3BFFA

Class a beta-lactamase sed-g238c complexed with faropenem
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
262
structure length
262
Chain Sequence
VQQVQKKLAALEKQSGGRLGVALINTADNSQVLYRADERFAMCSTSKVMTAAAVLKQSETHDGILQQKMTIKKADLTNWNPVTEKYVGNTMTLAELSAATLQYSDNTAMNKLLAHLGGPGNVTAFARSIGDTTFRLDRKEPELNTAIPGDERDTTSPLAMAKSLRKLTLGDALAGPQRAQLVDWLKGNTTGGQSIRAGLPAHWVVGDKTGACDYGTTNDIAVIWPEDRAPLVLVTYFTQPQQDAKWRKDVLAAAAKIVTEGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Class A beta-lactamase Sed1
publication title acyl-intermediate structures of the class A beta-lactamase SED-G238C
rcsb
source organism Citrobacter sedlakii
molecule tags Hydrolase
total genus 96
structure length 262
sequence length 262
chains with identical sequence B, C, D
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2007-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3bffA00
1K25A 3ITAA 2XD5A 1RCJA 5AQBA 5FAPA 4Y7PA 3MBZA 5CGXA 4E6WA 2EXAA 3PBOA 4S2NA 5FI6A 4PMAA 3ZDJA 1ZKJA 2ZC3B 4JF5A 3NY4A 3HREA 2P74A 3CMZA 3P09A 1FCOA 3Q07A 2DRWA 3PBNA 4UAAA 4BQMA 5HW3A 4OLGA 1PWCA 2WGWB 2WKEA 1FQGA 3GR2A 4F94A 4U3TA 1AXBA 3WS0A 3GRJA 4S2OA 4LCMA 2XGNA 3DTMA 4JXGA 3BEBA 4FD8A 1E25A 3NIAA 4LV2A 2ZQ7A 2V2FF 5CEBA 2WKHA 2ZQCA 4RA7A 3LCEA 1XP4A 2J8YA 3Q7VA 3NDEA 4Y0UA 4MEZA 3BFEA 2X02A 4WZ5C 3ZG7B 5FQKA 2HDSA 4ZBEA 1GA0A 3IH9A 4R0QA 1C3BA 2XD1A 1E4DA 2A3UA 1DJAA 2EFUA 2PU4A 5HFOA 4BL2A 1TEMA 4X55A 3IF6B 3VP3A 4JXVA 1CEGA 1JWVA 3ZFZA 2EX2A 1NZUA 3JYIA 4R3JA 3HLWA 4CJNA 2VGJA 3HLDA 2Y55A 4P6BA 2R9WA 3ZG8B 3FWLA 1LL9A 4HEFA 3LEZA 2Y2QA 4LV3A 5CHMA 1OMEA 5GHXA 1MKIA 4C3QA 4DE1A 1K6RA 1DJCA 3A3EA 3MXSA 1ESIA 1YMXA 4HESA 4B88A 3IHBA 4IVIA 3SOIA 3Q7VB 2OLUA 2HP5A 4DDSA 3G2ZA 5CECA 1W8YA 2RL3A 4OH0A 2X01A 5DTKA 1MWTA 4KG6A 5CERA 4E3MA 1HD8A 3FZCA 4S2IA 1NZOA 4WELA 4X69A 1PZPA 1FCMA 3ZG5A 1IYOA 1ESUA 1MPLA 1TVFA 3QHYA 4QY5A 2ZM8A 4S2KA 3WS4A 3RXWA 3SH9A 2ZQ9A 3E2LA 1HTZA 4OPZA 4QD4A 1GHPA 2XR0A 2WYXA 5CRFA 1KE3A 2ZC6B 3O86A 4DF6A 2EXBA 2JBFA 4N92A 4B4ZA 3EQUA 1L0EA 1ES2A 2GDNA 4ID4A 5CXWA 4ZJ1A 4ZTKA 4IBXA 3I7JA 3VOZA 3RJUA 3TSGA 5M19A 3WRZA 2JC7A 3Q1FA 5IHVA 1CEFA 3UY6A 4DXCA 2WKIA 2G2UA 5FQIA 3S1YA 3NBLA 1W79A 4OQ0A 4MBKA 1KGFA 3MKEA 3FKVA 4S2MA 4X56A 3BLSA 1BLSA 5GHYA 4GNUA 3PBQA 2XH9A 3V3SA 3G2YA 1LL5A 1Q2PA 3EQVA 3FV7A 5CGSA 4KZ6A 3ZVWA 2XFSA 3VFHA 1IKIA 1BLHA 2IWDA 4GDNA 4JXSA 4MNRA 3S22A 5HL1A 3N8LA 5D3OA 4WMCA 3OPRA 1JVJA 1MWRA 5DVAA 2OV5A 5KZHA 2FFFB 4PM6A 3VP2A 4R23A 1M40A 2I72A 2HDRA 1BT5A 3C7UA 4WMCD 3ZCZA 3IQAA 2WZZA 3Q81A 1KDWA 2Y2LA 3C4PA 5FQ9A 4C6YA 2XLNA 1K6SA 3NC8A 5CHJA 4DE3A 4QU3A 1PYYA 4KZ3A 4ZJ3A 4X6TA 1NJ4A 1GA9A 4WZ4A 5TR7A 1DJBA 2P9VA 4IEDA 1H8YA 3N4IA 2XEPA 1ONGA 4JLFA 3V5MA 3HBRA 2EX9A 1IYQA 3G31A 1I2WA 2PBYA 1H8ZA 4KZ7A 5BOHA 3IF6A 3W4PA 3OPPA 3ZNYA 1VQQA 5FI7A 4CPKA 4R4RA 1MXOA 1FR1A 5GLCA 3VOYA 3WWXA 1Y54A 1FR6A 1YMSA 2JE5A 5FAQA 3MXRA 4NK3A 2HP6A 3O3VA 3M2JA 1H5XA 4E6XA 1CK3A 2WK0A 3PBSA 4KG2A 5KSHA 4PM9A 3SS3A 3N8SA 2ZJ9A 1QMFA 1IKGA 2Y2PA 3HLGA 4FH2A 4P0MA 4PM7A 4S2NC 5AQAA 4EUZA 4ZDXA 3IF6C 3A3JA 1CI9A 1EWZA 1NYYA 2XQZA 1GCEA 5EE8A 1BLCA 1I5QA 3W4QA 2P9VB 2BLSA 4LCLA 3PBRA 5FATA 3HLFA 1JTDA 2HDQA 2QMIA 2Y2OA 3ISGA 4WM9A 5EECA 2H5SA 5FSRA 1Z6FA 4X53A 3BECA 1RGYA 1YLWA 1W5DA 4RX2A 1E3UA 1KE4A 1XX2A 2ZMAA 5JYOA 1IYSA 1RP5A 2ZC7A 4KQQA 4R1GA 4KZ4A 4ZAMA 1N9BA 4RX3A 1XA7A 5EVLA 3VMAA 4UA7A 5HARA 4BD0A 3W8KA 1LHYA 1E3UD 5HAIA 3ZNTA 4OQGA 1CI8A 2EFXA 4LV0A 4YFMA 3C5AA 2WAFA 2RCXA 4GN2A 5JYPA 1I2SA 2H10A 1TDLA 3VSLA 1WE4A 1K4EA 4DE0A 4E3NA 3O87A 5FASA 3P98A 3ZHHA 5KMWA 3VSKA 4L0LA 3VP1A 4BJPA 5CTMA 3N7WA 4DRTA 3G34A 2V1ZA 1FOFA 3MKFA 4JXWA 1L0FA 4FH4A 1PIOA 1J9MA 5A90A 5E2HA 1IYPA 4GDBA 4X68A 5I94A 3HVFA 3Q82A 4EBPA 4OQHA 2ZD8A 3N8RA 5HAPA 4JKTA 1PWDA 3GMWA 4E3KA 5FQQA 4EV4A 4OONA 3SS4A 1SDEA 2J9PA 1U60A 4E3OA 5CHUA 1SHVA 3CG5A 4OOYA 1SDNA 4RVAA 1K4FA 1BULA 1YT4A 4QHCA 5E43A 4BL3A 5HAQA 1BUEA 1K38A 3DWZA 1KGGA 2Y2MA 1LI0A 3G35A 1K56A 3D4FA 1L0DA 3MZFA 4JF6A 5CEDA 3ITBA 3AGDA 1ERMA 3UE0A 1WYBA 2WGIA 4JPMA 2ZC5B 3NDGA 2BG1A 4R3BA 4QY6A 3DW0A 3HUMA 3IXBA 4N1HA 4DE2A 5FAOA 2WAEA 3OPHA 4U0XA 3OZHA 3CZDA 3IHAA 3VP4A 1TDGA 5E2EA 4OPYA 1YQSA 5CGWA 3HUNA 3WS2A 1KDSA 1W8QA 3A3FA 4PPRA 5FQJA 4OKPA 1ONHA 2H0YA 5A93A 3BFGA 1O07A 3PAEA 2Y2GA 4HBUA 1JTGA 1IELA 2JCHA 2R9XA 4IVKA 4MLLA 2XF3A 1EI5A 2PU2A 5EOOA 4GKUA 3IT9A 2OLVA 3UDIA 2ZQDA 4K91A 2Q9MA 3SS5A 1W7FA 3TOIA 4E3IA 3ZVTA 2QZ6A 3PTEA 3LY4A 3QNCA 4K0XA 5J8XA 3IWOA 5E2GA 4EWFA 4A5RA 4Y0OA 1ES5A 4IBRA 3HLCA 1PWGA 2VGKA 3VFFA 5TFQA 5M1AA 1G68A 1ZG4A 1XXMA 2WADA 3NCKA 2FFYA 4HBTA 1FSWA 3IXHA 3V39A 4WYYA 4BLMA 4S2PA 5DF9A 3G30A 4XXRA 1NXYA 1BSGA 2WGVA 4GD8A 4JF4A 3A3IA 2H0TA 2Y2JA 3BFDA 1YLYA 2IWCA 3IF5A 1BZAA 1HZOA 1PW8A 1VM1A 2Y2IA 5G18A 4DKIA 3HUOA 4OP5A 4E3JA 3IXDA 3OCNA 4E3LA 4KQOA 5GL9A 1YLPA 5EVIA 4DXBA 1K54A 3QNBA 1N4OA 4N9LA 3UDXA 2HPBA 1FSYA 2J9OA 3PBTA 2XK1A 1IEMA 4M3KA 2G2WA 3WS1A 4Y0TA 3S4XA 3B3XA 5EVID 2EX6A 1MWUA 3UN7A 3A3DA 1MBLA 1Q2QA 4UA9A 1G6AA 3LO7A 5EUAA 3UDFA 5EVIC 1K54C 5DF8A 1KGEA 1NY0A 3PAGA 4GZBA 3IWIA 4NETA 5DTSA 5GLDA 3WS5A 1K55A 3BFCA 4N1XA 1YLTA 2B5RA 4P85A 4Q8IA 5GLAA 4WZ5A 5AQ9A 5EVIB 4KZ5A 4U0TA 5EOEA 4QJGA 4PM5A 5F83A 5U47A 4GD6A 2IWBA 1XA1A 3WRTA 3Q7ZA 1LLBA 4XUZA 3NI9A 3TG9A 4EBNA 4GOGA 2Z2LB 2HDUA 5GHZA 4ZJ2A 5GLBA 1K55C 2XDMA 2Y91A 3AGEA 4OVDA 1KE0A 3GSGA 1YLJA 4JBFA 3UNWA 1XGIA 4RYEA 5M18A 3ZG9B 2A49A 4WEJA 5L2FA 2Y59A 4OOLA 3AGFA 1S6RA 1MWSA 1NYMA 3FYZA 5HX9A 4EBLA 4R4SA 3BFFA 1YM1A 3UO9A 3GQZA 4MBFA 2HP9A 4YINA 1QMEA 1ZG6A 1ZC2A 3IWQA 4QB8A 2E8IA 1DY6A 2Y2HA 2Y2NA 3O88A 1ES3A 4OOMA 2UWXA 1JWZA 4MBHA 4KZBA 1LI9A 5FQMA 3SH8A 2Q9NA 3ZGAB 4BD1A 2X71A 2ZC4B 2ZM0A 3OCLA 3HL9A 5A91A 1XKZA 1M6KA 1ERQA 3E2KA 2ZM2A 3VP0A 3LY3A 3HLEA 3BRMA 5FA7A 4BENA 1JWPA 4OQIA 2C5WB 4S2JA 3N6IA 3V50A 3M6HA 4FCFA 1GHMA 1L2SA 5FDHA 3UPPA 1PI4A 3C7VA 2Y4AA 2ZQ8A 4EQIA 2ZLYA 4O7DA 2EX8A 1XPBA 3C4OA 1K56D 4K0WA 4D2OA 4N9KA 2DNSA 1EROA 1KVMA 4LV1A 3GVBA 5F82A 4KZ9A 2Z2MB 1ALQA 2C6WB 3GTCA 4OPQA 4KZAA 4FSFA 4GB7A 4KQRA 4OPRA 3GV9A 1RGZA 4KENB 3M6BA 5FI2A 5F1GA 4P87A 1SKFA 5TGFA 1PW1A 3W4OA 1BTLA 3UPOA 3IXGA 4PM8A 3G32A 3ZG0A 3IH8A 2WZXA 4OLDA 4DDYA 3MZDA 3UE3A 2QPNA 1KVLA 4WBGA 5AQ7A 1S0WA 1XGJA 2J7VA 4WEKA 2Y2KA 4KG5A 3MFDA 2XFTA 2V20A 3MZEA 2OSUA 1SCWA 3HLBA 1HVBA 3DWKA 4XUXA 4UA6A 4Z9QA 5EPHA 3CJMA 3V3RA 3M2KA 1K57A 3SH7A 4H8RA 4OP8A 3OPLA 3G4PA 1WYCA 4C75A 4LENA 4UHUA 2DCFA 3BLMA 4KZ8A 1O7EA 1FCNA 1PZOA 5KSCA 5A92A 3BM6A 2CC1A 4B4XA 3OC2A 1BLPA 5DTTA 1L0GA 3UE1A 1MY8A 2WGWA 2ZQAA 1YLZA 3FKWA 3BYDA 1PI5A 1K57C 2WUQA 4S2LA 5E2FA 1GHIA 3RXXA 5F1FA 1NRFA 5CTNA 5DF7A 1ES4A 3UPNA
chains in the Genus database with same CATH superfamily
