2HDQ A;  5GHY A;  2Y2K A;  2VGJ A;  3HLG A;  3IXD A;  3VP1 A;  5EPH A;  4DRT A;  1BLS A;  3UO9 A;  4K0W A;  1Q2Q A;  5CTM A;  1W8Q A;  3NC8 A;  3RXW A;  3MXS A;  4D2O A;  3BRM A;  5HAI A;  2ZC6 B;  3VMA A;  3GQZ A;  5AQ9 A;  1FCO A;  3A3E A;  4OPQ A;  3VSK A;  1L0D A;  3NDE A;  4L0L A;  5FI7 A;  4HES A;  4MBH A;  3G32 A;  3PAG A;  4EBN A;  4RYE A;  1CEG A;  3Q82 A;  5E43 A;  3UDI A;  2R9W A;  3GVB A;  4ZJ2 A;  1KDS A;  2ZM8 A;  4GDN A;  5GLC A;  1MWU A;  4KZ7 A;  4B4Z A;  5CHJ A;  3V50 A;  1HZO A;  4C3Q A;  1NY0 A;  3GV9 A;  5HFO A;  4E3L A;  2WZX A;  2ZC5 B;  1BSG A;  4CJN A;  2ZLY A;  3GMW A;  1LLB A;  3N8R A;  5EVI B;  5FAT A;  3ITA A;  5FQQ A;  4B88 A;  1K55 A;  2ZC7 A;  5A92 A;  1H8Y A;  4ID4 A;  3NBL A;  3IH9 A;  1NYM A;  5F83 A;  3NCK A;  1G6A A;  3HVF A;  3N4I A;  4OOY A;  3IHB A;  3MFD A;  5L2F A;  3MBZ A;  4KQQ A;  2WGI A;  3LO7 A;  5FQI A;  2ZM2 A;  3OCL A;  3BFG A;  4K91 A;  5FDH A;  3EQU A;  2XH9 A;  3V3S A;  3WS4 A;  5J8X A;  4U0T A;  3SH9 A;  3W4O A;  2OLU A;  3ZG9 B;  1N9B A;  4R0Q A;  3IXH A;  3SS4 A;  1LL9 A;  2WGW B;  1JTG A;  2WGV A;  1NYY A;  3LEZ A;  3UDX A;  5EVI D;  1K56 D;  4DE0 A;  4P85 A;  1DY6 A;  3HLC A;  3MKF A;  2XFS A;  3LY3 A;  4MLL A;  1IYO A;  2ZQ8 A;  4P0M A;  3N6I A;  1XPB A;  1YQS A;  2BG1 A;  3CZD A;  4UAA A;  4WEJ A;  3ZG0 A;  3M6B A;  2OLV A;  3BFE A;  3GRJ A;  3E2K A;  1RP5 A;  4Y0O A;  4JF5 A;  4JKT A;  4OPY A;  3VP0 A;  5A93 A;  4EV4 A;  1MWS A;  5GL9 A;  1XA1 A;  4OPZ A;  5CRF A;  2CC1 A;  1G68 A;  1IKG A;  2BLS A;  4DDS A;  4KZ8 A;  2X02 A;  3V3R A;  1BTL A;  1EI5 A;  2Z2M B;  2PU4 A;  3ZG7 B;  5CED A;  3NY4 A;  4S2M A;  2UWX A;  1L2S A;  4WZ4 A;  2DNS A;  4R3B A;  4S2K A;  5EEC A;  2A49 A;  4OQH A;  2Y2G A;  4PM7 A;  4KQR A;  2Q9N A;  3G30 A;  3WWX A;  2EX6 A;  3CG5 A;  5CHU A;  4XUZ A;  1KE3 A;  4KZ6 A;  2Y59 A;  2Y2M A;  4RX2 A;  5GLB A;  5FSR A;  3HBR A;  1FR1 A;  2ZJ9 A;  2Y2N A;  2FFY A;  3RXX A;  3Q81 A;  4KZ9 A;  4LEN A;  5HW3 A;  2QPN A;  2XR0 A;  2ZC3 B;  4DE3 A;  1AXB A;  3W4Q A;  3WRZ A;  2ZMA A;  2WAE A;  3IHA A;  3AGF A;  5EE8 A;  4R23 A;  1MWT A;  3UY6 A;  3WRT A;  3UE1 A;  5BOH A;  1MWR A;  3M2J A;  4NET A;  3ZHH A;  3HUO A;  3ISG A;  3IQA A;  3NI9 A;  5HAP A;  3PTE A;  3ZVW A;  4A5R A;  1IEM A;  2PU2 A;  4E3J A;  2HDU A;  1PI5 A;  3LY4 A;  3OPR A;  1SCW A;  3G35 A;  1BUL A;  2WAD A;  5D3O A;  4KQO A;  4KZ4 A;  3C7U A;  4BD0 A;  1XX2 A;  1PWC A;  3PBT A;  4DE1 A;  4FD8 A;  3JYI A;  1JTD A;  3TSG A;  4FH2 A;  1FCM A;  2EFX A;  3GR2 A;  3A3D A;  1NRF A;  3DWK A;  4S2N A;  2JE5 A;  1L0E A;  5DF8 A;  4N1H A;  4O7D A;  2WKI A;  3DTM A;  1KE4 A;  3VP2 A;  1XA7 A;  1Z6F A;  1ES5 A;  1K57 A;  2WZZ A;  1IYS A;  2V1Z A;  5GHZ A;  3G34 A;  4WZ5 C;  5F1G A;  2A3U A;  5IHV A;  5HAR A;  4IVI A;  1KVL A;  1GA0 A;  3IF5 A;  3SH7 A;  1ZKJ A;  1O07 A;  1HTZ A;  4FSF A;  3WS1 A;  3PBR A;  1ERM A;  4Y0T A;  4X69 A;  5AQA A;  5EVI C;  3ZG5 A;  3ZNY A;  2ZQA A;  4UA6 A;  1GHI A;  1NJ4 A;  1K38 A;  2WYX A;  4EUZ A;  2Y2P A;  3N8L A;  1K54 C;  4H8R A;  5HAQ A;  5TGF A;  1FCN A;  2HP5 A;  4JXW A;  4QHC A;  4BL3 A;  4KZA A;  2Y2Q A;  3OPL A;  1PZO A;  3MZE A;  4QB8 A;  4Y7P A;  1E25 A;  1KDW A;  3VOZ A;  1U60 A;  3IH8 A;  4Y0U A;  2XF3 A;  4JLF A;  4DXB A;  1LHY A;  3BFD A;  4GNU A;  4DF6 A;  5FQM A;  1ESU A;  5CEB A;  1H5X A;  3BEB A;  4JF6 A;  3CMZ A;  4GB7 A;  4FH4 A;  1LI0 A;  3O86 A;  4UA9 A;  5DTS A;  5GLA A;  2JC7 A;  5HL1 A;  4Z9Q A;  3OC2 A;  4Q8I A;  3FKW A;  2DCF A;  1ES3 A;  5CTN A;  3VOY A;  4DXC A;  1S0W A;  2EXA A;  4KZB A;  1XKZ A;  1IYQ A;  2E8I A;  3B3X A;  5M1A A;  3VP3 A;  1K4E A;  1SDN A;  1ERQ A;  2Y2H A;  4N9K A;  3M6H A;  3AGE A;  1NXY A;  3QNC A;  3ZVT A;  3P09 A;  3I7J A;  1YLP A;  4E3I A;  3OCN A;  5E2F A;  3SS5 A;  4BQM A;  4E6X A;  2GDN A;  3RJU A;  3OZH A;  1CEF