1JWPA

Structure of m182t mutant of tem-1 beta-lactamase
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTTPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-LACTAMASE TEM
publication title Evolution of an antibiotic resistance enzyme constrained by stability and activity trade-offs.
pubmed doi rcsb
source organism Escherichia coli
total genus 95
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2001-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1jwpA00
3WWXA 5FATA 1PI4A 3ZG7B 3HLFA 1FCMA 3ZG9B 4WYYA 2ZQCA 3EQVA 4PM8A 4JKTA 1MWRA 2BG1A 3V39A 3VP0A 2EXBA 1K57C 2JCHA 4WBGA 3G32A 5TFQA 1SCWA 4IVKA 1N9BA 1ZC2A 2WAEA 3M2JA 1MWUA 3VP4A 1XA7A 3UDXA 3TG9A 3W4QA 3V50A 5EUAA 4DRTA 3Q7ZA 4MBFA 5EPHA 1BLSA 1K6SA 2QPNA 2V1ZA 4JBFA 4WM9A 2ZMAA 2P9VB 4RX2A 1NJ4A 1PW1A 2HP9A 4JF5A 4UA7A 4ZJ1A 3MKEA 3SH9A 3GR2A 3OPRA 2HPBA 1GCEA 1GA9A 1XGJA 4LENA 5GLBA 5DTSA 4E3JA 3G35A 4IVIA 3A3EA 1BLHA 2C6WB 4QD4A 1FQGA 4OOYA 3BFFA 1W7FA 1VM1A 1E3UA 3WS4A 2EX6A 3C7VA 4BL2A 5DF8A 2Z2MB 1PWDA 3SH7A 5AQ7A 1QMFA 1Q2QA 2JBFA 2R9XA 1XX2A 5FA7A 3VSLA 5F1GA 3DW0A 4FSFA 2WADA 2OLVA 1O7EA 5G18A 1LLBA 4E3NA 3DWKA 1ES3A 2BLSA 4KZ6A 4GZBA 4IBRA 3FZCA 5KMWA 1KVMA 5EOOA 3UPPA 3MZEA 1JVJA 1K56D 3O88A 1IYQA 3C7UA 3IF6C 3NC8A 4ID4A 3UPOA 2ZM0A 4ZTKA 3O86A 1H5XA 4X69A 4S2IA 2WZXA 5EOEA 4E3MA 3IQAA 4GDNA 4BJPA 1LL9A 1K57A 2VGKA 2Y2KA 2ZQ8A 4PMAA 1FSYA 5DF9A 4B4XA 3FKWA 4RVAA 3HLWA 4D2OA 4KQRA 2J8YA 2E8IA 1MWSA 1L0DA 1BULA 3C4OA 3ZHHA 3C4PA 4L0LA 3UDIA 1CEGA 1WE4A 1E3UD 4KZAA 3ZG0A 1L0EA 3A3JA 1YLWA 2Q9NA 4OQGA 5AQ9A 4DXBA 4OPZA 3N8SA 4DE1A 2ZM2A 4HBTA 4JF6A 4KQOA 5FQKA 1JTDA 2J7VA 1YLJA 1HD8A 1RGYA 3O3VA 3EQUA 2CC1A 2XR0A 4R4SA 2WKHA 1YMXA 3NDEA 5CERA 3VSKA 4KENB 1WYBA 1SKFA 4S2LA 2IWDA 4KZ3A 1KDSA 4OVDA 2JC7A 2HP5A 4QB8A 4OP5A 3SH8A 1DJBA 1W8YA 2PBYA 5HW3A 4DF6A 2XLNA 2WZZA 1EWZA 3PTEA 3OZHA 1FOFA 3UPNA 4GOGA 3WS2A 1PWGA 3BRMA 2A3UA 4KZ7A 4MBHA 1CEFA 2EXAA 3LCEA 4KZ9A 2G2WA 1U60A 2HDSA 3VMAA 1ES4A 4R23A 4Y7PA 2ZJ9A 4Z9QA 2HDRA 2P74A 2WYXA 4WEJA 3O87A 4QU3A 2QZ6A 1Y54A 3NBLA 2Y2LA 2XQZA 5E2GA 1H8ZA 4Y0TA 4DKIA 5DF7A 3VP1A 1JWZA 1NRFA 4KG5A 5HFOA 4R0QA 1QMEA 1NY0A 4P0MA 4UA9A 1BUEA 5CTMA 3NY4A 5FQIA 4EBLA 3OCNA 3IWQA 4KZ5A 4KQQA 1K4FA 1TEMA 3VFFA 4GKUA 5EE8A 4PM5A 2I72A 5A91A 4DE0A 1PIOA 4N1XA 5F1FA 2XD1A 3S22A 3Q07A 4PM9A 3VP3A 2Y2IA 2G2UA 1IKIA 1EI5A 5HL1A 2OV5A 1FR6A 3IWOA 1IELA 3UY6A 3G2ZA 4GN2A 2WKEA 1WYCA 4R4RA 1CI9A 3Q82A 2ZD8A 3N4IA 3OPPA 3IF5A 3BFCA 5EVIB 1BZAA 2ZC6B 4GB7A 2H5SA 4K0XA 4DE2A 4E3LA 4U3TA 2GDNA 2UWXA 2WUQA 3IHAA 3Q7VB 4JXGA 4EBPA 5A92A 1Q2PA 4OKPA 5FSRA 2Y4AA 4GNUA 3AGFA 4BQMA 5E2EA 4N9KA 3ZGAB 3G4PA 1PI5A 3MZDA 3FWLA 4OLGA 4N1HA 3WS1A 3CMZA 4KZBA 1K6RA 3HUNA 1YLTA 1LI0A 4IEDA 4S2OA 3UO9A 2ZC7A 1MBLA 5EECA 1ESIA 3I7JA 2XFSA 1KE4A 4MEZA 3ZNTA 2ZLYA 3ZVTA 4EQIA 4X6TA 4EV4A 4KG2A 1FR1A 4ZJ2A 4QJGA 2Y2PA 5AQAA 4OOLA 1ERMA 2Q9MA 4UAAA 4BD0A 2HDUA 4PM7A 4S2PA 1YQSA 4GDBA 4OH0A 4NK3A 3S1YA 4K0WA 2XDMA 1PZOA 5M18A 4N92A 1S6RA 2Y2MA 5HARA 3QNCA 4P85A 1Z6FA 4X53A 3V3SA 4F94A 2WGIA 1YLZA 3FV7A 5GHYA 2X71A 3IXHA 4WELA 2WGWA 4HBUA 1L2SA 4X68A 3AGDA 4XXRA 5CHJA 4JXVA 5GHXA 4EWFA 2PU4A 2EX8A 3PBQA 4S2JA 3A3IA 4DDSA 2EFXA 4JLFA 5J8XA 3VP2A 3IF6B 5BOHA 4LV1A 1LL5A 3GQZA 5F82A 1KVLA 5KSHA 3ITBA 1HVBA 1MY8A 4H8RA 4U0TA 1C3BA 3E2KA 4ZJ3A 1ALQA 2VGJA 3WS0A 1ES5A 3G34A 4O7DA 1MWTA 3HVFA 3IXDA 2C5WB 2IWCA 3ZG8B 1PZPA 3G31A 3HLDA 4QY5A 1XPBA 4DE3A 4CJNA 1PWCA 3SS3A 2Y55A 2Y2OA 1IEMA 4HEFA 2P9VA 3DWZA 3PBSA 2Y2HA 3UE3A 1BLPA 4ZDXA 3ZVWA 4E3KA 4BD1A 5F83A 3HLEA 5I94A 2XH9A 5FI2A 3HUOA 3UE1A 1ES2A 3BM6A 4OLDA 2RCXA 3UN7A 4DDYA 2Y2QA 3G2YA 5DVAA 5E2FA 1K54C 5GLCA 5CEBA 3HREA 4FD8A 1KGEA 1JTGA 3D4FA 2ZM8A 1K55C 4M3KA 2EX2A 4PPRA 5KSCA 1W8QA 4DXCA 1IKGA 3WRZA 4OQIA 3LO7A 4K91A 1W5DA 3UE0A 3ISGA 5A93A 3V5MA 4JF4A 4S2KA 2X01A 2Y91A 5DTTA 1EROA 3MBZA 5U47A 4EUZA 1IYOA 4BL3A 1FCNA 4WZ5C 2HP6A 1M40A 3NCKA 3M6BA 2OSUA 5CRFA 1BSGA 4QY6A 4OONA 3BECA 3N8RA 3N7WA 4E3OA 3HBRA 4LV2A 1CK3A 1FSWA 1G6AA 2DNSA 1K4EA 3Q81A 4JPMA 4LCLA 3SS5A 3DTMA 3GTCA 5CGSA 2H0TA 1YLYA 3FYZA 5E43A 3RXWA 3QNBA 3P09A 1O07A 4XUXA 1L0GA 4MBKA 5HX9A 5A90A 1L0FA 2ZQDA 4JXWA 4NETA 3P98A 5GL9A 4E6XA 3OC2A 4LV0A 3BLMA 3IH9A 1SDNA 5JYOA 3ITAA 1LI9A 3SOIA 2FFYA 3PBTA 2H10A 4Q8IA 5FAPA 4WEKA 3BFDA 1BTLA 1TVFA 5CECA 4YINA 4MLLA 5FAQA 4E3IA 2WKIA 1YMSA 3CG5A 1NXYA 4S2NA 4WZ4A 1CI8A 5FQ9A 4R1GA 3TOIA 2WGWB 4OPQA 1KGFA 4IBXA 5FAOA 4RYEA 1FCOA 2Y2GA 2Z2LB 4OP8A 2X02A 3IH8A 2FFFB 3IWIA 4Y0UA 3W8KA 1K54A 1IYPA 3IHBA 4R3JA 1J9MA 1K55A 4WMCA 3CZDA 5EVIC 5HAIA 3BFGA 2QMIA 1YLPA 3IT9A 2DCFA 2XGNA 4FCFA 1N4OA 1K56A 5TGFA 4E6WA 1VQQA 3M6HA 2WGVA 2Y2JA 1NYYA 3PBNA 2IWBA 1AXBA 2ZC5B 3OCLA 4WZ5A 5JYPA 4X55A 5FI7A 3NDGA 1NZOA 4OQ0A 4FH2A 1HZOA 4U0XA 4UA6A 1XKZA 4OPRA 1GHMA 3C5AA 2ZQ9A 2XEPA 3OPLA 1KE0A 4RA7A 1SHVA 5KZHA 1PW8A 1XGIA 3GV9A 3FKVA 3V3RA 5AQBA 3CJMA 4C6YA 2WK0A 1ESUA 3GMWA 3GVBA 2A49A 4JXSA 3OPHA 1KDWA 4BLMA 3SS4A 3GSGA 3HLGA 2B5RA 4Y0OA 4EBNA 1JWVA 5HAPA 1BLCA 3A3FA 3BYDA 3ZG5A 4B4ZA 1XA1A 5CTNA 3HL9A 1ZG6A 3HLBA 3LY4A 3QHYA 4FH4A 4HESA 3W4OA 3WS5A 3N6IA 5CXWA 3WRTA 1KE3A 2ZC4B 5M19A 2J9PA 3NIAA 1ONHA 1MKIA 4WMCD 5FI6A 1LHYA 4P87A 1I2SA 1GHPA 4GD6A 1XP4A 2H0YA 3RJUA 3BLSA 3M2KA 3LEZA 1JWPA 5D3OA 5M1AA 4N9LA 1ONGA 4BENA 3VFHA 5CEDA 2Y2NA 5CGXA 3AGEA 1OMEA 3GRJA 3MKFA 4KZ8A 1I2WA 1TDGA 2OLUA 5GHZA 1HTZA 1YT4A 4OOMA 1H8YA 4X56A 5EVIA 3S4XA 1NZUA 4PM6A 1DJAA 1BT5A 3PBOA 5GLAA 3Q7VA 4S2NC 3BFEA 1NYMA 3IXGA 3MXSA 5FDHA 3ZDJA 3MZFA 3E2LA 2ZC3B 4B88A 2WAFA 2EX9A 5IHVA 1RCJA 5EVLA 3RXXA 4A5RA 3ZCZA 3PBRA 3ZFZA 1GA0A 2Y59A 2V20A 4QHCA 5FQMA 5E2HA 3VOYA 1S0WA 2ZQ7A 2J9OA 5FASA 1TDLA 4KG6A 5CHUA 3LY3A 4LCMA 5TR7A 3UNWA 1YM1A 2PU2A 4GD8A 1ZG4A 3B3XA 1XXMA 3BEBA 1RP5A 4XUZA 4MNRA 3N8LA 4CPKA 2XFTA 1E4DA 1SDEA 2EFUA 4P6BA 5FQQA 1K25A 1DY6A 4OPYA 2XD5A 5HAQA 1PYYA 1GHIA 3UDFA 3HLCA 2ZQAA 3W4PA 4UHUA 4R3BA 4S2MA 1MXOA 4ZBEA 5DTKA 4YFMA 5EVID 1MPLA 2XF3A 5FQJA 3ZNYA 2JE5A 1W79A 3JYIA 1IYSA 2DRWA 1RGZA 1E25A 5CHMA 3TSGA 3NI9A 3PAEA 3PAGA 3G30A 5GLDA 5CGWA 3IF6A 1KGGA 2RL3A 3A3DA 3VOZA 1K38A 2R9WA 3HUMA 3IXBA 1M6KA 2XK1A 4OQHA 1I5QA 3MXRA 3MFDA 4C75A 4LV3A 4RX3A 1ERQA 2V2FF 3Q1FA 4C3QA 4KZ4A 1G68A 1ZKJA 1DJCA 4ZAMA 5L2FA 2HDQA
chains in the Genus database with same CATH superfamily
