1JWPA

Structure of m182t mutant of tem-1 beta-lactamase
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
263
structure length
263
Chain Sequence
b'HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTTPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE TEM
publication title Evolution of an antibiotic resistance enzyme constrained by stability and activity trade-offs.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 95
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2001-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1jwpA00
5M19A 5EVLA 1O07A 1YLTA 4Q8IA 5KZHA 4OQIA 1HD8A 2EXAA 3GV9A 4KENB 4E3MA 3GTCA 1ES2A 4KZ6A 4MNRA 3ZG7B 2WKHA 3FKVA 3M6HA 1XPBA 1XXMA 2XD1A 3C5AA 4H8RA 4U0XA 3HLDA 4KQRA 4KZ5A 5GLBA 3IF6B 3E2LA 3CMZA 1Y54A 3OZHA 5FAOA 2XGNA 4OVDA 3HLFA 2C5WB 5A93A 1ES5A 1ONGA 2Y2HA 4WZ5A 4DE2A 3O87A 4N9KA 1CI8A 3VP2A 3SS4A 4EWFA 3IXGA 3QNBA 1K55A 3G4PA 1RP5A 4X56A 4E3IA 4JXSA 2H10A 3QNCA 2WK0A 4Y0UA 4JPMA 5EE8A 4S2PA 1MBLA 3GQZA 1JWPA 1S6RA 2JC7A 1BULA 4S2KA 4WZ4A 3IT9A 1W8YA 4OOMA 1I2SA 2ZC3B 1BUEA 1XP4A 1I5QA 1L0EA 1PI4A 5GL9A 2Y59A 4E3NA 4R0QA 2ZQ9A 1YT4A 2X71A 4IVIA 1K25A 3PTEA 1PZPA 3A3DA 1TEMA 2Y2GA 3UPNA 1W8QA 2WGIA 4N92A 3C7VA 3D4FA 3IXDA 1HVBA 4OQHA 4WZ5C 3HBRA 3M2JA 3P09A 1K55C 5FAPA 1GHMA 4KG2A 3ISGA 2P9VB 4KQOA 4PM7A 3UE1A 2X01A 4MEZA 3WWXA 4BLMA 1RCJA 3G34A 2H5SA 3AGDA 4PM9A 2ZQ7A 3RJUA 1KVLA 3MKEA 4K0XA 4UA9A 3MBZA 2Y2IA 2X02A 4OH0A 4Y7PA 1FCNA 2Y2NA 5DTTA 5D3OA 3VP4A 1NZOA 3ZGAB 2Z2MB 3UDIA 2J7VA 3OPLA 3OPPA 1WYCA 1BLPA 4D2OA 4R3JA 5EVIB 4F94A 1DY6A 1U60A 5E2GA 1YLPA 1LL9A 4FD8A 5EOOA 3NI9A 1ES3A 5FQIA 3IWIA 2GDNA 1NYMA 3GRJA 3SH8A 3UPOA 4JF5A 1WYBA 4E3KA 4IBRA 2QMIA 2Y2QA 4XUZA 4OKPA 1SDEA 4K0WA 3HUOA 1DJAA 1MWTA 2ZC4B 2H0YA 5CERA 2XR0A 4X69A 1H5XA 1KGEA 3UDXA 3Q1FA 3Q82A 5F1FA 5FQ9A 5FQKA 5CEBA 4Y0OA 5TR7A 5U47A 2XFSA 4ZJ2A 3VP0A 2JE5A 1SCWA 4OP8A 4EUZA 1ERMA 4X53A 1PWGA 2WGWA 1FOFA 4MLLA 2XDMA 3IQAA 5HX9A 1IYOA 1AXBA 1PWCA 2HPBA 1NY0A 1L0DA 3HLEA 3HREA 1K4EA 3JYIA 4L0LA 2WUQA 4LCLA 2ZM8A 4LV1A 2ZC7A 5CTNA 1Q2QA 4X55A 4BENA 3I7JA 3PBRA 3V50A 4DE1A 3GR2A 4N1HA 4OPYA 4JXVA 4BJPA 3RXWA 4KZ4A 1KVMA 3IH8A 4O7DA 1E25A 2WAFA 5BOHA 4GN2A 2ZQCA 3PBQA 3UDFA 5DTSA 3ZVWA 3BFEA 3A3FA 3ZDJA 3LEZA 3VSKA 5TGFA 4QHCA 3VOYA 2HP9A 4LENA 2WGVA 1GHPA 1MPLA 3W4QA 5EOEA 3HUMA 4Z9QA 3NIAA 2Y2JA 1EI5A 4GDBA 4PPRA 5KMWA 2EFXA 3LCEA 2HDRA 5AQ9A 3VFHA 4DKIA 2R9XA 3QHYA 1ESIA 4JKTA 5FATA 5CRFA 5L2FA 3BM6A 4E3LA 5CECA 4OPZA 5EUAA 1BLSA 4R1GA 3A3EA 1DJCA 1XGIA 5DTKA 1I2WA 2I72A 5FI7A 5M1AA 4C75A 5HAQA 4GZBA 4ZJ3A 1CI9A 4OOLA 4E6WA 5EVID 3FV7A 5FASA 1EWZA 4JXGA 4WYYA 1GCEA 5DVAA 3Q7ZA 1O7EA 4GD6A 3V5MA 1KGFA 3EQUA 1K56A 3PBOA 4K91A 5HARA 4R4SA 3TSGA 1KE0A 3SOIA 4C3QA 4PM5A 3FZCA 4M3KA 3NDEA 3S1YA 4DXCA 1K6RA 3WRZA 1PIOA 1YLWA 4MBHA 4GD8A 4UHUA 1KDWA 1IELA 3BRMA 4KZBA 3HLWA 5GHZA 5DF9A 5DF8A 2HP6A 4PM6A 5FA7A 2ZC5B 2HDQA 3M2KA 3MZFA 1KDSA 1NRFA 3A3JA 1KE4A 2XFTA 3OPHA 2A49A 2UWXA 4KZ3A 3UPPA 3EQVA 3SH7A 5FQQA 2DNSA 3UY6A 1LLBA 1ONHA 1IYPA 3BYDA 1YLYA 2ZJ9A 3LY3A 2ZQAA 3CZDA 3TOIA 4EQIA 4WMCA 1NZUA 2ZQ8A 4UAAA 2OSUA 3W4PA 1JWZA 1NJ4A 1W5DA 1YMXA 4B88A 5A92A 3IF5A 1HZOA 5CGSA 3W4OA 