A;  4RVA A;  1PI4 A;  4ZAM A;  1MPL A;  3WS2 A;  4JF4 A;  1ALQ A;  5FQK A;  4M3K A;  4R4R A;  3HRE A;  3VFF A;  3PBS A;  3ITB A;  1WYB A;  3BM6 A;  2WAF A;  2WKH A;  5FA7 A;  3OPP A;  5DTT A;  1GHM A;  5KSH A;  3E2L A;  3VSL A;  3SOI A;  4QY5 A;  2WKE A;  2XEP A;  4GKU A;  4EBL A;  5FQ9 A;  5F1F A;  3ZCZ A;  2XFT A;  5FQJ A;  4F94 A;  4OOM A;  5EUA A;  1WE4 A;  4FCF A;  4QU3 A;  2ZQC A;  1K25 A;  1K4F A;  3C7V A;  5KMW A;  1YT4 A;  4HBT A;  3G4P A;  1BLP A;  2VGK A;  3UDF A;  1MY8 A;  4HEF A;  1ONG A;  2QMI A;  2HDR A;  1K55 C;  4C75 A;  5HX9 A;  4GOG A;  2H0Y A;  5EOE A;  4MBF A;  1TVF A;  2I72 A;  3O88 A;  4LV2 A;  3DWZ A;  1ERO A;  2QZ6 A;  4LCM A;  2Y4A A;  3IT9 A;  3OPH A;  4GN2 A;  5U47 A;  1KGE A;  3IXB A;  1W5D A;  4R3J A;  1RCJ A;  3UE0 A;  2RCX A;  4XUX A;  3IF6 A;  3MZD A;  1Q2P A;  4P87 A;  3C4P A;  3HLE A;  2WUQ A;  2H5S A;  4X68 A;  1M40 A;  4GDB A;  4S2L A;  3MKE A;  4R4S A;  4WM9 A;  3P98 A;  2H10 A;  3S22 A;  4CPK A;  4OOL A;  4U0X A;  2ZM0 A;  4HBU A;  5CGS A;  5FAO A;  4EQI A;  1RGZ A;  4MNR A;  3UE3 A;  4E6W A;  5I94 A;  5FI2 A;  1M6K A;  2EX8 A;  3Q7V A;  1QME A;  4OLG A;  3ZFZ A;  3BFC A;  4GD6 A;  1DJA A;  1ZG6 A;  4P6B A;  2PBY A;  3S4X A;  3UN7 A;  1MKI A;  2ZD8 A;  4BJP A;  5CEC A;  4IVK A;  4R1G A;  3QNB A;  4WMC A;  2HDS A;  4OVD A;  4BL2 A;  1K6R A;  5DVA A;  1PW1 A;  2X01 A;  1YLY A;  4ZJ3 A;  1CK3 A;  4X56 A;  5FAS A;  3MZF A;  3N7W A;  2OV5 A;  1GCE A;  5EOO A;  5EVL A;  4N9L A;  1IKI A;  1PWD A;  1W8Y A;  1GA9 A;  1FSY A;  1J9M A;  1RGY A;  2J7V A;  4GD8 A;  4IED A;  1CI9 A;  2XQZ A;  3FKV A;  2JCH A;  3ZDJ A;  1KVM A;  4OON A;  1GHP A;  4EBP A;  1QMF A;  1KGG A;  1L0G A;  1YM1 A;  2G2W A;  2P9V B;  2Y91 A;  5CER A;  1W7F A;  1I2W A;  4OQG A;  3AGD A;  1PYY A;  2XDM A;  3GTC A;  3O87 A;  2IWB A;  1KE0 A;  3UPP A;  3V39 A;  1IEL A;  4QD4 A;  2H0T A;  3A3I A;  5CGW A;  3G2Z A;  2B5R A;  1ZC2 A;  5JYO A;  2FFF B;  5TFQ A;  4X55 A;  5AQ7 A;  1LI9 A;  1JVJ A;  4XXR A;  1I5Q A;  3HLF A;  1XGJ A;  4OP5 A;  3IF6 B;  1E3U A;  3HL9 A;  4N1X A;  4JXV A;  1DJB A;  3BEC A;  1W79 A;  4WEK A;  4OQI A;  3A3J A;  4NK3 A;  4PM9 A;  4JPM A;  4ZDX A;  4DE2 A;  2Z2L B;  4PM6 A;  1XXM A;  2Q9M A;  4LV0 A;  3BLM A;  3BYD A;  3HLD A;  3GSG A;  4X53 A;  1ONH A;  5DF9 A;  4PMA A;  3M2K A;  2RL3 A;  4KZ5 A;  3C4O A;  4QJG A;  1ESI A;  3IWI A;  5E2G A;  1WYC A;  4KG2 A;  1SHV A;  3MXR A;  2G2U A;  2C5W B;  2J8Y A;  3NIA A;  4S2I A;  3FV7 A;  2Y2I A;  1Y54 A;  2Y55 A;  4QY6 A;  4OP8 A;  1N4O A;  3Q7V B;  3FWL A;  1O7E A;  4U3T A;  3PBO A;  4S2N C;  4B4X A;  1BLC A;  1XP4 A;  5GHX A;  4IBX A;  1H8Z A;  1VQQ A;  4KZ3 A;  4OKP A;  2HP6 A;  3WS5 A;  3N8S A;  1FSW A;  1VM1 A;  4LV3 A;  4JXS A;  5CXW A;  5G18 A;  2EX2 A;  2WK0 A;  3C5A A;  4E3O A;  4GZB A;  1K57 C;  1OME A;  1EWZ A;  1HD8 A;  5FAQ A;  4JBF A;  5DF7 A;  1JWP A;  4KEN B;  4E3K A;  3DW0 A;  3UPO A;  1BZA A;  1KGF A;  4YFM A;  1DJC A;  1IYP A;  1PW8 A;  2IWD A;  1ES4 A;  4OQ0 A;  1HVB A;  3TOI A;  5TR7 A;  4DDY A;  3FYZ A;  1NZU A;  4MBK A;  5FAP A;  4BLM A;  4PPR A;  4WBG A;  1SKF A;  1C3B A;  4RA7 A;  1XGI A;  2EFU A;  4ZBE A;  3PAE A;  4WMC D;  1TEM A;  2HPB A;  2P9V A;  3HUN A;  3G31 A;  3W8K A;  5DTK A;  1YLZ A;  2DRW A;  3S1Y A;  4YIN A;  1MXO A;  1BLH A;  2XD1 A;  2OSU A;  2Y2L A;  3SH8 A;  3VP4 A;  1YMX A;  1E4D A;  2X71 A;  1TDG A; 
#chains in the Genus database with same CATH topology
