1BUEA

Nmc-a carbapenemase from enterobacter cloacae
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
265
structure length
265
Chain Sequence
NTKGIDEIKNLETDFNGRIGVYALDTGSGKSFSYRANERFPLCSSFKGFLAAAVLKGSQDNRLNLNQIVNYNTRSLEFHSPITTKYKDNGMSLGDMAAAALQYSDNGATNIILERYIGGPEGMTKFMRSIGDEDFRLDRWELDLNTAIPGDERDTSTPAAVAKSLKTLALGNILSEHEKETYQTWLKGNTTGAARIRASVPSDWVVGDKTGSCGAYGTANDYAVVWPKNRAPLIISVYTTKNEKEAKHEDKVIAEASRIAIDNLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (IMIPENEM-HYDROLYSING BETA-LACTAMASE)
publication title X-ray analysis of the NMC-A beta-lactamase at 1.64-A resolution, a class A carbapenemase with broad substrate specificity.
pubmed doi rcsb
source organism Enterobacter cloacae
molecule tags Hydrolase
total genus 93
structure length 265
sequence length 265
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 1998-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1bueA00
3PTEA 4GOGA 3S4XA 3IXBA 1YLYA 3W4OA 1MWUA 1NZOA 3M2KA 5HAIA 3ZCZA 3BLMA 3NC8A 3OPRA 1PI4A 5AQAA 1HTZA 2EFXA 1JWPA 5AQ7A 3VP1A 3IWQA 2VGJA 5FDHA 4QU3A 2HP9A 1BTLA 3A3DA 2V1ZA 3IWIA 1ZG4A 3IF5A 3DWZA 1MWTA 2RL3A 4JXGA 5KZHA 2XQZA 3OC2A 4DXCA 3DW0A 1ZKJA 2Y2JA 4C6YA 4S2LA 4DDYA 1XA7A 2XGNA 4S2PA 5TGFA 4KZ3A 3G32A 1MWRA 5DTKA 1K54C 3MZFA 1M6KA 1KDWA 4IBRA 4KQOA 4R0QA 4E3NA 4WZ4A 1PWDA 2Q9NA 2P9VA 3CZDA 2V2FF 5F83A 3O88A 1WE4A 4KZ8A 3G35A 3MXRA 4MBHA 4E3IA 1FSWA 4OQHA 4S2IA 3UE0A 2EX8A 2HDQA 1YLWA 2OLUA 3MBZA 3ZVTA 1MWSA 4GDNA 4ZDXA 3UPOA 2Y2HA 3HLEA 3BLSA 5CECA 1VM1A 3UPNA 1G6AA 1EWZA 1JWVA 4S2NC 1K56D 4D2OA 1W79A 3EQUA 4QB8A 1L0EA 1RGYA 1ES5A 1BT5A 4DRTA 4EBPA 3S22A 5KSHA 1KVMA 4KZ7A 3IF6C 3ZFZA 3UDIA 3IXHA 3BYDA 4JPMA 5CGXA 3ZG7B 1I5QA 1XXMA 1SCWA 4JF5A 4BD1A 4Y0TA 5E43A 1BLCA 1ERMA 2HP5A 4OP5A 1K4EA 2C5WB 3OPHA 1ZG6A 1I2SA 4PM6A 1GHMA 1L0DA 1HVBA 1RCJA 2XF3A 4KQRA 4M3KA 3C4OA 4HBUA 1IYSA 1MPLA 1KE4A 3CG5A 3JYIA 2V20A 4CJNA 2BG1A 1LI9A 4FSFA 5BOHA 4JF6A 5I94A 4BENA 2WYXA 4QY5A 3PBRA 1JVJA 4IVKA 3FV7A 4P85A 3EQVA 4UA9A 4R4RA 4WMCD 4X6TA 3A3EA 5DTTA 5HL1A 1NYMA 2ZC3B 3OPLA 4P6BA 4Y0OA 4R1GA 4O7DA 2XD1A 4DE0A 4FD8A 5E2HA 5EVID 1CEGA 5EVIB 1E25A 3WWXA 1OMEA 1FR6A 1XP4A 3IXDA 4H8RA 4OH0A 4E3JA 1SDEA 2Y2NA 3Q1FA 4FH4A 1Y54A 5FAQA 4EV4A 3G2YA 4N1XA 3ZG0A 1E3UA 5TR7A 5M1AA 2Y2OA 4MLLA 3VSLA 4LV2A 1EROA 1NJ4A 3GR2A 2H0TA 1FCNA 3HVFA 5IHVA 3IH9A 4WZ5C 5EPHA 4B4XA 4S2KA 4ZAMA 4ID4A 2X02A 1PWCA 1PIOA 3G4PA 3HLBA 2VGKA 1W7FA 2BLSA 4OLDA 5CHUA 5JYPA 1YLPA 3RJUA 3RXXA 5FI6A 5FAOA 2J7VA 4IEDA 3D4FA 3N8SA 3V3RA 4DE1A 3TOIA 3ZVWA 1FOFA 4LV3A 4R3JA 1IKGA 4Q8IA 2PU2A 3N7WA 2IWDA 1ES2A 2Y2GA 5EVIC 5JYOA 3P09A 1KDSA 2EXAA 4BJPA 3GMWA 3GTCA 4MBFA 1WYBA 2XR0A 5CGWA 4OONA 5AQBA 3B3XA 4WEKA 4LENA 3Q7VB 1ONGA 4RVAA 1MXOA 4RA7A 4U0XA 5E2EA 4ZTKA 1NY0A 3WS5A 1W5DA 2A3UA 2R9XA 2XEPA 1FR1A 1YT4A 3RXWA 2EX6A 2C6WB 1MY8A 5AQ9A 4C3QA 2ZQ9A 1LLBA 3LCEA 1TVFA 4GKUA 5CHJA 5GLCA 2Y4AA 1KVLA 3FWLA 5FQMA 2QPNA 2Y91A 3V50A 1I2WA 3PAEA 4JBFA 3I7JA 3SH8A 1RGZA 1PYYA 2GDNA 1ES4A 5DF8A 5EUAA 4K91A 4S2MA 3WRZA 3VSKA 3O86A 1BULA 4OVDA 5HARA 4OP8A 4WM9A 1H8YA 2OLVA 3UDXA 3WS1A 1CK3A 1TEMA 1N9BA 4YFMA 3NDGA 1JTDA 2FFFB 1XA1A 4U0TA 1JWZA 5FQIA 4GDBA 4GB7A 1PZOA 3WRTA 2UWXA 5CEBA 3HLCA 2XD5A 5U47A 3IQAA 5KMWA 3MZEA 4N1HA 2WGWA 4NK3A 4PM5A 3BFGA 4K0WA 1BUEA 2Y55A 1ESUA 1YMSA 3IF6A 4PM8A 5FSRA 5F82A 3VP0A 1SDNA 2EX9A 4KZAA 3BFEA 2R9WA 3FZCA 2P9VB 2ZQCA 4OOMA 3GVBA 5E2GA 4X56A 2PU4A 5A93A 1ALQA 1BSGA 3HUNA 1JTGA 1L0FA 3UE1A 4IBXA 4JXSA 2XDMA 4NETA 1GHIA 2DCFA 4JXVA 4DXBA 3BRMA 3IH8A 3UY6A 3SS3A 1IELA 5FI2A 2P74A 3W4QA 2G2UA 3BFDA 3HBRA 4E3LA 3ZGAB 2IWBA 3DWKA 1CI8A 4KG6A 2EFUA 3HL9A 5CGSA 1ONHA 5F1GA 3TG9A 1SKFA 4HEFA 4GZBA 4OPQA 5L2FA 4KENB 3VFHA 2Y59A 4N92A 2WKIA 3UNWA 4BLMA 4BQMA 1NXYA 4R23A 5HFOA 2ZC5B 1K6RA 3IHAA 3P98A 4A5RA 2X01A 2EXBA 2ZC4B 4E3MA 1DJCA 2ZQDA 2I72A 4OQGA 3VP2A 1K55C 2CC1A 3ITAA 2ZM0A 3G31A 4ZJ1A 5M19A 2J8YA 5GL9A 3GSGA 3MZDA 5HX9A 1GA0A 2B5RA 1FSYA 1U60A 2WUQA 3PAGA 4MNRA 4WZ5A 4OOYA 3ITBA 4ZJ3A 2ZM2A 4PPRA 4QY6A 2WK0A 5CXWA 1Q2PA 2J9OA 1K4FA 1S6RA 4GN2A 3G34A 1O07A 2HDUA 2ZM8A 3QHYA 5HW3A 1XX2A 2HP6A 2A49A 1LI0A 4RX3A 4U3TA 5FQ9A 1PZPA 4Z9QA 5TFQA 2Y2MA 4KZ4A 1IYQA 1YLTA 2Z2MB 4GD6A 1RP5A 5FASA 2ZJ9A 5E2FA 3SH7A 3UE3A 4B4ZA 4KZBA 3BECA 1E3UD 2WZXA 3M6HA 1GA9A 4DE2A 3GQZA 3UN7A 3C7UA 3LY3A 4P87A 5D3OA 3GRJA 4DF6A 4EBLA 1MBLA 1NZUA 3VFFA 4PM7A 3NIAA 2WGIA 1J9MA 5EECA 4B88A 4JF4A 4JXWA 4X69A 1NYYA 3M2JA 1ES3A 1XGJA 3OCNA 4RX2A 4N9LA 1YMXA 2Q9MA 3O3VA 4KZ9A 5GLDA 4EWFA 2WAFA 4GNUA 4KZ5A 3N8LA 2H0YA 3N8RA 4MBKA 3A3FA 3WS4A 4QJGA 4CPKA 3HLGA 1BZAA 2JE5A 1ZC2A 2XLNA 3PBSA 1KGGA 5DF7A 3Q82A 1ERQA 1G68A 2Y2QA 3G30A 1XGIA 3VP3A 2H5SA 3FKVA 1H8ZA 2G2WA 3WS0A 1MKIA 1IKIA 2RCXA 4C75A 5A91A 3HLDA 1VQQA 2WKHA 1K54A 3OZHA 2ZMAA 4OQIA 3E2KA 3MXSA 3ZG9B 3IXGA 3C7VA 1N4OA 4XUZA 3NBLA 3UO9A 1IYPA 3Q07A 5CTNA 2XFSA 3HUMA 3ZNYA 5EOEA 5HAQA 3LEZA 1NRFA 1HD8A 4JKTA 1CI9A 1KE0A 5FA7A 5FQJA 4KQQA 2HDRA 3IWOA 3A3JA 4ZJ2A 3AGEA 2WAEA 4OLGA 4E3OA 4S2NA 2ZC7A 1FQGA 3WS2A 4BL3A 2XFTA 4XXRA 5G18A 3NDEA 1DY6A 3ZHHA 5HAPA 3O87A 4K0XA 4MEZA 1K57C 1LL9A 4FCFA 1FCOA 4LV0A 4EQIA 4ZBEA 4OPRA 1BLPA 5M18A 4DDSA 1IYOA 3AGDA 4JLFA 5DF9A 2WGWB 2QZ6A 3SS4A 1XPBA 3VP4A 3E2LA 4OPZA 3IF6B 4L0LA 3VMAA 1YQSA 1YLJA 4UA6A 1LL5A 4HBTA 5FI7A 4EUZA 1KE3A 1LHYA 1TDLA 2ZQ7A 3LY4A 1E4DA 5FAPA 3C5AA 2HPBA 1K55A 2PBYA 1PW8A 1W8YA 3QNBA 2ZD8A 4Y7PA 1DJBA 3OCLA 4DE3A 3VOYA 3TSGA 1FCMA 2DRWA 2OV5A 2XH9A 3G2ZA 4IVIA 3MKEA 5A92A 1H5XA 4LV1A 3ZDJA 1EI5A 5GHXA 3AGFA 1K56A 3HUOA 4WYYA 5FQKA 3SH9A 4WBGA 4KG2A 4S2JA 1SHVA 3DTMA 4EBNA 3CMZA 2JBFA 3N4IA 3FKWA 4LCMA 4BL2A 2HDSA 3SOIA 1DJAA 1GCEA 1C3BA 2J9PA 1Z6FA 2QMIA 5CTMA 4UA7A 5EE8A 5GHZA 1QMFA 1Q2QA 4R3BA 5CERA 3MKFA 4PM9A 3IHBA 4KZ6A 5FQQA 1YM1A 3PBTA 3ZNTA 3OPPA 3QNCA 1CEFA 1K38A 4RYEA 4E6WA 4HESA 4S2OA 3N6IA 4F94A 3NY4A 5GHYA 4OKPA 2X71A 2ZLYA 3M6BA 4X53A 1PI5A 3CJMA 2IWCA 4FH2A 4GD8A 2ZQAA 2WADA 2XK1A 3V39A 4WELA 1QMEA 4WMCA 3PBQA 3PBOA 1XKZA 1GHPA 3BFCA 5J8XA 3ISGA 2H10A 1BLHA 4OQ0A 1PW1A 4E3KA 3C4PA 1K25A 3BFFA 5EVIA 4OPYA 1KGEA 3PBNA 1TDGA 3A3IA 4YINA 3HREA 3MFDA 4UHUA 3BM6A 3GV9A 4P0MA 5GLBA 5DTSA 3HLFA 2FFYA 2OSUA 1S0WA 2DNSA 2JCHA 2WZZA 3LO7A 4XUXA 4QHCA 3Q7ZA 3VOZA 5KSCA 1ESIA 4OOLA 2E8IA 3IT9A 3V3SA 3NI9A 1M40A 1HZOA 3HLWA 4N9KA 4KG5A 5A90A 2JC7A 3NCKA 5DVAA 5F1FA 1AXBA 5CHMA 3FYZA 2Y2KA 4Y0UA 4QD4A 5CEDA 3UDFA 4WEJA 4PMAA 2WKEA 1WYCA 3V5MA 1IEMA 5GLAA 1K6SA 4X55A 1PWGA 3S1YA 1BLSA 3ZG5A 4BD0A 2ZC6B 4LCLA 3Q81A 2Y2PA 1O7EA 5FATA 1W8QA 2WGVA 3BEBA 4DKIA 1KGFA 1L2SA 1L0GA 3W8KA 4E6XA 1K57A 5EVLA 5CRFA 3SS5A 2Y2IA 3ZG8B 5EOOA 4R4SA 1YLZA 2EX2A 3Q7VA 4X68A 3W4PA 2Z2LB 2ZQ8A 3UPPA 2Y2LA 4UAAA
chains in the Genus database with same CATH superfamily