5FATA 1PI4A 2GJ3A 1DP8A 4KUKA 1Y28A 1K0KA 1SCWA 1ZC2A 2P08A 3M2JA 1MWUA 3W4QA 4DRTA 3Q7ZA 4MBFA 1K6SA 4I39A 4RX2A 4GHIB 3F1PA 4JF5A 3EEHA 3MKEA 1LL8A 3GR2A 3IX3A 5GLBA 5HL6A 1BLHA 2WKRA 1VM1A 2Z2MB 2WKQA 5DJUA 2DMWA 1O7EA 2BLSA 2IA2A 4IBRA 2HV1A 3EWKA 3K3DA 3MJQA 1JVJA 2HJEA 2K2NA 2PYPA 4ID4A 4X69A 4P6ZS 5EV0A 2QYBA 2FH5A 1XFNA 2ZQ8A 4B4XA 1FSYA 5DF9A 3FKWA 4D2OA 2LB9A 4L0LA 4HP4A 1WE4A 4BBVA 1E3UD 5EVEA 3ZG0A 4OQGA 5AQ9A 1YLWA 2Q9NA 3N8SA 2ZM2A 4JF6A 5FQKA 1HD8A 4IHQA 1XJ3A 2J3TC 4YNRA 1YSQA 4S2LA 4KZ3A 1KDSA 2HP5A 1OPXA 3TE8A 4OP5A 4NG2A 2XLNA 1X0OA 2J80A 1CEFA 3LCEA 4KZ9A 2W1RA 3OLOA 5HDDA 2G2WA 3VMAA 4WL9A 1BYWA 1ZTUA 1S4RA 2WYXA 3T1QB 3QP6A 1YPRA 2Y2LA 4I3JA 5E2GA 1GSVA 4P0MA 4UA9A 4KQQA 1TEMA 1OTIA 4DE0A 2XD1A 3S22A 3VP3A 4M4XA 5HL1A 2BTFP 4GN2A 3MQ0A 1WYCA 4R4RA 1CI9A 4GW9A 3OPPA 3BFCA 3LR0A 2XA7S 4U3TA 3IHAA 5FSRA 2Y4AA 3AGFA 4HH2A 3IX4A 4N9KA 3ZGAB 3PR6A 3ICYA 3FWLA 4N1HA 4CLCC 1NRJA 1N9NA 3HCYA 4NXGA 3KO6A 1N9LA 3BJNA 4S2OA 2ZC7A 5EECA 1ESIA 3TW8A 3ZVTA 1KE4A 4EQIA 4EV4A 4X6TA 4QJGA 4ZJ2A 1ERMA 5FDSA 1YQSA 4GDBA 2VK3A 3S1YA 2VJWA 4QWOA 1PZOA 5M18A 2Y79A 4PKYG 3LI9A 5GHYA 2X71A 2WGWA 1L2SA 4X68A 4XXRA 5GHXA 3PBQA 2VLGA 5L09A 3VP2A 3IF6B 5BOHA 4LV1A 4H8RA 2VV6A 1ALQA 2VGJA 3WS0A 3T4KA 4CLCE 2C5WB 2IWCA 2OAQ1 4FUWA 2Y55A 4Y15A 3ZVWA 4E3KA 1FILA 5F83A 5G4ZA 5I94A 3UE1A 4I3IA 3BM6A 2RCXA 2WKPA 4IUHA 4DDYA 5DVAA 3HREA 4FD8A 3D4FA 2ZM8A 5KSCA 3WRZA 2Y91A 5DTTA 1EROA 3MBZA 2W3GA 4Q0IA 5U47A 4WZ5C 4EEUA 1M40A 3NCKA 2ZMFA 1BSGA 3N8RA 1XJ6A 3HBRA 4LV2A 1TS6A 2DNSA 1YLYA 2A2LA 5J4EA 4GS9B 2ZQDA 4NETA 3P98A 4E6XA 2NUPC 3SOIA 3MSHA 4Y3IA 2H10A 4Q8IA 3BFDA 5IT5A 1F98A 1G5UA 4R6LA 4MLLA 5FAQA 1NXYA 2WGWB 4OPQA 1A0KA 1KGFA 3H9WA 4Y0UA 3IHBA 1J9MA 5EVIC 2DCFA 3FPWA 2XGNA 4FCFA 5TGFA 1VQQA 3PBNA 3R4KA 2OWJA 3OCLA 3NDGA 3NULA 1T18A 4OPRA 1GHMA 3OPLA 2XEPA 5HD3A 2PD7A 3GV9A 3FKVA 5AQBA 5J7EA 3CJMA 4DJ3A 4PAUA 4BLMA 3GSGA 4X1LA 2B5RA 4EBNA 4HNBA 3ZG5A 4B4ZA 1XA1A 2V9AA 3LIAA 3QHYA 3CHWP 3N6IA 5AVEA 1ONHA 1MKIA 3PHYA 1ACFA 1OTDA 4WMCD 1LHYA 4Y13A 3IS2A 3RJUA 1JWPA 1OTEA 3D72A 2Y2NA 5CGXA 3GRJA 1H3QA 1V9YA 1TDGA 1HTZA 1YT4A 5MC7A 4OOMA 1XJ4A 1NZUA 5HWTA 3R7WB 3VE4A 3PBOA 1T19A 1NYMA 3IXGA 2YKFA 3E2LA 2WAFA 3ZCZA 3PBRA 3ZFZA 4NEED 1N9OA 4O8GA 5E2HA 2HGVA 4KG6A 3UNWA 2PU2A 1ZG4A 1P9RA 1XXMA 4XUZA 2V8CA 3KSGA 3N8LA 4CPKA 2XFTA 1E4DA 1XJ2A 3NOUC 2B02A 2PBDP 1PYYA 4UEYA 4UHUA 2VKSA 1MPLA 3ZNYA 2QKPA 3NHQA 3BQAA 1E25A 5CHMA 2V0UA 5CGWA 2GX5A 1K38A 2R9WA 3MFDA 4LV3A 4RX3A 3Q1FA 2ZOHA 4KZ4A 1Y4OA 3WWXA 3TJZC 4PM8A 1F9IA 2BG1A 3VP0A 2JCHA 3EGXC 3G32A 2WAEA 3VP4A 3TG9A 5EUAA 5EPHA 4JBFA 2V1ZA 3B33A 4WM9A 1NJ4A 1PW1A 4UA7A 2EA9A 3SH9A 5EFWA 3OPRA 1GA9A 3G6OA 3G35A 3DAVA 4QD4A 5TBMA 1FQGA 4LPZA 4OOYA 2EWWA 4BL2A 5AQ7A 1MC0A 1Q2QA 1QMFA 2AVXA 3C38A 3VSLA 2QJ7A 5F1GA 4CQHA 5G18A 3LEQA 3DWKA 1ES3A 4KZ6A 1TS7A 4H6JA 5EOOA 4LRXC 3MZEA 4RQ9A 1G6OA 3C7UA 3NC8A 1AWIA 4ZTKA 3H82A 2VGKA 2Y2KA 3MF0A 1GSWA 1MWSA 4IUKA 1L0DA 1VEUB 3C4OA 4EQ1A 4HY8A 5G4YA 3B47A 3T4LA 1L0EA 3A3JA 4DXBA 4OPZA 4HBTA 1YLJA 1HLUP 3EQUA 4R4SA 5HDCA 1YMXA 1WYBA 1SKFA 2IWDA 2JC7A 2W3EA 1EWZA 3PTEA 3OZHA 3CWFA 3WS2A 3BRMA 4PKYA 2W0NA 3C2WA 3F1NA 4R23A 2ZJ9A 5HDSA 2HDRA 3PYPA 4IJGA 2R78A 1Z09A 3O87A 2I9VA 3RTYA 3VOLA 5AJGA 5FL3A 3U4LP 3EOIA 4DKIA 4R0QA 1NY0A 1BUEA 5CTMA 2HJ9C 3NY4A 4EBLA 3OCNA 4L9EA 4GKUA 5A91A 5F1FA 1TS8A 3Q07A 2Y2IA 4BWIA 2G2UA 1EI5A 3JVVA 1FR6A 3IWOA 2WKEA 4Z1WA 3Q82A 4G3KA 3IF5A 1BZAA 4GB7A 4K0XA 4E3LA 2GDNA 2UWXA 3A0SA 3Q7VB 4EBPA 1LT0A 2CMNA 2P04A 5E2EA 4X25A 1OJGA 2G7UA 3WS1A 4ARZB 2K31A 1YLTA 1LI0A 1MBLA 2EWVA 2W27A 4I38A 4OOLA 4UAAA 5AQAA 3E4PA 2ZL1A 4PM7A 4S2PA 3MFXA 4NK3A 3LUQA 3DTKA 4KQDA 1NWZA 2VZWA 3FV7A 4WELA 1P9WA 4I3AA 3T50A 4EWFA 3A3IA 4L9GA 2V1BA 3E98A 3CUEC 3ITBA 1MY8A 2A24B 4DMZA 5HD5A 3HVFA 3IXDA 2BASA 3G31A 3HLDA 5DFXA 4DE3A 3SS3A 1IEMA 4HEFA 2P9VA 3DWZA 5CX7A 3E0YA 3HUOA 2ZOIA 1ES2A 1T1BA 3UMDA 5DKLA 1W63Q 3A0RA 4CLCA 3DTIA 2PD8A 5CEBA 5GLCA 1JTGA 2JKFA 1K55C 4FOFA 3SW1A 1YAXA 2EX2A 1W8QA 1IKGA 3F1PB 4K91A 3ISGA 3V5MA 4S2KA 1FCNA 3N7WA 1MKMA 3UB8A 1XFQA 3Q81A 3LICA 5CGSA 5E43A 4R38A 4YOFA 3P09A 1O07A 5FEFA 3L9KA 1L0FA 5L8MA 5GL9A 3OC2A 5F69A 3BLMA 1SDNA 3LIBA 3ITAA 2FFYA 4QPRA 4YINA 4E3IA 2WKIA 1YMSA 4S2NA 2O99A 3TOIA 4IBXA 5FAOA 4RYEA 3UB9A 1IYPA 3MR0A 1PNEA 4WN5A 3IT9A 2Z6DA 4F3LA 1N4OA 4E6WA 1NYYA 2IWBA 4EW7A 4WZ5A 5JYPA 3B42A 4U0XA 3T1SA 1XKZA 3LR4A 3C5AA 4RA7A 3KSFA 1S66L 1SHVA 3H7WA 4LGWA 2WK0A 2V1AA 4JXSA 3OPHA 1SZVA 2JHEA 4R3AA 4BMWA 3DBAA 3S7PA 3BYDA 3HJIA 4WLAA 1ZG6A 2HF6A 4FH4A 4HESA 4MN7A 3W4OA 4Q0JA 4P87A 2H0YA 3M2KA 3ZQ5A 5D3OA 5M1AA 4BENA 1ONGA 1S4SA 5CEDA 1OMEA 3MKFA 3W2ZA 1ODVA 5EVIA 1OTBA 3S4XA 1DJAA 4S2NC 3BFEA 3MXSA 3MZFA 5IHVA 2EX9A 4HIAA 4A5RA 1GA0A 4HOIA 4ESPA 2JKRM 3E4OA 4NXEA 4LCMA 5IU1A 1CQAA 2VGLS 3E4QA 1ZHHB 2XD5A 4ETZA 4MN5A 1GHIA 3HLCA 3W4PA 3OOVA 4GJ4A 4S2MA 1MXOA 2XSSA 5DTKA 4YFMA 4I5SA 2XF3A 3F1OA 2JE5A 2DRWA 1DP9A 3H7WB 2M7UA 3IXBA 2XK1A 1I5QA 4C75A 1ERQA 1G68A 1ZKJA 5L2FA 2PYRA 4Y5FA 3ZG7B 1FCMA 3ZG9B 3EQVA 4JGPA 4HP9A 4LLOB 1K57C 1TS0A 4WBGA 5TFQA 2HZ5A 4IVKA 3UB6A 4NKPA 2W3FA 3V50A 3LI8A 1BLSA 2QPNA 4MMNA 1P97A 2OOLA 4MDZA 2HP9A 4LRZE 2HPBA 1GCEA 4LENA 5DTSA 4IVIA 5DJTA 3A3EA 2C6WB 3C8CA 2UV0E 1W7FA 1E3UA 3WS4A 2EX6A 3C7VA 3LIEA 5DF8A 3LR5A 1PWDA 3OBFA 3SH7A 4MCWA 2NUTC 5FA7A 2Q0OA 4FSFA 3FPVA 2OLVA 1LLBA 5F5YA 3LYXA 4GZBA 3UPPA 4UQIM 1IYQA 2QWSA 3NOPC 4Y2FA 3UPOA 1H5XA 1D06A 5EOEA 4E3MA 5EM0A 1T1AA 2H28A 1LL9A 3HLWA 2J8YA 5I5LA 3RH8B 2VA0A 3IBRA 2PAVP 4NXFA 4DE1A 1JTDA 2J7VA 1RGYA 3KYEA 3O3VA 4XT2A 2CC1A 1VHMA 3NDEA 5CERA 3VSKA 3C30A 4OVDA 3CPTA 5L10A 1DJBA 1G28A 1W8YA 2PBYA 4DF6A 2GZAA 2A3UA 4KZ7A 4AFIA 1S67L 2VV7A 1OT6A 2EXAA 1GSXA 1U60A 3K3CA 4Y7PA 4Z9QA 2PR6A 3MQQA 1Y54A 4P6ZM 4Y0TA 5DF7A 1JWZA 1NRFA 5HFOA 2PDRA 2KOIA 3IWQA 4KZ5A 5IS1A 1K4FA 3VFFA 1LSWA 3IS2B 4PM5A 1PIOA 3QP8A 4N1XA 4PM9A 3KX0X 2OV5A 1IELA 3UY6A 5TJJA 4JGOA 2V8FA 2PR5A 2ZD8A 3K2NA 2WUQA 3QP1A 2JKRI 4JXGA 1Q2PA 3KYZA 4OKPA 4GNUA 1IFQA 2QHKA 3G4PA 4JGQA 1K6RA 4IEDA 3UO9A 3I7JA 5HW3A 2ZLYA 4KG2A 1V9ZA 2KLIA 3UE6A 4OH0A 2XDMA 4N92A 5HARA 3QNCA 4P85A 1Z6FA 4X53A 4F94A 1YLZA 1VETA 2LB5A 2P7JA 4HBUA 5CHJA 2PU4A 4S2JA 2EFXA 5HWWA 4EUVA 3GQZA 2O9BA 1C3BA 3E2KA 3LIFA 1ES5A 3G34A 4O7DA 3DTEA 3TRCA 2XA7M 4CJNA 1PWCA 3UE3A 3PBSA 1BLPA 2XH9A 2QJ5A 4G3WA 5FI2A 3G2YA 5E2FA 1K54C 4DN0A 4M3KA 3MMHA 4ME4A 4OQIA 3LO7A 1W5DA 5A93A 3CI6A 4EUZA 4BL3A 2HP6A 4BBTA 3M6BA 2OSUA 5CRFA 4QY6A 5TBMB 3BECA 2L1MA 4ZRRA 1G6AA 1UWPX 3DTMA 2H0TA 1J3WA 3CUEA 4XUXA 1L0GA 4MBKA 4X1MA 4H6JB 2B95A 5JYOA 1LI9A 1BTLA 1TVFA 3H82B 1W63M 3QP4A 3ZYTA 5FQ9A 1CI8A 1FCOA 2Z2LB 4OP8A 3IH8A 4FTXA 1YKDA 3NECA 1K55A 2KX6A 4WMCA 5HAIA 3BFGA 2YKHA 1AXBA 3D9YA 1NZOA 1HZOA 2J3WA 2VGLM 3BWLA 1PW8A 5DKKA 3V3RA 4C6YA 3GMWA 4HH3A 2L4RA 1KDWA 5L07A 1UGUA 3HLGA 1JWVA 3T1XA 5CTNA 3HL9A 1S1YA 4O01A 3HLBA 3LY4A 3F1NB 5CXWA 2Z6CA 4HHDA 1YSPA 4O0PA 2O9CA 3VFHA 1DP6A 4Q0HA 3AGEA 2OLUA 5GHZA 3NOTC 1F5MA 1WA9A 1H8YA 3UMEA 4PM6A 1BT5A 5GLAA 1NLZA 2ZC3B 4EERA 1RCJA 3RXXA 4DJ2A 2OWHA 2V20A 4QHCA 5FQMA 1S0WA 3L7HA 2ZQ7A 1TDLA 5CHUA 3O5YA 5TR7A 2XROA 3KYQA 1D1JA 4MNRA 2B18A 4EETB 2L0WA 4P6BA 5FQQA 1DY6A 3HJKA 4OPYA 3LFVA 5HAQA 1JNUA 2ZQAA 1MZUA 4R3BA 2W3DA 5F68A 5FQJA 3JYIA 3TSGA 3NI9A 3PAEA 3G30A 2ZL1B 1PRQA 2ZBBA 3IF6A 1KGGA 3A3DA 