 1K0K A;  3DAV A;  2QJ5 A;  2W1T B;  3Q7Z A;  3HLB A;  5M18 A;  3QHY A;  5HD5 A;  3T1R A;  4OH0 A;  3PBN A;  4KG5 A;  5CHM A;  2IWC A;  4WZ5 A;  1ZG4 A;  4S2J A;  4X6T A;  5HDC A;  1MBL A;  2Y2J A;  3ZNT A;  3MQO A;  4BEN A;  5EVI A;  3G2Y A;  4S2O A;  2BAS A;  1HLU P;  2INW A;  3IXG A;  2UV0 E;  4E04 A;  2J9P A;  3O3V A;  2IA2 A;  3T12 B;  2JKR I;  3HLW A;  1BUE A;  4NXE A;  4MEZ A;  1GSV A;  2W3H A;  3CJM A;  2WGW A;  4JXG A;  5TBM A;  5L10 A;  3A3F A;  4EQ1 A;  1F98 A;  3EQV A;  5HWT A;  1P9R A;  4E3M A;  3UPN A;  3JVV A;  1CF0 A;  4WYY A;  2KDK A;  2J9O A;  3TG9 A;  2HDQ A;  2Y2K A;  3VP1 A;  5EPH A;  4DRT A;  2VA0 A;  3UO9 A;  1Q2Q A;  3NC8 A;  4I3J A;  3GQZ A;  1L0D A;  4L0L A;  3K2N A;  3JVU A;  4EXO A;  3GVB A;  1MWU A;  3NEC A;  1ZHH B;  1JNU A;  3A0S A;  2WZX A;  2ZC5 B;  4CJN A;  2ZLY A;  2W27 A;  3U2A A;  5EVI B;  5FQQ A;  4B88 A;  2ZC7 A;  3NBL A;  4R38 A;  1NYM A;  5L2F A;  3MBZ A;  3LO7 A;  4K91 A;  5FDH A;  2XH9 A;  2PD8 A;  2OLU A;  3IXH A;  2WGW B;  5TBM B;  1JTG A;  2L4R A;  1XFN A;  1IYO A;  3N6I A;  1XPB A;  5HSQ A;  4GW9 A;  3R7W A;  1YSQ A;  5HD3 A;  3E4O A;  2FH5 A;  4JF5 A;  3VP0 A;  1VB6 A;  4X1L A;  2NUP C;  2CC1 A;  4HOI A;  4KZ8 A;  2X02 A;  2PR6 A;  4BWI A;  2OWH A;  2PU4 A;  3ZG7 B;  4S2M A;  2DNS A;  4R3B A;  5EEC A;  2A49 A;  2Y2G A;  4KQR A;  2G7U A;  3SW1 A;  3LR4 A;  2FFY A;  2WKP A;  4I3A A;  4LEN A;  2XR0 A;  4Y3I A;  2ZC3 B;  4DE3 A;  3WRZ A;  5DKL A;  4R23 A;  2VV7 A;  2W3D A;  3UE1 A;  3M2J A;  3T1Q B;  3ISG A;  3NI9 A;  5HAP A;  4GLQ A;  4A5R A;  1IEM A;  4E3J A;  1MKM A;  2HDU A;  5EM1 A;  4B9O A;  3OPR A;  2ZBB A;  1F2K A;  3E4Q A;  3C7U A;  4DE1 A;  2XA7 S;  1JTD A;  2L1M A;  2VX8 A;  2KX6 A;  3R7W B;  5DJU A;  2QYB A;  3GR2 A;  1NRF A;  1KE4 A;  3VP2 A;  1XA7 A;  3LIE A;  1IYS A;  2V1Z A;  4DN0 A;  5GHZ A;  2A3U A;  5HAR A;  4IVI A;  1KVL A;  3CPT A;  3SH7 A;  1O07 A;  3CAX A;  4FSF A;  4BBT A;  3ZG5 A;  3ZNY A;  4EUZ A;  1GHI A;  4G3W A;  4H8R A;  3T4Q A;  4X1M A;  4LGW A;  5KIZ A;  4KQD A;  3IH8 A;  5F5Y A;  4JLF A;  4DF6 A;  2BTF P;  2HGV A;  1H5X A;  3BEB A;  4GB7 A;  1IYQ A;  2E8I A;  3VP3 A;  1SDN A;  1ERQ A;  3M6H A;  2W3E A;  3I7J A;  1YLP A;  4BQM A;  3C2W A;  1CEF A;  1MPL A;  3PYP A;  1ALQ A;  1D1J A;  4M3K A;  4EER A;  3HRE A;  3VFF A;  3PBS A;  5FA7 A;  3KSI A;  3OPP A;  4Q0I A;  1XJ6 A;  3SOI A;  4HQA A;  4GKU A;  2XFT A;  5A8B A;  5FQJ A;  5EUA A;  1WE4 A;  4QU3 A;  5J3W A;  3CPT B;  3L9K A;  5KMW A;  1PFL A;  5AJG A;  1TVF A;  2I72 A;  2M1C A;  3DWZ A;  3S7N A;  1DP9 A;  3IT9 A;  4PHT A;  3IXB A;  1W5D A;  2JN7 A;  1RCJ A;  1S66 L;  2RCX A;  4QWO A;  3C4P A;  3KYE A;  3HLE A;  1M40 A;  4GDB A;  4Q0J A;  3S22 A;  4CPK A;  2XA7 M;  2ZM0 A;  4HBU A;  5CGS A;  5FAO A;  1FIK A;  4E6W A;  3Q7V A;  4OLG A;  3ZFZ A;  3BFC A;  1DJA A;  1ZG6 A;  4P6B A;  3KYZ A;  4BJP A;  3KYQ A;  4MDZ A;  2HDS A;  3OBF A;  2V8C A;  4NKP A;  4H6J A;  1CK3 A;  2OV5 A;  2J80 A;  3F1N A;  1PWD A;  1FSY A;  1RGY A;  2J7V A;  4GD8 A;  1CI9 A;  2XQZ A;  2JCH A;  1UGU A;  1GHP A;  4EBP A;  2B18 A;  4OQG A;  1PYY A;  4MMN A;  3O87 A;  4HJ6 A;  1KE0 A;  1Y4O A;  2IWB A;  3V39 A;  3MXQ A;  4QD4 A;  4P6Z S;  4L9G A;  2V1B A;  4O0P A;  2XRO A;  1E3U A;  3LR3 A;  4WEK A;  4LFU A;  1EW0 A;  2HZ5 A;  4PM9 A;  2Q9M A;  1GSW A;  3BYD A;  1ONH A;  4D60 A;  1WYC A;  2FZ0 A;  1SHV A;  1H8M A;  2Y2I A;  1S1Y A;  3SZT A;  5HPI A;  3DTI A;  2PR5 A;  3Q7V B;  1VQQ A;  4OKP A;  1KOU A;  4JXS A;  1BYW A;  2EX2 A;  1K57 C;  1HD8 A;  5F68 A;  1OTE A;  3LYX A;  4H6J B;  4E3K A;  3UPO A;  1YAX A;  4YFM A;  1IYP A;  3UB5 P;  3F1N B;  2JKT M;  3KSG A;  5FAP A;  4BLM A;  4NXG A;  1SKF A;  4AFI A;  2ZMF A;  2PRF A;  3G31 A;  1YLZ A;  3B47 A;  4HI4 A;  4YIN A;  1BLH A;  3SH8 A;  3VP4 A;  1YMX A;  4DJ2 A;  1NWZ A;  3PR6 A;  4N92 A;  4MN5 A;  5F82 A;  1L0F A;  1YMS A;  1XFQ A;  5GLD A;  3UE6 A;  2B02 A;  4WEL A;  4FUW A;  4UHU A;  3WS0 A;  1TDL A;  2V20 A;  1ACF A;  4IBR A;  3ZG8 B;  4S2P A;  3VOL A;  1PIO A;  3S7Q A;  1PZP A;  2Y2O A;  4ZTK A;  1FQG A;  3ZGA B;  2ZQ9 A;  3V5M A;  5AQB A;  2VLG A;  1V9Z A;  4DKI A;  3IWQ A;  4PM5 A;  2ZQD A;  5A91 A;  4KUO A;  2EXB A;  2QHK A;  2JKF A;  2QKP A;  1Y28 