3IWQA 4B4ZA 2Q9MA 3MKFA 3VMAA 2IWDA 4FH4A 4IEDA 2OV5A 4UA6A 1TDGA 4OP5A 4RA7A 2WKEA 4S2NC 3GMWA 3PBNA 4QB8A 1W79A 3BFCA 2Y2PA 4HBUA 3UE3A 3SS3A 1RGZA 2FFFB 3ZCZA 4DE0A 1W7FA 5A90A 3PAGA 4CPKA 5IHVA 3M6BA 1K4FA 3IF6A 4R4RA 1FSWA 2EX9A 1BLCA 2VGJA 1N4OA 4IBXA 2A3UA 4KZAA 3N7WA 2V1ZA 4DRTA 3BLSA 4NK3A 1GHIA 5A91A 4IVKA 1E3UA 1KE3A 3ZG9B 3TG9A 1MKIA 4X68A 5CEDA 4WBGA 2J9PA 2ZMAA 3ZG5A 3NC8A 4RYEA 3G32A 3UE0A 4JXWA 3AGEA 4XUXA 1K54A 3N8RA 3PBTA 4MBFA 1XA1A 2CC1A 3S22A 4EBLA 3E2KA 4DE3A 1HTZA 4DF6A 1MWUA 4N9LA 4LV2A 4OQ0A 2Y4AA 3G30A 3HVFA 4WELA 2ZC6B 5F1GA 2JBFA 3IF6C 4C6YA 3NDGA 4B4XA 3IXBA 4KG5A 3P98A 3Q81A 4ZBEA 3ZHHA 5CHJA 1LI9A 4NETA 2WADA 2IWCA 2QZ6A 3VOZA 1IYSA 4UA7A 1CEFA 1FR1A 1LL5A 3UO9A 1PI5A 1C3BA 3MXSA 4N1XA 5DF7A 5HW3A 5JYPA 5J8XA 4QY6A 4BD0A 5HAIA 5FQMA 3BECA 1PZOA 2Y2MA 1BLHA 3C4OA 2J8YA 1K54C 2XF3A 3ZG0A 1K38A 3SH9A 3WRTA 3OCLA 5F82A 1WE4A 1MWRA 3RXXA 4DDYA 2XH9A 5KSCA 4OLDA 2Y91A 2XQZA 2HDSA 2WKIA 3Q7VA 4OOYA 3VSLA 1PYYA 4WM9A 4R3BA 1BZAA 3HLBA 5I94A 3HL9A 4LV3A 3ZNTA 5EVIA 3PAEA 1QMEA 5FI6A 5E2HA 1CK3A 2HP5A 4QU3A 1H8ZA 3G31A 3NY4A 3G35A 3IXHA 4S2JA 4EBNA 2HDUA 5EECA 1G68A 5FAQA 1RGYA 5AQ7A 3GSGA 1LI0A 2EX2A 3G2ZA 5JYOA 1IEMA 4GB7A 3V3RA 4QD4A 1BTLA 2R9WA 4LCMA 4P6BA 1ZG4A 3BLMA 5AQAA 4P87A 5HL1A 3IH9A 4HEFA 2H0TA 3Q07A 1ZKJA 5CGWA 1SKFA 5GLCA 3ZFZA 4MBKA 4KZ9A 1VM1A 2QPNA 3WS4A 1FQGA 3LO7A 4OPQA 1SHVA 5EVIC 2Q9NA 2ZM0A 3W8KA 1LHYA 4S2LA 5E2FA 1FCOA 5EPHA 5GLAA 3FWLA 2EX8A 3V3SA 3ZVTA 5HAPA 3O3VA 1PW1A 1IKIA 2PBYA 3WS5A 2Y2LA 3NCKA 1Z6FA 2WZXA 5CHMA 3IWOA 2DCFA 5TFQA 3IHBA 1ZC2A 3MZDA 4ID4A 4S2MA 4KG6A 5FDHA 5HFOA 4S2NA 3DWZA 3NBLA 4EBPA 4ZAMA 2ZM2A 2ZQDA 4BL2A 1MY8A 2V2FF 1YMSA 4XXRA 4A5RA 4RX3A 3DWKA 3CJMA 1XA7A 3IHAA 1K57A 2OLVA 3MZEA 4OPRA 3ZG8B 1ES4A 2XLNA 3GVBA 2EX6A 2RL3A 3N8SA 1PW8A 3FYZA 3WS0A 2WGWB 1ALQA 5CXWA 1K56D 1VQQA 3UN7A 4BD1A 4LV0A 2G2UA 4YFMA 3BFGA 4P0MA 4PM8A 4DDSA 4ZDXA 3PBSA 3OCNA 4HBTA 1GA9A 3VP3A 1S0WA 1NXYA 2Z2LB 4JF4A 5F83A 1YQSA 5KSHA 5FQJA 1K57C 3N8LA 5CGXA 5M18A 4E3OA 1XKZA 4X6TA 1H8YA 1FCMA 2P74A 2XD5A 1J9MA 1MWSA 1TDLA 3ITBA 4GOGA 4CJNA 1JVJA 2B5RA 5AQBA 4S2IA 3ZNYA 3Q7VB 4WEKA 3DTMA 1GA0A 1OMEA 2EXBA 4RVAA 4R23A 1IYQA 4FH2A 5CHUA 3HUNA 3LY4A 1YLJA 3A3IA 2PU2A 1L0GA 1ZG6A 4WMCD 2Y2KA 1Q2PA 3BEBA 3C7UA 3G2YA 3SS5A 2C6WB 4WEJA 3MXRA 2DRWA 4ZTKA 4E6XA 1JTGA 4KZ8A 3V39A 3VFFA 3N4IA 1G6AA 2OLUA 5E43A 3WS2A 1XX2A 4OQGA 1ERQA 2VGKA 3ITAA 3VP1A 3OPRA 5FI2A 4YINA 4RX2A 3AGFA 2RCXA 4OLGA 1XGJA 1QMFA 4FCFA 5GHYA 2ZLYA 2J9OA 1YM1A 3C4PA 2WZZA 1DJBA 4GDNA 2V20A 1L2SA 4BQMA 4KZ7A 1JTDA 2P9VA 4EV4A 1CEGA 1KGGA 4DXBA 2BG1A 1M6KA 3BFFA 4E3JA 4P85A 2BLSA 1E3UD 2G2WA 2WAEA 2IWBA 1N9BA 1EROA 3O88A 5FSRA 4Y0TA 1IKGA 2WYXA 3B3XA 1FSYA 5GLDA 4QJGA 4S2OA 4JLFA 4JBFA 4FSFA 3O86A 3OC2A 2ZD8A 1ESUA 3MFDA 3N6IA 1E4DA 1YLZA 1BT5A 1NYYA 4QY5A 2XEPA 3HLCA 2JCHA 4JF6A 1K6SA 3FKWA 4GNUA 1SDNA 2E8IA 3BFDA 3UNWA 1PWDA 4PMAA 4OONA 4BL3A 5G18A 1JWVA 5CTMA 1BSGA 2XK1A 4KQQA 4ZJ1A 3CG5A 2FFYA 1M40A 3WS1A 4HESA 3S4XA 2Y2OA 4GKUA 2EFUA 2Y55A 3DW0A 1MXOA 1TVFA 1FR6A 5GHXA 4U0TA 1L0FA 2PU4A 3HLGA 4U3TA 5E2EA
chains in the Genus database with same CATH superfamily