3T1XA 2L4RA 1K25A 2XD5A 4Y7PA 3PBOA 4S2NA 3U4LP 5HW3A 3Q07A 1FCOA 5HDDA 2DRWA 4BQMA 2WGWB 1AXBA 2R78A 4S2OA 4JXGA 1YKDA 3BEBA 1E25A 4FD8A 2ZQ7A 3Q7VA 3CUEC 2X02A 4WZ5C 1DJAA 4X55A 1A0KA 3IF6B 1JWVA 5F6AA 3H82B 2VGJA 1D06A 3HLDA 3ZG8B 3T4KA 1LL9A 3LEZA 3EEAA 1OMEA 5GHXA 4DE1A 1K6RA 3LR5A 3A3EA 3LIDA 2JKTM 3IHBA 2HF6A 4DDSA 4GHIA 4OH0A 3NHQA 5CERA 3A0RA 4ETZA 1MC0A 3FZCA 4HJ4A 4X69A 4X1LA 2GX5A 1IYOA 3F1PB 4S2KA 3WS4A 4LRXC 2ZQ9A 4ETXA 2PAVP 4OPZA 1GHPA 4DF6A 2EXBA 5EFWA 5HWVA 2YKHA 2VLGA 3FG8A 3I7JA 3RJUA 3DAVA 1TF1A 3TSGA 3UB6A 3CPTB 2JN7A 1W79A 4EEPA 1UWNX 3FKVA 4X56A 1XJ3A 1LSWA 2OAQ1 4HH3A 3PBQA 2XH9A 3V3SA 3G2YA 4KZ6A 3ZVWA 4GDNA 4MNRA 5HL1A 3QP1A 5L10A 4EUVA 2WKQA 4R23A 1M40A 4DJ3A 2I72A 2HDRA 4WMCD 5AVEA 2XA7S 2XLNA 4QWOA 3T1RA 3LI9A 3S7NA 4LPZA 1NJ4A 1GA9A 1DJBA 3IBRA 1H8YA 3N4IA 4JLFA 3R4KA 2PBYA 1OTIA 3SZTA 4CPKA 1FR1A 1Y54A 1FR6A 5FAQA 1H8MA 4NK3A 3D72A 2HP6A 1H5XA 5F5YA 4E6XA 1CK3A 3PBSA 5KSHA 2ZJ9A 2Y2PA 1IKGA 4FH2A 2O9AA 3MFXA 1CI9A 1EWZA 1GCEA 5EE8A 1BLCA 2P9VB 2BLSA 3PBRA 3T4TA 1JTDA 2HDQA 4WM9A 5FSRA 1Z6FA 2JKRI 3VE3A 1YLWA 4FOFA 1E3UD 1NRJA 4LV0A 2RCXA 4GN2A 4HP4A 1TDLA 3VSLA 1K4EA 4HIAA 5FL3A 4E3NA 3VSKA 1DP6A 4IUHA 3IS2A 1FOFA 2W3FA 1IYPA 1SKOB 3E98A 4GDBA 4PAUA 4NXBA 2ZD8A 2BTFP 5HAPA 1PWDA 4E3KA 3SS4A 2J9PA 3O5YA 4O01A 4OOYA 1K4FA 1BULA 2PBDP 1K38A 3MZFA 1L0DA 4DMZA 3ITBA 3AGDA 1WYBA 3DW0A 3IXBA 4HJ3A 5L09A 4N1HA 5FAOA 2WAEA 2JKTI 3OZHA 3CZDA 2FZ0A 2A24A 4OPYA 1YQSA 1W8QA 3K2NA 3A3FA 4PPRA 1ONHA 2H0YA 3PAEA 2XF3A 1XJ2A 2PYRA 5G4YA 3UDIA 2ZQDA 5EVEA 3E4QA 4O0PA 5HDSA 3PTEA 4ARZA 3LY4A 1OTBA 5J8XA 4P6ZS 2I9VA 4JGOA 1ZTUA 1PWGA 1G68A 2O9BA 1XXMA 3NCKA 3QP4A 2FFYA 3IXHA 4WYYA 3BW6A 4S2PA 4Y17A 1NXYA 1BSGA 1GSVA 1OT9A 3F1OB 1HZOA 1PW8A 1TS7A 4DKIA 3HUOA 1YAXA 3IXDA 4E3LA 4KQOA 5EVIA 4DXBA 4N9LA 2J9OA 1IEMA 3S4XA 3B3XA 2EX6A 4CLCE 2O99A 1G6AA 4GLQA 3PXPA 5DF8A 3MXQA 1ACFA 1YPRA 3JVUA 5GLDA 1K55A 4P85A 4Q8IA 5GLAA 1XA1A 2V8FA 3Q7ZA 5IS1A 3NI9A 3TG9A 4ZJ2A 5GHZA 3P01A 5HDCA 1YLJA 4MDZA 3UNWA 1VHMA 4WEJA 4OOLA 1YSQA 3AGFA 1YM1A 2VV8A 5KIZA 2VK3A 4YINA 1ZC2A 5HWWA 3O88A 1S1YA 4OOMA 2ZL1A 3E4PA 5FQMA 4BD1A 1FILA 3ZGAB 2X71A 2M1CA 1M6KA 3V50A 4WLAA 2Y4AA 2ZQ8A 4K0WA 4N9KA 2DNSA 1H0MA 2K31A 4EERA 4LV1A 2C6WB 3MQQA 4KZAA 4KQRA 4EQ1A 3GV9A 4KENB 4PKYA 3ZG0A 1CQAA 3IH8A 3T1QB 3KYQA 4WBGA 5AQ7A 2V1BA 2HGVA 2NUPC 4WEKA 4KG5A 1DRMA 3A0VA 2OSUA 5I5LA 2L0WA 3FPVA 2ZMFA 4MN5A 4UA6A 3TE8A 4H8RA 3OPLA 4C75A 4LENA 4KZ8A 1O7EA 1PZOA 3BM6A 4B4XA 1BLPA 2LB9A 1L0GA 3R7WA 2WGWA 3OBFA 1H3QA 1K57C 1LT0A 5HL6A 4S2LA 1LSVA 3MS6A 3RXXA 5AQBA 3MBZA 2EXAA 1F2KA 5FI6A 4PMAA 4JF5A 1IFQA 1VEUB 3CMZA 3H82A 3TRCA 4OLGA 4M4XA 1STZA 1FQGA 3WS0A 3KO6A 4I38A 1V9YA 3NIAA 4LV2A 2PT7A 2WKHA 1XP4A 2J8YA 4Y0UA 4ZBEA 3IH9A 1C3BA 2EFUA 1BYWA 4BL2A 1TEMA 3VP3A 5IT5A 4MN6A 3C30A 1NZUA 2EA9A 3F1PA 4CJNA 1PNEA 1YSPA 3C8CA 2Y2QA 4EETB 2V1AA 2M7VA 3MXSA 1ESIA 1YMXA 4I3IA 4IVIA 3SOIA 2OLUA 3VV4A 2RL3A 1NWZA 4KG6A 3CPTA 4G3KA 5LBRA 4E3MA 1HD8A 4S2IA 1NZOA 3ZG5A 3QHYA 1ESUA 4QY5A 2XR0A 1KE3A 5C5KA 2QYBA 4D60A 2Z6DA 5FDSA 1L0EA 4ID4A 5CXWA 4ZTKA 5M19A 2WKPA 3WRZA 2JC7A 2W3GA 3Q1FA 5IHVA 2J80A 4OQ0A 5TBMB 3MKEA 5TJJA 5J7EA 4S2MA 3BLSA 3KYZA 1Y28A 3FV7A 5CGSA 3VFHA 2W3HA 3BQAA 4HH2A 3OPRA 2HJEA 2OV5A 5KZHA 2FFFB 2ZOHA 1F5MA 4ZRRA 3C7UA 3ZCZA 2D01A 3NJAA 3IQAA 3JPUA 3Q81A 1KDWA 3C4PA 4EU0A 5CHJA 4MCWA 4KZ3A 4X6TA 2P9VA 3JVVA 1ONGA 2B95A 3V5MA 4KZ7A 5K5BA 3OPPA 5FI7A 1MXOA 3H7WB 3O3VA 2WK0A 4Y15A 3SS3A 3N8SA 5AQAA 1NYYA 3T4SA 4HI4A 4MN7A 1ODVA 2EWWA 4I39A 5FATA 2PR6A 3HLFA 4GW9A 5EECA 2QMIA 2Y2OA 4X53A 1SKOA 1W5DA 1KE4A 1XX2A 1RP5A 1TS6A 4KQQA 4R1GA 4RX3A 1XA7A 5EVLA 1CF0A 1WA9A 4UA7A 1N9NA 5HAIA 1CI8A 3MF0A 3C5AA 1GSWA 4R38A 4DE0A 3P98A 3ZHHA 5KMWA 2V1ZA 2P08A 3MKFA 2EWVA 1J9MA 5E2HA 4X68A 3HVFA 3N8RA 4JKTA 3GDIA 3KSGA 1U60A 4E3OA 5CHUA 1SHVA 3CG5A 1SDNA 1YT4A 4QHCA 4BL3A 3LICA 1BUEA 2Y2MA 1K56A 3D4FA 1ERMA 4YNRA 2PD8A 2PRFA 3KSHA 4R3BA 3NDGA 3HUMA 3G6OA 1TS0A 2PR5A 3IHAA 3VP4A 2HJ9C 3MMHA 3WS2A 3CHWP 2OOLA 4G3VA 4OKPA 3BFGA 1O07A 2DMWA 2Y2GA 4GS9A 4IVKA 3KX0X 1ZHHB 2D02A 3F1OA 1G28A 1N9OA 2Q9MA 3SS5A 4E3IA 4IJGA 2QZ6A 3QNCA 4EWFA 1HLUP 4A5RA 4Y0OA 3HLCA 1GSXA 1ZG4A 2WADA 3G30A 3LR4A 2H0TA 2Y2JA 3BFDA 3TJZC 5G18A 2QKPA 4OP5A 4E3JA 1OTDA 3OCNA 1K54A 2HPBA 2XK1A 4M3KA 2G2WA 4Y0TA 5EVID 2QWSA 1MBLA 3LO7A 3UDFA 5EVIC 3D3OA 1NY0A 4HJ6A 3PAGA 3S7OA 4NETA 1YLTA 3B47A 1NLZA 4WZ5A 4KZ5A 2M7UA 4U0TA 5EOEA 5F83A 3WRTA 4B9OA 1X0OA 1K55C 2XDMA 2Y91A 4OVDA 1KE0A 1LL8A 4RQ9A 2Y59A 1S6RA 5HX9A 3FYZA 2NUTC 2HP9A 4Y13A 3FC7A 1ZG6A 5F68A 4QB8A 4Q0IA 4L9EA 1ES3A 1JWZA 1P9WA 1LI9A 3SH8A 3OCLA 3HJKA 3E2KA 2ZM2A 3VP0A 4BENA 2W0NA 1N9LA 1GHMA 3UPPA 5FDHA 3EGDC 4O7DA 1OTEA 2VKSA 3C4OA 1W63M 5AVFA 3LIBA 2VEAA 3GVBA 2Z2MB 4OPQA 1XJ6A 1S1ZA 4GB7A 3M6BA 3CLOA 4P87A 1SKFA 5TGFA 1PW1A 3W4OA 1BTLA 4DDYA 1DP9A 4JGRA 2VV6A 5F69A 2J7VA 5J4EA 4WF0A 2Y2KA 2XFTA 3ZQ5A 1SCWA 3A0SA 1HVBA 1D1JA 3DWKA 3V3RA 3CJMA 5FEFA 3M2KA 4CLCA 3SH7A 1F98A 3T4QA 1VEUA 1FCNA 4NEED 5KSCA 1MY8A 2ZQAA 3BYDA 2WUQA 5F1FA 1NRFA 5CTNA 3UPNA 3ITAA 1RCJA 5FAPA 4PHTA 4R3AA 1ZKJA 2ZC3B 3NY4A 3HREA 2P74A 4O8GA 3PBNA 3VOLA 3QP6A 4KUKA 2WKEA 3GR2A 4F94A 2VGLS 3B33A 3GRJA 2XGNA 3RH8B 3MSHA 5IU1A 2V2FF 5CEBA 4RA7A 3LCEA 3NDEA 4MEZA 4H6JB 3ZG7B 5FQKA 5FEGA 1GA0A 2XD1A 1E4DA 2PU4A 3CWFA 4JXVA 3RTYA 1CEGA 2EX2A 4R3JA 3HLWA 2Y8HA 4P6BA 2R9WA 4LGWA 3PYPA 4QPRA 5CHMA 4C3QA 1DJCA 4B88A 1Y4OA 2HP5A 1UGUA 2W3EA 1W8YA 5DTKA 5DJTA 3C2WA 2KDKA 1PZPA 4EW7A 2BASA 2O0YA 4KQDA 5TBMA 3SH9A 1F9IA 3E2LA 4QD4A 2UV0E 2HZ5A 4XT2B 5CRFA 2K7SA 1JNUA 3L7HA 2JBFA 1D7EA 4B4ZA 3EQUA 1G5UA 1SZVA 2GDNA 2Q0OA 4ZJ1A 4IBXA 3VOZA 3ULFA 4DXCA 2G2UA 3S1YA 4UEYA 3L9KA 4MBKA 1KGFA 3U2AA 3NOUC 5L07A 3UMDA 2LB5A 1LL5A 1Q2PA 3EQVA 1VB6A 1IKIA 1BLHA 4JXSA 3LI8A 1MWRA 5DVAA 4PM6A 3H7WA 1BT5A 2WZZA 4F3LB 4C6YA 4QU3A 1PYYA 4ZJ3A 4WUJA 4IEDA 1I2WA 1H8ZA 5BOHA 4R6LA 3IF6A 4X25A 1W63Q 3UB9A 1VQQA 4R4RA 1YMSA 3M2JA 5DFXA 1S4SA 3S7PA 3S7QA 3CAXA 4PM7A 4S2NC 2OAP1 3A3JA 2QJ5A 1I5QA 4NXFA 4LCLA 1G6OA 3BY8A 3ISGA 3DTIA 1OTAA 2H5SA 1RGYA 5JYOA 2ZMAA 4ZAMA 2IA2A 4KZ4A 5HARA 4NXGA 3W8KA 4BD0A 1LHYA 2JKFA 4LRYC 4YFMA 5JYPA 1I2SA 2GJ3A 2J3WA 2VV7A 4BBTA 4L0LA 3N7WA 3G34A 4JXWA 2A2LA 3BJNA 1PIOA 5A90A 4R70A 3Q82A 1CJFA 4OQHA 3GMWA 5FQQA 1T19A 4EV4A 2B02A 4HQAA 4RVAA 2CMNA 3CITA 3DWZA 4LRZE 4JF6A 4KUOA 4BBVA 3UE0A 2ZC5B 1P9RA 2BG1A 4GCZA 1LSXA 4DE2A 4U0XA 1TDGA 5E2EA 4L9FA 1KDSA 3GECA 2KX6A 5A93A 3KYEA 2R9XA 3P7NA 5EOOA 2KLIA 4K91A 2ACGA 1W7FA 3TOIA 3ZVTA 2V9AA 4K0XA 3IWOA 5E2GA 3MQ0A 4IHQA 3F1NB 1ES5A 4IBRA 2PYPA 2VGKA 3VFFA 5TFQA 5M1AA 3V39A 4BLMA 1T1BA 3OLOA 4XXRA 4GD8A 3A3IA 3OOVA 1YLYA 2IWCA 3IF5A 1P97A 1BZAA 2Y2IA 2E8JA 2XRNA 4I3AA 5GL9A 1YLPA 3QNBA 1FSYA 3WS1A 5HD3A 4WL9A 1PRQA 3A3DA 2JKRM 1Q2QA 5HZHA 1T18A 1K54C 1KGEA 4MMNA 4WN5A 3IWIA 2G7UA 3BFCA 3VE4A 4N1XA 2B5RA 5A8BA 5AQ9A 2KOIA 3R7WB 4QJGA 4PM5A 2IWBA 4GD6A 3IX4A 1LLBA 5HD5A 3PR6A 4BWIA 2HDUA 3UB5P 3AGEA 3GSGA 1XGIA 5L8MA 1PFLA 3ZG9B 5M18A 2A49A 1T1AA 5L2FA 3EEHA 