A;  5E2E A;  2CMN A;  2V2F F;  4P6Z M;  2HP9 A;  3PBQ A;  4II7 A;  4ME4 A;  2HJ9 C;  3MF0 A;  1YLT A;  3MFX A;  4OLD A;  3IWO A;  3UNW A;  4HNB A;  5K5B A;  3QP1 A;  2O9C A;  3JPU A;  2QJ7 A;  3BRM A;  5HAI A;  5AQ9 A;  1FCO A;  3A3E A;  2PHY A;  4WN5 A;  1W63 M;  4HES A;  3NOP C;  1CEG A;  2GJ3 A;  2K31 A;  3UDI A;  4NEE D;  4ZJ2 A;  1HZO A;  3BY9 A;  4E3L A;  3T4K A;  1LLB A;  3N8R A;  3ITA A;  1SZV A;  3FG8 A;  4OOY A;  5EV0 A;  1LSV A;  3MFD A;  4KQQ A;  3OCL A;  3BFG A;  3EQU A;  3W4O A;  4R0Q A;  2WGV A;  3S7O A;  5EVI D;  4DE0 A;  1DY6 A;  4EUV A;  2BG1 A;  3ICY A;  4UAA A;  3OLO A;  4WEJ A;  5HL6 A;  3ZG0 A;  4HP9 A;  3QP6 A;  3TRC A;  4RQ9 A;  2L0W A;  1RP5 A;  1XJ4 A;  3C8C A;  4JKT A;  5A93 A;  1MWS A;  1CQA A;  3MR0 A;  3LR5 A;  2GX5 A;  2W3G A;  1G68 A;  1IKG A;  5I5L A;  3V3R A;  1BTL A;  2Z2M B;  2OAP 1;  4HH3 A;  4PM7 A;  2Q9N A;  3G30 A;  1KE3 A;  3T4S A;  4RX2 A;  3A0R A;  5GLB A;  2ZJ9 A;  3RXX A;  4HJ4 A;  4KZ9 A;  2ACG A;  2QPN A;  5FEG A;  3QP2 A;  4I3I A;  5EE8 A;  3WRT A;  3H82 A;  5BOH A;  3EGD C;  3T50 A;  3LIB A;  3LEQ A;  3KO6 A;  3D3O A;  3T1X A;  5HDD A;  5J7E A;  4JGP A;  4KZ4 A;  4PAU A;  4DMZ A;  3TW8 A;  3T4T A;  4NXB A;  1H3Q A;  4Y2F A;  2JE5 A;  3F1P A;  2GNX A;  1ODV A;  1ES5 A;  1K57 A;  3IX8 A;  5F1G A;  5IHV A;  1ZKJ A;  3WS1 A;  4X69 A;  4UA6 A;  2ZQA A;  1NJ4 A;  1K38 A;  1K54 C;  5HAQ A;  5TGF A;  1FCN A;  2HP5 A;  4JXW A;  1OT6 A;  2Y2Q A;  1PZO A;  4QB8 A;  4HH2 A;  4Y7P A;  4EU0 A;  1U60 A;  2XF3 A;  3LIC A;  1ESU A;  3H82 B;  3CMZ A;  3MQ0 A;  3HJK A;  1LI0 A;  5DTS A;  1STZ A;  4UA9 A;  5HL1 A;  4Z9Q A;  3FKW A;  2DCF A;  1ES3 A;  2LB5 A;  2V0U A;  4KZB A;  1K4E A;  3QNC A;  4CLC E;  4E3I A;  3P7N A;  2J3T C;  3SS5 A;  2GDN A;  4MCW A;  3RJU A;  4RVA A;  4ZAM A;  3LGO A;  5FQK A;  4R4R A;  3BM6 A;  1P97 A;  1GHM A;  2Z6C A;  2KOI A;  3E2L A;  3VSL A;  3F1P B;  4EW7 A;  4QY5 A;  5CX7 A;  3IX3 A;  2ZQC A;  4G3K A;  4LRZ E;  3FPV A;  1VHM A;  2VGK A;  4PKY G;  2HDR A;  1K55 C;  4C75 A;  5HX9 A;  2H0Y A;  3CHW P;  1VET A;  2K7S A;  3VV4 A;  1ERO A;  2QZ6 A;  1H0M A;  2Y4A A;  3R4K A;  3QP5 A;  5FL3 A;  1AWI A;  3LID A;  1Q2P A;  3NOT C;  2J3W A;  3BY8 A;  2ZMV A;  2D02 A;  4R4S A;  3VE4 A;  1T1C A;  3L7H A;  1RGZ A;  3LIF A;  4MNR A;  3UE3 A;  1QME A;  3S4X A;  3MMH A;  2A24 A;  3QNB A;  4IVK A;  4R1G A;  4Y13 A;  4OVD A;  3A0V A;  1PW1 A;  4WLA A;  1YLY A;  4ZJ3 A;  3MZF A;  2PYR A;  3N7W A;  5EOO A;  4N9L A;  1J9M A;  3FKV A;  1KVM A;  1QMF A;  1KGG A;  2P9V B;  3MS6 A;  2XDM A;  3MQQ A;  3OOV A;  3UPP A;  1IEL A;  1VET B;  4EET B;  2WKR A;  3VE3 A;  1ZC2 A;  4XXR A;  1XGJ A;  3BEC A;  4OQI A;  4ZDX A;  1OT9 A;  4PM6 A;  1XXM A;  2H28 A;  4LV0 A;  2KLI A;  3HLD A;  3GSG A;  3LR0 A;  5DF9 A;  4PMA A;  4Y5F A;  4QJG A;  1IOU A;  3GDI A;  2G2U A;  2C5W B;  2J8Y A;  3NIA A;  4ETX A;  1Y54 A;  3PHY A;  1O7E A;  3PBO A;  4B4X A;  1BLC A;  1XP4 A;  2I9V A;  2OOL A;  2HP6 A;  4GCZ A;  2A24 B;  3C5A A;  1OME A;  5HZH A;  5FAQ A;  2JKG A;  1P9W A;  1KGF A;  1DJC A;  2IWD A;  4OQ0 A;  3TOI A;  1ES4 A;  5TR7 A;  3FYZ A;  1DP6 A;  3KSF A;  1XGI A;  2EFU A;  3ULF A;  3W8K A;  5DTK A;  2DRW A;  1OTB A;  4UQI S;  1MXO A;  1LSX A;  1E4D A;  3UMD A;  2X71 A;  4OPQ A;  1GSX A;  3W4P A;  3VFH A;  3BFF A;  1BT5 A;  4IJG A;  3O5Y A;  5CGX A;  4LRY C;  3Q1F A;  1ES2 A;  3F1O A;  2XK1 A;  4KG6 A;  4E3N A;  2ZQ7 A;  2P7J A;  2XD5 A;  4HIA A;  1UWP X;  4KUK A;  5L07 A;  3LUQ A;  3PXP A;  1E3U D;  2K2N A;  4PM8 A;  1K56 A;  2R9X A;  3DTE A;  5FI6 A;  1K6S A;  2V1A A;  1K54 A;  2EX9 A;  3LCE A;  3D4F A;  5KSC A;  5AVE A;  1YLW A;  3LIA A;  1FR6 A;  2XLN A;  4RX3 A;  1S6R A;  3G6O A;  4EWF A;  2EWW A;  1TD5 A;  2HJE A;  4EEP A;  5DFX A;  1PWG A;  1N9L A;  3HUM A;  1NLY A;  5GHY A;  3HLG A;  3IXD A;  4X25 A;  1IFQ A;  1BLS A;  4K0W A;  1Z09 A;  1DRM A;  5CTM A;  4L9F A;  3RXW A;  4D2O A;  2QWS A;  1PNE A;  2EA9 A;  3F1O B;  3G32 A;  4EBN A;  1OTD A;  4RYE A;  5E43 A;  3Q82 A;  2R9W A;  2ZM8 A;  4GDN A;  1OTA A;  2HV1 A;  5CHJ A;  1T1B A;  4C3Q A;  4ARZ B;  2V9A A;  1BSG A;  5FAT A;  1K55 A;  1H8Y A;  4CLC A;  5F83 A;  3NCK A;  3IHB A;  3UB8 A;  2WGI A;  5FQI A;  1S1Z A;  3K3D A;  3WS4 A;  5J8X A;  3ZG9 B;  3SH9 A;  1N9B A;  4O8G A;  3SS4 A;  4UQI M;  3CUE C;  3HLC A;  3LY3 A;  4MLL A;  1YQS A;  1T18 A;  3FPW A;  2OLV A;  1OTI A;  3GRJ A;  4UEY A;  3E2K A;  4Y0O A;  4OPY A;  5GL9 A;  1XA1 A;  4OPZ A;  1S4R A;  4JGQ A;  4BMW A;  2BLS A;  4DDS A;  3NY4 A;  3BQ8 A;  3IBJ A;  3MJQ A;  4CQH A;  1L2S A;  2E8J A;  2EWV A;  4S2K A;  4R3A A;  2EX6 A;  3CG5 A;  4KZ6 A;  2Y59 A;  3HBR A;  1FR1 A;  2Y2N A;  3Q81 A;  5HW3 A;  1AXB A;  4CLC B;  2WAE A;  3AGF A;  3K3C A;  1T1A A;  1N9N A;  1MWT A;  3EEA A;  3UY6 A;  4BBV A;  1TS0 A;  1MWR A;  3HUO A;  5L8M A;  2O9B A;  3MSH A;  3DBA A;  3ZVW A;  3UB6 A;  1PI5 A;  1S67 L;  3EOI A;  3G35 A;  2WAD A;  5D3O A;  4KQO A;  4BD0 A;  2O0Y A;  1XX2 A;  3PBT A;  5EFW A;  1A0K A;  1TS7 A;  4FD8 A;  3C38 A;  3JYI A;  3TSG A;  3QP8 A;  1FCM A;  3LI9 A;  3A3D A;  4N1H A;  4O7D A;  2WKI A;  3DTM A;  3LI8 A;  4GJ4 A;  3G34 A;  3BWL A;  3EEH A;  1HTZ A;  3PBR A;  4Y0T A;  1OJ5 A;  2WYX A;  2Y2P A;  3N8L A;  2R78 A;  4IHQ A;  4QHC A;  4KZA A;  4EEU A;  2O99 A;  3MZE A;  3BJN A;  1E25 A;  1G5U A;  1KDW A;  3VOZ A;  4LLO B;  4DXB A;  1LHY A;  4GNU A;  1TS6 A;  5FQM A;  5CEB A;  2V0W A;  4JF6 A;  3IX4 A;  2PBD P;  4FH4 A;  3O86 A;  5GLA A;  5CTN A;  4DXC A;  1S0W A;  4R6L A;  3B3X A;  5LBR A;  4N9K A;  3ZVT A;  3AGE A;  4MN7 A;  1FIL A;  3OCN A;  5E2F A;  3OZH A;  1PI4 A;  4JF4 A;  5F6A A;  3ITB A;  1WYB A;  2WAF A;  2A2L A;  2WKE A;  5FQ9 A;  5F1F A;  3ZCZ A;  3FC7 A;  4OOM A;  1D7E A;  4FCF A;  1K25 A;  5FDS A;  1YT4 A;  3BW6 A;  2LB9 A;  3G4P A;  1BLP A;  4MN6 A;  4HEF A;  1ONG A;  2QMI A;  2P04 A;  2VZW A;  5EOE A;  3O88 A;  4LV2 A;  4LCM A;  5U47 A;  4R70 A;  1KGE A;  3UE0 A;  3MZD A;  3NJA A;  1SKO A;  3T1S A;  2WUQ A;  2H5S A;  4X68 A;  4S2L A;  4YOF A;  2WKQ A;  3P98 A;  4WM9 A;  5DKK A;  1LL8 A;  4Z1W A;  5HWW A;  2JKT I;  5I94 A;  3CWF A;  3V67 A;  2Q0O A;  4GD6 A;  3UN7 A;  2PBY A;  2ZD8 A;  4HHD A;  4WMC A;  4NG2 A;  3B42 A;  4BL2 A;  1VEU A;  1K6R A;  5DVA A;  5FAS A;  4Y15 A;  5EVL A;  1LT0 A;  2OAQ 1;  2D01 A;  4IUH A;  1GA9 A;  3NUL A;  4IED A;  3ZDJ A;  1D06 A;  3CIT A;  3RTY A;  1L0G A;  4O01 A;  2VV8 A;  5G4Z A;  5CER A;  1I2W A;  3AGD A;  2H0T A;  3G2Z A;  2B5R A;  3CUE A;  1JVJ A;  3UB9 A;  1I5Q A;  3HL9 A;  4JXV A;  1SKO B;  3A3J A;  4NK3 A;  4JGR A;  4XT2 A;  2Z2L B;  3DTK A;  2JHE A;  2RL3 A;  3T4J A;  2PD7 A;  1ESI A;  5E2G A;  4KG2 A;  2Y55 A;  4OP8 A;  1N4O A;  3FWL A;  4S2N C;  4IBX A;  4KZ3 A;  1FSW A;  1VM1 A;  5G18 A;  5AVF A;  3ZQ5 A;  3HJI A;  1VEU B;  1MC0 A;  1EWZ A;  1JWP A;  4KEN B;  1BZA A;  1V9Y A;  1PW8 A;  1HVB A;  4DDY A;  1WA9 A;  2HPB A;  2P9V A;  4I38 A;  3S1Y A;  1MZU A;  2XD1 A;  2OSU A;  2Y2L A;  4CLC C;  1CI8 A;  1TDG A;  2W3F A;  5E2H A;  5M19 A;  1PRQ A;  4F3L A;  4ZRR A;  2M7U A;  3C30 A;  4XT2 B;  1YLJ A;  1YKD A;  1SDE A;  2C6W B;  3FZC A;  4ZJ1 A;  1FOF A;  4K0X A;  4ESP A;  3BLS A;  1JWZ A;  4HY8 A;  5DJT A;  5JYP A;  2VEA A;  1LL5 A;  2JBF A;  5FEF A;  2P74 A;  1F5M A;  5KZH A;  2Y8H A;  4HJ3 A;  4BD1 A;  3NDG A;  2ZC4 B;  4UA7 A;  4WL9 A;  1I2S A;  5A90 A;  1JWV A;  3Q07 A;  2XGN A;  1OJG A;  4OPR A;  1NZO A;  3SS3 A;  5IS1 A;  4LCL A;  4C6Y A;  2VGL S;  5IU1 A;  3IF6 C;  5C5K A;  3E0Y A;  4WUJ A;  4LV1 A;  2PDR A;  2ZL1 A;  2VGJ A;  5HWV A;  4F3L B;  3H7W A;  1W8Q A;  3MXS A;  2ZC6 B;  3VMA A;  3VSK A;  4GHI A;  3NDE A;  5FI7 A;  4MBH A;  3NOU C;  3PAG A;  1OPX A;  