3BWLA 1YLTA 4BBTA 4EQ1A 4XT2A 4KENB 4E3MA 3PHYA 1W63M 4MNRA 3C5AA 3HLDA 4KZ5A 3IF6B 3HLFA 3LIBA 1ES5A 1ONGA 2Y2HA 4DE2A 1T19A 3VP2A 3LIFA 3G4PA 1RP5A 4JXSA 4LRYC 5TBMB 4Y0UA 4S2PA 1S6RA 2JC7A 4S2KA 4WZ4A 2V8CA 3T12B 4HI4A 5GL9A 2ZQ9A 2X71A 4IVIA 1OT6A 1TEMA 2Y2GA 3A3DA 3UPNA 3LUQA 3IXDA 4OQHA 2VLGA 2PRFA 3HBRA 3C38A 3M2JA 3P09A 1CF0A 4HP9A 3VOLA 4HH2A 1EW0A 3MS6A 3VE4A 4BLMA 1LSVA 3MBZA 4AFIA 1Y4OA 2Z2MB 3UDIA 1WYCA 1YLPA 3NI9A 1NYMA 3GRJA 3TRCA 3UPOA 3SZTA 4YNRA 2Y2QA 5CERA 2XA7S 4X69A 1H5XA 1DRMA 2O9CA 2XFSA 3LICA 2V1BA 3VP0A 2JE5A 1FILA 3OLOA 4EUZA 1FOFA 4MLLA 1ZTUA 3HREA 2HPBA 1NY0A 3HLEA 4D60A 2ZC7A 3A0SA 3T4QA 3PBRA 3BY9A 3RXWA 1KVMA 3EEAA 4O7DA 1E25A 2CMNA 4G3VA 3UDFA 3ZVWA 4ARZA 3LEZA 1KOUA 4P6ZS 5TGFA 1S1ZA 4QHCA 3VOYA 3S7NA 5HSQA 5J7EA 2AVXA 5IU1A 3DTEA 3D9YA 2EFXA 3LCEA 3QHYA 1ESIA 4JKTA 1VHMA 5CRFA 3BM6A 5EUAA 4ESPA 2JN7A 1BLSA 3A3EA 1XGIA 5HAQA 4GZBA 3H7WA 4OOLA 4JXGA 4WYYA 5HWTA 5DVAA 3UB6A 4K91A 4R4SA 3H82A 1KE0A 3FZCA 4UEYA 2O9BA 3S1YA 4DXCA 4LRXC 3WRZA 3KX0X 4KZBA 2BASA 2HP6A 5FA7A 2ZC5B 1LSWA 2HDQA 4PKYG 4LFUA 3A0RA 3C8CA 4EEPA 2OAP1 2UWXA 2QKPA 3EQVA 2O9AA 3LI8A 1YLYA 2ZQAA 4EQIA 3TOIA 2ZQ8A 1JWZA 3IF5A 4LPZA 5CGSA 4PHTA 3MKFA 2IWDA 4UA6A 4RA7A 2WKEA 4H6JB 4HBUA 2INWA 4DE0A 1W7FA 3MQOA 1K4FA 1FSWA 1N4OA 4G3KA 4KZAA 1GHIA 5A91A 4IVKA 4IHQA 1YAXA 4X68A 2J9PA 2JKFA 3AGEA 1K54A 2CC1A 3S22A 3E2KA 4DE3A 1HTZA 3PYPA 4F3LB 2Y4AA 3CWFA 4WELA 4XT2B 4KG5A 3P98A 3Q81A 3KSGA 5HL6A 1T18A 3UE6A 3KYQA 3KYZA 5HW3A 5JYPA 1G6OA 5HAIA 1PZOA 1K54C 3FPWA 4RQ9A 3RXXA 5KSCA 2XQZA 3BQ8A 5K5BA 1PFLA 2BTFP 4R3BA 2HJ9C 2KLIA 1CK3A 2HP5A 4QU3A 3IS2A 1RGYA 3GSGA 3G2ZA 5HL1A 5CGWA 1SKFA 3WS4A 2QPNA 3TE8A 1FQGA 1F9IA 3W8KA 5E2FA 3ZVTA 4GHIA 2WKPA 3DBAA 3T1RA 2DCFA 5TFQA 5HZHA 2HJEA 3MZDA 2K31A 5FDHA 5J4EA 4S2NA 3IX4A 2PYPA 2ZQDA 4BL2A 1L3LA 1MY8A 1NWZA 2XLNA 3N8SA 4GW9A 5EV0A 2LB5A 4DDSA 2EWWA 1MC0A 3VP3A 1TS7A 5CGXA 4ARZB 3MFXA 1JVJA 4S2IA 5HWWA 1OMEA 4R23A 5IS1A 4FH2A 3NULA 3HUNA 3LY4A 3A3IA 1H0MA 1Q2PA 3C7UA 3MXRA 1JTGA 2OLUA 5HPFA 3VP1A 3H7WB 4HP4A 2QHKA 3AGFA 4OLGA 1XGJA 4FCFA 2ACGA 2J3TC 3DTKA 3C4PA 3H82B 4LGWA 4GDNA 5AVFA 4Y2FA 2Y8HA 4KZ7A 4UQIS 5DKKA 4P85A 2VK3A 1XJ4A 2WAEA 1N9LA 2IWBA 5FSRA 1IKGA 5FEFA 3P01A 1OTDA 3OC2A 2A24A 1E4DA 3BQAA 2PHYA 4DMZA 3H9WA 1SDNA 3CUEA 4WN5A 4HJ4A 4IUKA 3CG5A 3NOPC 2Y2OA 3MJQA 1L0FA 3HLGA 2FH5A 5E2EA 5GLBA 2J80A 3U4LP 4Q8IA 1HD8A 3GV9A 1UWPX 1ES2A 4KZ6A 1G5UA 3FKVA 1XPBA 1XXMA 2XD1A 2ZMVA 1Y54A 3OZHA 5A93A 2ZMFA 3EEHA 4WZ5A 3IXGA 3QNBA 1OTAA 4X56A 4E3IA 3RTYA 2WK0A 5EE8A 1MBLA 4OOMA 1W8YA 2QWSA 2ZC3B 1BUEA 1HLUP 1PI4A 4R0QA 2QJ7A 3A0VA 4B93A 3PTEA 4X25A 1VEUA 3T4OA 4N92A 1W63Q 4WZ5C 3R4KA 3CLOA 3NJAA 1F5MA 2XSSA 3UE1A 2VJWA 4L9GA 3NOTC 5F6AA 2ZQ7A 3RJUA 3ICYA 1KVLA 3MKEA 2Y2IA 4EXOA 1LSXA 1NZOA 3ZGAB 3OPPA 4R3JA 1DY6A 1ODVA 1U60A 5E2GA 5EOOA 3MSHA 4JF5A 4YOFA 4K0WA 1DJAA 5AJGA 2ZC4B 2H0YA 4II7A 5FQ9A 5TR7A 4ZJ2A 1SCWA 4OP8A 1ERMA 1XFQA 3IQAA 1IYOA 1PWCA 4LV1A 4LCLA 1Q2QA 4GHIB 2LB9A 2JKRI 4H6JA 2VGLM 4OPYA 2VX8A 3NHQA 3IH8A 3NOUC 5BOHA 4GN2A 4Q0JA 3RFBA 2P04A 3VSKA 3T4TA 2HP9A 4LENA 1GHPA 4Z9QA 2Y2JA 4GDBA 4PPRA 4R6LA 4DKIA 2R9XA 4BMWA 4NKPA 5FATA 4I39A 1ACFA 4F3LA 1K0KA 4R1GA 2I72A 5M1AA 4QPRA 