1JWPA

Structure of m182t mutant of tem-1 beta-lactamase
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTTPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE TEM
publication title Evolution of an antibiotic resistance enzyme constrained by stability and activity trade-offs.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 95
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2001-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1jwpA00
3WRZA 2Q9MA 1JTGA 4JLFA 1E3UD 4DF6A 2VGKA 1K6RA 4KZ9A 3UDFA 1CEGA 4DE2A 5KSCA 3MXSA 5KMWA 1FCMA 5DTKA 1KE3A 5EUAA 2OSUA 5DTTA 3IHAA 2JBFA 3HLWA 1ES2A 1O07A 1CI9A 5FI2A 3Q7ZA 5AQ9A 3A3DA 1K57C 3OZHA 5FQKA 2R9XA 1FR1A 3MKEA 4EQIA 5HAIA 4ZJ3A 3VSLA 1MPLA 1YLTA 1SKFA 2Z2LB 5EVID 3WS5A 2WGWB 2Y91A 1NJ4A 4ZJ1A 3TG9A 3DTMA 4KZ7A 2Y2OA 1PWCA 3OCNA 3P09A 4FSFA 1KGEA 4H8RA 4Y0TA 1NYMA 4CPKA 3G35A 5EE8A 2EX9A 3QNBA 4BENA 1JWPA 2EFUA 4GOGA 4HESA 4YFMA 5KZHA 1TDLA 3M2KA 4K91A 3PBTA 4IEDA 3OPLA 4GDBA 5FSRA 4JPMA 5HL1A 2HP9A 1OMEA 5CERA 1YLYA 1LL9A 1S6RA 2H10A 3IXGA 3B3XA 3UDXA 3BLMA 1QMEA 1BTLA 3BFGA 4EWFA 3A3EA 4RX2A 4ZTKA 4GB7A 4F94A 2IWBA 5CHMA 4K0WA 5EOEA 5DTSA 3C5AA 1LLBA 4FH4A 2HP6A 1EROA 4KZ4A 3O87A 2WUQA 4Y7PA 4DE0A 3BFFA 5GLAA 5A91A 4RX3A 3SS5A 3CJMA 1I2SA 1K6SA 5IHVA 3GSGA 3OPRA 1YLJA 2ZC5B 2JC7A 4QD4A 5DF7A 5M1AA 3SS4A 4E6XA 1IYSA 3O86A 4OKPA 5JYOA 2WAFA 2IWDA 3W4PA 4X55A 4BD0A 3OPPA 3UNWA 4EUZA 4QY5A 4WZ5A 2Y4AA 5E2HA 1Z6FA 3FWLA 5GLBA 4N9LA 5TR7A 5E43A 3IWQA 3SS3A 1E4DA 3HREA 2FFYA 4E6WA 2WGWA 3ZVTA 3V50A 3PBQA 2ZQCA 1GHIA 4S2LA 5EOOA 3BEBA 3BYDA 3N7WA 2ZMAA 1K25A 1L0DA 1SCWA 2VGJA 3G2ZA 3PBRA 4HBTA 2ZQDA 4S2NA 5GHXA 4D2OA 2H0YA 5GLDA 1CI8A 1PWGA 1PZOA 4FCFA 3QNCA 5HW3A 1KVLA 4PM8A 3RJUA 1L2SA 1PWDA 4Z9QA 5JYPA 3FKWA 4KENB 4EV4A 1H8YA 2UWXA 3NDGA 5F82A 1M40A 3W8KA 1U60A 2WADA 2C6WB 2JCHA 4Q8IA 2WKEA 2H5SA 1K55C 4PMAA 1LI0A 3MZDA 1WYCA 3SOIA 3ZG9B 1XKZA 4LENA 5I94A 1ZC2A 2RCXA 4R3BA 1YLWA 5HX9A 2ZQ8A 3BM6A 4NK3A 3Q7VB 3N4IA 4PPRA 1DY6A 1NYYA 1N4OA 2V2FF 4S2IA 4R4SA 1FCOA 3ZGAB 5EVIC 1SDEA 2WK0A 4QY6A 5TGFA 3UPNA 2ZC4B 1K54C 4LV0A 3VP4A 3IXBA 1ESUA 4KQRA 2IWCA 4NETA 4OQHA 2J9PA 5AQAA 1BULA 3HLGA 3IF6C 4KG6A 4DE3A 4E3KA 4P85A 1I5QA 1XPBA 4X68A 5CTMA 4ZJ2A 1S0WA 3HLEA 2G2UA 3EQUA 4WEKA 5DVAA 1W79A 2OLUA 3BFDA 4UA7A 1IKIA 4QHCA 4X6TA 3WS0A 4XXRA 1AXBA 4Y0OA 3LCEA 1KE0A 2P74A 3LEZA 4EBLA 3C4PA 3O3VA 5F1GA 4GKUA 4P0MA 2WKHA 3IWOA 2CC1A 4CJNA 2FFFB 4N1HA 4MBFA 5GHYA 1H5XA 3IXHA 3UY6A 3RXXA 4N1XA 2HP5A 3GTCA 3ZNTA 1LHYA 1ZG6A 5U47A 4EBPA 5CEBA 4DE1A 5KSHA 4IVIA 5FA7A 3VP2A 4E3MA 4OQGA 5EECA 1XXMA 3NC8A 3PAGA 1PW1A 4JXGA 4LV2A 1NXYA 3IT9A 4IBRA 4ZAMA 3PBSA 3GQZA 4GD8A 5E2EA 1N9BA 5DF8A 5FI7A 4E3LA 2XGNA 2EFXA 2Y55A 3ZVWA 5CGSA 4BQMA 3G4PA 4WM9A 1JTDA 2WAEA 4OPQA 1KDSA 4LV3A 1YMXA 3Q82A 1FSWA 3NY4A 3HLCA 2C5WB 3FYZA 5M19A 2XH9A 3FZCA 3ISGA 4R23A 1ES3A 3Q7VA 3IQAA 4LCMA 4X53A 1MXOA 2Z2MB 4BJPA 3NCKA 2WKIA 4GDNA 2XFSA 1MKIA 1YQSA 1ZKJA 4KG2A 4C75A 2J7VA 3IHBA 4BL3A 1GA0A 2ZQ7A 4GD6A 5CRFA 1BLPA 5CEDA 3NIAA 5GHZA 5FDHA 1GHMA 1MWSA 3HUNA 3WWXA 4BL2A 3N8SA 2A49A 5F83A 1DJCA 4U0XA 3O88A 3VSKA 5FAQA 1IKGA 3W4QA 2EX6A 3NI9A 2B5RA 3A3FA 4HBUA 1MWUA 1PIOA 1LI9A 4KZ6A 3WS2A 1W8QA 2ZQ9A 1PZPA 2EX8A 2Y2KA 2WZXA 5A93A 1NRFA 1DJBA 3Q07A 1E3UA 1WYBA 4XUXA 3RXWA 3IH8A 4KZ8A 1YM1A 4M3KA 2XR0A 3BECA 3HL9A 3LY4A 4DRTA 3M2JA 2XD1A 1EWZA 1K4FA 3S4XA 2XF3A 1BLSA 3HBRA 4PM7A 2JE5A 5CGWA 4OPRA 2HDSA 2OV5A 3VFHA 4JF6A 2I72A 4N92A 5HARA 2PU2A 4P87A 3V39A 5E2GA 4B4ZA 2WYXA 1K4EA 2RL3A 3SH9A 4DKIA 4WZ4A 2X01A 4OOYA 2Y2PA 4WELA 2HDRA 1CEFA 2Y2IA 3V3RA 1BLCA 4KZBA 5A92A 2DRWA 3Q1FA 2QZ6A 2Y59A 4LV1A 1C3BA 5HFOA 2Y2QA 1MBLA 5AQBA 3UPOA 1IYOA 4FD8A 4GN2A 4MBHA 1SHVA 2QMIA 1RCJA 1ZG4A 5FQMA 1BLHA 2Y2MA 3OCLA 4MEZA 3OPHA 2XFTA 3CG5A 4KG5A 1ERMA 1GA9A 1XGIA 5GLCA 3S22A 3GR2A 1FCNA 3A3IA 2OLVA 2XD5A 3BLSA 3VOZA 2X71A 2DCFA 4QB8A 1ERQA 4K0XA 1J9MA 3MZEA 2ZM2A 2ZQAA 3VP3A 4S2KA 3TOIA 1EI5A 1K56A 4X56A 4OPYA 4RA7A 3WRTA 4B88A 2ZLYA 1K57A 4WZ5C 1M6KA 3GRJA 4OLDA 4RVAA 1PW8A 2A3UA 5CHUA 3DW0A 2BG1A 3CZDA 1PYYA 5FAOA 5FQIA 4WYYA 1BSGA 1TVFA 4JF5A 4OOMA 4B4XA 3DWZA 4E3OA 1W5DA 2EXAA 3HUOA 1YT4A 4X69A 2V20A 1YMSA 1L0EA 3CMZA 5G18A 3LY3A 3PBOA 4S2NC 2ZC3B 4IBXA 4U3TA 4JKTA 3BFEA 1TDGA 2J8YA 2BLSA 3MXRA 4R0QA 1L0GA 1HD8A 2V1ZA 3ITBA 4FH2A 4S2PA 1LL5A 1IELA 2ZJ9A 4KZ3A 4BLMA 2HPBA 2P9VB 3GMWA 1Q2QA 1VQQA 3ZCZA 2ZM0A 4OH0A 1PI4A 4OOLA 1RP5A 1ONHA 4Y0UA 5EPHA 1IYPA 3PAEA 3D4FA 3UN7A 3BRMA 4JXSA 1G6AA 4OVDA 4PM6A 5L2FA 3BFCA 4KZ5A 3UE0A 2HDQA 3AGDA 2Y2JA 3VFFA 2Y2GA 3ZDJA 1BZAA 1DJAA 4R4RA 4BD1A 1W8YA 1YLZA 1ES5A 4OONA 5EVIB 4C3QA 3VMAA 4HEFA 1XX2A 3IH9A 5F1FA 1HTZA 3VP0A 3UE1A 1GHPA 5HAQA 2J9OA 4L0LA 4S2MA 4MLLA 1KVMA 5FQQA 3AGEA 1RGZA 2ZD8A 2ZC7A 3IF6B 3IXDA 3FV7A 3MZFA 5FQ9A 3JYIA 4DDYA 2XDMA 3N8LA 3ITAA 5A90A 2XEPA 3S1YA 3UPPA 5D3OA 4WMCA 3ZG0A 1JVJA 2GDNA 2H0TA 3EQVA 3MKFA 4ID4A 4S2JA 4UA9A 3HLFA 4KQOA 3HVFA 4E3NA 2DNSA 4UHUA 4GZBA 1IEMA 3I7JA 4DXCA 2XLNA 3C4OA 1GCEA 1RGYA 4U0TA 4PM5A 4OLGA 3UDIA 1FR6A 4KZAA 4C6YA 1TEMA 4QJGA 4XUZA 3LO7A 4OQ0A 1JWZA 1K56D 2G2WA 3NBLA 3Q81A 4OP5A 3G30A 5BOHA 5FASA 3ZFZA 5CGXA 5FATA 3G32A 4OQIA 5FQJA 4O7DA 1SDNA 1FSYA 2WZZA 3N6IA 1KGFA 3UE3A 2R9WA 4JXVA 3ZG7B 4E3JA 4WBGA 2P9VA 2Y2NA 3W4OA 1E25A 1MWTA 3MBZA 4IVKA 5FI6A 1ES4A 1K55A 1K38A 4N9KA 5J8XA 3AGFA 3G31A 3HUMA 5HAPA 4JF4A 3WS1A 1JWVA 1WE4A 4JXWA 3PTEA 3ZHHA 1QMFA 3E2KA 1NY0A 2HDUA 4UAAA 4OPZA 4A5RA 2XK1A 2X02A 3E2LA 4P6BA 5CXWA 4JBFA 4KQQA 4ZBEA 5EVIA 3IF5A 1YLPA 5GL9A 3SH8A 1K54A 1XA1A 4RYEA 1ALQA 1ESIA 2Y2HA 3G34A 2ZC6B 4DXBA 3V5MA 5CHJA 3VOYA 2Q9NA 1BUEA 3IF6A 4E3IA 1ONGA 4EBNA 4OP8A 1PI5A 4LCLA 4MBKA 4R3JA 3M6HA 3QHYA 3SH7A 3HLDA 3ZG5A 1W7FA 1BT5A 4ZDXA 3GVBA 4S2OA 3V3SA 3G2YA 1FOFA 5FAPA 3GV9A 1VM1A 1NZUA 2EXBA 4PM9A 5M18A 2PBYA 1NZOA 2XQZA 3HLBA 3ZG8B 3A3JA 5AQ7A 1O7EA 1CK3A 3WS4A 4R1GA 4WMCD 1FQGA 3MFDA 4DDSA 1KDWA 5CTNA 3UO9A 3TSGA 3VP1A 5TFQA 1KE4A 1Y54A 2EX2A 1G68A 4WEJA 3NDEA 1MY8A 3C7UA 3OC2A 1H8ZA 2QPNA 1XA7A 5EVLA 3FKVA 1IYQA 2ZM8A 4MNRA 3ZNYA 1HZOA 1KGGA 4UA6A 1Q2PA 2E8IA 3DWKA 2Y2LA 5E2FA 5DF9A 1XGJA 2WGIA 3M6BA 4GNUA 3PBNA 1L0FA 3N8RA 2PU4A 3IWIA 3P98A 4YINA 4QU3A 3C7VA 2WGVA 1HVBA 5CECA 1MWRA 1I2WA 1XP4A
chains in the Genus database with same CATH superfamily