5DKKA 1AWIA 1NYMA 4YWZA 4R4SA 3BFFA 3UO9A 4MBFA 1QMEA 3IWQA 3LR3A 2E8IA 2Y2HA 2Y2NA 3HJIA 4II7A 2UWXA 4MBHA 2Q9NA 2ZC4B 2ZM0A 3HL9A 2FH5A 5FA7A 1JWPA 2C5WB 4S2JA 3N6IA 3M6HA 1PI4A 4EQIA 2ZLYA 2EX8A 1XPBA 3D9YA 4G3WA 4YOFA 1EROA 1IOUA 1KVMA 1KOUA 1ALQA 1XFQA 1MZUA 2VJWA 1RGZA 5FI2A 2W1TB 3UPOA 3IXGA 3G32A 3T50A 3MZDA 1VETB 3UE3A 1KVLA 3IX3A 1S0WA 4DJ2A 3BY9A 4HY8A 4BBUA 4ME4A 1DP8A 3MFDA 2V20A 4UQIM 4NXEA 4EESA 3LGOA 4XUXA 5EPHA 2W27A 3QP5A 4OP8A 3G4PA 1WYCA 3EWKA 3MQOA 4CLCD 4UHUA 3BLMA 2CC1A 3C38A 3UE1A 4X1MA 1YLZA 3FKWA 2JHEA 4CLCC 1EW0A 5DF7A 1ES4A 4H6JA 3NOPC 4E6WA 5CGXA 3ZDJA 4L9GA 3NOTC 3CUEA 3IBJA 3P09A 4UAAA 2PD7A 2GZAA 3LYXA 1PWCA 4U3TA 5AJGA 3DBAA 3QP2A 4LCMA 3LR0A 3DTMA 2Z6CA 2INWA 3FPWA 2ZQCA 3BFEA 2HDSA 4R0QA 2A3UA 5HFOA 2W1RA 5EM0A 2J3TD 3ZFZA 3JYIA 4PKYG 3T1SA 5HSQA 2Y55A 3FWLA 4HEFA 2J3TC 4LV3A 4XT2A 3W2ZA 1MKIA 2ZMVA 4E04A 4HESA 4I5SA 3BWLA 3Q7VB 3G2ZA 5CECA 5G4ZA 2X01A 4FTXA 1MWTA 1J3WA 1L3LA 4WELA 4EXOA 3B42A 1FCMA 1TVFA 1MPLA 2ZM8A 3RXWA 1HTZA 5DFYA 2WYXA 2ZC6B 3O86A 3EOIA 1S66L 4N92A 1ES2A 4I3JA 3CI6A 4GHIB 3NULA 1CEFA 3UY6A 2WKIA 5EV0A 5FQIA 3NBLA 4F3LA 2L1MA 4AFIA 1XFNA 1K0KA 1BLSA 4NG2A 5GHYA 4GNUA 2VZWA 2XFSA 3DTEA 2IWDA 3S22A 3N8LA 5D3OA 4WMCA 1JVJA 3MR0A 4B93A 3QP8A 2XA7M 3VP2A 2Y2LA 5FQ9A 1K6SA 3NC8A 4DE3A 4GS9B 4WZ4A 5TR7A 4LLOB 2XEPA 4Z1WA 4ESPA 3HBRA 2EX9A 1IYQA 3G31A 3E0YA 3W4PA 3ZNYA 4HNBA 5GLCA 3VOYA 3WWXA 2JE5A 3MXRA 1P0ZA 3LUQA 3NECA 2V8CA 4KG2A 4JGQA 4PM9A 4P0MA 3HCYA 1QMFA 1S4RA 3V67A 3HLGA 4EUZA 4ZDXA 3IF6C 2XQZA 3W4QA 3LIAA 3LEQA 4LFUA 3BECA 5HPFA 4RX2A 1E3UA 1IYSA 2ZC7A 1N9BA 3UMEA 3VMAA 4Y3IA 3T4LA 3ZNTA 4OQGA 2EFXA 2WAFA 2VX8A 4HHDA 2H10A 1WE4A 2V0UA 1FIKA 1TD5A 3O87A 5FASA 2GNXA 3VP1A 4GJ4A 4BJPA 5CTMA 4DRTA 5CX7A 1L0FA 4FH4A 4IUKA 5I94A 2O9CA 4EBPA 4Q0JA 4OONA 1SDEA 3UB8A 1T1CA 5E43A 5HAQA 1KGGA 3G35A 1LI0A 5CEDA 1OJ5A 2B18A 2VA0A 3UE6A 2WGIA 1OJGA 4JPMA 4QY6A 2QJ7A 3IS2B 3F1NA 4Y2FA 3OPHA 4HP9A 3K3DA 2AVXA 3T4JA 4Y5FA 5CGWA 3HUNA 5J3WA 4DN0A 5FQJA 4HBUA 4NKPA 1JTGA 1IELA 2JCHA 4MLLA 1EI5A 3KSFA 2PU2A 4GKUA 3IT9A 2OLVA 4HOIA 2OWHA 4P6ZM 1XJ4A 2XROA 2P04A 4HBTA 2A24B 1FSWA 5DF9A 2WGVA 4JF4A 3KSIA 1V9ZA 1VM1A 3DTKA 2ZOIA 4K08A 1N4OA 4ARZB 3UDXA 3LIEA 3PBTA 4JGPA 2MJ6A 1MWUA 2Y79A 2HV1A 3UN7A 3T4OA 4UA9A 2PDRA 5EUAA 4CLCB 4GZBA 3T12B 2YKFA 1OT6A 5DTSA 3WS5A 4CQHA 1Z09A 5DJUA 5EVIB 3LIFA 2VGLM 5U47A 4XUZA 3SW1A 4EBNA 4GOGA 2QHKA 2Z2LB 4FUWA 5GLBA 4JBFA 4RYEA 4Q0HA 2PHYA 2ZBBA 1MWSA 4EBLA 3GQZA 3EGXC 2K2NA 1DY6A 3LFVA 4KZBA 5A91A 1XKZA 1ERQA 3LY3A 3HLEA 3BRMA 3K3CA 2W1TA 4OQIA 1NLYA 1VETA 3BQ8A 4FCFA 3E4OA 1L2SA 3C7VA 5MC7A 2XSSA 3ICYA 3RFBA 3UB7A 1K56D 2JKGA 4D2OA 1MKMA 2W3DA 5F82A 4KZ9A 3GTCA 2ZL1B 4FSFA 4OPRA 2OWJA 5HPIA 5F1GA 3H9WA 4PM8A 2WZXA 4OLDA 5EM1A 2QPNA 4EEUA 1XGJA 4BMWA 3MZEA 3TW8A 1UWPX 3HLBA 4UQIS 3IX8A 4Z9QA 3PHYA 1OPXA 1K57A 3MJQA 5HWTA 2WKRA 1S67L 2DCFA 5A92A 3OC2A 5DTTA 3ZYTA 2V0WA 1PI5A 1TS8A 5DKLA 5E2FA 1GHIA 2H28A 2P7JA
chains in the Genus database with same CATH topology
1K25A 3ITAA 2XD5A 1RCJA 5AQBA 5FAPA 4Y7PA 3MBZA 5CGXA 4E6WA 2EXAA 3PBOA 4S2NA 5FI6A 4PMAA 3ZDJA 1ZKJA 2ZC3B 4JF5A 3NY4A 3HREA 2P74A 3CMZA 3P09A 1FCOA 3Q07A 2DRWA 3PBNA 4UAAA 4BQMA 5HW3A 4OLGA 1PWCA 2WGWB 2WKEA 1FQGA 3GR2A 4F94A 4U3TA 1AXBA 3WS0A 3GRJA 4S2OA 4LCMA 2XGNA 3DTMA 4JXGA 3BEBA 4FD8A 1E25A 3NIAA 4LV2A 2ZQ7A 2V2FF 5CEBA 2WKHA 2ZQCA 4RA7A 3LCEA 1XP4A 2J8YA 3Q7VA 3NDEA 4Y0UA 4MEZA 3BFEA 2X02A 4WZ5C 3ZG7B 5FQKA 2HDSA 4ZBEA 1GA0A 3IH9A 4R0QA 1C3BA 2XD1A 1E4DA 2A3UA 1DJAA 2EFUA 2PU4A 5HFOA 4BL2A 1TEMA 4X55A 3IF6B 3VP3A 4JXVA 1CEGA 1JWVA 3ZFZA 2EX2A 1NZUA 3JYIA 4R3JA 3HLWA 4CJNA 2VGJA 3HLDA 2Y55A 4P6BA 2R9WA 3ZG8B 3FWLA 1LL9A 4HEFA 3LEZA 2Y2QA 4LV3A 5CHMA 1OMEA 5GHXA 1MKIA 4C3QA 4DE1A 1K6RA 1DJCA 3A3EA 3MXSA 1ESIA 1YMXA 4HESA 4B88A 3IHBA 4IVIA 3SOIA 3Q7VB 2OLUA 2HP5A 4DDSA 3G2ZA 5CECA 1W8YA 2RL3A 4OH0A 2X01A 5DTKA 1MWTA 4KG6A 5CERA 4E3MA 1HD8A 3FZCA 4S2IA 1NZOA 4WELA 4X69A 1PZPA 1FCMA 3ZG5A 1IYOA 1ESUA 1MPLA 1TVFA 3QHYA 4QY5A 2ZM8A 4S2KA 3WS4A 3RXWA 3SH9A 2ZQ9A 3E2LA 1HTZA 4OPZA 4QD4A 1GHPA 2XR0A 2WYXA 5CRFA 1KE3A 2ZC6B 3O86A 4DF6A 2EXBA 2JBFA 4N92A 4B4ZA 3EQUA 1L0EA 1ES2A 2GDNA 4ID4A 5CXWA 4ZJ1A 4ZTKA 4IBXA 3I7JA 3VOZA 3RJUA 3TSGA 5M19A 3WRZA 2JC7A 3Q1FA 5IHVA 1CEFA 3UY6A 4DXCA 2WKIA 2G2UA 5FQIA 3S1YA 3NBLA 1W79A 4OQ0A 4MBKA 1KGFA 3MKEA 3FKVA 4S2MA 4X56A 3BLSA 1BLSA 5GHYA 4GNUA 3PBQA 2XH9A 3V3SA 3G2YA 1LL5A 1Q2PA 3EQVA 3FV7A 5CGSA 4KZ6A 3ZVWA 2XFSA 3VFHA 1IKIA 1BLHA 2IWDA 4GDNA 4JXSA 4MNRA 3S22A 5HL1A 3N8LA 5D3OA 4WMCA 3OPRA 1JVJA 1MWRA 5DVAA 2OV5A 5KZHA 2FFFB 4PM6A 3VP2A 4R23A 1M40A 2I72A 2HDRA 1BT5A 3C7UA 4WMCD 3ZCZA 3IQAA 2WZZA 3Q81A 1KDWA 2Y2LA 3C4PA 5FQ9A 4C6YA 2XLNA 1K6SA 3NC8A 5CHJA 4DE3A 4QU3A 1PYYA 4KZ3A 4ZJ3A 4X6TA 1NJ4A 1GA9A 4WZ4A 5TR7A 1DJBA 2P9VA 4IEDA 1H8YA 3N4IA 2XEPA 1ONGA 4JLFA 3V5MA 3HBRA 2EX9A 1IYQA 3G31A 1I2WA 2PBYA 1H8ZA 4KZ7A 5BOHA 3IF6A 3W4PA 3OPPA 3ZNYA 1VQQA 5FI7A 4CPKA 4R4RA 1MXOA 1FR1A 5GLCA 3VOYA 3WWXA 1Y54A 1FR6A 1YMSA 2JE5A 5FAQA 3MXRA 4NK3A 2HP6A 3O3VA 3M2JA 1H5XA 4E6XA 1CK3A 2WK0A 3PBSA 4KG2A 5KSHA 4PM9A 3SS3A 3N8SA 2ZJ9A 1QMFA 1IKGA 2Y2PA 3HLGA 4FH2A 4P0MA 4PM7A 4S2NC 5AQAA 4EUZA 4ZDXA 3IF6C 3A3JA 1CI9A 1EWZA 1NYYA 2XQZA 1GCEA 5EE8A 1BLCA 1I5QA 3W4QA 2P9VB 2BLSA 4LCLA 3PBRA 5FATA 3HLFA 1JTDA 2HDQA 2QMIA 2Y2OA 3ISGA 4WM9A 5EECA 2H5SA 5FSRA 1Z6FA 4X53A 3BECA 1RGYA 1YLWA 1W5DA 4RX2A 1E3UA 1KE4A 1XX2A 2ZMAA 5JYOA 1IYSA 1RP5A 2ZC7A 4KQQA 4R1GA 4KZ4A 4ZAMA 1N9BA 4RX3A 1XA7A 5EVLA 3VMAA 4UA7A 5HARA 4BD0A 3W8KA 1LHYA 1E3UD 5HAIA 3ZNTA 4OQGA 1CI8A 2EFXA 4LV0A 4YFMA 3C5AA 2WAFA 2RCXA 4GN2A 5JYPA 1I2SA 2H10A 1TDLA 3VSLA 1WE4A 1K4EA 4DE0A 4E3NA 3O87A 5FASA 3P98A 3ZHHA 5KMWA 3VSKA 4L0LA 3VP1A 4BJPA 5CTMA 3N7WA 4DRTA 3G34A 2V1ZA 1FOFA 3MKFA 4JXWA 1L0FA 4FH4A 1PIOA 1J9MA 5A90A 5E2HA 1IYPA 4GDBA 4X68A 5I94A 3HVFA 3Q82A 4EBPA 4OQHA 2ZD8A 3N8RA 5HAPA 4JKTA 1PWDA 3GMWA 4E3KA 5FQQA 4EV4A 4OONA 3SS4A 1SDEA 2J9PA 1U60A 4E3OA 5CHUA 1SHVA 3CG5A 4OOYA 1SDNA 4RVAA 1K4FA 1BULA 1YT4A 4QHCA 5E43A 4BL3A 5HAQA 1BUEA 1K38A 3DWZA 1KGGA 2Y2MA 1LI0A 3G35A 1K56A 3D4FA 1L0DA 3MZFA 4JF6A 5CEDA 3ITBA 3AGDA 1ERMA 3UE0A 1WYBA 2WGIA 4JPMA 2ZC5B 3NDGA 2BG1A 4R3BA 4QY6A 3DW0A 3HUMA 3IXBA 4N1HA 4DE2A 5FAOA 2WAEA 3OPHA 4U0XA 3OZHA 3CZDA 3IHAA 3VP4A 1TDGA 5E2EA 4OPYA 1YQSA 5CGWA 3HUNA 3WS2A 1KDSA 1W8QA 3A3FA 4PPRA 5FQJA 4OKPA 1ONHA 2H0YA 5A93A 3BFGA 1O07A 3PAEA 2Y2GA 4HBUA 1JTGA 1IELA 2JCHA 2R9XA 4IVKA 4MLLA 2XF3A 1EI5A 2PU2A 5EOOA 4GKUA 3IT9A 2OLVA 3UDIA 2ZQDA 4K91A 2Q9MA 3SS5A 1W7FA 3TOIA 4E3IA 3ZVTA 2QZ6A 3PTEA 3LY4A 3QNCA 4K0XA 5J8XA 3IWOA 5E2GA 4EWFA 4A5RA 4Y0OA 1ES5A 4IBRA 3HLCA 1PWGA 2VGKA 3VFFA 5TFQA 5M1AA 1G68A 1ZG4A 1XXMA 2WADA 3NCKA 2FFYA 4HBTA 1FSWA 3IXHA 3V39A 4WYYA 4BLMA 4S2PA 5DF9A 3G30A 4XXRA 1NXYA 1BSGA 2WGVA 4GD8A 4JF4A 3A3IA 2H0TA 2Y2JA 3BFDA 1YLYA 2IWCA 3IF5A 1BZAA 1HZOA 