1JWPA

Structure of m182t mutant of tem-1 beta-lactamase
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTTPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE TEM
publication title Evolution of an antibiotic resistance enzyme constrained by stability and activity trade-offs.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 95
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2001-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1jwpA00
3HLWA 2WZZA 2DRWA 4E3KA 1DY6A 2XF3A 4FH2A 4EUZA 3ZG9B 3A3FA 4EBLA 4WEKA 5HAPA 1YM1A 2ZC5B 3C7UA 3FV7A 3IF5A 1YT4A 1ONGA 3HBRA 2ZC4B 3HLGA 1GCEA 3M2KA 3S4XA 5CXWA 3ZDJA 2BG1A 2X71A 3OCNA 1O07A 5FI7A 2ZQAA 3VOZA 3NIAA 4OPYA 4WMCD 3WS5A 2R9WA 3VMAA 3ITAA 1IELA 2UWXA 2ZQDA 1E4DA 1NXYA 2DCFA 4PMAA 4Y0TA 3ZG7B 1ZG6A 1N9BA 3IHBA 3WRTA 4E3LA 1KDWA 1LI9A 2ZM2A 2ZM8A 1MKIA 2X02A 4GN2A 1PWGA 1PZPA 3JYIA 4RYEA 5DVAA 5A90A 3W4OA 1HVBA 2IWDA 2R9XA 3FKVA 4WYYA 4FCFA 2XLNA 4Y7PA 3GSGA 2ZQCA 1NRFA 4X55A 4S2IA 2G2WA 1YMSA 2Y2OA 5HFOA 2WZXA 3CJMA 1FOFA 1S6RA 1FR1A 3BYDA 2EX6A 1JTGA 3P09A 2EXAA 2ZC3B 1PYYA 2WKHA 2WK0A 4ZJ3A 5GLBA 4JF5A 4IBRA 4R3JA 1M40A 4Z9QA 1W79A 4X68A 4FSFA 4B88A 4S2OA 4GD6A 1Q2PA 1KE4A 4N1XA 3M6BA 1G6AA 3IWQA 4WELA 3C4OA 1MPLA 4XXRA 3V3SA 4KENB 4PM6A 2B5RA 5CGSA 5FQQA 1SHVA 1YLZA 4MNRA 1PZOA 1XA7A 4ZAMA 1PW1A 1ERMA 1ZKJA 5EOEA 4HBUA 1BLHA 1BSGA 3CZDA 4IEDA 4GOGA 4IVIA 4NETA 2H10A 2XK1A 2H5SA 3ZG8B 1BTLA 1MWUA 3VFFA 2Z2LB 1JTDA 1K6RA 1E3UD 2BLSA 3A3DA 3NDGA 4JPMA 4HESA 1N4OA 3AGFA 3PBRA 4LCMA 1JWPA 4WEJA 1ES5A 2ZC6B 3NDEA 4HEFA 4OVDA 3WS2A 3Q7VA 3MKEA 2VGJA 2Y55A 1E3UA 5E2EA 3SS4A 2Z2MB 1TDGA 1KVMA 3M2JA 3RXWA 1GHMA 5CEDA 5I94A 1TEMA 3NBLA 1FSWA 4N9KA 3C4PA 5DTKA 4E3JA 1O7EA 4BJPA 2J9PA 1FQGA 5FSRA 4OONA 2A49A 3UE3A 2RCXA 3TSGA 3G31A 4OPRA 2ZC7A 4OPZA 4P85A 3HUOA 4KG6A 3UPNA 1RP5A 2P74A 3SS3A 3IXDA 4K0XA 4S2MA 1ALQA 4RX3A 2I72A 2XEPA 4LCLA 4BL3A 2WADA 5BOHA 3P98A 2IWBA 3Q82A 4R1GA 3TG9A 4DDYA 4E3NA 1XPBA 2Y2LA 4OP5A 4QD4A 5U47A 5EVID 4QY6A 3QNBA 3G32A 5M1AA 1LL5A 2XD1A 1DJAA 4BENA 3LCEA 1I2WA 2WYXA 4JBFA 3AGEA 3VOYA 1IYQA 5M18A 1GA0A 1CEFA 4U3TA 3MXSA 2J9OA 4GKUA 4R4SA 2HDSA 3BRMA 5CERA 3LY4A 3W4QA 1YQSA 4S2NA 3QHYA 2Y2GA 3CMZA 3ZVWA 1RGZA 2G2UA 4OKPA 3VP2A 4EWFA 3QNCA 1XGIA 2ZMAA 5JYPA 3IF6B 4H8RA 2EX9A 5TGFA 3WS0A 2FFFB 3BFEA 3IH9A 4JF6A 4KZ7A 2WKEA 3G30A 4U0TA 3C5AA 4X53A 2JE5A 5FAPA 5FAOA 5GLAA 1PIOA 4P0MA 1MWRA 5TFQA 4DDSA 3ZFZA 1YLTA 5GHZA 4GB7A 4WZ4A 4L0LA 1PI4A 3UE1A 2CC1A 4FH4A 3OZHA 4LV0A 4PM7A 3SH8A 3O87A 1KVLA 1FR6A 1SCWA 5EVIB 3PBTA 4E6XA 4N92A 4LENA 4KZ8A 4LV2A 3NCKA 3V5MA 4WMCA 3FKWA 3GMWA 4RA7A 4KG5A 2ZD8A 4QB8A 4OOYA 2RL3A 4XUZA 3S1YA 4B4ZA 2V1ZA 3VP0A 5JYOA 4PM8A 4R3BA 4BLMA 1NYMA 1IEMA 2GDNA 4DE3A 4OH0A 1JWZA 3PTEA 5GLDA 1L0GA 3BLSA 4MBKA 5KSHA 4OOMA 3IHAA 3Q1FA 2J7VA 2XH9A 3HREA 4B4XA 5F82A 3OPHA 4OLDA 1Q2QA 3W8KA 3ISGA 3OPPA 1U60A 2ZLYA 1IYPA 3DW0A 4OQHA 4D2OA 2XD5A 4PM5A 1ES4A 2H0YA 4UA9A 4DF6A 4DE2A 2JCHA 3VP4A 1GA9A 1W8YA 4MBHA 1NZUA 3MFDA 5FAQA 5FQ9A 2HP6A 4OQ0A 2WGVA 3BFDA 3UDIA 1RGYA 1LLBA 5AQ7A 3UE0A 4RVAA 4OPQA 5CTMA 5A92A 4WZ5A 2Q9NA 1EI5A 1XGJA 4R23A 4C3QA 4IVKA 1MWSA 1ZG4A 3PBNA 2XDMA 4IBXA 1L0FA 1KDSA 5CHMA 5EECA 3ZG5A 1K54A 4KZ5A 4CPKA 5FI2A 3UO9A 2H0TA 4FD8A 2C6WB 5KZHA 4BL2A 1CI9A 1L0EA 1GHIA 3BM6A 1IYSA 5FASA 3IT9A 2ZQ8A 1ERQA 4UA6A 5AQAA 1QMFA 4KZAA 4P6BA 4KZBA 2ZQ9A 5DF8A 1NZOA 1BLPA 2HDUA 2VGKA 2E8IA 4PM9A 4YINA 2XGNA 3VSKA 5HX9A 3G35A 4DXCA 3MZEA 1SDNA 3GTCA 1Z6FA 4JKTA 4X69A 5EE8A 1XXMA 3HLEA 1KGEA 4ID4A 4MBFA 4OLGA 3ZVTA 4QHCA 1FCOA 4WBGA 1M6KA 2HP9A 3IXGA 2PU2A 5A93A 2Q9MA 4NK3A 3WRZA 2JC7A 1DJBA 3UDFA 4DRTA 1QMEA 3RJUA 1KE3A 1CK3A 3IF6A 2OV5A 4OQIA 5EVIC 3HL9A 3NC8A 5AQBA 3N8RA 5TR7A 1XKZA 4KZ6A 1TDLA 3PAEA 1CI8A 4DXBA 4S2NC 2OLVA 5GLCA 4C75A 3WWXA 3TOIA 1KGFA 2EXBA 4UA7A 3IH8A 1CEGA 1L0DA 3SH7A 3V3RA 1HZOA 1PWCA 3IWIA 1RCJA 5FDHA 2Y2JA 2ZQ7A 1E25A 5GHXA 4DKIA 5EVIA 3VP3A 5F1FA 1K57A 1Y54A 2Y2MA 2Y2QA 4JXSA 3UY6A 3HUMA 3HUNA 2OSUA 3D4FA 1BUEA 2EFXA 3G2ZA 5FQJA 2Y2NA 4S2JA 5E2FA 1YLWA 5FQMA 5FATA 3VFHA 1MWTA 1PWDA 2XFSA 3VP1A 1XP4A 2QMIA 4E3IA 1GHPA 3OCLA 4Y0UA 4R0QA 4X6TA 3WS4A 1HTZA 4EV4A 1BULA 5CECA 4MLLA 5HAIA 5A91A 1SDEA 3AGDA 2A3UA 4ZJ2A 3UN7A 4QJGA 2Y2PA 5F1GA 1ZC2A 3OPRA 1VQQA 3NI9A 4ZDXA 1JVJA 3N7WA 4K91A 4UAAA 4F94A 5HAQA 4ZTKA 4GNUA 1L2SA 1HD8A 1K4EA 2WGWB 2HDRA 3IXHA 2WGIA 4JXWA 4KZ4A 3G2YA 1ESIA 2XFTA 5FI6A 3MZDA 1ONHA 3GVBA 1ES2A 4E3OA 3WS1A 1OMEA 1IYOA 1K4FA 4KQOA 1MY8A 2Y2IA 4HBTA 4XUXA 1I5QA 2PBYA 3BLMA 3N6IA 3Q07A 4QU3A 4LV1A 3SOIA 2P9VB 3E2LA 3N8SA 4KZ9A 3BEBA 3NY4A 2Y2KA 5CRFA 5DTTA 3BFGA 4GD8A 1K55C 1NJ4A 2EFUA 3EQVA 3EQUA 1YLPA 2C5WB 5E43A 5EOOA 3ZGAB 4WZ5C 1LHYA 2OLUA 2WUQA 3RXXA 4KG2A 1PW8A 5EPHA 3LO7A 1JWVA 4U0XA 2IWCA 3A3EA 1K54C 2V20A 3O86A 5FQIA 3ZNTA 1XX2A 3FWLA 4JXVA 1WYBA 3BFCA 3N8LA 3UDXA 3ZCZA 3MKFA 4N9LA 1K55A 1MXOA 3O3VA 2QPNA 3MXRA 5GHYA 3HLBA 3MBZA 2WKIA 4Q8IA 5CTNA 2DNSA 3M6HA 1VM1A 3V50A 3I7JA 1AXBA 3OPLA 3S22A 5CEBA 5G18A 1H8ZA 5CHJA 3SS5A 4OP8A 3OC2A 4N1HA 2QZ6A 4KZ3A 1WE4A 2EX8A 5EUAA 3DWZA 4Y0OA 5AQ9A 1NYYA 4GDNA 5CHUA 1IKGA 4M3KA 4S2LA 4YFMA 2HPBA 3Q7ZA 4ZJ1A 3ZHHA 3G34A 5E2GA 5CGWA 1K6SA 2X01A 3N4IA 4BD1A 2HP5A 2J8YA 3LEZA 4JLFA 3GRJA 3SH9A 5DF7A 1FCNA 3LY3A 1FCMA 4QY5A 4P87A 2XR0A 3GV9A 3O88A 3PBOA 4MEZA 1XA1A 1DJCA 3IF6C 1ESUA 3PBSA 1KGGA 4X56A 4KQRA 1ES3A 4OQGA 5HL1A 1K38A 1K56D 2Y2HA 5KSCA 2Y59A 1MBLA 4WM9A 4C6YA 3HLDA 2Y4AA 5D3OA 2HDQA 4EBPA 5E2HA 3IQAA 1SKFA 2PU4A 4DE0A 3IWOA 2ZM0A 4R4RA 1K56A 1YLJA 4EQIA 2Y91A 4GDBA 3W4PA 3A3IA 5DTSA 1I2SA 4O7DA 5HW3A 5FQKA 5M19A 4GZBA 3CG5A 1K57C 1TVFA 1FSYA 4PPRA 4DE1A 1BT5A 4S2PA 4E6WA 5F83A 1LL9A 3DTMA 1IKIA 3Q81A 5FA7A 3B3XA 4JF4A 3UPPA 5L2FA 1EWZA 4LV3A 1C3BA 3IXBA 4K0WA 3MZFA 4BD0A 4EBNA 5KMWA 2FFYA 1W8QA 1BLSA 1K25A 1WYCA 4RX2A 4UHUA 3V39A 3E2KA 3VSLA 5GL9A 4ZBEA 2WGWA 3DWKA 4BQMA 5IHVA 5HARA 3HLCA 5DF9A 2XQZA 5EVLA 2V2FF 4JXGA 1PI5A 1W5DA 3C7VA 3GR2A 3HLFA 3PAGA 1EROA 4CJNA 1H8YA 5J8XA 1BZAA 1YLYA 3G4PA 1J9MA 1S0WA 4OOLA 3PBQA 4S2KA 1NY0A 4E3MA 4KQQA 2WAEA 1W7FA 3HVFA 2ZJ9A 5CGXA 3Q7VB 2P9VA 3GQZA 1G68A 3UNWA 3ITBA 3BECA 4A5RA 3A3JA 3BFFA 3ZNYA 3FYZA 1BLCA 3UPOA 2EX2A 1LI0A 1KE0A 2WAFA 1YMXA 2JBFA 1H5XA 3ZG0A 3FZCA
chains in the Genus database with same CATH superfamily