2J3TC 3WRZA 1WA9A 1K6RA 3UDFA 3MXSA 5KMWA 1KE3A 5DTTA 3IHAA 1CI9A 4II7A 4L9FA 4MMNA 4D60A 4HQAA 3MKEA 5HAIA 3VSLA 5IS1A 1MPLA 4R70A 3LIDA 4EERA 1YLTA 3K2NA 3KO6A 2Y91A 1FILA 2KDKA 3TG9A 4KZ7A 2VX8A 4KUOA 1PWCA 3OCNA 2M7UA 3RFBA 2K7SA 2W1TB 1D06A 2EX9A 3MJQA 3QNBA 4YFMA 1TDLA 3M2KA 3PBTA 4GDBA 5FSRA 3LIAA 4HIAA 5FDSA 1YLYA 1F9IA 1N9LA 3U4LP 4F94A 2IWBA 1LLBA 1H8MA 2PT7A 4DE0A 4RX3A 3SS5A 2CMNA 1K6SA 1YLJA 1IYSA 5JYOA 2WAFA 4EUZA 4X55A 3OPPA 3UNWA 5HPFA 3DTEA 2HF6A 3UB6A 1E4DA 5IU1A 3ZVTA 3KYEA 1VHMA 3PBQA 4NXGA 5EOOA 4S2LA 3BEBA 3PBRA 3SZTA 2ZQDA 2VKSA 3PHYA 1LSVA 5GLDA 1CI8A 1L2SA 4IUKA 1PFLA 5F69A 4EV4A 3W8KA 1M40A 2C6WB 4Q8IA 3TE8A 3ZQ5A 2ZBBA 1XKZA 5I94A 4XT2B 5HX9A 2ZQ8A 3S7PA 3Q7VB 1N4OA 1S1YA 2J3WA 3LEQA 2WK0A 4I38A 2ZC4B 3VP4A 5EM1A 4NETA 2H28A 5AQAA 1BULA 4X68A 4HH2A 5CTMA 1LSXA 3S7NA 1W79A 2J80A 2OLUA 4UA7A 1PRQA 4XXRA 2W3HA 3FC7A 3TJZC 4LFUA 2V0UA 2FFFB 3NOPC 3T4QA 3RXXA 2HP5A 3VP2A 3CPTA 1XXMA 3C30A 4LV2A 3T4LA 4JGQA 3MXQA 2KLIA 2Y55A 3MQ0A 3VOLA 4GCZA 2QKPA 2WAEA 1KDSA 1YMXA 3Q82A 1CJFA 1FSWA 2XH9A 3NOUC 3IQAA 2Z2MB 3NCKA 2WKIA 3K3CA 3MQQA 5CRFA 1BLPA 1NRJA 5GHZA 3B42A 1MWSA 2K31A 3N8SA 4U0XA 1PNEA 2JKTI 1DP8A 2EX6A 2B5RA 2L1MA 4HBUA 3DAVA 5A93A 1DJBA 1WYBA 4XUXA 3F1PA 4KZ8A 2XR0A 3S4XA 3HBRA 4PM7A 2JE5A 4ETZA 1VB6A 2HDSA 2JHEA 2OV5A 4N92A 2PU2A 5HDSA 2Y8HA 2P04A 2RL3A 5L07A 4Y13A 2JKTM 2Y2PA 1D1JA 1BLCA 4Q0HA 2QZ6A 5HFOA 2PYPA 1SHVA 2O9CA 1ZG4A 3OCLA 1P9WA 1VEUB 1ERMA 1XGIA 1STZA 2QJ7A 1FCNA 1G28A 2XD5A 3VOZA 2NUPC 3MZEA 2ZM2A 3VE3A 4S2KA 3TOIA 3LFVA 4X56A 1P0ZA 2OWJA 2PBDP 3GRJA 1PW8A 3CZDA 1PYYA 1BSGA 1TVFA 3L7HA 3DWZA 4E3OA 3HUOA 4X69A 1EW0A 1YMSA 3CMZA 3LIBA 3PBOA 2ZC3B 4LPZA 3MXRA 1OJGA 2BLSA 3MF0A 1HD8A 3ITBA 4S2PA 1LL5A 1IELA 2ZJ9A 4BLMA 1VQQA 2A24B 3FPWA 3PAEA 3D4FA 3BRMA 5HL6A 4KZ5A 3AGDA 3EEAA 3VFFA 4C3QA 1TD5A 4HEFA 3QP1A 4MLLA 2JKFA 1RGZA 2LB9A 3FV7A 3MZFA 4P6ZS 3JYIA 2PHYA 3F1OB 3RH8B 2GDNA 4JGOA 1SKOB 1V9ZA 4UA9A 4F3LB 1IEMA 3I7JA 2XLNA 4CLCA 1F2KA 4PM5A 2W3FA 4XUZA 4I3JA 4OQ0A 1T1CA 5K5BA 2G2WA 3T4KA 3B33A 3ZFZA 3F1NB 4HHDA 3G32A 2WZZA 5HWTA 2R9WA 3ZG7B 2P9VA 2Y2NA 3MBZA 1K55A 1K38A 5HAPA 4JGRA 3PTEA 1QMFA 4A5RA 2XK1A 2X02A 3E2LA 3LYXA 3DTIA 4P6BA 2LB5A 4KQQA 4ZBEA 3CITA 3IF5A 2HJ9C 1K54A 2Y2HA 3G34A 5DFYA 5CHJA 3E98A 3IF6A 1XJ4A 1ONGA 4EBNA 4OP8A 4R3JA 4MBKA 3M6HA 3HLDA 4S2OA 1NZUA 2PBYA 2W1RA 2G7UA 2XQZA 4BBUA 4UQIS 1O7EA 5AQ7A 3KX0X 3KSIA 3WS4A 4R1GA 4WMCD 1FQGA 3MFDA 5CTNA 2KX6A 1LSWA 3QP2A 1ZTUA 1Y54A 1G5UA 1G68A 4WEJA 3NOTC 4B93A 1BYWA 1MY8A 3E4OA 3NDEA 1Q2PA 5F5YA 2WGIA 1L0FA 3IWIA 2HZ5A 2WGVA 1I2WA 1JTGA 4JLFA 2PR6A 2VGKA 4KUKA 3NECA 1XJ2A 5EUAA 2OSUA 2JBFA 3MR0A 4I5SA 3HLWA 1ES2A 3V67A 5AQ9A 3A3DA 1CF0A 1SKFA 5EVID 4O8GA 5AVFA 4HH3A 4B9OA 5J7EA 4Y0TA 1LT0A 2V1BA 3G35A 5DJTA 4K91A 5I5LA 3CUEA 4YWZA 2B02A 1J3WA 1S6RA 3BLMA 1QMEA 3NHQA 1SZVA 4K0WA 3C5AA 2VGLM 4KZ4A 3O87A 3T50A 4AFIA 2XA7M 1I2SA 4HOIA 4QPRA 4WLAA 3GSGA 2JC7A 5M1AA 2ZOIA 3SS4A 4BD0A 1NLZA 4WZ5A 2Y4AA 5E2HA 3FWLA 5GLBA 4N9LA 5E43A 3IWQA 2WGWA 3V50A 1SKOA 4HJ3A 2INWA 2VGJA 3G2ZA 3CPTB 4D2OA 2H0YA 2R78A 1PZOA 4FCFA 1KVLA 4PM8A 3H7WA 1PWDA 5JYPA 3JVVA 1U60A 2H5SA 3ZG9B 1LI0A 1WYCA 4LENA 4FTXA 2RCXA 3BM6A 4NK3A 3N4IA 4PPRA 4Y3IA 2AVXA 3LR4A 4S2IA 3ZGAB 4NEED 1SDEA 4QY6A 4LV0A 3IXBA 4KQRA 4BWIA 4NXFA 1OTBA 5HZHA 3L9KA 2VEAA 1S0WA 2G2UA 5DVAA 3BFDA 4QHCA 2P7JA 4X6TA 4JGPA 4I39A 3LCEA 1KE0A 3C4PA 4GKUA 3IWOA 3F1PB 2XSSA 2EA9A 3R7WA 4MBFA 3UY6A 4EEPA 3LICA 3PXPA 3ZNTA 1LHYA 1ZG6A 4IVIA 1OTIA 5EECA 3NC8A 3IT9A 4ZAMA 4IJGA 3PBSA 3GQZA 5E2EA 1N9BA 5DF8A 2XROA 2XGNA 2D02A 5CGSA 2WKQA 4WM9A 1P97A 4HJ4A 1H3QA 1JTDA 4LV3A 2C5WB 3T4TA 3FZCA 1ES3A 4X53A 4LCMA 4NG2A 1MXOA 1MKIA 5KIZA 4BL3A 2ZQ7A 3NIAA 4PAUA 5EVEA 4I3IA 3VSKA 1JNUA 3QP6A 2ZQ9A 2EX8A 1ACFA 3Q07A 4GS9A 3RXWA 3IH8A 3JPUA 3BECA 3HL9A 3M2JA 1K4FA 4X1MA 2XRNA 3VFHA 1S66L 5HARA 4B4ZA 2W3DA 2X01A 1OT6A 4L9EA 1CEFA 3V3RA 5A92A 1MBLA 3VE4A 3UPOA 4GN2A 5HDDA 5IT5A 2QMIA 1RCJA 2A2LA 2XFTA 3CG5A 2FH5A 2OLVA 4K0XA 4OPYA 1UGUA 4HP9A 4CLCB 1K57A 5CHUA 5FQIA 3T12B 4OOMA 3NULA 1W5DA 4HY8A 1L0EA 4CLCE 3D3OA 4JKTA 3R4KA 2J8YA 3FG8A 2V1ZA 1L0GA 1ODVA 4G3WA 2ZMVA 2P9VB 1Q2QA 3DBAA 2ZM0A 4E04A 2P08A 3CI6A 5EPHA 3UN7A 3FPVA 2Z6DA 3NJAA 3BFCA 1LL8A 2M7VA 1BZAA 1DJAA 2O0YA 1YLZA 4OONA 1XX2A 1HTZA 3VP0A 4DMZA 1GHPA 3AGEA 3IF6B 3IXDA 3LUQA 4GW9A 4WMCA 3EQVA 2H0TA 4ID4A 2PD8A 4UHUA 4DXCA 3BJNA 1T19A 3MMHA 4U0TA 3UDIA 1FR6A 4DJ3A 1K56D 2Q0OA 3NBLA 4OP5A 4ARZA 1UWNX 3EOIA 4M4XA 1T18A 5FQJA 3N6IA 3BQ8A 4JXVA 4E3JA 2BASA 3G31A 4JF4A 3K3DA 1JWVA 4JXWA 3ZHHA 3E2KA 3O5YA 4OPZA 4UAAA 5EVIA 5F6AA 1YLPA 1XA1A 4GLQA 1ALQA 1ESIA 4DXBA 3EWKA 3V5MA 5HSQA 4E3IA 1BUEA 1PI5A 3GECA 4LCLA 2VZWA 1BT5A 3V3SA 5FAPA 3GV9A 1VM1A 3CLOA 5M18A 3KSHA 5HD5A 3HLBA 3ZG8B 5J4EA 5TBMA 1KDWA 3TSGA 1P9RA 3E0YA 4G3VA 5TFQA 3JVUA 3OC2A 2ZM8A 1KGGA 3D9YA 1S4RA 5E2FA 2VV7A 3UB7A 2B18A 1N9NA 4YINA 4QU3A 4YNRA 1HVBA 5CECA 1XP4A 2Q9MA 3LR0A 4DF6A 3BY8A 1CEGA 4DE2A 1FCMA 2UV0E 3UMEA 3C8CA 1NLYA 3MFXA 5FI2A 4NKPA 3OZHA 4LRXC 4FOFA 2WGWB 1NJ4A 5G4ZA 1VETA 1YSPA 4ZJ1A 2Y2OA 2KOIA 4FSFA 1KGEA 1XFQA 1OTEA 3H7WB 5EE8A 4BENA 1JWPA 4HESA 1H0MA 3OBFA 3OPLA 2VGLS 3QP4A 3LGOA 3H9WA 5HL1A 2HP9A 1OMEA 1LL9A 2H10A 2JN7A 2XA7S 1F5MA 3UDXA 1Z09A 1TF1A 4EWFA 1W63M 4MN6A 4NXBA 4GB7A 4RX2A 4ZTKA 5CHMA 3T1SA 2HP6A 4Y7PA 3BFFA 5GLAA 5A91A 1TS0A 4EUVA 2ZC5B 5DF7A 4E6XA 4IUHA 3O86A 2NUTC 4CLCC 1Z6FA 3PYPA 5TR7A 3R7WB 2VV6A 3SS3A 2FFYA 2HGVA 5EM0A 4UEYA 3IS2A 2ZQCA 3T1XA 2W27A 4OQHA 2ZMAA 1K25A 1SCWA 4S2NA 5GHXA 4HBTA 1TS8A 3QNCA 4EQ1A 2YKFA 3FKWA 4KENB 1H8YA 2UWXA 5F82A 2JCHA 1TS7A 1K55C 3SOIA 4IHQA 4R3BA 4EEUA 1DY6A 2VLGA 5HD3A 1MKMA 2V2FF 4R4SA 1FCOA 4MCWA 4BBVA 1K54C 1MZUA 3QP5A 1YSQA 3IF6C 1XJ3A 3HLGA 1I5QA 4WUJA 2L4RA 4DJ2A 4ZJ2A 3HLEA 3EQUA 4WEKA 1G6OA 3WS0A 1AWIA 4LRYC 1AXBA 3LEZA 4EBLA 4I3AA 2V8FA 4GS9B 3CHWP 3EEHA 2WKHA 4CJNA 2CC1A 2YKHA 4N1HA 5GHYA 3T1QB 1H5XA 2MJ6A 2QJ5A 4HJ6A 4N1XA 5U47A 4EBPA 4DE1A 4PKYG 5KSHA 5FA7A 1Y4OA 1YAXA 3HJIA 3PAGA 1PW1A 4JXGA 2BTFP 1NXYA 4IBRA 3LIFA 3ZVWA 4OPQA 3SW1A 3IX3A 3OLOA 3NY4A 3ISGA 3S7QA 4G3KA 1A0KA 1ZKJA 4KG2A 2J7VA 5CEDA 3RTYA 2DMWA 3WWXA 4BL2A 2A49A 5F83A 1OJ5A 3G6OA 3P01A 3O88A 1MWUA 1PIOA 4KZ6A 3WS2A 3VV4A 3T4JA 2WZXA 2GX5A 1E3UA 3LI8A 3LY4A 4ZRRA 1BLSA 2I9VA 3T4OA 4GJ4A 3CUEC 3V39A 4DKIA 3SH9A 2HDRA 2Y2IA 4KZBA 3Q1FA 2Y59A 4LV1A 1C3BA 3W2ZA 2Y2QA 5AQBA 1IYOA 4FD8A 4MBHA 1NWZA 5FQMA 1BLHA 2VA0A 1GA9A 3S22A 3GR2A 3A3IA 3BLSA 4QB8A 2M1CA 4ME4A 2ZQAA 3CAXA 2O9AA 1K56A 3WRTA 4WZ5C 4EESA 4OLDA 3DW0A 1FIKA 5FAOA 1XJ6A 4JF5A 4GHIA 2W3EA 4B4XA 2EXAA 2V20A 4ARZB 3LY3A 4IBXA 3QP8A 3BFEA 4R0QA 1TDGA 1DP6A 4FH2A 2B95A 2JKRI 3GMWA 3ZCZA 4OH0A 4LGWA 1PI4A 4H6JA 1RP5A 4Y0UA 1YPRA 2OAP1 4JXSA 3BWLA 3LR5A 5L2FA 2HDQA 1OT9A 3ZDJA 2PRFA 4BD1A 4R4RA 4NXEA 1W8YA 3E4PA 5EVIB 3KYZA 3IH9A 5F1FA 4X1LA 3UE1A 5HAQA 4S2MA 2W3GA 1OTDA 1KVMA 2ZC7A 4R38A 5FQ9A 4DDYA 2XDMA 3ITAA 5J3WA 3UB5P 3S1YA 3UPPA 5D3OA 1JVJA 4ETXA 3MQOA 2JKRM 3HLFA 3HVFA 4GZBA 3C4OA 5TBMB 4OLGA 1TEMA 2HJEA 3B47A 4QJGA 1JWZA 4EXOA 3G30A 5BOHA 5FASA 5FATA 4OQIA 4O7DA 1FSYA 1K0KA 5TJJA 1KGFA 4Y17A 2Y79A 1E25A 5J8XA 3AGFA 3HUMA 4Z1WA 3WS1A 2QWSA 4Q0IA 4JBFA 3SH8A 4RYEA 5HWWA 3ICYA 4Y2FA 2ZC6B 2Q9NA 2ACGA 4HP4A 3SH7A 3ZG5A 1W7FA 3T4SA 4ZDXA 2IA2A 1FOFA 1OTAA 1VETB 4PM9A 1NZOA 4LRZE 3IX4A 5FL3A 3UO9A 1TS6A 4WF0A 