1PW8A 1VM1A 2Y2IA 5G18A 4DKIA 3HUOA 4OP5A 4E3JA 3IXDA 3OCNA 4E3LA 4KQOA 5GL9A 1YLPA 5EVIA 4DXBA 1K54A 3QNBA 1N4OA 4N9LA 3UDXA 2HPBA 1FSYA 2J9OA 3PBTA 2XK1A 1IEMA 4M3KA 2G2WA 3WS1A 4Y0TA 3S4XA 3B3XA 5EVID 2EX6A 1MWUA 3UN7A 3A3DA 1MBLA 1Q2QA 4UA9A 1G6AA 3LO7A 5EUAA 3UDFA 5EVIC 1K54C 5DF8A 1KGEA 1NY0A 3PAGA 4GZBA 3IWIA 4NETA 5DTSA 5GLDA 3WS5A 1K55A 3BFCA 4N1XA 1YLTA 2B5RA 4P85A 4Q8IA 5GLAA 4WZ5A 5AQ9A 5EVIB 4KZ5A 4U0TA 5EOEA 4QJGA 4PM5A 5F83A 5U47A 4GD6A 2IWBA 1XA1A 3WRTA 3Q7ZA 1LLBA 4XUZA 3NI9A 3TG9A 4EBNA 4GOGA 2Z2LB 2HDUA 5GHZA 4ZJ2A 5GLBA 1K55C 2XDMA 2Y91A 3AGEA 4OVDA 1KE0A 3GSGA 1YLJA 4JBFA 3UNWA 1XGIA 4RYEA 5M18A 3ZG9B 2A49A 4WEJA 5L2FA 2Y59A 4OOLA 3AGFA 1S6RA 1MWSA 1NYMA 3FYZA 5HX9A 4EBLA 4R4SA 3BFFA 1YM1A 3UO9A 3GQZA 4MBFA 2HP9A 4YINA 1QMEA 1ZG6A 1ZC2A 3IWQA 4QB8A 2E8IA 1DY6A 2Y2HA 2Y2NA 3O88A 1ES3A 4OOMA 2UWXA 1JWZA 4MBHA 4KZBA 1LI9A 5FQMA 3SH8A 2Q9NA 3ZGAB 4BD1A 2X71A 2ZC4B 2ZM0A 3OCLA 3HL9A 5A91A 1XKZA 1M6KA 1ERQA 3E2KA 2ZM2A 3VP0A 3LY3A 3HLEA 3BRMA 5FA7A 4BENA 1JWPA 4OQIA 2C5WB 4S2JA 3N6IA 3V50A 3M6HA 4FCFA 1GHMA 1L2SA 5FDHA 3UPPA 1PI4A 3C7VA 2Y4AA 2ZQ8A 4EQIA 2ZLYA 4O7DA 2EX8A 1XPBA 3C4OA 1K56D 4K0WA 4D2OA 4N9KA 2DNSA 1EROA 1KVMA 4LV1A 3GVBA 5F82A 4KZ9A 2Z2MB 1ALQA 2C6WB 3GTCA 4OPQA 4KZAA 4FSFA 4GB7A 4KQRA 4OPRA 3GV9A 1RGZA 4KENB 3M6BA 5FI2A 5F1GA 4P87A 1SKFA 5TGFA 1PW1A 3W4OA 1BTLA 3UPOA 3IXGA 4PM8A 3G32A 3ZG0A 3IH8A 2WZXA 4OLDA 4DDYA 3MZDA 3UE3A 2QPNA 1KVLA 4WBGA 5AQ7A 1S0WA 1XGJA 2J7VA 4WEKA 2Y2KA 4KG5A 3MFDA 2XFTA 2V20A 3MZEA 2OSUA 1SCWA 3HLBA 1HVBA 3DWKA 4XUXA 4UA6A 4Z9QA 5EPHA 3CJMA 3V3RA 3M2KA 1K57A 3SH7A 4H8RA 4OP8A 3OPLA 3G4PA 1WYCA 4C75A 4LENA 4UHUA 2DCFA 3BLMA 4KZ8A 1O7EA 1FCNA 1PZOA 5KSCA 5A92A 3BM6A 2CC1A 4B4XA 3OC2A 1BLPA 5DTTA 1L0GA 3UE1A 1MY8A 2WGWA 2ZQAA 1YLZA 3FKWA 3BYDA 1PI5A 1K57C 2WUQA 4S2LA 5E2FA 1GHIA 3RXXA 5F1FA 1NRFA 5CTNA 5DF7A 1ES4A 3UPNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K25 A;  3ITA A;  2XD5 A;  1RCJ A;  5AQB A;  5FAP A;  4Y7P A;  3MBZ A;  5CGX A;  4E6W A;  2EXA A;  3PBO A;  4S2N A;  5FI6 A;  4PMA A;  3ZDJ A;  1ZKJ A;  2ZC3 B;  4JF5 A;  3NY4 A;  3HRE A;  2P74 A;  3CMZ A;  3P09 A;  1FCO A;  3Q07 A;  2DRW A;  3PBN A;  4UAA A;  4BQM A;  5HW3 A;  4OLG A;  1PWC A;  2WGW B;  2WKE A;  1FQG A;  3GR2 A;  4F94 A;  4U3T A;  1AXB A;  3WS0 A;  3GRJ A;  4S2O A;  4LCM A;  2XGN A;  3DTM A;  4JXG A;  3BEB A;  4FD8 A;  1E25 A;  3NIA A;  4LV2 A;  2ZQ7 A;  2V2F F;  5CEB A;  2WKH A;  2ZQC A;  4RA7 A;  3LCE A;  1XP4 A;  2J8Y A;  3Q7V A;  3NDE A;  4Y0U A;  4MEZ A;  3BFE A;  2X02 A;  4WZ5 C;  3ZG7 B;  5FQK A;  2HDS A;  4ZBE A;  1GA0 A;  3IH9 A;  4R0Q A;  1C3B A;  2XD1 A;  1E4D A;  2A3U A;  1DJA A;  2EFU A;  2PU4 A;  5HFO A;  4BL2 A;  1TEM A;  4X55 A;  3IF6 B;  3VP3 A;  4JXV A;  1CEG A;  1JWV A;  3ZFZ A;  2EX2 A;  1NZU A;  3JYI A;  4R3J A;  3HLW A;  4CJN A;  2VGJ A;  3HLD A;  2Y55 A;  4P6B A;  2R9W A;  3ZG8 B;  3FWL A;  1LL9 A;  4HEF A;  3LEZ A;  2Y2Q A;  4LV3 A;  5CHM A;  1OME A;  5GHX A;  1MKI A;  4C3Q A;  4DE1 A;  1K6R A;  1DJC A;  3A3E A;  3MXS A;  1ESI A;  1YMX A;  4HES A;  4B88 A;  3IHB A;  4IVI A;  3SOI A;  3Q7V B;  2OLU A;  2HP5 A;  4DDS A;  3G2Z A;  5CEC A;  1W8Y A;  2RL3 A;  4OH0 A;  2X01 A;  5DTK A;  1MWT A;  4KG6 A;  5CER A;  4E3M A;  1HD8 A;  3FZC A;  4S2I A;  1NZO A;  4WEL A;  4X69 A;  1PZP A;  1FCM A;  3ZG5 A;  1IYO A;  1ESU A;  1MPL A;  1TVF A;  3QHY A;  4QY5 A;  2ZM8 A;  4S2K A;  3WS4 A;  3RXW A;  3SH9 A;  2ZQ9 A;  3E2L A;  1HTZ A;  4OPZ A;  4QD4 A;  1GHP A;  2XR0 A;  2WYX A;  5CRF A;  1KE3 A;  2ZC6 B;  3O86 A;  4DF6 A;  2EXB A;  2JBF A;  4N92 A;  4B4Z A;  3EQU A;  1L0E A;  1ES2 A;  2GDN A;  4ID4 A;  5CXW A;  4ZJ1 A;  4ZTK A;  4IBX A;  3I7J A;  3VOZ A;  3RJU A;  3TSG A;  5M19 A;  3WRZ A;  2JC7 A;  3Q1F A;  5IHV A;  1CEF A;  3UY6 A;  4DXC A;  2WKI A;  2G2U A;  5FQI A;  3S1Y A;  3NBL A;  1W79 A;  4OQ0 A;  4MBK A;  1KGF A;  3MKE A;  3FKV A;  4S2M A;  4X56 A;  3BLS A;  1BLS A;  5GHY A;  4GNU A;  3PBQ A;  2XH9 A;  3V3S A;  3G2Y A;  1LL5 A;  1Q2P A;  3EQV A;  3FV7 A;  5CGS A;  4KZ6 A;  3ZVW A;  2XFS A;  3VFH A;  1IKI A;  1BLH A;  2IWD A;  4GDN A;  4JXS A;  4MNR A;  3S22 A;  5HL1 A;  3N8L A;  5D3O A;  4WMC A;  3OPR A;  1JVJ A;  1MWR A;  5DVA A;  2OV5 A;  5KZH A;  2FFF B;  4PM6 A;  3VP2 A;  4R23 A;  1M40 A;  2I72 A;  2HDR A;  1BT5 A;  3C7U A;  4WMC D;  3ZCZ A;  3IQA A;  2WZZ A;  3Q81 A;  1KDW A;  2Y2L A;  3C4P A;  5FQ9 A;  4C6Y A;  2XLN A;  1K6S A;  3NC8 A;  5CHJ A;  4DE3 A;  4QU3 A;  1PYY A;  4KZ3 A;  4ZJ3 A;  4X6T A;  1NJ4 A;  1GA9 A;  4WZ4 A;  5TR7 A;  1DJB A;  2P9V A;  4IED A;  1H8Y A;  3N4I A;  2XEP A;  1ONG A;  4JLF A;  3V5M A;  3HBR A;  2EX9 A;  1IYQ A;  3G31 A;  1I2W A;  2PBY A;  1H8Z A;  4KZ7 A;  5BOH A;  3IF6 A;  3W4P A;  3OPP A;  3ZNY A;  1VQQ A;  5FI7 A;  4CPK A;  4R4R A;  1MXO A;  1FR1 A;  5GLC A;  3VOY A;  3WWX A;  1Y54 A;  1FR6 A;  1YMS A;  2JE5 A;  5FAQ A;  3MXR A;  4NK3 A;  2HP6 A;  3O3V A;  3M2J A;  1H5X A;  4E6X A;  1CK3 A;  2WK0 A;  3PBS A;  4KG2 A;  5KSH A;  4PM9 A;  3SS3 A;  3N8S A;  2ZJ9 A;  1QMF A;  1IKG A;  2Y2P A;  3HLG A;  4FH2 A;  4P0M A;  4PM7 A;  4S2N C;  5AQA A;  4EUZ A;  4ZDX A;  3IF6 C;  3A3J A;  1CI9 A;  1EWZ A;  1NYY A;  2XQZ A;  1GCE A;  5EE8 A;  1BLC A;  1I5Q A;  3W4Q A;  2P9V B;  2BLS A;  4LCL A;  3PBR A;  5FAT A;  3HLF A;  1JTD A;  2HDQ A;  2QMI A;  2Y2O A;  3ISG A;  4WM9 A;  5EEC A;  2H5S A;  5FSR A;  1Z6F A;  4X53 A;  3BEC A;  1RGY A;  1YLW A;  1W5D A;  4RX2 A;  1E3U A;  1KE4 A;  1XX2 A;  2ZMA A;  5JYO A;  1IYS A;  1RP5 A;  2ZC7 A;  4KQQ A;  4R1G A;  4KZ4 A;  4ZAM A;  1N9B A;  4RX3 A;  1XA7 A;  5EVL A;  3VMA A;  4UA7 A;  5HAR A;  4BD0 A;  3W8K A;  1LHY A;  1E3U D;  5HAI A;  3ZNT A;  4OQG A;  1CI8 A;  2EFX A;  4LV0 A;  4YFM A;  3C5A A;  2WAF A;  2RCX A;  4GN2 A;  5JYP A;  1I2S A;  2H10 A;  1TDL A;  3VSL A;  1WE4 A;  1K4E A;  4DE0 A;  4E3N A;  3O87 A;  5FAS A;  3P98 A;  3ZHH A;  5KMW A;  3VSK A;  4L0L A;  3VP1 A;  4BJP A;  5CTM A;  3N7W A;  4DRT A;  3G34 A;  2V1Z A;  1FOF A;  3MKF A;  4JXW A;  1L0F A;  4FH4 A;  1PIO A;  1J9M A;  5A90 A;  5E2H A;  1IYP A;  4GDB A;  4X68 A;  5I94 A;  3HVF A;  3Q82 A;  4EBP A;  4OQH A;  2ZD8 A;  3N8R A;  5HAP A;  4JKT A;  1PWD A;  3GMW A;  4E3K A;  5FQQ A;  4EV4 A;  4OON A;  3SS4 A;  1SDE A;  2J9P A;  1U60 A;  4E3O A;  5CHU A;  1SHV A;  3CG5 A;  4OOY A;  1SDN A;  4RVA A;  1K4F A;  1BUL A;  1YT4 A;  4QHC A;  5E43 A;  4BL3 A;  5HAQ A;  1BUE A;  1K38 A;  3DWZ A;  1KGG A;  2Y2M A;  1LI0 A;  3G35 A;  1K56 A;  3D4F A;  1L0D A;  3MZF A;  4JF6 A;  5CED A;  3ITB A;  3AGD A;  1ERM A;  3UE0 A;  1WYB A;  2WGI A;  4JPM A;  2ZC5 B;  3NDG A;  2BG1 A;  4R3B A;  4QY6 A;  3DW0 A;  3HUM A;  3IXB A;  4N1H A;  4DE2 A;  5FAO A;  2WAE A;  3OPH A;  4U0X A;  3OZH A;  3CZD A;  3IHA A;  3VP4 A;  1TDG A;  5E2E A;  4OPY A;  