2DRWA 3UMDA 1DY6A 3IS2B 3ZG9B 4EBLA 1YM1A 2ZC5B 3FV7A 3IF5A 1ONGA 3HBRA 2ZC4B 4YWZA 5CXWA 2X71A 4UQIS 2ZQAA 2DCFA 4DMZA 1ZG6A 2W27A 3MQQA 1N9BA 3WRTA 1LI9A 2W1RA 2ZM8A 4NKPA 3S7NA 4GN2A 3LGOA 1PWGA 3JYIA 5DVAA 1HVBA 2PBDP 2IWDA 3FKVA 4WYYA 3PR6A 4LGWA 3H82A 2G2WA 4ARZB 5HFOA 2VV8A 1FOFA 3BYDA 2JKTI 4PKYG 1ZTUA 2WK0A 5GLBA 2PRFA 3BQ8A 2VGLM 3MXQA 4HI4A 4WELA 1MPLA 4KENB 4MN6A 3LIEA 1PW1A 1ERMA 1BLHA 4IEDA 4NXBA 2XA7M 3SW1A 1MWUA 1IFQA 3A3DA 4JPMA 4LRXC 4EUVA 3NDEA 1UGUA 3MKEA 2VGJA 5EFWA 2O9BA 2Y55A 3MQ0A 1TDGA 1KVMA 1V9YA 1FSWA 3C4PA 1O7EA 2J9PA 3W2ZA 4KG6A 3DAVA 5DJUA 2I72A 4O01A 4I38A 4GW9A 3Q82A 4DDYA 4QY6A 3QNBA 5K5BA 3U2AA 3LCEA 2WYXA 2GX5A 2EWWA 1IYQA 2PD8A 3S7OA 4ZRRA 3QHYA 2O0YA 3CMZA 4NG2A 2HGVA 5HDDA 2G2UA 4OKPA 5TGFA 4HJ3A 2FFFB 3BFEA 4U0TA 5J3WA 1PIOA 4P0MA 3ZFZA 3B33A 2V0WA 3UE6A 1S67L 1YSQA 1PI4A 3OLOA 4LV0A 4PM7A 5LBRA 3O87A 1SCWA 2W0NA 4E6XA 1XJ2A 4KZ8A 2M7VA 3V5MA 2QYBA 3GMWA 4RA7A 4AFIA 4KG5A 4OOYA 1XJ3A 4R3BA 1NYMA 5IT5A 3BWLA 4L9GA 1L0GA 2W3EA 4MBKA 2XH9A 3HREA 4OLDA 3IX4A 1Q2QA 3ISGA 4D2OA 4UA9A 3VP4A 4II7A 1GA9A 4PHTA 2HP6A 4I3AA 2G7UA 1S1ZA 4OPQA 5A92A 1J3WA 5CHMA 5EECA 1K54A 4KZ5A 4NXGA 5FASA 1ERQA 4HY8A 1LSXA 2A24B 4L9EA 2VGKA 4YINA 5EV0A 3G35A 3MZEA 1SDNA 3GTCA 3P01A 3NOTC 4I39A 4JKTA 4JGOA 4MBFA 3VE4A 2HP9A 3IXGA 4H6JA 2Q9MA 4DRTA 1QMEA 4Q0JA 1KE3A 3IF6A 3KYZA 2OV5A 5TR7A 5AQBA 3MQOA 4KZ6A 1TDLA 4C75A 3TOIA 1CEGA 1L0DA 4GHIA 1HZOA 1PWCA 1RCJA 5FDHA 1E25A 1G5UA 5GHXA 2Y2MA 3LIFA 5EVEA 1CF0A 2OSUA 4EESA 5E2FA 1YLWA 5FQMA 3CUEC 2QMIA 3OCLA 4X6TA 1EW0A 1BULA 4EV4A 3OBFA 4BBVA 2HV1A 1OTAA 4GS9B 4ZJ2A 3UN7A 5AVFA 2Y2PA 4EU0A 3OPRA 1VQQA 3T1QB 2W1TB 1JVJA 4UAAA 4K91A 4ZTKA 5DJTA 2WGWB 5IU1A 4JXWA 3G2YA 1F2KA 2D01A 5G4YA 1MY8A 2Y2IA 3LICA 4CLCB 4XUXA 2PBYA 4QU3A 3N8SA 3BEBA 4FTXA 1NJ4A 1ACFA 2EFUA 1YLPA 4WZ5C 1LHYA 1JWVA 4U0XA 5FEGA 4FUWA 5FQIA 3ZNTA 3FWLA 4JXVA 3JPUA 3N8LA 3HJKA 4UEYA 3MXRA 3MBZA 2DNSA 4IUKA 5CEBA 2W3FA 3SS5A 2YKHA 2HPBA 4WL9A 4BD1A 2R78A 4JLFA 4P87A 4X1MA 1XA1A 4X56A 3QP8A 4OQGA 2Y2HA 3H82B 3HLDA 3BW6A 3L9KA 3KSGA 5E2HA 1SKFA 1LSVA 1K56A 2ZBBA 3A3IA 1I2SA 4GZBA 3CG5A 4KUKA 3T4TA 1OJGA 4DE1A 2O9CA 1BT5A 2VKSA 5HPIA 1EWZA 1W8QA 4RX2A 4UHUA 4EETB 5DFYA 3VSLA 3NOUC 3DWKA 4BQMA 5IHVA 5AVEA 3BY9A 4CLCD 3C7VA 1EROA 4ESPA 3OOVA 3MFXA 3G4PA 1J9MA 1NY0A 4KQQA 5HZHA 1W7FA 3GQZA 3UNWA 3BECA 4R6LA 2Y8HA 1BLCA 3R4KA 2EX2A 3UB7A 1LI0A 1KE0A 2HZ5A 2JBFA 3LYXA 3ZG0A 2PR6A 4E3KA 2XF3A 4EUZA 1S1YA 2JKRI 5HAPA 1YT4A 3HLGA 1GCEA 3S4XA 3C30A 3WS5A 4OPYA 1IELA 1NXYA 4PMAA 2L4RA 3IHBA 3A0VA 3LR3A 4E3LA 3JVUA 3QP4A 4RYEA 1NRFA 1TF1A 1PFLA 1YSPA 2Y2OA 2WZXA 3A0SA 5A8BA 2EX6A 3KYQA 1F98A 4ZJ3A 3E4OA 4IBRA 4R3JA 4X68A 3PXPA 4ETXA 4GD6A 4N1XA 5DKKA 4NXFA 3V3SA 2B5RA 1SHVA 4PKYA 1YLZA 2VV6A 1PZOA 1YAXA 2J3TC 4LLOB 4CLCE 3K3CA 1ZKJA 3BQAA 4GOGA 4Q0IA 2XK1A 2B02A 5F5YA 3VFFA 4HP4A 1K6RA 3NDGA 4LCMA 1N4OA 2I9VA 1JWPA 1ES5A 3EEAA 3Q7VA 1E3UA 3RXWA 4WF0A 5FEFA 2BASA 4BJPA 5FSRA 2PD7A 4OONA 3T4QA 5AJGA 4B93A 3G31A 4OPRA 2ZC7A 4OPZA 2P74A 3SS3A 5HWWA 4S2MA 2XEPA 3K3DA 1GSVA 1SKOA 4BL3A 2WADA 3E0YA 5BOHA 2IWBA 1XPBA 2Y2LA 3MF0A 4OP5A 4E04A 5EVID 5L10A 2FZ0A 5M1AA 4BWIA 1MZUA 4BENA 2J80A 3F1NA 4HQAA 4LRYC 4EEUA 3S7PA 4U3TA 5F6AA 2V9AA 2J9OA 5CERA 3BRMA 3LY4A 1OTIA 4S2NA 2Z6CA 3F1OA 4H6JB 2QJ7A 1XGIA 4ME4A 5JYPA 3IF6B 2EX9A 4JF6A 5FAPA 3C5AA 4HH2A 2JE5A 3R7WA 1MWRA 5TFQA 3LR4A 4WZ4A 4L0LA 4GHIB 2CC1A 5F69A 5MC7A 3SH8A 1FR6A 3FKWA 3UB9A 4QB8A 4XUZA 4B4ZA 3VP0A 3T1RA 5JYOA 1IEMA 2M1CA 3EOIA 4I3JA 2P7JA 3BLSA 4X1LA 4OOMA 3IHAA 4B4XA 5F82A 3OPPA 2A2LA 1U60A 4OQHA 1ES4A 2H0YA 2VJWA 1OT6A 3LEQA 5FAQA 4OQ0A 3BFDA 3CAXA 5CX7A 5HPFA 4RVAA 2Q9NA 1XGJA 4C3QA 4EQ1A 1TS6A 1ZG4A 2YKFA 2EWVA 4IBXA 1L0FA 4HP9A 1CQAA 5FI2A 2WKRA 1GHIA 3P7NA 3IT9A 4UA6A 4KZBA 2HDUA 4DXCA 1D7EA 1P9RA 5EE8A 4MDZA 1XXMA 3HLEA 3NHQA 4QHCA 3ZVTA 2WKQA 5A93A 4P6ZM 2JC7A 3UDFA 3RJUA 3HL9A 3EGDC 1CI8A 2K2NA 5HDSA 2UV0E 4DKIA 5EVIA 1JNUA 1Y54A 4JXSA 3E4QA 4S2JA 1FILA 2XFSA 4KUOA 2VEAA 1GHPA 3NOPC 4R0QA 3WS4A 1W63Q 4MLLA 1SDEA 1VEUA 1OTEA 4ZDXA 2MJ6A 4GNUA 1K4EA 2HDRA 2XFTA 3MZDA 1ONHA 4E3OA 3V67A 3WS1A 3UB6A 1K4FA 1I5QA 3BLMA 3E2LA 2K31A 4YOFA 5CRFA 3BJNA 2Y79A 3VE3A 1Y4OA 1H8MA 2PT7A 3RXXA 5EPHA 2IWCA 3RH8B 3O86A 3ZQ5A 1XX2A 1WYBA 3BFCA 3LUQA 3D3OA 3MKFA 4N9LA 1K55A 3O3VA 5GHYA 3HLBA 2WKIA 4Y3IA 1AXBA 1H8ZA 2H28A 1S4SA 5EUAA 3DWZA 4MN5A 5AQ9A 5L8MA 1NYYA 4YFMA 4M3KA 3G34A 5E2GA 2X01A 3KSFA 2HP5A 2J8YA 3SH9A 5DF7A 3K2NA 4MEZA 1DJCA 3PBSA 2HF6A 3TW8A 1ES3A 5HL1A 1K56D 4WM9A 5G4ZA 2HDQA 1T1CA 3IQAA 3IWOA 1YLJA 2Y91A 4GDBA 1T1AA 3VV4A 5DTSA 5M19A 1DP9A 1K57C 4S2PA 5F83A 1IKIA 3Q81A 5FA7A 3B3XA 3UPPA 5L2FA 3BY8A 4LV3A 1C3BA 3EWKA 5KMWA 4BD0A 2FFYA 1BLSA 4K08A 3V39A 3E2KA 2KLIA 3KSIA 3HLCA 1YLYA 1S0WA 4UQIM 4E3MA 1OTDA 2ZJ9A 2Z6DA 3MS6A 2P9VA 3Q7VB 3ITBA 2XRNA 3U4LP 3BFFA 2JKGA 5L09A 2WAFA 1A0KA 4Y5FA 1IOUA 1ODVA 3CPTA 3FZCA 2WZZA 1PNEA 5C5KA 4FH2A 3CWFA 4WEKA 3C7UA 1SKOB 2O99A 3M2KA 4HJ4A 3ZDJA 1O07A 5FI7A 3F1NB 3NJAA 3VOZA 3NIAA 2R9WA 3VMAA 1DP6A 2ZQDA 3LR0A 1E4DA 2FH5A 4Y0TA 3B42A 3ZG7B 3F1OB 1MKIA 2X02A 5EM0A 2QKPA 3D9YA 1DP8A 2XLNA 4Y7PA 5HD5A 1DRMA 1XFQA 3R7WB 1WA9A 3TJZC 3CJMA 3RFBA 1FR1A 4JF5A 4Z9QA 4ETZA 1M40A 5EM1A 3M6BA 4DJ3A 1G6AA 3C4OA 4MNRA 2V1AA 2Q0OA 4HBUA 4IVIA 3CZDA 2H10A 1BTLA 1JTDA 1E3UD 2BLSA 3VOYA 4HESA 3AGFA 3PBRA 4I5SA 2ZC6B 4HEFA 3WS2A 2VGLS 3SS4A 3C8CA 3ICYA 3M2JA 5CEDA 5I94A 3NBLA 4E3JA 1FQGA 2W3HA 3NECA 4LPZA 4CLCC 2A49A 2RCXA 3TSGA 4JGRA 1SZVA 2ZOHA 3HUOA 4P85A 4DJ2A 2NUPC 3UPNA 1RP5A 3IXDA 5L07A 4MCWA 1CJFA 4RX3A 4BMWA 2XA7S 4R1GA 3TG9A 3L7HA 2M7UA 1LL5A 2XD1A 1DJAA 4JBFA 3AGEA 5M18A 1GA0A 3W4QA 1YPRA 3ZVWA 1RGZA 2P08A 4P6ZS 3VP2A 4EWFA 3QNCA 2ZMAA 3WS0A 4KZ7A 5FAOA 3G30A 3C2WA 5GLAA 5GHZA 3QP1A 4GLQA 4GB7A 3SZTA 1BYWA 3UE1A 3CUEA 2OWJA 1KVLA 5EVIB 4N92A 4LENA 4F3LA 2ZD8A 2RL3A 2P04A 1L3LA 2V1ZA 4Y17A 2GDNA 1JWZA 3PTEA 5GLDA 5KSHA 1VEUB 2J7VA 3OPHA 3W8KA 1IYPA 2OOLA 4PM5A 4DE2A 3CITA 4MBHA 5FQ9A 3DTEA 2OAQ1 3UE0A 1LLBA 2ACGA 1MC0A 5CTMA 4WZ5A 1EI5A 4R23A 1MWSA 4PAUA 2XDMA 4XT2A 4G3WA 1LT0A 3S7QA 3UO9A 1OTBA 2C6WB 1GSXA 2PR5A 1L0EA 4NXEA 3BM6A 1IYSA 2ZL1A 3MMHA 5AQAA 1QMFA 3T4SA 3O5YA 4P6BA 1TS7A 2JKTM 2V8FA 1NLYA 1X0OA 1BLPA 2E8IA 4QPRA 1OT9A 4PM9A 3F1PA 1VETA 3KSHA 1OPXA 4X69A 1Z6FA 1KGEA 4ID4A 4OLGA 5J7EA 1FCOA 2KDKA 2LB5A 2PU2A 3WRZA 4JGPA 3D72A 4OQIA 5EVIC 2OLVA 1KGFA 2EXBA 3PHYA 3IH8A 3SH7A 3V3RA 2PYPA 3ULFA 2Y2JA 2OAP1 4CQHA 3VP3A 2KOIA 4R70A 3TE8A 1T19A 3UY6A 3HUMA 3HUNA 3D4FA 3G2ZA 1BUEA 2EFXA 4BBTA 2Y2NA 4Y13A 1XJ6A 5TBMA 1MWTA 3VP1A 1XP4A 4GJ4A 2ZMFA 5CECA 3MJQA 5A91A 3UB5P 4QJGA 2XROA 5F1GA 4RQ9A 3NI9A 4O0PA 4F94A 5HAQA 1L2SA 2BTFP 3FC7A 4KZ4A 1N9NA 3GVBA 1ES2A 1XJ4A 1OMEA 1IYOA 1YKDA 4HBTA 3ZYTA 4MMNA 4HHDA 3Q07A 4LV1A 2P9VB 3NY4A 4HOIA 5DTTA 3BFGA 1K55C 1VB6A 2C5WB 5E43A 3UMEA 3ZGAB 2HJ9C 2WUQA 1N9LA 1HLUP 4R3AA 1PW8A 3CPTB 3LO7A 3A3EA 1K54C 3UDXA 4IHQA 4G3VA 4YNRA 2IA2A 2QPNA 4Q8IA 5CTNA 3M6HA 1VM1A 3V50A 3I7JA 3OPLA 3S22A 1MKMA 1STZA 4OP8A 3OC2A 1WE4A 2EX8A 1IKGA 4S2LA 3ZHHA 5CGWA 3HJIA 2ZMVA 3T4OA 4FOFA 5IS1A 3GRJA 5HSQA 3GV9A 3IF6C 1ESUA 4IUHA 1KGGA 2J3WA 4KQRA 2EA9A 2Y59A 1MBLA 4C6YA 2PHYA 4DE0A 4R4RA 3RTYA 4EQIA 4HH3A 3W4PA 1TVFA 1FSYA 4PPRA 3GDIA 3LIBA 4E6WA 1LL9A 3DTMA 4JF4A 5HDCA 3MZFA 1WYCA 4ZBEA 5HARA 3GECA 5DF9A 5EVLA 4JXGA 1W5DA 3GR2A 3PAGA 3EGXC 