3JVVA 4ZJ3A 1CI9A 1EWZA 3EOIA 2W3DA 3PBOA 5HARA 4C3QA 3E0YA 1PIOA 1YLWA 4MDZA 1YSQA 1KDWA 3PR6A 3HLWA 5GHZA 3T1XA 5DF8A 3M2KA 1P0ZA 2A49A 4KZ3A 1TF1A 3UPPA 1ONHA 5CX7A 1IYPA 2ZJ9A 3CZDA 1NZUA 4UAAA 4FUWA 2JKTM 2OSUA 1NJ4A 4B88A 2W1TA 1HZOA 4B4ZA 3VMAA 2OV5A 2GX5A 1TDGA 2ZL1B 3SS3A 4WL9A 3E4OA 2A24B 4BWIA 4L9EA 4B9OA 4DRTA 1KE3A 3ZG9B 4JGPA 1MKIA 5CEDA 4WBGA 2ZMAA 3TJZC 3ZG5A 3CHWP 4JXWA 4XUXA 3N8RA 4MBFA 3D3OA 4EBLA 1GSXA 4DF6A 4LV2A 3HVFA 2J3TD 5F1GA 2JBFA 2Y79A 5CHJA 1LI9A 4NETA 3UB8A 2QZ6A 3B42A 4UA7A 1LL5A 1PI5A 3L9KA 3MXSA 2UV0E 4N1XA 5DF7A 5FQMA 2Y2MA 1BLHA 3C4OA 2J8YA 3ZG0A 2EWVA 3WRTA 3OCLA 2Y91A 2HDSA 4WM9A 2VEAA 3HL9A 4LV3A 3ZNTA 5EVIA 2NUTC 1H8ZA 3G31A 2ZOIA 1XJ6A 3NY4A 2PD8A 2PDRA 2VA0A 1VEUB 1G68A 4KQDA 4MN6A 3FPVA 1BTLA 2R9WA 4LCMA 4P6BA 3BLMA 5AQAA 4HEFA 4OPQA 2V8FA 1SHVA 5EVIC 2ZM0A 5TJJA 1OTBA 3V3SA 3O3VA 2J3WA 1IKIA 3UB5P 3NCKA 3MF0A 1Z6FA 4HOIA 5CHMA 3IWOA 1FIKA 3EWKA 3IHBA 4O8GA 2O0YA 4ZAMA 4BBVA 2ZM2A 1DP8A 2PBDP 3MQQA 1XA7A 3ZG8B 1ES4A 2B95A 3GVBA 1S1YA 1PW8A 3UB7A 2OWJA 5CXWA 2OOLA 3UN7A 4BD1A 4X1LA 4ZDXA 3OCNA 4HBTA 4PAUA 3GECA 5FQJA 2ZBBA 2QYBA 1BYWA 4E3OA 1H8YA 3JVUA 2XD5A 4CJNA 4R70A 3JPUA 2EXBA 5FDSA 2Z6DA 1V9ZA 2PU2A 1P97A 3SS5A 4ZTKA 4KZ8A 3V39A 1GSWA 3VFFA 2L4RA 1G6AA 5E43A 1XX2A 2VGKA 3OPRA 5FI2A 4YINA 4RX2A 2RCXA 2ZLYA 2J9OA 1YM1A 1DJBA 4MMNA 2V20A 4EV4A 4NEED 2L1MA 2QJ5A 1M6KA 2O99A 5HDDA 3T1SA 2BLSA 1E3UD 1DP9A 2HF6A 1FSYA 4QJGA 1T1CA 2Q0OA 4FSFA 4GCZA 3O86A 2NUPC 1YLZA 3HLCA 1PWDA 5CTMA 1BSGA 1MKMA 2XK1A 4KQQA 4ZJ1A 3T4LA 2FFYA 3LIEA 1M40A 4HESA 2W1TB 4HIAA 3S4XA 4GKUA 1FR6A 5GHXA 4U0TA 5M19A 5EVLA 4OQIA 2EXAA 3GTCA 1YKDA 3ZG7B 3M6HA 4H8RA 4IJGA 1DP6A 4KQRA 5HDSA 3E2LA 3CMZA 1VB6A 2YKHA 4JGOA 4N9KA 1CI8A 1OJGA 3SS4A 4EWFA 1IOUA 1K55A 2H10A 4NXEA 5AVEA 4JPMA 3FG8A 2L0WA 3QP1A 3GQZA 1JWPA 3UB9A 1BULA 4HHDA 1I2SA 1XP4A 4ETXA 1I5QA 1L0EA 5FEGA 4E3NA 2W1RA 1YT4A 1K25A 2R78A 4GLQA 1H3QA 3D4FA 1HVBA 3LGOA 1K55C 4KQOA 4MEZA 3WWXA 3KO6A 1RCJA 2H5SA 4PM9A 3LFVA 3DTIA 4UA9A 4L9FA 4OH0A 4Y7PA 2Y2NA 1S4RA 5D3OA 3VP4A 2J7VA 3OPLA 4D2OA 3S7OA 5EVIB 2MJ6A 1LL9A 4FD8A 3E4QA 5FQIA 3IWIA 2GDNA 2W3EA 2W3GA 4E3KA 4IBRA 2QMIA 4XUZA 1SDEA 3HUOA 1SKOB 3UDXA 4HJ3A 1KGEA 3Q1FA 5FQKA 5CEBA 2WGWA 3C2WA 2XDMA 3IX8A 3OOVA 3JYIA 1L0DA 2WUQA 3QP5A 4X55A 4BENA 2V0UA 3I7JA 3GDIA 4DE1A 2ZL1A 4BJPA 2XA7M 1A0KA 3PBQA 4NXFA 3BFEA 2D02A 2V0WA 3BY8A 1MPLA 3W4QA 3T1QB 3HUMA 1VETA 1EI5A 5KMWA 1CQAA 4P6ZM 3O5YA 4OPZA 4Y15A 1DJCA 5DTKA 1I2WA 2W3HA 3QP6A 5EVEA 4E6WA 5EVID 5FASA 1O7EA 4GD6A 3V5MA 3EQUA 3TSGA 1T1BA 4PM5A 4M3KA 2G7UA 1K6RA 4MN7A 4WLAA 1ZHHB 4MBHA 4GD8A 3UMDA 4IUHA 4LLOB 4PM6A 3LI9A 1NRFA 3A3JA 1KE4A 2XFTA 3OPHA 2DNSA 1LLBA 5HD3A 5DJTA 3G6OA 3W4PA 5HWVA 5G4ZA 4WUJA 3CPTA 3W4OA 4HNBA 4OP5A 2KOIA 1W79A 3BFCA 1RGZA 3ZCZA 5C5KA 1D06A 3M6BA 4R4RA 5DFXA 3C30A 2A3UA 4CLCA 1E3UA 3TG9A 1TS8A 3NC8A 4RYEA 3UE0A 1D7EA 5HDCA 1F98A 4NXBA 1XA1A 4NG2A 1NRJA 1XJ2A 4N9LA 3P7NA 2ZC6B 1S67L 3IXBA 1MZUA 3KYEA 4ZBEA 2WADA 2IWCA 3VOZA 1IYSA 1FR1A 4CLCC 1C3BA 4R3AA 1OPXA 3KSFA 4I3JA 2XF3A 1K38A 3SH9A 3DAVA 5F82A 2XH9A 4OLDA 3QP4A 2WKIA 4OOYA 2JHEA 3HLBA 5I94A 3PAEA 2PAVP 5L09A 3LR3A 5FI6A 5E2HA 4EEUA 3ZQ5A 1LT0A 1LL8A 