1YQS A;  5CGW A;  3HUN A;  3WS2 A;  1KDS A;  1W8Q A;  3A3F A;  4PPR A;  5FQJ A;  4OKP A;  1ONH A;  2H0Y A;  5A93 A;  3BFG A;  1O07 A;  3PAE A;  2Y2G A;  4HBU A;  1JTG A;  1IEL A;  2JCH A;  2R9X A;  4IVK A;  4MLL A;  2XF3 A;  1EI5 A;  2PU2 A;  5EOO A;  4GKU A;  3IT9 A;  2OLV A;  3UDI A;  2ZQD A;  4K91 A;  2Q9M A;  3SS5 A;  1W7F A;  3TOI A;  4E3I A;  3ZVT A;  2QZ6 A;  3PTE A;  3LY4 A;  3QNC A;  4K0X A;  5J8X A;  3IWO A;  5E2G A;  4EWF A;  4A5R A;  4Y0O A;  1ES5 A;  4IBR A;  3HLC A;  1PWG A;  2VGK A;  3VFF A;  5TFQ A;  5M1A A;  1G68 A;  1ZG4 A;  1XXM A;  2WAD A;  3NCK A;  2FFY A;  4HBT A;  1FSW A;  3IXH A;  3V39 A;  4WYY A;  4BLM A;  4S2P A;  5DF9 A;  3G30 A;  4XXR A;  1NXY A;  1BSG A;  2WGV A;  4GD8 A;  4JF4 A;  3A3I A;  2H0T A;  2Y2J A;  3BFD A;  1YLY A;  2IWC A;  3IF5 A;  1BZA A;  1HZO A;  1PW8 A;  1VM1 A;  2Y2I A;  5G18 A;  4DKI A;  3HUO A;  4OP5 A;  4E3J A;  3IXD A;  3OCN A;  4E3L A;  4KQO A;  5GL9 A;  1YLP A;  5EVI A;  4DXB A;  1K54 A;  3QNB A;  1N4O A;  4N9L A;  3UDX A;  2HPB A;  1FSY A;  2J9O A;  3PBT A;  2XK1 A;  1IEM A;  4M3K A;  2G2W A;  3WS1 A;  4Y0T A;  3S4X A;  3B3X A;  5EVI D;  2EX6 A;  1MWU A;  3UN7 A;  3A3D A;  1MBL A;  1Q2Q A;  4UA9 A;  1G6A A;  3LO7 A;  5EUA A;  3UDF A;  5EVI C;  1K54 C;  5DF8 A;  1KGE A;  1NY0 A;  3PAG A;  4GZB A;  3IWI A;  4NET A;  5DTS A;  5GLD A;  3WS5 A;  1K55 A;  3BFC A;  4N1X A;  1YLT A;  2B5R A;  4P85 A;  4Q8I A;  5GLA A;  4WZ5 A;  5AQ9 A;  5EVI B;  4KZ5 A;  4U0T A;  5EOE A;  4QJG A;  4PM5 A;  5F83 A;  5U47 A;  4GD6 A;  2IWB A;  1XA1 A;  3WRT A;  3Q7Z A;  1LLB A;  4XUZ A;  3NI9 A;  3TG9 A;  4EBN A;  4GOG A;  2Z2L B;  2HDU A;  5GHZ A;  4ZJ2 A;  5GLB A;  1K55 C;  2XDM A;  2Y91 A;  3AGE A;  4OVD A;  1KE0 A;  3GSG A;  1YLJ A;  4JBF A;  3UNW A;  1XGI A;  4RYE A;  5M18 A;  3ZG9 B;  2A49 A;  4WEJ A;  5L2F A;  2Y59 A;  4OOL A;  3AGF A;  1S6R A;  1MWS A;  1NYM A;  3FYZ A;  5HX9 A;  4EBL A;  4R4S A;  3BFF A;  1YM1 A;  3UO9 A;  3GQZ A;  4MBF A;  2HP9 A;  4YIN A;  1QME A;  1ZG6 A;  1ZC2 A;  3IWQ A;  4QB8 A;  2E8I A;  1DY6 A;  2Y2H A;  2Y2N A;  3O88 A;  1ES3 A;  4OOM A;  2UWX A;  1JWZ A;  4MBH A;  4KZB A;  1LI9 A;  5FQM A;  3SH8 A;  2Q9N A;  3ZGA B;  4BD1 A;  2X71 A;  2ZC4 B;  2ZM0 A;  3OCL A;  3HL9 A;  5A91 A;  1XKZ A;  1M6K A;  1ERQ A;  3E2K A;  2ZM2 A;  3VP0 A;  3LY3 A;  3HLE A;  3BRM A;  5FA7 A;  4BEN A;  1JWP A;  4OQI A;  2C5W B;  4S2J A;  3N6I A;  3V50 A;  3M6H A;  4FCF A;  1GHM A;  1L2S A;  5FDH A;  3UPP A;  1PI4 A;  3C7V A;  2Y4A A;  2ZQ8 A;  4EQI A;  2ZLY A;  4O7D A;  2EX8 A;  1XPB A;  3C4O A;  1K56 D;  4K0W A;  4D2O A;  4N9K A;  2DNS A;  1ERO A;  1KVM A;  4LV1 A;  3GVB A;  5F82 A;  4KZ9 A;  2Z2M B;  1ALQ A;  2C6W B;  3GTC A;  4OPQ A;  4KZA A;  4FSF A;  4GB7 A;  4KQR A;  4OPR A;  3GV9 A;  1RGZ A;  4KEN B;  3M6B A;  5FI2 A;  5F1G A;  4P87 A;  1SKF A;  5TGF A;  1PW1 A;  3W4O A;  1BTL A;  3UPO A;  3IXG A;  4PM8 A;  3G32 A;  3ZG0 A;  3IH8 A;  2WZX A;  4OLD A;  4DDY A;  3MZD A;  3UE3 A;  2QPN A;  1KVL A;  4WBG A;  5AQ7 A;  1S0W A;  1XGJ A;  2J7V A;  4WEK A;  2Y2K A;  4KG5 A;  3MFD A;  2XFT A;  2V20 A;  3MZE A;  2OSU A;  1SCW A;  3HLB A;  1HVB A;  3DWK A;  4XUX A;  4UA6 A;  4Z9Q A;  5EPH A;  3CJM A;  3V3R A;  3M2K A;  1K57 A;  3SH7 A;  4H8R A;  4OP8 A;  3OPL A;  3G4P A;  1WYC A;  4C75 A;  4LEN A;  4UHU A;  2DCF A;  3BLM A;  4KZ8 A;  1O7E A;  1FCN A;  1PZO A;  5KSC A;  5A92 A;  3BM6 A;  2CC1 A;  4B4X A;  3OC2 A;  1BLP A;  5DTT A;  1L0G A;  3UE1 A;  1MY8 A;  2WGW A;  2ZQA A;  1YLZ A;  3FKW A;  3BYD A;  1PI5 A;  1K57 C;  2WUQ A;  4S2L A;  5E2F A;  1GHI A;  3RXX A;  5F1F A;  1NRF A;  5CTN A;  5DF7 A;  1ES4 A;  3UPN A; 
#chains in the Genus database with same CATH topology
 3T1X A;  2L4R A;  1K25 A;  2XD5 A;  4Y7P A;  3PBO A;  4S2N A;  3U4L P;  5HW3 A;  3Q07 A;  1FCO A;  5HDD A;  2DRW A;  4BQM A;  2WGW B;  1AXB A;  2R78 A;  4S2O A;  4JXG A;  1YKD A;  3BEB A;  1E25 A;  4FD8 A;  2ZQ7 A;  3Q7V A;  3CUE C;  2X02 A;  4WZ5 C;  1DJA A;  4X55 A;  1A0K A;  3IF6 B;  1JWV A;  5F6A A;  3H82 B;  2VGJ A;  1D06 A;  3HLD A;  3ZG8 B;  3T4K A;  1LL9 A;  3LEZ A;  3EEA A;  1OME A;  5GHX A;  4DE1 A;  1K6R A;  3LR5 A;  3A3E A;  3LID A;  2JKT M;  3IHB A;  2HF6 A;  4DDS A;  4GHI A;  4OH0 A;  3NHQ A;  5CER A;  3A0R A;  4ETZ A;  1MC0 A;  3FZC A;  4HJ4 A;  4X69 A;  4X1L A;  2GX5 A;  1IYO A;  3F1P B;  4S2K A;  3WS4 A;  4LRX C;  2ZQ9 A;  4ETX A;  2PAV P;  4OPZ A;  1GHP A;  4DF6 A;  2EXB A;  5EFW A;  5HWV A;  2YKH A;  2VLG A;  3FG8 A;  3I7J A;  3RJU A;  3DAV A;  1TF1 A;  3TSG A;  3UB6 A;  3CPT B;  2JN7 A;  1W79 A;  4EEP A;  1UWN X;  3FKV A;  4X56 A;  1XJ3 A;  1LSW A;  2OAQ 1;  4HH3 A;  3PBQ A;  2XH9 A;  3V3S A;  3G2Y A;  4KZ6 A;  3ZVW A;  4GDN A;  4MNR A;  5HL1 A;  3QP1 A;  5L10 A;  4EUV A;  2WKQ A;  4R23 A;  1M40 A;  4DJ3 A;  2I72 A;  2HDR A;  4WMC D;  5AVE A;  2XA7 S;  2XLN A;  4QWO A;  3T1R A;  3LI9 A;  3S7N A;  4LPZ A;  1NJ4 A;  1GA9 A;  1DJB A;  3IBR A;  1H8Y A;  3N4I A;  4JLF A;  3R4K A;  2PBY A;  1OTI A;  3SZT A;  4CPK A;  1FR1 A;  1Y54 A;  1FR6 A;  5FAQ A;  1H8M A;  4NK3 A;  3D72 A;  2HP6 A;  1H5X A;  5F5Y A;  4E6X A;  1CK3 A;  3PBS A;  5KSH A;  2ZJ9 A;  2Y2P A;  1IKG A;  4FH2 A;  2O9A A;  3MFX A;  1CI9 A;  1EWZ A;  1GCE A;  5EE8 A;  1BLC A;  2P9V B;  2BLS A;  3PBR A;  3T4T A;  1JTD A;  2HDQ A;  4WM9 A;  5FSR A;  1Z6F A;  2JKR I;  3VE3 A;  1YLW A;  4FOF A;  1E3U D;  1NRJ A;  4LV0 A;  2RCX A;  4GN2 A;  4HP4 A;  1TDL A;  3VSL A;  1K4E A;  4HIA A;  5FL3 A;  4E3N A;  3VSK A;  1DP6 A;  4IUH A;  3IS2 A;  1FOF A;  2W3F A;  1IYP A;  1SKO B;  3E98 A;  4GDB A;  4PAU A;  4NXB A;  2ZD8 A;  2BTF P;  5HAP A;  1PWD A;  4E3K A;  3SS4 A;  2J9P A;  3O5Y A;  4O01 A;  4OOY A;  1K4F A;  1BUL A;  2PBD P;  1K38 A;  3MZF A;  1L0D A;  4DMZ A;  3ITB A;  3AGD A;  1WYB A;  3DW0 A;  3IXB A;  4HJ3 A;  5L09 A;  4N1H A;  5FAO A;  2WAE A;  2JKT I;  3OZH A;  3CZD A;  2FZ0 A;  2A24 A;  4OPY A;  1YQS A;  1W8Q A;  3K2N A;  3A3F A;  4PPR A;  1ONH A;  2H0Y A;  3PAE A;  2XF3 A;  1XJ2 A;  2PYR A;  5G4Y A;  3UDI A;  2ZQD A;  5EVE A;  3E4Q A;  4O0P A;  5HDS A;  3PTE A;  4ARZ A;  3LY4 A;  1OTB A;  5J8X A;  4P6Z S;  2I9V A;  4JGO A;  1ZTU A;  1PWG A;  1G68 A;  2O9B A;  1XXM A;  3NCK A;  3QP4 A;  2FFY A;  3IXH A;  4WYY A;  3BW6 A;  4S2P A;  4Y17 A;  1NXY A;  1BSG A;  1GSV A;  1OT9 A;  3F1O B;  1HZO A;  1PW8 A;  1TS7 A;  4DKI A;  3HUO A;  1YAX A;  3IXD A;  4E3L A;  4KQO A;  5EVI A;  4DXB A;  4N9L A;  2J9O A;  1IEM A;  3S4X A;  3B3X A;  2EX6 A;  4CLC E;  2O99 A;  1G6A A;  4GLQ A;  3PXP A;  5DF8 A;  3MXQ A;  1ACF A;  1YPR A;  3JVU A;  5GLD A;  1K55 A;  4P85 A;  4Q8I A;  5GLA A;  1XA1 A;  2V8F A;  3Q7Z A;  5IS1 A;  3NI9 A;  3TG9 A;  4ZJ2 A;  5GHZ A;  3P01 A;  5HDC A;  1YLJ A;  4MDZ A;  3UNW A;  1VHM A;  4WEJ A;  4OOL A;  1YSQ A;  3AGF A;  1YM1 A;  2VV8 