1H8YA 3H7WA 4OOLA 5HL6A 2VZWA 2WAEA 1Y28A 3HVFA 5CGXA 3T1XA 1G68A 4L9FA 4A5RA 4R38A 2L1MA 4MN7A 3ZNYA 2VV7A 3UPOA 1YMXA 3T4KA 1H5XA 4UA7A 3HLWA 1GSWA 1VHMA 2ZOIA 5DKLA 3A3FA 3T50A 3H9WA 1G28A 2BG1A 3OCNA 2QHKA 1FIKA 4WMCD 2B95A 1ZHHB 3ITAA 2UWXA 2V1BA 1KDWA 5HD3A 2ZM2A 3QP6A 1PZPA 5A90A 3W4OA 2R9XA 4FCFA 5I5LA 1LSWA 3VOLA 3GSGA 2ZQCA 2PAVP 4X55A 1NLZA 4S2IA 4QWOA 1YMSA 2JHEA 2HJEA 3HCYA 1S6RA 3CI6A 1JTGA 3P09A 2EXAA 2ZC3B 1PYYA 2WKHA 4WN5A 3DTKA 1W79A 2O9AA 4FSFA 4B88A 3DTIA 4S2OA 1Q2PA 1KE4A 3KO6A 2QWSA 1KOUA 4F3LB 4NEED 4EERA 3IWQA 3IX8A 4XXRA 5HWTA 4PM6A 2VA0A 5CGSA 3T12B 1UWNX 5FQQA 1K0KA 3PYPA 1XA7A 2VLGA 3A0RA 4ZAMA 1OJ5A 2JN7A 2GJ3A 5EOEA 4NETA 1BSGA 4D60A 4B9OA 2KX6A 4Z1WA 2VK3A 2H5SA 3ZG8B 2W3DA 4Y15A 2Z2LB 4ZJ1A 4WEJA 4OVDA 2W3GA 5E2EA 2Z2MB 1GHMA 1TEMA 4N9KA 4O8GA 5DTKA 2GNXA 3LIAA 4XT2B 3UE3A 1TD5A 2L0WA 3LIDA 3IS2A 4K0XA 1ALQA 1AWIA 1G6OA 2ZL1B 4LCLA 3P98A 5DFXA 4E3NA 4QD4A 5U47A 3G32A 1I2WA 3F1PB 1VETB 1CEFA 3MXSA 4GKUA 4R4SA 2HDSA 1YQSA 2Y2GA 1S66L 2XSSA 1PRQA 4I3IA 4H8RA 1D06A 3IH9A 2WKEA 4HJ6A 4X53A 2K7SA 4WLAA 4DDSA 1YLTA 3FPWA 4ARZA 4FH4A 3OZHA 4EXOA 4EW7A 3PBTA 1NRJA 4LV2A 3LI9A 3NCKA 4WMCA 3NULA 5TBMB 3S1YA 3KX0X 4PM8A 4BLMA 2JKRM 4DE3A 1XFNA 4OH0A 5FDSA 2PYRA 4IJGA 1LL8A 3Q1FA 4HIAA 2ZLYA 3DW0A 2XD5A 4WUJA 4DF6A 2JCHA 1W8YA 1NZUA 3MFDA 2WGVA 3UDIA 1RGYA 5AQ7A 2NUTC 2E8JA 4IVKA 4G3KA 3PBNA 1KDSA 5J4EA 3ZG5A 4CPKA 1P0ZA 1P97A 2H0TA 4FD8A 3B47A 5KZHA 4BL2A 1CI9A 2ZQ8A 4KZAA 2WKPA 2GZAA 2ZQ9A 3E4PA 5DF8A 2DMWA 1NZOA 2XGNA 3VSKA 5HX9A 4GCZA 3IBJA 3IBRA 4WBGA 1M6KA 2QJ5A 4NK3A 1DJBA 1CK3A 1D1JA 3NC8A 4X25A 3N8RA 1XKZA 3PAEA 4DXBA 2OWHA 4S2NC 3T4LA 5GLCA 3WWXA 5F68A 3IWIA 2ZQ7A 5F1FA 3MSHA 1K57A 2Y2QA 5FQJA 4JGQA 5FATA 3VFHA 3E98A 1PWDA 4LRZE 4E3IA 4Y0UA 2V8CA 3UB8A 1HTZA 3T1SA 1UWPX 3MR0A 5HAIA 4M4XA 3AGDA 2A3UA 3C38A 1ZC2A 1T18A 3N7WA 4Q0HA 1HD8A 3IXHA 2WGIA 2D02A 1ESIA 5FI6A 4KQOA 3H7WB 1F5MA 2VX8A 2PDRA 2INWA 3N6IA 3SOIA 4KZ9A 2Y2KA 4GD8A 1W63M 3EQVA 3EQUA 5EOOA 3G6OA 2OLUA 2JKFA 4KG2A 3QP5A 2V20A 2A24A 3ZCZA 4LFUA 4HNBA 1MXOA 1Z09A 1S4RA 3LR5A 5G18A 1H0MA 5CHJA 4N1HA 2QZ6A 4KZ3A 4Y0OA 4GDNA 5CHUA 3Q7ZA 1TS8A 2LB9A 1K6SA 3JVVA 1V9ZA 3N4IA 2B18A 3LEZA 1T1BA 1FCNA 3LY3A 1FCMA 4QY5A 2XR0A 4EEPA 3O88A 3PBOA 2AVXA 1H3QA 1K38A 5KSCA 3DBAA 2Y4AA 5D3OA 5FL3A 4EBPA 3EEHA 2J3TD 2PU4A 2ZM0A 3CLOA 4O7DA 5HW3A 5FQKA 3LI8A 5HWVA 4Y2FA 4KQDA 4GS9A 3CHWP 3IXBA 4K0WA 1TS0A 4EBNA 3TRCA 2W1TA 1K25A 5GL9A 2WGWA 3QP2A 2XQZA 2V2FF 1NWZA 1PI5A 3HLFA 1F9IA 4CJNA 5J8XA 5KIZA 1BZAA 1P9WA 4CLCA 4BBUA 3PBQA 3LFVA 4S2KA 1N9OA 3IX3A 3KYEA 5TJJA 4DN0A 2V0UA 3T4JA 2CMNA 3A3JA 3FYZA 3FG8A 3FPVA
chains in the Genus database with same CATH topology
3HLWA 2WZZA 2DRWA 4E3KA 1DY6A 2XF3A 4FH2A 4EUZA 3ZG9B 3A3FA 4EBLA 4WEKA 5HAPA 1YM1A 2ZC5B 3C7UA 3FV7A 3IF5A 1YT4A 1ONGA 3HBRA 2ZC4B 3HLGA 1GCEA 3M2KA 3S4XA 5CXWA 3ZDJA 2BG1A 2X71A 3OCNA 1O07A 5FI7A 2ZQAA 3VOZA 3NIAA 4OPYA 4WMCD 3WS5A 2R9WA 3VMAA 3ITAA 1IELA 2UWXA 2ZQDA 1E4DA 1NXYA 2DCFA 4PMAA 4Y0TA 3ZG7B 1ZG6A 1N9BA 3IHBA 3WRTA 4E3LA 1KDWA 1LI9A 2ZM2A 2ZM8A 1MKIA 2X02A 4GN2A 1PWGA 1PZPA 3JYIA 4RYEA 5DVAA 5A90A 3W4OA 1HVBA 2IWDA 2R9XA 3FKVA 4WYYA 4FCFA 2XLNA 4Y7PA 3GSGA 2ZQCA 1NRFA 4X55A 4S2IA 2G2WA 1YMSA 2Y2OA 5HFOA 2WZXA 3CJMA 1FOFA 1S6RA 1FR1A 3BYDA 2EX6A 1JTGA 3P09A 2EXAA 2ZC3B 1PYYA 2WKHA 2WK0A 4ZJ3A 5GLBA 4JF5A 4IBRA 4R3JA 1M40A 4Z9QA 1W79A 4X68A 4FSFA 4B88A 4S2OA 4GD6A 1Q2PA 1KE4A 4N1XA 3M6BA 1G6AA 3IWQA 4WELA 3C4OA 1MPLA 4XXRA 3V3SA 4KENB 4PM6A 2B5RA 5CGSA 5FQQA 1SHVA 1YLZA 4MNRA 1PZOA 1XA7A 4ZAMA 1PW1A 1ERMA 1ZKJA 5EOEA 4HBUA 1BLHA 1BSGA 3CZDA 4IEDA 4GOGA 4IVIA 4NETA 2H10A 2XK1A 2H5SA 3ZG8B 1BTLA 1MWUA 3VFFA 2Z2LB 1JTDA 1K6RA 1E3UD 2BLSA 3A3DA 3NDGA 4JPMA 4HESA 1N4OA 3AGFA 3PBRA 4LCMA 1JWPA 4WEJA 1ES5A 2ZC6B 3NDEA 4HEFA 4OVDA 3WS2A 3Q7VA 3MKEA 2VGJA 2Y55A 1E3UA 5E2EA 3SS4A 2Z2MB 1TDGA 1KVMA 3M2JA 3RXWA 1GHMA 5CEDA 5I94A 1TEMA 3NBLA 1FSWA 4N9KA 3C4PA 5DTKA 4E3JA 1O7EA 4BJPA 2J9PA 1FQGA 5FSRA 4OONA 2A49A 3UE3A 2RCXA 3TSGA 3G31A 4OPRA 2ZC7A 4OPZA 4P85A 3HUOA 4KG6A 3UPNA 1RP5A 2P74A 3SS3A 3IXDA 4K0XA 4S2MA 1ALQA 4RX3A 2I72A 2XEPA 4LCLA 4BL3A 2WADA 5BOHA 3P98A 2IWBA 3Q82A 4R1GA 3TG9A 4DDYA 4E3NA 1XPBA 2Y2LA 4OP5A 4QD4A 5U47A 5EVID 4QY6A 3QNBA 3G32A 5M1AA 1LL5A 2XD1A 1DJAA 4BENA 3LCEA 1I2WA 2WYXA 4JBFA 3AGEA 3VOYA 1IYQA 5M18A 1GA0A 1CEFA 4U3TA 3MXSA 2J9OA 4GKUA 4R4SA 2HDSA 3BRMA 5CERA 3LY4A 3W4QA 1YQSA 4S2NA 3QHYA 2Y2GA 3CMZA 3ZVWA 1RGZA 2G2UA 4OKPA 3VP2A 4EWFA 3QNCA 1XGIA 2ZMAA 5JYPA 3IF6B 4H8RA 2EX9A 5TGFA 3WS0A 2FFFB 3BFEA 3IH9A 4JF6A 4KZ7A 2WKEA 3G30A 4U0TA 3C5AA 4X53A 2JE5A 5FAPA 5FAOA 5GLAA 1PIOA 4P0MA 1MWRA 5TFQA 4DDSA 3ZFZA 1YLTA 5GHZA 4GB7A 4WZ4A 4L0LA 1PI4A 3UE1A 2CC1A 4FH4A 3OZHA 4LV0A 4PM7A 3SH8A 3O87A 1KVLA 1FR6A 1SCWA 5EVIB 3PBTA 4E6XA 4N92A 4LENA 4KZ8A 4LV2A 3NCKA 3V5MA 4WMCA 3FKWA 3GMWA 4RA7A 4KG5A 2ZD8A 4QB8A 4OOYA 2RL3A 4XUZA 3S1YA 4B4ZA 2V1ZA 3VP0A 5JYOA 4PM8A 4R3BA 4BLMA 1NYMA 1IEMA 2GDNA 4DE3A 4OH0A 1JWZA 3PTEA 5GLDA 1L0GA 3BLSA 4MBKA 5KSHA 4OOMA 3IHAA 3Q1FA 2J7VA 2XH9A 3HREA 4B4XA 5F82A 3OPHA 4OLDA 1Q2QA 3W8KA 3ISGA 3OPPA 1U60A 2ZLYA 1IYPA 3DW0A 4OQHA 4D2OA 2XD5A 4PM5A 1ES4A 2H0YA 4UA9A 4DF6A 4DE2A 2JCHA 3VP4A 1GA9A 1W8YA 4MBHA 1NZUA 3MFDA 5FAQA 5FQ9A 2HP6A 4OQ0A 2WGVA 3BFDA 3UDIA 1RGYA 1LLBA 5AQ7A 3UE0A 4RVAA 4OPQA 5CTMA 5A92A 4WZ5A 2Q9NA 1EI5A 1XGJA 4R23A 4C3QA 4IVKA 1MWSA 1ZG4A 3PBNA 2XDMA 4IBXA 1L0FA 1KDSA 5CHMA 5EECA 3ZG5A 1K54A 4KZ5A 4CPKA 5FI2A 3UO9A 2H0TA 4FD8A 2C6WB 5KZHA 4BL2A 1CI9A 1L0EA 1GHIA 3BM6A 1IYSA 5FASA 3IT9A 2ZQ8A 1ERQA 4UA6A 5AQAA 1QMFA 4KZAA 4P6BA 4KZBA 2ZQ9A 5DF8A 1NZOA 1BLPA 2HDUA 2VGKA 2E8IA 4PM9A 4YINA 2XGNA 3VSKA 5HX9A 3G35A 4DXCA 3MZEA 1SDNA 3GTCA 1Z6FA 4JKTA 4X69A 5EE8A 1XXMA 3HLEA 1KGEA 4ID4A 4MBFA 4OLGA 3ZVTA 4QHCA 1FCOA 4WBGA 1M6KA 2HP9A 3IXGA 2PU2A 5A93A 2Q9MA 4NK3A 3WRZA 2JC7A 1DJBA 3UDFA 4DRTA 1QMEA 3RJUA 1KE3A 1CK3A 3IF6A 2OV5A 4OQIA 5EVIC 3HL9A 3NC8A 5AQBA 3N8RA 5TR7A 1XKZA 4KZ6A 1TDLA 3PAEA 1CI8A 4DXBA 4S2NC 2OLVA 5GLCA 4C75A 3WWXA 3TOIA 1KGFA 2EXBA 4UA7A 3IH8A 1CEGA 1L0DA 3SH7A 3V3RA 1HZOA 1PWCA 3IWIA 1RCJA 5FDHA 2Y2JA 2ZQ7A 1E25A 5GHXA 4DKIA 5EVIA 3VP3A 5F1FA 1K57A 1Y54A 2Y2MA 2Y2QA 4JXSA 3UY6A 3HUMA 3HUNA 2OSUA 3D4FA 1BUEA 2EFXA 3G2ZA 5FQJA 2Y2NA 4S2JA 5E2FA 1YLWA 5FQMA 5FATA 3VFHA 1MWTA 1PWDA 2XFSA 3VP1A 1XP4A 2QMIA 4E3IA 1GHPA 3OCLA 4Y0UA 4R0QA 4X6TA 3WS4A 1HTZA 4EV4A 1BULA 5CECA 4MLLA 5HAIA 5A91A 1SDEA 3AGDA 2A3UA 4ZJ2A 3UN7A 4QJGA 2Y2PA 5F1GA 1ZC2A 3OPRA 1VQQA 3NI9A 4ZDXA 1JVJA 3N7WA 4K91A 4UAAA 4F94A 5HAQA 4ZTKA 4GNUA 1L2SA 1HD8A 1K4EA 2WGWB 2HDRA 3IXHA 2WGIA 4JXWA 4KZ4A 3G2YA 1ESIA 2XFTA 5FI6A 3MZDA 1ONHA 3GVBA 1ES2A 4E3OA 3WS1A 1OMEA 1IYOA 1K4FA 4KQOA 1MY8A 2Y2IA 4HBTA 4XUXA 1I5QA 2PBYA 3BLMA 3N6IA 3Q07A 4QU3A 4LV1A 3SOIA 2P9VB 3E2LA 3N8SA 4KZ9A 3BEBA 3NY4A 