1MZUA 3IXBA 1NZOA 2ZMFA 4WUJA 4EEPA 2K31A 3NOUC 3NC8A 1EW0A 1P97A 1JWPA 2EWWA 3VP1A 2BTFP 3IWQA 5FDHA 4Y17A 2HP9A 2V1ZA 3LICA 3IWIA 1OPXA 3IF5A 3OC2A 3DW0A 4DDYA 4S2LA 2XGNA 3NJAA 4KZ3A 3IS2B 1GSWA 4Y5FA 2GX5A 1MWRA 4IBRA 4KQOA 4R0QA 4WZ4A 1PWDA 2Q9NA 2V2FF 3O88A 1WE4A 4Y3IA 4MBHA 3UE0A 3MBZA 2HGVA 5CECA 3MQ0A 4XT2A 4D2OA 4QB8A 3DTEA 1BT5A 2ZL1B 4DRTA 5KSHA 4KZ7A 3IF6C 3IXHA 3BYDA 3MJQA 4BD1A 2K2NA 4Y0TA 4OP5A 1K4EA 2PDRA 4M3KA 2XF3A 4KQRA 5DFYA 2O9BA 1H0MA 4JF6A 3B47A 4QY5A 4X6TA 1PFLA 1NYMA 3OPLA 4P6BA 4Y0OA 3EEAA 2XD1A 5E2HA 2XA7S 3WWXA 4BBUA 2KLIA 5DJTA 1Y54A 1E3UA 1EROA 3HVFA 4WZ5C 5EPHA 1PWCA 3G4PA 5CHUA 3CUEA 1YLPA 3RJUA 1Y28A 5FAOA 4IEDA 3V3RA 3ZVWA 1IKGA 4UQIM 1ES2A 4Q0JA 2Y2GA 2VK3A 5EVIC 2EXAA 1K0KA 3GTCA 4MBFA 1WYBA 2Q0OA 4OONA 4WEKA 3Q7VB 5E2EA 5HWTA 3WS5A 4RA7A 1OJ5A 5FEFA 2JKTI 2YKFA 3UB6A 5AQ9A 4C3QA 1KVLA 2M1CA 3PAEA 4GLQA 3SH8A 3CWFA 5IU1A 4QWOA 5J4EA 3PYPA 3O86A 3UDXA 1N9BA 4YFMA 4HP9A 3OLOA 1JWZA 5FQIA 4AFIA 2XD5A 4N1HA 4NK3A 3QP4A 2R9WA 4P6ZS 3RFBA 5HDCA 3HCYA 4X56A 5DJUA 1ALQA 3UE1A 5EV0A 3S7OA 4IBXA 2KDKA 3MF0A 1GHIA 2GJ3A 2PD7A 3IX8A 3UY6A 4Z1WA 2P74A 3W4QA 2G2UA 2W1TA 3BFDA 3BY8A 4E3LA 4KG6A 5F1GA 1ONHA 3CPTB 1G28A 3D72A 5HDSA 3VFHA 2Y59A 5HFOA 3ZYTA 3IHAA 3P98A 3TJZC 1V9YA 2ZM0A 4ZJ1A 3GSGA 3P7NA 2ZM2A 1IFQA 4JGOA 1S6RA 3QHYA 4ESPA 2HP6A 3OBFA 4RX3A 2CMNA 1PZPA 4Z9QA 5TFQA 3K2NA 4EU0A 1RP5A 3UE3A 5HDDA 3FG8A 2W3DA 4CLCE 3LYXA 3R4KA 4ZRRA 4GCZA 3LY3A 4P87A 1OJGA 4DF6A 2VX8A 1MBLA 1S4SA 3NIAA 5EECA 1D1JA 1J9MA 4JF4A 3M2JA 1ES3A 3KSIA 3OCNA 5F6AA 4GNUA 3N8RA 4MBKA 4QJGA 4CPKA 3HLGA 1ZC2A 2XLNA 3PBSA 1KGGA 2Y2QA 1G68A 5L09A 5A91A 3S7NA 1K54A 3IXGA 5HSQA 5EFWA 3NBLA 3R7WA 3HUMA 3ZNYA 5FA7A 4FUWA 1KE0A 4MN6A 3CUEC 3A3JA 1FQGA 3TE8A 3WS2A 4BL3A 2XFTA 3EGDC 4XXRA 1DY6A 5EM1A 3LIEA 3O87A 1K57C 1XJ4A 4OPRA 5DFXA 4DDSA 5DF9A 2WGWB 1LSXA 3T4QA 3JVUA 4L0LA 2M7UA 4EUZA 3F1OB 1TDLA 1E4DA 3C5AA 4L9FA 1W8YA 2ZD8A 4DE3A 2JKRM 3G2ZA 3MKEA 4HY8A 5A92A 1EI5A 2PBDP 5FQKA 1P0ZA 1BYWA 4EBNA 3K3DA 2JBFA 3FKWA 1X0OA 5HZHA 1Z6FA 5GHZA 1QMFA 5HD3A 5CERA 1YSPA 3MKFA 1T1BA 5FQQA 1YM1A 3PBTA 1OT6A 1D7EA 4E6WA 4HESA 5GHYA 2QKPA 3UB8A 2XROA 1PI5A 3H82A 4WF0A 3CJMA 2IWCA 3KX0X 3DTKA 5HPIA 3V39A 4WELA 2VV7A 2VJWA 1Z09A 1BLHA 4OQ0A 4E3KA 1K25A 3BFFA 4GW9A 3CAXA 3PBNA 3H7WA 3PR6A 4UHUA 4CLCA 5A8BA 3GV9A 3QP2A 1Y4OA 3LIFA 2DNSA 4XUXA 2WZZA 3BY9A 3IT9A 3NI9A 1M40A 3HLWA 4KG5A 5A90A 4GHIA 1AXBA 1W63Q 2UV0E 2Y2KA 5CEDA 1WYCA 2K7SA 3ZQ5A 3CHWP 1PWGA 1BLSA 3ZG5A 1PRQA 1GSXA 2ZC6B 4LCLA 3E4QA 2WGVA 3MQOA 4MMNA 4E6XA 4R4SA 4JGPA 2Y2LA 1AWIA 3M2KA 3ZCZA 3BLMA 5AVFA 2EFXA 2VGJA 5L8MA 1DRMA 4QU3A 5AVEA 3A3DA 1ZG4A 2RL3A 4JXGA 2XQZA 1JNUA 3IBJA 1ZKJA 2Y2JA 3RTYA 2ZOIA 3G32A 4ME4A 3B42A 1VETB 4RQ9A 1K54C 1M6KA 1KDWA 2J3WA 4E3NA 1G5UA 3G35A 3MXRA 4E3IA 1FSWA 1VEUB 2HDQA 1YLWA 2OLUA 3ZVTA 1LL8A 1T19A 2PAVP 2Y2HA 3BLSA 1CF0A 2EWVA 3NECA 1G6AA 4HJ4A 1L0EA 3QP6A 3EOIA 3ZFZA 1S67L 3UDIA 3D3OA 3L9KA 3P01A 4JF5A 2BASA 2C5WB 4PM6A 1ZG6A 1GHMA 1RCJA 1HVBA 4DJ3A 2HJ9C 2Y79A 5L10A 1IOUA 1MPLA 4IJGA 1DP6A 4CJNA 2BG1A 1LI9A 4PHTA 5BOHA 5I94A 4BENA 2W3EA 3EQVA 4WMCD 2ZC3B 4F3LA 2W3GA 3SZTA 4GS9A 4QPRA 5EVID 1CEGA 5EVIB 1G6OA 1E25A 4G3VA 1OMEA 3IXDA 4R3AA 3Q1FA 2Y2NA 5FAQA 1S1ZA 1NJ4A 2FZ0A 2H0TA 1LSWA 2WKPA 2AVXA 3TRCA 2E8JA 1XJ2A 3QP1A 2X02A 3MR0A 1PIOA 4NXGA 5FI6A 2PD8A 4DE1A 2KOIA 1TS6A 4Q8IA 5DKKA 1FIKA 3N7WA 2VGLM 4O8GA 4Y13A 3UB7A 3T1RA 5JYOA 3P09A 3T4KA 4BJPA 1T1AA 3LUQA 1F5MA 4LENA 4RVAA 1W5DA 2R9XA 2L0WA 3TW8A 3A0RA 1YT4A 1F9IA 4EW7A 1TVFA 4GKUA 2Y4AA 3FWLA 4UEYA 5FQMA 2QPNA 3I7JA 2ZOHA 3IBRA 1PYYA 5EUAA 4S2MA 3WRZA 3JVVA 5HARA 5HWWA 1H8YA 2W1RA 3NDGA 3KSFA 3VE4A 4U0TA 3UMDA 2V8CA 4GB7A 5IT5A 2UWXA 2WKQA 5CEBA 3HLCA 3S7PA 2QYBA 3D9YA 3BFGA 2Y55A 5K5BA 1YMSA 4NXBA 4LPZA 5F82A 2V8FA 1SDNA 2EX9A 4KZAA 3KYZA 3BFEA 4OOMA 2PU4A 5FL3A 3HUNA 4JXVA 4DXBA 3BRMA 4XT2B 3DWKA 1CI8A 3HL9A 1SKFA 1A0KA 4GZBA 2JKGA 5L2FA 4KENB 4WLAA 1XFNA 3IX4A 1NWZA 2WKIA 4LFUA 1NXYA 1K6RA 4A5RA 2X01A 1N9OA 2ZL1A 2ZC4B 2I72A 2V9AA 4UQIS 2XRNA 3LIDA 5M19A 5GL9A 3MZDA 2B5RA 1U60A 3PAGA 2B95A 4OOYA 3ITBA 2ZM8A 2A49A 5FQ9A 4KZ4A 1YLTA 4HOIA 3MQQA 2HV1A 2V1AA 4MN5A 3V67A 3HJKA 1E3UD 2WZXA 3K3CA 3E0YA 5D3OA 2KX6A 4B88A 4JXWA 3C38A 4X69A 1XGJA 4N9LA 5L07A 3O3VA 5GLDA 2H0YA 3LR3A 2JE5A 4IUKA 1S1YA 5DF7A 2W0NA 2H5SA 1H8ZA 3T4OA 3DTIA 1MKIA 4C75A 1VQQA 3OZHA 4OQIA 4I3IA 3E2KA 1N4OA 4XUZA 2VV8A 1DP8A 3UE6A 5HAQA 4JKTA 3MFXA 3IWOA 3AGEA 4I39A 4E3OA 4PAUA 2ZC7A 3ZHHA 1ACFA 4MEZA 2HF6A 1LL9A 4EQIA 1FCOA 5M18A 1XPBA 2JKTM 3E2LA 4OPZA 3GDIA 2PHYA 1LL5A 2PYRA 4HBTA 2L4RA 1H8MA 2ZQ7A 2HPBA 1K55A 4KQDA 1T1CA 3QNBA 2MJ6A 3VOYA 3TSGA 1FCMA 1XFQA 2XH9A 1S66L 2VA0A 1OTAA 4LV1A 2W1TB 3AGFA 1K56A 4WYYA 4ARZB 4Q0IA 2HDSA 3SOIA 1DJAA 2INWA 1C3BA 5EE8A 4DJ2A 4UA7A 4R3BA 1LT0A 4EEUA 3QNCA 2W3FA 2H28A 3NY4A 2ZLYA 1XJ3A 4GD8A 4FH2A 2V1BA 3PBOA 1XKZA 3ISGA 3T12B 4BBTA 2H10A 2OAQ1 4HH2A 1J3WA 1KGEA 1W63M 1MC0A 4YINA 3MFDA 3BM6A 4P0MA 5AJGA 3HLFA 2QHKA 2OAP1 4QHCA 3Q7ZA 4FTXA 3T4LA 3V3SA 5HWVA 2JC7A 3NCKA 5F1FA 3FYZA 1HLUP 4L9EA 4PMAA 2WKEA 2YKHA 3MMHA 3C8CA 3V5MA 3EWKA 5GLAA 5TBMB 4K08A 5J3WA 4I3AA 2EA9A 2Y2PA 1O7EA 3SS5A 2VEAA 5EOOA 2D02A 5FDSA 4X68A 4R70A 2ZQ8A 2VLGA 3UPPA 3PTEA 3S4XA 3W4OA 3R7WB 1V9ZA 1PI4A 5AQAA 1HTZA 4EUVA 4L9GA 3LGOA 5KZHA 4DXCA 2JKRI 5IS1A 1SKOB 4EETB 5DTKA 2PRFA 3CZDA 2P9VA 1LSVA 4OQHA 3IX3A 1MWSA 4ZDXA 4DMZA 1OT9A 1VM1A 2V0WA 3PHYA 1P9RA 1EWZA 5I5LA 3UPNA 3UMEA 1W79A 3EQUA 4WN5A 1RGYA 3FC7A 4NG2A 1I5QA 3QP5A 4DN0A 1SCWA 4YWZA 4PM5A 1I2SA 1L0DA 3C4OA 1WA9A 1IYSA 1KE4A 3CG5A 3H82B 4MN7A 4FSFA 2WYXA 3PBRA 1JVJA 4IVKA 3FV7A 4P85A 4G3KA 5EVEA 4O7DA 4DE0A 4FD8A 3A0VA 3H7WB 4CLCD 2QWSA 4N1XA 2A24A 5TR7A 3U2AA 5M1AA 3VSLA 4LV2A 1OTIA 1TS8A 3SW1A 1FCNA 5IHVA 3IH9A 3F1PA 1YAXA 4GHIB 4BWIA 4E04A 4R6LA 3F1NB 1GSVA 2VGKA 1W7FA 2BLSA 4OLDA 5JYPA 3H9WA 4FOFA 5G4YA 2VZWA 2PYPA 2PU2A 3BW6A 3LR5A 4GJ4A 4JGQA 2O9AA 4R38A 1KDSA 3GMWA 2XR0A 5AQBA 3B3XA 1ONGA 1MXOA 1NY0A 3VOLA 2XEPA 1FR1A 2C6WB 1MY8A 2VV6A 1LLBA 5CHJA 1I2WA 4JBFA 1ES4A 3VSKA 1BULA 2Z6CA 3UB5P 1STZA 1TEMA 2FFFB 4GDBA 4H6JA 3WRTA 1F2KA 3IQAA 3MZEA 1VHMA 5F5YA 3CLOA 4K0WA 1BUEA 3IF6A 5FSRA 3FZCA 5A93A 3FPVA 2XDMA 3IH8A 2NUTC 4X1LA 1IELA 5FI2A 2WKRA 4O0PA 5CGSA 4HEFA 3HJIA 2I9VA 2D01A 4N92A 3UNWA 4BQMA 4NXEA 2ZC5B 2VGLS 2EXBA 4E3MA 4OQGA 2J8YA 4WZ5A 1FSYA 2WUQA 2JKFA 1L3LA 4PPRA 2WK0A 1Q2PA 2J9OA 1K4FA 2OOLA 1T18A 5HW3A 1XX2A 4F3LB 4GS9B 4U3TA 3PXPA 2Z2MB 2QJ7A 3SH7A 4B4ZA 4G3WA 1CJFA 1NLYA 2JN7A 1CQAA 3BECA 4EBLA 1NZUA 4PM7A 1NYYA 4BMWA 4RX2A 2P7JA 2Q9MA 4HJ6A 4NXFA 4KZ5A 4EESA 1BZAA 2P08A 2PT7A 3Q82A 1ERQA 3G30A 1XGIA 4CLCC 4LRYC 3FKVA 2G2WA 1IKIA 2Z6DA 2LB9A 2ZMAA 3MXSA 1F98A 3MS6A 3UO9A 1IYPA 5EOEA 3LEZA 1NRFA 3CI6A 1HD8A 1CI9A 5FQJA 3T4TA 2HDRA 3W2ZA 2WAEA 4OLGA 4S2NA 1NLZA 3OOVA 3L7HA 5G18A 3T4SA 1UWPX 4LV0A 4ZBEA 1N9LA 1BLPA 3BQ8A 2Y8HA 4ETXA 1IYOA 3AGDA 3IS2A 5TJJA 2PR6A 1YQSA 4I38A 4UA6A 5FI7A 1VB6A 1KE3A 1LHYA 2B18A 3LY4A 1NRJA 5FAPA 2PBYA 2O0YA 1PW8A 