2W0NA 1KE4A 4HI4A 3C7UA 2QPNA 1XA7A 3FKVA 1IYQA 1HZOA 2E8IA 3DWKA 2Y2LA 5DF9A 4GNUA 2EWVA 4Y15A 3N8RA 3KYQA 5DKLA 3P98A 3C7VA 1CQAA 1MWRA 1OPXA 1E3UD 2PYRA 4KZ9A 5KSCA 5DTKA 1O07A 2QYBA 5DKKA 3Q7ZA 1K57C 5FQKA 2R9XA 1FR1A 4EQIA 4ZJ3A 2Z2LB 1V9YA 3WS5A 4O0PA 3D72A 3A0RA 3H82A 3IS2B 3UB9A 4FUWA 3DTMA 4H8RA 3P09A 2J3TD 1NYMA 1N9OA 4CPKA 2V9AA 3BW6A 2O99A 2EFUA 4GOGA 1W63Q 5KZHA 2ZL1B 4IEDA 3LI9A 2GJ3A 4MN5A 4JPMA 3KSGA 3IX8A 5CERA 4PHTA 3IXGA 3B3XA 5L09A 1BTLA 3BFGA 3A3EA 5EOEA 5DTSA 1S4SA 4FH4A 1EROA 2WUQA 3IBJA 4K08A 3CJMA 5IHVA 5L8MA 3OPRA 4QD4A 1IFQA 4OKPA 2IWDA 3W4PA 4QY5A 3HJKA 4ESPA 4Y5FA 1F98A 3UB8A 3HREA 4E6WA 2V8CA 1GHIA 1YKDA 3N7WA 3BYDA 5HWVA 1L0DA 2W1TA 3C2WA 1PWGA 3BY9A 5HW3A 3RJUA 2WKPA 4Z9QA 4EU0A 3NDGA 2WADA 5C5KA 4MN7A 2WKEA 2PDRA 4PMAA 3MZDA 1ZC2A 1YLWA 2D01A 2PD7A 1NYYA 1DRMA 3IBRA 2L0WA 5EVIC 3UPNA 5TGFA 1ESUA 1GSXA 2IWCA 2J9PA 4KG6A 5G4YA 4DE3A 5EFWA 4E3KA 4P85A 1XPBA 4HNBA 2O9BA 1IKIA 2QHKA 2OAQ1 1S1ZA 4Y0OA 2P74A 3LIEA 3O3VA 5F1GA 5L10A 4P0MA 5EV0A 3GTCA 5FEGA 5CEBA 3ZYTA 3EGDC 2PR5A 4E3MA 1L3LA 4OQGA 1GSWA 5FEFA 4L9GA 5AVEA 4GD8A 5FI7A 5HPIA 1GSVA 4E3LA 2EFXA 2GNXA 3G4PA 3P7NA 3HLCA 3FYZA 4XT2A 4KQDA 4DN0A 5M19A 4R23A 3E4QA 3Q7VA 4X25A 4RQ9A 4GDNA 4BJPA 2XFSA 3BQAA 1YQSA 4C75A 3IHBA 1GA0A 4GD6A 5FDHA 1GHMA 4WN5A 3HUNA 4BBTA 2PAVP 1DJCA 5HDCA 5FAQA 1IKGA 2OWHA 3W4QA 1UWPX 3NI9A 5DJUA 1S67L 3A3FA 3CWFA 4GHIB 2EWWA 1LI9A 1W8QA 5A8BA 1PZPA 2Y2KA 1NRFA 4R3AA 1T1AA 3T1RA 4M3KA 1YM1A 1KOUA 4DRTA 2XD1A 1EWZA 2XF3A 2E8JA 5CGWA 4OPRA 4H6JB 4Q0JA 3A0VA 4JF6A 3S7OA 2I72A 4P87A 5E2GA 2WYXA 1K4EA 4WZ4A 4OOYA 4WELA 2DRWA 5LBRA 2FZ0A 2ZL1A 2Y2MA 4MEZA 3OPHA 4KG5A 5GLCA 3C38A 1XFNA 2X71A 2DCFA 1ERQA 3MS6A 1J9MA 3VP3A 2VJWA 1EI5A 4RA7A 4B88A 2ZLYA 1M6KA 4RVAA 2A3UA 2BG1A 2VK3A 5DFXA 4WYYA 2ZMFA 1IOUA 1YT4A 5F68A 5G18A 3OOVA 1HLUP 4S2NC 4U3TA 3A0SA 4MDZA 3HCYA 4KZ3A 2HPBA 2Z6CA 4R6LA 3MSHA 4OOLA 1ONHA 1IYPA 5CX7A 1G6AA 4OVDA 4PM6A 3UE0A 3ULFA 2Y2JA 4BQMA 2Y2GA 1Y28A 1ES5A 2VV8A 1MC0A 3TW8A 3VMAA 2OOLA 2J9OA 4L0LA 1D7EA 5FQQA 2ZD8A 1VEUA 3N8LA 3GDIA 5A90A 2XEPA 3ZG0A 3MKFA 4S2JA 4KQOA 3UE6A 4E3NA 2DNSA 2V1AA 4P6ZM 1X0OA 1GCEA 1RGYA 3U2AA 4KZAA 4C6YA 1ZHHB 3LO7A 1T1BA 3Q81A 4EETB 3DTKA 5CGXA 1SDNA 3UE3A 3TRCA 4WBGA 2JKGA 2A24A 1MWTA 3W4OA 4PKYA 4IVKA 5FI6A 1ES4A 4N9KA 3UMDA 1WE4A 2GZAA 1NY0A 2HDUA 4BMWA 5CXWA 4O01A 5GL9A 3KSFA 4WL9A 3VOYA 4LLOB 3F1OA 3QHYA 3GVBA 3G2YA 3H82B 4F3LA 2EXBA 4CQHA 3A3JA 3EGXC 4EW7A 1CK3A 2K2NA 3PR6A 4DDSA 3VP1A 2EX2A 4CLCD 1DP9A 1H8ZA 4YOFA 5EVLA 4UQIM 2HV1A 3F1NA 4MNRA 3ZNYA 4UA6A 3LR3A 4QWOA 1XGJA 2ZOHA 5AJGA 5MC7A 3M6BA 3PBNA 2PU4A 2V0WA 2WKRA 3IXHA
chains in the Genus database with same CATH topology
3WRZA 2Q9MA 1JTGA 4JLFA 1E3UD 4DF6A 2VGKA 1K6RA 4KZ9A 3UDFA 1CEGA 4DE2A 5KSCA 3MXSA 5KMWA 1FCMA 5DTKA 1KE3A 5EUAA 2OSUA 5DTTA 3IHAA 2JBFA 3HLWA 1ES2A 1O07A 1CI9A 5FI2A 3Q7ZA 5AQ9A 3A3DA 1K57C 3OZHA 5FQKA 2R9XA 1FR1A 3MKEA 4EQIA 5HAIA 4ZJ3A 3VSLA 1MPLA 1YLTA 1SKFA 2Z2LB 5EVID 3WS5A 2WGWB 2Y91A 1NJ4A 4ZJ1A 3TG9A 3DTMA 4KZ7A 2Y2OA 1PWCA 3OCNA 3P09A 4FSFA 1KGEA 4H8RA 4Y0TA 1NYMA 4CPKA 3G35A 5EE8A 2EX9A 3QNBA 4BENA 1JWPA 2EFUA 4GOGA 4HESA 4YFMA 5KZHA 1TDLA 3M2KA 4K91A 3PBTA 4IEDA 3OPLA 4GDBA 5FSRA 4JPMA 5HL1A 2HP9A 1OMEA 5CERA 1YLYA 1LL9A 1S6RA 2H10A 3IXGA 3B3XA 3UDXA 3BLMA 1QMEA 1BTLA 3BFGA 4EWFA 3A3EA 4RX2A 4ZTKA 4GB7A 4F94A 2IWBA 5CHMA 4K0WA 5EOEA 5DTSA 3C5AA 1LLBA 4FH4A 2HP6A 1EROA 4KZ4A 3O87A 2WUQA 4Y7PA 4DE0A 3BFFA 5GLAA 5A91A 4RX3A 3SS5A 3CJMA 1I2SA 1K6SA 5IHVA 3GSGA 3OPRA 1YLJA 2ZC5B 2JC7A 4QD4A 5DF7A 5M1AA 3SS4A 4E6XA 1IYSA 3O86A 4OKPA 5JYOA 2WAFA 2IWDA 3W4PA 4X55A 4BD0A 3OPPA 3UNWA 4EUZA 4QY5A 4WZ5A 2Y4AA 5E2HA 1Z6FA 3FWLA 5GLBA 4N9LA 5TR7A 5E43A 3IWQA 3SS3A 1E4DA 3HREA 2FFYA 4E6WA 2WGWA 3ZVTA 3V50A 3PBQA 2ZQCA 1GHIA 4S2LA 5EOOA 3BEBA 3BYDA 3N7WA 2ZMAA 1K25A 1L0DA 1SCWA 2VGJA 3G2ZA 3PBRA 4HBTA 2ZQDA 4S2NA 5GHXA 4D2OA 2H0YA 5GLDA 1CI8A 1PWGA 1PZOA 4FCFA 3QNCA 5HW3A 1KVLA 4PM8A 3RJUA 1L2SA 1PWDA 4Z9QA 5JYPA 3FKWA 4KENB 4EV4A 1H8YA 2UWXA 3NDGA 5F82A 1M40A 3W8KA 1U60A 2WADA 2C6WB 2JCHA 4Q8IA 2WKEA 2H5SA 1K55C 4PMAA 1LI0A 3MZDA 1WYCA 3SOIA 3ZG9B 1XKZA 4LENA 5I94A 1ZC2A 2RCXA 4R3BA 1YLWA 5HX9A 2ZQ8A 3BM6A 4NK3A 3Q7VB 3N4IA 4PPRA 1DY6A 1NYYA 1N4OA 2V2FF 4S2IA 4R4SA 1FCOA 3ZGAB 5EVIC 1SDEA 2WK0A 4QY6A 5TGFA 3UPNA 2ZC4B 1K54C 4LV0A 3VP4A 3IXBA 1ESUA 4KQRA 2IWCA 4NETA 4OQHA 2J9PA 5AQAA 1BULA 3HLGA 3IF6C 4KG6A 4DE3A 4E3KA 4P85A 1I5QA 1XPBA 4X68A 5CTMA 4ZJ2A 1S0WA 3HLEA 2G2UA 3EQUA 4WEKA 5DVAA 1W79A 2OLUA 3BFDA 4UA7A 1IKIA 4QHCA 4X6TA 3WS0A 4XXRA 1AXBA 4Y0OA 3LCEA 1KE0A 2P74A 3LEZA 4EBLA 3C4PA 3O3VA 5F1GA 4GKUA 4P0MA 2WKHA 3IWOA 2CC1A 4CJNA 2FFFB 4N1HA 4MBFA 5GHYA 1H5XA 3IXHA 3UY6A 3RXXA 4N1XA 2HP5A 3GTCA 3ZNTA 1LHYA 1ZG6A 5U47A 4EBPA 5CEBA 4DE1A 5KSHA 4IVIA 5FA7A 3VP2A 4E3MA 4OQGA 5EECA 1XXMA 3NC8A 3PAGA 1PW1A 4JXGA 4LV2A 1NXYA 3IT9A 4IBRA 4ZAMA 3PBSA 3GQZA 4GD8A 5E2EA 1N9BA 5DF8A 5FI7A 4E3LA 2XGNA 2EFXA 2Y55A 3ZVWA 5CGSA 4BQMA 3G4PA 4WM9A 1JTDA 2WAEA 4OPQA 1KDSA 4LV3A 1YMXA 3Q82A 1FSWA 3NY4A 3HLCA 2C5WB 3FYZA 5M19A 2XH9A 3FZCA 3ISGA 4R23A 1ES3A 3Q7VA 3IQAA 4LCMA 4X53A 1MXOA 2Z2MB 4BJPA 3NCKA 2WKIA 4GDNA 2XFSA 1MKIA 1YQSA 1ZKJA 4KG2A 4C75A 2J7VA 3IHBA 4BL3A 1GA0A 2ZQ7A 4GD6A 5CRFA 1BLPA 5CEDA 3NIAA 5GHZA 5FDHA 1GHMA 1MWSA 3HUNA 3WWXA 4BL2A 3N8SA 2A49A 5F83A 1DJCA 4U0XA 3O88A 3VSKA 5FAQA 1IKGA 3W4QA 2EX6A 3NI9A 2B5RA 3A3FA 4HBUA 1MWUA 1PIOA 1LI9A 4KZ6A 3WS2A 1W8QA 2ZQ9A 1PZPA 2EX8A 2Y2KA 2WZXA 5A93A 1NRFA 1DJBA 3Q07A 1E3UA 1WYBA 4XUXA 3RXWA 3IH8A 4KZ8A 1YM1A 4M3KA 2XR0A 3BECA 3HL9A 3LY4A 4DRTA 3M2JA 2XD1A 1EWZA 1K4FA 3S4XA 2XF3A 1BLSA 3HBRA 4PM7A 2JE5A 5CGWA 4OPRA 2HDSA 2OV5A 3VFHA 4JF6A 2I72A 4N92A 5HARA 2PU2A 4P87A 3V39A 5E2GA 4B4ZA 2WYXA 1K4EA 2RL3A 3SH9A 4DKIA 4WZ4A 2X01A 4OOYA 2Y2PA 4WELA 2HDRA 1CEFA 2Y2IA 3V3RA 1BLCA 4KZBA 5A92A 2DRWA 3Q1FA 2QZ6A 2Y59A 4LV1A 1C3BA 5HFOA 2Y2QA 1MBLA 5AQBA 3UPOA 1IYOA 4FD8A 4GN2A 4MBHA 1SHVA 2QMIA 1RCJA 1ZG4A 5FQMA 1BLHA 2Y2MA 3OCLA 4MEZA 3OPHA 2XFTA 3CG5A 4KG5A 1ERMA 1GA9A 1XGIA 5GLCA 3S22A 3GR2A 1FCNA 3A3IA 2OLVA 2XD5A 3BLSA 3VOZA 2X71A 2DCFA 4QB8A 1ERQA 4K0XA 1J9MA 3MZEA 2ZM2A 2ZQAA 3VP3A 4S2KA 3TOIA 1EI5A 1K56A 4X56A 4OPYA 4RA7A 3WRTA 4B88A 2ZLYA 1K57A 4WZ5C 1M6KA 3GRJA 4OLDA 4RVAA 1PW8A 2A3UA 5CHUA 3DW0A 2BG1A 3CZDA 1PYYA 5FAOA 5FQIA 4WYYA 1BSGA 1TVFA 4JF5A 4OOMA 4B4XA 3DWZA 4E3OA 1W5DA 2EXAA 3HUOA 1YT4A 4X69A 2V20A 1YMSA 1L0EA 3CMZA 5G18A 3LY3A 3PBOA 4S2NC 2ZC3B 4IBXA 4U3TA 4JKTA 3BFEA 1TDGA 2J8YA 2BLSA 3MXRA 4R0QA 1L0GA 1HD8A 2V1ZA 3ITBA 4FH2A 4S2PA 1LL5A 1IELA 2ZJ9A 4KZ3A 4BLMA 2HPBA 2P9VB 3GMWA 1Q2QA 1VQQA 3ZCZA 2ZM0A 4OH0A 1PI4A 4OOLA 1RP5A 1ONHA 4Y0UA 5EPHA 1IYPA 3PAEA 3D4FA 3UN7A 3BRMA 4JXSA 1G6AA 4OVDA 4PM6A 5L2FA 3BFCA 4KZ5A 3UE0A 2HDQA 3AGDA 2Y2JA 3VFFA 2Y2GA 3ZDJA 1BZAA 1DJAA 4R4RA 