3VOZA 3HUMA 1M6KA 2V0WA 3P7NA 4OQHA 2V2FF 4ZAMA 1DJCA 2HDQA 3HLFA 3S7NA 4WYYA 3D3OA 2ZQCA 4JKTA 1MWRA 5HSQA 3V39A 2EXBA 3UB7A 1N9BA 2JKTI 1XA7A 2OAP1 3UDXA 3IBJA 4E04A 2ZMAA 2P9VB 4ZJ1A 4GCZA 2Y8HA 3GECA 5HZHA 1XGJA 4E3JA 4NXBA 3BW6A 4CLCB 4WF0A 3BFFA 4WUJA 3RFBA 1H8MA 2JBFA 2R9XA 1XX2A 5DFYA 3DW0A 4YWZA 2WADA 4GS9A 4E3NA 4HQAA 3SZTA 3FZCA 5KMWA 1KVMA 3KSHA 1K56D 3O88A 1P0ZA 3IF6C 2ZM0A 2VV8A 3O86A 4S2IA 4PHTA 2WZXA 3IQAA 4GDNA 4BJPA 1K57A 3EEAA 4PMAA 2VEAA 4RVAA 4KQRA 2E8IA 1LSVA 1BULA 3ZHHA 3C4PA 3UDIA 1CEGA 4KZAA 3BY8A 3T4SA 4KQOA 4EESA 4MN6A 2XR0A 2WKHA 4KENB 2M1CA 4QB8A 4F3LB 3SH8A 3BQ8A 1KOUA 3S7OA 2WZZA 1FOFA 3UPNA 4GOGA 1PWGA 4MBHA 4HI4A 3S7QA 4G3VA 2HDSA 2PRFA 1ES4A 2P74A 5AVFA 4WEJA 4QU3A 2QZ6A 3NBLA 2XQZA 2KDKA 3PXPA 1H8ZA 3VP1A 2FZ0A 4KG5A 1QMEA 5FQIA 2XRNA 1VB6A 3R7WA 1TD5A 5EE8A 2I72A 5EM1A 3FC7A 1IKIA 4BBUA 1OJ5A 4HJ3A 2D01A 4EEPA 3G2ZA 2O9AA 5LBRA 3N4IA 5EVIB 2ZC6B 2H5SA 4DE2A 5A92A 3CLOA 4BQMA 2W3HA 1PI5A 3MZDA 4OLGA 3CMZA 4KZBA 5F6AA 3HUNA 2MJ6A 3ZNTA 2XFSA 4MEZA 5FEGA 1FR1A 3T12B 2Y2PA 2Q9MA 4BD0A 2HDUA 3MXQA 4R70A 4K0WA 1SKOA 2J3TD 1S6RA 2Y2MA 3V3SA 5K5BA 1CJFA 2WGIA 3IXHA 3F1OB 1EW0A 3AGDA 4JXVA 3EGDC 2EX8A 5HPIA 4DDSA 2VX8A 4JLFA 5J8XA 1LL5A 5F82A 2W1TA 1H0MA 1KVLA 5KSHA 1HVBA 4U0TA 4ZJ3A 3A0VA 3VV4A 2D02A 1MWTA 3ZG8B 1NLYA 1PZPA 4QY5A 1XPBA 4LFUA 2Y2OA 4ZDXA 2Y2HA 4BD1A 3HLEA 4OLDA 3UN7A 2Y2QA 5J3WA 1KGEA 3JPUA 4PPRA 4GLQA 4DXCA 3UE0A 4JF4A 3GDIA 2X01A 3QP2A 3P01A 1OTAA 1IYOA 4OONA 2O0YA 4E3OA 1UWNX 1CK3A 1FSWA 1LSXA 4KUOA 1K4EA 3T4QA 4JPMA 4LCLA 3SS5A 3GTCA 3FYZA 3RXWA 3QNBA 4K08A 5HX9A 1DRMA 5A90A 4JXWA 3LR3A 4LV0A 4EXOA 3IH9A 4II7A 1VEUA 3KSIA 4CLCD 1L3LA 5C5KA 3PBTA 1TF1A 5FAPA 4WEKA 1SKOB 3JVUA 4LRYC 3NJAA 4EU0A 5CECA 4HJ6A 1IOUA 2GNXA 3CG5A 4WZ4A 4R1GA 3MQOA 1D7EA 2Y2GA 2X02A 3W8KA 1F2KA 2FFFB 3IWIA 1K54A 2PT7A 4R3JA 2W1TB 3CZDA 2QMIA 1YLPA 3MS6A 5A8BA 1K56A 3M6HA 2WGVA 2Y2JA 4XT2B 2ZC5B 4X55A 5FI7A 2ACGA 4OQ0A 4FH2A 1PFLA 4UA6A 2ZQ9A 1KE0A 2JKGA 1FIKA 4B9OA 5KZHA 3CPTB 1XGIA 2E8JA 3CAXA 1ESUA 3GVBA 2A49A 3SS4A 2M7VA 4Y0OA 3ULFA 5HAPA 1BLCA 4ETXA 3A3FA 1S1ZA 3WS5A 3T4OA 3T4TA 3WRTA 1KE3A 2ZC4B 5M19A 2J9PA 3NIAA 5FI6A 1I2SA 1GHPA 4GD6A 1XP4A 3BLSA 1STZA 3LEZA 4B93A 4N9LA 4KZ8A 1I2WA 3CITA 4D60A 4X56A 4GHIA 3T1RA 3UB5P 2JKTM 5HPFA 3Q7VA 3IX8A 2ZMVA 5HWVA 5FDHA 3ZDJA 4B88A 4JGRA 1T1CA 1OT9A 5EVLA 4Y17A 2Y59A 3U2AA 2K7SA 3VOYA 5FASA 2J9OA 2JN7A 4ARZA 3LY3A 4L9FA 1YM1A 4GD8A 3B3XA 3BEBA 1RP5A 3T4JA 2INWA 1SDEA 2EFUA 1K25A 3VE3A 3LIDA 3UDFA 3LGOA 3QP5A 5KIZA 4ZBEA 5EVID 3V67A 1W79A 1IYSA 1RGZA 3PAGA 5GLDA 3FG8A 2RL3A 2PHYA 1CF0A 3MXRA 2A24A 4HJ4A 4UQIS 4C3QA 3BY9A 1VETB
chains in the Genus database with same CATH topology
3WWXA 5FATA 1PI4A 3ZG7B 3HLFA 1FCMA 3ZG9B 4WYYA 2ZQCA 3EQVA 4PM8A 4JKTA 1MWRA 2BG1A 3V39A 3VP0A 2EXBA 1K57C 2JCHA 4WBGA 3G32A 5TFQA 1SCWA 4IVKA 1N9BA 1ZC2A 2WAEA 3M2JA 1MWUA 3VP4A 1XA7A 3UDXA 3TG9A 3W4QA 3V50A 5EUAA 4DRTA 3Q7ZA 4MBFA 5EPHA 1BLSA 1K6SA 2QPNA 2V1ZA 4JBFA 4WM9A 2ZMAA 2P9VB 4RX2A 1NJ4A 1PW1A 2HP9A 4JF5A 4UA7A 4ZJ1A 3MKEA 3SH9A 3GR2A 3OPRA 2HPBA 1GCEA 1GA9A 1XGJA 4LENA 5GLBA 5DTSA 4E3JA 3G35A 4IVIA 3A3EA 1BLHA 2C6WB 4QD4A 1FQGA 4OOYA 3BFFA 1W7FA 1VM1A 1E3UA 3WS4A 2EX6A 3C7VA 4BL2A 5DF8A 2Z2MB 1PWDA 3SH7A 5AQ7A 1QMFA 1Q2QA 2JBFA 2R9XA 1XX2A 5FA7A 3VSLA 5F1GA 3DW0A 4FSFA 2WADA 2OLVA 1O7EA 5G18A 1LLBA 4E3NA 3DWKA 1ES3A 2BLSA 4KZ6A 4GZBA 4IBRA 3FZCA 5KMWA 1KVMA 5EOOA 3UPPA 3MZEA 1JVJA 1K56D 3O88A 1IYQA 3C7UA 3IF6C 3NC8A 4ID4A 3UPOA 2ZM0A 4ZTKA 3O86A 1H5XA 4X69A 4S2IA 2WZXA 5EOEA 4E3MA 3IQAA 4GDNA 4BJPA 1LL9A 1K57A 2VGKA 2Y2KA 2ZQ8A 4PMAA 1FSYA 5DF9A 4B4XA 3FKWA 4RVAA 3HLWA 4D2OA 4KQRA 2J8YA 2E8IA 1MWSA 1L0DA 1BULA 3C4OA 3ZHHA 3C4PA 4L0LA 3UDIA 1CEGA 1WE4A 1E3UD 4KZAA 3ZG0A 1L0EA 3A3JA 1YLWA 2Q9NA 4OQGA 5AQ9A 4DXBA 4OPZA 3N8SA 4DE1A 2ZM2A 4HBTA 4JF6A 4KQOA 5FQKA 1JTDA 2J7VA 1YLJA 1HD8A 1RGYA 3O3VA 3EQUA 2CC1A 2XR0A 4R4SA 2WKHA 1YMXA 3NDEA 5CERA 3VSKA 4KENB 1WYBA 1SKFA 4S2LA 2IWDA 4KZ3A 1KDSA 4OVDA 2JC7A 2HP5A 4QB8A 4OP5A 3SH8A 1DJBA 1W8YA 2PBYA 5HW3A 4DF6A 2XLNA 2WZZA 1EWZA 3PTEA 3OZHA 1FOFA 3UPNA 4GOGA 3WS2A 1PWGA 3BRMA 2A3UA 4KZ7A 4MBHA 1CEFA 2EXAA 3LCEA 4KZ9A 2G2WA 1U60A 2HDSA 3VMAA 1ES4A 4R23A 4Y7PA 2ZJ9A 4Z9QA 2HDRA 2P74A 2WYXA 4WEJA 3O87A 4QU3A 2QZ6A 1Y54A 3NBLA 2Y2LA 2XQZA 5E2GA 1H8ZA 4Y0TA 4DKIA 5DF7A 3VP1A 1JWZA 1NRFA 4KG5A 5HFOA 4R0QA 1QMEA 1NY0A 4P0MA 4UA9A 1BUEA 5CTMA 3NY4A 5FQIA 4EBLA 3OCNA 3IWQA 4KZ5A 4KQQA 1K4FA 1TEMA 3VFFA 4GKUA 5EE8A 4PM5A 2I72A 5A91A 4DE0A 1PIOA 4N1XA 5F1FA 2XD1A 3S22A 3Q07A 4PM9A 3VP3A 2Y2IA 2G2UA 1IKIA 1EI5A 5HL1A 2OV5A 1FR6A 3IWOA 1IELA 3UY6A 3G2ZA 4GN2A 2WKEA 1WYCA 4R4RA 1CI9A 3Q82A 2ZD8A 3N4IA 3OPPA 3IF5A 3BFCA 5EVIB 1BZAA 2ZC6B 4GB7A 2H5SA 4K0XA 4DE2A 4E3LA 4U3TA 2GDNA 2UWXA 2WUQA 3IHAA 3Q7VB 4JXGA 4EBPA 5A92A 1Q2PA 4OKPA 5FSRA 2Y4AA 4GNUA 3AGFA 4BQMA 5E2EA 4N9KA 3ZGAB 3G4PA 1PI5A 3MZDA 3FWLA 4OLGA 4N1HA 3WS1A 3CMZA 4KZBA 1K6RA 3HUNA 1YLTA 1LI0A 4IEDA 4S2OA 3UO9A 2ZC7A 1MBLA 5EECA 1ESIA 3I7JA 2XFSA 1KE4A 4MEZA 3ZNTA 2ZLYA 3ZVTA 4EQIA 4X6TA 4EV4A 4KG2A 1FR1A 4ZJ2A 4QJGA 2Y2PA 5AQAA 4OOLA 1ERMA 2Q9MA 4UAAA 4BD0A 2HDUA 4PM7A 4S2PA 1YQSA 4GDBA 4OH0A 4NK3A 3S1YA 4K0WA 2XDMA 1PZOA 5M18A 4N92A 1S6RA 2Y2MA 5HARA 3QNCA 4P85A 1Z6FA 4X53A 3V3SA 4F94A 2WGIA 1YLZA 3FV7A 5GHYA 2X71A 3IXHA 4WELA 2WGWA 4HBUA 1L2SA 4X68A 3AGDA 4XXRA 5CHJA 4JXVA 5GHXA 4EWFA 2PU4A 2EX8A 3PBQA 4S2JA 3A3IA 4DDSA 2EFXA 4JLFA 5J8XA 3VP2A 3IF6B 5BOHA 4LV1A 1LL5A 3GQZA 5F82A 1KVLA 5KSHA 3ITBA 1HVBA 1MY8A 4H8RA 4U0TA 1C3BA 3E2KA 4ZJ3A 1ALQA 2VGJA 3WS0A 1ES5A 3G34A 4O7DA 1MWTA 3HVFA 3IXDA 2C5WB 2IWCA 3ZG8B 1PZPA 3G31A 3HLDA 4QY5A 1XPBA 4DE3A 4CJNA 1PWCA 3SS3A 2Y55A 2Y2OA 1IEMA 4HEFA 2P9VA 3DWZA 3PBSA 2Y2HA 3UE3A 1BLPA 4ZDXA 3ZVWA 4E3KA 4BD1A 5F83A 3HLEA 5I94A 2XH9A 5FI2A 3HUOA 3UE1A 1ES2A 3BM6A 4OLDA 2RCXA 3UN7A 4DDYA 2Y2QA 3G2YA 5DVAA 5E2FA 1K54C 5GLCA 5CEBA 3HREA 4FD8A 1KGEA 1JTGA 3D4FA 2ZM8A 1K55C 4M3KA 2EX2A 4PPRA 5KSCA 1W8QA 4DXCA 1IKGA 3WRZA 4OQIA 3LO7A 4K91A 1W5DA 3UE0A 3ISGA 5A93A 3V5MA 4JF4A 4S2KA 2X01A 2Y91A 5DTTA 1EROA 3MBZA 5U47A 4EUZA 1IYOA 4BL3A 1FCNA 4WZ5C 2HP6A 1M40A 3NCKA 3M6BA 2OSUA 5CRFA 1BSGA 4QY6A 4OONA 3BECA 3N8RA 3N7WA 4E3OA 3HBRA 4LV2A 1CK3A 1FSWA 1G6AA 2DNSA 1K4EA 3Q81A 4JPMA 4LCLA 3SS5A 3DTMA 3GTCA 5CGSA 2H0TA 1YLYA 3FYZA 5E43A 3RXWA 3QNBA 3P09A 1O07A 4XUXA 1L0GA 4MBKA 5HX9A 5A90A 1L0FA 2ZQDA 4JXWA 4NETA 3P98A 5GL9A 4E6XA 3OC2A 4LV0A 3BLMA 3IH9A 1SDNA 5JYOA 3ITAA 1LI9A 3SOIA 2FFYA 3PBTA 2H10A 4Q8IA 5FAPA 4WEKA 3BFDA 1BTLA 1TVFA 5CECA 4YINA 4MLLA 5FAQA 4E3IA 2WKIA 1YMSA 3CG5A 1NXYA 4S2NA 4WZ4A 1CI8A 5FQ9A 4R1GA 3TOIA 2WGWB 4OPQA 1KGFA 4IBXA 5FAOA 4RYEA 1FCOA 2Y2GA 2Z2LB 4OP8A 2X02A 3IH8A 2FFFB 3IWIA 4Y0UA 3W8KA 1K54A 1IYPA 3IHBA 4R3JA 1J9MA 1K55A 4WMCA 3CZDA 5EVIC 5HAIA 3BFGA 2QMIA 1YLPA 