4Y7PA 1DJBA 3OCLA 4WL9A 4HIAA 1H5XA 3VV4A 3ZDJA 5GHXA 3NOTC 5J7EA 4WBGA 4S2JA 3CMZA 2DMWA 3N4IA 5DKLA 5CTMA 1GCEA 2J9PA 2IWBA 3A0SA 1Q2QA 3NOPC 5CX7A 2OWHA 3OPPA 1CEFA 5HPFA 4S2OA 3N6IA 4OKPA 2X71A 3M6BA 3T1QB 4MCWA 3LIAA 1OTBA 2WADA 2XK1A 3PBQA 1TS0A 2ZMVA 3BFCA 4I3JA 5J8XA 4KUKA 1PW1A 2O9CA 1N9NA 4OPYA 1TDGA 3NULA 5GLBA 5DTSA 2FFYA 2OSUA 1S0WA 2JCHA 3LO7A 3VOZA 3LI9A 1ESIA 4OOLA 4N9KA 2GNXA 4Q0HA 5CHMA 4Y0UA 4QD4A 1MKMA 4Y2FA 4X55A 3DAVA 3S1YA 4JGRA 3Q81A 5FATA 4DKIA 1KGFA 1L2SA 1L0GA 1K57A 2Y2IA 1YLZA 2EX2A 3Q7VA 2Z2LB 4UAAA 4GOGA 3RH8B 1YLYA 1MWUA 1ZTUA 5HAIA 2B02A 3E4OA 2XA7M 3OPRA 5FEGA 4X1MA 5AQ7A 1ZHHB 1BTLA 3T50A 3DWZA 1MWTA 2R78A 3LIBA 2W27A 4C6YA 1XA7A 2VKSA 4S2PA 5TGFA 3LFVA 2PR5A 3EGXC 3MZFA 3MXQA 2J80A 4HQAA 4O01A 5F83A 3ULFA 3VE3A 4KZ8A 4CQHA 3JPUA 4S2IA 2EX8A 4GDNA 3UPOA 3HLEA 1OTEA 2JHEA 1JWVA 4S2NC 1K56D 1KOUA 3C2WA 3CPTA 1YPRA 1ES5A 3ICYA 4EBPA 3S22A 1KVMA 4JPMA 5CGXA 3ZG7B 1XXMA 5LBRA 5E43A 1BLCA 1ERMA 2HP5A 4ARZA 3OPHA 4LLOB 4HBUA 4EQ1A 3LI8A 3S7QA 3JYIA 2G7UA 2V20A 3LEQA 2LB5A 2IA2A 1DP9A 5KIZA 4UA9A 3ZGAB 4R4RA 5DTTA 3A3EA 5HL1A 3NHQA 4EERA 1H3QA 4R1GA 4P6ZM 1FR6A 1XP4A 4OH0A 4H8RA 4E3JA 1SDEA 3O5YA 4FH4A 1XJ6A 2FH5A 3G2YA 3ZG0A 3EEHA 2Y2OA 4MLLA 3GR2A 3BWLA 4B4XA 2W3HA 4S2KA 4ZAMA 4ID4A 3KSHA 4HH3A 3HLBA 5EM0A 3RXXA 2J7VA 3D4FA 3N8SA 1YKDA 3TOIA 1FOFA 4LV3A 4R3JA 2IWDA 4D60A 4PKYA 5TBMA 4M4XA 4HI4A 3DBAA 3U4LP 5CGWA 2HJEA 2GZAA 4U0XA 1S4RA 4ZTKA 4NEED 2A3UA 3RXWA 2EX6A 4EXOA 3GECA 2ZQ9A 3LCEA 5GLCA 3V50A 2Y91A 2XSSA 1RGZA 2GDNA 5DF8A 4K91A 1D06A 4OP8A 2V0UA 4WM9A 3T4JA 2OLVA 3WS1A 1CK3A 1UGUA 1JTDA 1XA1A 3B33A 1PZOA 5F68A 4I5SA 5U47A 3LR4A 5KMWA 2WGWA 2NUPC 1ESUA 5HD5A 4PM8A 3VP0A 1SKOA 2P9VB 2ZQCA 3GVBA 3F1OA 3G6OA 3BJNA 5E2GA 4B93A 1BSGA 1JTGA 1L0FA 4JXSA 4NETA 5MC7A 2DCFA 2HZ5A 3E4PA 1FILA 3SS3A 3HBRA 2P04A 2EFUA 3TG9A 4OPQA 3C30A 4BLMA 4R23A 1DJCA 2ZQDA 3VP2A 1K55C 2CC1A 3ITAA 3G31A 4X25A 2QJ5A 4HHDA 2O99A 5HX9A 1GA0A 5F69A 4MNRA 4ZJ3A 4IUHA 5C5KA 4II7A 4QY6A 5CXWA 4GN2A 4PKYG 3G34A 3MSHA 1O07A 2HDUA 2ACGA 1LI0A 4CLCB 2Y2MA 4Y15A 1IYQA 4GD6A 4HNBA 5FASA 2ZJ9A 5E2FA 4KZBA 2ZBBA 3QP8A 3UB9A 2A24B 4BBVA 3M6HA 1GA9A 4DE2A 4LRZE 3GQZA 3UN7A 3C7UA 2J3TD 3GRJA 3F1PB 1YSQA 3VFFA 2WGIA 1YMXA 4EWFA 4KZ9A 2WAFA 3N8LA 3A3FA 3WS4A 3F1NA 3CITA 3VP3A 3WS0A 2RCXA 3HLDA 2WKHA 5HL6A 3ZG9B 3C7VA 4B9OA 3Q07A 5CTNA 2XFSA 1SZVA 4KQQA 4ZJ2A 2L1MA 1TF1A 3KO6A 3NDEA 5HAPA 4K0XA 4FCFA 4H6JB 4JLFA 1TD5A 2QZ6A 3SS4A 3VP4A 1VETA 3IF6B 1UWNX 3VMAA 1YLJA 2A2LA 3KSGA 1ODVA 4YNRA 1PNEA 3BQAA 1VEUA 2DRWA 2OV5A 4IVIA 2M7VA 1TS7A 3KYQA 4IHQA 3HUOA 3SH9A 4KG2A 3T1SA 1SHVA 4LRXC 3DTMA 4ETZA 4BL2A 4LCMA 2QMIA 4PM9A 3IHBA 4KZ6A 3ZNTA 1K38A 4HP4A 4YOFA 4RYEA 4NKPA 4F94A 4X53A 2ZQAA 1QMEA 4WMCA 1GHPA 3C4PA 5EVIA 3T1XA 3KYEA 3A3IA 4MDZA 3HREA 1P9WA 3E98A 4HJ3A 5KSCA 2E8IA 1HZOA 5DVAA 3LR0A 3UDFA 4LGWA 4WEJA 1IEMA 5G4ZA 1K6SA 3FPWA 4KUOA 4BD0A 2OWJA 1W8QA 3BEBA 3W8KA 1OTDA 5CRFA 3ZG8B 3W4PA 2J3TC 5EVLA 4EV4A 4OVDA
chains in the Genus database with same CATH topology
3PTEA 4GOGA 3S4XA 3IXBA 1YLYA 3W4OA 1MWUA 1NZOA 3M2KA 5HAIA 3ZCZA 3BLMA 3NC8A 3OPRA 1PI4A 5AQAA 1HTZA 2EFXA 1JWPA 5AQ7A 3VP1A 3IWQA 2VGJA 5FDHA 4QU3A 2HP9A 1BTLA 3A3DA 2V1ZA 3IWIA 1ZG4A 3IF5A 3DWZA 1MWTA 2RL3A 4JXGA 5KZHA 2XQZA 3OC2A 4DXCA 3DW0A 1ZKJA 2Y2JA 4C6YA 4S2LA 4DDYA 1XA7A 2XGNA 4S2PA 5TGFA 4KZ3A 3G32A 1MWRA 5DTKA 1K54C 3MZFA 1M6KA 1KDWA 4IBRA 4KQOA 4R0QA 4E3NA 4WZ4A 1PWDA 2Q9NA 2P9VA 3CZDA 2V2FF 5F83A 3O88A 1WE4A 4KZ8A 3G35A 3MXRA 4MBHA 4E3IA 1FSWA 4OQHA 4S2IA 3UE0A 2EX8A 2HDQA 1YLWA 2OLUA 3MBZA 3ZVTA 1MWSA 4GDNA 4ZDXA 3UPOA 2Y2HA 3HLEA 3BLSA 5CECA 1VM1A 3UPNA 1G6AA 1EWZA 1JWVA 4S2NC 1K56D 4D2OA 1W79A 3EQUA 4QB8A 1L0EA 1RGYA 1ES5A 1BT5A 4DRTA 4EBPA 3S22A 5KSHA 1KVMA 4KZ7A 3IF6C 3ZFZA 3UDIA 3IXHA 3BYDA 4JPMA 5CGXA 3ZG7B 1I5QA 1XXMA 1SCWA 4JF5A 4BD1A 4Y0TA 5E43A 1BLCA 1ERMA 2HP5A 4OP5A 1K4EA 2C5WB 3OPHA 1ZG6A 1I2SA 4PM6A 1GHMA 1L0DA 1HVBA 1RCJA 2XF3A 4KQRA 4M3KA 3C4OA 4HBUA 1IYSA 1MPLA 1KE4A 3CG5A 3JYIA 2V20A 4CJNA 2BG1A 1LI9A 4FSFA 5BOHA 4JF6A 5I94A 4BENA 2WYXA 4QY5A 3PBRA 1JVJA 4IVKA 3FV7A 4P85A 3EQVA 4UA9A 4R4RA 4WMCD 4X6TA 3A3EA 5DTTA 5HL1A 1NYMA 2ZC3B 3OPLA 4P6BA 4Y0OA 4R1GA 4O7DA 2XD1A 4DE0A 4FD8A 5E2HA 5EVID 1CEGA 5EVIB 1E25A 3WWXA 1OMEA 1FR6A 1XP4A 3IXDA 4H8RA 4OH0A 4E3JA 1SDEA 2Y2NA 3Q1FA 4FH4A 1Y54A 5FAQA 4EV4A 3G2YA 4N1XA 3ZG0A 1E3UA 5TR7A 5M1AA 2Y2OA 4MLLA 3VSLA 4LV2A 1EROA 1NJ4A 3GR2A 2H0TA 1FCNA 3HVFA 5IHVA 3IH9A 4WZ5C 5EPHA 4B4XA 4S2KA 4ZAMA 4ID4A 2X02A 1PWCA 1PIOA 3G4PA 3HLBA 2VGKA 1W7FA 2BLSA 4OLDA 5CHUA 5JYPA 1YLPA 3RJUA 3RXXA 5FI6A 5FAOA 2J7VA 4IEDA 3D4FA 3N8SA 3V3RA 4DE1A 3TOIA 3ZVWA 1FOFA 4LV3A 4R3JA 1IKGA 4Q8IA 2PU2A 3N7WA 2IWDA 1ES2A 2Y2GA 5EVIC 5JYOA 3P09A 1KDSA 2EXAA 4BJPA 3GMWA 3GTCA 4MBFA 1WYBA 2XR0A 5CGWA 4OONA 5AQBA 3B3XA 4WEKA 4LENA 3Q7VB 1ONGA 4RVAA 1MXOA 4RA7A 4U0XA 5E2EA 4ZTKA 1NY0A 3WS5A 1W5DA 2A3UA 2R9XA 2XEPA 1FR1A 1YT4A 3RXWA 2EX6A 2C6WB 1MY8A 5AQ9A 4C3QA 2ZQ9A 1LLBA 3LCEA 1TVFA 4GKUA 5CHJA 5GLCA 2Y4AA 1KVLA 3FWLA 5FQMA 2QPNA 2Y91A 3V50A 1I2WA 3PAEA 4JBFA 3I7JA 3SH8A 1RGZA 1PYYA 2GDNA 1ES4A 5DF8A 5EUAA 4K91A 4S2MA 3WRZA 3VSKA 3O86A 1BULA 4OVDA 5HARA 4OP8A 4WM9A 1H8YA 2OLVA 3UDXA 3WS1A 1CK3A 1TEMA 1N9BA 4YFMA 3NDGA 1JTDA 2FFFB 1XA1A 4U0TA 1JWZA 5FQIA 4GDBA 4GB7A 1PZOA 3WRTA 2UWXA 5CEBA 3HLCA 2XD5A 5U47A 3IQAA 5KMWA 3MZEA 4N1HA 2WGWA 4NK3A 4PM5A 3BFGA 4K0WA 1BUEA 2Y55A 1ESUA 1YMSA 3IF6A 4PM8A 5FSRA 5F82A 3VP0A 1SDNA 2EX9A 4KZAA 3BFEA 2R9WA 3FZCA 2P9VB 2ZQCA 4OOMA 3GVBA 5E2GA 4X56A 2PU4A 5A93A 1ALQA 1BSGA 3HUNA 1JTGA 1L0FA 3UE1A 4IBXA 4JXSA 2XDMA 4NETA 1GHIA 2DCFA 4JXVA 4DXBA 3BRMA 3IH8A 3UY6A 3SS3A 1IELA 5FI2A 2P74A 3W4QA 2G2UA 3BFDA 3HBRA 4E3LA 3ZGAB 2IWBA 3DWKA 1CI8A 4KG6A 2EFUA 3HL9A 5CGSA 1ONHA 5F1GA 3TG9A 1SKFA 4HEFA 4GZBA 4OPQA 5L2FA 4KENB 3VFHA 2Y59A 4N92A 2WKIA 3UNWA 4BLMA 4BQMA 1NXYA 4R23A 5HFOA 2ZC5B 1K6RA 3IHAA 3P98A 4A5RA 2X01A 2EXBA 2ZC4B 4E3MA 1DJCA 2ZQDA 2I72A 4OQGA 3VP2A 1K55C 2CC1A 3ITAA 2ZM0A 3G31A 4ZJ1A 5M19A 2J8YA 5GL9A 3GSGA 3MZDA 5HX9A 1GA0A 2B5RA 1FSYA 1U60A 2WUQA 3PAGA 4MNRA 4WZ5A 4OOYA 3ITBA 4ZJ3A 2ZM2A 4PPRA 4QY6A 2WK0A 5CXWA 1Q2PA 2J9OA 1K4FA 1S6RA 4GN2A 3G34A 1O07A 2HDUA 2ZM8A 3QHYA 5HW3A 1XX2A 2HP6A 2A49A 1LI0A 4RX3A 4U3TA 5FQ9A 1PZPA 4Z9QA 5TFQA 2Y2MA 4KZ4A 1IYQA 1YLTA 2Z2MB 4GD6A 1RP5A 5FASA 2ZJ9A 5E2FA 3SH7A 3UE3A 4B4ZA 4KZBA 3BECA 1E3UD 2WZXA 3M6HA 1GA9A 4DE2A 3GQZA 3UN7A 3C7UA 3LY3A 4P87A 5D3OA 3GRJA 4DF6A 4EBLA 1MBLA 1NZUA 3VFFA 4PM7A 3NIAA 2WGIA 1J9MA 5EECA 4B88A 4JF4A 4JXWA 4X69A 1NYYA 3M2JA 1ES3A 1XGJA 3OCNA 4RX2A 4N9LA 1YMXA 2Q9MA 3O3VA 4KZ9A 5GLDA 4EWFA 2WAFA 4GNUA 4KZ5A 3N8LA 2H0YA 3N8RA 4MBKA 3A3FA 3WS4A 4QJGA 4CPKA 3HLGA 1BZAA 2JE5A 1ZC2A 2XLNA 3PBSA 1KGGA 5DF7A 3Q82A 1ERQA 1G68A 2Y2QA 3G30A 1XGIA 3VP3A 2H5SA 3FKVA 1H8ZA 2G2WA 3WS0A 1MKIA 1IKIA 2RCXA 4C75A 5A91A 3HLDA 1VQQA 2WKHA 