4BD1A 1W8YA 1YLZA 1ES5A 4OONA 5EVIB 4C3QA 3VMAA 4HEFA 1XX2A 3IH9A 5F1FA 1HTZA 3VP0A 3UE1A 1GHPA 5HAQA 2J9OA 4L0LA 4S2MA 4MLLA 1KVMA 5FQQA 3AGEA 1RGZA 2ZD8A 2ZC7A 3IF6B 3IXDA 3FV7A 3MZFA 5FQ9A 3JYIA 4DDYA 2XDMA 3N8LA 3ITAA 5A90A 2XEPA 3S1YA 3UPPA 5D3OA 4WMCA 3ZG0A 1JVJA 2GDNA 2H0TA 3EQVA 3MKFA 4ID4A 4S2JA 4UA9A 3HLFA 4KQOA 3HVFA 4E3NA 2DNSA 4UHUA 4GZBA 1IEMA 3I7JA 4DXCA 2XLNA 3C4OA 1GCEA 1RGYA 4U0TA 4PM5A 4OLGA 3UDIA 1FR6A 4KZAA 4C6YA 1TEMA 4QJGA 4XUZA 3LO7A 4OQ0A 1JWZA 1K56D 2G2WA 3NBLA 3Q81A 4OP5A 3G30A 5BOHA 5FASA 3ZFZA 5CGXA 5FATA 3G32A 4OQIA 5FQJA 4O7DA 1SDNA 1FSYA 2WZZA 3N6IA 1KGFA 3UE3A 2R9WA 4JXVA 3ZG7B 4E3JA 4WBGA 2P9VA 2Y2NA 3W4OA 1E25A 1MWTA 3MBZA 4IVKA 5FI6A 1ES4A 1K55A 1K38A 4N9KA 5J8XA 3AGFA 3G31A 3HUMA 5HAPA 4JF4A 3WS1A 1JWVA 1WE4A 4JXWA 3PTEA 3ZHHA 1QMFA 3E2KA 1NY0A 2HDUA 4UAAA 4OPZA 4A5RA 2XK1A 2X02A 3E2LA 4P6BA 5CXWA 4JBFA 4KQQA 4ZBEA 5EVIA 3IF5A 1YLPA 5GL9A 3SH8A 1K54A 1XA1A 4RYEA 1ALQA 1ESIA 2Y2HA 3G34A 2ZC6B 4DXBA 3V5MA 5CHJA 3VOYA 2Q9NA 1BUEA 3IF6A 4E3IA 1ONGA 4EBNA 4OP8A 1PI5A 4LCLA 4MBKA 4R3JA 3M6HA 3QHYA 3SH7A 3HLDA 3ZG5A 1W7FA 1BT5A 4ZDXA 3GVBA 4S2OA 3V3SA 3G2YA 1FOFA 5FAPA 3GV9A 1VM1A 1NZUA 2EXBA 4PM9A 5M18A 2PBYA 1NZOA 2XQZA 3HLBA 3ZG8B 3A3JA 5AQ7A 1O7EA 1CK3A 3WS4A 4R1GA 4WMCD 1FQGA 3MFDA 4DDSA 1KDWA 5CTNA 3UO9A 3TSGA 3VP1A 5TFQA 1KE4A 1Y54A 2EX2A 1G68A 4WEJA 3NDEA 1MY8A 3C7UA 3OC2A 1H8ZA 2QPNA 1XA7A 5EVLA 3FKVA 1IYQA 2ZM8A 4MNRA 3ZNYA 1HZOA 1KGGA 4UA6A 1Q2PA 2E8IA 3DWKA 2Y2LA 5E2FA 5DF9A 1XGJA 2WGIA 3M6BA 4GNUA 3PBNA 1L0FA 3N8RA 2PU4A 3IWIA 3P98A 4YINA 4QU3A 3C7VA 2WGVA 1HVBA 5CECA 1MWRA 1I2WA 1XP4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WRZ A;  2Q9M A;  1JTG A;  4JLF A;  1E3U D;  4DF6 A;  2VGK A;  1K6R A;  4KZ9 A;  3UDF A;  1CEG A;  4DE2 A;  5KSC A;  3MXS A;  5KMW A;  1FCM A;  5DTK A;  1KE3 A;  5EUA A;  2OSU A;  5DTT A;  3IHA A;  2JBF A;  3HLW A;  1ES2 A;  1O07 A;  1CI9 A;  5FI2 A;  3Q7Z A;  5AQ9 A;  3A3D A;  1K57 C;  3OZH A;  5FQK A;  2R9X A;  1FR1 A;  3MKE A;  4EQI A;  5HAI A;  4ZJ3 A;  3VSL A;  1MPL A;  1YLT A;  1SKF A;  2Z2L B;  5EVI D;  3WS5 A;  2WGW B;  2Y91 A;  1NJ4 A;  4ZJ1 A;  3TG9 A;  3DTM A;  4KZ7 A;  2Y2O A;  1PWC A;  3OCN A;  3P09 A;  4FSF A;  1KGE A;  4H8R A;  4Y0T A;  1NYM A;  4CPK A;  3G35 A;  5EE8 A;  2EX9 A;  3QNB A;  4BEN A;  1JWP A;  2EFU A;  4GOG A;  4HES A;  4YFM A;  5KZH A;  1TDL A;  3M2K A;  4K91 A;  3PBT A;  4IED A;  3OPL A;  4GDB A;  5FSR A;  4JPM A;  5HL1 A;  2HP9 A;  1OME A;  5CER A;  1YLY A;  1LL9 A;  1S6R A;  2H10 A;  3IXG A;  3B3X A;  3UDX A;  3BLM A;  1QME A;  1BTL A;  3BFG A;  4EWF A;  3A3E A;  4RX2 A;  4ZTK A;  4GB7 A;  4F94 A;  2IWB A;  5CHM A;  4K0W A;  5EOE A;  5DTS A;  3C5A A;  1LLB A;  4FH4 A;  2HP6 A;  1ERO A;  4KZ4 A;  3O87 A;  2WUQ A;  4Y7P A;  4DE0 A;  3BFF A;  5GLA A;  5A91 A;  4RX3 A;  3SS5 A;  3CJM A;  1I2S A;  1K6S A;  5IHV A;  3GSG A;  3OPR A;  1YLJ A;  2ZC5 B;  2JC7 A;  4QD4 A;  5DF7 A;  5M1A A;  3SS4 A;  4E6X A;  1IYS A;  3O86 A;  4OKP A;  5JYO A;  2WAF A;  2IWD A;  3W4P A;  4X55 A;  4BD0 A;  3OPP A;  3UNW A;  4EUZ A;  4QY5 A;  4WZ5 A;  2Y4A A;  5E2H A;  1Z6F A;  3FWL A;  5GLB A;  4N9L A;  5TR7 A;  5E43 A;  3IWQ A;  3SS3 A;  1E4D A;  3HRE A;  2FFY A;  4E6W A;  2WGW A;  3ZVT A;  3V50 A;  3PBQ A;  2ZQC A;  1GHI A;  4S2L A;  5EOO A;  3BEB A;  3BYD A;  3N7W A;  2ZMA A;  1K25 A;  1L0D A;  1SCW A;  2VGJ A;  3G2Z A;  3PBR A;  4HBT A;  2ZQD A;  4S2N A;  5GHX A;  4D2O A;  2H0Y A;  5GLD A;  1CI8 A;  1PWG A;  1PZO A;  4FCF A;  3QNC A;  5HW3 A;  1KVL A;  4PM8 A;  3RJU A;  1L2S A;  1PWD A;  4Z9Q A;  5JYP A;  3FKW A;  4KEN B;  4EV4 A;  1H8Y A;  2UWX A;  3NDG A;  5F82 A;  1M40 A;  3W8K A;  1U60 A;  2WAD A;  2C6W B;  2JCH A;  4Q8I A;  2WKE A;  2H5S A;  1K55 C;  4PMA A;  1LI0 A;  3MZD A;  1WYC A;  3SOI A;  3ZG9 B;  1XKZ A;  4LEN A;  5I94 A;  1ZC2 A;  2RCX A;  4R3B A;  1YLW A;  5HX9 A;  2ZQ8 A;  3BM6 A;  4NK3 A;  3Q7V B;  3N4I A;  4PPR A;  1DY6 A;  1NYY A;  1N4O A;  2V2F F;  4S2I A;  4R4S A;  1FCO A;  3ZGA B;  5EVI C;  1SDE A;  2WK0 A;  4QY6 A;  5TGF A;  3UPN A;  2ZC4 B;  1K54 C;  4LV0 A;  3VP4 A;  3IXB A;  1ESU A;  4KQR A;  2IWC A;  4NET A;  4OQH A;  2J9P A;  5AQA A;  1BUL A;  3HLG A;  3IF6 C;  4KG6 A;  4DE3 A;  4E3K A;  4P85 A;  1I5Q A;  1XPB A;  4X68 A;  5CTM A;  4ZJ2 A;  1S0W A;  3HLE A;  2G2U A;  3EQU A;  4WEK A;  5DVA A;  1W79 A;  2OLU A;  3BFD A;  4UA7 A;  1IKI A;  4QHC A;  4X6T A;  3WS0 A;  4XXR A;  1AXB A;  4Y0O A;  3LCE A;  1KE0 A;  2P74 A;  3LEZ A;  4EBL A;  3C4P A;  3O3V A;  5F1G A;  4GKU A;  4P0M A;  2WKH A;  3IWO A;  2CC1 A;  4CJN A;  2FFF B;  4N1H A;  4MBF A;  5GHY A;  1H5X A;  3IXH A;  3UY6 A;  3RXX A;  4N1X A;  2HP5 A;  3GTC A;  3ZNT A;  1LHY A;  1ZG6 A;  5U47 A;  4EBP A;  5CEB A;  4DE1 A;  5KSH A;  4IVI A;  5FA7 A;  3VP2 A;  4E3M A;  4OQG A;  5EEC A;  1XXM A;  3NC8 A;  3PAG A;  1PW1 A;  4JXG A;  4LV2 A;  1NXY A;  3IT9 A;  4IBR A;  4ZAM A;  3PBS A;  3GQZ A;  4GD8 A;  5E2E A;  1N9B A;  5DF8 A;  5FI7 A;  4E3L A;  2XGN A;  2EFX A;  2Y55 A;  3ZVW A;  5CGS A;  4BQM A;  3G4P A;  4WM9 A;  1JTD A;  2WAE A;  4OPQ A;  1KDS A;  4LV3 A;  1YMX A;  3Q82 A;  1FSW A;  3NY4 A;  3HLC A;  2C5W B;  3FYZ A;  5M19 A;  2XH9 A;  3FZC A;  3ISG A;  4R23 A;  1ES3 A;  3Q7V A;  3IQA A;  4LCM A;  4X53 A;  1MXO A;  2Z2M B;  4BJP A;  3NCK A;  2WKI A;  4GDN A;  2XFS A;  1MKI A;  1YQS A;  1ZKJ A;  4KG2 A;  4C75 A;  2J7V A;  3IHB A;  4BL3 A;  1GA0 A;  2ZQ7 A;  4GD6 A;  5CRF A;  1BLP A;  5CED A;  3NIA A;  5GHZ A;  5FDH A;  1GHM A;  1MWS A;  3HUN A;  3WWX A;  4BL2 A;  3N8S A;  2A49 A;  5F83 A;  1DJC A;  4U0X A;  3O88 A;  3VSK A;  5FAQ A;  1IKG A;  3W4Q A;  2EX6 A;  3NI9 A;  2B5R A;  3A3F A;  4HBU A;  1MWU A;  1PIO A;  1LI9 A;  4KZ6 A;  3WS2 A;  1W8Q A;  2ZQ9 A;  1PZP A;  2EX8 A;  2Y2K A;  2WZX A;  5A93 A;  1NRF A;  1DJB A;  3Q07 A;  1E3U A;  1WYB A;  4XUX A;  3RXW A;  3IH8 A;  4KZ8 A;  1YM1 A;  4M3K A;  2XR0 A;  3BEC A;  3HL9 A;  3LY4 A;  4DRT A;  3M2J A;  2XD1 A;  1EWZ A;  1K4F A;  3S4X A;  2XF3 A;  1BLS A;  3HBR A;  4PM7 A;  2JE5 A;  5CGW A;  4OPR A;  2HDS A;  2OV5 A;  3VFH A;  4JF6 A;  2I72 A;  4N92 A;  5HAR A;  2PU2 A;  4P87 A;  3V39 A;  5E2G A;  4B4Z A;  2WYX A;  1K4E A;  2RL3 A;  3SH9 A;  4DKI A;  4WZ4 A;  2X01 A;  4OOY A;  2Y2P A;  4WEL A;  2HDR A;  1CEF A;  2Y2I A;  3V3R A;  1BLC A;  4KZB A;  5A92 A;  2DRW A;  3Q1F A;  2QZ6 A;  2Y59 A;  4LV1 A;  1C3B A;  5HFO A;  2Y2Q A;  1MBL A;  5AQB A;  3UPO A;  1IYO A;  4FD8 A;  4GN2 A;  4MBH A;  1SHV A;  2QMI A;  1RCJ A;  1ZG4 A;  5FQM A;  1BLH A;  2Y2M A;  3OCL A;  4MEZ A;  3OPH A;  2XFT A;  3CG5 A;  4KG5 A;  1ERM A;  1GA9 A;  1XGI A;  5GLC A;  3S22 A;  3GR2 A;  1FCN A;  3A3I A;  2OLV A;  2XD5 A;  3BLS A;  3VOZ A;  2X71 A;  2DCF A;  4QB8 A;  1ERQ A;  4K0X