3IT9A 2DCFA 2XGNA 4FCFA 1N4OA 1K56A 5TGFA 4E6WA 1VQQA 3M6HA 2WGVA 2Y2JA 1NYYA 3PBNA 2IWBA 1AXBA 2ZC5B 3OCLA 4WZ5A 5JYPA 4X55A 5FI7A 3NDGA 1NZOA 4OQ0A 4FH2A 1HZOA 4U0XA 4UA6A 1XKZA 4OPRA 1GHMA 3C5AA 2ZQ9A 2XEPA 3OPLA 1KE0A 4RA7A 1SHVA 5KZHA 1PW8A 1XGIA 3GV9A 3FKVA 3V3RA 5AQBA 3CJMA 4C6YA 2WK0A 1ESUA 3GMWA 3GVBA 2A49A 4JXSA 3OPHA 1KDWA 4BLMA 3SS4A 3GSGA 3HLGA 2B5RA 4Y0OA 4EBNA 1JWVA 5HAPA 1BLCA 3A3FA 3BYDA 3ZG5A 4B4ZA 1XA1A 5CTNA 3HL9A 1ZG6A 3HLBA 3LY4A 3QHYA 4FH4A 4HESA 3W4OA 3WS5A 3N6IA 5CXWA 3WRTA 1KE3A 2ZC4B 5M19A 2J9PA 3NIAA 1ONHA 1MKIA 4WMCD 5FI6A 1LHYA 4P87A 1I2SA 1GHPA 4GD6A 1XP4A 2H0YA 3RJUA 3BLSA 3M2KA 3LEZA 1JWPA 5D3OA 5M1AA 4N9LA 1ONGA 4BENA 3VFHA 5CEDA 2Y2NA 5CGXA 3AGEA 1OMEA 3GRJA 3MKFA 4KZ8A 1I2WA 1TDGA 2OLUA 5GHZA 1HTZA 1YT4A 4OOMA 1H8YA 4X56A 5EVIA 3S4XA 1NZUA 4PM6A 1DJAA 1BT5A 3PBOA 5GLAA 3Q7VA 4S2NC 3BFEA 1NYMA 3IXGA 3MXSA 5FDHA 3ZDJA 3MZFA 3E2LA 2ZC3B 4B88A 2WAFA 2EX9A 5IHVA 1RCJA 5EVLA 3RXXA 4A5RA 3ZCZA 3PBRA 3ZFZA 1GA0A 2Y59A 2V20A 4QHCA 5FQMA 5E2HA 3VOYA 1S0WA 2ZQ7A 2J9OA 5FASA 1TDLA 4KG6A 5CHUA 3LY3A 4LCMA 5TR7A 3UNWA 1YM1A 2PU2A 4GD8A 1ZG4A 3B3XA 1XXMA 3BEBA 1RP5A 4XUZA 4MNRA 3N8LA 4CPKA 2XFTA 1E4DA 1SDEA 2EFUA 4P6BA 5FQQA 1K25A 1DY6A 4OPYA 2XD5A 5HAQA 1PYYA 1GHIA 3UDFA 3HLCA 2ZQAA 3W4PA 4UHUA 4R3BA 4S2MA 1MXOA 4ZBEA 5DTKA 4YFMA 5EVID 1MPLA 2XF3A 5FQJA 3ZNYA 2JE5A 1W79A 3JYIA 1IYSA 2DRWA 1RGZA 1E25A 5CHMA 3TSGA 3NI9A 3PAEA 3PAGA 3G30A 5GLDA 5CGWA 3IF6A 1KGGA 2RL3A 3A3DA 3VOZA 1K38A 2R9WA 3HUMA 3IXBA 1M6KA 2XK1A 4OQHA 1I5QA 3MXRA 3MFDA 4C75A 4LV3A 4RX3A 1ERQA 2V2FF 3Q1FA 4C3QA 4KZ4A 1G68A 1ZKJA 1DJCA 4ZAMA 5L2FA 2HDQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WWX A;  5FAT A;  1PI4 A;  3ZG7 B;  3HLF A;  1FCM A;  3ZG9 B;  4WYY A;  2ZQC A;  3EQV A;  4PM8 A;  4JKT A;  1MWR A;  2BG1 A;  3V39 A;  3VP0 A;  2EXB A;  1K57 C;  2JCH A;  4WBG A;  3G32 A;  5TFQ A;  1SCW A;  4IVK A;  1N9B A;  1ZC2 A;  2WAE A;  3M2J A;  1MWU A;  3VP4 A;  1XA7 A;  3UDX A;  3TG9 A;  3W4Q A;  3V50 A;  5EUA A;  4DRT A;  3Q7Z A;  4MBF A;  5EPH A;  1BLS A;  1K6S A;  2QPN A;  2V1Z A;  4JBF A;  4WM9 A;  2ZMA A;  2P9V B;  4RX2 A;  1NJ4 A;  1PW1 A;  2HP9 A;  4JF5 A;  4UA7 A;  4ZJ1 A;  3MKE A;  3SH9 A;  3GR2 A;  3OPR A;  2HPB A;  1GCE A;  1GA9 A;  1XGJ A;  4LEN A;  5GLB A;  5DTS A;  4E3J A;  3G35 A;  4IVI A;  3A3E A;  1BLH A;  2C6W B;  4QD4 A;  1FQG A;  4OOY A;  3BFF A;  1W7F A;  1VM1 A;  1E3U A;  3WS4 A;  2EX6 A;  3C7V A;  4BL2 A;  5DF8 A;  2Z2M B;  1PWD A;  3SH7 A;  5AQ7 A;  1QMF A;  1Q2Q A;  2JBF A;  2R9X A;  1XX2 A;  5FA7 A;  3VSL A;  5F1G A;  3DW0 A;  4FSF A;  2WAD A;  2OLV A;  1O7E A;  5G18 A;  1LLB A;  4E3N A;  3DWK A;  1ES3 A;  2BLS A;  4KZ6 A;  4GZB A;  4IBR A;  3FZC A;  5KMW A;  1KVM A;  5EOO A;  3UPP A;  3MZE A;  1JVJ A;  1K56 D;  3O88 A;  1IYQ A;  3C7U A;  3IF6 C;  3NC8 A;  4ID4 A;  3UPO A;  2ZM0 A;  4ZTK A;  3O86 A;  1H5X A;  4X69 A;  4S2I A;  2WZX A;  5EOE A;  4E3M A;  3IQA A;  4GDN A;  4BJP A;  1LL9 A;  1K57 A;  2VGK A;  2Y2K A;  2ZQ8 A;  4PMA A;  1FSY A;  5DF9 A;  4B4X A;  3FKW A;  4RVA A;  3HLW A;  4D2O A;  4KQR A;  2J8Y A;  2E8I A;  1MWS A;  1L0D A;  1BUL A;  3C4O A;  3ZHH A;  3C4P A;  4L0L A;  3UDI A;  1CEG A;  1WE4 A;  1E3U D;  4KZA A;  3ZG0 A;  1L0E A;  3A3J A;  1YLW A;  2Q9N A;  4OQG A;  5AQ9 A;  4DXB A;  4OPZ A;  3N8S A;  4DE1 A;  2ZM2 A;  4HBT A;  4JF6 A;  4KQO A;  5FQK A;  1JTD A;  2J7V A;  1YLJ A;  1HD8 A;  1RGY A;  3O3V A;  3EQU A;  2CC1 A;  2XR0 A;  4R4S A;  2WKH A;  1YMX A;  3NDE A;  5CER A;  3VSK A;  4KEN B;  1WYB A;  1SKF A;  4S2L A;  2IWD A;  4KZ3 A;  1KDS A;  4OVD A;  2JC7 A;  2HP5 A;  4QB8 A;  4OP5 A;  3SH8 A;  1DJB A;  1W8Y A;  2PBY A;  5HW3 A;  4DF6 A;  2XLN A;  2WZZ A;  1EWZ A;  3PTE A;  3OZH A;  1FOF A;  3UPN A;  4GOG A;  3WS2 A;  1PWG A;  3BRM A;  2A3U A;  4KZ7 A;  4MBH A;  1CEF A;  2EXA A;  3LCE A;  4KZ9 A;  2G2W A;  1U60 A;  2HDS A;  3VMA A;  1ES4 A;  4R23 A;  4Y7P A;  2ZJ9 A;  4Z9Q A;  2HDR A;  2P74 A;  2WYX A;  4WEJ A;  3O87 A;  4QU3 A;  2QZ6 A;  1Y54 A;  3NBL A;  2Y2L A;  2XQZ A;  5E2G A;  1H8Z A;  4Y0T A;  4DKI A;  5DF7 A;  3VP1 A;  1JWZ A;  1NRF A;  4KG5 A;  5HFO A;  4R0Q A;  1QME A;  1NY0 A;  4P0M A;  4UA9 A;  1BUE A;  5CTM A;  3NY4 A;  5FQI A;  4EBL A;  3OCN A;  3IWQ A;  4KZ5 A;  4KQQ A;  1K4F A;  1TEM A;  3VFF A;  4GKU A;  5EE8 A;  4PM5 A;  2I72 A;  5A91 A;  4DE0 A;  1PIO A;  4N1X A;  5F1F A;  2XD1 A;  3S22 A;  3Q07 A;  4PM9 A;  3VP3 A;  2Y2I A;  2G2U A;  1IKI A;  1EI5 A;  5HL1 A;  2OV5 A;  1FR6 A;  3IWO A;  1IEL A;  3UY6 A;  3G2Z A;  4GN2 A;  2WKE A;  1WYC A;  4R4R A;  1CI9 A;  3Q82 A;  2ZD8 A;  3N4I A;  3OPP A;  3IF5 A;  3BFC A;  5EVI B;  1BZA A;  2ZC6 B;  4GB7 A;  2H5S A;  4K0X A;  4DE2 A;  4E3L A;  4U3T A;  2GDN A;  2UWX A;  2WUQ A;  3IHA A;  3Q7V B;  4JXG A;  4EBP A;  5A92 A;  1Q2P A;  4OKP A;  5FSR A;  2Y4A A;  4GNU A;  3AGF A;  4BQM A;  5E2E A;  4N9K A;  3ZGA B;  3G4P A;  1PI5 A;  3MZD A;  3FWL A;  4OLG A;  4N1H A;  3WS1 A;  3CMZ A;  4KZB A;  1K6R A;  3HUN A;  1YLT A;  1LI0 A;  4IED A;  4S2O A;  3UO9 A;  2ZC7 A;  1MBL A;  5EEC A;  1ESI A;  3I7J A;  2XFS A;  1KE4 A;  4MEZ A;  3ZNT A;  2ZLY A;  3ZVT A;  4EQI A;  4X6T A;  4EV4 A;  4KG2 A;  1FR1 A;  4ZJ2 A;  4QJG A;  2Y2P A;  5AQA A;  4OOL A;  1ERM A;  2Q9M A;  4UAA A;  4BD0 A;  2HDU A;  4PM7 A;  4S2P A;  1YQS A;  4GDB A;  4OH0 A;  4NK3 A;  3S1Y A;  4K0W A;  2XDM A;  1PZO A;  5M18 A;  4N92 A;  1S6R A;  2Y2M A;  5HAR A;  3QNC A;  4P85 A;  1Z6F A;  4X53 A;  3V3S A;  4F94 A;  2WGI A;  1YLZ A;  3FV7 A;  5GHY A;  2X71 A;  3IXH A;  4WEL A;  2WGW A;  4HBU A;  1L2S A;  4X68 A;  3AGD A;  4XXR A;  5CHJ A;  4JXV A;  5GHX A;  4EWF A;  2PU4 A;  2EX8 A;  3PBQ A;  4S2J A;  3A3I A;  4DDS A;  2EFX A;  4JLF A;  5J8X A;  3VP2 A;  3IF6 B;  5BOH A;  4LV1 A;  1LL5 A;  3GQZ A;  5F82 A;  1KVL A;  5KSH A;  3ITB A;  1HVB A;  1MY8 A;  4H8R A;  4U0T A;  1C3B A;  3E2K A;  4ZJ3 A;  1ALQ A;  2VGJ A;  3WS0 A;  1ES5 A;  3G34 A;  4O7D A;  1MWT A;  3HVF A;  3IXD A;  2C5W B;  2IWC A;  3ZG8 B;  1PZP A;  3G31 A;  3HLD A;  4QY5 A;  1XPB A;  4DE3 A;  4CJN A;  1PWC A;  3SS3 A;  2Y55 A;  2Y2O A;  1IEM A;  4HEF A;  2P9V A;  3DWZ A;  3PBS A;  2Y2H A;  3UE3 A;  1BLP A;  4ZDX A;  3ZVW A;  4E3K A;  4BD1 A;  5F83 A;  3HLE A;  5I94 A;  2XH9 A;  5FI2 A;  3HUO A;  3UE1 A;  1ES2 A;  3BM6 A;  4OLD A;  2RCX A;  3UN7 A;  4DDY A;  2Y2Q A;  3G2Y A;  5DVA A;  5E2F A;  1K54 C;  5GLC A;  5CEB A;  3HRE A;  4FD8 A;  1KGE A;  1JTG A;  3D4F A;  2ZM8 A;  1K55 C;  4M3K A;  2EX2 A;  4PPR A;  5KSC A;  1W8Q A;  4DXC A;  1IKG A;  3WRZ A;  4OQI A;  3LO7 A;  4K91 A;  1W5D A;  3UE0 A;  3ISG A;  5A93 A;  3V5M A;  4JF4 A;  4S2K A;  2X01 A;  2Y91 A;  5DTT A;  1ERO A;  3MBZ A;  5U47 A;  4EUZ A;  1IYO A;  4BL3 A;  1FCN A;  4WZ5 C;  2HP6 A;  1M40 