1K54A 3OZHA 2ZMAA 4OQIA 3E2KA 3MXSA 3ZG9B 3IXGA 3C7VA 1N4OA 4XUZA 3NBLA 3UO9A 1IYPA 3Q07A 5CTNA 2XFSA 3HUMA 3ZNYA 5EOEA 5HAQA 3LEZA 1NRFA 1HD8A 4JKTA 1CI9A 1KE0A 5FA7A 5FQJA 4KQQA 2HDRA 3IWOA 3A3JA 4ZJ2A 3AGEA 2WAEA 4OLGA 4E3OA 4S2NA 2ZC7A 1FQGA 3WS2A 4BL3A 2XFTA 4XXRA 5G18A 3NDEA 1DY6A 3ZHHA 5HAPA 3O87A 4K0XA 4MEZA 1K57C 1LL9A 4FCFA 1FCOA 4LV0A 4EQIA 4ZBEA 4OPRA 1BLPA 5M18A 4DDSA 1IYOA 3AGDA 4JLFA 5DF9A 2WGWB 2QZ6A 3SS4A 1XPBA 3VP4A 3E2LA 4OPZA 3IF6B 4L0LA 3VMAA 1YQSA 1YLJA 4UA6A 1LL5A 4HBTA 5FI7A 4EUZA 1KE3A 1LHYA 1TDLA 2ZQ7A 3LY4A 1E4DA 5FAPA 3C5AA 2HPBA 1K55A 2PBYA 1PW8A 1W8YA 3QNBA 2ZD8A 4Y7PA 1DJBA 3OCLA 4DE3A 3VOYA 3TSGA 1FCMA 2DRWA 2OV5A 2XH9A 3G2ZA 4IVIA 3MKEA 5A92A 1H5XA 4LV1A 3ZDJA 1EI5A 5GHXA 3AGFA 1K56A 3HUOA 4WYYA 5FQKA 3SH9A 4WBGA 4KG2A 4S2JA 1SHVA 3DTMA 4EBNA 3CMZA 2JBFA 3N4IA 3FKWA 4LCMA 4BL2A 2HDSA 3SOIA 1DJAA 1GCEA 1C3BA 2J9PA 1Z6FA 2QMIA 5CTMA 4UA7A 5EE8A 5GHZA 1QMFA 1Q2QA 4R3BA 5CERA 3MKFA 4PM9A 3IHBA 4KZ6A 5FQQA 1YM1A 3PBTA 3ZNTA 3OPPA 3QNCA 1CEFA 1K38A 4RYEA 4E6WA 4HESA 4S2OA 3N6IA 4F94A 3NY4A 5GHYA 4OKPA 2X71A 2ZLYA 3M6BA 4X53A 1PI5A 3CJMA 2IWCA 4FH2A 4GD8A 2ZQAA 2WADA 2XK1A 3V39A 4WELA 1QMEA 4WMCA 3PBQA 3PBOA 1XKZA 1GHPA 3BFCA 5J8XA 3ISGA 2H10A 1BLHA 4OQ0A 1PW1A 4E3KA 3C4PA 1K25A 3BFFA 5EVIA 4OPYA 1KGEA 3PBNA 1TDGA 3A3IA 4YINA 3HREA 3MFDA 4UHUA 3BM6A 3GV9A 4P0MA 5GLBA 5DTSA 3HLFA 2FFYA 2OSUA 1S0WA 2DNSA 2JCHA 2WZZA 3LO7A 4XUXA 4QHCA 3Q7ZA 3VOZA 5KSCA 1ESIA 4OOLA 2E8IA 3IT9A 3V3SA 3NI9A 1M40A 1HZOA 3HLWA 4N9KA 4KG5A 5A90A 2JC7A 3NCKA 5DVAA 5F1FA 1AXBA 5CHMA 3FYZA 2Y2KA 4Y0UA 4QD4A 5CEDA 3UDFA 4WEJA 4PMAA 2WKEA 1WYCA 3V5MA 1IEMA 5GLAA 1K6SA 4X55A 1PWGA 3S1YA 1BLSA 3ZG5A 4BD0A 2ZC6B 4LCLA 3Q81A 2Y2PA 1O7EA 5FATA 1W8QA 2WGVA 3BEBA 4DKIA 1KGFA 1L2SA 1L0GA 3W8KA 4E6XA 1K57A 5EVLA 5CRFA 3SS5A 2Y2IA 3ZG8B 5EOOA 4R4SA 1YLZA 2EX2A 3Q7VA 4X68A 3W4PA 2Z2LB 2ZQ8A 3UPPA 2Y2LA 4UAAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PTE A;  4GOG A;  3S4X A;  3IXB A;  1YLY A;  3W4O A;  1MWU A;  1NZO A;  3M2K A;  5HAI A;  3ZCZ A;  3BLM A;  3NC8 A;  3OPR A;  1PI4 A;  5AQA A;  1HTZ A;  2EFX A;  1JWP A;  5AQ7 A;  3VP1 A;  3IWQ A;  2VGJ A;  5FDH A;  4QU3 A;  2HP9 A;  1BTL A;  3A3D A;  2V1Z A;  3IWI A;  1ZG4 A;  3IF5 A;  3DWZ A;  1MWT A;  2RL3 A;  4JXG A;  5KZH A;  2XQZ A;  3OC2 A;  4DXC A;  3DW0 A;  1ZKJ A;  2Y2J A;  4C6Y A;  4S2L A;  4DDY A;  1XA7 A;  2XGN A;  4S2P A;  5TGF A;  4KZ3 A;  3G32 A;  1MWR A;  5DTK A;  1K54 C;  3MZF A;  1M6K A;  1KDW A;  4IBR A;  4KQO A;  4R0Q A;  4E3N A;  4WZ4 A;  1PWD A;  2Q9N A;  2P9V A;  3CZD A;  2V2F F;  5F83 A;  3O88 A;  1WE4 A;  4KZ8 A;  3G35 A;  3MXR A;  4MBH A;  4E3I A;  1FSW A;  4OQH A;  4S2I A;  3UE0 A;  2EX8 A;  2HDQ A;  1YLW A;  2OLU A;  3MBZ A;  3ZVT A;  1MWS A;  4GDN A;  4ZDX A;  3UPO A;  2Y2H A;  3HLE A;  3BLS A;  5CEC A;  1VM1 A;  3UPN A;  1G6A A;  1EWZ A;  1JWV A;  4S2N C;  1K56 D;  4D2O A;  1W79 A;  3EQU A;  4QB8 A;  1L0E A;  1RGY A;  1ES5 A;  1BT5 A;  4DRT A;  4EBP A;  3S22 A;  5KSH A;  1KVM A;  4KZ7 A;  3IF6 C;  3ZFZ A;  3UDI A;  3IXH A;  3BYD A;  4JPM A;  5CGX A;  3ZG7 B;  1I5Q A;  1XXM A;  1SCW A;  4JF5 A;  4BD1 A;  4Y0T A;  5E43 A;  1BLC A;  1ERM A;  2HP5 A;  4OP5 A;  1K4E A;  2C5W B;  3OPH A;  1ZG6 A;  1I2S A;  4PM6 A;  1GHM A;  1L0D A;  1HVB A;  1RCJ A;  2XF3 A;  4KQR A;  4M3K A;  3C4O A;  4HBU A;  1IYS A;  1MPL A;  1KE4 A;  3CG5 A;  3JYI A;  2V20 A;  4CJN A;  2BG1 A;  1LI9 A;  4FSF A;  5BOH A;  4JF6 A;  5I94 A;  4BEN A;  2WYX A;  4QY5 A;  3PBR A;  1JVJ A;  4IVK A;  3FV7 A;  4P85 A;  3EQV A;  4UA9 A;  4R4R A;  4WMC D;  4X6T A;  3A3E A;  5DTT A;  5HL1 A;  1NYM A;  2ZC3 B;  3OPL A;  4P6B A;  4Y0O A;  4R1G A;  4O7D A;  2XD1 A;  4DE0 A;  4FD8 A;  5E2H A;  5EVI D;  1CEG A;  5EVI B;  1E25 A;  3WWX A;  1OME A;  1FR6 A;  1XP4 A;  3IXD A;  4H8R A;  4OH0 A;  4E3J A;  1SDE A;  2Y2N A;  3Q1F A;  4FH4 A;  1Y54 A;  5FAQ A;  4EV4 A;  3G2Y A;  4N1X A;  3ZG0 A;  1E3U A;  5TR7 A;  5M1A A;  2Y2O A;  4MLL A;  3VSL A;  4LV2 A;  1ERO A;  1NJ4 A;  3GR2 A;  2H0T A;  1FCN A;  3HVF A;  5IHV A;  3IH9 A;  4WZ5 C;  5EPH A;  4B4X A;  4S2K A;  4ZAM A;  4ID4 A;  2X02 A;  1PWC A;  1PIO A;  3G4P A;  3HLB A;  2VGK A;  1W7F A;  2BLS A;  4OLD A;  5CHU A;  5JYP A;  1YLP A;  3RJU A;  3RXX A;  5FI6 A;  5FAO A;  2J7V A;  4IED A;  3D4F A;  3N8S A;  3V3R A;  4DE1 A;  3TOI A;  3ZVW A;  1FOF A;  4LV3 A;  4R3J A;  1IKG A;  4Q8I A;  2PU2 A;  3N7W A;  2IWD A;  1ES2 A;  2Y2G A;  5EVI C;  5JYO A;  3P09 A;  1KDS A;  2EXA A;  4BJP A;  3GMW A;  3GTC A;  4MBF A;  1WYB A;  2XR0 A;  5CGW A;  4OON A;  5AQB A;  3B3X A;  4WEK A;  4LEN A;  3Q7V B;  1ONG A;  4RVA A;  1MXO A;  4RA7 A;  4U0X A;  5E2E A;  4ZTK A;  1NY0 A;  3WS5 A;  1W5D A;  2A3U A;  2R9X A;  2XEP A;  1FR1 A;  1YT4 A;  3RXW A;  2EX6 A;  2C6W B;  1MY8 A;  5AQ9 A;  4C3Q A;  2ZQ9 A;  1LLB A;  3LCE A;  1TVF A;  4GKU A;  5CHJ A;  5GLC A;  2Y4A A;  1KVL A;  3FWL A;  5FQM A;  2QPN A;  2Y91 A;  3V50 A;  1I2W A;  3PAE A;  4JBF A;  3I7J A;  3SH8 A;  1RGZ A;  1PYY A;  2GDN A;  1ES4 A;  5DF8 A;  5EUA A;  4K91 A;  4S2M A;  3WRZ A;  3VSK A;  3O86 A;  1BUL A;  4OVD A;  5HAR A;  4OP8 A;  4WM9 A;  1H8Y A;  2OLV A;  3UDX A;  3WS1 A;  1CK3 A;  1TEM A;  1N9B A;  4YFM A;  3NDG A;  1JTD A;  2FFF B;  1XA1 A;  4U0T A;  1JWZ A;  5FQI A;  4GDB A;  4GB7 A;  1PZO A;  3WRT A;  2UWX A;  5CEB A;  3HLC A;  2XD5 A;  5U47 A;  3IQA A;  5KMW A;  3MZE A;  4N1H A;  2WGW A;  4NK3 A;  4PM5 A;  3BFG A;  4K0W A;  1BUE A;  2Y55 A;  1ESU A;  1YMS A;  3IF6 A;  4PM8 A;  5FSR A;  5F82 A;  3VP0 A;  1SDN A;  2EX9 A;  4KZA A;  3BFE A;  2R9W A;  3FZC A;  2P9V B;  2ZQC A;  4OOM A;  3GVB A;  5E2G A;  4X56 A;  2PU4 A;  5A93 A;  1ALQ A;  1BSG A;  3HUN A;  1JTG A;  1L0F A;  3UE1 A;  4IBX A;  4JXS A;  2XDM A;  4NET A;  1GHI A;  2DCF A;  4JXV A;  4DXB A;  3BRM A;  3IH8 A;  3UY6 A;  3SS3 A;  1IEL A;  5FI2 A;  2P74 A;  3W4Q A;  2G2U A;  3BFD A;  3HBR A;  4E3L A;  3ZGA B;  2IWB A;  3DWK A;  1CI8 A;  4KG6 A;  2EFU A;  3HL9 A;  5CGS A;  1ONH A;  5F1G A;  3TG9 A;  1SKF A;  4HEF A;  4GZB A;  4OPQ A;  5L2F A;  4KEN B;  3VFH A;  2Y59 A;  4N92 A;  2WKI A;  3UNW A;  4BLM A;  4BQM A;  1NXY A;  4R23 A;  5HFO A;  2ZC5 B;  1K6R A;  3IHA A;  3P98 A;  4A5R A;  2X01 A;  2EXB A;  2ZC4 B;  4E3M A;  1DJC A;  2ZQD A;  2I72 A;  4OQG A;  3VP2 A;  1K55 C;  2CC1 A;  3ITA A;  2ZM0 A;  3G31 A;  4ZJ1 A;  5M19 A;  2J8Y A;  5GL9 A;  3GSG A;  3MZD A;  5HX9 A;  1GA0 A;  2B5R A;  1FSY A;  1U60 A;  2WUQ A;  3PAG A;  4MNR A;  4WZ5 A;  4OOY A;  3ITB A;  4ZJ3 A;  2ZM2 A;  4PPR A;  4QY6 A;  2WK0 A;  5CXW A;  1Q2P A;  2J9O A;  1K4F A;  1S6R A;  4GN2 A;  3G34 A;  1O07 A;  2HDU A;  2ZM8 A;  3QHY A;  5HW3 A;  1XX2 A;  2HP6 A;  2A49 A;  1LI0 A;  4RX3 A;  4U3T A;  5FQ9 A;  1PZP A;  4Z9Q A;  5TFQ A;  2Y2M A;  4KZ4 A;  1IYQ A;  1YLT A;  2Z2M B;  4GD6 