A;  1J9M A;  3MZE A;  2ZM2 A;  2ZQA A;  3VP3 A;  4S2K A;  3TOI A;  1EI5 A;  1K56 A;  4X56 A;  4OPY A;  4RA7 A;  3WRT A;  4B88 A;  2ZLY A;  1K57 A;  4WZ5 C;  1M6K A;  3GRJ A;  4OLD A;  4RVA A;  1PW8 A;  2A3U A;  5CHU A;  3DW0 A;  2BG1 A;  3CZD A;  1PYY A;  5FAO A;  5FQI A;  4WYY A;  1BSG A;  1TVF A;  4JF5 A;  4OOM A;  4B4X A;  3DWZ A;  4E3O A;  1W5D A;  2EXA A;  3HUO A;  1YT4 A;  4X69 A;  2V20 A;  1YMS A;  1L0E A;  3CMZ A;  5G18 A;  3LY3 A;  3PBO A;  4S2N C;  2ZC3 B;  4IBX A;  4U3T A;  4JKT A;  3BFE A;  1TDG A;  2J8Y A;  2BLS A;  3MXR A;  4R0Q A;  1L0G A;  1HD8 A;  2V1Z A;  3ITB A;  4FH2 A;  4S2P A;  1LL5 A;  1IEL A;  2ZJ9 A;  4KZ3 A;  4BLM A;  2HPB A;  2P9V B;  3GMW A;  1Q2Q A;  1VQQ A;  3ZCZ A;  2ZM0 A;  4OH0 A;  1PI4 A;  4OOL A;  1RP5 A;  1ONH A;  4Y0U A;  5EPH A;  1IYP A;  3PAE A;  3D4F A;  3UN7 A;  3BRM A;  4JXS A;  1G6A A;  4OVD A;  4PM6 A;  5L2F A;  3BFC A;  4KZ5 A;  3UE0 A;  2HDQ A;  3AGD A;  2Y2J A;  3VFF A;  2Y2G A;  3ZDJ A;  1BZA A;  1DJA A;  4R4R A;  4BD1 A;  1W8Y A;  1YLZ A;  1ES5 A;  4OON A;  5EVI B;  4C3Q A;  3VMA A;  4HEF A;  1XX2 A;  3IH9 A;  5F1F A;  1HTZ A;  3VP0 A;  3UE1 A;  1GHP A;  5HAQ A;  2J9O A;  4L0L A;  4S2M A;  4MLL A;  1KVM A;  5FQQ A;  3AGE A;  1RGZ A;  2ZD8 A;  2ZC7 A;  3IF6 B;  3IXD A;  3FV7 A;  3MZF A;  5FQ9 A;  3JYI A;  4DDY A;  2XDM A;  3N8L A;  3ITA A;  5A90 A;  2XEP A;  3S1Y A;  3UPP A;  5D3O A;  4WMC A;  3ZG0 A;  1JVJ A;  2GDN A;  2H0T A;  3EQV A;  3MKF A;  4ID4 A;  4S2J A;  4UA9 A;  3HLF A;  4KQO A;  3HVF A;  4E3N A;  2DNS A;  4UHU A;  4GZB A;  1IEM A;  3I7J A;  4DXC A;  2XLN A;  3C4O A;  1GCE A;  1RGY A;  4U0T A;  4PM5 A;  4OLG A;  3UDI A;  1FR6 A;  4KZA A;  4C6Y A;  1TEM A;  4QJG A;  4XUZ A;  3LO7 A;  4OQ0 A;  1JWZ A;  1K56 D;  2G2W A;  3NBL A;  3Q81 A;  4OP5 A;  3G30 A;  5BOH A;  5FAS A;  3ZFZ A;  5CGX A;  5FAT A;  3G32 A;  4OQI A;  5FQJ A;  4O7D A;  1SDN A;  1FSY A;  2WZZ A;  3N6I A;  1KGF A;  3UE3 A;  2R9W A;  4JXV A;  3ZG7 B;  4E3J A;  4WBG A;  2P9V A;  2Y2N A;  3W4O A;  1E25 A;  1MWT A;  3MBZ A;  4IVK A;  5FI6 A;  1ES4 A;  1K55 A;  1K38 A;  4N9K A;  5J8X A;  3AGF A;  3G31 A;  3HUM A;  5HAP A;  4JF4 A;  3WS1 A;  1JWV A;  1WE4 A;  4JXW A;  3PTE A;  3ZHH A;  1QMF A;  3E2K A;  1NY0 A;  2HDU A;  4UAA A;  4OPZ A;  4A5R A;  2XK1 A;  2X02 A;  3E2L A;  4P6B A;  5CXW A;  4JBF A;  4KQQ A;  4ZBE A;  5EVI A;  3IF5 A;  1YLP A;  5GL9 A;  3SH8 A;  1K54 A;  1XA1 A;  4RYE A;  1ALQ A;  1ESI A;  2Y2H A;  3G34 A;  2ZC6 B;  4DXB A;  3V5M A;  5CHJ A;  3VOY A;  2Q9N A;  1BUE A;  3IF6 A;  4E3I A;  1ONG A;  4EBN A;  4OP8 A;  1PI5 A;  4LCL A;  4MBK A;  4R3J A;  3M6H A;  3QHY A;  3SH7 A;  3HLD A;  3ZG5 A;  1W7F A;  1BT5 A;  4ZDX A;  3GVB A;  4S2O A;  3V3S A;  3G2Y A;  1FOF A;  5FAP A;  3GV9 A;  1VM1 A;  1NZU A;  2EXB A;  4PM9 A;  5M18 A;  2PBY A;  1NZO A;  2XQZ A;  3HLB A;  3ZG8 B;  3A3J A;  5AQ7 A;  1O7E A;  1CK3 A;  3WS4 A;  4R1G A;  4WMC D;  1FQG A;  3MFD A;  4DDS A;  1KDW A;  5CTN A;  3UO9 A;  3TSG A;  3VP1 A;  5TFQ A;  1KE4 A;  1Y54 A;  2EX2 A;  1G68 A;  4WEJ A;  3NDE A;  1MY8 A;  3C7U A;  3OC2 A;  1H8Z A;  2QPN A;  1XA7 A;  5EVL A;  3FKV A;  1IYQ A;  2ZM8 A;  4MNR A;  3ZNY A;  1HZO A;  1KGG A;  4UA6 A;  1Q2P A;  2E8I A;  3DWK A;  2Y2L A;  5E2F A;  5DF9 A;  1XGJ A;  2WGI A;  3M6B A;  4GNU A;  3PBN A;  1L0F A;  3N8R A;  2PU4 A;  3IWI A;  3P98 A;  4YIN A;  4QU3 A;  3C7V A;  2WGV A;  1HVB A;  5CEC A;  1MWR A;  1I2W A;  1XP4 A; 
#chains in the Genus database with same CATH topology
 2J3T C;  3WRZ A;  1WA9 A;  1K6R A;  3UDF A;  3MXS A;  5KMW A;  1KE3 A;  5DTT A;  3IHA A;  1CI9 A;  4II7 A;  4L9F A;  4MMN A;  4D60 A;  4HQA A;  3MKE A;  5HAI A;  3VSL A;  5IS1 A;  1MPL A;  4R70 A;  3LID A;  4EER A;  1YLT A;  3K2N A;  3KO6 A;  2Y91 A;  1FIL A;  2KDK A;  3TG9 A;  4KZ7 A;  2VX8 A;  4KUO A;  1PWC A;  3OCN A;  2M7U A;  3RFB A;  2K7S A;  2W1T B;  1D06 A;  2EX9 A;  3MJQ A;  3QNB A;  4YFM A;  1TDL A;  3M2K A;  3PBT A;  4GDB A;  5FSR A;  3LIA A;  4HIA A;  5FDS A;  1YLY A;  1F9I A;  1N9L A;  3U4L P;  4F94 A;  2IWB A;  1LLB A;  1H8M A;  2PT7 A;  4DE0 A;  4RX3 A;  3SS5 A;  2CMN A;  1K6S A;  1YLJ A;  1IYS A;  5JYO A;  2WAF A;  4EUZ A;  4X55 A;  3OPP A;  3UNW A;  5HPF A;  3DTE A;  2HF6 A;  3UB6 A;  1E4D A;  5IU1 A;  3ZVT A;  3KYE A;  1VHM A;  3PBQ A;  4NXG A;  5EOO A;  4S2L A;  3BEB A;  3PBR A;  3SZT A;  2ZQD A;  2VKS A;  3PHY A;  1LSV A;  5GLD A;  1CI8 A;  1L2S A;  4IUK A;  1PFL A;  5F69 A;  4EV4 A;  3W8K A;  1M40 A;  2C6W B;  4Q8I A;  3TE8 A;  3ZQ5 A;  2ZBB A;  1XKZ A;  5I94 A;  4XT2 B;  5HX9 A;  2ZQ8 A;  3S7P A;  3Q7V B;  1N4O A;  1S1Y A;  2J3W A;  3LEQ A;  2WK0 A;  4I38 A;  2ZC4 B;  3VP4 A;  5EM1 A;  4NET A;  2H28 A;  5AQA A;  1BUL A;  4X68 A;  4HH2 A;  5CTM A;  1LSX A;  3S7N A;  1W79 A;  2J80 A;  2OLU A;  4UA7 A;  1PRQ A;  4XXR A;  2W3H A;  3FC7 A;  3TJZ C;  4LFU A;  2V0U A;  2FFF B;  3NOP C;  3T4Q A;  3RXX A;  2HP5 A;  3VP2 A;  3CPT A;  1XXM A;  3C30 A;  4LV2 A;  3T4L A;  4JGQ A;  3MXQ A;  2KLI A;  2Y55 A;  3MQ0 A;  3VOL A;  4GCZ A;  2QKP A;  2WAE A;  1KDS A;  1YMX A;  3Q82 A;  1CJF A;  1FSW A;  2XH9 A;  3NOU C;  3IQA A;  2Z2M B;  3NCK A;  2WKI A;  3K3C A;  3MQQ A;  5CRF A;  1BLP A;  1NRJ A;  5GHZ A;  3B42 A;  1MWS A;  2K31 A;  3N8S A;  4U0X A;  1PNE A;  2JKT I;  1DP8 A;  2EX6 A;  2B5R A;  2L1M A;  4HBU A;  3DAV A;  5A93 A;  1DJB A;  1WYB A;  4XUX A;  3F1P A;  4KZ8 A;  2XR0 A;  3S4X A;  3HBR A;  4PM7 A;  2JE5 A;  4ETZ A;  1VB6 A;  2HDS A;  2JHE A;  2OV5 A;  4N92 A;  2PU2 A;  5HDS A;  2Y8H A;  2P04 A;  2RL3 A;  5L07 A;  4Y13 A;  2JKT M;  2Y2P A;  1D1J A;  1BLC A;  4Q0H A;  2QZ6 A;  5HFO A;  2PYP A;  1SHV A;  2O9C A;  1ZG4 A;  3OCL A;  1P9W A;  1VEU B;  1ERM A;  1XGI A;  1STZ A;  2QJ7 A;  1FCN A;  1G28 A;  2XD5 A;  3VOZ A;  2NUP C;  3MZE A;  2ZM2 A;  3VE3 A;  4S2K A;  3TOI A;  3LFV A;  4X56 A;  1P0Z A;  2OWJ A;  2PBD P;  3GRJ A;  1PW8 A;  3CZD A;  1PYY A;  1BSG A;  1TVF A;  3L7H A;  3DWZ A;  4E3O A;  3HUO A;  4X69 A;  1EW0 A;  1YMS A;  3CMZ A;  3LIB A;  3PBO A;  2ZC3 B;  4LPZ A;  3MXR A;  1OJG A;  2BLS A;  3MF0 A;  1HD8 A;  3ITB A;  4S2P A;  1LL5 A;  1IEL A;  2ZJ9 A;  4BLM A;  1VQQ A;  2A24 B;  3FPW A;  3PAE A;  3D4F A;  3BRM A;  5HL6 A;  4KZ5 A;  3AGD A;  3EEA A;  3VFF A;  4C3Q A;  1TD5 A;  4HEF A;  3QP1 A;  4MLL A;  2JKF A;  1RGZ A;  2LB9 A;  3FV7 A;  3MZF A;  4P6Z S;  3JYI A;  2PHY A;  3F1O B;  3RH8 B;  2GDN A;  4JGO A;  1SKO B;  1V9Z A;  4UA9 A;  4F3L B;  1IEM A;  3I7J A;  2XLN A;  4CLC A;  1F2K A;  4PM5 A;  2W3F A;  4XUZ A;  4I3J A;  4OQ0 A;  1T1C A;  5K5B A;  2G2W A;  3T4K A;  3B33 A;  3ZFZ A;  3F1N B;  4HHD A;  3G32 A;  2WZZ A;  5HWT A;  2R9W A;  3ZG7 B;  2P9V A;  2Y2N A;  3MBZ A;  1K55 A;  1K38 A;  5HAP A;  4JGR A;  3PTE A;  1QMF A;  4A5R A;  2XK1 