A;  3NCK A;  3M6B A;  2OSU A;  5CRF A;  1BSG A;  4QY6 A;  4OON A;  3BEC A;  3N8R A;  3N7W A;  4E3O A;  3HBR A;  4LV2 A;  1CK3 A;  1FSW A;  1G6A A;  2DNS A;  1K4E A;  3Q81 A;  4JPM A;  4LCL A;  3SS5 A;  3DTM A;  3GTC A;  5CGS A;  2H0T A;  1YLY A;  3FYZ A;  5E43 A;  3RXW A;  3QNB A;  3P09 A;  1O07 A;  4XUX A;  1L0G A;  4MBK A;  5HX9 A;  5A90 A;  1L0F A;  2ZQD A;  4JXW A;  4NET A;  3P98 A;  5GL9 A;  4E6X A;  3OC2 A;  4LV0 A;  3BLM A;  3IH9 A;  1SDN A;  5JYO A;  3ITA A;  1LI9 A;  3SOI A;  2FFY A;  3PBT A;  2H10 A;  4Q8I A;  5FAP A;  4WEK A;  3BFD A;  1BTL A;  1TVF A;  5CEC A;  4YIN A;  4MLL A;  5FAQ A;  4E3I A;  2WKI A;  1YMS A;  3CG5 A;  1NXY A;  4S2N A;  4WZ4 A;  1CI8 A;  5FQ9 A;  4R1G A;  3TOI A;  2WGW B;  4OPQ A;  1KGF A;  4IBX A;  5FAO A;  4RYE A;  1FCO A;  2Y2G A;  2Z2L B;  4OP8 A;  2X02 A;  3IH8 A;  2FFF B;  3IWI A;  4Y0U A;  3W8K A;  1K54 A;  1IYP A;  3IHB A;  4R3J A;  1J9M A;  1K55 A;  4WMC A;  3CZD A;  5EVI C;  5HAI A;  3BFG A;  2QMI A;  1YLP A;  3IT9 A;  2DCF A;  2XGN A;  4FCF A;  1N4O A;  1K56 A;  5TGF A;  4E6W A;  1VQQ A;  3M6H A;  2WGV A;  2Y2J A;  1NYY A;  3PBN A;  2IWB A;  1AXB A;  2ZC5 B;  3OCL A;  4WZ5 A;  5JYP A;  4X55 A;  5FI7 A;  3NDG A;  1NZO A;  4OQ0 A;  4FH2 A;  1HZO A;  4U0X A;  4UA6 A;  1XKZ A;  4OPR A;  1GHM A;  3C5A A;  2ZQ9 A;  2XEP A;  3OPL A;  1KE0 A;  4RA7 A;  1SHV A;  5KZH A;  1PW8 A;  1XGI A;  3GV9 A;  3FKV A;  3V3R A;  5AQB A;  3CJM A;  4C6Y A;  2WK0 A;  1ESU A;  3GMW A;  3GVB A;  2A49 A;  4JXS A;  3OPH A;  1KDW A;  4BLM A;  3SS4 A;  3GSG A;  3HLG A;  2B5R A;  4Y0O A;  4EBN A;  1JWV A;  5HAP A;  1BLC A;  3A3F A;  3BYD A;  3ZG5 A;  4B4Z A;  1XA1 A;  5CTN A;  3HL9 A;  1ZG6 A;  3HLB A;  3LY4 A;  3QHY A;  4FH4 A;  4HES A;  3W4O A;  3WS5 A;  3N6I A;  5CXW A;  3WRT A;  1KE3 A;  2ZC4 B;  5M19 A;  2J9P A;  3NIA A;  1ONH A;  1MKI A;  4WMC D;  5FI6 A;  1LHY A;  4P87 A;  1I2S A;  1GHP A;  4GD6 A;  1XP4 A;  2H0Y A;  3RJU A;  3BLS A;  3M2K A;  3LEZ A;  1JWP A;  5D3O A;  5M1A A;  4N9L A;  1ONG A;  4BEN A;  3VFH A;  5CED A;  2Y2N A;  5CGX A;  3AGE A;  1OME A;  3GRJ A;  3MKF A;  4KZ8 A;  1I2W A;  1TDG A;  2OLU A;  5GHZ A;  1HTZ A;  1YT4 A;  4OOM A;  1H8Y A;  4X56 A;  5EVI A;  3S4X A;  1NZU A;  4PM6 A;  1DJA A;  1BT5 A;  3PBO A;  5GLA A;  3Q7V A;  4S2N C;  3BFE A;  1NYM A;  3IXG A;  3MXS A;  5FDH A;  3ZDJ A;  3MZF A;  3E2L A;  2ZC3 B;  4B88 A;  2WAF A;  2EX9 A;  5IHV A;  1RCJ A;  5EVL A;  3RXX A;  4A5R A;  3ZCZ A;  3PBR A;  3ZFZ A;  1GA0 A;  2Y59 A;  2V20 A;  4QHC A;  5FQM A;  5E2H A;  3VOY A;  1S0W A;  2ZQ7 A;  2J9O A;  5FAS A;  1TDL A;  4KG6 A;  5CHU A;  3LY3 A;  4LCM A;  5TR7 A;  3UNW A;  1YM1 A;  2PU2 A;  4GD8 A;  1ZG4 A;  3B3X A;  1XXM A;  3BEB A;  1RP5 A;  4XUZ A;  4MNR A;  3N8L A;  4CPK A;  2XFT A;  1E4D A;  1SDE A;  2EFU A;  4P6B A;  5FQQ A;  1K25 A;  1DY6 A;  4OPY A;  2XD5 A;  5HAQ A;  1PYY A;  1GHI A;  3UDF A;  3HLC A;  2ZQA A;  3W4P A;  4UHU A;  4R3B A;  4S2M A;  1MXO A;  4ZBE A;  5DTK A;  4YFM A;  5EVI D;  1MPL A;  2XF3 A;  5FQJ A;  3ZNY A;  2JE5 A;  1W79 A;  3JYI A;  1IYS A;  2DRW A;  1RGZ A;  1E25 A;  5CHM A;  3TSG A;  3NI9 A;  3PAE A;  3PAG A;  3G30 A;  5GLD A;  5CGW A;  3IF6 A;  1KGG A;  2RL3 A;  3A3D A;  3VOZ A;  1K38 A;  2R9W A;  3HUM A;  3IXB A;  1M6K A;  2XK1 A;  4OQH A;  1I5Q A;  3MXR A;  3MFD A;  4C75 A;  4LV3 A;  4RX3 A;  1ERQ A;  2V2F F;  3Q1F A;  4C3Q A;  4KZ4 A;  1G68 A;  1ZKJ A;  1DJC A;  4ZAM A;  5L2F A;  2HDQ A; 
#chains in the Genus database with same CATH topology
 5FAT A;  1PI4 A;  2GJ3 A;  1DP8 A;  4KUK A;  1Y28 A;  1K0K A;  1SCW A;  1ZC2 A;  2P08 A;  3M2J A;  1MWU A;  3W4Q A;  4DRT A;  3Q7Z A;  4MBF A;  1K6S A;  4I39 A;  4RX2 A;  4GHI B;  3F1P A;  4JF5 A;  3EEH A;  3MKE A;  1LL8 A;  3GR2 A;  3IX3 A;  5GLB A;  5HL6 A;  1BLH A;  2WKR A;  1VM1 A;  2Z2M B;  2WKQ A;  5DJU A;  2DMW A;  1O7E A;  2BLS A;  2IA2 A;  4IBR A;  2HV1 A;  3EWK A;  3K3D A;  3MJQ A;  1JVJ A;  2HJE A;  2K2N A;  2PYP A;  4ID4 A;  4X69 A;  4P6Z S;  5EV0 A;  2QYB A;  2FH5 A;  1XFN A;  2ZQ8 A;  4B4X A;  1FSY A;  5DF9 A;  3FKW A;  4D2O A;  2LB9 A;  4L0L A;  4HP4 A;  1WE4 A;  4BBV A;  1E3U D;  5EVE A;  3ZG0 A;  4OQG A;  5AQ9 A;  1YLW A;  2Q9N A;  3N8S A;  2ZM2 A;  4JF6 A;  5FQK A;  1HD8 A;  4IHQ A;  1XJ3 A;  2J3T C;  4YNR A;  1YSQ A;  4S2L A;  4KZ3 A;  1KDS A;  2HP5 A;  1OPX A;  3TE8 A;  4OP5 A;  4NG2 A;  2XLN A;  1X0O A;  2J80 A;  1CEF A;  3LCE A;  4KZ9 A;  2W1R A;  3OLO A;  5HDD A;  2G2W A;  3VMA A;  4WL9 A;  1BYW A;  1ZTU A;  1S4R A;  2WYX A;  3T1Q B;  3QP6 A;  1YPR A;  2Y2L A;  4I3J A;  5E2G A;  1GSV A;  4P0M A;  4UA9 A;  4KQQ A;  1TEM A;  1OTI A;  4DE0 A;  2XD1 A;  3S22 A;  3VP3 A;  4M4X A;  5HL1 A;  2BTF P;  4GN2 A;  3MQ0 A;  1WYC A;  4R4R A;  1CI9 A;  4GW9 A;  3OPP A;  3BFC A;  3LR0 A;  2XA7 S;  4U3T A;  3IHA A;  5FSR A;  2Y4A A;  3AGF A;  4HH2 A;  3IX4 A;  4N9K A;  3ZGA B;  3PR6 A;  3ICY A;  3FWL A;  4N1H A;  4CLC C;  1NRJ A;  1N9N A;  3HCY A;  4NXG A;  3KO6 A;  1N9L A;  3BJN A;  4S2O A;  2ZC7 A;  5EEC A;  1ESI A;  3TW8 A;  3ZVT A;  1KE4 A;  4EQI A;  4EV4 A;  4X6T A;  4QJG A;  4ZJ2 A;  1ERM A;  5FDS A;  1YQS A;  4GDB A;  2VK3 A;  3S1Y A;  2VJW A;  4QWO A;  1PZO A;  5M18 A;  2Y79 A;  4PKY G;  3LI9 A;  5GHY A;  2X71 A;  2WGW A;  1L2S A;  4X68 A;  4XXR A;  5GHX A;  3PBQ A;  2VLG A;  5L09 A;  3VP2 A;  3IF6 B;  5BOH A;  4LV1 A;  4H8R A;  2VV6 A;  1ALQ A;  2VGJ A;  3WS0 A;  3T4K A;  4CLC E;  2C5W B;  2IWC A;  2OAQ 1;  4FUW A;  2Y55 A;  4Y15 A;  3ZVW A;  4E3K A;  1FIL A;  5F83 A;  5G4Z A;  5I94 A;  3UE1 A;  4I3I A;  3BM6 A;  2RCX A;  2WKP A;  4IUH A;  4DDY A;  5DVA A;  3HRE A;  4FD8 A;  3D4F A;  2ZM8 A;  5KSC A;  3WRZ A;  2Y91 A;  5DTT A;  1ERO A;  3MBZ A;  2W3G A;  4Q0I A;  5U47 A;  4WZ5 C;  4EEU A;  1M40 A;  3NCK A;  2ZMF A;  1BSG A;  3N8R A;  1XJ6 A;  3HBR A;  4LV2 A;  1TS6 A;  2DNS A;  1YLY A;  2A2L A;  5J4E A;  4GS9 B;  2ZQD A;  4NET A;  3P98 A;  4E6X A;  2NUP C;  3SOI A;  3MSH A;  4Y3I A;  2H10 A;  4Q8I A;  3BFD A;  5IT5 A;  1F98 A;  1G5U A;  4R6L A;  4MLL A;  5FAQ A;  1NXY A;  2WGW B;  4OPQ A;  1A0K A;  1KGF A;  3H9W A;  4Y0U A;  3IHB A;  1J9M A;  5EVI C;  2DCF A;  3FPW A;  2XGN A;  4FCF A;  5TGF A;  1VQQ A;  3PBN A;  3R4K A;  2OWJ A;  3OCL A;  3NDG A;  3NUL A;  1T18 A;  4OPR A;  1GHM A;  3OPL A;  2XEP A;  5HD3 A;  2PD7 A;  3GV9 A;  3FKV A;  5AQB A;  5J7E A;  3CJM A;  4DJ3 A;  4PAU A;  4BLM A;  3GSG A;  4X1L A;  2B5R A;  4EBN A;  4HNB A;  3ZG5 A;  4B4Z A;  1XA1 A;  2V9A A;  3LIA A;  3QHY A;  3CHW P;  3N6I A;  5AVE A;  1ONH A;  1MKI A;  3PHY A;  1ACF A;  1OTD A;  4WMC D;  1LHY A;  4Y13 A;  3IS2 A;  3RJU A;  1JWP A;  1OTE A;  3D72 A;  2Y2N A;  5CGX A;  3GRJ A;  1H3Q A;  1V9Y A;  1TDG A;  1HTZ A;  1YT4 A;  5MC7 A;  4OOM A;  1XJ4 A;  1NZU A;  5HWT