2PAV P;  1W63 Q;  1KDS A;  5GLC A;  4KZ7 A;  4B4Z A;  3V50 A;  3E4P A;  1NY0 A;  3GV9 A;  5HFO A;  1XJ2 A;  3GMW A;  3U4L P;  5A92 A;  3EGX C;  4ID4 A;  2OWJ A;  3IH9 A;  1G6A A;  3HVF A;  3N4I A;  4LRX C;  2ZM2 A;  3V3S A;  3KX0 X;  4QPR A;  4U0T A;  5HPF A;  1LL9 A;  4YWZ A;  1NYY A;  3LEZ A;  4FOF A;  3UDX A;  1K56 D;  4P85 A;  1TS8 A;  4PKY A;  3MKF A;  2XFS A;  2ZQ8 A;  4P0M A;  3CZD A;  4NXF A;  2PT7 A;  2XRN A;  1NRJ A;  3M6B A;  3BFE A;  2ZL1 B;  3LFV A;  4EV4 A;  3H7W B;  2VKS A;  3KSH A;  5CRF A;  4JGO A;  1EI5 A;  2PYP A;  4GHI B;  4ETZ A;  5CED A;  3P01 A;  2UWX A;  4WZ4 A;  4OQH A;  3QP4 A;  3WWX A;  4XUZ A;  1UWN X;  3GEC A;  2Y2M A;  2J3T D;  5FSR A;  3IBR A;  2O9A A;  4ARZ A;  1P0Z A;  4L9E A;  1TF1 A;  3W4Q A;  2ZMA A;  3IHA A;  1G28 A;  5EVE A;  4NET A;  3ZHH A;  2YKH A;  3IQA A;  2VGL M;  3PTE A;  2PU2 A;  3D9Y A;  3LY4 A;  3T4O A;  1SCW A;  1J3W A;  1BUL A;  4CLC D;  1PWC A;  1F9I A;  4FH2 A;  1XJ3 A;  2EFX A;  3DWK A;  4S2N A;  1L0E A;  5DF8 A;  5DFY A;  1Z6F A;  2WZZ A;  3EWK A;  4WZ5 C;  2GZA A;  5F69 A;  1GA0 A;  3IF5 A;  1ERM A;  5AQA A;  5EVI C;  4Y17 A;  2W0N A;  3T4L A;  4DJ3 A;  2P08 A;  4BL3 A;  2V8F A;  3OPL A;  4M4X A;  1G6O A;  3ZYT A;  4K08 A;  3B33 A;  4Y0U A;  2YKF A;  3BFD A;  4GS9 A;  3CI6 A;  4WF0 A;  2Y79 A;  2VJW A;  4I39 A;  2JC7 A;  3OC2 A;  1YPR A;  4Q8I A;  3IS2 A;  3VOY A;  2EXA A;  4G3V A;  1XKZ A;  5M1A A;  2Y2H A;  1NXY A;  3P09 A;  2XSS A;  4E6X A;  3WS2 A;  1L3L A;  2WKH A;  2JKR M;  5DTT A;  5KSH A;  4EBL A;  2XEP A;  1CJF A;  4F94 A;  2Z6D A;  4YNR A;  1K4F A;  4LPZ A;  3C7V A;  4HBT A;  4EES A;  3UDF A;  1MY8 A;  3CLO A;  4GOG A;  4MBF A;  4GN2 A;  3OPH A;  3TE8 A;  4R3J A;  4XUX A;  2M7V A;  3IF6 A;  4FTX A;  4P87 A;  2VV6 A;  4GS9 B;  4HP4 A;  3MKE A;  2W1R A;  3RH8 B;  1X0O A;  2H10 A;  3IS2 B;  4OOL A;  3TJZ C;  4I5S A;  4U0X A;  1ZTU A;  4EQI A;  5FI2 A;  1M6K A;  5G4Y A;  2EX8 A;  3E98 A;  1MKI A;  5CEC A;  3UB7 A;  5J4E A;  2X01 A;  2DMW A;  5IT5 A;  1N9O A;  4X56 A;  2NUT C;  1GCE A;  1IKI A;  1W8Y A;  4BBU A;  5EM0 A;  5HDS A;  3W2Z A;  4OON A;  3HCY A;  1YM1 A;  2G2W A;  2Y91 A;  1W7F A;  3GTC A;  2B95 A;  1DP8 A;  3A3I A;  5CGW A;  5JYO A;  5MC7 A;  2FFF B;  5TFQ A;  4X55 A;  5AQ7 A;  1LI9 A;  1LSW A;  1T19 A;  2VK3 A;  3HLF A;  2W1T A;  4OP5 A;  3IF6 B;  4N1X A;  5L09 A;  1DJB A;  1S4S A;  1W79 A;  4JPM A;  4DE2 A;  2MJ6 A;  1NLZ A;  3BLM A;  4B93 A;  4X53 A;  3M2K A;  4KZ5 A;  3C4O A;  3IWI A;  2HF6 A;  3MXR A;  4S2I A;  3FV7 A;  4QY6 A;  4U3T A;  5GHX A;  1H8Z A;  3WS5 A;  3N8S A;  4LV3 A;  5CXW A;  3UME A;  3NHQ A;  2WK0 A;  4E3O A;  4GZB A;  3H9W A;  2ZOI A;  4JBF A;  3RFB A;  5DF7 A;  3DW0 A;  3D72 A;  4IUK A;  1NZU A;  3BQA A;  4MBK A;  5TJJ A;  4PPR A;  4WBG A;  2ZOH A;  1C3B A;  4RA7 A;  4ZBE A;  3PAE A;  4WMC D;  1TEM A;  3HUN A;  1YSP A;  4Q0H A;  2AVX A;  3S7P A;  5CHU A; 
#chains in the Genus database with same CATH homology
 3W4P A;  5E2H A;  3VFH A;  3BFF A;  1BT5 A;  5M19 A;  3Q7Z A;  5CGX A;  3HLB A;  4N92 A;  5F82 A;  1L0F A;  1YMS A;  1YLJ A;  3QHY A;  5M18 A;  3Q1F A;  5GLD A;  4OH0 A;  1SDE A;  2C6W B;  3FZC A;  1ES2 A;  4WEL A;  4ZJ1 A;  4UHU A;  2XK1 A;  4KG6 A;  3WS0 A;  1FOF A;  3PBN A;  4KG5 A;  2ZQ7 A;  1TDL A;  4E3N A;  2V20 A;  5CHM A;  4K0X A;  2XD5 A;  4IBR A;  3ZG8 B;  4S2P A;  3BLS A;  1PIO A;  1JWZ A;  2IWC A;  5JYP A;  4WZ5 A;  1ZG4 A;  1PZP A;  2Y2O A;  4ZTK A;  1FQG A;  1E3U D;  1LL5 A;  3ZGA B;  4S2J A;  2JBF A;  4X6T A;  1MBL A;  2P74 A;  5KZH A;  2ZQ9 A;  2Y2J A;  3ZNT A;  4BEN A;  4PM8 A;  5EVI A;  1K56 A;  2R9X A;  3G2Y A;  3V5M A;  5FI6 A;  1K6S A;  4S2O A;  4BD1 A;  3NDG A;  3IXG A;  1K54 A;  5AQB A;  2EX9 A;  2J9P A;  2ZC4 B;  3LCE A;  1CI8 A;  3D4F A;  3O3V A;  4UA7 A;  5KSC A;  4DKI A;  1YLW A;  3IWQ A;  4PM5 A;  2ZQD