1Y28A 4EBNA 2HDUA 5EECA 5FAQA 5G4YA 1X0OA 1GSVA 1LI0A 5JYOA 4EERA 3V3RA 4QD4A 4I38A 4NXGA 4P87A 3IH9A 2H0TA 1ZKJA 3D72A 5GLCA 4MBKA 1VM1A 5FL3A 3LO7A 2Q9NA 4QWOA 1LHYA 1WA9A 3EGXC 3FWLA 5F5YA 3LIAA 2PBYA 4HH3A 2Y2LA 2WZXA 1ZC2A 4ID4A 4S2MA 4KG6A 5HFOA 3NBLA 2K2NA 2HZ5A 4G3WA 4Y13A 2VV6A 3MR0A 1N9OA 1YMSA 4XXRA 4A5RA 4RX3A 3IHAA 1K57A 2EX6A 2RL3A 2WGWB 1ALQA 4R38A 3W2ZA 1K56D 1VQQA 4JGQA 2G2UA 4YFMA 4PM8A 3ZYTA 4ME4A 4DJ2A 2I9VA 1OTEA 2W3FA 3CI6A 1UGUA 1NXYA 4JF4A 1YQSA 5KSHA 5DJUA 1K57C 4X6TA 3RH8B 3LIDA 2P74A 1OT9A 1J9MA 1MWSA 1TDLA 3Q7VB 2D01A 4WEKA 4RVAA 1VETB 1YLJA 1L0GA 4WMCD 4X1MA 2IA2A 4MN5A 2FZ0A 3G2YA 2C6WB 4WEJA 4DJ3A 2P08A 3N4IA 2JKTI 4PKYA 2KX6A 3WS2A 4OQGA 2K7SA 4WF0A 3ITAA 1NLYA 2WZZA 2XRNA 1L2SA 1JTDA 2V1AA 1CEGA 4DXBA 2WKRA 3BFFA 2G2WA 3O88A 1EROA 4Y0TA 3F1NA 3B3XA 2WYXA 1TS6A 2W27A 4S2OA 4JBFA 1NLZA 2ZD8A 4Z1WA 3MFDA 4UQIM 1S66L 2XEPA 2M7UA 4O01A 4JF6A 4CLCE 4EESA 1K6SA 3BFDA 4PMAA 3QP2A 4BL3A 5G18A 1SKOA 4ETZA 3F1PB 1TVFA 3CPTB 2PU4A 4LRZE 1O07A 3F1OB 4Q0HA 3K3DA 5KZHA 2OAQ1 2WKHA 5F68A 4U0XA 4EU0A 5FAOA 2XGNA 4OVDA 2C5WB 2M7VA 1STZA 3O87A 4CLCB 2Z6CA 3QNCA 1SZVA 3TW8A 2W0NA 3IT9A 1T1AA 3CAXA 3QP8A 2Y59A 2YKFA 1PZPA 1W8QA 2WGIA 3C7VA 3T4JA 1IFQA 4DN0A 1S4SA 2OWHA 2KDKA 5A8BA 5FAPA 1GHMA 4KG2A 3ISGA 2P9VB 4PM7A 2X01A 2VKSA 3G34A 3AGDA 3LYXA 3HJIA 4EUVA 4K0XA 5LBRA 2X02A 5F69A 1FCNA 5DTTA 2A2LA 1BLPA 2PR6A 4F94A 3FC7A 1ES3A 3T50A 3SH8A 1WYBA 4OKPA 3IX3A 4E04A 1MWTA 3MQ0A 3VE3A 1TS0A 2VGLS 2XR0A 5F1FA 3Q82A 4GS9B 4I3IA 4Y0OA 5U47A 3L7HA 1YPRA 2JKGA 4X53A 1PWGA 4EW7A 1D1JA 5HX9A 1AXBA 1K4EA 4L0LA 2ZM8A 5CTNA 4CLCD 2VV7A 4JGRA 4ZRRA 4Y17A 3V50A 3GR2A 4N1HA 4JXVA 4KZ4A 2WAFA 2ZQCA 5DTSA 3A3FA 5KIZA 3ZDJA 2HGVA 2WGVA 1P9RA 3IBJA 3IBRA 5EOEA 2H28A 3NIAA 5AQ9A 2HDRA 5L10A 3VFHA 2XROA 3MMHA 5L2FA 1F2KA 4E3LA 5CECA 3K3CA 1TD5A 3LR0A 2E8JA 3LEQA 5FI7A 4C75A 2V9AA 3FV7A 2P7JA 1GCEA 3Q7ZA 1XJ3A 1KGFA 1K56A 3SOIA 5L8MA 2PD7A 3NDEA 3BJNA 2DMWA 3R7WA 4UHUA 1IELA 3BRMA 2HV1A 5DF9A 3S7QA 3MZFA 1KDSA 3NECA 3HCYA 3SH7A 5FQQA 3UY6A 3BYDA 3LY3A 4WMCA 5A92A 1OTIA 1W5DA 5L07A 1YMXA 2GNXA 3IWQA 2Q9MA 2GJ3A 4FH4A 4IEDA 3F1NB 4S2NC 3GMWA 3PBNA 4QB8A 2Y2PA 3UE3A 2WKQA 2FFFB 5A90A 3PAGA 4CPKA 5IHVA 3IF6A 2EX9A 1BLCA 2VGJA 1P9WA 4IBXA 3N7WA 2V1ZA 2VV8A 3BLSA 4NK3A 5TBMA 3U2AA 4O0PA 3G32A 3PBTA 1JNUA 5EFWA 1N9NA 1MWUA 4OQ0A 3G30A 4GJ4A 3IF6C 4C6YA 3NDGA 4B4XA 4HY8A 3KSIA 1J3WA 3ZHHA 3BW6A 1CEFA 3UO9A 2ZOHA 4HJ6A 3S7PA 1YSPA 5J8XA 4QY6A 4BD0A 3BECA 1OJ5A 4DDYA 1WE4A 1MWRA 3LR4A 4YWZA 3ULFA 3EGDC 3Q7VA 3VSLA 1PYYA 1BZAA 3V67A 1QMEA 3K2NA 3G35A 3IXHA 4Y5FA 4S2JA 5AQ7A 2B18A 2EX2A 3UMEA 4I5SA 1IEMA 4GB7A 4KUOA 1ZG4A 3Q07A 4KUKA 5EM0A 3ZFZA 4KZ9A 3SW1A 3PXPA 5EM1A 4CQHA 4S2LA 5EPHA 1FCOA 5GLAA 2EX8A 3B47A 1PNEA 5HAPA 3WS5A 1PW1A 5HPIA 3CUEC 3T4KA 3DWZA 4EBPA 4Y3IA 1UWNX 1CJFA 2V2FF 3DWKA 3CJMA 2OLVA 3MZEA 4OPRA 2VZWA 5HD5A 4MCWA 3FYZA 3LR5A 3WS0A 4FTXA 3F1PA 4LV0A 3BFGA 4P0MA 3PBSA 3F1OA 4Q0IA 1GA9A 2M1CA 1S0WA 2PT7A 2Z2LB 5F83A 2EA9A 5I5LA 5M18A 3N8LA 1XKZA 1Z09A 1FCMA 2JKRM 5DFYA 4GOGA 3ITBA 2B5RA 5AQBA 3ZNYA 3DTMA 1GA0A 3T4SA 2GZAA 1IYQA 4FOFA 5CHUA 1ZG6A 2Y2KA 3BEBA 3IS2B 4I3AA 2DRWA 3B33A 4E6XA 2B02A 1AWIA 1ERQA 2PYRA 3MXQA 5DKLA 1QMFA 4M4XA 5GHYA 3KSHA 5J3WA 1XFNA 4BQMA 2P9VA 3CITA 3HJKA 1KGGA 2BG1A 4E3JA 3R7WB 3E4PA 3OBFA 4HQAA 1N9BA 4K08A 5GLDA 4JLFA 5IT5A 1ESUA 3N6IA 1PRQA 1BT5A 1NYYA 1G28A 1H8MA 3E98A 4QY5A 2PR5A 2JCHA 4BBUA 3FKWA 4GNUA 2E8IA 3UNWA 4OONA 3VV4A 1JWVA 4GS9A 4EETB 3WS1A 1V9YA 2EFUA 2Y55A 3DW0A 1MXOA 5MC7A 4U3TA