A;  2X02 A;  3E2L A;  3LYX A;  3DTI A;  4P6B A;  2LB5 A;  4KQQ A;  4ZBE A;  3CIT A;  3IF5 A;  2HJ9 C;  1K54 A;  2Y2H A;  3G34 A;  5DFY A;  5CHJ A;  3E98 A;  3IF6 A;  1XJ4 A;  1ONG A;  4EBN A;  4OP8 A;  4R3J A;  4MBK A;  3M6H A;  3HLD A;  4S2O A;  1NZU A;  2PBY A;  2W1R A;  2G7U A;  2XQZ A;  4BBU A;  4UQI S;  1O7E A;  5AQ7 A;  3KX0 X;  3KSI A;  3WS4 A;  4R1G A;  4WMC D;  1FQG A;  3MFD A;  5CTN A;  2KX6 A;  1LSW A;  3QP2 A;  1ZTU A;  1Y54 A;  1G5U A;  1G68 A;  4WEJ A;  3NOT C;  4B93 A;  1BYW A;  1MY8 A;  3E4O A;  3NDE A;  1Q2P A;  5F5Y A;  2WGI A;  1L0F A;  3IWI A;  2HZ5 A;  2WGV A;  1I2W A;  1JTG A;  4JLF A;  2PR6 A;  2VGK A;  4KUK A;  3NEC A;  1XJ2 A;  5EUA A;  2OSU A;  2JBF A;  3MR0 A;  4I5S A;  3HLW A;  1ES2 A;  3V67 A;  5AQ9 A;  3A3D A;  1CF0 A;  1SKF A;  5EVI D;  4O8G A;  5AVF A;  4HH3 A;  4B9O A;  5J7E A;  4Y0T A;  1LT0 A;  2V1B A;  3G35 A;  5DJT A;  4K91 A;  5I5L A;  3CUE A;  4YWZ A;  2B02 A;  1J3W A;  1S6R A;  3BLM A;  1QME A;  3NHQ A;  1SZV A;  4K0W A;  3C5A A;  2VGL M;  4KZ4 A;  3O87 A;  3T50 A;  4AFI A;  2XA7 M;  1I2S A;  4HOI A;  4QPR A;  4WLA A;  3GSG A;  2JC7 A;  5M1A A;  2ZOI A;  3SS4 A;  4BD0 A;  1NLZ A;  4WZ5 A;  2Y4A A;  5E2H A;  3FWL A;  5GLB A;  4N9L A;  5E43 A;  3IWQ A;  2WGW A;  3V50 A;  1SKO A;  4HJ3 A;  2INW A;  2VGJ A;  3G2Z A;  3CPT B;  4D2O A;  2H0Y A;  2R78 A;  1PZO A;  4FCF A;  1KVL A;  4PM8 A;  3H7W A;  1PWD A;  5JYP A;  3JVV A;  1U60 A;  2H5S A;  3ZG9 B;  1LI0 A;  1WYC A;  4LEN A;  4FTX A;  2RCX A;  3BM6 A;  4NK3 A;  3N4I A;  4PPR A;  4Y3I A;  2AVX A;  3LR4 A;  4S2I A;  3ZGA B;  4NEE D;  1SDE A;  4QY6 A;  4LV0 A;  3IXB A;  4KQR A;  4BWI A;  4NXF A;  1OTB A;  5HZH A;  3L9K A;  2VEA A;  1S0W A;  2G2U A;  5DVA A;  3BFD A;  4QHC A;  2P7J A;  4X6T A;  4JGP A;  4I39 A;  3LCE A;  1KE0 A;  3C4P A;  4GKU A;  3IWO A;  3F1P B;  2XSS A;  2EA9 A;  3R7W A;  4MBF A;  3UY6 A;  4EEP A;  3LIC A;  3PXP A;  3ZNT A;  1LHY A;  1ZG6 A;  4IVI A;  1OTI A;  5EEC A;  3NC8 A;  3IT9 A;  4ZAM A;  4IJG A;  3PBS A;  3GQZ A;  5E2E A;  1N9B A;  5DF8 A;  2XRO A;  2XGN A;  2D02 A;  5CGS A;  2WKQ A;  4WM9 A;  1P97 A;  4HJ4 A;  1H3Q A;  1JTD A;  4LV3 A;  2C5W B;  3T4T A;  3FZC A;  1ES3 A;  4X53 A;  4LCM A;  4NG2 A;  1MXO A;  1MKI A;  5KIZ A;  4BL3 A;  2ZQ7 A;  3NIA A;  4PAU A;  5EVE A;  4I3I A;  3VSK A;  1JNU A;  3QP6 A;  2ZQ9 A;  2EX8 A;  1ACF A;  3Q07 A;  4GS9 A;  3RXW A;  3IH8 A;  3JPU A;  3BEC A;  3HL9 A;  3M2J A;  1K4F A;  4X1M A;  2XRN A;  3VFH A;  1S66 L;  5HAR A;  4B4Z A;  2W3D A;  2X01 A;  1OT6 A;  4L9E A;  1CEF A;  3V3R A;  5A92 A;  1MBL A;  3VE4 A;  3UPO A;  4GN2 A;  5HDD A;  5IT5 A;  2QMI A;  1RCJ A;  2A2L A;  2XFT A;  3CG5 A;  2FH5 A;  2OLV A;  4K0X A;  4OPY A;  1UGU A;  4HP9 A;  4CLC B;  1K57 A;  5CHU A;  5FQI A;  3T12 B;  4OOM A;  3NUL A;  1W5D A;  4HY8 A;  1L0E A;  4CLC E;  3D3O A;  4JKT A;  3R4K A;  2J8Y A;  3FG8 A;  2V1Z A;  1L0G A;  1ODV A;  4G3W A;  2ZMV A;  2P9V B;  1Q2Q A;  3DBA A;  2ZM0 A;  4E04 A;  2P08 A;  3CI6 A;  5EPH A;  3UN7 A;  3FPV A;  2Z6D A;  3NJA A;  3BFC A;  1LL8 A;  2M7V A;  1BZA A;  1DJA A;  2O0Y A;  1YLZ A;  4OON A;  1XX2 A;  1HTZ A;  3VP0 A;  4DMZ A;  1GHP A;  3AGE A;  3IF6 B;  3IXD A;  3LUQ A;  4GW9 A;  4WMC A;  3EQV A;  2H0T A;  4ID4 A;  2PD8 A;  4UHU A;  4DXC A;  3BJN A;  1T19 A;  3MMH A;  4U0T A;  3UDI A;  1FR6 A;  4DJ3 A;  1K56 D;  2Q0O A;  3NBL A;  4OP5 A;  4ARZ A;  1UWN X;  3EOI A;  4M4X A;  1T18 A;  5FQJ A;  3N6I A;  3BQ8 A;  4JXV A;  4E3J A;  2BAS A;  3G31 A;  4JF4 A;  3K3D A;  1JWV A;  4JXW A;  3ZHH A;  3E2K A;  3O5Y A;  4OPZ A;  4UAA A;  5EVI A;  5F6A A;  1YLP A;  1XA1 A;  4GLQ A;  1ALQ A;  1ESI A;  4DXB A;  3EWK A;  3V5M A;  5HSQ A;  4E3I A;  1BUE A;  1PI5 A;  3GEC A;  4LCL A;  2VZW A;  1BT5 A;  3V3S A;  5FAP A;  3GV9 A;  1VM1 A;  3CLO A;  5M18 A;  3KSH A;  5HD5 A;  3HLB A;  3ZG8 B;  5J4E A;  5TBM A;  1KDW A;  3TSG A;  1P9R A;  3E0Y A;  4G3V A;  5TFQ A;  3JVU A;  3OC2 A;  2ZM8 A;  1KGG A;  3D9Y A;  1S4R A;  5E2F A;  2VV7 A;  3UB7 A;  2B18 A;  1N9N A;  4YIN A;  4QU3 A;  4YNR A;  1HVB A;  5CEC A;  1XP4 A;  2Q9M A;  3LR0 A;  4DF6 A;  3BY8 A;  1CEG A;  4DE2 A;  1FCM A;  2UV0 E;  3UME A;  3C8C A;  1NLY A;  3MFX A;  5FI2 A;  4NKP A;  3OZH A;  4LRX C;  4FOF A;  2WGW B;  1NJ4 A;  5G4Z A;  1VET A;  1YSP A;  4ZJ1 A;  2Y2O A;  2KOI A;  4FSF A;  1KGE A;  1XFQ A;  1OTE A;  3H7W B;  5EE8 A;  4BEN A;  1JWP A;  4HES A;  1H0M A;  3OBF A;  3OPL A;  2VGL S;  3QP4 A;  3LGO A;  3H9W A;  5HL1 A;  2HP9 A;  1OME A;  1LL9 A;  2H10 A;  2JN7 A;  2XA7 S;  1F5M A;  3UDX A;  1Z09 A;  1TF1 A;  4EWF A;  1W63 M;  4MN6 A;  4NXB A;  4GB7 A;  4RX2 A;  4ZTK A;  5CHM A;  3T1S A;  2HP6 A;  4Y7P A;  3BFF A;  5GLA A;  5A91 A;  1TS0 A;  4EUV A;  2ZC5 B;  5DF7 A;  4E6X A;  4IUH A;  3O86 A;  2NUT C;  4CLC C;  1Z6F A;  3PYP A;  5TR7 A;  3R7W B;  2VV6 A;  3SS3 A;  2FFY A;  2HGV A;  5EM0 A;  4UEY A;  3IS2 A;  2ZQC A;  3T1X A;  2W27 A;  4OQH A;  2ZMA A;  1K25 A;  1SCW A;  4S2N A;  5GHX A;  4HBT A;  1TS8 A;  3QNC A;  4EQ1 A;  2YKF A;  3FKW A;  4KEN B;  1H8Y A;  2UWX A;  5F82 A;  2JCH A;  1TS7 A;  1K55 C;  3SOI A;  4IHQ A;  4R3B A;  4EEU A;  1DY6 A;  2VLG A;  5HD3 A;  1MKM A;  2V2F F;  4R4S A;  1FCO A;  4MCW A;  4BBV A;  1K54 C;  1MZU A;  3QP5 A;  1YSQ A;  3IF6 C;  1XJ3 A;  3HLG A;  1I5Q A;  4WUJ A;  2L4R A;  4DJ2 A;  4ZJ2 A;  3HLE A;  3EQU A;  4WEK A;  1G6O A;  3WS0 A;  1AWI A;  4LRY C;  1AXB A;  3LEZ A;  4EBL A;  4I3A A;  2V8F A;  4GS9 B;  3CHW P;  3EEH A;  2WKH A;  4CJN A;  2CC1 A;  2YKH A;  4N1H A;  5GHY A;  3T1Q B;  1H5X A;  2MJ6 A;  2QJ5 A;  4HJ6 A;  4N1X A;  5U47 A;  4EBP A;  4DE1 A;  4PKY G;  5KSH A;  5FA7 A;  1Y4O A;  1YAX A;  3HJI A;  3PAG A;  1PW1 A;  4JXG A;  2BTF P;  1NXY A;  4IBR A;  3LIF A;  3ZVW A;  4OPQ A;  3SW1 A;  3IX3 A;  3OLO A;  3NY4 A;  3ISG A;  3S7Q A;  4G3K A;  1A0K A;  1ZKJ A;  4KG2 A;  2J7V A;  5CED A;  3RTY A;  2DMW A;  3WWX A;  4BL2 A;  2A49 A;  5F83 A;  1OJ5 A;  3G6O A;  3P01 A;  3O88 A;  1MWU A;  1PIO A;  4KZ6 A;  3WS2 A;  3VV4 A;  3T4J A;  2WZX A;  2GX5 A;  1E3U A;  3LI8 A;  3LY4 A;  4ZRR A;  1BLS A;  2I9V A;  3T4O A;  4GJ4 A;  3CUE C;  3V39 A;  4DKI A;  3SH9 A;  2HDR A;  2Y2I A;  4KZB A;  3Q1F A;  2Y59 A;  4LV1 A;  1C3B A;  3W2Z A;  2Y2Q A;  5AQB A;  1IYO A;  4FD8 A;  4MBH A;  1NWZ A;  5FQM A;  1BLH A;  2VA0 A;  1GA9 A;  3S22 A;  3GR2 A;  3A3I A;  3BLS A;  4QB8 A;  2M1C A;  4ME4 A;  2ZQA A;  3CAX A;  2O9A A;  1K56 A;  3WRT A;  4WZ5 C;  4EES A;  4OLD A;  3DW0 A;  1FIK A;  5FAO A;  1XJ6 A;  4JF5 A;  4GHI A;  2W3E A;  4B4X A;  2EXA A;  2V20 A;  4ARZ B;  3LY3 A;  4IBX A;  3QP8 A;  3BFE A;  4R0Q A;  1TDG A;  1DP6 A;  4FH2 A;  2B95 A;  2JKR I;  3GMW A;  3ZCZ A;  4OH0 A;  4LGW A;  1PI4 A;  4H6J A;  1RP5 A;  4Y0U A;  1YPR A;  2OAP 1;  