A;  1RP5 A;  5FAS A;  2ZJ9 A;  5E2F A;  3SH7 A;  3UE3 A;  4B4Z A;  4KZB A;  3BEC A;  1E3U D;  2WZX A;  3M6H A;  1GA9 A;  4DE2 A;  3GQZ A;  3UN7 A;  3C7U A;  3LY3 A;  4P87 A;  5D3O A;  3GRJ A;  4DF6 A;  4EBL A;  1MBL A;  1NZU A;  3VFF A;  4PM7 A;  3NIA A;  2WGI A;  1J9M A;  5EEC A;  4B88 A;  4JF4 A;  4JXW A;  4X69 A;  1NYY A;  3M2J A;  1ES3 A;  1XGJ A;  3OCN A;  4RX2 A;  4N9L A;  1YMX A;  2Q9M A;  3O3V A;  4KZ9 A;  5GLD A;  4EWF A;  2WAF A;  4GNU A;  4KZ5 A;  3N8L A;  2H0Y A;  3N8R A;  4MBK A;  3A3F A;  3WS4 A;  4QJG A;  4CPK A;  3HLG A;  1BZA A;  2JE5 A;  1ZC2 A;  2XLN A;  3PBS A;  1KGG A;  5DF7 A;  3Q82 A;  1ERQ A;  1G68 A;  2Y2Q A;  3G30 A;  1XGI A;  3VP3 A;  2H5S A;  3FKV A;  1H8Z A;  2G2W A;  3WS0 A;  1MKI A;  1IKI A;  2RCX A;  4C75 A;  5A91 A;  3HLD A;  1VQQ A;  2WKH A;  1K54 A;  3OZH A;  2ZMA A;  4OQI A;  3E2K A;  3MXS A;  3ZG9 B;  3IXG A;  3C7V A;  1N4O A;  4XUZ A;  3NBL A;  3UO9 A;  1IYP A;  3Q07 A;  5CTN A;  2XFS A;  3HUM A;  3ZNY A;  5EOE A;  5HAQ A;  3LEZ A;  1NRF A;  1HD8 A;  4JKT A;  1CI9 A;  1KE0 A;  5FA7 A;  5FQJ A;  4KQQ A;  2HDR A;  3IWO A;  3A3J A;  4ZJ2 A;  3AGE A;  2WAE A;  4OLG A;  4E3O A;  4S2N A;  2ZC7 A;  1FQG A;  3WS2 A;  4BL3 A;  2XFT A;  4XXR A;  5G18 A;  3NDE A;  1DY6 A;  3ZHH A;  5HAP A;  3O87 A;  4K0X A;  4MEZ A;  1K57 C;  1LL9 A;  4FCF A;  1FCO A;  4LV0 A;  4EQI A;  4ZBE A;  4OPR A;  1BLP A;  5M18 A;  4DDS A;  1IYO A;  3AGD A;  4JLF A;  5DF9 A;  2WGW B;  2QZ6 A;  3SS4 A;  1XPB A;  3VP4 A;  3E2L A;  4OPZ A;  3IF6 B;  4L0L A;  3VMA A;  1YQS A;  1YLJ A;  4UA6 A;  1LL5 A;  4HBT A;  5FI7 A;  4EUZ A;  1KE3 A;  1LHY A;  1TDL A;  2ZQ7 A;  3LY4 A;  1E4D A;  5FAP A;  3C5A A;  2HPB A;  1K55 A;  2PBY A;  1PW8 A;  1W8Y A;  3QNB A;  2ZD8 A;  4Y7P A;  1DJB A;  3OCL A;  4DE3 A;  3VOY A;  3TSG A;  1FCM A;  2DRW A;  2OV5 A;  2XH9 A;  3G2Z A;  4IVI A;  3MKE A;  5A92 A;  1H5X A;  4LV1 A;  3ZDJ A;  1EI5 A;  5GHX A;  3AGF A;  1K56 A;  3HUO A;  4WYY A;  5FQK A;  3SH9 A;  4WBG A;  4KG2 A;  4S2J A;  1SHV A;  3DTM A;  4EBN A;  3CMZ A;  2JBF A;  3N4I A;  3FKW A;  4LCM A;  4BL2 A;  2HDS A;  3SOI A;  1DJA A;  1GCE A;  1C3B A;  2J9P A;  1Z6F A;  2QMI A;  5CTM A;  4UA7 A;  5EE8 A;  5GHZ A;  1QMF A;  1Q2Q A;  4R3B A;  5CER A;  3MKF A;  4PM9 A;  3IHB A;  4KZ6 A;  5FQQ A;  1YM1 A;  3PBT A;  3ZNT A;  3OPP A;  3QNC A;  1CEF A;  1K38 A;  4RYE A;  4E6W A;  4HES A;  4S2O A;  3N6I A;  4F94 A;  3NY4 A;  5GHY A;  4OKP A;  2X71 A;  2ZLY A;  3M6B A;  4X53 A;  1PI5 A;  3CJM A;  2IWC A;  4FH2 A;  4GD8 A;  2ZQA A;  2WAD A;  2XK1 A;  3V39 A;  4WEL A;  1QME A;  4WMC A;  3PBQ A;  3PBO A;  1XKZ A;  1GHP A;  3BFC A;  5J8X A;  3ISG A;  2H10 A;  1BLH A;  4OQ0 A;  1PW1 A;  4E3K A;  3C4P A;  1K25 A;  3BFF A;  5EVI A;  4OPY A;  1KGE A;  3PBN A;  1TDG A;  3A3I A;  4YIN A;  3HRE A;  3MFD A;  4UHU A;  3BM6 A;  3GV9 A;  4P0M A;  5GLB A;  5DTS A;  3HLF A;  2FFY A;  2OSU A;  1S0W A;  2DNS A;  2JCH A;  2WZZ A;  3LO7 A;  4XUX A;  4QHC A;  3Q7Z A;  3VOZ A;  5KSC A;  1ESI A;  4OOL A;  2E8I A;  3IT9 A;  3V3S A;  3NI9 A;  1M40 A;  1HZO A;  3HLW A;  4N9K A;  4KG5 A;  5A90 A;  2JC7 A;  3NCK A;  5DVA A;  5F1F A;  1AXB A;  5CHM A;  3FYZ A;  2Y2K A;  4Y0U A;  4QD4 A;  5CED A;  3UDF A;  4WEJ A;  4PMA A;  2WKE A;  1WYC A;  3V5M A;  1IEM A;  5GLA A;  1K6S A;  4X55 A;  1PWG A;  3S1Y A;  1BLS A;  3ZG5 A;  4BD0 A;  2ZC6 B;  4LCL A;  3Q81 A;  2Y2P A;  1O7E A;  5FAT A;  1W8Q A;  2WGV A;  3BEB A;  4DKI A;  1KGF A;  1L2S A;  1L0G A;  3W8K A;  4E6X A;  1K57 A;  5EVL A;  5CRF A;  3SS5 A;  2Y2I A;  3ZG8 B;  5EOO A;  4R4S A;  1YLZ A;  2EX2 A;  3Q7V A;  4X68 A;  3W4P A;  2Z2L B;  2ZQ8 A;  3UPP A;  2Y2L A;  4UAA A; 
#chains in the Genus database with same CATH topology
 1MZU A;  3IXB A;  1NZO A;  2ZMF A;  4WUJ A;  4EEP A;  2K31 A;  3NOU C;  3NC8 A;  1EW0 A;  1P97 A;  1JWP A;  2EWW A;  3VP1 A;  2BTF P;  3IWQ A;  5FDH A;  4Y17 A;  2HP9 A;  2V1Z A;  3LIC A;  3IWI A;  1OPX A;  3IF5 A;  3OC2 A;  3DW0 A;  4DDY A;  4S2L A;  2XGN A;  3NJA A;  4KZ3 A;  3IS2 B;  1GSW A;  4Y5F A;  2GX5 A;  1MWR A;  4IBR A;  4KQO A;  4R0Q A;  4WZ4 A;  1PWD A;  2Q9N A;  2V2F F;  3O88 A;  1WE4 A;  4Y3I A;  4MBH A;  3UE0 A;  3MBZ A;  2HGV A;  5CEC A;  3MQ0 A;  4XT2 A;  4D2O A;  4QB8 A;  3DTE A;  1BT5 A;  2ZL1 B;  4DRT A;  5KSH A;  4KZ7 A;  3IF6 C;  3IXH A;  3BYD A;  3MJQ A;  4BD1 A;  2K2N A;  4Y0T A;  4OP5 A;  1K4E A;  2PDR A;  4M3K A;  2XF3 A;  4KQR A;  5DFY A;  2O9B A;  1H0M A;  4JF6 A;  3B47 A;  4QY5 A;  4X6T A;  1PFL A;  1NYM A;  3OPL A;  4P6B A;  4Y0O A;  3EEA A;  2XD1 A;  5E2H A;  2XA7 S;  3WWX A;  4BBU A;  2KLI A;  5DJT A;  1Y54 A;  1E3U A;  1ERO A;  3HVF A;  4WZ5 C;  5EPH A;  1PWC A;  3G4P A;  5CHU A;  3CUE A;  1YLP A;  3RJU A;  1Y28 A;  5FAO A;  4IED A;  3V3R A;  3ZVW A;  1IKG A;  4UQI M;  1ES2 A;  4Q0J A;  2Y2G A;  2VK3 A;  5EVI C;  2EXA A;  1K0K A;  3GTC A;  4MBF A;  1WYB A;  2Q0O A;  4OON A;  4WEK A;  3Q7V B;  5E2E A;  5HWT A;  3WS5 A;  4RA7 A;  1OJ5 A;  5FEF A;  2JKT I;  2YKF A;  3UB6 A;  5AQ9 A;  4C3Q A;  1KVL A;  2M1C A;  3PAE A;  4GLQ A;  3SH8 A;  3CWF A;  5IU1 A;  4QWO A;  5J4E A;  3PYP A;  3O86 A;  3UDX A;  1N9B A;  4YFM A;  4HP9 A;  3OLO A;  1JWZ A;  5FQI A;  4AFI A;  2XD5 A;  4N1H A;  4NK3 A;  3QP4 A;  2R9W A;  4P6Z S;  3RFB A;  5HDC A;  3HCY A;  4X56 A;  5DJU A;  1ALQ A;  3UE1 A;  5EV0 A;  3S7O A;  4IBX A;  2KDK A;  3MF0 A;  1GHI A;  2GJ3 A;  2PD7 A;  3IX8 A;  3UY6 A;  4Z1W A;  2P74 A;  3W4Q A;  2G2U A;  2W1T A;  3BFD A;  3BY8 A;  4E3L A;  4KG6 A;  5F1G A;  1ONH A;  3CPT B;  1G28 A;  3D72 A;  5HDS A;  3VFH A;  2Y59 A;  5HFO A;  3ZYT A;  3IHA A;  3P98 A;  3TJZ C;  1V9Y A;  2ZM0 A;  4ZJ1 A;  3GSG A;  3P7N A;  2ZM2 A;  1IFQ A;  4JGO A;  1S6R A;  3QHY A;  4ESP A;  2HP6 A;  3OBF A;  4RX3 A;  2CMN A;  1PZP A;  4Z9Q A;  5TFQ A;  3K2N A;  4EU0 A;  1RP5 A;  3UE3 A;  5HDD A;  3FG8 A;  2W3D A;  4CLC E;  3LYX A;  3R4K A;  4ZRR A;  4GCZ A;  3LY3 A;  4P87 A;  1OJG A;  4DF6 A;  2VX8 A;  1MBL A;  1S4S A;  3NIA A;  5EEC A;  1D1J A;  1J9M A;  4JF4 A;  3M2J A;  1ES3 A;  3KSI A;  3OCN A;  5F6A A;  4GNU A;  3N8R A;  4MBK A;  4QJG A;  4CPK A;  3HLG A;  1ZC2 A;  2XLN A;  3PBS A;  1KGG A;  2Y2Q A;  1G68 A;  5L09 A;  5A91 A;  3S7N A;  1K54 A;  3IXG A;  5HSQ A;  5EFW A;  3NBL A;  3R7W A;  3HUM A;  3ZNY A;  5FA7 A;  4FUW A;  1KE0 A;  4MN6 A;  3CUE C;  3A3J A;  1FQG A;  3TE8 A;  3WS2 A;  4BL3 A;  2XFT A;  3EGD C;  4XXR A;  1DY6 A;  5EM1 A;  3LIE A;  3O87 A;  1K57 C;  1XJ4 A;  4OPR A;  5DFX A;  4DDS A;  5DF9 A;  2WGW B;  1LSX A;  3T4Q A;  3JVU A;  4L0L A;  2M7U A;  4EUZ A;  3F1O B;  1TDL A;  1E4D A;  3C5A A;  4L9F A;  1W8Y A;  2ZD8 A;  4DE3 A;  2JKR M;  3G2Z A;  3MKE A;  4HY8 A;  5A92 A;  1EI5 A;  2PBD P;  5FQK A;  1P0Z A;  1BYW A;  4EBN A;  3K3D A;  2JBF A;  3FKW A;  1X0O A;  5HZH A;  1Z6F A;  5GHZ A;  