chains in the Genus database with same CATH topology
5M19A 5EVLA 1O07A 1YLTA 4Q8IA 5KZHA 4OQIA 1HD8A 2EXAA 3GV9A 4KENB 4E3MA 3GTCA 1ES2A 4KZ6A 4MNRA 3ZG7B 2WKHA 3FKVA 3M6HA 1XPBA 1XXMA 2XD1A 3C5AA 4H8RA 4U0XA 3HLDA 4KQRA 4KZ5A 5GLBA 3IF6B 3E2LA 3CMZA 1Y54A 3OZHA 5FAOA 2XGNA 4OVDA 3HLFA 2C5WB 5A93A 1ES5A 1ONGA 2Y2HA 4WZ5A 4DE2A 3O87A 4N9KA 1CI8A 3VP2A 3SS4A 4EWFA 3IXGA 3QNBA 1K55A 3G4PA 1RP5A 4X56A 4E3IA 4JXSA 2H10A 3QNCA 2WK0A 4Y0UA 4JPMA 5EE8A 4S2PA 1MBLA 3GQZA 1JWPA 1S6RA 2JC7A 1BULA 4S2KA 4WZ4A 3IT9A 1W8YA 4OOMA 1I2SA 2ZC3B 1BUEA 1XP4A 1I5QA 1L0EA 1PI4A 5GL9A 2Y59A 4E3NA 4R0QA 2ZQ9A 1YT4A 2X71A 4IVIA 1K25A 3PTEA 1PZPA 3A3DA 1TEMA 2Y2GA 3UPNA 1W8QA 2WGIA 4N92A 3C7VA 3D4FA 3IXDA 1HVBA 4OQHA 4WZ5C 3HBRA 3M2JA 3P09A 1K55C 5FAPA 1GHMA 4KG2A 3ISGA 2P9VB 4KQOA 4PM7A 3UE1A 2X01A 4MEZA 3WWXA 4BLMA 1RCJA 3G34A 2H5SA 3AGDA 4PM9A 2ZQ7A 3RJUA 1KVLA 3MKEA 4K0XA 4UA9A 3MBZA 2Y2IA 2X02A 4OH0A 4Y7PA 1FCNA 2Y2NA 5DTTA 5D3OA 3VP4A 1NZOA 3ZGAB 2Z2MB 3UDIA 2J7VA 3OPLA 3OPPA 1WYCA 1BLPA 4D2OA 4R3JA 5EVIB 4F94A 1DY6A 1U60A 5E2GA 1YLPA 1LL9A 4FD8A 5EOOA 3NI9A 1ES3A 5FQIA 3IWIA 2GDNA 1NYMA 3GRJA 3SH8A 3UPOA 4JF5A 1WYBA 4E3KA 4IBRA 2QMIA 2Y2QA 4XUZA 4OKPA 1SDEA 4K0WA 3HUOA 1DJAA 1MWTA 2ZC4B 2H0YA 5CERA 2XR0A 4X69A 1H5XA 1KGEA 3UDXA 3Q1FA 3Q82A 5F1FA 5FQ9A 5FQKA 5CEBA 4Y0OA 5TR7A 5U47A 2XFSA 4ZJ2A 3VP0A 2JE5A 1SCWA 4OP8A 4EUZA 1ERMA 4X53A 1PWGA 2WGWA 1FOFA 4MLLA 2XDMA 3IQAA 5HX9A 1IYOA 1AXBA 1PWCA 2HPBA 1NY0A 1L0DA 3HLEA 3HREA 1K4EA 3JYIA 4L0LA 2WUQA 4LCLA 2ZM8A 4LV1A 2ZC7A 5CTNA 1Q2QA 4X55A 4BENA 3I7JA 3PBRA 3V50A 4DE1A 3GR2A 4N1HA 4OPYA 4JXVA 4BJPA 3RXWA 4KZ4A 1KVMA 3IH8A 4O7DA 1E25A 2WAFA 5BOHA 4GN2A 2ZQCA 3PBQA 3UDFA 5DTSA 3ZVWA 3BFEA 3A3FA 3ZDJA 3LEZA 3VSKA 5TGFA 4QHCA 3VOYA 2HP9A 4LENA 2WGVA 1GHPA 1MPLA 3W4QA 5EOEA 3HUMA 4Z9QA 3NIAA 2Y2JA 1EI5A 4GDBA 4PPRA 5KMWA 2EFXA 3LCEA 2HDRA 5AQ9A 3VFHA 4DKIA 2R9XA 3QHYA 1ESIA 4JKTA 5FATA 5CRFA 5L2FA 3BM6A 4E3LA 5CECA 4OPZA 5EUAA 1BLSA 4R1GA 3A3EA 1DJCA 1XGIA 5DTKA 1I2WA 2I72A 5FI7A 5M1AA 4C75A 5HAQA 4GZBA 4ZJ3A 1CI9A 4OOLA 4E6WA 5EVID 3FV7A 5FASA 1EWZA 4JXGA 4WYYA 1GCEA 5DVAA 3Q7ZA 1O7EA 4GD6A 3V5MA 1KGFA 3EQUA 1K56A 3PBOA 4K91A 5HARA 4R4SA 3TSGA 1KE0A 3SOIA 4C3QA 4PM5A 3FZCA 4M3KA 3NDEA 3S1YA 4DXCA 1K6RA 3WRZA 1PIOA 1YLWA 4MBHA 4GD8A 4UHUA 1KDWA 1IELA 3BRMA 4KZBA 3HLWA 5GHZA 5DF9A 5DF8A 2HP6A 4PM6A 5FA7A 2ZC5B 2HDQA 3M2KA 3MZFA 1KDSA 1NRFA 3A3JA 1KE4A 2XFTA 3OPHA 2A49A 2UWXA 4KZ3A 3UPPA 3EQVA 3SH7A 5FQQA 2DNSA 3UY6A 1LLBA 1ONHA 1IYPA 3BYDA 1YLYA 2ZJ9A 3LY3A 2ZQAA 3CZDA 3TOIA 4EQIA 4WMCA 1NZUA 2ZQ8A 4UAAA 2OSUA 3W4PA 1JWZA 1NJ4A 1W5DA 1YMXA 4B88A 5A92A 3IF5A 1HZOA 5CGSA 3W4OA 3IWQA 4B4ZA 2Q9MA 3MKFA 3VMAA 2IWDA 4FH4A 4IEDA 2OV5A 4UA6A 1TDGA 4OP5A 4RA7A 2WKEA 4S2NC 3GMWA 3PBNA 4QB8A 1W79A 3BFCA 2Y2PA 4HBUA 3UE3A 3SS3A 1RGZA 2FFFB 3ZCZA 4DE0A 1W7FA 