A;  5KIZ A;  2VK3 A;  4YIN A;  1ZC2 A;  5HWW A;  3O88 A;  1S1Y A;  4OOM A;  2ZL1 A;  3E4P A;  5FQM A;  4BD1 A;  1FIL A;  3ZGA B;  2X71 A;  2M1C A;  1M6K A;  3V50 A;  4WLA A;  2Y4A A;  2ZQ8 A;  4K0W A;  4N9K A;  2DNS A;  1H0M A;  2K31 A;  4EER A;  4LV1 A;  2C6W B;  3MQQ A;  4KZA A;  4KQR A;  4EQ1 A;  3GV9 A;  4KEN B;  4PKY A;  3ZG0 A;  1CQA A;  3IH8 A;  3T1Q B;  3KYQ A;  4WBG A;  5AQ7 A;  2V1B A;  2HGV A;  2NUP C;  4WEK A;  4KG5 A;  1DRM A;  3A0V A;  2OSU A;  5I5L A;  2L0W A;  3FPV A;  2ZMF A;  4MN5 A;  4UA6 A;  3TE8 A;  4H8R A;  3OPL A;  4C75 A;  4LEN A;  4KZ8 A;  1O7E A;  1PZO A;  3BM6 A;  4B4X A;  1BLP A;  2LB9 A;  1L0G A;  3R7W A;  2WGW A;  3OBF A;  1H3Q A;  1K57 C;  1LT0 A;  5HL6 A;  4S2L A;  1LSV A;  3MS6 A;  3RXX A;  5AQB A;  3MBZ A;  2EXA A;  1F2K A;  5FI6 A;  4PMA A;  4JF5 A;  1IFQ A;  1VEU B;  3CMZ A;  3H82 A;  3TRC A;  4OLG A;  4M4X A;  1STZ A;  1FQG A;  3WS0 A;  3KO6 A;  4I38 A;  1V9Y A;  3NIA A;  4LV2 A;  2PT7 A;  2WKH A;  1XP4 A;  2J8Y A;  4Y0U A;  4ZBE A;  3IH9 A;  1C3B A;  2EFU A;  1BYW A;  4BL2 A;  1TEM A;  3VP3 A;  5IT5 A;  4MN6 A;  3C30 A;  1NZU A;  2EA9 A;  3F1P A;  4CJN A;  1PNE A;  1YSP A;  3C8C A;  2Y2Q A;  4EET B;  2V1A A;  2M7V A;  3MXS A;  1ESI A;  1YMX A;  4I3I A;  4IVI A;  3SOI A;  2OLU A;  3VV4 A;  2RL3 A;  1NWZ A;  4KG6 A;  3CPT A;  4G3K A;  5LBR A;  4E3M A;  1HD8 A;  4S2I A;  1NZO A;  3ZG5 A;  3QHY A;  1ESU A;  4QY5 A;  2XR0 A;  1KE3 A;  5C5K A;  2QYB A;  4D60 A;  2Z6D A;  5FDS A;  1L0E A;  4ID4 A;  5CXW A;  4ZTK A;  5M19 A;  2WKP A;  3WRZ A;  2JC7 A;  2W3G A;  3Q1F A;  5IHV A;  2J80 A;  4OQ0 A;  5TBM B;  3MKE A;  5TJJ A;  5J7E A;  4S2M A;  3BLS A;  3KYZ A;  1Y28 A;  3FV7 A;  5CGS A;  3VFH A;  2W3H A;  3BQA A;  4HH2 A;  3OPR A;  2HJE A;  2OV5 A;  5KZH A;  2FFF B;  2ZOH A;  1F5M A;  4ZRR A;  3C7U A;  3ZCZ A;  2D01 A;  3NJA A;  3IQA A;  3JPU A;  3Q81 A;  1KDW A;  3C4P A;  4EU0 A;  5CHJ A;  4MCW A;  4KZ3 A;  4X6T A;  2P9V A;  3JVV A;  1ONG A;  2B95 A;  3V5M A;  4KZ7 A;  5K5B A;  3OPP A;  5FI7 A;  1MXO A;  3H7W B;  3O3V A;  2WK0 A;  4Y15 A;  3SS3 A;  3N8S A;  5AQA A;  1NYY A;  3T4S A;  4HI4 A;  4MN7 A;  1ODV A;  2EWW A;  4I39 A;  5FAT A;  2PR6 A;  3HLF A;  4GW9 A;  5EEC A;  2QMI A;  2Y2O A;  4X53 A;  1SKO A;  1W5D A;  1KE4 A;  1XX2 A;  1RP5 A;  1TS6 A;  4KQQ A;  4R1G A;  4RX3 A;  1XA7 A;  5EVL A;  1CF0 A;  1WA9 A;  4UA7 A;  1N9N A;  5HAI A;  1CI8 A;  3MF0 A;  3C5A A;  1GSW A;  4R38 A;  4DE0 A;  3P98 A;  3ZHH A;  5KMW A;  2V1Z A;  2P08 A;  3MKF A;  2EWV A;  1J9M A;  5E2H A;  4X68 A;  3HVF A;  3N8R A;  4JKT A;  3GDI A;  3KSG A;  1U60 A;  4E3O A;  5CHU A;  1SHV A;  3CG5 A;  1SDN A;  1YT4 A;  4QHC A;  4BL3 A;  3LIC A;  1BUE A;  2Y2M A;  1K56 A;  3D4F A;  1ERM A;  4YNR A;  2PD8 A;  2PRF A;  3KSH A;  4R3B A;  3NDG A;  3HUM A;  3G6O A;  1TS0 A;  2PR5 A;  3IHA A;  3VP4 A;  2HJ9 C;  3MMH A;  3WS2 A;  3CHW P;  2OOL A;  4G3V A;  4OKP A;  3BFG A;  1O07 A;  2DMW A;  2Y2G A;  4GS9 A;  4IVK A;  3KX0 X;  1ZHH B;  2D02 A;  3F1O A;  1G28 A;  1N9O A;  2Q9M A;  3SS5 A;  4E3I A;  4IJG A;  2QZ6 A;  3QNC A;  4EWF A;  1HLU P;  4A5R A;  4Y0O A;  3HLC A;  1GSX A;  1ZG4 A;  2WAD A;  3G30 A;  3LR4 A;  2H0T A;  2Y2J A;  3BFD A;  3TJZ C;  5G18 A;  2QKP A;  4OP5 A;  4E3J A;  1OTD A;  3OCN A;  1K54 A;  2HPB A;  2XK1 A;  4M3K A;  2G2W A;  4Y0T A;  5EVI D;  2QWS A;  1MBL A;  3LO7 A;  3UDF A;  5EVI C;  3D3O A;  1NY0 A;  4HJ6 A;  3PAG A;  3S7O A;  4NET A;  1YLT A;  3B47 A;  1NLZ A;  4WZ5 A;  4KZ5 A;  2M7U A;  4U0T A;  5EOE A;  5F83 A;  3WRT A;  4B9O A;  1X0O A;  1K55 C;  2XDM A;  2Y91 A;  4OVD A;  1KE0 A;  1LL8 A;  4RQ9 A;  2Y59 A;  1S6R A;  5HX9 A;  3FYZ A;  2NUT C;  2HP9 A;  4Y13 A;  3FC7 A;  1ZG6 A;  5F68 A;  4QB8 A;  4Q0I A;  4L9E A;  1ES3 A;  1JWZ A;  1P9W A;  1LI9 A;  3SH8 A;  3OCL A;  3HJK A;  3E2K A;  2ZM2 A;  3VP0 A;  4BEN A;  2W0N A;  1N9L A;  1GHM A;  3UPP A;  5FDH A;  3EGD C;  4O7D A;  1OTE A;  2VKS A;  3C4O A;  1W63 M;  5AVF A;  3LIB A;  2VEA A;  3GVB A;  2Z2M B;  4OPQ A;  1XJ6 A;  1S1Z A;  4GB7 A;  3M6B A;  3CLO A;  4P87 A;  1SKF A;  5TGF A;  1PW1 A;  3W4O A;  1BTL A;  4DDY A;  1DP9 A;  4JGR A;  2VV6 A;  5F69 A;  2J7V A;  5J4E A;  4WF0 A;  2Y2K A;  2XFT A;  3ZQ5 A;  1SCW A;  3A0S A;  1HVB A;  1D1J A;  3DWK A;  3V3R A;  3CJM A;  5FEF A;  3M2K A;  4CLC A;  3SH7 A;  1F98 A;  3T4Q A;  1VEU A;  1FCN A;  4NEE D;  5KSC A;  1MY8 A;  2ZQA A;  3BYD A;  2WUQ A;  5F1F A;  1NRF A;  5CTN A;  3UPN A;  3ITA A;  1RCJ A;  5FAP A;  4PHT A;  4R3A A;  1ZKJ A;  2ZC3 B;  3NY4 A;  3HRE A;  2P74 A;  4O8G A;  3PBN A;  3VOL A;  3QP6 A;  4KUK A;  2WKE A;  3GR2 A;  4F94 A;  2VGL S;  3B33 A;  3GRJ A;  2XGN A;  3RH8 B;  3MSH A;  5IU1 A;  2V2F F;  5CEB A;  4RA7 A;  3LCE A;  3NDE A;  4MEZ A;  4H6J B;  3ZG7 B;  5FQK A;  5FEG A;  1GA0 A;  2XD1 A;  1E4D A;  2PU4 A;  3CWF A;  4JXV A;  3RTY A;  1CEG A;  2EX2 A;  4R3J A;  3HLW A;  2Y8H A;  4P6B A;  2R9W A;  4LGW A;  3PYP A;  4QPR A;  5CHM A;  4C3Q A;  1DJC A;  4B88 A;  1Y4O A;  2HP5 A;  1UGU A;  2W3E A;  1W8Y A;  5DTK A;  5DJT A;  3C2W A;  2KDK A;  1PZP A;  4EW7 A;  2BAS A;  2O0Y A;  4KQD A;  5TBM A;  3SH9 A;  1F9I A;  3E2L A;  4QD4 A;  2UV0 E;  2HZ5 A;  4XT2 B;  5CRF A;  2K7S A;  1JNU A;  3L7H A;  2JBF A;  1D7E A;  4B4Z A;  3EQU A;  1G5U A;  1SZV A;  2GDN A;  2Q0O A;  4ZJ1 A;  4IBX A;  3VOZ A;  3ULF A;  4DXC A;  2G2U A;  3S1Y A;  4UEY A;  3L9K A;  4MBK A;  1KGF A;  3U2A A;  3NOU C;  5L07 A;  3UMD A;  2LB5 A;  1LL5 A;  1Q2P A;  3EQV A;  1VB6 A;  1IKI A;  1BLH A;  4JXS A;  3LI8 A;  1MWR A;  5DVA A;  4PM6 A;  3H7W A;  1BT5 A;  2WZZ A;  4F3L B;  4C6Y A;  4QU3 A;  1PYY A;  4ZJ3 A;  4WUJ A;  4IED A;  1I2W A;  1H8Z A;  5BOH A;  4R6L A;  3IF6 A;  4X25 A;  1W63 Q;  3UB9 A;  1VQQ A;  4R4R A;  1YMS A;  3M2J A;  5DFX A;  1S4S A;  3S7P A;  3S7Q A;  3CAX A;  4PM7 A;  4S2N C;  2OAP 1;  3A3J A;  2QJ5 A;  1I5Q A;  4NXF A;  4LCL A;  1G6O A;  3BY8 A;  3ISG A;  3DTI A;  1OTA A;  2H5S A;  1RGY A;  5JYO A;  2ZMA A;  4ZAM A;  2IA2 A;  4KZ4 A;  5HAR A;  4NXG A;  3W8K A;  4BD0 A;  1LHY A;  2JKF A;  4LRY C;  4YFM A;  5JYP A;  1I2S A;  2GJ3 A;  2J3W A;  2VV7 A;  4BBT A;  4L0L A;  3N7W A;  3G34 A;  4JXW A;  2A2L A;  3BJN A;  1PIO A;  5A90 A;  4R70 A;  3Q82 A;  1CJF A;  4OQH A;  3GMW A;  5FQQ A;  1T19 A;  4EV4 A;  2B02 A;  4HQA A;  4RVA A;  2CMN A;  3CIT A;  3DWZ A;  4LRZ E;  4JF6 A;  4KUO A;  4BBV A;  3UE0 A;  2ZC5 B;  1P9R A;  2BG1 A;  4GCZ A;  1LSX A;  4DE2 A;  4U0X A;  1TDG A;  5E2E A;  4L9F A;  1KDS A;  3GEC A;  2KX6 A;  5A93 A;  3KYE A;  2R9X A;  3P7N A;  5EOO A;  2KLI A;  4K91 A;  2ACG A;  1W7F A;  3TOI A;  3ZVT A;  2V9A A;  4K0X A;  3IWO A;  5E2G A;  3MQ0 A;  4IHQ A;  3F1N B;  1ES5 A;  4IBR A;  2PYP A;  2VGK A;  3VFF A;  5TFQ A;  5M1A A;  3V39 A;  4BLM A;  1T1B A;  3OLO A;  4XXR A;  4GD8 A;  3A3I A;  3OOV A;  