4JXS A;  3BWL A;  3LR5 A;  5L2F A;  2HDQ A;  1OT9 A;  3ZDJ A;  2PRF A;  4BD1 A;  4R4R A;  4NXE A;  1W8Y A;  3E4P A;  5EVI B;  3KYZ A;  3IH9 A;  5F1F A;  4X1L A;  3UE1 A;  5HAQ A;  4S2M A;  2W3G A;  1OTD A;  1KVM A;  2ZC7 A;  4R38 A;  5FQ9 A;  4DDY A;  2XDM A;  3ITA A;  5J3W A;  3UB5 P;  3S1Y A;  3UPP A;  5D3O A;  1JVJ A;  4ETX A;  3MQO A;  2JKR M;  3HLF A;  3HVF A;  4GZB A;  3C4O A;  5TBM B;  4OLG A;  1TEM A;  2HJE A;  3B47 A;  4QJG A;  1JWZ A;  4EXO A;  3G30 A;  5BOH A;  5FAS A;  5FAT A;  4OQI A;  4O7D A;  1FSY A;  1K0K A;  5TJJ A;  1KGF A;  4Y17 A;  2Y79 A;  1E25 A;  5J8X A;  3AGF A;  3HUM A;  4Z1W A;  3WS1 A;  2QWS A;  4Q0I A;  4JBF A;  3SH8 A;  4RYE A;  5HWW A;  3ICY A;  4Y2F A;  2ZC6 B;  2Q9N A;  2ACG A;  4HP4 A;  3SH7 A;  3ZG5 A;  1W7F A;  3T4S A;  4ZDX A;  2IA2 A;  1FOF A;  1OTA A;  1VET B;  4PM9 A;  1NZO A;  4LRZ E;  3IX4 A;  5FL3 A;  3UO9 A;  1TS6 A;  4WF0 A;  2W0N A;  1KE4 A;  4HI4 A;  3C7U A;  2QPN A;  1XA7 A;  3FKV A;  1IYQ A;  1HZO A;  2E8I A;  3DWK A;  2Y2L A;  5DF9 A;  4GNU A;  2EWV A;  4Y15 A;  3N8R A;  3KYQ A;  5DKL A;  3P98 A;  3C7V A;  1CQA A;  1MWR A;  1OPX A;  1E3U D;  2PYR A;  4KZ9 A;  5KSC A;  5DTK A;  1O07 A;  2QYB A;  5DKK A;  3Q7Z A;  1K57 C;  5FQK A;  2R9X A;  1FR1 A;  4EQI A;  4ZJ3 A;  2Z2L B;  1V9Y A;  3WS5 A;  4O0P A;  3D72 A;  3A0R A;  3H82 A;  3IS2 B;  3UB9 A;  4FUW A;  3DTM A;  4H8R A;  3P09 A;  2J3T D;  1NYM A;  1N9O A;  4CPK A;  2V9A A;  3BW6 A;  2O99 A;  2EFU A;  4GOG A;  1W63 Q;  5KZH A;  2ZL1 B;  4IED A;  3LI9 A;  2GJ3 A;  4MN5 A;  4JPM A;  3KSG A;  3IX8 A;  5CER A;  4PHT A;  3IXG A;  3B3X A;  5L09 A;  1BTL A;  3BFG A;  3A3E A;  5EOE A;  5DTS A;  1S4S A;  4FH4 A;  1ERO A;  2WUQ A;  3IBJ A;  4K08 A;  3CJM A;  5IHV A;  5L8M A;  3OPR A;  4QD4 A;  1IFQ A;  4OKP A;  2IWD A;  3W4P A;  4QY5 A;  3HJK A;  4ESP A;  4Y5F A;  1F98 A;  3UB8 A;  3HRE A;  4E6W A;  2V8C A;  1GHI A;  1YKD A;  3N7W A;  3BYD A;  5HWV A;  1L0D A;  2W1T A;  3C2W A;  1PWG A;  3BY9 A;  5HW3 A;  3RJU A;  2WKP A;  4Z9Q A;  4EU0 A;  3NDG A;  2WAD A;  5C5K A;  4MN7 A;  2WKE A;  2PDR A;  4PMA A;  3MZD A;  1ZC2 A;  1YLW A;  2D01 A;  2PD7 A;  1NYY A;  1DRM A;  3IBR A;  2L0W A;  5EVI C;  3UPN A;  5TGF A;  1ESU A;  1GSX A;  2IWC A;  2J9P A;  4KG6 A;  5G4Y A;  4DE3 A;  5EFW A;  4E3K A;  4P85 A;  1XPB A;  4HNB A;  2O9B A;  1IKI A;  2QHK A;  2OAQ 1;  1S1Z A;  4Y0O A;  2P74 A;  3LIE A;  3O3V A;  5F1G A;  5L10 A;  4P0M A;  5EV0 A;  3GTC A;  5FEG A;  5CEB A;  3ZYT A;  3EGD C;  2PR5 A;  4E3M A;  1L3L A;  4OQG A;  1GSW A;  5FEF A;  4L9G A;  5AVE A;  4GD8 A;  5FI7 A;  5HPI A;  1GSV A;  4E3L A;  2EFX A;  2GNX A;  3G4P A;  3P7N A;  3HLC A;  3FYZ A;  4XT2 A;  4KQD A;  4DN0 A;  5M19 A;  4R23 A;  3E4Q A;  3Q7V A;  4X25 A;  4RQ9 A;  4GDN A;  4BJP A;  2XFS A;  3BQA A;  1YQS A;  4C75 A;  3IHB A;  1GA0 A;  4GD6 A;  5FDH A;  1GHM A;  4WN5 A;  3HUN A;  4BBT A;  2PAV P;  1DJC A;  5HDC A;  5FAQ A;  1IKG A;  2OWH A;  3W4Q A;  1UWP X;  3NI9 A;  5DJU A;  1S67 L;  3A3F A;  3CWF A;  4GHI B;  2EWW A;  1LI9 A;  1W8Q A;  5A8B A;  1PZP A;  2Y2K A;  1NRF A;  4R3A A;  1T1A A;  3T1R A;  4M3K A;  1YM1 A;  1KOU A;  4DRT A;  2XD1 A;  1EWZ A;  2XF3 A;  2E8J A;  5CGW A;  4OPR A;  4H6J B;  4Q0J A;  3A0V A;  4JF6 A;  3S7O A;  2I72 A;  4P87 A;  5E2G A;  2WYX A;  1K4E A;  4WZ4 A;  4OOY A;  4WEL A;  2DRW A;  5LBR A;  2FZ0 A;  2ZL1 A;  2Y2M A;  4MEZ A;  3OPH A;  4KG5 A;  5GLC A;  3C38 A;  1XFN A;  2X71 A;  2DCF A;  1ERQ A;  3MS6 A;  1J9M A;  3VP3 A;  2VJW A;  1EI5 A;  4RA7 A;  4B88 A;  2ZLY A;  1M6K A;  4RVA A;  2A3U A;  2BG1 A;  2VK3 A;  5DFX A;  4WYY A;  2ZMF A;  1IOU A;  1YT4 A;  5F68 A;  5G18 A;  3OOV A;  1HLU P;  4S2N C;  4U3T A;  3A0S A;  4MDZ A;  3HCY A;  4KZ3 A;  2HPB A;  2Z6C A;  4R6L A;  3MSH A;  4OOL A;  1ONH A;  1IYP A;  5CX7 A;  1G6A A;  4OVD A;  4PM6 A;  3UE0 A;  3ULF A;  2Y2J A;  4BQM A;  2Y2G A;  1Y28 A;  1ES5 A;  2VV8 A;  1MC0 A;  3TW8 A;  3VMA A;  2OOL A;  2J9O A;  4L0L A;  1D7E A;  5FQQ A;  2ZD8 A;  1VEU A;  3N8L A;  3GDI A;  5A90 A;  2XEP A;  3ZG0 A;  3MKF A;  4S2J A;  4KQO A;  3UE6 A;  4E3N A;  2DNS A;  2V1A A;  4P6Z M;  1X0O A;  1GCE A;  1RGY A;  3U2A A;  4KZA A;  4C6Y A;  1ZHH B;  3LO7 A;  1T1B A;  3Q81 A;  4EET B;  3DTK A;  5CGX A;  1SDN A;  3UE3 A;  3TRC A;  4WBG A;  2JKG A;  2A24 A;  1MWT A;  3W4O A;  4PKY A;  4IVK A;  5FI6 A;  1ES4 A;  4N9K A;  3UMD A;  1WE4 A;  2GZA A;  1NY0 A;  2HDU A;  4BMW A;  5CXW A;  4O01 A;  5GL9 A;  3KSF A;  4WL9 A;  3VOY A;  4LLO B;  3F1O A;  3QHY A;  3GVB A;  3G2Y A;  3H82 B;  4F3L A;  2EXB A;  4CQH A;  3A3J A;  3EGX C;  4EW7 A;  1CK3 A;  2K2N A;  3PR6 A;  4DDS A;  3VP1 A;  2EX2 A;  4CLC D;  1DP9 A;  1H8Z A;  4YOF A;  5EVL A;  4UQI M;  2HV1 A;  3F1N A;  4MNR A;  3ZNY A;  4UA6 A;  3LR3 A;  4QWO A;  1XGJ A;  2ZOH A;  5AJG A;  5MC7 A;  3M6B A;  3PBN A;  2PU4 A;  2V0W A;  2WKR A;  3IXH A; 
#chains in the Genus database with same CATH homology
 3WRZ A;  2Q9M A;  1JTG A;  4JLF A;  1E3U D;  4DF6 A;  2VGK A;  1K6R A;  4KZ9 A;  3UDF A;  1CEG A;  4DE2 A;  5KSC A;  3MXS A;  5KMW A;  1FCM A;  5DTK A;  1KE3 A;  5EUA A;  2OSU A;  5DTT A;  3IHA A;  2JBF A;  3HLW A;  1ES2 A;  1O07 A;  1CI9 A;  5FI2 A;  3Q7Z A;  5AQ9 A;  3A3D A;  1K57 C;  3OZH A;  5FQK A;  2R9X A;  1FR1 A;  3MKE A;  4EQI A;  5HAI A;  4ZJ3 A;  3VSL A;  1MPL A;  1YLT A;  1SKF A;  2Z2L B;  5EVI D;  3WS5 A;  2WGW B;  2Y91 A;  1NJ4 A;  4ZJ1 A;  3TG9 A;  3DTM A;  4KZ7 A;  2Y2O A;  1PWC A;  3OCN A;  3P09 A;  4FSF A;  1KGE A;  4H8R A;  4Y0T A;  1NYM A;  4CPK A;  3G35 A;  5EE8 A;  2EX9 A;  3QNB A;  4BEN A;  1JWP A;  2EFU A;  4GOG A;  4HES A;  4YFM A;  5KZH A;  1TDL A;  3M2K A;  4K91 A;  3PBT A;  4IED A;  3OPL A;  4GDB A;  5FSR A;  4JPM A;  5HL1 A;  2HP9 A;  1OME A;  5CER A;  1YLY A;  1LL9 A;  1S6R A;  2H10 A;  3IXG A;  3B3X A;  3UDX A;  3BLM A;  1QME A;  1BTL A;  3BFG A;  4EWF A;  3A3E A;  4RX2 A;  4ZTK A;  4GB7 A;  4F94 A;  2IWB A;  5CHM A;  4K0W A;  5EOE A;  5DTS A;  3C5A A;  1LLB A;  4FH4 A;  2HP6 A;  1ERO A;  4KZ4 A;  3O87 A;  2WUQ A;  4Y7P A;  4DE0 A;  3BFF A;  5GLA A;  5A91 A;  4RX3 A;  3SS5 A;  3CJM A;  1I2S A;  1K6S A;  5IHV A;  3GSG A;  3OPR A;  1YLJ A;  2ZC5 B;  2JC7 A;  4QD4 A;  5DF7 A;  5M1A A;  3SS4 A;  4E6X A;  1IYS A;  3O86 A;  4OKP A;  5JYO A;  2WAF A;  2IWD A;  3W4P A;  4X55 A;  4BD0 A;  3OPP A;  3UNW A;  4EUZ A;  4QY5 A;  4WZ5 A;  2Y4A A;  5E2H A;  1Z6F A;  3FWL A;  5GLB A;  4N9L A;  5TR7 A;  5E43 A;  3IWQ A;  3SS3 A;  1E4D A;  3HRE A;  2FFY A;  4E6W A;  2WGW A;  3ZVT A;  3V50 A;  3PBQ A;  2ZQC A;  1GHI A;  4S2L A;  5EOO A;  3BEB A;  3BYD A;  3N7W A;  2ZMA A;  1K25 A;  1L0D A;  1SCW A;  2VGJ A;  3G2Z A;  3PBR A;  4HBT A;  2ZQD A;  4S2N A;  5GHX A;  4D2O A;  2H0Y A;  5GLD A;  1CI8 A;  1PWG A;  1PZO A;  