A;  3R7W B;  3VE4 A;  3PBO A;  1T19 A;  1NYM A;  3IXG A;  2YKF A;  3E2L A;  2WAF A;  3ZCZ A;  3PBR A;  3ZFZ A;  4NEE D;  1N9O A;  4O8G A;  5E2H A;  2HGV A;  4KG6 A;  3UNW A;  2PU2 A;  1ZG4 A;  1P9R A;  1XXM A;  4XUZ A;  2V8C A;  3KSG A;  3N8L A;  4CPK A;  2XFT A;  1E4D A;  1XJ2 A;  3NOU C;  2B02 A;  2PBD P;  1PYY A;  4UEY A;  4UHU A;  2VKS A;  1MPL A;  3ZNY A;  2QKP A;  3NHQ A;  3BQA A;  1E25 A;  5CHM A;  2V0U A;  5CGW A;  2GX5 A;  1K38 A;  2R9W A;  3MFD A;  4LV3 A;  4RX3 A;  3Q1F A;  2ZOH A;  4KZ4 A;  1Y4O A;  3WWX A;  3TJZ C;  4PM8 A;  1F9I A;  2BG1 A;  3VP0 A;  2JCH A;  3EGX C;  3G32 A;  2WAE A;  3VP4 A;  3TG9 A;  5EUA A;  5EPH A;  4JBF A;  2V1Z A;  3B33 A;  4WM9 A;  1NJ4 A;  1PW1 A;  4UA7 A;  2EA9 A;  3SH9 A;  5EFW A;  3OPR A;  1GA9 A;  3G6O A;  3G35 A;  3DAV A;  4QD4 A;  5TBM A;  1FQG A;  4LPZ A;  4OOY A;  2EWW A;  4BL2 A;  5AQ7 A;  1MC0 A;  1Q2Q A;  1QMF A;  2AVX A;  3C38 A;  3VSL A;  2QJ7 A;  5F1G A;  4CQH A;  5G18 A;  3LEQ A;  3DWK A;  1ES3 A;  4KZ6 A;  1TS7 A;  4H6J A;  5EOO A;  4LRX C;  3MZE A;  4RQ9 A;  1G6O A;  3C7U A;  3NC8 A;  1AWI A;  4ZTK A;  3H82 A;  2VGK A;  2Y2K A;  3MF0 A;  1GSW A;  1MWS A;  4IUK A;  1L0D A;  1VEU B;  3C4O A;  4EQ1 A;  4HY8 A;  5G4Y A;  3B47 A;  3T4L A;  1L0E A;  3A3J A;  4DXB A;  4OPZ A;  4HBT A;  1YLJ A;  1HLU P;  3EQU A;  4R4S A;  5HDC A;  1YMX A;  1WYB A;  1SKF A;  2IWD A;  2JC7 A;  2W3E A;  1EWZ A;  3PTE A;  3OZH A;  3CWF A;  3WS2 A;  3BRM A;  4PKY A;  2W0N A;  3C2W A;  3F1N A;  4R23 A;  2ZJ9 A;  5HDS A;  2HDR A;  3PYP A;  4IJG A;  2R78 A;  1Z09 A;  3O87 A;  2I9V A;  3RTY A;  3VOL A;  5AJG A;  5FL3 A;  3U4L P;  3EOI A;  4DKI A;  4R0Q A;  1NY0 A;  1BUE A;  5CTM A;  2HJ9 C;  3NY4 A;  4EBL A;  3OCN A;  4L9E A;  4GKU A;  5A91 A;  5F1F A;  1TS8 A;  3Q07 A;  2Y2I A;  4BWI A;  2G2U A;  1EI5 A;  3JVV A;  1FR6 A;  3IWO A;  2WKE A;  4Z1W A;  3Q82 A;  4G3K A;  3IF5 A;  1BZA A;  4GB7 A;  4K0X A;  4E3L A;  2GDN A;  2UWX A;  3A0S A;  3Q7V B;  4EBP A;  1LT0 A;  2CMN A;  2P04 A;  5E2E A;  4X25 A;  1OJG A;  2G7U A;  3WS1 A;  4ARZ B;  2K31 A;  1YLT A;  1LI0 A;  1MBL A;  2EWV A;  2W27 A;  4I38 A;  4OOL A;  4UAA A;  5AQA A;  3E4P A;  2ZL1 A;  4PM7 A;  4S2P A;  3MFX A;  4NK3 A;  3LUQ A;  3DTK A;  4KQD A;  1NWZ A;  2VZW A;  3FV7 A;  4WEL A;  1P9W A;  4I3A A;  3T50 A;  4EWF A;  3A3I A;  4L9G A;  2V1B A;  3E98 A;  3CUE C;  3ITB A;  1MY8 A;  2A24 B;  4DMZ A;  5HD5 A;  3HVF A;  3IXD A;  2BAS A;  3G31 A;  3HLD A;  5DFX A;  4DE3 A;  3SS3 A;  1IEM A;  4HEF A;  2P9V A;  3DWZ A;  5CX7 A;  3E0Y A;  3HUO A;  2ZOI A;  1ES2 A;  1T1B A;  3UMD A;  5DKL A;  1W63 Q;  3A0R A;  4CLC A;  3DTI A;  2PD8 A;  5CEB A;  5GLC A;  1JTG A;  2JKF A;  1K55 C;  4FOF A;  3SW1 A;  1YAX A;  2EX2 A;  1W8Q A;  1IKG A;  3F1P B;  4K91 A;  3ISG A;  3V5M A;  4S2K A;  1FCN A;  3N7W A;  1MKM A;  3UB8 A;  1XFQ A;  3Q81 A;  3LIC A;  5CGS A;  5E43 A;  4R38 A;  4YOF A;  3P09 A;  1O07 A;  5FEF A;  3L9K A;  1L0F A;  5L8M A;  5GL9 A;  3OC2 A;  5F69 A;  3BLM A;  1SDN A;  3LIB A;  3ITA A;  2FFY A;  4QPR A;  4YIN A;  4E3I A;  2WKI A;  1YMS A;  4S2N A;  2O99 A;  3TOI A;  4IBX A;  5FAO A;  4RYE A;  3UB9 A;  1IYP A;  3MR0 A;  1PNE A;  4WN5 A;  3IT9 A;  2Z6D A;  4F3L A;  1N4O A;  4E6W A;  1NYY A;  2IWB A;  4EW7 A;  4WZ5 A;  5JYP A;  3B42 A;  4U0X A;  3T1S A;  1XKZ A;  3LR4 A;  3C5A A;  4RA7 A;  3KSF A;  1S66 L;  1SHV A;  3H7W A;  4LGW A;  2WK0 A;  2V1A A;  4JXS A;  3OPH A;  1SZV A;  2JHE A;  4R3A A;  4BMW A;  3DBA A;  3S7P A;  3BYD A;  3HJI A;  4WLA A;  1ZG6 A;  2HF6 A;  4FH4 A;  4HES A;  4MN7 A;  3W4O A;  4Q0J A;  4P87 A;  2H0Y A;  3M2K A;  3ZQ5 A;  5D3O A;  5M1A A;  4BEN A;  1ONG A;  1S4S A;  5CED A;  1OME A;  3MKF A;  3W2Z A;  1ODV A;  5EVI A;  1OTB A;  3S4X A;  1DJA A;  4S2N C;  3BFE A;  3MXS A;  3MZF A;  5IHV A;  2EX9 A;  4HIA A;  4A5R A;  1GA0 A;  4HOI A;  4ESP A;  2JKR M;  3E4O A;  4NXE A;  4LCM A;  5IU1 A;  1CQA A;  2VGL S;  3E4Q A;  1ZHH B;  2XD5 A;  4ETZ A;  4MN5 A;  1GHI A;  3HLC A;  3W4P A;  3OOV A;  4GJ4 A;  4S2M A;  1MXO A;  2XSS A;  5DTK A;  4YFM A;  4I5S A;  2XF3 A;  3F1O A;  2JE5 A;  2DRW A;  1DP9 A;  3H7W B;  2M7U A;  3IXB A;  2XK1 A;  1I5Q A;  4C75 A;  1ERQ A;  1G68 A;  1ZKJ A;  5L2F A;  2PYR A;  4Y5F A;  3ZG7 B;  1FCM A;  3ZG9 B;  3EQV A;  4JGP A;  4HP9 A;  4LLO B;  1K57 C;  1TS0 A;  4WBG A;  5TFQ A;  2HZ5 A;  4IVK A;  3UB6 A;  4NKP A;  2W3F A;  3V50 A;  3LI8 A;  1BLS A;  2QPN A;  4MMN A;  1P97 A;  2OOL A;  4MDZ A;  2HP9 A;  4LRZ E;  2HPB A;  1GCE A;  4LEN A;  5DTS A;  4IVI A;  5DJT A;  3A3E A;  2C6W B;  3C8C A;  2UV0 E;  1W7F A;  1E3U A;  3WS4 A;  2EX6 A;  3C7V A;  3LIE A;  5DF8 A;  3LR5 A;  1PWD A;  3OBF A;  3SH7 A;  4MCW A;  2NUT C;  5FA7 A;  2Q0O A;  4FSF A;  3FPV A;  2OLV A;  1LLB A;  5F5Y A;  3LYX A;  4GZB A;  3UPP A;  4UQI M;  1IYQ A;  2QWS A;  3NOP C;  4Y2F A;  3UPO A;  1H5X A;  1D06 A;  5EOE A;  4E3M A;  5EM0 A;  1T1A A;  2H28 A;  1LL9 A;  3HLW A;  2J8Y A;  5I5L A;  3RH8 B;  2VA0 A;  3IBR A;  2PAV P;  4NXF A;  4DE1 A;  1JTD A;  2J7V A;  1RGY A;  3KYE A;  3O3V A;  4XT2 A;  2CC1 A;  1VHM A;  3NDE A;  5CER A;  3VSK A;  3C30 A;  4OVD A;  3CPT A;  5L10 A;  1DJB A;  1G28 A;  1W8Y A;  2PBY A;  4DF6 A;  2GZA A;  2A3U A;  4KZ7 A;  4AFI A;  1S67 L;  2VV7 A;  1OT6 A;  2EXA A;  1GSX A;  1U60 A;  3K3C A;  4Y7P A;  4Z9Q A;  2PR6 A;  3MQQ A;  1Y54 A;  4P6Z M;  4Y0T A;  5DF7 A;  1JWZ A;  1NRF A;  5HFO A;  2PDR A;  2KOI A;  3IWQ A;  4KZ5 A;  5IS1 A;  1K4F A;  3VFF A;  1LSW A;  3IS2 B;  4PM5 A;  1PIO A;  3QP8 A;  4N1X A;  4PM9 A;  3KX0 X;  2OV5 A;  1IEL A;  3UY6 A;  5TJJ A;  4JGO A;  2V8F A;  2PR5 A;  2ZD8 A;  3K2N A;  2WUQ A;  3QP1 A;  2JKR I;  4JXG A;  1Q2P A;  3KYZ A;  4OKP A;  4GNU A;  1IFQ A;  2QHK A;  3G4P A;  4JGQ A;  1K6R A;  4IED A;  3UO9 A;  3I7J A;  5HW3 A;  2ZLY A;  4KG2 A;  1V9Z A;  2KLI A;  3UE6 A;  4OH0 A;  2XDM A;  4N92 A;  5HAR A;  3QNC A;  4P85 A;  1Z6F A;  4X53 A;  4F94 A;  1YLZ A;  1VET A;  2LB5 A;  2P7J A;  4HBU A;  5CHJ A;  2PU4 A;  4S2J A;  2EFX A;  5HWW A;  4EUV A;  3GQZ A;  2O9B A;  1C3B A;  3E2K A;  3LIF A;  1ES5 A;  3G34 A;  4O7D A;  3DTE A;  3TRC A;  2XA7 M;  4CJN A;  1PWC A;  3UE3 A;  3PBS A;  1BLP A;  2XH9 A;  2QJ5 A;  4G3W A;  5FI2 A;  3G2Y A;  5E2F A;  1K54 C;  4DN0 A;  4M3K A;  3MMH A;  4ME4 A;  4OQI A;  3LO7 A;  1W5D A;  5A93 A;  3CI6 A;  4EUZ A;  4BL3 A;  2HP6 A;  4BBT A;  3M6B A;  2OSU A;  5CRF A;  4QY6 A;  5TBM B;  3BEC A;  2L1M A;  4ZRR A;  1G6A A;  1UWP X;  3DTM A;  2H0T A;  1J3W A;  3CUE A;  4XUX A;  1L0G A;  4MBK A;  4X1M A;  4H6J B;  2B95 A;  5JYO A;  1LI9 A;  1BTL A;  1TVF A;  3H82 B;  1W63 M;  3QP4 A;  3ZYT A;  5FQ9 A;  1CI8 A;  1FCO A;  2Z2L B;  4OP8 A;  3IH8 A;  4FTX A;  1YKD A;  3NEC A;  1K55 A;  2KX6 A;  4WMC A;  5HAI A;  3BFG A;  2YKH