A;  5A91 A;  2EXB A;  3HLW A;  1BUE A;  1FR6 A;  1I2S A;  2XLN A;  5A90 A;  1JWV A;  3Q07 A;  4MEZ A;  4RX3 A;  2XGN A;  1S6R A;  3CJM A;  2WGW A;  4JXG A;  4EWF A;  5E2E A;  4OPR A;  3A3F A;  1NZO A;  3SS3 A;  2V2F F;  4LCL A;  4C6Y A;  2HP9 A;  3PBQ A;  3EQV A;  1YLT A;  3IF6 C;  4E3M A;  3UPN A;  4OLD A;  4WYY A;  1PWG A;  3IWO A;  2J9O A;  4LV1 A;  3TG9 A;  3UNW A;  3HUM A;  2HDQ A;  5GHY A;  2Y2K A;  2VGJ A;  3HLG A;  3IXD A;  3VP1 A;  5EPH A;  4DRT A;  1BLS A;  3UO9 A;  4K0W A;  1Q2Q A;  5CTM A;  1W8Q A;  3NC8 A;  3RXW A;  3MXS A;  4D2O A;  3BRM A;  5HAI A;  2ZC6 B;  3VMA A;  3GQZ A;  5AQ9 A;  1FCO A;  3A3E A;  4OPQ A;  3VSK A;  1L0D A;  3NDE A;  4L0L A;  5FI7 A;  4HES A;  4MBH A;  3G32 A;  3PAG A;  4EBN A;  4RYE A;  1CEG A;  3Q82 A;  5E43 A;  3UDI A;  2R9W A;  3GVB A;  4ZJ2 A;  1KDS A;  2ZM8 A;  4GDN A;  5GLC A;  1MWU A;  4KZ7 A;  4B4Z A;  5CHJ A;  3V50 A;  1HZO A;  4C3Q A;  1NY0 A;  3GV9 A;  5HFO A;  4E3L A;  2WZX A;  2ZC5 B;  1BSG A;  4CJN A;  2ZLY A;  3GMW A;  1LLB A;  3N8R A;  5EVI B;  5FAT A;  3ITA A;  5FQQ A;  4B88 A;  1K55 A;  2ZC7 A;  5A92 A;  1H8Y A;  4ID4 A;  3NBL A;  3IH9 A;  1NYM A;  5F83 A;  3NCK A;  1G6A A;  3HVF A;  3N4I A;  4OOY A;  3IHB A;  3MFD A;  5L2F A;  3MBZ A;  4KQQ A;  2WGI A;  3LO7 A;  5FQI A;  2ZM2 A;  3OCL A;  3BFG A;  4K91 A;  5FDH A;  3EQU A;  2XH9 A;  3V3S A;  3WS4 A;  5J8X A;  4U0T A;  3SH9 A;  3W4O A;  2OLU A;  3ZG9 B;  1N9B A;  4R0Q A;  3IXH A;  3SS4 A;  1LL9 A;  2WGW B;  1JTG A;  2WGV A;  1NYY A;  3LEZ A;  3UDX A;  5EVI D;  1K56 D;  4DE0 A;  4P85 A;  1DY6 A;  3HLC A;  3MKF A;  2XFS A;  3LY3 A;  4MLL A;  1IYO A;  2ZQ8 A;  4P0M A;  3N6I A;  1XPB A;  1YQS A;  2BG1 A;  3CZD A;  4UAA A;  4WEJ A;  3ZG0 A;  3M6B A;  2OLV A;  3BFE A;  3GRJ A;  3E2K A;  1RP5 A;  4Y0O A;  4JF5 A;  4JKT A;  4OPY A;  3VP0 A;  5A93 A;  4EV4 A;  1MWS A;  5GL9 A;  1XA1 A;  4OPZ A;  5CRF A;  2CC1 A;  1G68 A;  1IKG A;  2BLS A;  4DDS A;  4KZ8 A;  2X02 A;  3V3R A;  1BTL A;  1EI5 A;  2Z2M B;  2PU4 A;  3ZG7 B;  5CED A;  3NY4 A;  4S2M A;  2UWX A;  1L2S A;  4WZ4 A;  2DNS A;  4R3B A;  4S2K A;  5EEC A;  2A49 A;  4OQH A;  2Y2G A;  4PM7 A;  4KQR A;  2Q9N A;  3G30 A;  3WWX A;  2EX6 A;  3CG5 A;  5CHU A;  4XUZ A;  1KE3 A;  4KZ6 A;  2Y59 A;  2Y2M A;  4RX2 A;  5GLB A;  5FSR A;  3HBR A;  1FR1 A;  2ZJ9 A;  2Y2N A;  2FFY A;  3RXX A;  3Q81 A;  4KZ9 A;  4LEN A;  5HW3 A;  2QPN A;  2XR0 A;  2ZC3 B;  4DE3 A;  1AXB A;  3W4Q A;  3WRZ A;  2ZMA A;  2WAE A;  3IHA A;  3AGF A;  5EE8 A;  4R23 A;  1MWT A;  3UY6 A;  3WRT A;  3UE1 A;  5BOH A;  1MWR A;  3M2J A;  4NET A;  3ZHH A;  3HUO A;  3ISG A;  3IQA A;  3NI9 A;  5HAP A;  3PTE A;  3ZVW A;  4A5R A;  1IEM A;  2PU2 A;  4E3J A;  2HDU A;  1PI5 A;  3LY4 A;  3OPR A;  1SCW A;  3G35 A;  1BUL A;  2WAD A;  5D3O A;  4KQO A;  4KZ4 A;  3C7U A;  4BD0 A;  1XX2 A;  1PWC A;  3PBT A;  4DE1 A;  4FD8 A;  3JYI A;  1JTD A;  3TSG A;  4FH2 A;  1FCM A;  2EFX A;  3GR2 A;  3A3D A;  1NRF A;  3DWK A;  4S2N A;  2JE5 A;  1L0E A;  5DF8 A;  4N1H A;  4O7D A;  2WKI A;  3DTM A;  1KE4 A;  3VP2 A;  1XA7 A;  1Z6F A;  1ES5 A;  1K57 A;  2WZZ A;  1IYS A;  2V1Z A;  5GHZ A;  3G34 A;  4WZ5 C;  5F1G A;  2A3U A;  5IHV A;  5HAR A;  4IVI A;  1KVL A;  1GA0 A;  3IF5 A;  3SH7 A;  1ZKJ A;  1O07 A;  1HTZ A;  4FSF A;  3WS1 A;  3PBR A;  1ERM A;  4Y0T A;  4X69 A;  5AQA A;  5EVI C;  3ZG5 A;  3ZNY A;  2ZQA A;  4UA6 A;  1GHI A;  1NJ4 A;  1K38 A;  2WYX A;  4EUZ A;  2Y2P A;  3N8L A;  1K54 C;  4H8R A;  5HAQ A;  5TGF A;  1FCN A;  2HP5 A;  4JXW A;  4QHC A;  4BL3 A;  4KZA A;  2Y2Q A;  3OPL A;  1PZO A;  3MZE A;  4QB8 A;  4Y7P A;  1E25 A;  1KDW A;  3VOZ A;  1U60 A;  3IH8 A;  4Y0U A;  2XF3 A;  4JLF A;  4DXB A;  1LHY A;  3BFD A;  4GNU A;  4DF6 A;  5FQM A;  1ESU A;  5CEB A;  1H5X A;  3BEB A;  4JF6 A;  3CMZ A;  4GB7 A;  4FH4 A;  1LI0 A;  3O86 A;  4UA9 A;  5DTS A;  5GLA A;  