1QMF A;  5HD3 A;  5CER A;  1YSP A;  3MKF A;  1T1B A;  5FQQ A;  1YM1 A;  3PBT A;  1OT6 A;  1D7E A;  4E6W A;  4HES A;  5GHY A;  2QKP A;  3UB8 A;  2XRO A;  1PI5 A;  3H82 A;  4WF0 A;  3CJM A;  2IWC A;  3KX0 X;  3DTK A;  5HPI A;  3V39 A;  4WEL A;  2VV7 A;  2VJW A;  1Z09 A;  1BLH A;  4OQ0 A;  4E3K A;  1K25 A;  3BFF A;  4GW9 A;  3CAX A;  3PBN A;  3H7W A;  3PR6 A;  4UHU A;  4CLC A;  5A8B A;  3GV9 A;  3QP2 A;  1Y4O A;  3LIF A;  2DNS A;  4XUX A;  2WZZ A;  3BY9 A;  3IT9 A;  3NI9 A;  1M40 A;  3HLW A;  4KG5 A;  5A90 A;  4GHI A;  1AXB A;  1W63 Q;  2UV0 E;  2Y2K A;  5CED A;  1WYC A;  2K7S A;  3ZQ5 A;  3CHW P;  1PWG A;  1BLS A;  3ZG5 A;  1PRQ A;  1GSX A;  2ZC6 B;  4LCL A;  3E4Q A;  2WGV A;  3MQO A;  4MMN A;  4E6X A;  4R4S A;  4JGP A;  2Y2L A;  1AWI A;  3M2K A;  3ZCZ A;  3BLM A;  5AVF A;  2EFX A;  2VGJ A;  5L8M A;  1DRM A;  4QU3 A;  5AVE A;  3A3D A;  1ZG4 A;  2RL3 A;  4JXG A;  2XQZ A;  1JNU A;  3IBJ A;  1ZKJ A;  2Y2J A;  3RTY A;  2ZOI A;  3G32 A;  4ME4 A;  3B42 A;  1VET B;  4RQ9 A;  1K54 C;  1M6K A;  1KDW A;  2J3W A;  4E3N A;  1G5U A;  3G35 A;  3MXR A;  4E3I A;  1FSW A;  1VEU B;  2HDQ A;  1YLW A;  2OLU A;  3ZVT A;  1LL8 A;  1T19 A;  2PAV P;  2Y2H A;  3BLS A;  1CF0 A;  2EWV A;  3NEC A;  1G6A A;  4HJ4 A;  1L0E A;  3QP6 A;  3EOI A;  3ZFZ A;  1S67 L;  3UDI A;  3D3O A;  3L9K A;  3P01 A;  4JF5 A;  2BAS A;  2C5W B;  4PM6 A;  1ZG6 A;  1GHM A;  1RCJ A;  1HVB A;  4DJ3 A;  2HJ9 C;  2Y79 A;  5L10 A;  1IOU A;  1MPL A;  4IJG A;  1DP6 A;  4CJN A;  2BG1 A;  1LI9 A;  4PHT A;  5BOH A;  5I94 A;  4BEN A;  2W3E A;  3EQV A;  4WMC D;  2ZC3 B;  4F3L A;  2W3G A;  3SZT A;  4GS9 A;  4QPR A;  5EVI D;  1CEG A;  5EVI B;  1G6O A;  1E25 A;  4G3V A;  1OME A;  3IXD A;  4R3A A;  3Q1F A;  2Y2N A;  5FAQ A;  1S1Z A;  1NJ4 A;  2FZ0 A;  2H0T A;  1LSW A;  2WKP A;  2AVX A;  3TRC A;  2E8J A;  1XJ2 A;  3QP1 A;  2X02 A;  3MR0 A;  1PIO A;  4NXG A;  5FI6 A;  2PD8 A;  4DE1 A;  2KOI A;  1TS6 A;  4Q8I A;  5DKK A;  1FIK A;  3N7W A;  2VGL M;  4O8G A;  4Y13 A;  3UB7 A;  3T1R A;  5JYO A;  3P09 A;  3T4K A;  4BJP A;  1T1A A;  3LUQ A;  1F5M A;  4LEN A;  4RVA A;  1W5D A;  2R9X A;  2L0W A;  3TW8 A;  3A0R A;  1YT4 A;  1F9I A;  4EW7 A;  1TVF A;  4GKU A;  2Y4A A;  3FWL A;  4UEY A;  5FQM A;  2QPN A;  3I7J A;  2ZOH A;  3IBR A;  1PYY A;  5EUA A;  4S2M A;  3WRZ A;  3JVV A;  5HAR A;  5HWW A;  1H8Y A;  2W1R A;  3NDG A;  3KSF A;  3VE4 A;  4U0T A;  3UMD A;  2V8C A;  4GB7 A;  5IT5 A;  2UWX A;  2WKQ A;  5CEB A;  3HLC A;  3S7P A;  2QYB A;  3D9Y A;  3BFG A;  2Y55 A;  5K5B A;  1YMS A;  4NXB A;  4LPZ A;  5F82 A;  2V8F A;  1SDN A;  2EX9 A;  4KZA A;  3KYZ A;  3BFE A;  4OOM A;  2PU4 A;  5FL3 A;  3HUN A;  4JXV A;  4DXB A;  3BRM A;  4XT2 B;  3DWK A;  1CI8 A;  3HL9 A;  1SKF A;  1A0K A;  4GZB A;  2JKG A;  5L2F A;  4KEN B;  4WLA A;  1XFN A;  3IX4 A;  1NWZ A;  2WKI A;  4LFU A;  1NXY A;  1K6R A;  4A5R A;  2X01 A;  1N9O A;  2ZL1 A;  2ZC4 B;  2I72 A;  2V9A A;  4UQI S;  2XRN A;  3LID A;  5M19 A;  5GL9 A;  3MZD A;  2B5R A;  1U60 A;  3PAG A;  2B95 A;  4OOY A;  3ITB A;  2ZM8 A;  2A49 A;  5FQ9 A;  4KZ4 A;  1YLT A;  4HOI A;  3MQQ A;  2HV1 A;  2V1A A;  4MN5 A;  3V67 A;  3HJK A;  1E3U D;  2WZX A;  3K3C A;  3E0Y A;  5D3O A;  2KX6 A;  4B88 A;  4JXW A;  3C38 A;  4X69 A;  1XGJ A;  4N9L A;  5L07 A;  3O3V A;  5GLD A;  2H0Y A;  3LR3 A;  2JE5 A;  4IUK A;  1S1Y A;  5DF7 A;  2W0N A;  2H5S A;  1H8Z A;  3T4O A;  3DTI A;  1MKI A;  4C75 A;  1VQQ A;  3OZH A;  4OQI A;  4I3I A;  3E2K A;  1N4O A;  4XUZ A;  2VV8 A;  1DP8 A;  3UE6 A;  5HAQ A;  4JKT A;  3MFX A;  3IWO A;  3AGE A;  4I39 A;  4E3O A;  4PAU A;  2ZC7 A;  3ZHH A;  1ACF A;  4MEZ A;  2HF6 A;  1LL9 A;  4EQI A;  1FCO A;  5M18 A;  1XPB A;  2JKT M;  3E2L A;  4OPZ A;  3GDI A;  2PHY A;  1LL5 A;  2PYR A;  4HBT A;  2L4R A;  1H8M A;  2ZQ7 A;  2HPB A;  1K55 A;  4KQD A;  1T1C A;  3QNB A;  2MJ6 A;  3VOY A;  3TSG A;  1FCM A;  1XFQ A;  2XH9 A;  1S66 L;  2VA0 A;  1OTA A;  4LV1 A;  2W1T B;  3AGF A;  1K56 A;  4WYY A;  4ARZ B;  4Q0I A;  2HDS A;  3SOI A;  1DJA A;  2INW A;  1C3B A;  5EE8 A;  4DJ2 A;  4UA7 A;  4R3B A;  1LT0 A;  4EEU A;  3QNC A;  2W3F A;  2H28 A;  3NY4 A;  2ZLY A;  1XJ3 A;  4GD8 A;  4FH2 A;  2V1B A;  3PBO A;  1XKZ A;  3ISG A;  3T12 B;  4BBT A;  2H10 A;  2OAQ 1;  4HH2 A;  1J3W A;  1KGE A;  1W63 M;  1MC0 A;  4YIN A;  3MFD A;  3BM6 A;  4P0M A;  5AJG A;  3HLF A;  2QHK A;  2OAP 1;  4QHC A;  3Q7Z A;  4FTX A;  3T4L A;  3V3S A;  5HWV A;  2JC7 A;  3NCK A;  5F1F A;  3FYZ A;  1HLU P;  4L9E A;  4PMA A;  2WKE A;  2YKH A;  3MMH A;  3C8C A;  3V5M A;  3EWK A;  5GLA A;  5TBM B;  4K08 A;  5J3W A;  4I3A A;  2EA9 A;  2Y2P A;  1O7E A;  3SS5 A;  2VEA A;  5EOO A;  2D02 A;  5FDS A;  4X68 A;  4R70 A;  2ZQ8 A;  2VLG A;  3UPP A;  3PTE A;  3S4X A;  3W4O A;  3R7W B;  1V9Z A;  1PI4 A;  5AQA A;  1HTZ A;  4EUV A;  4L9G A;  3LGO A;  5KZH A;  4DXC A;  2JKR I;  5IS1 A;  1SKO B;  4EET B;  5DTK A;  2PRF A;  3CZD A;  2P9V A;  1LSV A;  4OQH A;  3IX3 A;  1MWS A;  4ZDX A;  4DMZ A;  1OT9 A;  1VM1 A;  2V0W A;  3PHY A;  1P9R A;  1EWZ A;  5I5L A;  3UPN A;  3UME A;  1W79 A;  3EQU A;  4WN5 A;  1RGY A;  3FC7 A;  4NG2 A;  1I5Q A;  3QP5 A;  4DN0 A;  1SCW A;  4YWZ A;  4PM5 A;  1I2S A;  1L0D A;  3C4O A;  1WA9 A;  1IYS A;  1KE4 A;  3CG5 A;  3H82 B;  4MN7 A;  4FSF A;  2WYX A;  3PBR A;  1JVJ A;  4IVK A;  3FV7 A;  4P85 A;  4G3K A;  5EVE A;  4O7D A;  4DE0 A;  4FD8 A;  3A0V A;  3H7W B;  4CLC D;  2QWS A;  4N1X A;  2A24 A;  5TR7 A;  3U2A A;  5M1A A;  3VSL A;  4LV2 A;  1OTI A;  1TS8 A;  3SW1 A;  1FCN A;  5IHV A;  3IH9 A;  3F1P A;  1YAX A;  4GHI B;  4BWI A;  4E04 A;  4R6L A;  3F1N B;  1GSV A;  2VGK A;  1W7F A;  2BLS A;  4OLD A;  5JYP A;  3H9W A;  4FOF A;  5G4Y A;  2VZW A;  2PYP A;  2PU2 A;  3BW6 A;  3LR5 A;  4GJ4 A;  4JGQ A;  2O9A A;  4R38 A;  1KDS A;  3GMW A;  2XR0 A;  5AQB A;  3B3X A;  1ONG A;  1MXO A;  1NY0 A;  3VOL A;  2XEP A;  1FR1 A;  2C6W B;  1MY8 A;  2VV6 A;  1LLB A;  5CHJ A;  1I2W A;  4JBF A;  1ES4 A;  3VSK A;  1BUL A;  2Z6C A;  3UB5 P;  1STZ A;  1TEM A;  2FFF B;  4GDB A;  4H6J A;  3WRT A;  1F2K A;  3IQA A;  3MZE A;  1VHM A;  5F5Y A;  3CLO A;  4K0W A;  1BUE A;  3IF6 A;  5FSR A;  3FZC A;  5A93 A;  3FPV A;  2XDM A;  3IH8 A;  2NUT C;  4X1L A;  1IEL A;  5FI2 A;  2WKR A;  4O0P A;  5CGS A;  4HEF A;  3HJI A;  2I9V A;  2D01 A;  4N92 A;  3UNW A;  4BQM A;  4NXE A;  2ZC5 B;  2VGL S;  2EXB A;  4E3M A;  4OQG A;  2J8Y A;  4WZ5 A;  1FSY A;  2WUQ A;  2JKF A;  1L3L A;  4PPR A;  2WK0 A;  1Q2P A;  2J9O A;  1K4F A;  2OOL A;  1T18 A;  5HW3 A;  1XX2 A;  4F3L B;  4GS9 B;  4U3T A;  3PXP A;  2Z2M B;  2QJ7 A;  3SH7 A;  4B4Z A;  4G3W A;  1CJF A;  1NLY A;  2JN7 A;  1CQA A;  3BEC A;  4EBL A;  1NZU A;  4PM7 A;  1NYY A;  4BMW A;  4RX2 A;  2P7J A;  2Q9M A;  4HJ6 A;  4NXF A;  4KZ5 A;  4EES A;  1BZA A;  2P08 A;  2PT7 A;  3Q82 A;  1ERQ A;  3G30 A;  1XGI A;  4CLC C;  4LRY C;  