A;  1AXB A;  3D9Y A;  1NZO A;  1HZO A;  2J3W A;  2VGL M;  3BWL A;  1PW8 A;  5DKK A;  3V3R A;  4C6Y A;  3GMW A;  4HH3 A;  2L4R A;  1KDW A;  5L07 A;  1UGU A;  3HLG A;  1JWV A;  3T1X A;  5CTN A;  3HL9 A;  1S1Y A;  4O01 A;  3HLB A;  3LY4 A;  3F1N B;  5CXW A;  2Z6C A;  4HHD A;  1YSP A;  4O0P A;  2O9C A;  3VFH A;  1DP6 A;  4Q0H A;  3AGE A;  2OLU A;  5GHZ A;  3NOT C;  1F5M A;  1WA9 A;  1H8Y A;  3UME A;  4PM6 A;  1BT5 A;  5GLA A;  1NLZ A;  2ZC3 B;  4EER A;  1RCJ A;  3RXX A;  4DJ2 A;  2OWH A;  2V20 A;  4QHC A;  5FQM A;  1S0W A;  3L7H A;  2ZQ7 A;  1TDL A;  5CHU A;  3O5Y A;  5TR7 A;  2XRO A;  3KYQ A;  1D1J A;  4MNR A;  2B18 A;  4EET B;  2L0W A;  4P6B A;  5FQQ A;  1DY6 A;  3HJK A;  4OPY A;  3LFV A;  5HAQ A;  1JNU A;  2ZQA A;  1MZU A;  4R3B A;  2W3D A;  5F68 A;  5FQJ A;  3JYI A;  3TSG A;  3NI9 A;  3PAE A;  3G30 A;  2ZL1 B;  1PRQ A;  2ZBB A;  3IF6 A;  1KGG A;  3A3D A;  3VOZ A;  3HUM A;  1M6K A;  2V0W A;  3P7N A;  4OQH A;  2V2F F;  4ZAM A;  1DJC A;  2HDQ A;  3HLF A;  3S7N A;  4WYY A;  3D3O A;  2ZQC A;  4JKT A;  1MWR A;  5HSQ A;  3V39 A;  2EXB A;  3UB7 A;  1N9B A;  2JKT I;  1XA7 A;  2OAP 1;  3UDX A;  3IBJ A;  4E04 A;  2ZMA A;  2P9V B;  4ZJ1 A;  4GCZ A;  2Y8H A;  3GEC A;  5HZH A;  1XGJ A;  4E3J A;  4NXB A;  3BW6 A;  4CLC B;  4WF0 A;  3BFF A;  4WUJ A;  3RFB A;  1H8M A;  2JBF A;  2R9X A;  1XX2 A;  5DFY A;  3DW0 A;  4YWZ A;  2WAD A;  4GS9 A;  4E3N A;  4HQA A;  3SZT A;  3FZC A;  5KMW A;  1KVM A;  3KSH A;  1K56 D;  3O88 A;  1P0Z A;  3IF6 C;  2ZM0 A;  2VV8 A;  3O86 A;  4S2I A;  4PHT A;  2WZX A;  3IQA A;  4GDN A;  4BJP A;  1K57 A;  3EEA A;  4PMA A;  2VEA A;  4RVA A;  4KQR A;  2E8I A;  1LSV A;  1BUL A;  3ZHH A;  3C4P A;  3UDI A;  1CEG A;  4KZA A;  3BY8 A;  3T4S A;  4KQO A;  4EES A;  4MN6 A;  2XR0 A;  2WKH A;  4KEN B;  2M1C A;  4QB8 A;  4F3L B;  3SH8 A;  3BQ8 A;  1KOU A;  3S7O A;  2WZZ A;  1FOF A;  3UPN A;  4GOG A;  1PWG A;  4MBH A;  4HI4 A;  3S7Q A;  4G3V A;  2HDS A;  2PRF A;  1ES4 A;  2P74 A;  5AVF A;  4WEJ A;  4QU3 A;  2QZ6 A;  3NBL A;  2XQZ A;  2KDK A;  3PXP A;  1H8Z A;  3VP1 A;  2FZ0 A;  4KG5 A;  1QME A;  5FQI A;  2XRN A;  1VB6 A;  3R7W A;  1TD5 A;  5EE8 A;  2I72 A;  5EM1 A;  3FC7 A;  1IKI A;  4BBU A;  1OJ5 A;  4HJ3 A;  2D01 A;  4EEP A;  3G2Z A;  2O9A A;  5LBR A;  3N4I A;  5EVI B;  2ZC6 B;  2H5S A;  4DE2 A;  5A92 A;  3CLO A;  4BQM A;  2W3H A;  1PI5 A;  3MZD A;  4OLG A;  3CMZ A;  4KZB A;  5F6A A;  3HUN A;  2MJ6 A;  3ZNT A;  2XFS A;  4MEZ A;  5FEG A;  1FR1 A;  3T12 B;  2Y2P A;  2Q9M A;  4BD0 A;  2HDU A;  3MXQ A;  4R70 A;  4K0W A;  1SKO A;  2J3T D;  1S6R A;  2Y2M A;  3V3S A;  5K5B A;  1CJF A;  2WGI A;  3IXH A;  3F1O B;  1EW0 A;  3AGD A;  4JXV A;  3EGD C;  2EX8 A;  5HPI A;  4DDS A;  2VX8 A;  4JLF A;  5J8X A;  1LL5 A;  5F82 A;  2W1T A;  1H0M A;  1KVL A;  5KSH A;  1HVB A;  4U0T A;  4ZJ3 A;  3A0V A;  3VV4 A;  2D02 A;  1MWT A;  3ZG8 B;  1NLY A;  1PZP A;  4QY5 A;  1XPB A;  4LFU A;  2Y2O A;  4ZDX A;  2Y2H A;  4BD1 A;  3HLE A;  4OLD A;  3UN7 A;  2Y2Q A;  5J3W A;  1KGE A;  3JPU A;  4PPR A;  4GLQ A;  4DXC A;  3UE0 A;  4JF4 A;  3GDI A;  2X01 A;  3QP2 A;  3P01 A;  1OTA A;  1IYO A;  4OON A;  2O0Y A;  4E3O A;  1UWN X;  1CK3 A;  1FSW A;  1LSX A;  4KUO A;  1K4E A;  3T4Q A;  4JPM A;  4LCL A;  3SS5 A;  3GTC A;  3FYZ A;  3RXW A;  3QNB A;  4K08 A;  5HX9 A;  1DRM A;  5A90 A;  4JXW A;  3LR3 A;  4LV0 A;  4EXO A;  3IH9 A;  4II7 A;  1VEU A;  3KSI A;  4CLC D;  1L3L A;  5C5K A;  3PBT A;  1TF1 A;  5FAP A;  4WEK A;  1SKO B;  3JVU A;  4LRY C;  3NJA A;  4EU0 A;  5CEC A;  4HJ6 A;  1IOU A;  2GNX A;  3CG5 A;  4WZ4 A;  4R1G A;  3MQO A;  1D7E A;  2Y2G A;  2X02 A;  3W8K A;  1F2K A;  2FFF B;  3IWI A;  1K54 A;  2PT7 A;  4R3J A;  2W1T B;  3CZD A;  2QMI A;  1YLP A;  3MS6 A;  5A8B A;  1K56 A;  3M6H A;  2WGV A;  2Y2J A;  4XT2 B;  2ZC5 B;  4X55 A;  5FI7 A;  2ACG A;  4OQ0 A;  4FH2 A;  1PFL A;  4UA6 A;  2ZQ9 A;  1KE0 A;  2JKG A;  1FIK A;  4B9O A;  5KZH A;  3CPT B;  1XGI A;  2E8J A;  3CAX A;  1ESU A;  3GVB A;  2A49 A;  3SS4 A;  2M7V A;  4Y0O A;  3ULF A;  5HAP A;  1BLC A;  4ETX A;  3A3F A;  1S1Z A;  3WS5 A;  3T4O A;  3T4T A;  3WRT A;  1KE3 A;  2ZC4 B;  5M19 A;  2J9P A;  3NIA A;  5FI6 A;  1I2S A;  1GHP A;  4GD6 A;  1XP4 A;  3BLS A;  1STZ A;  3LEZ A;  4B93 A;  4N9L A;  4KZ8 A;  1I2W A;  3CIT A;  4D60 A;  4X56 A;  4GHI A;  3T1R A;  3UB5 P;  2JKT M;  5HPF A;  3Q7V A;  3IX8 A;  2ZMV A;  5HWV A;  5FDH A;  3ZDJ A;  4B88 A;  4JGR A;  1T1C A;  1OT9 A;  5EVL A;  4Y17 A;  2Y59 A;  3U2A A;  2K7S A;  3VOY A;  5FAS A;  2J9O A;  2JN7 A;  4ARZ A;  3LY3 A;  4L9F A;  1YM1 A;  4GD8 A;  3B3X A;  3BEB A;  1RP5 A;  3T4J A;  2INW A;  1SDE A;  2EFU A;  1K25 A;  3VE3 A;  3LID A;  3UDF A;  3LGO A;  3QP5 A;  5KIZ A;  4ZBE A;  5EVI D;  3V67 A;  1W79 A;  1IYS A;  1RGZ A;  3PAG A;  5GLD A;  3FG8 A;  2RL3 A;  2PHY A;  1CF0 A;  3MXR A;  2A24 A;  4HJ4 A;  4UQI S;  4C3Q A;  3BY9 A;  1VET B; 
#chains in the Genus database with same CATH homology
 3WWX A;  5FAT A;  1PI4 A;  3ZG7 B;  3HLF A;  1FCM A;  3ZG9 B;  4WYY A;  2ZQC A;  3EQV A;  4PM8 A;  4JKT A;  1MWR A;  2BG1 A;  3V39 A;  3VP0 A;  2EXB A;  1K57 C;  2JCH A;  4WBG A;  3G32 A;  5TFQ A;  1SCW A;  4IVK A;  1N9B A;  1ZC2 A;  2WAE A;  3M2J A;  1MWU A;  3VP4 A;  1XA7 A;  3UDX A;  3TG9 A;  3W4Q A;  3V50 A;  5EUA A;  4DRT A;  3Q7Z A;  4MBF A;  5EPH A;  1BLS A;  1K6S A;  2QPN A;  2V1Z A;  4JBF A;  4WM9 A;  2ZMA A;  2P9V B;  4RX2 A;  1NJ4 A;  1PW1 A;  2HP9 A;  4JF5 A;  4UA7 A;  4ZJ1 A;  3MKE A;  3SH9 A;  3GR2 A;  3OPR A;  2HPB A;  1GCE A;  1GA9 A;  1XGJ A;  4LEN A;  5GLB A;  5DTS A;  4E3J A;  3G35 A;  4IVI A;  3A3E A;  1BLH A;  2C6W B;  4QD4 A;  1FQG A;  4OOY A;  3BFF A;  1W7F A;  1VM1 A;  1E3U A;  3WS4 A;  2EX6 A;  3C7V A;  4BL2 A;  5DF8 A;  2Z2M B;  1PWD A;  3SH7 A;  5AQ7 A;  1QMF A;  1Q2Q A;  2JBF A;  2R9X A;  1XX2 A;  5FA7 A;  3VSL A;  5F1G A;  3DW0 A;  4FSF A;  2WAD A;  2OLV A;  1O7E A;  5G18 A;  1LLB A;  4E3N A;  3DWK A;  1ES3 A;  2BLS A;  4KZ6 A;  4GZB A;  4IBR A;  3FZC A;  5KMW A;  1KVM A;  5EOO A;  3UPP A;  3MZE A;  1JVJ A;  1K56 D;  3O88 A;  1IYQ A;  3C7U A;  3IF6 C;  3NC8 A;  4ID4 A;  3UPO A;  2ZM0 A;  4ZTK A;  3O86 A;  1H5X A;  4X69 A;  4S2I A;  2WZX A;  5EOE A;  4E3M A;  3IQA A;  4GDN A;  4BJP A;  1LL9 A;  1K57 A;  2VGK A;  2Y2K A;  2ZQ8 A;  4PMA A;  1FSY A;  5DF9 A;  4B4X A;  3FKW A;  4RVA A;  3HLW A;  4D2O A;  4KQR A;  2J8Y A;  2E8I A;  1MWS A;  1L0D A;  1BUL A;  3C4O A;  3ZHH A;  3C4P A;  4L0L A;  3UDI A;  1CEG A;  1WE4 A;  1E3U D;  4KZA A;  3ZG0 A;  1L0E A;  3A3J A;  1YLW A;  2Q9N A;  4OQG A;  5AQ9 A;  4DXB A;  4OPZ A;  3N8S A;  4DE1 A;  2ZM2 A;  4HBT A;  4JF6 A;  4KQO A;  5FQK A;  1JTD A;  2J7V A;  1YLJ A;  1HD8 A;  1RGY A;  3O3V A;  3EQU A;  2CC1 A;  2XR0 A;  4R4S A;  2WKH A;  1YMX A;  3NDE A;  5CER