2Y2KA 5CRFA 5DTTA 3BFGA 4GD8A 1K55C 1NJ4A 2EFUA 3EQVA 3EQUA 1YLPA 2C5WB 5E43A 5EOOA 3ZGAB 4WZ5C 1LHYA 2OLUA 2WUQA 3RXXA 4KG2A 1PW8A 5EPHA 3LO7A 1JWVA 4U0XA 2IWCA 3A3EA 1K54C 2V20A 3O86A 5FQIA 3ZNTA 1XX2A 3FWLA 4JXVA 1WYBA 3BFCA 3N8LA 3UDXA 3ZCZA 3MKFA 4N9LA 1K55A 1MXOA 3O3VA 2QPNA 3MXRA 5GHYA 3HLBA 3MBZA 2WKIA 4Q8IA 5CTNA 2DNSA 3M6HA 1VM1A 3V50A 3I7JA 1AXBA 3OPLA 3S22A 5CEBA 5G18A 1H8ZA 5CHJA 3SS5A 4OP8A 3OC2A 4N1HA 2QZ6A 4KZ3A 1WE4A 2EX8A 5EUAA 3DWZA 4Y0OA 5AQ9A 1NYYA 4GDNA 5CHUA 1IKGA 4M3KA 4S2LA 4YFMA 2HPBA 3Q7ZA 4ZJ1A 3ZHHA 3G34A 5E2GA 5CGWA 1K6SA 2X01A 3N4IA 4BD1A 2HP5A 2J8YA 3LEZA 4JLFA 3GRJA 3SH9A 5DF7A 1FCNA 3LY3A 1FCMA 4QY5A 4P87A 2XR0A 3GV9A 3O88A 3PBOA 4MEZA 1XA1A 1DJCA 3IF6C 1ESUA 3PBSA 1KGGA 4X56A 4KQRA 1ES3A 4OQGA 5HL1A 1K38A 1K56D 2Y2HA 5KSCA 2Y59A 1MBLA 4WM9A 4C6YA 3HLDA 2Y4AA 5D3OA 2HDQA 4EBPA 5E2HA 3IQAA 1SKFA 2PU4A 4DE0A 3IWOA 2ZM0A 4R4RA 1K56A 1YLJA 4EQIA 2Y91A 4GDBA 3W4PA 3A3IA 5DTSA 1I2SA 4O7DA 5HW3A 5FQKA 5M19A 4GZBA 3CG5A 1K57C 1TVFA 1FSYA 4PPRA 4DE1A 1BT5A 4S2PA 4E6WA 5F83A 1LL9A 3DTMA 1IKIA 3Q81A 5FA7A 3B3XA 4JF4A 3UPPA 5L2FA 1EWZA 4LV3A 1C3BA 3IXBA 4K0WA 3MZFA 4BD0A 4EBNA 5KMWA 2FFYA 1W8QA 1BLSA 1K25A 1WYCA 4RX2A 4UHUA 3V39A 3E2KA 3VSLA 5GL9A 4ZBEA 2WGWA 3DWKA 4BQMA 5IHVA 5HARA 3HLCA 5DF9A 2XQZA 5EVLA 2V2FF 4JXGA 1PI5A 1W5DA 3C7VA 3GR2A 3HLFA 3PAGA 1EROA 4CJNA 1H8YA 5J8XA 1BZAA 1YLYA 3G4PA 1J9MA 1S0WA 4OOLA 3PBQA 4S2KA 1NY0A 4E3MA 4KQQA 2WAEA 1W7FA 3HVFA 2ZJ9A 5CGXA 3Q7VB 2P9VA 3GQZA 1G68A 3UNWA 3ITBA 3BECA 4A5RA 3A3JA 3BFFA 3ZNYA 3FYZA 1BLCA 3UPOA 2EX2A 1LI0A 1KE0A 2WAFA 1YMXA 2JBFA 1H5XA 3ZG0A 3FZCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HLW A;  2WZZ A;  2DRW A;  4E3K A;  1DY6 A;  2XF3 A;  4FH2 A;  4EUZ A;  3ZG9 B;  3A3F A;  4EBL A;  4WEK A;  5HAP A;  1YM1 A;  2ZC5 B;  3C7U A;  3FV7 A;  3IF5 A;  1YT4 A;  1ONG A;  3HBR A;  2ZC4 B;  3HLG A;  1GCE A;  3M2K A;  3S4X A;  5CXW A;  3ZDJ A;  2BG1 A;  2X71 A;  3OCN A;  1O07 A;  5FI7 A;  2ZQA A;  3VOZ A;  3NIA A;  4OPY A;  4WMC D;  3WS5 A;  2R9W A;  3VMA A;  3ITA A;  1IEL A;  2UWX A;  2ZQD A;  1E4D A;  1NXY A;  2DCF A;  4PMA A;  4Y0T A;  3ZG7 B;  1ZG6 A;  1N9B A;  3IHB A;  3WRT A;  4E3L A;  1KDW A;  1LI9 A;  2ZM2 A;  2ZM8 A;  1MKI A;  2X02 A;  4GN2 A;  1PWG A;  1PZP A;  3JYI A;  4RYE A;  5DVA A;  5A90 A;  3W4O A;  1HVB A;  2IWD A;  2R9X A;  3FKV A;  4WYY A;  4FCF A;  2XLN A;  4Y7P A;  3GSG A;  2ZQC A;  1NRF A;  4X55 A;  4S2I A;  2G2W A;  1YMS A;  2Y2O A;  5HFO A;  2WZX A;  3CJM A;  1FOF A;  1S6R A;  1FR1 A;  3BYD A;  2EX6 A;  1JTG A;  3P09 A;  2EXA A;  2ZC3 B;  1PYY A;  2WKH A;  2WK0 A;  4ZJ3 A;  5GLB A;  4JF5 A;  4IBR A;  4R3J A;  1M40 A;  4Z9Q A;  1W79 A;  4X68 A;  4FSF A;  4B88 A;  4S2O A;  4GD6 A;  1Q2P A;  1KE4 A;  4N1X A;  3M6B A;  1G6A A;  3IWQ A;  4WEL A;  3C4O A;  1MPL A;  4XXR A;  3V3S A;  4KEN B;  4PM6 A;  2B5R A;  5CGS A;  5FQQ A;  1SHV A;  1YLZ A;  4MNR A;  1PZO A;  1XA7 A;  4ZAM A;  1PW1 A;  1ERM A;  1ZKJ A;  5EOE A;  4HBU A;  1BLH A;  1BSG A;  3CZD A;  4IED A;  4GOG A;  4IVI A;  4NET A;  2H10 A;  2XK1 A;  2H5S A;  3ZG8 B;  1BTL A;  1MWU A;  3VFF A;  2Z2L B;  1JTD A;  1K6R A;  1E3U D;  2BLS A;  3A3D A;  3NDG A;  4JPM A;  4HES A;  1N4O A;  3AGF A;  3PBR A;  4LCM A;  1JWP A;  4WEJ A;  1ES5 A;  2ZC6 B;  3NDE A;  4HEF A;  4OVD A;  3WS2 A;  3Q7V A;  3MKE A;  2VGJ A;  2Y55 A;  1E3U A;  5E2E A;  3SS4 A;  2Z2M B;  1TDG A;  1KVM A;  3M2J A;  3RXW A;  1GHM A;  5CED A;  5I94 A;  1TEM A;  3NBL A;  1FSW A;  4N9K A;  3C4P A;  5DTK A;  4E3J A;  1O7E A;  4BJP A;  2J9P A;  1FQG A;  5FSR A;  4OON A;  2A49 A;  3UE3 A;  2RCX A;  3TSG A;  3G31 A;  4OPR A;  2ZC7 A;  4OPZ A;  4P85 A;  3HUO A;  4KG6 A;  3UPN A;  1RP5 A;  2P74 A;  3SS3 A;  3IXD A;  4K0X A;  4S2M A;  1ALQ A;  4RX3 A;  2I72 A;  2XEP A;  4LCL A;  4BL3 A;  2WAD A;  5BOH A;  3P98 A;  2IWB A;  3Q82 A;  4R1G A;  3TG9 A;  4DDY A;  4E3N A;  1XPB A;  2Y2L A;  4OP5 A;  4QD4 A;  5U47 A;  5EVI D;  4QY6 A;  3QNB A;  3G32 A;  5M1A A;  1LL5 A;  2XD1 A;  1DJA A;  4BEN A;  3LCE A;  1I2W A;  2WYX A;  4JBF A;  3AGE A;  3VOY A;  1IYQ A;  5M18 A;  1GA0 A;  1CEF A;  4U3T A;  3MXS A;  2J9O A;  4GKU A;  4R4S A;  2HDS A;  3BRM A;  5CER A;  3LY4 A;  3W4Q A;  1YQS A;  4S2N A;  3QHY A;  2Y2G A;  3CMZ A;  3ZVW A;  1RGZ A;  2G2U A;  4OKP A;  3VP2 A;  4EWF A;  3QNC A;  1XGI A;  2ZMA A;  5JYP A;  3IF6 B;  4H8R A;  2EX9 A;  5TGF A;  3WS0 A;  2FFF B;  3BFE A;  3IH9 A;  4JF6 A;  4KZ7 A;  2WKE A;  3G30 A;  4U0T A;  3C5A A;  4X53 A;  2JE5 A;  5FAP A;  5FAO A;  5GLA A;  1PIO A;  4P0M A;  1MWR A;  5TFQ A;  4DDS A;  3ZFZ A;  1YLT A;  5GHZ A;  4GB7 A;  4WZ4 A;  4L0L A;  1PI4 A;  3UE1 A;  2CC1 A;  4FH4 A;  3OZH A;  4LV0 A;  4PM7 A;  3SH8 A;  3O87 A;  1KVL A;  1FR6 A;  1SCW A;  5EVI B;  3PBT A;  4E6X A;  4N92 A;  4LEN A;  4KZ8 A;  4LV2 A;  3NCK A;  3V5M A;  4WMC A;  3FKW A;  3GMW A;  4RA7 A;  4KG5 A;  2ZD8 A;  4QB8 A;  4OOY A;  2RL3 A;  4XUZ A;  3S1Y A;  4B4Z A;  2V1Z A;  3VP0 A;  5JYO A;  4PM8 A;  4R3B A;  4BLM A;  1NYM A;  1IEM A;  2GDN A;  4DE3 A;  4OH0 A;  1JWZ A;  3PTE A;  5GLD A;  1L0G A;  3BLS A;  4MBK A;  5KSH A;  4OOM A;  3IHA A;  3Q1F A;  2J7V A;  2XH9 A;  3HRE A;  4B4X A;  5F82 A;  3OPH A;  4OLD A;  1Q2Q A;  3W8K A;  3ISG A;  3OPP A;  1U60 A;  2ZLY A;  1IYP A;  3DW0 A;  4OQH A;  4D2O A;  2XD5 A;  4PM5 A;  1ES4 A;  2H0Y A;  4UA9 A;  4DF6 A;  4DE2 A;  2JCH A;  3VP4 A;  1GA9 A;  1W8Y A;  4MBH A;  1NZU A;  3MFD A;  5FAQ A;  5FQ9 A;  2HP6 A;  4OQ0 A;  2WGV A;  3BFD A;  3UDI A;  1RGY A;  1LLB A;  5AQ7 A;  3UE0 A;  4RVA A;  4OPQ A;  5CTM A;  5A92 A;  4WZ5 A;  2Q9N A;  1EI5 A;  1XGJ A;  4R23 A;  4C3Q A;  4IVK A;  1MWS A;  1ZG4 A;  3PBN A;  2XDM A;  4IBX A;  1L0F A;  1KDS A;  5CHM A;  5EEC A;  3ZG5 A;  1K54 A;  4KZ5 A;  4CPK A;  5FI2 A;  3UO9 A;  2H0T A;  4FD8 A;  2C6W B;  5KZH A;  4BL2 A;  1CI9 A;  1L0E A;  1GHI A;  3BM6 A;  1IYS A;  5FAS A;  3IT9 A;  2ZQ8 A;  1ERQ A;  4UA6 A;  5AQA A;  1QMF A;  4KZA A;  4P6B A;  4KZB A;  2ZQ9 A;  5DF8 A;  1NZO A;  1BLP A;  2HDU A;  2VGK A;  2E8I A;  4PM9 A;  4YIN A;  2XGN A;  3VSK A;  5HX9 A;  3G35 A;  4DXC A;  3MZE A;  1SDN A;  3GTC A;  1Z6F A;  4JKT A;  4X69 A;  5EE8 A;  1XXM A;  3HLE A;  1KGE A;  4ID4 A;  4MBF A;  4OLG A;  3ZVT A;  4QHC A;  1FCO A;  4WBG A;  1M6K A;  2HP9 A;  3IXG A;  2PU2 A;  5A93 A;  2Q9M A;  4NK3 A;  3WRZ A;  2JC7 A;  1DJB A;  3UDF A;  4DRT A;  1QME A;  3RJU A;  1KE3 A;  1CK3 A;  3IF6 A;  2OV5 A;  4OQI A;  5EVI C;  3HL9 A;  3NC8 A;  5AQB A;  3N8R A;  5TR7 A;  1XKZ A;  4KZ6 A;  1TDL A;  3PAE A;  1CI8 A;  4DXB A;  4S2N C;  2OLV A;  5GLC A;  4C75 A;  3WWX A;  3TOI A;  1KGF A;  2EXB A;  4UA7 A;  3IH8 A;  1CEG A;  1L0D A;  3SH7 A;  3V3R A;  1HZO A;  1PWC A;  3IWI A;  1RCJ A;  5FDH A;  2Y2J A;  2ZQ7 A;  1E25 