1YLY A;  2IWC A;  3IF5 A;  1P97 A;  1BZA A;  2Y2I A;  2E8J A;  2XRN A;  4I3A A;  5GL9 A;  1YLP A;  3QNB A;  1FSY A;  3WS1 A;  5HD3 A;  4WL9 A;  1PRQ A;  3A3D A;  2JKR M;  1Q2Q A;  5HZH A;  1T18 A;  1K54 C;  1KGE A;  4MMN A;  4WN5 A;  3IWI A;  2G7U A;  3BFC A;  3VE4 A;  4N1X A;  2B5R A;  5A8B A;  5AQ9 A;  2KOI A;  3R7W B;  4QJG A;  4PM5 A;  2IWB A;  4GD6 A;  3IX4 A;  1LLB A;  5HD5 A;  3PR6 A;  4BWI A;  2HDU A;  3UB5 P;  3AGE A;  3GSG A;  1XGI A;  5L8M A;  1PFL A;  3ZG9 B;  5M18 A;  2A49 A;  1T1A A;  5L2F A;  3EEH A;  5DKK A;  1AWI A;  1NYM A;  4YWZ A;  4R4S A;  3BFF A;  3UO9 A;  4MBF A;  1QME A;  3IWQ A;  3LR3 A;  2E8I A;  2Y2H A;  2Y2N A;  3HJI A;  4II7 A;  2UWX A;  4MBH A;  2Q9N A;  2ZC4 B;  2ZM0 A;  3HL9 A;  2FH5 A;  5FA7 A;  1JWP A;  2C5W B;  4S2J A;  3N6I A;  3M6H A;  1PI4 A;  4EQI A;  2ZLY A;  2EX8 A;  1XPB A;  3D9Y A;  4G3W A;  4YOF A;  1ERO A;  1IOU A;  1KVM A;  1KOU A;  1ALQ A;  1XFQ A;  1MZU A;  2VJW A;  1RGZ A;  5FI2 A;  2W1T B;  3UPO A;  3IXG A;  3G32 A;  3T50 A;  3MZD A;  1VET B;  3UE3 A;  1KVL A;  3IX3 A;  1S0W A;  4DJ2 A;  3BY9 A;  4HY8 A;  4BBU A;  4ME4 A;  1DP8 A;  3MFD A;  2V20 A;  4UQI M;  4NXE A;  4EES A;  3LGO A;  4XUX A;  5EPH A;  2W27 A;  3QP5 A;  4OP8 A;  3G4P A;  1WYC A;  3EWK A;  3MQO A;  4CLC D;  4UHU A;  3BLM A;  2CC1 A;  3C38 A;  3UE1 A;  4X1M A;  1YLZ A;  3FKW A;  2JHE A;  4CLC C;  1EW0 A;  5DF7 A;  1ES4 A;  4H6J A;  3NOP C;  4E6W A;  5CGX A;  3ZDJ A;  4L9G A;  3NOT C;  3CUE A;  3IBJ A;  3P09 A;  4UAA A;  2PD7 A;  2GZA A;  3LYX A;  1PWC A;  4U3T A;  5AJG A;  3DBA A;  3QP2 A;  4LCM A;  3LR0 A;  3DTM A;  2Z6C A;  2INW A;  3FPW A;  2ZQC A;  3BFE A;  2HDS A;  4R0Q A;  2A3U A;  5HFO A;  2W1R A;  5EM0 A;  2J3T D;  3ZFZ A;  3JYI A;  4PKY G;  3T1S A;  5HSQ A;  2Y55 A;  3FWL A;  4HEF A;  2J3T C;  4LV3 A;  4XT2 A;  3W2Z A;  1MKI A;  2ZMV A;  4E04 A;  4HES A;  4I5S A;  3BWL A;  3Q7V B;  3G2Z A;  5CEC A;  5G4Z A;  2X01 A;  4FTX A;  1MWT A;  1J3W A;  1L3L A;  4WEL A;  4EXO A;  3B42 A;  1FCM A;  1TVF A;  1MPL A;  2ZM8 A;  3RXW A;  1HTZ A;  5DFY A;  2WYX A;  2ZC6 B;  3O86 A;  3EOI A;  1S66 L;  4N92 A;  1ES2 A;  4I3J A;  3CI6 A;  4GHI B;  3NUL A;  1CEF A;  3UY6 A;  2WKI A;  5EV0 A;  5FQI A;  3NBL A;  4F3L A;  2L1M A;  4AFI A;  1XFN A;  1K0K A;  1BLS A;  4NG2 A;  5GHY A;  4GNU A;  2VZW A;  2XFS A;  3DTE A;  2IWD A;  3S22 A;  3N8L A;  5D3O A;  4WMC A;  1JVJ A;  3MR0 A;  4B93 A;  3QP8 A;  2XA7 M;  3VP2 A;  2Y2L A;  5FQ9 A;  1K6S A;  3NC8 A;  4DE3 A;  4GS9 B;  4WZ4 A;  5TR7 A;  4LLO B;  2XEP A;  4Z1W A;  4ESP A;  3HBR A;  2EX9 A;  1IYQ A;  3G31 A;  3E0Y A;  3W4P A;  3ZNY A;  4HNB A;  5GLC A;  3VOY A;  3WWX A;  2JE5 A;  3MXR A;  1P0Z A;  3LUQ A;  3NEC A;  2V8C A;  4KG2 A;  4JGQ A;  4PM9 A;  4P0M A;  3HCY A;  1QMF A;  1S4R A;  3V67 A;  3HLG A;  4EUZ A;  4ZDX A;  3IF6 C;  2XQZ A;  3W4Q A;  3LIA A;  3LEQ A;  4LFU A;  3BEC A;  5HPF A;  4RX2 A;  1E3U A;  1IYS A;  2ZC7 A;  1N9B A;  3UME A;  3VMA A;  4Y3I A;  3T4L A;  3ZNT A;  4OQG A;  2EFX A;  2WAF A;  2VX8 A;  4HHD A;  2H10 A;  1WE4 A;  2V0U A;  1FIK A;  1TD5 A;  3O87 A;  5FAS A;  2GNX A;  3VP1 A;  4GJ4 A;  4BJP A;  5CTM A;  4DRT A;  5CX7 A;  1L0F A;  4FH4 A;  4IUK A;  5I94 A;  2O9C A;  4EBP A;  4Q0J A;  4OON A;  1SDE A;  3UB8 A;  1T1C A;  5E43 A;  5HAQ A;  1KGG A;  3G35 A;  1LI0 A;  5CED A;  1OJ5 A;  2B18 A;  2VA0 A;  3UE6 A;  2WGI A;  1OJG A;  4JPM A;  4QY6 A;  2QJ7 A;  3IS2 B;  3F1N A;  4Y2F A;  3OPH A;  4HP9 A;  3K3D A;  2AVX A;  3T4J A;  4Y5F A;  5CGW A;  3HUN A;  5J3W A;  4DN0 A;  5FQJ A;  4HBU A;  4NKP A;  1JTG A;  1IEL A;  2JCH A;  4MLL A;  1EI5 A;  3KSF A;  2PU2 A;  4GKU A;  3IT9 A;  2OLV A;  4HOI A;  2OWH A;  4P6Z M;  1XJ4 A;  2XRO A;  2P04 A;  4HBT A;  2A24 B;  1FSW A;  5DF9 A;  2WGV A;  4JF4 A;  3KSI A;  1V9Z A;  1VM1 A;  3DTK A;  2ZOI A;  4K08 A;  1N4O A;  4ARZ B;  3UDX A;  3LIE A;  3PBT A;  4JGP A;  2MJ6 A;  1MWU A;  2Y79 A;  2HV1 A;  3UN7 A;  3T4O A;  4UA9 A;  2PDR A;  5EUA A;  4CLC B;  4GZB A;  3T12 B;  2YKF A;  1OT6 A;  5DTS A;  3WS5 A;  4CQH A;  1Z09 A;  5DJU A;  5EVI B;  3LIF A;  2VGL M;  5U47 A;  4XUZ A;  3SW1 A;  4EBN A;  4GOG A;  2QHK A;  2Z2L B;  4FUW A;  5GLB A;  4JBF A;  4RYE A;  4Q0H A;  2PHY A;  2ZBB A;  1MWS A;  4EBL A;  3GQZ A;  3EGX C;  2K2N A;  1DY6 A;  3LFV A;  4KZB A;  5A91 A;  1XKZ A;  1ERQ A;  3LY3 A;  3HLE A;  3BRM A;  3K3C A;  2W1T A;  4OQI A;  1NLY A;  1VET A;  3BQ8 A;  4FCF A;  3E4O A;  1L2S A;  3C7V A;  5MC7 A;  2XSS A;  3ICY A;  3RFB A;  3UB7 A;  1K56 D;  2JKG A;  4D2O A;  1MKM A;  2W3D A;  5F82 A;  4KZ9 A;  3GTC A;  2ZL1 B;  4FSF A;  4OPR A;  2OWJ A;  5HPI A;  5F1G A;  3H9W A;  4PM8 A;  2WZX A;  4OLD A;  5EM1 A;  2QPN A;  4EEU A;  1XGJ A;  4BMW A;  3MZE A;  3TW8 A;  1UWP X;  3HLB A;  4UQI S;  3IX8 A;  4Z9Q A;  3PHY A;  1OPX A;  1K57 A;  3MJQ A;  5HWT A;  2WKR A;  1S67 L;  2DCF A;  5A92 A;  3OC2 A;  5DTT A;  3ZYT A;  2V0W A;  1PI5 A;  1TS8 A;  5DKL A;  5E2F A;  1GHI A;  2H28 A;  2P7J A; 
#chains in the Genus database with same CATH homology
 1K25 A;  3ITA A;  2XD5 A;  1RCJ A;  5AQB A;  5FAP A;  4Y7P A;  3MBZ A;  5CGX A;  4E6W A;  2EXA A;  3PBO A;  4S2N A;  5FI6 A;  4PMA A;  3ZDJ A;  1ZKJ A;  2ZC3 B;  4JF5 A;  3NY4 A;  3HRE A;  2P74 A;  3CMZ A;  3P09 A;  1FCO A;  3Q07 A;  2DRW A;  3PBN A;  4UAA A;  4BQM A;  5HW3 A;  4OLG A;  1PWC A;  2WGW B;  2WKE A;  1FQG A;  3GR2 A;  4F94 A;  4U3T A;  1AXB A;  3WS0 A;  3GRJ A;  4S2O A;  4LCM A;  2XGN A;  3DTM A;  4JXG A;  3BEB A;  4FD8 A;  1E25 A;  3NIA A;  4LV2 A;  2ZQ7 A;  2V2F F;  5CEB A;  2WKH A;  2ZQC A;  4RA7 A;  3LCE A;  1XP4 A;  2J8Y A;  3Q7V A;  3NDE A;  4Y0U A;  4MEZ A;  3BFE A;  2X02 A;  4WZ5 C;  3ZG7 B;  5FQK A;  2HDS A;  4ZBE A;  1GA0 A;  3IH9 A;  4R0Q A;  1C3B A;  2XD1 A;  1E4D A;  2A3U A;  1DJA A;  2EFU A;  2PU4 A;  5HFO A;  4BL2 A;  1TEM A;  4X55 A;  3IF6 B;  3VP3 A;  4JXV A;  1CEG A;  1JWV A;  3ZFZ A;  2EX2 A;  1NZU A;  3JYI A;  4R3J A;  3HLW A;  4CJN A;  2VGJ A;  3HLD A;  2Y55 A;  4P6B A;  2R9W A;  3ZG8 B;  3FWL A;  1LL9 A;  4HEF A;  3LEZ A;  2Y2Q A;  4LV3 A;  5CHM A;  1OME A;  5GHX A;  1MKI A;  4C3Q A;  4DE1 A;  1K6R A;  1DJC A;  3A3E A;  3MXS A;  1ESI A;  1YMX A;  4HES A;  4B88 A;  3IHB A;  4IVI A;  3SOI A;  3Q7V B;  2OLU A;  2HP5 A;  4DDS A;  3G2Z A;  5CEC A;  1W8Y A;  2RL3 A;  4OH0 A;  2X01 A;  5DTK A;  1MWT A;  4KG6 A;  5CER A;  4E3M A;  1HD8 A;  3FZC A;  4S2I A;  1NZO A;  4WEL A;  4X69 A;  1PZP A;  1FCM A;  3ZG5 A;  1IYO A;  1ESU A;  1MPL A;  1TVF A;  3QHY A;  4QY5 A;  2ZM8 A;  4S2K A;  3WS4 A;  3RXW A;  3SH9 A;  2ZQ9 A;  3E2L A;  1HTZ A;  4OPZ A;  4QD4 A;  1GHP A;  2XR0 A;  2WYX A;  5CRF A;  1KE3 A;  2ZC6 B;  3O86 A;  4DF6 A;  2EXB A;  2JBF A;  4N92 A;  4B4Z A;  3EQU A;  1L0E A;  1ES2 A;  2GDN A;  4ID4 A;  5CXW A;  4ZJ1 A;  4ZTK A;  4IBX A;  3I7J A;  