A;  3VSK A;  4KEN B;  1WYB A;  1SKF A;  4S2L A;  2IWD A;  4KZ3 A;  1KDS A;  4OVD A;  2JC7 A;  2HP5 A;  4QB8 A;  4OP5 A;  3SH8 A;  1DJB A;  1W8Y A;  2PBY A;  5HW3 A;  4DF6 A;  2XLN A;  2WZZ A;  1EWZ A;  3PTE A;  3OZH A;  1FOF A;  3UPN A;  4GOG A;  3WS2 A;  1PWG A;  3BRM A;  2A3U A;  4KZ7 A;  4MBH A;  1CEF A;  2EXA A;  3LCE A;  4KZ9 A;  2G2W A;  1U60 A;  2HDS A;  3VMA A;  1ES4 A;  4R23 A;  4Y7P A;  2ZJ9 A;  4Z9Q A;  2HDR A;  2P74 A;  2WYX A;  4WEJ A;  3O87 A;  4QU3 A;  2QZ6 A;  1Y54 A;  3NBL A;  2Y2L A;  2XQZ A;  5E2G A;  1H8Z A;  4Y0T A;  4DKI A;  5DF7 A;  3VP1 A;  1JWZ A;  1NRF A;  4KG5 A;  5HFO A;  4R0Q A;  1QME A;  1NY0 A;  4P0M A;  4UA9 A;  1BUE A;  5CTM A;  3NY4 A;  5FQI A;  4EBL A;  3OCN A;  3IWQ A;  4KZ5 A;  4KQQ A;  1K4F A;  1TEM A;  3VFF A;  4GKU A;  5EE8 A;  4PM5 A;  2I72 A;  5A91 A;  4DE0 A;  1PIO A;  4N1X A;  5F1F A;  2XD1 A;  3S22 A;  3Q07 A;  4PM9 A;  3VP3 A;  2Y2I A;  2G2U A;  1IKI A;  1EI5 A;  5HL1 A;  2OV5 A;  1FR6 A;  3IWO A;  1IEL A;  3UY6 A;  3G2Z A;  4GN2 A;  2WKE A;  1WYC A;  4R4R A;  1CI9 A;  3Q82 A;  2ZD8 A;  3N4I A;  3OPP A;  3IF5 A;  3BFC A;  5EVI B;  1BZA A;  2ZC6 B;  4GB7 A;  2H5S A;  4K0X A;  4DE2 A;  4E3L A;  4U3T A;  2GDN A;  2UWX A;  2WUQ A;  3IHA A;  3Q7V B;  4JXG A;  4EBP A;  5A92 A;  1Q2P A;  4OKP A;  5FSR A;  2Y4A A;  4GNU A;  3AGF A;  4BQM A;  5E2E A;  4N9K A;  3ZGA B;  3G4P A;  1PI5 A;  3MZD A;  3FWL A;  4OLG A;  4N1H A;  3WS1 A;  3CMZ A;  4KZB A;  1K6R A;  3HUN A;  1YLT A;  1LI0 A;  4IED A;  4S2O A;  3UO9 A;  2ZC7 A;  1MBL A;  5EEC A;  1ESI A;  3I7J A;  2XFS A;  1KE4 A;  4MEZ A;  3ZNT A;  2ZLY A;  3ZVT A;  4EQI A;  4X6T A;  4EV4 A;  4KG2 A;  1FR1 A;  4ZJ2 A;  4QJG A;  2Y2P A;  5AQA A;  4OOL A;  1ERM A;  2Q9M A;  4UAA A;  4BD0 A;  2HDU A;  4PM7 A;  4S2P A;  1YQS A;  4GDB A;  4OH0 A;  4NK3 A;  3S1Y A;  4K0W A;  2XDM A;  1PZO A;  5M18 A;  4N92 A;  1S6R A;  2Y2M A;  5HAR A;  3QNC A;  4P85 A;  1Z6F A;  4X53 A;  3V3S A;  4F94 A;  2WGI A;  1YLZ A;  3FV7 A;  5GHY A;  2X71 A;  3IXH A;  4WEL A;  2WGW A;  4HBU A;  1L2S A;  4X68 A;  3AGD A;  4XXR A;  5CHJ A;  4JXV A;  5GHX A;  4EWF A;  2PU4 A;  2EX8 A;  3PBQ A;  4S2J A;  3A3I A;  4DDS A;  2EFX A;  4JLF A;  5J8X A;  3VP2 A;  3IF6 B;  5BOH A;  4LV1 A;  1LL5 A;  3GQZ A;  5F82 A;  1KVL A;  5KSH A;  3ITB A;  1HVB A;  1MY8 A;  4H8R A;  4U0T A;  1C3B A;  3E2K A;  4ZJ3 A;  1ALQ A;  2VGJ A;  3WS0 A;  1ES5 A;  3G34 A;  4O7D A;  1MWT A;  3HVF A;  3IXD A;  2C5W B;  2IWC A;  3ZG8 B;  1PZP A;  3G31 A;  3HLD A;  4QY5 A;  1XPB A;  4DE3 A;  4CJN A;  1PWC A;  3SS3 A;  2Y55 A;  2Y2O A;  1IEM A;  4HEF A;  2P9V A;  3DWZ A;  3PBS A;  2Y2H A;  3UE3 A;  1BLP A;  4ZDX A;  3ZVW A;  4E3K A;  4BD1 A;  5F83 A;  3HLE A;  5I94 A;  2XH9 A;  5FI2 A;  3HUO A;  3UE1 A;  1ES2 A;  3BM6 A;  4OLD A;  2RCX A;  3UN7 A;  4DDY A;  2Y2Q A;  3G2Y A;  5DVA A;  5E2F A;  1K54 C;  5GLC A;  5CEB A;  3HRE A;  4FD8 A;  1KGE A;  1JTG A;  3D4F A;  2ZM8 A;  1K55 C;  4M3K A;  2EX2 A;  4PPR A;  5KSC A;  1W8Q A;  4DXC A;  1IKG A;  3WRZ A;  4OQI A;  3LO7 A;  4K91 A;  1W5D A;  3UE0 A;  3ISG A;  5A93 A;  3V5M A;  4JF4 A;  4S2K A;  2X01 A;  2Y91 A;  5DTT A;  1ERO A;  3MBZ A;  5U47 A;  4EUZ A;  1IYO A;  4BL3 A;  1FCN A;  4WZ5 C;  2HP6 A;  1M40 A;  3NCK A;  3M6B A;  2OSU A;  5CRF A;  1BSG A;  4QY6 A;  4OON A;  3BEC A;  3N8R A;  3N7W A;  4E3O A;  3HBR A;  4LV2 A;  1CK3 A;  1FSW A;  1G6A A;  2DNS A;  1K4E A;  3Q81 A;  4JPM A;  4LCL A;  3SS5 A;  3DTM A;  3GTC A;  5CGS A;  2H0T A;  1YLY A;  3FYZ A;  5E43 A;  3RXW A;  3QNB A;  3P09 A;  1O07 A;  4XUX A;  1L0G A;  4MBK A;  5HX9 A;  5A90 A;  1L0F A;  2ZQD A;  4JXW A;  4NET A;  3P98 A;  5GL9 A;  4E6X A;  3OC2 A;  4LV0 A;  3BLM A;  3IH9 A;  1SDN A;  5JYO A;  3ITA A;  1LI9 A;  3SOI A;  2FFY A;  3PBT A;  2H10 A;  4Q8I A;  5FAP A;  4WEK A;  3BFD A;  1BTL A;  1TVF A;  5CEC A;  4YIN A;  4MLL A;  5FAQ A;  4E3I A;  2WKI A;  1YMS A;  3CG5 A;  1NXY A;  4S2N A;  4WZ4 A;  1CI8 A;  5FQ9 A;  4R1G A;  3TOI A;  2WGW B;  4OPQ A;  1KGF A;  4IBX A;  5FAO A;  4RYE A;  1FCO A;  2Y2G A;  2Z2L B;  4OP8 A;  2X02 A;  3IH8 A;  2FFF B;  3IWI A;  4Y0U A;  3W8K A;  1K54 A;  1IYP A;  3IHB A;  4R3J A;  1J9M A;  1K55 A;  4WMC A;  3CZD A;  5EVI C;  5HAI A;  3BFG A;  2QMI A;  1YLP A;  3IT9 A;  2DCF A;  2XGN A;  4FCF A;  1N4O A;  1K56 A;  5TGF A;  4E6W A;  1VQQ A;  3M6H A;  2WGV A;  2Y2J A;  1NYY A;  3PBN A;  2IWB A;  1AXB A;  2ZC5 B;  3OCL A;  4WZ5 A;  5JYP A;  4X55 A;  5FI7 A;  3NDG A;  1NZO A;  4OQ0 A;  4FH2 A;  1HZO A;  4U0X A;  4UA6 A;  1XKZ A;  4OPR A;  1GHM A;  3C5A A;  2ZQ9 A;  2XEP A;  3OPL A;  1KE0 A;  4RA7 A;  1SHV A;  5KZH A;  1PW8 A;  1XGI A;  3GV9 A;  3FKV A;  3V3R A;  5AQB A;  3CJM A;  4C6Y A;  2WK0 A;  1ESU A;  3GMW A;  3GVB A;  2A49 A;  4JXS A;  3OPH A;  1KDW A;  4BLM A;  3SS4 A;  3GSG A;  3HLG A;  2B5R A;  4Y0O A;  4EBN A;  1JWV A;  5HAP A;  1BLC A;  3A3F A;  3BYD A;  3ZG5 A;  4B4Z A;  1XA1 A;  5CTN A;  3HL9 A;  1ZG6 A;  3HLB A;  3LY4 A;  3QHY A;  4FH4 A;  4HES A;  3W4O A;  3WS5 A;  3N6I A;  5CXW A;  3WRT A;  1KE3 A;  2ZC4 B;  5M19 A;  2J9P A;  3NIA A;  1ONH A;  1MKI A;  4WMC D;  5FI6 A;  1LHY A;  4P87 A;  1I2S A;  1GHP A;  4GD6 A;  1XP4 A;  2H0Y A;  3RJU A;  3BLS A;  3M2K A;  3LEZ A;  1JWP A;  5D3O A;  5M1A A;  4N9L A;  1ONG A;  4BEN A;  3VFH A;  5CED A;  2Y2N A;  5CGX A;  3AGE A;  1OME A;  3GRJ A;  3MKF A;  4KZ8 A;  1I2W A;  1TDG A;  2OLU A;  5GHZ A;  1HTZ A;  1YT4 A;  4OOM A;  1H8Y A;  4X56 A;  5EVI A;  3S4X A;  1NZU A;  4PM6 A;  1DJA A;  1BT5 A;  3PBO A;  5GLA A;  3Q7V A;  4S2N C;  3BFE A;  1NYM A;  3IXG A;  3MXS A;  5FDH A;  3ZDJ A;  3MZF A;  3E2L A;  2ZC3 B;  4B88 A;  2WAF A;  2EX9 A;  5IHV A;  1RCJ A;  5EVL A;  3RXX A;  4A5R A;  3ZCZ A;  3PBR A;  3ZFZ A;  1GA0 A;  2Y59 A;  2V20 A;  4QHC A;  5FQM A;  5E2H A;  3VOY A;  1S0W A;  2ZQ7 A;  2J9O A;  5FAS A;  1TDL A;  4KG6 A;  5CHU A;  3LY3 A;  4LCM A;  5TR7 A;  3UNW A;  1YM1 A;  2PU2 A;  4GD8 A;  1ZG4 A;  3B3X A;  1XXM A;  3BEB A;  1RP5 A;  4XUZ A;  4MNR A;  3N8L A;  4CPK A;  2XFT A;  1E4D A;  1SDE A;  2EFU A;  4P6B A;  5FQQ A;  1K25 A;  1DY6 A;  4OPY A;  2XD5 A;  5HAQ A;  1PYY A;  1GHI A;  3UDF A;  3HLC A;  2ZQA A;  3W4P A;  4UHU A;  4R3B A;  4S2M A;  1MXO A;  4ZBE A;  5DTK A;  4YFM A;  5EVI D;  1MPL A;  2XF3 A;  5FQJ A;  3ZNY A;  2JE5 A;  1W79 A;  3JYI A;  1IYS A;  2DRW A;  1RGZ A;  1E25 A;  5CHM A;  3TSG A;  3NI9 A;  3PAE A;  3PAG A;  3G30 A;  5GLD A;  5CGW A;  3IF6 A;  1KGG A;  2RL3 A;  3A3D A;  3VOZ A;  1K38 A;  2R9W A;  3HUM A;  3IXB A;  1M6K A;  2XK1 A;  4OQH A;  1I5Q A;  3MXR A;  3MFD A;  4C75 A;  4LV3 A;  4RX3 A;  1ERQ A;  2V2F F;  3Q1F A;  4C3Q A;  4KZ4 A;  1G68 A;  1ZKJ A;  1DJC A;  4ZAM A;  5L2F A;  2HDQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...