A;  5GHX A;  4DKI A;  5EVI A;  3VP3 A;  5F1F A;  1K57 A;  1Y54 A;  2Y2M A;  2Y2Q A;  4JXS A;  3UY6 A;  3HUM A;  3HUN A;  2OSU A;  3D4F A;  1BUE A;  2EFX A;  3G2Z A;  5FQJ A;  2Y2N A;  4S2J A;  5E2F A;  1YLW A;  5FQM A;  5FAT A;  3VFH A;  1MWT A;  1PWD A;  2XFS A;  3VP1 A;  1XP4 A;  2QMI A;  4E3I A;  1GHP A;  3OCL A;  4Y0U A;  4R0Q A;  4X6T A;  3WS4 A;  1HTZ A;  4EV4 A;  1BUL A;  5CEC A;  4MLL A;  5HAI A;  5A91 A;  1SDE A;  3AGD A;  2A3U A;  4ZJ2 A;  3UN7 A;  4QJG A;  2Y2P A;  5F1G A;  1ZC2 A;  3OPR A;  1VQQ A;  3NI9 A;  4ZDX A;  1JVJ A;  3N7W A;  4K91 A;  4UAA A;  4F94 A;  5HAQ A;  4ZTK A;  4GNU A;  1L2S A;  1HD8 A;  1K4E A;  2WGW B;  2HDR A;  3IXH A;  2WGI A;  4JXW A;  4KZ4 A;  3G2Y A;  1ESI A;  2XFT A;  5FI6 A;  3MZD A;  1ONH A;  3GVB A;  1ES2 A;  4E3O A;  3WS1 A;  1OME A;  1IYO A;  1K4F A;  4KQO A;  1MY8 A;  2Y2I A;  4HBT A;  4XUX A;  1I5Q A;  2PBY A;  3BLM A;  3N6I A;  3Q07 A;  4QU3 A;  4LV1 A;  3SOI A;  2P9V B;  3E2L A;  3N8S A;  4KZ9 A;  3BEB A;  3NY4 A;  2Y2K A;  5CRF A;  5DTT A;  3BFG A;  4GD8 A;  1K55 C;  1NJ4 A;  2EFU A;  3EQV A;  3EQU A;  1YLP A;  2C5W B;  5E43 A;  5EOO A;  3ZGA B;  4WZ5 C;  1LHY A;  2OLU A;  2WUQ A;  3RXX A;  4KG2 A;  1PW8 A;  5EPH A;  3LO7 A;  1JWV A;  4U0X A;  2IWC A;  3A3E A;  1K54 C;  2V20 A;  3O86 A;  5FQI A;  3ZNT A;  1XX2 A;  3FWL A;  4JXV A;  1WYB A;  3BFC A;  3N8L A;  3UDX A;  3ZCZ A;  3MKF A;  4N9L A;  1K55 A;  1MXO A;  3O3V A;  2QPN A;  3MXR A;  5GHY A;  3HLB A;  3MBZ A;  2WKI A;  4Q8I A;  5CTN A;  2DNS A;  3M6H A;  1VM1 A;  3V50 A;  3I7J A;  1AXB A;  3OPL A;  3S22 A;  5CEB A;  5G18 A;  1H8Z A;  5CHJ A;  3SS5 A;  4OP8 A;  3OC2 A;  4N1H A;  2QZ6 A;  4KZ3 A;  1WE4 A;  2EX8 A;  5EUA A;  3DWZ A;  4Y0O A;  5AQ9 A;  1NYY A;  4GDN A;  5CHU A;  1IKG A;  4M3K A;  4S2L A;  4YFM A;  2HPB A;  3Q7Z A;  4ZJ1 A;  3ZHH A;  3G34 A;  5E2G A;  5CGW A;  1K6S A;  2X01 A;  3N4I A;  4BD1 A;  2HP5 A;  2J8Y A;  3LEZ A;  4JLF A;  3GRJ A;  3SH9 A;  5DF7 A;  1FCN A;  3LY3 A;  1FCM A;  4QY5 A;  4P87 A;  2XR0 A;  3GV9 A;  3O88 A;  3PBO A;  4MEZ A;  1XA1 A;  1DJC A;  3IF6 C;  1ESU A;  3PBS A;  1KGG A;  4X56 A;  4KQR A;  1ES3 A;  4OQG A;  5HL1 A;  1K38 A;  1K56 D;  2Y2H A;  5KSC A;  2Y59 A;  1MBL A;  4WM9 A;  4C6Y A;  3HLD A;  2Y4A A;  5D3O A;  2HDQ A;  4EBP A;  5E2H A;  3IQA A;  1SKF A;  2PU4 A;  4DE0 A;  3IWO A;  2ZM0 A;  4R4R A;  1K56 A;  1YLJ A;  4EQI A;  2Y91 A;  4GDB A;  3W4P A;  3A3I A;  5DTS A;  1I2S A;  4O7D A;  5HW3 A;  5FQK A;  5M19 A;  4GZB A;  3CG5 A;  1K57 C;  1TVF A;  1FSY A;  4PPR A;  4DE1 A;  1BT5 A;  4S2P A;  4E6W A;  5F83 A;  1LL9 A;  3DTM A;  1IKI A;  3Q81 A;  5FA7 A;  3B3X A;  4JF4 A;  3UPP A;  5L2F A;  1EWZ A;  4LV3 A;  1C3B A;  3IXB A;  4K0W A;  3MZF A;  4BD0 A;  4EBN A;  5KMW A;  2FFY A;  1W8Q A;  1BLS A;  1K25 A;  1WYC A;  4RX2 A;  4UHU A;  3V39 A;  3E2K A;  3VSL A;  5GL9 A;  4ZBE A;  2WGW A;  3DWK A;  4BQM A;  5IHV A;  5HAR A;  3HLC A;  5DF9 A;  2XQZ A;  5EVL A;  2V2F F;  4JXG A;  1PI5 A;  1W5D A;  3C7V A;  3GR2 A;  3HLF A;  3PAG A;  1ERO A;  4CJN A;  1H8Y A;  5J8X A;  1BZA A;  1YLY A;  3G4P A;  1J9M A;  1S0W A;  4OOL A;  3PBQ A;  4S2K A;  1NY0 A;  4E3M A;  4KQQ A;  2WAE A;  1W7F A;  3HVF A;  2ZJ9 A;  5CGX A;  3Q7V B;  2P9V A;  3GQZ A;  1G68 A;  3UNW A;  3ITB A;  3BEC A;  4A5R A;  3A3J A;  3BFF A;  3ZNY A;  3FYZ A;  1BLC A;  3UPO A;  2EX2 A;  1LI0 A;  1KE0 A;  2WAF A;  1YMX A;  2JBF A;  1H5X A;  3ZG0 A;  3FZC A; 
#chains in the Genus database with same CATH topology
 2DRW A;  3UMD A;  1DY6 A;  3IS2 B;  3ZG9 B;  4EBL A;  1YM1 A;  2ZC5 B;  3FV7 A;  3IF5 A;  1ONG A;  3HBR A;  2ZC4 B;  4YWZ A;  5CXW A;  2X71 A;  4UQI S;  2ZQA A;  2DCF A;  4DMZ A;  1ZG6 A;  2W27 A;  3MQQ A;  1N9B A;  3WRT A;  1LI9 A;  2W1R A;  2ZM8 A;  4NKP A;  3S7N A;  4GN2 A;  3LGO A;  1PWG A;  3JYI A;  5DVA A;  1HVB A;  2PBD P;  2IWD A;  3FKV A;  4WYY A;  3PR6 A;  4LGW A;  3H82 A;  2G2W A;  4ARZ B;  5HFO A;  2VV8 A;  1FOF A;  3BYD A;  2JKT I;  4PKY G;  1ZTU A;  2WK0 A;  5GLB A;  2PRF A;  3BQ8 A;  2VGL M;  3MXQ A;  4HI4 A;  4WEL A;  1MPL A;  4KEN B;  4MN6 A;  3LIE A;  1PW1 A;  1ERM A;  1BLH A;  4IED A;  4NXB A;  2XA7 M;  3SW1 A;  1MWU A;  1IFQ A;  3A3D A;  4JPM A;  4LRX C;  4EUV A;  3NDE A;  1UGU A;  3MKE A;  2VGJ A;  5EFW A;  2O9B A;  2Y55 A;  3MQ0 A;  1TDG A;  1KVM A;  1V9Y A;  1FSW A;  3C4P A;  1O7E A;  2J9P A;  3W2Z A;  4KG6 A;  3DAV A;  5DJU A;  2I72 A;  4O01 A;  4I38 A;  4GW9 A;  3Q82 A;  4DDY A;  4QY6 A;  3QNB A;  5K5B A;  3U2A A;  3LCE A;  2WYX A;  2GX5 A;  2EWW A;  1IYQ A;  2PD8 A;  3S7O A;  4ZRR A;  3QHY A;  2O0Y A;  3CMZ A;  4NG2 A;  2HGV A;  5HDD A;  2G2U A;  4OKP A;  5TGF A;  4HJ3 A;  2FFF B;  3BFE A;  4U0T A;  5J3W A;  1PIO A;  4P0M A;  3ZFZ A;  3B33 A;  2V0W A;  3UE6 A;  1S67 L;  1YSQ A;  1PI4 A;  3OLO A;  4LV0 A;  4PM7 A;  5LBR A;  3O87 A;  1SCW A;  2W0N A;  4E6X A;  1XJ2 A;  4KZ8 A;  2M7V A;  3V5M A;  2QYB A;  3GMW A;  4RA7 A;  4AFI A;  4KG5 A;  4OOY A;  1XJ3 A;  4R3B A;  1NYM A;  5IT5 A;  3BWL A;  4L9G A;  1L0G A;  2W3E A;  4MBK A;  2XH9 A;  3HRE A;  4OLD A;  3IX4 A;  1Q2Q A;  3ISG A;  4D2O A;  4UA9 A;  3VP4 A;  4II7 A;  1GA9 A;  4PHT A;  2HP6 A;  4I3A A;  2G7U A;  1S1Z A;  4OPQ A;  5A92 A;  1J3W A;  5CHM A;  5EEC A;  1K54 A;  4KZ5 A;  4NXG A;  5FAS A;  1ERQ A;  4HY8 A;  1LSX A;  2A24 B;  4L9E A;  2VGK A;  4YIN A;  5EV0 A;  3G35 A;  3MZE A;  1SDN A;  3GTC A;  3P01 A;  3NOT C;  4I39 A;  4JKT A;  4JGO A;  4MBF A;  3VE4 A;  2HP9 A;  3IXG A;  4H6J A;  2Q9M A;  4DRT A;  1QME A;  4Q0J A;  1KE3 A;  3IF6 A;  3KYZ A;  2OV5 A;  5TR7 A;  5AQB A;  3MQO A;  4KZ6 A;  1TDL A;  4C75 A;  3TOI A;  1CEG A;  1L0D A;  4GHI A;  1HZO A;  1PWC A;  1RCJ A;  5FDH A;  1E25 A;  1G5U A;  5GHX A;  2Y2M A;  3LIF A;  5EVE A;  1CF0 A;  2OSU A;  4EES A;  5E2F A;  1YLW A;  5FQM A;  3CUE C;  2QMI A;  3OCL A;  4X6T A;  1EW0 A;  1BUL A;  4EV4 A;  3OBF A;  4BBV A;  2HV1 A;  1OTA A;  4GS9 B;  4ZJ2 A;  3UN7 A;  5AVF A;  2Y2P A;  4EU0 A;  3OPR A;  1VQQ A;  3T1Q B;  2W1T B;  1JVJ A;  4UAA A;  4K91 A;  4ZTK A;  5DJT A;  2WGW B;  5IU1 A;  4JXW A;  3G2Y A;  1F2K A;  2D01 A;  5G4Y A;  1MY8 A;  2Y2I A;  3LIC A;  4CLC B;  4XUX A;  2PBY A;  4QU3 A;  3N8S A;  3BEB A;  4FTX A;  1NJ4 A;  1ACF A;  2EFU A;  1YLP A;  4WZ5 C;  1LHY A;  1JWV A;  4U0X A;  5FEG A;  4FUW A;  5FQI A;  3ZNT A;  3FWL A;  4JXV A;  3JPU A;  3N8L A;  3HJK A;  4UEY A;  3MXR A;  3MBZ A;  2DNS A;  4IUK A;  5CEB A;  2W3F A;  3SS5 A;  2YKH A;  2HPB A;  4WL9 A;  4BD1 A;  2R78 A;  4JLF A;  4P87 A;  4X1M A;  1XA1 A;  4X56 A;  3QP8 A;  4OQG A;  2Y2H A;  3H82 B;  3HLD A;  3BW6 A;  3L9K A;  3KSG A;  5E2H A;  1SKF A;  1LSV A;  1K56 A;  2ZBB A;  3A3I A;  1I2S A;  4GZB A;  3CG5 A;  4KUK A;  3T4T A;  1OJG A;  4DE1 A;  2O9C A;  1BT5 A;  2VKS