4FCF A;  3QNC A;  5HW3 A;  1KVL A;  4PM8 A;  3RJU A;  1L2S A;  1PWD A;  4Z9Q A;  5JYP A;  3FKW A;  4KEN B;  4EV4 A;  1H8Y A;  2UWX A;  3NDG A;  5F82 A;  1M40 A;  3W8K A;  1U60 A;  2WAD A;  2C6W B;  2JCH A;  4Q8I A;  2WKE A;  2H5S A;  1K55 C;  4PMA A;  1LI0 A;  3MZD A;  1WYC A;  3SOI A;  3ZG9 B;  1XKZ A;  4LEN A;  5I94 A;  1ZC2 A;  2RCX A;  4R3B A;  1YLW A;  5HX9 A;  2ZQ8 A;  3BM6 A;  4NK3 A;  3Q7V B;  3N4I A;  4PPR A;  1DY6 A;  1NYY A;  1N4O A;  2V2F F;  4S2I A;  4R4S A;  1FCO A;  3ZGA B;  5EVI C;  1SDE A;  2WK0 A;  4QY6 A;  5TGF A;  3UPN A;  2ZC4 B;  1K54 C;  4LV0 A;  3VP4 A;  3IXB A;  1ESU A;  4KQR A;  2IWC A;  4NET A;  4OQH A;  2J9P A;  5AQA A;  1BUL A;  3HLG A;  3IF6 C;  4KG6 A;  4DE3 A;  4E3K A;  4P85 A;  1I5Q A;  1XPB A;  4X68 A;  5CTM A;  4ZJ2 A;  1S0W A;  3HLE A;  2G2U A;  3EQU A;  4WEK A;  5DVA A;  1W79 A;  2OLU A;  3BFD A;  4UA7 A;  1IKI A;  4QHC A;  4X6T A;  3WS0 A;  4XXR A;  1AXB A;  4Y0O A;  3LCE A;  1KE0 A;  2P74 A;  3LEZ A;  4EBL A;  3C4P A;  3O3V A;  5F1G A;  4GKU A;  4P0M A;  2WKH A;  3IWO A;  2CC1 A;  4CJN A;  2FFF B;  4N1H A;  4MBF A;  5GHY A;  1H5X A;  3IXH A;  3UY6 A;  3RXX A;  4N1X A;  2HP5 A;  3GTC A;  3ZNT A;  1LHY A;  1ZG6 A;  5U47 A;  4EBP A;  5CEB A;  4DE1 A;  5KSH A;  4IVI A;  5FA7 A;  3VP2 A;  4E3M A;  4OQG A;  5EEC A;  1XXM A;  3NC8 A;  3PAG A;  1PW1 A;  4JXG A;  4LV2 A;  1NXY A;  3IT9 A;  4IBR A;  4ZAM A;  3PBS A;  3GQZ A;  4GD8 A;  5E2E A;  1N9B A;  5DF8 A;  5FI7 A;  4E3L A;  2XGN A;  2EFX A;  2Y55 A;  3ZVW A;  5CGS A;  4BQM A;  3G4P A;  4WM9 A;  1JTD A;  2WAE A;  4OPQ A;  1KDS A;  4LV3 A;  1YMX A;  3Q82 A;  1FSW A;  3NY4 A;  3HLC A;  2C5W B;  3FYZ A;  5M19 A;  2XH9 A;  3FZC A;  3ISG A;  4R23 A;  1ES3 A;  3Q7V A;  3IQA A;  4LCM A;  4X53 A;  1MXO A;  2Z2M B;  4BJP A;  3NCK A;  2WKI A;  4GDN A;  2XFS A;  1MKI A;  1YQS A;  1ZKJ A;  4KG2 A;  4C75 A;  2J7V A;  3IHB A;  4BL3 A;  1GA0 A;  2ZQ7 A;  4GD6 A;  5CRF A;  1BLP A;  5CED A;  3NIA A;  5GHZ A;  5FDH A;  1GHM A;  1MWS A;  3HUN A;  3WWX A;  4BL2 A;  3N8S A;  2A49 A;  5F83 A;  1DJC A;  4U0X A;  3O88 A;  3VSK A;  5FAQ A;  1IKG A;  3W4Q A;  2EX6 A;  3NI9 A;  2B5R A;  3A3F A;  4HBU A;  1MWU A;  1PIO A;  1LI9 A;  4KZ6 A;  3WS2 A;  1W8Q A;  2ZQ9 A;  1PZP A;  2EX8 A;  2Y2K A;  2WZX A;  5A93 A;  1NRF A;  1DJB A;  3Q07 A;  1E3U A;  1WYB A;  4XUX A;  3RXW A;  3IH8 A;  4KZ8 A;  1YM1 A;  4M3K A;  2XR0 A;  3BEC A;  3HL9 A;  3LY4 A;  4DRT A;  3M2J A;  2XD1 A;  1EWZ A;  1K4F A;  3S4X A;  2XF3 A;  1BLS A;  3HBR A;  4PM7 A;  2JE5 A;  5CGW A;  4OPR A;  2HDS A;  2OV5 A;  3VFH A;  4JF6 A;  2I72 A;  4N92 A;  5HAR A;  2PU2 A;  4P87 A;  3V39 A;  5E2G A;  4B4Z A;  2WYX A;  1K4E A;  2RL3 A;  3SH9 A;  4DKI A;  4WZ4 A;  2X01 A;  4OOY A;  2Y2P A;  4WEL A;  2HDR A;  1CEF A;  2Y2I A;  3V3R A;  1BLC A;  4KZB A;  5A92 A;  2DRW A;  3Q1F A;  2QZ6 A;  2Y59 A;  4LV1 A;  1C3B A;  5HFO A;  2Y2Q A;  1MBL A;  5AQB A;  3UPO A;  1IYO A;  4FD8 A;  4GN2 A;  4MBH A;  1SHV A;  2QMI A;  1RCJ A;  1ZG4 A;  5FQM A;  1BLH A;  2Y2M A;  3OCL A;  4MEZ A;  3OPH A;  2XFT A;  3CG5 A;  4KG5 A;  1ERM A;  1GA9 A;  1XGI A;  5GLC A;  3S22 A;  3GR2 A;  1FCN A;  3A3I A;  2OLV A;  2XD5 A;  3BLS A;  3VOZ A;  2X71 A;  2DCF A;  4QB8 A;  1ERQ A;  4K0X A;  1J9M A;  3MZE A;  2ZM2 A;  2ZQA A;  3VP3 A;  4S2K A;  3TOI A;  1EI5 A;  1K56 A;  4X56 A;  4OPY A;  4RA7 A;  3WRT A;  4B88 A;  2ZLY A;  1K57 A;  4WZ5 C;  1M6K A;  3GRJ A;  4OLD A;  4RVA A;  1PW8 A;  2A3U A;  5CHU A;  3DW0 A;  2BG1 A;  3CZD A;  1PYY A;  5FAO A;  5FQI A;  4WYY A;  1BSG A;  1TVF A;  4JF5 A;  4OOM A;  4B4X A;  3DWZ A;  4E3O A;  1W5D A;  2EXA A;  3HUO A;  1YT4 A;  4X69 A;  2V20 A;  1YMS A;  1L0E A;  3CMZ A;  5G18 A;  3LY3 A;  3PBO A;  4S2N C;  2ZC3 B;  4IBX A;  4U3T A;  4JKT A;  3BFE A;  1TDG A;  2J8Y A;  2BLS A;  3MXR A;  4R0Q A;  1L0G A;  1HD8 A;  2V1Z A;  3ITB A;  4FH2 A;  4S2P A;  1LL5 A;  1IEL A;  2ZJ9 A;  4KZ3 A;  4BLM A;  2HPB A;  2P9V B;  3GMW A;  1Q2Q A;  1VQQ A;  3ZCZ A;  2ZM0 A;  4OH0 A;  1PI4 A;  4OOL A;  1RP5 A;  1ONH A;  4Y0U A;  5EPH A;  1IYP A;  3PAE A;  3D4F A;  3UN7 A;  3BRM A;  4JXS A;  1G6A A;  4OVD A;  4PM6 A;  5L2F A;  3BFC A;  4KZ5 A;  3UE0 A;  2HDQ A;  3AGD A;  2Y2J A;  3VFF A;  2Y2G A;  3ZDJ A;  1BZA A;  1DJA A;  4R4R A;  4BD1 A;  1W8Y A;  1YLZ A;  1ES5 A;  4OON A;  5EVI B;  4C3Q A;  3VMA A;  4HEF A;  1XX2 A;  3IH9 A;  5F1F A;  1HTZ A;  3VP0 A;  3UE1 A;  1GHP A;  5HAQ A;  2J9O A;  4L0L A;  4S2M A;  4MLL A;  1KVM A;  5FQQ A;  3AGE A;  1RGZ A;  2ZD8 A;  2ZC7 A;  3IF6 B;  3IXD A;  3FV7 A;  3MZF A;  5FQ9 A;  3JYI A;  4DDY A;  2XDM A;  3N8L A;  3ITA A;  5A90 A;  2XEP A;  3S1Y A;  3UPP A;  5D3O A;  4WMC A;  3ZG0 A;  1JVJ A;  2GDN A;  2H0T A;  3EQV A;  3MKF A;  4ID4 A;  4S2J A;  4UA9 A;  3HLF A;  4KQO A;  3HVF A;  4E3N A;  2DNS A;  4UHU A;  4GZB A;  1IEM A;  3I7J A;  4DXC A;  2XLN A;  3C4O A;  1GCE A;  1RGY A;  4U0T A;  4PM5 A;  4OLG A;  3UDI A;  1FR6 A;  4KZA A;  4C6Y A;  1TEM A;  4QJG A;  4XUZ A;  3LO7 A;  4OQ0 A;  1JWZ A;  1K56 D;  2G2W A;  3NBL A;  3Q81 A;  4OP5 A;  3G30 A;  5BOH A;  5FAS A;  3ZFZ A;  5CGX A;  5FAT A;  3G32 A;  4OQI A;  5FQJ A;  4O7D A;  1SDN A;  1FSY A;  2WZZ A;  3N6I A;  1KGF A;  3UE3 A;  2R9W A;  4JXV A;  3ZG7 B;  4E3J A;  4WBG A;  2P9V A;  2Y2N A;  3W4O A;  1E25 A;  1MWT A;  3MBZ A;  4IVK A;  5FI6 A;  1ES4 A;  1K55 A;  1K38 A;  4N9K A;  5J8X A;  3AGF A;  3G31 A;  3HUM A;  5HAP A;  4JF4 A;  3WS1 A;  1JWV A;  1WE4 A;  4JXW A;  3PTE A;  3ZHH A;  1QMF A;  3E2K A;  1NY0 A;  2HDU A;  4UAA A;  4OPZ A;  4A5R A;  2XK1 A;  2X02 A;  3E2L A;  4P6B A;  5CXW A;  4JBF A;  4KQQ A;  4ZBE A;  5EVI A;  3IF5 A;  1YLP A;  5GL9 A;  3SH8 A;  1K54 A;  1XA1 A;  4RYE A;  1ALQ A;  1ESI A;  2Y2H A;  3G34 A;  2ZC6 B;  4DXB A;  3V5M A;  5CHJ A;  3VOY A;  2Q9N A;  1BUE A;  3IF6 A;  4E3I A;  1ONG A;  4EBN A;  4OP8 A;  1PI5 A;  4LCL A;  4MBK A;  4R3J A;  3M6H A;  3QHY A;  3SH7 A;  3HLD A;  3ZG5 A;  1W7F A;  1BT5 A;  4ZDX A;  3GVB A;  4S2O A;  3V3S A;  3G2Y A;  1FOF A;  5FAP A;  3GV9 A;  1VM1 A;  1NZU A;  2EXB A;  4PM9 A;  5M18 A;  2PBY A;  1NZO A;  2XQZ A;  3HLB A;  3ZG8 B;  3A3J A;  5AQ7 A;  1O7E A;  1CK3 A;  3WS4 A;  4R1G A;  4WMC D;  1FQG A;  3MFD A;  4DDS A;  1KDW A;  5CTN A;  3UO9 A;  3TSG A;  3VP1 A;  5TFQ A;  1KE4 A;  1Y54 A;  2EX2 A;  1G68 A;  4WEJ A;  3NDE A;  1MY8 A;  3C7U A;  3OC2 A;  1H8Z A;  2QPN A;  1XA7 A;  5EVL A;  3FKV A;  1IYQ A;  2ZM8 A;  4MNR A;  3ZNY A;  1HZO A;  1KGG A;  4UA6 A;  1Q2P A;  2E8I A;  3DWK A;  2Y2L A;  5E2F A;  5DF9 A;  1XGJ A;  2WGI A;  3M6B A;  4GNU A;  3PBN A;  1L0F A;  3N8R A;  2PU4 A;  3IWI A;  3P98 A;  4YIN A;  4QU3 A;  3C7V A;  2WGV A;  1HVB A;  5CEC A;  1MWR A;  1I2W A;  1XP4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...