3FKV A;  2G2W A;  1IKI A;  2Z6D A;  2LB9 A;  2ZMA A;  3MXS A;  1F98 A;  3MS6 A;  3UO9 A;  1IYP A;  5EOE A;  3LEZ A;  1NRF A;  3CI6 A;  1HD8 A;  1CI9 A;  5FQJ A;  3T4T A;  2HDR A;  3W2Z A;  2WAE A;  4OLG A;  4S2N A;  1NLZ A;  3OOV A;  3L7H A;  5G18 A;  3T4S A;  1UWP X;  4LV0 A;  4ZBE A;  1N9L A;  1BLP A;  3BQ8 A;  2Y8H A;  4ETX A;  1IYO A;  3AGD A;  3IS2 A;  5TJJ A;  2PR6 A;  1YQS A;  4I38 A;  4UA6 A;  5FI7 A;  1VB6 A;  1KE3 A;  1LHY A;  2B18 A;  3LY4 A;  1NRJ A;  5FAP A;  2PBY A;  2O0Y A;  1PW8 A;  4Y7P A;  1DJB A;  3OCL A;  4WL9 A;  4HIA A;  1H5X A;  3VV4 A;  3ZDJ A;  5GHX A;  3NOT C;  5J7E A;  4WBG A;  4S2J A;  3CMZ A;  2DMW A;  3N4I A;  5DKL A;  5CTM A;  1GCE A;  2J9P A;  2IWB A;  3A0S A;  1Q2Q A;  3NOP C;  5CX7 A;  2OWH A;  3OPP A;  1CEF A;  5HPF A;  4S2O A;  3N6I A;  4OKP A;  2X71 A;  3M6B A;  3T1Q B;  4MCW A;  3LIA A;  1OTB A;  2WAD A;  2XK1 A;  3PBQ A;  1TS0 A;  2ZMV A;  3BFC A;  4I3J A;  5J8X A;  4KUK A;  1PW1 A;  2O9C A;  1N9N A;  4OPY A;  1TDG A;  3NUL A;  5GLB A;  5DTS A;  2FFY A;  2OSU A;  1S0W A;  2JCH A;  3LO7 A;  3VOZ A;  3LI9 A;  1ESI A;  4OOL A;  4N9K A;  2GNX A;  4Q0H A;  5CHM A;  4Y0U A;  4QD4 A;  1MKM A;  4Y2F A;  4X55 A;  3DAV A;  3S1Y A;  4JGR A;  3Q81 A;  5FAT A;  4DKI A;  1KGF A;  1L2S A;  1L0G A;  1K57 A;  2Y2I A;  1YLZ A;  2EX2 A;  3Q7V A;  2Z2L B;  4UAA A;  4GOG A;  3RH8 B;  1YLY A;  1MWU A;  1ZTU A;  5HAI A;  2B02 A;  3E4O A;  2XA7 M;  3OPR A;  5FEG A;  4X1M A;  5AQ7 A;  1ZHH B;  1BTL A;  3T50 A;  3DWZ A;  1MWT A;  2R78 A;  3LIB A;  2W27 A;  4C6Y A;  1XA7 A;  2VKS A;  4S2P A;  5TGF A;  3LFV A;  2PR5 A;  3EGX C;  3MZF A;  3MXQ A;  2J80 A;  4HQA A;  4O01 A;  5F83 A;  3ULF A;  3VE3 A;  4KZ8 A;  4CQH A;  3JPU A;  4S2I A;  2EX8 A;  4GDN A;  3UPO A;  3HLE A;  1OTE A;  2JHE A;  1JWV A;  4S2N C;  1K56 D;  1KOU A;  3C2W A;  3CPT A;  1YPR A;  1ES5 A;  3ICY A;  4EBP A;  3S22 A;  1KVM A;  4JPM A;  5CGX A;  3ZG7 B;  1XXM A;  5LBR A;  5E43 A;  1BLC A;  1ERM A;  2HP5 A;  4ARZ A;  3OPH A;  4LLO B;  4HBU A;  4EQ1 A;  3LI8 A;  3S7Q A;  3JYI A;  2G7U A;  2V20 A;  3LEQ A;  2LB5 A;  2IA2 A;  1DP9 A;  5KIZ A;  4UA9 A;  3ZGA B;  4R4R A;  5DTT A;  3A3E A;  5HL1 A;  3NHQ A;  4EER A;  1H3Q A;  4R1G A;  4P6Z M;  1FR6 A;  1XP4 A;  4OH0 A;  4H8R A;  4E3J A;  1SDE A;  3O5Y A;  4FH4 A;  1XJ6 A;  2FH5 A;  3G2Y A;  3ZG0 A;  3EEH A;  2Y2O A;  4MLL A;  3GR2 A;  3BWL A;  4B4X A;  2W3H A;  4S2K A;  4ZAM A;  4ID4 A;  3KSH A;  4HH3 A;  3HLB A;  5EM0 A;  3RXX A;  2J7V A;  3D4F A;  3N8S A;  1YKD A;  3TOI A;  1FOF A;  4LV3 A;  4R3J A;  2IWD A;  4D60 A;  4PKY A;  5TBM A;  4M4X A;  4HI4 A;  3DBA A;  3U4L P;  5CGW A;  2HJE A;  2GZA A;  4U0X A;  1S4R A;  4ZTK A;  4NEE D;  2A3U A;  3RXW A;  2EX6 A;  4EXO A;  3GEC A;  2ZQ9 A;  3LCE A;  5GLC A;  3V50 A;  2Y91 A;  2XSS A;  1RGZ A;  2GDN A;  5DF8 A;  4K91 A;  1D06 A;  4OP8 A;  2V0U A;  4WM9 A;  3T4J A;  2OLV A;  3WS1 A;  1CK3 A;  1UGU A;  1JTD A;  1XA1 A;  3B33 A;  1PZO A;  5F68 A;  4I5S A;  5U47 A;  3LR4 A;  5KMW A;  2WGW A;  2NUP C;  1ESU A;  5HD5 A;  4PM8 A;  3VP0 A;  1SKO A;  2P9V B;  2ZQC A;  3GVB A;  3F1O A;  3G6O A;  3BJN A;  5E2G A;  4B93 A;  1BSG A;  1JTG A;  1L0F A;  4JXS A;  4NET A;  5MC7 A;  2DCF A;  2HZ5 A;  3E4P A;  1FIL A;  3SS3 A;  3HBR A;  2P04 A;  2EFU A;  3TG9 A;  4OPQ A;  3C30 A;  4BLM A;  4R23 A;  1DJC A;  2ZQD A;  3VP2 A;  1K55 C;  2CC1 A;  3ITA A;  3G31 A;  4X25 A;  2QJ5 A;  4HHD A;  2O99 A;  5HX9 A;  1GA0 A;  5F69 A;  4MNR A;  4ZJ3 A;  4IUH A;  5C5K A;  4II7 A;  4QY6 A;  5CXW A;  4GN2 A;  4PKY G;  3G34 A;  3MSH A;  1O07 A;  2HDU A;  2ACG A;  1LI0 A;  4CLC B;  2Y2M A;  4Y15 A;  1IYQ A;  4GD6 A;  4HNB A;  5FAS A;  2ZJ9 A;  5E2F A;  4KZB A;  2ZBB A;  3QP8 A;  3UB9 A;  2A24 B;  4BBV A;  3M6H A;  1GA9 A;  4DE2 A;  4LRZ E;  3GQZ A;  3UN7 A;  3C7U A;  2J3T D;  3GRJ A;  3F1P B;  1YSQ A;  3VFF A;  2WGI A;  1YMX A;  4EWF A;  4KZ9 A;  2WAF A;  3N8L A;  3A3F A;  3WS4 A;  3F1N A;  3CIT A;  3VP3 A;  3WS0 A;  2RCX A;  3HLD A;  2WKH A;  5HL6 A;  3ZG9 B;  3C7V A;  4B9O A;  3Q07 A;  5CTN A;  2XFS A;  1SZV A;  4KQQ A;  4ZJ2 A;  2L1M A;  1TF1 A;  3KO6 A;  3NDE A;  5HAP A;  4K0X A;  4FCF A;  4H6J B;  4JLF A;  1TD5 A;  2QZ6 A;  3SS4 A;  3VP4 A;  1VET A;  3IF6 B;  1UWN X;  3VMA A;  1YLJ A;  2A2L A;  3KSG A;  1ODV A;  4YNR A;  1PNE A;  3BQA A;  1VEU A;  2DRW A;  2OV5 A;  4IVI A;  2M7V A;  1TS7 A;  3KYQ A;  4IHQ A;  3HUO A;  3SH9 A;  4KG2 A;  3T1S A;  1SHV A;  4LRX C;  3DTM A;  4ETZ A;  4BL2 A;  4LCM A;  2QMI A;  4PM9 A;  3IHB A;  4KZ6 A;  3ZNT A;  1K38 A;  4HP4 A;  4YOF A;  4RYE A;  4NKP A;  4F94 A;  4X53 A;  2ZQA A;  1QME A;  4WMC A;  1GHP A;  3C4P A;  5EVI A;  3T1X A;  3KYE A;  3A3I A;  4MDZ A;  3HRE A;  1P9W A;  3E98 A;  4HJ3 A;  5KSC A;  2E8I A;  1HZO A;  5DVA A;  3LR0 A;  3UDF A;  4LGW A;  4WEJ A;  1IEM A;  5G4Z A;  1K6S A;  3FPW A;  4KUO A;  4BD0 A;  2OWJ A;  1W8Q A;  3BEB A;  3W8K A;  1OTD A;  5CRF A;  3ZG8 B;  3W4P A;  2J3T C;  5EVL A;  4EV4 A;  4OVD A; 
#chains in the Genus database with same CATH homology
 3PTE A;  4GOG A;  3S4X A;  3IXB A;  1YLY A;  3W4O A;  1MWU A;  1NZO A;  3M2K A;  5HAI A;  3ZCZ A;  3BLM A;  3NC8 A;  3OPR A;  1PI4 A;  5AQA A;  1HTZ A;  2EFX A;  1JWP A;  5AQ7 A;  3VP1 A;  3IWQ A;  2VGJ A;  5FDH A;  4QU3 A;  2HP9 A;  1BTL A;  3A3D A;  2V1Z A;  3IWI A;  1ZG4 A;  3IF5 A;  3DWZ A;  1MWT A;  2RL3 A;  4JXG A;  5KZH A;  2XQZ A;  3OC2 A;  4DXC A;  3DW0 A;  1ZKJ A;  2Y2J A;  4C6Y A;  4S2L A;  4DDY A;  1XA7 A;  2XGN A;  4S2P A;  5TGF A;  4KZ3 A;  3G32 A;  1MWR A;  5DTK A;  1K54 C;  3MZF A;  1M6K A;  1KDW A;  4IBR A;  4KQO A;  4R0Q A;  4E3N A;  4WZ4 A;  1PWD A;  2Q9N A;  2P9V A;  3CZD A;  2V2F F;  5F83 A;  3O88 A;  1WE4 A;  4KZ8 A;  3G35 A;  3MXR A;  4MBH A;  4E3I A;  1FSW A;  4OQH A;  4S2I A;  3UE0 A;  2EX8 A;  2HDQ A;  1YLW A;  2OLU A;  3MBZ A;  3ZVT A;  1MWS A;  4GDN A;  4ZDX A;  3UPO A;  2Y2H A;  3HLE A;  3BLS A;  5CEC A;  1VM1 A;  3UPN A;  1G6A A;  1EWZ A;  1JWV A;  4S2N C;  1K56 D;  4D2O A;  1W79 A;  3EQU A;  4QB8 A;  1L0E A;  1RGY A;  1ES5 A;  1BT5 A;  4DRT A;  4EBP A;  3S22 A;  5KSH A;  1KVM A;  4KZ7 A;  3IF6 C;  3ZFZ A;  3UDI A;  3IXH A;  3BYD A;  4JPM A;  5CGX A;  3ZG7 B;  1I5Q A;  1XXM A;  1SCW A;  4JF5 A;  4BD1 A;  4Y0T A;  5E43 A;  1BLC A;  1ERM A;  2HP5 A;  4OP5 A;  1K4E A;  2C5W B;  3OPH A;  1ZG6 A;  1I2S A;  4PM6 A;  1GHM A;  1L0D A;  1HVB A;  1RCJ A;  2XF3 A;  4KQR A;  4M3K A;  3C4O A;  4HBU A;  1IYS A;  1MPL A;  1KE4 A;  3CG5 A;  3JYI A;  2V20 A;  4CJN A;  2BG1 A;  1LI9 A;  4FSF A;  5BOH A;  4JF6 A;  5I94 A;  4BEN A;  2WYX A;  4QY5 A;  3PBR A;  1JVJ A;  4IVK A;  3FV7 A;  4P85 A;  3EQV A;  4UA9 A;  4R4R A;  4WMC D;  4X6T A;  3A3E A;  5DTT A;  5HL1 A;  1NYM A;  2ZC3 B;  3OPL A;  4P6B A;  4Y0O A;  4R1G A;  4O7D A;  2XD1 A;  4DE0 A;  4FD8 A;  5E2H A;  