2JC7 A;  5HL1 A;  4Z9Q A;  3OC2 A;  4Q8I A;  3FKW A;  2DCF A;  1ES3 A;  5CTN A;  3VOY A;  4DXC A;  1S0W A;  2EXA A;  4KZB A;  1XKZ A;  1IYQ A;  2E8I A;  3B3X A;  5M1A A;  3VP3 A;  1K4E A;  1SDN A;  1ERQ A;  2Y2H A;  4N9K A;  3M6H A;  3AGE A;  1NXY A;  3QNC A;  3ZVT A;  3P09 A;  3I7J A;  1YLP A;  4E3I A;  3OCN A;  5E2F A;  3SS5 A;  4BQM A;  4E6X A;  2GDN A;  3RJU A;  3OZH A;  1CEF A;  4RVA A;  1PI4 A;  4ZAM A;  1MPL A;  3WS2 A;  4JF4 A;  1ALQ A;  5FQK A;  4M3K A;  4R4R A;  3HRE A;  3VFF A;  3PBS A;  3ITB A;  1WYB A;  3BM6 A;  2WAF A;  2WKH A;  5FA7 A;  3OPP A;  5DTT A;  1GHM A;  5KSH A;  3E2L A;  3VSL A;  3SOI A;  4QY5 A;  2WKE A;  2XEP A;  4GKU A;  4EBL A;  5FQ9 A;  5F1F A;  3ZCZ A;  2XFT A;  5FQJ A;  4F94 A;  4OOM A;  5EUA A;  1WE4 A;  4FCF A;  4QU3 A;  2ZQC A;  1K25 A;  1K4F A;  3C7V A;  5KMW A;  1YT4 A;  4HBT A;  3G4P A;  1BLP A;  2VGK A;  3UDF A;  1MY8 A;  4HEF A;  1ONG A;  2QMI A;  2HDR A;  1K55 C;  4C75 A;  5HX9 A;  4GOG A;  2H0Y A;  5EOE A;  4MBF A;  1TVF A;  2I72 A;  3O88 A;  4LV2 A;  3DWZ A;  1ERO A;  2QZ6 A;  4LCM A;  2Y4A A;  3IT9 A;  3OPH A;  4GN2 A;  5U47 A;  1KGE A;  3IXB A;  1W5D A;  4R3J A;  1RCJ A;  3UE0 A;  2RCX A;  4XUX A;  3IF6 A;  3MZD A;  1Q2P A;  4P87 A;  3C4P A;  3HLE A;  2WUQ A;  2H5S A;  4X68 A;  1M40 A;  4GDB A;  4S2L A;  3MKE A;  4R4S A;  4WM9 A;  3P98 A;  2H10 A;  3S22 A;  4CPK A;  4OOL A;  4U0X A;  2ZM0 A;  4HBU A;  5CGS A;  5FAO A;  4EQI A;  1RGZ A;  4MNR A;  3UE3 A;  4E6W A;  5I94 A;  5FI2 A;  1M6K A;  2EX8 A;  3Q7V A;  1QME A;  4OLG A;  3ZFZ A;  3BFC A;  4GD6 A;  1DJA A;  1ZG6 A;  4P6B A;  2PBY A;  3S4X A;  3UN7 A;  1MKI A;  2ZD8 A;  4BJP A;  5CEC A;  4IVK A;  4R1G A;  3QNB A;  4WMC A;  2HDS A;  4OVD A;  4BL2 A;  1K6R A;  5DVA A;  1PW1 A;  2X01 A;  1YLY A;  4ZJ3 A;  1CK3 A;  4X56 A;  5FAS A;  3MZF A;  3N7W A;  2OV5 A;  1GCE A;  5EOO A;  5EVL A;  4N9L A;  1IKI A;  1PWD A;  1W8Y A;  1GA9 A;  1FSY A;  1J9M A;  1RGY A;  2J7V A;  4GD8 A;  4IED A;  1CI9 A;  2XQZ A;  3FKV A;  2JCH A;  3ZDJ A;  1KVM A;  4OON A;  1GHP A;  4EBP A;  1QMF A;  1KGG A;  1L0G A;  1YM1 A;  2G2W A;  2P9V B;  2Y91 A;  5CER A;  1W7F A;  1I2W A;  4OQG A;  3AGD A;  1PYY A;  2XDM A;  3GTC A;  3O87 A;  2IWB A;  1KE0 A;  3UPP A;  3V39 A;  1IEL A;  4QD4 A;  2H0T A;  3A3I A;  5CGW A;  3G2Z A;  2B5R A;  1ZC2 A;  5JYO A;  2FFF B;  5TFQ A;  4X55 A;  5AQ7 A;  1LI9 A;  1JVJ A;  4XXR A;  1I5Q A;  3HLF A;  1XGJ A;  4OP5 A;  3IF6 B;  1E3U A;  3HL9 A;  4N1X A;  4JXV A;  1DJB A;  3BEC A;  1W79 A;  4WEK A;  4OQI A;  3A3J A;  4NK3 A;  4PM9 A;  4JPM A;  4ZDX A;  4DE2 A;  2Z2L B;  4PM6 A;  1XXM A;  2Q9M A;  4LV0 A;  3BLM A;  3BYD A;  3HLD A;  3GSG A;  4X53 A;  1ONH A;  5DF9 A;  4PMA A;  3M2K A;  2RL3 A;  4KZ5 A;  3C4O A;  4QJG A;  1ESI A;  3IWI A;  5E2G A;  1WYC A;  4KG2 A;  1SHV A;  3MXR A;  2G2U A;  2C5W B;  2J8Y A;  3NIA A;  4S2I A;  3FV7 A;  2Y2I A;  1Y54 A;  2Y55 A;  4QY6 A;  4OP8 A;  1N4O A;  3Q7V B;  3FWL A;  1O7E A;  4U3T A;  3PBO A;  4S2N C;  4B4X A;  1BLC A;  1XP4 A;  5GHX A;  4IBX A;  1H8Z A;  1VQQ A;  4KZ3 A;  4OKP A;  2HP6 A;  3WS5 A;  3N8S A;  1FSW A;  1VM1 A;  4LV3 A;  4JXS A;  5CXW A;  5G18 A;  2EX2 A;  2WK0 A;  3C5A A;  4E3O A;  4GZB A;  1K57 C;  1OME A;  1EWZ A;  1HD8 A;  5FAQ A;  4JBF A;  5DF7 A;  1JWP A;  4KEN B;  4E3K A;  3DW0 A;  3UPO A;  1BZA A;  1KGF A;  4YFM A;  1DJC A;  1IYP A;  1PW8 A;  2IWD A;  1ES4 A;  4OQ0 A;  1HVB A;  3TOI A;  5TR7 A;  4DDY A;  3FYZ A;  1NZU A;  4MBK A;  5FAP A;  4BLM A;  4PPR A;  4WBG A;  1SKF A;  1C3B A;  4RA7 A;  1XGI A;  2EFU A;  4ZBE A;  3PAE A;  4WMC D;  1TEM A;  2HPB A;  2P9V A;  3HUN A;  3G31 A;  3W8K A;  5DTK A;  1YLZ A;  2DRW A;  3S1Y A;  4YIN A;  1MXO A;  1BLH A;  2XD1 A;  2OSU A;  2Y2L A;  3SH8 A;  3VP4 A;  1YMX A;  1E4D A;  2X71 A;  1TDG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...