3VOZ A;  3RJU A;  3TSG A;  5M19 A;  3WRZ A;  2JC7 A;  3Q1F A;  5IHV A;  1CEF A;  3UY6 A;  4DXC A;  2WKI A;  2G2U A;  5FQI A;  3S1Y A;  3NBL A;  1W79 A;  4OQ0 A;  4MBK A;  1KGF A;  3MKE A;  3FKV A;  4S2M A;  4X56 A;  3BLS A;  1BLS A;  5GHY A;  4GNU A;  3PBQ A;  2XH9 A;  3V3S A;  3G2Y A;  1LL5 A;  1Q2P A;  3EQV A;  3FV7 A;  5CGS A;  4KZ6 A;  3ZVW A;  2XFS A;  3VFH A;  1IKI A;  1BLH A;  2IWD A;  4GDN A;  4JXS A;  4MNR A;  3S22 A;  5HL1 A;  3N8L A;  5D3O A;  4WMC A;  3OPR A;  1JVJ A;  1MWR A;  5DVA A;  2OV5 A;  5KZH A;  2FFF B;  4PM6 A;  3VP2 A;  4R23 A;  1M40 A;  2I72 A;  2HDR A;  1BT5 A;  3C7U A;  4WMC D;  3ZCZ A;  3IQA A;  2WZZ A;  3Q81 A;  1KDW A;  2Y2L A;  3C4P A;  5FQ9 A;  4C6Y A;  2XLN A;  1K6S A;  3NC8 A;  5CHJ A;  4DE3 A;  4QU3 A;  1PYY A;  4KZ3 A;  4ZJ3 A;  4X6T A;  1NJ4 A;  1GA9 A;  4WZ4 A;  5TR7 A;  1DJB A;  2P9V A;  4IED A;  1H8Y A;  3N4I A;  2XEP A;  1ONG A;  4JLF A;  3V5M A;  3HBR A;  2EX9 A;  1IYQ A;  3G31 A;  1I2W A;  2PBY A;  1H8Z A;  4KZ7 A;  5BOH A;  3IF6 A;  3W4P A;  3OPP A;  3ZNY A;  1VQQ A;  5FI7 A;  4CPK A;  4R4R A;  1MXO A;  1FR1 A;  5GLC A;  3VOY A;  3WWX A;  1Y54 A;  1FR6 A;  1YMS A;  2JE5 A;  5FAQ A;  3MXR A;  4NK3 A;  2HP6 A;  3O3V A;  3M2J A;  1H5X A;  4E6X A;  1CK3 A;  2WK0 A;  3PBS A;  4KG2 A;  5KSH A;  4PM9 A;  3SS3 A;  3N8S A;  2ZJ9 A;  1QMF A;  1IKG A;  2Y2P A;  3HLG A;  4FH2 A;  4P0M A;  4PM7 A;  4S2N C;  5AQA A;  4EUZ A;  4ZDX A;  3IF6 C;  3A3J A;  1CI9 A;  1EWZ A;  1NYY A;  2XQZ A;  1GCE A;  5EE8 A;  1BLC A;  1I5Q A;  3W4Q A;  2P9V B;  2BLS A;  4LCL A;  3PBR A;  5FAT A;  3HLF A;  1JTD A;  2HDQ A;  2QMI A;  2Y2O A;  3ISG A;  4WM9 A;  5EEC A;  2H5S A;  5FSR A;  1Z6F A;  4X53 A;  3BEC A;  1RGY A;  1YLW A;  1W5D A;  4RX2 A;  1E3U A;  1KE4 A;  1XX2 A;  2ZMA A;  5JYO A;  1IYS A;  1RP5 A;  2ZC7 A;  4KQQ A;  4R1G A;  4KZ4 A;  4ZAM A;  1N9B A;  4RX3 A;  1XA7 A;  5EVL A;  3VMA A;  4UA7 A;  5HAR A;  4BD0 A;  3W8K A;  1LHY A;  1E3U D;  5HAI A;  3ZNT A;  4OQG A;  1CI8 A;  2EFX A;  4LV0 A;  4YFM A;  3C5A A;  2WAF A;  2RCX A;  4GN2 A;  5JYP A;  1I2S A;  2H10 A;  1TDL A;  3VSL A;  1WE4 A;  1K4E A;  4DE0 A;  4E3N A;  3O87 A;  5FAS A;  3P98 A;  3ZHH A;  5KMW A;  3VSK A;  4L0L A;  3VP1 A;  4BJP A;  5CTM A;  3N7W A;  4DRT A;  3G34 A;  2V1Z A;  1FOF A;  3MKF A;  4JXW A;  1L0F A;  4FH4 A;  1PIO A;  1J9M A;  5A90 A;  5E2H A;  1IYP A;  4GDB A;  4X68 A;  5I94 A;  3HVF A;  3Q82 A;  4EBP A;  4OQH A;  2ZD8 A;  3N8R A;  5HAP A;  4JKT A;  1PWD A;  3GMW A;  4E3K A;  5FQQ A;  4EV4 A;  4OON A;  3SS4 A;  1SDE A;  2J9P A;  1U60 A;  4E3O A;  5CHU A;  1SHV A;  3CG5 A;  4OOY A;  1SDN A;  4RVA A;  1K4F A;  1BUL A;  1YT4 A;  4QHC A;  5E43 A;  4BL3 A;  5HAQ A;  1BUE A;  1K38 A;  3DWZ A;  1KGG A;  2Y2M A;  1LI0 A;  3G35 A;  1K56 A;  3D4F A;  1L0D A;  3MZF A;  4JF6 A;  5CED A;  3ITB A;  3AGD A;  1ERM A;  3UE0 A;  1WYB A;  2WGI A;  4JPM A;  2ZC5 B;  3NDG A;  2BG1 A;  4R3B A;  4QY6 A;  3DW0 A;  3HUM A;  3IXB A;  4N1H A;  4DE2 A;  5FAO A;  2WAE A;  3OPH A;  4U0X A;  3OZH A;  3CZD A;  3IHA A;  3VP4 A;  1TDG A;  5E2E A;  4OPY A;  1YQS A;  5CGW A;  3HUN A;  3WS2 A;  1KDS A;  1W8Q A;  3A3F A;  4PPR A;  5FQJ A;  4OKP A;  1ONH A;  2H0Y A;  5A93 A;  3BFG A;  1O07 A;  3PAE A;  2Y2G A;  4HBU A;  1JTG A;  1IEL A;  2JCH A;  2R9X A;  4IVK A;  4MLL A;  2XF3 A;  1EI5 A;  2PU2 A;  5EOO A;  4GKU A;  3IT9 A;  2OLV A;  3UDI A;  2ZQD A;  4K91 A;  2Q9M A;  3SS5 A;  1W7F A;  3TOI A;  4E3I A;  3ZVT A;  2QZ6 A;  3PTE A;  3LY4 A;  3QNC A;  4K0X A;  5J8X A;  3IWO A;  5E2G A;  4EWF A;  4A5R A;  4Y0O A;  1ES5 A;  4IBR A;  3HLC A;  1PWG A;  2VGK A;  3VFF A;  5TFQ A;  5M1A A;  1G68 A;  1ZG4 A;  1XXM A;  2WAD A;  3NCK A;  2FFY A;  4HBT A;  1FSW A;  3IXH A;  3V39 A;  4WYY A;  4BLM A;  4S2P A;  5DF9 A;  3G30 A;  4XXR A;  1NXY A;  1BSG A;  2WGV A;  4GD8 A;  4JF4 A;  3A3I A;  2H0T A;  2Y2J A;  3BFD A;  1YLY A;  2IWC A;  3IF5 A;  1BZA A;  1HZO A;  1PW8 A;  1VM1 A;  2Y2I A;  5G18 A;  4DKI A;  3HUO A;  4OP5 A;  4E3J A;  3IXD A;  3OCN A;  4E3L A;  4KQO A;  5GL9 A;  1YLP A;  5EVI A;  4DXB A;  1K54 A;  3QNB A;  1N4O A;  4N9L A;  3UDX A;  2HPB A;  1FSY A;  2J9O A;  3PBT A;  2XK1 A;  1IEM A;  4M3K A;  2G2W A;  3WS1 A;  4Y0T A;  3S4X A;  3B3X A;  5EVI D;  2EX6 A;  1MWU A;  3UN7 A;  3A3D A;  1MBL A;  1Q2Q A;  4UA9 A;  1G6A A;  3LO7 A;  5EUA A;  3UDF A;  5EVI C;  1K54 C;  5DF8 A;  1KGE A;  1NY0 A;  3PAG A;  4GZB A;  3IWI A;  4NET A;  5DTS A;  5GLD A;  3WS5 A;  1K55 A;  3BFC A;  4N1X A;  1YLT A;  2B5R A;  4P85 A;  4Q8I A;  5GLA A;  4WZ5 A;  5AQ9 A;  5EVI B;  4KZ5 A;  4U0T A;  5EOE A;  4QJG A;  4PM5 A;  5F83 A;  5U47 A;  4GD6 A;  2IWB A;  1XA1 A;  3WRT A;  3Q7Z A;  1LLB A;  4XUZ A;  3NI9 A;  3TG9 A;  4EBN A;  4GOG A;  2Z2L B;  2HDU A;  5GHZ A;  4ZJ2 A;  5GLB A;  1K55 C;  2XDM A;  2Y91 A;  3AGE A;  4OVD A;  1KE0 A;  3GSG A;  1YLJ A;  4JBF A;  3UNW A;  1XGI A;  4RYE A;  5M18 A;  3ZG9 B;  2A49 A;  4WEJ A;  5L2F A;  2Y59 A;  4OOL A;  3AGF A;  1S6R A;  1MWS A;  1NYM A;  3FYZ A;  5HX9 A;  4EBL A;  4R4S A;  3BFF A;  1YM1 A;  3UO9 A;  3GQZ A;  4MBF A;  2HP9 A;  4YIN A;  1QME A;  1ZG6 A;  1ZC2 A;  3IWQ A;  4QB8 A;  2E8I A;  1DY6 A;  2Y2H A;  2Y2N A;  3O88 A;  1ES3 A;  4OOM A;  2UWX A;  1JWZ A;  4MBH A;  4KZB A;  1LI9 A;  5FQM A;  3SH8 A;  2Q9N A;  3ZGA B;  4BD1 A;  2X71 A;  2ZC4 B;  2ZM0 A;  3OCL A;  3HL9 A;  5A91 A;  1XKZ A;  1M6K A;  1ERQ A;  3E2K A;  2ZM2 A;  3VP0 A;  3LY3 A;  3HLE A;  3BRM A;  5FA7 A;  4BEN A;  1JWP A;  4OQI A;  2C5W B;  4S2J A;  3N6I A;  3V50 A;  3M6H A;  4FCF A;  1GHM A;  1L2S A;  5FDH A;  3UPP A;  1PI4 A;  3C7V A;  2Y4A A;  2ZQ8 A;  4EQI A;  2ZLY A;  4O7D A;  2EX8 A;  1XPB A;  3C4O A;  1K56 D;  4K0W A;  4D2O A;  4N9K A;  2DNS A;  1ERO A;  1KVM A;  4LV1 A;  3GVB A;  5F82 A;  4KZ9 A;  2Z2M B;  1ALQ A;  2C6W B;  3GTC A;  4OPQ A;  4KZA A;  4FSF A;  4GB7 A;  4KQR A;  4OPR A;  3GV9 A;  1RGZ A;  4KEN B;  3M6B A;  5FI2 A;  5F1G A;  4P87 A;  1SKF A;  5TGF A;  1PW1 A;  3W4O A;  1BTL A;  3UPO A;  3IXG A;  4PM8 A;  3G32 A;  3ZG0 A;  3IH8 A;  2WZX A;  4OLD A;  4DDY A;  3MZD A;  3UE3 A;  2QPN A;  1KVL A;  4WBG A;  5AQ7 A;  1S0W A;  1XGJ A;  2J7V A;  4WEK A;  2Y2K A;  4KG5 A;  3MFD A;  2XFT A;  2V20 A;  3MZE A;  2OSU A;  1SCW A;  3HLB A;  1HVB A;  3DWK A;  4XUX A;  4UA6 A;  4Z9Q A;  5EPH A;  3CJM A;  3V3R A;  3M2K A;  1K57 A;  3SH7 A;  4H8R A;  4OP8 A;  3OPL A;  3G4P A;  1WYC A;  4C75 A;  4LEN A;  4UHU A;  2DCF A;  3BLM A;  4KZ8 A;  1O7E A;  1FCN A;  1PZO A;  5KSC A;  5A92 A;  3BM6 A;  2CC1 A;  4B4X A;  3OC2 A;  1BLP A;  5DTT A;  1L0G A;  3UE1 A;  1MY8 A;  2WGW A;  2ZQA A;  1YLZ A;  3FKW A;  3BYD A;  1PI5 A;  1K57 C;  2WUQ A;  4S2L A;  5E2F A;  1GHI A;  3RXX A;  5F1F A;  1NRF A;  5CTN A;  5DF7 A;  1ES4 A;  3UPN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...