5EVI D;  1CEG A;  5EVI B;  1E25 A;  3WWX A;  1OME A;  1FR6 A;  1XP4 A;  3IXD A;  4H8R A;  4OH0 A;  4E3J A;  1SDE A;  2Y2N A;  3Q1F A;  4FH4 A;  1Y54 A;  5FAQ A;  4EV4 A;  3G2Y A;  4N1X A;  3ZG0 A;  1E3U A;  5TR7 A;  5M1A A;  2Y2O A;  4MLL A;  3VSL A;  4LV2 A;  1ERO A;  1NJ4 A;  3GR2 A;  2H0T A;  1FCN A;  3HVF A;  5IHV A;  3IH9 A;  4WZ5 C;  5EPH A;  4B4X A;  4S2K A;  4ZAM A;  4ID4 A;  2X02 A;  1PWC A;  1PIO A;  3G4P A;  3HLB A;  2VGK A;  1W7F A;  2BLS A;  4OLD A;  5CHU A;  5JYP A;  1YLP A;  3RJU A;  3RXX A;  5FI6 A;  5FAO A;  2J7V A;  4IED A;  3D4F A;  3N8S A;  3V3R A;  4DE1 A;  3TOI A;  3ZVW A;  1FOF A;  4LV3 A;  4R3J A;  1IKG A;  4Q8I A;  2PU2 A;  3N7W A;  2IWD A;  1ES2 A;  2Y2G A;  5EVI C;  5JYO A;  3P09 A;  1KDS A;  2EXA A;  4BJP A;  3GMW A;  3GTC A;  4MBF A;  1WYB A;  2XR0 A;  5CGW A;  4OON A;  5AQB A;  3B3X A;  4WEK A;  4LEN A;  3Q7V B;  1ONG A;  4RVA A;  1MXO A;  4RA7 A;  4U0X A;  5E2E A;  4ZTK A;  1NY0 A;  3WS5 A;  1W5D A;  2A3U A;  2R9X A;  2XEP A;  1FR1 A;  1YT4 A;  3RXW A;  2EX6 A;  2C6W B;  1MY8 A;  5AQ9 A;  4C3Q A;  2ZQ9 A;  1LLB A;  3LCE A;  1TVF A;  4GKU A;  5CHJ A;  5GLC A;  2Y4A A;  1KVL A;  3FWL A;  5FQM A;  2QPN A;  2Y91 A;  3V50 A;  1I2W A;  3PAE A;  4JBF A;  3I7J A;  3SH8 A;  1RGZ A;  1PYY A;  2GDN A;  1ES4 A;  5DF8 A;  5EUA A;  4K91 A;  4S2M A;  3WRZ A;  3VSK A;  3O86 A;  1BUL A;  4OVD A;  5HAR A;  4OP8 A;  4WM9 A;  1H8Y A;  2OLV A;  3UDX A;  3WS1 A;  1CK3 A;  1TEM A;  1N9B A;  4YFM A;  3NDG A;  1JTD A;  2FFF B;  1XA1 A;  4U0T A;  1JWZ A;  5FQI A;  4GDB A;  4GB7 A;  1PZO A;  3WRT A;  2UWX A;  5CEB A;  3HLC A;  2XD5 A;  5U47 A;  3IQA A;  5KMW A;  3MZE A;  4N1H A;  2WGW A;  4NK3 A;  4PM5 A;  3BFG A;  4K0W A;  1BUE A;  2Y55 A;  1ESU A;  1YMS A;  3IF6 A;  4PM8 A;  5FSR A;  5F82 A;  3VP0 A;  1SDN A;  2EX9 A;  4KZA A;  3BFE A;  2R9W A;  3FZC A;  2P9V B;  2ZQC A;  4OOM A;  3GVB A;  5E2G A;  4X56 A;  2PU4 A;  5A93 A;  1ALQ A;  1BSG A;  3HUN A;  1JTG A;  1L0F A;  3UE1 A;  4IBX A;  4JXS A;  2XDM A;  4NET A;  1GHI A;  2DCF A;  4JXV A;  4DXB A;  3BRM A;  3IH8 A;  3UY6 A;  3SS3 A;  1IEL A;  5FI2 A;  2P74 A;  3W4Q A;  2G2U A;  3BFD A;  3HBR A;  4E3L A;  3ZGA B;  2IWB A;  3DWK A;  1CI8 A;  4KG6 A;  2EFU A;  3HL9 A;  5CGS A;  1ONH A;  5F1G A;  3TG9 A;  1SKF A;  4HEF A;  4GZB A;  4OPQ A;  5L2F A;  4KEN B;  3VFH A;  2Y59 A;  4N92 A;  2WKI A;  3UNW A;  4BLM A;  4BQM A;  1NXY A;  4R23 A;  5HFO A;  2ZC5 B;  1K6R A;  3IHA A;  3P98 A;  4A5R A;  2X01 A;  2EXB A;  2ZC4 B;  4E3M A;  1DJC A;  2ZQD A;  2I72 A;  4OQG A;  3VP2 A;  1K55 C;  2CC1 A;  3ITA A;  2ZM0 A;  3G31 A;  4ZJ1 A;  5M19 A;  2J8Y A;  5GL9 A;  3GSG A;  3MZD A;  5HX9 A;  1GA0 A;  2B5R A;  1FSY A;  1U60 A;  2WUQ A;  3PAG A;  4MNR A;  4WZ5 A;  4OOY A;  3ITB A;  4ZJ3 A;  2ZM2 A;  4PPR A;  4QY6 A;  2WK0 A;  5CXW A;  1Q2P A;  2J9O A;  1K4F A;  1S6R A;  4GN2 A;  3G34 A;  1O07 A;  2HDU A;  2ZM8 A;  3QHY A;  5HW3 A;  1XX2 A;  2HP6 A;  2A49 A;  1LI0 A;  4RX3 A;  4U3T A;  5FQ9 A;  1PZP A;  4Z9Q A;  5TFQ A;  2Y2M A;  4KZ4 A;  1IYQ A;  1YLT A;  2Z2M B;  4GD6 A;  1RP5 A;  5FAS A;  2ZJ9 A;  5E2F A;  3SH7 A;  3UE3 A;  4B4Z A;  4KZB A;  3BEC A;  1E3U D;  2WZX A;  3M6H A;  1GA9 A;  4DE2 A;  3GQZ A;  3UN7 A;  3C7U A;  3LY3 A;  4P87 A;  5D3O A;  3GRJ A;  4DF6 A;  4EBL A;  1MBL A;  1NZU A;  3VFF A;  4PM7 A;  3NIA A;  2WGI A;  1J9M A;  5EEC A;  4B88 A;  4JF4 A;  4JXW A;  4X69 A;  1NYY A;  3M2J A;  1ES3 A;  1XGJ A;  3OCN A;  4RX2 A;  4N9L A;  1YMX A;  2Q9M A;  3O3V A;  4KZ9 A;  5GLD A;  4EWF A;  2WAF A;  4GNU A;  4KZ5 A;  3N8L A;  2H0Y A;  3N8R A;  4MBK A;  3A3F A;  3WS4 A;  4QJG A;  4CPK A;  3HLG A;  1BZA A;  2JE5 A;  1ZC2 A;  2XLN A;  3PBS A;  1KGG A;  5DF7 A;  3Q82 A;  1ERQ A;  1G68 A;  2Y2Q A;  3G30 A;  1XGI A;  3VP3 A;  2H5S A;  3FKV A;  1H8Z A;  2G2W A;  3WS0 A;  1MKI A;  1IKI A;  2RCX A;  4C75 A;  5A91 A;  3HLD A;  1VQQ A;  2WKH A;  1K54 A;  3OZH A;  2ZMA A;  4OQI A;  3E2K A;  3MXS A;  3ZG9 B;  3IXG A;  3C7V A;  1N4O A;  4XUZ A;  3NBL A;  3UO9 A;  1IYP A;  3Q07 A;  5CTN A;  2XFS A;  3HUM A;  3ZNY A;  5EOE A;  5HAQ A;  3LEZ A;  1NRF A;  1HD8 A;  4JKT A;  1CI9 A;  1KE0 A;  5FA7 A;  5FQJ A;  4KQQ A;  2HDR A;  3IWO A;  3A3J A;  4ZJ2 A;  3AGE A;  2WAE A;  4OLG A;  4E3O A;  4S2N A;  2ZC7 A;  1FQG A;  3WS2 A;  4BL3 A;  2XFT A;  4XXR A;  5G18 A;  3NDE A;  1DY6 A;  3ZHH A;  5HAP A;  3O87 A;  4K0X A;  4MEZ A;  1K57 C;  1LL9 A;  4FCF A;  1FCO A;  4LV0 A;  4EQI A;  4ZBE A;  4OPR A;  1BLP A;  5M18 A;  4DDS A;  1IYO A;  3AGD A;  4JLF A;  5DF9 A;  2WGW B;  2QZ6 A;  3SS4 A;  1XPB A;  3VP4 A;  3E2L A;  4OPZ A;  3IF6 B;  4L0L A;  3VMA A;  1YQS A;  1YLJ A;  4UA6 A;  1LL5 A;  4HBT A;  5FI7 A;  4EUZ A;  1KE3 A;  1LHY A;  1TDL A;  2ZQ7 A;  3LY4 A;  1E4D A;  5FAP A;  3C5A A;  2HPB A;  1K55 A;  2PBY A;  1PW8 A;  1W8Y A;  3QNB A;  2ZD8 A;  4Y7P A;  1DJB A;  3OCL A;  4DE3 A;  3VOY A;  3TSG A;  1FCM A;  2DRW A;  2OV5 A;  2XH9 A;  3G2Z A;  4IVI A;  3MKE A;  5A92 A;  1H5X A;  4LV1 A;  3ZDJ A;  1EI5 A;  5GHX A;  3AGF A;  1K56 A;  3HUO A;  4WYY A;  5FQK A;  3SH9 A;  4WBG A;  4KG2 A;  4S2J A;  1SHV A;  3DTM A;  4EBN A;  3CMZ A;  2JBF A;  3N4I A;  3FKW A;  4LCM A;  4BL2 A;  2HDS A;  3SOI A;  1DJA A;  1GCE A;  1C3B A;  2J9P A;  1Z6F A;  2QMI A;  5CTM A;  4UA7 A;  5EE8 A;  5GHZ A;  1QMF A;  1Q2Q A;  4R3B A;  5CER A;  3MKF A;  4PM9 A;  3IHB A;  4KZ6 A;  5FQQ A;  1YM1 A;  3PBT A;  3ZNT A;  3OPP A;  3QNC A;  1CEF A;  1K38 A;  4RYE A;  4E6W A;  4HES A;  4S2O A;  3N6I A;  4F94 A;  3NY4 A;  5GHY A;  4OKP A;  2X71 A;  2ZLY A;  3M6B A;  4X53 A;  1PI5 A;  3CJM A;  2IWC A;  4FH2 A;  4GD8 A;  2ZQA A;  2WAD A;  2XK1 A;  3V39 A;  4WEL A;  1QME A;  4WMC A;  3PBQ A;  3PBO A;  1XKZ A;  1GHP A;  3BFC A;  5J8X A;  3ISG A;  2H10 A;  1BLH A;  4OQ0 A;  1PW1 A;  4E3K A;  3C4P A;  1K25 A;  3BFF A;  5EVI A;  4OPY A;  1KGE A;  3PBN A;  1TDG A;  3A3I A;  4YIN A;  3HRE A;  3MFD A;  4UHU A;  3BM6 A;  3GV9 A;  4P0M A;  5GLB A;  5DTS A;  3HLF A;  2FFY A;  2OSU A;  1S0W A;  2DNS A;  2JCH A;  2WZZ A;  3LO7 A;  4XUX A;  4QHC A;  3Q7Z A;  3VOZ A;  5KSC A;  1ESI A;  4OOL A;  2E8I A;  3IT9 A;  3V3S A;  3NI9 A;  1M40 A;  1HZO A;  3HLW A;  4N9K A;  4KG5 A;  5A90 A;  2JC7 A;  3NCK A;  5DVA A;  5F1F A;  1AXB A;  5CHM A;  3FYZ A;  2Y2K A;  4Y0U A;  4QD4 A;  5CED A;  3UDF A;  4WEJ A;  4PMA A;  2WKE A;  1WYC A;  3V5M A;  1IEM A;  5GLA A;  1K6S A;  4X55 A;  1PWG A;  3S1Y A;  1BLS A;  3ZG5 A;  4BD0 A;  2ZC6 B;  4LCL A;  3Q81 A;  2Y2P A;  1O7E A;  5FAT A;  1W8Q A;  2WGV A;  3BEB A;  4DKI A;  1KGF A;  1L2S A;  1L0G A;  3W8K A;  4E6X A;  1K57 A;  5EVL A;  5CRF A;  3SS5 A;  2Y2I A;  3ZG8 B;  5EOO A;  4R4S A;  1YLZ A;  2EX2 A;  3Q7V A;  4X68 A;  3W4P A;  2Z2L B;  2ZQ8 A;  3UPP A;  2Y2L A;  4UAA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...