A;  5HPI A;  1EWZ A;  1W8Q A;  4RX2 A;  4UHU A;  4EET B;  5DFY A;  3VSL A;  3NOU C;  3DWK A;  4BQM A;  5IHV A;  5AVE A;  3BY9 A;  4CLC D;  3C7V A;  1ERO A;  4ESP A;  3OOV A;  3MFX A;  3G4P A;  1J9M A;  1NY0 A;  4KQQ A;  5HZH A;  1W7F A;  3GQZ A;  3UNW A;  3BEC A;  4R6L A;  2Y8H A;  1BLC A;  3R4K A;  2EX2 A;  3UB7 A;  1LI0 A;  1KE0 A;  2HZ5 A;  2JBF A;  3LYX A;  3ZG0 A;  2PR6 A;  4E3K A;  2XF3 A;  4EUZ A;  1S1Y A;  2JKR I;  5HAP A;  1YT4 A;  3HLG A;  1GCE A;  3S4X A;  3C30 A;  3WS5 A;  4OPY A;  1IEL A;  1NXY A;  4PMA A;  2L4R A;  3IHB A;  3A0V A;  3LR3 A;  4E3L A;  3JVU A;  3QP4 A;  4RYE A;  1NRF A;  1TF1 A;  1PFL A;  1YSP A;  2Y2O A;  2WZX A;  3A0S A;  5A8B A;  2EX6 A;  3KYQ A;  1F98 A;  4ZJ3 A;  3E4O A;  4IBR A;  4R3J A;  4X68 A;  3PXP A;  4ETX A;  4GD6 A;  4N1X A;  5DKK A;  4NXF A;  3V3S A;  2B5R A;  1SHV A;  4PKY A;  1YLZ A;  2VV6 A;  1PZO A;  1YAX A;  2J3T C;  4LLO B;  4CLC E;  3K3C A;  1ZKJ A;  3BQA A;  4GOG A;  4Q0I A;  2XK1 A;  2B02 A;  5F5Y A;  3VFF A;  4HP4 A;  1K6R A;  3NDG A;  4LCM A;  1N4O A;  2I9V A;  1JWP A;  1ES5 A;  3EEA A;  3Q7V A;  1E3U A;  3RXW A;  4WF0 A;  5FEF A;  2BAS A;  4BJP A;  5FSR A;  2PD7 A;  4OON A;  3T4Q A;  5AJG A;  4B93 A;  3G31 A;  4OPR A;  2ZC7 A;  4OPZ A;  2P74 A;  3SS3 A;  5HWW A;  4S2M A;  2XEP A;  3K3D A;  1GSV A;  1SKO A;  4BL3 A;  2WAD A;  3E0Y A;  5BOH A;  2IWB A;  1XPB A;  2Y2L A;  3MF0 A;  4OP5 A;  4E04 A;  5EVI D;  5L10 A;  2FZ0 A;  5M1A A;  4BWI A;  1MZU A;  4BEN A;  2J80 A;  3F1N A;  4HQA A;  4LRY C;  4EEU A;  3S7P A;  4U3T A;  5F6A A;  2V9A A;  2J9O A;  5CER A;  3BRM A;  3LY4 A;  1OTI A;  4S2N A;  2Z6C A;  3F1O A;  4H6J B;  2QJ7 A;  1XGI A;  4ME4 A;  5JYP A;  3IF6 B;  2EX9 A;  4JF6 A;  5FAP A;  3C5A A;  4HH2 A;  2JE5 A;  3R7W A;  1MWR A;  5TFQ A;  3LR4 A;  4WZ4 A;  4L0L A;  4GHI B;  2CC1 A;  5F69 A;  5MC7 A;  3SH8 A;  1FR6 A;  3FKW A;  3UB9 A;  4QB8 A;  4XUZ A;  4B4Z A;  3VP0 A;  3T1R A;  5JYO A;  1IEM A;  2M1C A;  3EOI A;  4I3J A;  2P7J A;  3BLS A;  4X1L A;  4OOM A;  3IHA A;  4B4X A;  5F82 A;  3OPP A;  2A2L A;  1U60 A;  4OQH A;  1ES4 A;  2H0Y A;  2VJW A;  1OT6 A;  3LEQ A;  5FAQ A;  4OQ0 A;  3BFD A;  3CAX A;  5CX7 A;  5HPF A;  4RVA A;  2Q9N A;  1XGJ A;  4C3Q A;  4EQ1 A;  1TS6 A;  1ZG4 A;  2YKF A;  2EWV A;  4IBX A;  1L0F A;  4HP9 A;  1CQA A;  5FI2 A;  2WKR A;  1GHI A;  3P7N A;  3IT9 A;  4UA6 A;  4KZB A;  2HDU A;  4DXC A;  1D7E A;  1P9R A;  5EE8 A;  4MDZ A;  1XXM A;  3HLE A;  3NHQ A;  4QHC A;  3ZVT A;  2WKQ A;  5A93 A;  4P6Z M;  2JC7 A;  3UDF A;  3RJU A;  3HL9 A;  3EGD C;  1CI8 A;  2K2N A;  5HDS A;  2UV0 E;  4DKI A;  5EVI A;  1JNU A;  1Y54 A;  4JXS A;  3E4Q A;  4S2J A;  1FIL A;  2XFS A;  4KUO A;  2VEA A;  1GHP A;  3NOP C;  4R0Q A;  3WS4 A;  1W63 Q;  4MLL A;  1SDE A;  1VEU A;  1OTE A;  4ZDX A;  2MJ6 A;  4GNU A;  1K4E A;  2HDR A;  2XFT A;  3MZD A;  1ONH A;  4E3O A;  3V67 A;  3WS1 A;  3UB6 A;  1K4F A;  1I5Q A;  3BLM A;  3E2L A;  2K31 A;  4YOF A;  5CRF A;  3BJN A;  2Y79 A;  3VE3 A;  1Y4O A;  1H8M A;  2PT7 A;  3RXX A;  5EPH A;  2IWC A;  3RH8 B;  3O86 A;  3ZQ5 A;  1XX2 A;  1WYB A;  3BFC A;  3LUQ A;  3D3O A;  3MKF A;  4N9L A;  1K55 A;  3O3V A;  5GHY A;  3HLB A;  2WKI A;  4Y3I A;  1AXB A;  1H8Z A;  2H28 A;  1S4S A;  5EUA A;  3DWZ A;  4MN5 A;  5AQ9 A;  5L8M A;  1NYY A;  4YFM A;  4M3K A;  3G34 A;  5E2G A;  2X01 A;  3KSF A;  2HP5 A;  2J8Y A;  3SH9 A;  5DF7 A;  3K2N A;  4MEZ A;  1DJC A;  3PBS A;  2HF6 A;  3TW8 A;  1ES3 A;  5HL1 A;  1K56 D;  4WM9 A;  5G4Z A;  2HDQ A;  1T1C A;  3IQA A;  3IWO A;  1YLJ A;  2Y91 A;  4GDB A;  1T1A A;  3VV4 A;  5DTS A;  5M19 A;  1DP9 A;  1K57 C;  4S2P A;  5F83 A;  1IKI A;  3Q81 A;  5FA7 A;  3B3X A;  3UPP A;  5L2F A;  3BY8 A;  4LV3 A;  1C3B A;  3EWK A;  5KMW A;  4BD0 A;  2FFY A;  1BLS A;  4K08 A;  3V39 A;  3E2K A;  2KLI A;  3KSI A;  3HLC A;  1YLY A;  1S0W A;  4UQI M;  4E3M A;  1OTD A;  2ZJ9 A;  2Z6D A;  3MS6 A;  2P9V A;  3Q7V B;  3ITB A;  2XRN A;  3U4L P;  3BFF A;  2JKG A;  5L09 A;  2WAF A;  1A0K A;  4Y5F A;  1IOU A;  1ODV A;  3CPT A;  3FZC A;  2WZZ A;  1PNE A;  5C5K A;  4FH2 A;  3CWF A;  4WEK A;  3C7U A;  1SKO B;  2O99 A;  3M2K A;  4HJ4 A;  3ZDJ A;  1O07 A;  5FI7 A;  3F1N B;  3NJA A;  3VOZ A;  3NIA A;  2R9W A;  3VMA A;  1DP6 A;  2ZQD A;  3LR0 A;  1E4D A;  2FH5 A;  4Y0T A;  3B42 A;  3ZG7 B;  3F1O B;  1MKI A;  2X02 A;  5EM0 A;  2QKP A;  3D9Y A;  1DP8 A;  2XLN A;  4Y7P A;  5HD5 A;  1DRM A;  1XFQ A;  3R7W B;  1WA9 A;  3TJZ C;  3CJM A;  3RFB A;  1FR1 A;  4JF5 A;  4Z9Q A;  4ETZ A;  1M40 A;  5EM1 A;  3M6B A;  4DJ3 A;  1G6A A;  3C4O A;  4MNR A;  2V1A A;  2Q0O A;  4HBU A;  4IVI A;  3CZD A;  2H10 A;  1BTL A;  1JTD A;  1E3U D;  2BLS A;  3VOY A;  4HES A;  3AGF A;  3PBR A;  4I5S A;  2ZC6 B;  4HEF A;  3WS2 A;  2VGL S;  3SS4 A;  3C8C A;  3ICY A;  3M2J A;  5CED A;  5I94 A;  3NBL A;  4E3J A;  1FQG A;  2W3H A;  3NEC A;  4LPZ A;  4CLC C;  2A49 A;  2RCX A;  3TSG A;  4JGR A;  1SZV A;  2ZOH A;  3HUO A;  4P85 A;  4DJ2 A;  2NUP C;  3UPN A;  1RP5 A;  3IXD A;  5L07 A;  4MCW A;  1CJF A;  4RX3 A;  4BMW A;  2XA7 S;  4R1G A;  3TG9 A;  3L7H A;  2M7U A;  1LL5 A;  2XD1 A;  1DJA A;  4JBF A;  3AGE A;  5M18 A;  1GA0 A;  3W4Q A;  1YPR A;  3ZVW A;  1RGZ A;  2P08 A;  4P6Z S;  3VP2 A;  4EWF A;  3QNC A;  2ZMA A;  3WS0 A;  4KZ7 A;  5FAO A;  3G30 A;  3C2W A;  5GLA A;  5GHZ A;  3QP1 A;  4GLQ A;  4GB7 A;  3SZT A;  1BYW A;  3UE1 A;  3CUE A;  2OWJ A;  1KVL A;  5EVI B;  4N92 A;  4LEN A;  4F3L A;  2ZD8 A;  2RL3 A;  2P04 A;  1L3L A;  2V1Z A;  4Y17 A;  2GDN A;  1JWZ A;  3PTE A;  5GLD A;  5KSH A;  1VEU B;  2J7V A;  3OPH A;  3W8K A;  1IYP A;  2OOL A;  4PM5 A;  4DE2 A;  3CIT A;  4MBH A;  5FQ9 A;  3DTE A;  2OAQ 1;  3UE0 A;  1LLB A;  2ACG A;  1MC0 A;  5CTM A;  4WZ5 A;  1EI5 A;  4R23 A;  1MWS A;  4PAU A;  2XDM A;  4XT2 A;  4G3W A;  1LT0 A;  3S7Q A;  3UO9 A;  1OTB A;  2C6W B;  1GSX A;  2PR5 A;  1L0E A;  4NXE A;  3BM6 A;  1IYS A;  2ZL1 A;  3MMH A;  5AQA A;  1QMF A;  3T4S A;  3O5Y A;  4P6B A;  1TS7 A;  2JKT M;  2V8F A;  1NLY A;  1X0O A;  1BLP A;  2E8I A;  4QPR A;  1OT9 A;  4PM9 A;  3F1P A;  1VET A;  3KSH A;  1OPX A;  4X69 A;  1Z6F A;  1KGE A;  4ID4 A;  4OLG A;  5J7E A;  1FCO A;  2KDK A;  2LB5 A;  2PU2 A;  3WRZ A;  4JGP A;  3D72 A;  4OQI A;  5EVI C;  2OLV A;  1KGF A;  2EXB A;  3PHY A;  3IH8 A;  3SH7 A;  3V3R A;  2PYP A;  3ULF A;  2Y2J A;  2OAP 1;  4CQH A;  3VP3 A;  2KOI A;  4R70 A;  3TE8 A;  1T19 A;  3UY6 A;  3HUM A;  3HUN A;  3D4F A;  3G2Z A;  1BUE A;  2EFX A;  4BBT A;  2Y2N A;  4Y13 A;  1XJ6 A;  5TBM A;  1MWT A;  3VP1 A;  1XP4 A;  4GJ4 A;  2ZMF A;  5CEC A;  3MJQ A;  5A91 A;  3UB5 P;  4QJG A;  2XRO A;  5F1G A;  4RQ9 A;  3NI9 A;  4O0P A;  4F94 A;  5HAQ A;  1L2S A;  2BTF P;  3FC7 A;  4KZ4 A;  1N9N A;  3GVB A;  1ES2 A;  1XJ4 A;  1OME A;  1IYO A;  1YKD A;  