5A90A 3PAGA 4CPKA 5IHVA 3M6BA 1K4FA 3IF6A 4R4RA 1FSWA 2EX9A 1BLCA 2VGJA 1N4OA 4IBXA 2A3UA 4KZAA 3N7WA 2V1ZA 4DRTA 3BLSA 4NK3A 1GHIA 5A91A 4IVKA 1E3UA 1KE3A 3ZG9B 3TG9A 1MKIA 4X68A 5CEDA 4WBGA 2J9PA 2ZMAA 3ZG5A 3NC8A 4RYEA 3G32A 3UE0A 4JXWA 3AGEA 4XUXA 1K54A 3N8RA 3PBTA 4MBFA 1XA1A 2CC1A 3S22A 4EBLA 3E2KA 4DE3A 1HTZA 4DF6A 1MWUA 4N9LA 4LV2A 4OQ0A 2Y4AA 3G30A 3HVFA 4WELA 2ZC6B 5F1GA 2JBFA 3IF6C 4C6YA 3NDGA 4B4XA 3IXBA 4KG5A 3P98A 3Q81A 4ZBEA 3ZHHA 5CHJA 1LI9A 4NETA 2WADA 2IWCA 2QZ6A 3VOZA 1IYSA 4UA7A 1CEFA 1FR1A 1LL5A 3UO9A 1PI5A 1C3BA 3MXSA 4N1XA 5DF7A 5HW3A 5JYPA 5J8XA 4QY6A 4BD0A 5HAIA 5FQMA 3BECA 1PZOA 2Y2MA 1BLHA 3C4OA 2J8YA 1K54C 2XF3A 3ZG0A 1K38A 3SH9A 3WRTA 3OCLA 5F82A 1WE4A 1MWRA 3RXXA 4DDYA 2XH9A 5KSCA 4OLDA 2Y91A 2XQZA 2HDSA 2WKIA 3Q7VA 4OOYA 3VSLA 1PYYA 4WM9A 4R3BA 1BZAA 3HLBA 5I94A 3HL9A 4LV3A 3ZNTA 5EVIA 3PAEA 1QMEA 5FI6A 5E2HA 1CK3A 2HP5A 4QU3A 1H8ZA 3G31A 3NY4A 3G35A 3IXHA 4S2JA 4EBNA 2HDUA 5EECA 1G68A 5FAQA 1RGYA 5AQ7A 3GSGA 1LI0A 2EX2A 3G2ZA 5JYOA 1IEMA 4GB7A 3V3RA 4QD4A 1BTLA 2R9WA 4LCMA 4P6BA 1ZG4A 3BLMA 5AQAA 4P87A 5HL1A 3IH9A 4HEFA 2H0TA 3Q07A 1ZKJA 5CGWA 1SKFA 5GLCA 3ZFZA 4MBKA 4KZ9A 1VM1A 2QPNA 3WS4A 1FQGA 3LO7A 4OPQA 1SHVA 5EVIC 2Q9NA 2ZM0A 3W8KA 1LHYA 4S2LA 5E2FA 1FCOA 5EPHA 5GLAA 3FWLA 2EX8A 3V3SA 3ZVTA 5HAPA 3O3VA 1PW1A 1IKIA 2PBYA 3WS5A 2Y2LA 3NCKA 1Z6FA 2WZXA 5CHMA 3IWOA 2DCFA 5TFQA 3IHBA 1ZC2A 3MZDA 4ID4A 4S2MA 4KG6A 5FDHA 5HFOA 4S2NA 3DWZA 3NBLA 4EBPA 4ZAMA 2ZM2A 2ZQDA 4BL2A 1MY8A 2V2FF 1YMSA 4XXRA 4A5RA 4RX3A 3DWKA 3CJMA 1XA7A 3IHAA 1K57A 2OLVA 3MZEA 4OPRA 3ZG8B 1ES4A 2XLNA 3GVBA 2EX6A 2RL3A 3N8SA 1PW8A 3FYZA 3WS0A 2WGWB 1ALQA 5CXWA 1K56D 1VQQA 3UN7A 4BD1A 4LV0A 2G2UA 4YFMA 3BFGA 4P0MA 4PM8A 4DDSA 4ZDXA 3PBSA 3OCNA 4HBTA 1GA9A 3VP3A 1S0WA 1NXYA 2Z2LB 4JF4A 5F83A 1YQSA 5KSHA 5FQJA 1K57C 3N8LA 5CGXA 5M18A 4E3OA 1XKZA 4X6TA 1H8YA 1FCMA 2P74A 2XD5A 1J9MA 1MWSA 1TDLA 3ITBA 4GOGA 4CJNA 1JVJA 2B5RA 5AQBA 4S2IA 3ZNYA 3Q7VB 4WEKA 3DTMA 1GA0A 1OMEA 2EXBA 4RVAA 4R23A 1IYQA 4FH2A 5CHUA 3HUNA 3LY4A 1YLJA 3A3IA 2PU2A 1L0GA 1ZG6A 4WMCD 2Y2KA 1Q2PA 3BEBA 3C7UA 3G2YA 3SS5A 2C6WB 4WEJA 3MXRA 2DRWA 4ZTKA 4E6XA 1JTGA 4KZ8A 3V39A 3VFFA 3N4IA 1G6AA 2OLUA 5E43A 3WS2A 1XX2A 4OQGA 1ERQA 2VGKA 3ITAA 3VP1A 3OPRA 5FI2A 4YINA 4RX2A 3AGFA 2RCXA 4OLGA 1XGJA 1QMFA 4FCFA 5GHYA 2ZLYA 2J9OA 1YM1A 3C4PA 2WZZA 1DJBA 4GDNA 2V20A 1L2SA 4BQMA 4KZ7A 1JTDA 2P9VA 4EV4A 1CEGA 1KGGA 4DXBA 2BG1A 1M6KA 3BFFA 4E3JA 4P85A 2BLSA 1E3UD 2G2WA 2WAEA 2IWBA 1N9BA 1EROA 3O88A 5FSRA 4Y0TA 1IKGA 2WYXA 3B3XA 1FSYA 5GLDA 4QJGA 4S2OA 4JLFA 4JBFA 4FSFA 3O86A 3OC2A 2ZD8A 1ESUA 3MFDA 3N6IA 1E4DA 1YLZA 1BT5A 1NYYA 4QY5A 2XEPA 3HLCA 2JCHA 4JF6A 1K6SA 3FKWA 4GNUA 1SDNA 2E8IA 3BFDA 3UNWA 1PWDA 4PMAA 4OONA 4BL3A 5G18A 1JWVA 5CTMA 1BSGA 2XK1A 4KQQA 4ZJ1A 3CG5A 2FFYA 1M40A 3WS1A 4HESA 3S4XA 2Y2OA 4GKUA 2EFUA 2Y55A 3DW0A 1MXOA 1TVFA 1FR6A 5GHXA 4U0TA 1L0FA 2PU4A 3HLGA 4U3TA 5E2EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M19 A;  5EVL A;  1O07 A;  1YLT A;  4Q8I A;  5KZH A;  4OQI A;  1HD8 A;  2EXA A;  3GV9 A;  4KEN B;  4E3M A;  3GTC A;  1ES2 A;  4KZ6 A;  4MNR A;  3ZG7 B;  2WKH A;  3FKV A;  3M6H A;  1XPB A;  1XXM A;  2XD1 A;  3C5A