4HBT A;  3ZYT A;  4MMN A;  4HHD A;  3Q07 A;  4LV1 A;  2P9V B;  3NY4 A;  4HOI A;  5DTT A;  3BFG A;  1K55 C;  1VB6 A;  2C5W B;  5E43 A;  3UME A;  3ZGA B;  2HJ9 C;  2WUQ A;  1N9L A;  1HLU P;  4R3A A;  1PW8 A;  3CPT B;  3LO7 A;  3A3E A;  1K54 C;  3UDX A;  4IHQ A;  4G3V A;  4YNR A;  2IA2 A;  2QPN A;  4Q8I A;  5CTN A;  3M6H A;  1VM1 A;  3V50 A;  3I7J A;  3OPL A;  3S22 A;  1MKM A;  1STZ A;  4OP8 A;  3OC2 A;  1WE4 A;  2EX8 A;  1IKG A;  4S2L A;  3ZHH A;  5CGW A;  3HJI A;  2ZMV A;  3T4O A;  4FOF A;  5IS1 A;  3GRJ A;  5HSQ A;  3GV9 A;  3IF6 C;  1ESU A;  4IUH A;  1KGG A;  2J3W A;  4KQR A;  2EA9 A;  2Y59 A;  1MBL A;  4C6Y A;  2PHY A;  4DE0 A;  4R4R A;  3RTY A;  4EQI A;  4HH3 A;  3W4P A;  1TVF A;  1FSY A;  4PPR A;  3GDI A;  3LIB A;  4E6W A;  1LL9 A;  3DTM A;  4JF4 A;  5HDC A;  3MZF A;  1WYC A;  4ZBE A;  5HAR A;  3GEC A;  5DF9 A;  5EVL A;  4JXG A;  1W5D A;  3GR2 A;  3PAG A;  3EGX C;  1H8Y A;  3H7W A;  4OOL A;  5HL6 A;  2VZW A;  2WAE A;  1Y28 A;  3HVF A;  5CGX A;  3T1X A;  1G68 A;  4L9F A;  4A5R A;  4R38 A;  2L1M A;  4MN7 A;  3ZNY A;  2VV7 A;  3UPO A;  1YMX A;  3T4K A;  1H5X A;  4UA7 A;  3HLW A;  1GSW A;  1VHM A;  2ZOI A;  5DKL A;  3A3F A;  3T50 A;  3H9W A;  1G28 A;  2BG1 A;  3OCN A;  2QHK A;  1FIK A;  4WMC D;  2B95 A;  1ZHH B;  3ITA A;  2UWX A;  2V1B A;  1KDW A;  5HD3 A;  2ZM2 A;  3QP6 A;  1PZP A;  5A90 A;  3W4O A;  2R9X A;  4FCF A;  5I5L A;  1LSW A;  3VOL A;  3GSG A;  2ZQC A;  2PAV P;  4X55 A;  1NLZ A;  4S2I A;  4QWO A;  1YMS A;  2JHE A;  2HJE A;  3HCY A;  1S6R A;  3CI6 A;  1JTG A;  3P09 A;  2EXA A;  2ZC3 B;  1PYY A;  2WKH A;  4WN5 A;  3DTK A;  1W79 A;  2O9A A;  4FSF A;  4B88 A;  3DTI A;  4S2O A;  1Q2P A;  1KE4 A;  3KO6 A;  2QWS A;  1KOU A;  4F3L B;  4NEE D;  4EER A;  3IWQ A;  3IX8 A;  4XXR A;  5HWT A;  4PM6 A;  2VA0 A;  5CGS A;  3T12 B;  1UWN X;  5FQQ A;  1K0K A;  3PYP A;  1XA7 A;  2VLG A;  3A0R A;  4ZAM A;  1OJ5 A;  2JN7 A;  2GJ3 A;  5EOE A;  4NET A;  1BSG A;  4D60 A;  4B9O A;  2KX6 A;  4Z1W A;  2VK3 A;  2H5S A;  3ZG8 B;  2W3D A;  4Y15 A;  2Z2L B;  4ZJ1 A;  4WEJ A;  4OVD A;  2W3G A;  5E2E A;  2Z2M B;  1GHM A;  1TEM A;  4N9K A;  4O8G A;  5DTK A;  2GNX A;  3LIA A;  4XT2 B;  3UE3 A;  1TD5 A;  2L0W A;  3LID A;  3IS2 A;  4K0X A;  1ALQ A;  1AWI A;  1G6O A;  2ZL1 B;  4LCL A;  3P98 A;  5DFX A;  4E3N A;  4QD4 A;  5U47 A;  3G32 A;  1I2W A;  3F1P B;  1VET B;  1CEF A;  3MXS A;  4GKU A;  4R4S A;  2HDS A;  1YQS A;  2Y2G A;  1S66 L;  2XSS A;  1PRQ A;  4I3I A;  4H8R A;  1D06 A;  3IH9 A;  2WKE A;  4HJ6 A;  4X53 A;  2K7S A;  4WLA A;  4DDS A;  1YLT A;  3FPW A;  4ARZ A;  4FH4 A;  3OZH A;  4EXO A;  4EW7 A;  3PBT A;  1NRJ A;  4LV2 A;  3LI9 A;  3NCK A;  4WMC A;  3NUL A;  5TBM B;  3S1Y A;  3KX0 X;  4PM8 A;  4BLM A;  2JKR M;  4DE3 A;  1XFN A;  4OH0 A;  5FDS A;  2PYR A;  4IJG A;  1LL8 A;  3Q1F A;  4HIA A;  2ZLY A;  3DW0 A;  2XD5 A;  4WUJ A;  4DF6 A;  2JCH A;  1W8Y A;  1NZU A;  3MFD A;  2WGV A;  3UDI A;  1RGY A;  5AQ7 A;  2NUT C;  2E8J A;  4IVK A;  4G3K A;  3PBN A;  1KDS A;  5J4E A;  3ZG5 A;  4CPK A;  1P0Z A;  1P97 A;  2H0T A;  4FD8 A;  3B47 A;  5KZH A;  4BL2 A;  1CI9 A;  2ZQ8 A;  4KZA A;  2WKP A;  2GZA A;  2ZQ9 A;  3E4P A;  5DF8 A;  2DMW A;  1NZO A;  2XGN A;  3VSK A;  5HX9 A;  4GCZ A;  3IBJ A;  3IBR A;  4WBG A;  1M6K A;  2QJ5 A;  4NK3 A;  1DJB A;  1CK3 A;  1D1J A;  3NC8 A;  4X25 A;  3N8R A;  1XKZ A;  3PAE A;  4DXB A;  2OWH A;  4S2N C;  3T4L A;  5GLC A;  3WWX A;  5F68 A;  3IWI A;  2ZQ7 A;  5F1F A;  3MSH A;  1K57 A;  2Y2Q A;  5FQJ A;  4JGQ A;  5FAT A;  3VFH A;  3E98 A;  1PWD A;  4LRZ E;  4E3I A;  4Y0U A;  2V8C A;  3UB8 A;  1HTZ A;  3T1S A;  1UWP X;  3MR0 A;  5HAI A;  4M4X A;  3AGD A;  2A3U A;  3C38 A;  1ZC2 A;  1T18 A;  3N7W A;  4Q0H A;  1HD8 A;  3IXH A;  2WGI A;  2D02 A;  1ESI A;  5FI6 A;  4KQO A;  3H7W B;  1F5M A;  2VX8 A;  2PDR A;  2INW A;  3N6I A;  3SOI A;  4KZ9 A;  2Y2K A;  4GD8 A;  1W63 M;  3EQV A;  3EQU A;  5EOO A;  3G6O A;  2OLU A;  2JKF A;  4KG2 A;  3QP5 A;  2V20 A;  2A24 A;  3ZCZ A;  4LFU A;  4HNB A;  1MXO A;  1Z09 A;  1S4R A;  3LR5 A;  5G18 A;  1H0M A;  5CHJ A;  4N1H A;  2QZ6 A;  4KZ3 A;  4Y0O A;  4GDN A;  5CHU A;  3Q7Z A;  1TS8 A;  2LB9 A;  1K6S A;  3JVV A;  1V9Z A;  3N4I A;  2B18 A;  3LEZ A;  1T1B A;  1FCN A;  3LY3 A;  1FCM A;  4QY5 A;  2XR0 A;  4EEP A;  3O88 A;  3PBO A;  2AVX A;  1H3Q A;  1K38 A;  5KSC A;  3DBA A;  2Y4A A;  5D3O A;  5FL3 A;  4EBP A;  3EEH A;  2J3T D;  2PU4 A;  2ZM0 A;  3CLO A;  4O7D A;  5HW3 A;  5FQK A;  3LI8 A;  5HWV A;  4Y2F A;  4KQD A;  4GS9 A;  3CHW P;  3IXB A;  4K0W A;  1TS0 A;  4EBN A;  3TRC A;  2W1T A;  1K25 A;  5GL9 A;  2WGW A;  3QP2 A;  2XQZ A;  2V2F F;  1NWZ A;  1PI5 A;  3HLF A;  1F9I A;  4CJN A;  5J8X A;  5KIZ A;  1BZA A;  1P9W A;  4CLC A;  4BBU A;  3PBQ A;  3LFV A;  4S2K A;  1N9O A;  3IX3 A;  3KYE A;  5TJJ A;  4DN0 A;  2V0U A;  3T4J A;  2CMN A;  3A3J A;  3FYZ A;  3FG8 A;  3FPV A; 
#chains in the Genus database with same CATH homology
 3HLW A;  2WZZ A;  2DRW A;  4E3K A;  1DY6 A;  2XF3 A;  4FH2 A;  4EUZ A;  3ZG9 B;  3A3F A;  4EBL A;  4WEK A;  5HAP A;  1YM1 A;  2ZC5 B;  3C7U A;  3FV7 A;  3IF5 A;  1YT4 A;  1ONG A;  3HBR A;  2ZC4 B;  3HLG A;  1GCE A;  3M2K A;  3S4X A;  5CXW A;  3ZDJ A;  2BG1 A;  2X71 A;  3OCN A;  1O07 A;  5FI7 A;  2ZQA A;  3VOZ A;  3NIA A;  4OPY A;  4WMC D;  3WS5 A;  2R9W A;  3VMA A;  3ITA A;  1IEL A;  2UWX A;  2ZQD A;  1E4D A;  1NXY A;  2DCF A;  4PMA A;  4Y0T A;  3ZG7 B;  1ZG6 A;  1N9B A;  3IHB A;  3WRT A;  4E3L A;  1KDW A;  1LI9 A;  2ZM2 A;  2ZM8 A;  1MKI A;  2X02 A;  4GN2 A;  1PWG A;  1PZP A;  3JYI A;  4RYE A;  5DVA A;  5A90 A;  3W4O A;  1HVB A;  2IWD A;  2R9X A;  3FKV A;  4WYY A;  4FCF A;  2XLN A;  4Y7P A;  3GSG A;  2ZQC A;  1NRF A;  4X55 A;  4S2I A;  2G2W A;  1YMS A;  2Y2O A;  5HFO A;  2WZX A;  3CJM A;  1FOF A;  1S6R A;  1FR1 A;  3BYD A;  2EX6 A;  1JTG A;  3P09 A;  2EXA A;  2ZC3 B;  1PYY A;  2WKH A;  2WK0 A;  4ZJ3 A;  5GLB A;  4JF5 A;  4IBR A;  4R3J A;  1M40 A;  4Z9Q A;  1W79 A;  4X68 A;  4FSF A;  4B88 A;  4S2O A;  4GD6 A;  1Q2P A;  1KE4 A;  4N1X A;  3M6B A;  1G6A A;  3IWQ A;  4WEL A;  3C4O A;  1MPL A;  4XXR A;  3V3S A;  4KEN B;  4PM6 A;  2B5R A;  5CGS A;  5FQQ A;  1SHV A;  1YLZ A;  4MNR A;  1PZO A;  1XA7 A;  4ZAM A;  1PW1 A;  1ERM A;  1ZKJ A;  5EOE A;  4HBU A;  1BLH A;  1BSG A;  3CZD A;  4IED A;  4GOG A;  4IVI A;  4NET A;  2H10 A;  2XK1 A;  2H5S A;  3ZG8 B;  1BTL A;  1MWU A;  3VFF A;  2Z2L B;  1JTD A;  1K6R A;  1E3U D;  2BLS A;  3A3D A;  3NDG A;  4JPM A;  4HES A;  1N4O A;  3AGF A;  3PBR A;  4LCM A;  1JWP A;  4WEJ A;  1ES5 A;  2ZC6 B;  3NDE A;  4HEF A;  4OVD A;  3WS2 A;  3Q7V A;  3MKE A;  2VGJ A;  2Y55 A;  1E3U A;  5E2E A;  3SS4 A;  2Z2M B;  1TDG A;  1KVM A;  3M2J A;  3RXW A;  1GHM A;  5CED A;  5I94 A;  1TEM A;  3NBL A;  1FSW A;  4N9K A;  3C4P A;  5DTK A;  4E3J A;  1O7E A;  4BJP A;  2J9P A;  1FQG A;  5FSR A;  4OON A;  2A49 A;  3UE3 A;  2RCX A;  3TSG A;  3G31 A;  4OPR A;  2ZC7 A;  4OPZ A;  4P85 A;  3HUO A;  4KG6 A;  3UPN A;  1RP5 A;  2P74 A;  3SS3 A;  3IXD A;  4K0X A;  4S2M A;  1ALQ A;  4RX3 A;  2I72 A;  2XEP A;  4LCL A;  4BL3 A;  2WAD A;  5BOH A;  3P98 A;  2IWB A;  3Q82 A;  4R1G A;  3TG9 A;  4DDY A;  4E3N A;  1XPB A;  2Y2L A;  4OP5 A;  4QD4 A;  5U47 A;  5EVI D;  4QY6 A;  3QNB A;  3G32 A;  5M1A A;  1LL5 A;  2XD1 A;  1DJA A;  4BEN A;  3LCE A;  1I2W A;  2WYX A;  4JBF A;  3AGE A;  3VOY A;  1IYQ A;  5M18 A;  1GA0 A;  1CEF A;  4U3T A;  3MXS A;  2J9O A;  4GKU A;  4R4S A;  2HDS A;  3BRM A;  5CER A;  3LY4 A;  3W4Q A;  1YQS A;  4S2N A;  3QHY A;  2Y2G A;  3CMZ A;  3ZVW A;  1RGZ A;  2G2U A;  4OKP A;  3VP2 A;  4EWF A;  3QNC A;  1XGI A;  2ZMA A;  5JYP A;  3IF6 B;  4H8R A;  2EX9 A;  5TGF A;  3WS0 A;  2FFF B;  3BFE A;  3IH9 A;  4JF6 A;  4KZ7 A;  2WKE A;  3G30 A;  4U0T A;  3C5A A;  4X53 A;  2JE5 A;  5FAP A;  5FAO A;  5GLA A;  1PIO A;  4P0M A;  1MWR A;  5TFQ A;  4DDS A;  3ZFZ A;  1YLT A;  5GHZ A;  4GB7 A;  4WZ4 A;  4L0L A;  1PI4 A;  3UE1 A;  2CC1 A;  4FH4 A;  3OZH A;  4LV0 A;  4PM7 A;  3SH8 A;  3O87 A;  1KVL A;  1FR6 A;  1SCW A;  5EVI B;  3PBT A;  4E6X A;  4N92 A;  4LEN A;  4KZ8 A;  4LV2 A;  3NCK A;  3V5M A;  4WMC A;  3FKW A;  3GMW A;  4RA7 A;  4KG5 A;  2ZD8 A;  4QB8 A;  4OOY A;  2RL3 A;  4XUZ A;  3S1Y A;  4B4Z A;  2V1Z A;  3VP0 A;  5JYO A;  4PM8 A;  4R3B A;  4BLM A;  1NYM A;  1IEM A;  2GDN A;  4DE3 A;  4OH0 A;  1JWZ A;  3PTE A;  5GLD A;  1L0G A;  3BLS A;  4MBK A;  5KSH A;  4OOM A;  3IHA A;  3Q1F A;  2J7V A;  2XH9 A;  3HRE A;  4B4X A;  5F82 A;  3OPH A;  4OLD A;  1Q2Q A;  3W8K A;  3ISG A;  3OPP A;  1U60 A;  2ZLY A;  1IYP A;  3DW0 A;  4OQH A;  4D2O A;  2XD5 A;  4PM5 A;  1ES4 A;  2H0Y A;  4UA9 A;  4DF6 A;  4DE2 A;  2JCH A;  3VP4 A;  1GA9 A;  1W8Y A;  4MBH A;  1NZU A;  3MFD A;  5FAQ A;  5FQ9 A;  2HP6 A;  4OQ0 A;  2WGV A;  3BFD A;  3UDI A;  1RGY A;  1LLB A;  5AQ7 A;  3UE0 A;  4RVA A;  4OPQ A;  5CTM A;  5A92 A;  4WZ5 A;  2Q9N A;  1EI5 A;  1XGJ A;  4R23 A;  4C3Q A;  4IVK A;  1MWS A;  1ZG4 A;  3PBN A;  2XDM A;  4IBX A;  1L0F A;  1KDS A;  5CHM A;  5EEC A;  3ZG5 A;  1K54 A;  4KZ5 A;  4CPK A;  5FI2 A;  3UO9 A;  2H0T A;  4FD8 A;  2C6W B;  5KZH A;  4BL2 A;  1CI9 A;  1L0E A;  1GHI A;  3BM6 A;  1IYS A;  5FAS A;  3IT9 A;  2ZQ8 A;  1ERQ A;  4UA6 A;  5AQA A;  1QMF A;  4KZA A;  4P6B A;  4KZB A;  2ZQ9 A;  5DF8 A;  1NZO A;  1BLP A;  2HDU A;  2VGK A;  2E8I A;  4PM9 A;  4YIN A;  2XGN A;  3VSK A;  5HX9 A;  3G35 A;  4DXC A;  3MZE A;  1SDN A;  3GTC A;  1Z6F A;  4JKT A;  4X69 A;  5EE8 A;  1XXM A;  3HLE A;  1KGE A;  4ID4 A;  4MBF A;  4OLG A;  3ZVT A;  4QHC A;  1FCO A;  4WBG A;  1M6K A;  2HP9 A;  3IXG A;  2PU2 A;  5A93 A;  2Q9M A;  4NK3 A;  3WRZ A;  2JC7 A;  1DJB A;  3UDF A;  4DRT A;  1QME A;  3RJU A;  1KE3 A;  1CK3 A;  3IF6 A;  2OV5 A;  4OQI A;  5EVI C;  3HL9 A;  3NC8 A;  5AQB A;  3N8R A;  5TR7 A;  1XKZ A;  4KZ6 A;  1TDL A;  3PAE A;  1CI8 A;  4DXB A;  4S2N C;  2OLV A;  5GLC A;  4C75 A;  3WWX A;  3TOI A;  1KGF A;  2EXB A;  4UA7 A;  3IH8 A;  1CEG A;  1L0D A;  3SH7 A;  3V3R A;  1HZO A;  1PWC A;  3IWI A;  1RCJ A;  5FDH A;  2Y2J A;  2ZQ7 A;  1E25 A;  5GHX A;  4DKI A;  5EVI A;  3VP3 A;  5F1F A;  1K57 A;  1Y54 A;  2Y2M A;  2Y2Q A;  4JXS A;  3UY6 A;  3HUM A;  3HUN A;  2OSU A;  3D4F A;  1BUE A;  2EFX A;  3G2Z A;  5FQJ A;  2Y2N A;  4S2J A;  5E2F A;  1YLW A;  5FQM A;  5FAT A;  3VFH A;  1MWT A;  1PWD A;  2XFS A;  3VP1 A;  1XP4 A;  2QMI A;  4E3I A;  1GHP A;  3OCL A;  4Y0U A;  4R0Q A;  4X6T A;  3WS4 A;  1HTZ A;  4EV4 A;  1BUL A;  5CEC A;  4MLL A;  5HAI A;  5A91 A;  1SDE A;  3AGD A;  2A3U A;  4ZJ2 A;  3UN7 A;  4QJG A;  2Y2P A;  5F1G A;  1ZC2 A;  3OPR A;  1VQQ A;  3NI9 A;  4ZDX A;  1JVJ A;  3N7W A;  4K91 A;  4UAA A;  4F94 A;  5HAQ A;  4ZTK A;  4GNU A;  1L2S A;  1HD8 A;  1K4E A;  2WGW B;  2HDR A;  3IXH A;  2WGI A;  4JXW A;  4KZ4 A;  3G2Y A;  1ESI A;  2XFT A;  5FI6 A;  3MZD A;  1ONH A;  3GVB A;  1ES2 A;  4E3O A;  3WS1 A;  1OME A;  1IYO A;  1K4F A;  4KQO A;  1MY8 A;  2Y2I A;  4HBT A;  4XUX A;  1I5Q A;  2PBY A;  3BLM A;  3N6I A;  3Q07 A;  4QU3 A;  4LV1 A;  3SOI A;  2P9V B;  3E2L A;  3N8S A;  4KZ9 A;  3BEB A;  3NY4 A;  2Y2K A;  5CRF A;  5DTT A;  3BFG A;  4GD8 A;  1K55 C;  1NJ4 A;  2EFU A;  3EQV A;  3EQU A;  1YLP A;  2C5W B;  5E43 A;  5EOO A;  3ZGA B;  4WZ5 C;  1LHY A;  2OLU A;  2WUQ A;  3RXX A;  4KG2 A;  1PW8 A;  5EPH A;  3LO7 A;  1JWV A;  4U0X A;  2IWC A;  3A3E A;  1K54 C;  2V20 A;  3O86 A;  5FQI A;  3ZNT A;  1XX2 A;  3FWL A;  4JXV A;  1WYB A;  3BFC A;  3N8L A;  3UDX A;  3ZCZ A;  3MKF A;  4N9L A;  1K55 A;  1MXO A;  3O3V A;  2QPN A;  3MXR A;  5GHY A;  3HLB A;  3MBZ A;  2WKI A;  4Q8I A;  5CTN A;  2DNS A;  3M6H A;  1VM1 A;  3V50 A;  3I7J A;  1AXB A;  3OPL A;  3S22 A;  5CEB A;  5G18 A;  1H8Z A;  5CHJ A;  3SS5 A;  4OP8 A;  3OC2 A;  4N1H A;  2QZ6 A;  4KZ3 A;  1WE4 A;  2EX8 A;  5EUA A;  3DWZ A;  4Y0O A;  5AQ9 A;  1NYY A;  4GDN A;  5CHU A;  1IKG A;  4M3K A;  4S2L A;  4YFM A;  2HPB A;  3Q7Z A;  4ZJ1 A;  3ZHH A;  3G34 A;  5E2G A;  5CGW A;  1K6S A;  2X01 A;  3N4I A;  4BD1 A;  2HP5 A;  2J8Y A;  3LEZ A;  4JLF A;  3GRJ A;  3SH9 A;  5DF7 A;  1FCN A;  3LY3 A;  1FCM A;  4QY5 A;  4P87 A;  2XR0 A;  3GV9 A;  3O88 A;  3PBO A;  4MEZ A;  1XA1 A;  1DJC A;  3IF6 C;  1ESU A;  3PBS A;  1KGG A;  4X56 A;  4KQR A;  1ES3 A;  4OQG A;  5HL1 A;  1K38 A;  1K56 D;  2Y2H A;  5KSC A;  2Y59 A;  1MBL A;  4WM9 A;  4C6Y A;  3HLD A;  2Y4A A;  5D3O A;  2HDQ A;  4EBP A;  5E2H A;  3IQA A;  1SKF A;  2PU4 A;  4DE0 A;  3IWO A;  2ZM0 A;  4R4R A;  1K56 A;  1YLJ A;  4EQI A;  2Y91 A;  4GDB A;  3W4P A;  3A3I A;  5DTS A;  1I2S A;  4O7D A;  5HW3 A;  5FQK A;  5M19 A;  4GZB A;  3CG5 A;  1K57 C;  1TVF A;  1FSY A;  4PPR A;  4DE1 A;  1BT5 A;  4S2P A;  4E6W A;  5F83 A;  1LL9 A;  3DTM A;  1IKI A;  3Q81 A;  5FA7 A;  3B3X A;  4JF4 A;  3UPP A;  5L2F A;  1EWZ A;  4LV3 A;  1C3B A;  3IXB A;  4K0W A;  3MZF A;  4BD0 A;  4EBN A;  5KMW A;  2FFY A;  1W8Q A;  1BLS A;  1K25 A;  1WYC A;  4RX2 A;  4UHU A;  3V39 A;  3E2K A;  3VSL A;  5GL9 A;  4ZBE A;  2WGW A;  3DWK A;  4BQM A;  5IHV A;  5HAR A;  3HLC A;  5DF9 A;  2XQZ A;  5EVL A;  2V2F F;  4JXG A;  1PI5 A;  1W5D A;  3C7V A;  3GR2 A;  3HLF A;  3PAG A;  1ERO A;  4CJN A;  1H8Y A;  5J8X A;  1BZA A;  1YLY A;  3G4P A;  1J9M A;  1S0W A;  4OOL A;  3PBQ A;  4S2K A;  1NY0 A;  4E3M A;  4KQQ A;  2WAE A;  1W7F A;  3HVF A;  2ZJ9 A;  5CGX A;  3Q7V B;  2P9V A;  3GQZ A;  1G68 A;  3UNW A;  3ITB A;  3BEC A;  4A5R A;  3A3J A;  3BFF A;  3ZNY A;  3FYZ A;  1BLC A;  3UPO A;  2EX2 A;  1LI0 A;  1KE0 A;  2WAF A;  1YMX A;  2JBF A;  1H5X A;  3ZG0 A;  3FZC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...