A;  4H8R A;  4U0X A;  3HLD A;  4KQR A;  4KZ5 A;  5GLB A;  3IF6 B;  3E2L A;  3CMZ A;  1Y54 A;  3OZH A;  5FAO A;  2XGN A;  4OVD A;  3HLF A;  2C5W B;  5A93 A;  1ES5 A;  1ONG A;  2Y2H A;  4WZ5 A;  4DE2 A;  3O87 A;  4N9K A;  1CI8 A;  3VP2 A;  3SS4 A;  4EWF A;  3IXG A;  3QNB A;  1K55 A;  3G4P A;  1RP5 A;  4X56 A;  4E3I A;  4JXS A;  2H10 A;  3QNC A;  2WK0 A;  4Y0U A;  4JPM A;  5EE8 A;  4S2P A;  1MBL A;  3GQZ A;  1JWP A;  1S6R A;  2JC7 A;  1BUL A;  4S2K A;  4WZ4 A;  3IT9 A;  1W8Y A;  4OOM A;  1I2S A;  2ZC3 B;  1BUE A;  1XP4 A;  1I5Q A;  1L0E A;  1PI4 A;  5GL9 A;  2Y59 A;  4E3N A;  4R0Q A;  2ZQ9 A;  1YT4 A;  2X71 A;  4IVI A;  1K25 A;  3PTE A;  1PZP A;  3A3D A;  1TEM A;  2Y2G A;  3UPN A;  1W8Q A;  2WGI A;  4N92 A;  3C7V A;  3D4F A;  3IXD A;  1HVB A;  4OQH A;  4WZ5 C;  3HBR A;  3M2J A;  3P09 A;  1K55 C;  5FAP A;  1GHM A;  4KG2 A;  3ISG A;  2P9V B;  4KQO A;  4PM7 A;  3UE1 A;  2X01 A;  4MEZ A;  3WWX A;  4BLM A;  1RCJ A;  3G34 A;  2H5S A;  3AGD A;  4PM9 A;  2ZQ7 A;  3RJU A;  1KVL A;  3MKE A;  4K0X A;  4UA9 A;  3MBZ A;  2Y2I A;  2X02 A;  4OH0 A;  4Y7P A;  1FCN A;  2Y2N A;  5DTT A;  5D3O A;  3VP4 A;  1NZO A;  3ZGA B;  2Z2M B;  3UDI A;  2J7V A;  3OPL A;  3OPP A;  1WYC A;  1BLP A;  4D2O A;  4R3J A;  5EVI B;  4F94 A;  1DY6 A;  1U60 A;  5E2G A;  1YLP A;  1LL9 A;  4FD8 A;  5EOO A;  3NI9 A;  1ES3 A;  5FQI A;  3IWI A;  2GDN A;  1NYM A;  3GRJ A;  3SH8 A;  3UPO A;  4JF5 A;  1WYB A;  4E3K A;  4IBR A;  2QMI A;  2Y2Q A;  4XUZ A;  4OKP A;  1SDE A;  4K0W A;  3HUO A;  1DJA A;  1MWT A;  2ZC4 B;  2H0Y A;  5CER A;  2XR0 A;  4X69 A;  1H5X A;  1KGE A;  3UDX A;  3Q1F A;  3Q82 A;  5F1F A;  5FQ9 A;  5FQK A;  5CEB A;  4Y0O A;  5TR7 A;  5U47 A;  2XFS A;  4ZJ2 A;  3VP0 A;  2JE5 A;  1SCW A;  4OP8 A;  4EUZ A;  1ERM A;  4X53 A;  1PWG A;  2WGW A;  1FOF A;  4MLL A;  2XDM A;  3IQA A;  5HX9 A;  1IYO A;  1AXB A;  1PWC A;  2HPB A;  1NY0 A;  1L0D A;  3HLE A;  3HRE A;  1K4E A;  3JYI A;  4L0L A;  2WUQ A;  4LCL A;  2ZM8 A;  4LV1 A;  2ZC7 A;  5CTN A;  1Q2Q A;  4X55 A;  4BEN A;  3I7J A;  3PBR A;  3V50 A;  4DE1 A;  3GR2 A;  4N1H A;  4OPY A;  4JXV A;  4BJP A;  3RXW A;  4KZ4 A;  1KVM A;  3IH8 A;  4O7D A;  1E25 A;  2WAF A;  5BOH A;  4GN2 A;  2ZQC A;  3PBQ A;  3UDF A;  5DTS A;  3ZVW A;  3BFE A;  3A3F A;  3ZDJ A;  3LEZ A;  3VSK A;  5TGF A;  4QHC A;  3VOY A;  2HP9 A;  4LEN A;  2WGV A;  1GHP A;  1MPL A;  3W4Q A;  5EOE A;  3HUM A;  4Z9Q A;  3NIA A;  2Y2J A;  1EI5 A;  4GDB A;  4PPR A;  5KMW A;  2EFX A;  3LCE A;  2HDR A;  5AQ9 A;  3VFH A;  4DKI A;  2R9X A;  3QHY A;  1ESI A;  4JKT A;  5FAT A;  5CRF A;  5L2F A;  3BM6 A;  4E3L A;  5CEC A;  4OPZ A;  5EUA A;  1BLS A;  4R1G A;  3A3E A;  1DJC A;  1XGI A;  5DTK A;  1I2W A;  2I72 A;  5FI7 A;  5M1A A;  4C75 A;  5HAQ A;  4GZB A;  4ZJ3 A;  1CI9 A;  4OOL A;  4E6W A;  5EVI D;  3FV7 A;  5FAS A;  1EWZ A;  4JXG A;  4WYY A;  1GCE A;  5DVA A;  3Q7Z A;  1O7E A;  4GD6 A;  3V5M A;  1KGF A;  3EQU A;  1K56 A;  3PBO A;  4K91 A;  5HAR A;  4R4S A;  3TSG A;  1KE0 A;  3SOI A;  4C3Q A;  4PM5 A;  3FZC A;  4M3K A;  3NDE A;  3S1Y A;  4DXC A;  1K6R A;  3WRZ A;  1PIO A;  1YLW A;  4MBH A;  4GD8 A;  4UHU A;  1KDW A;  1IEL A;  3BRM A;  4KZB A;  3HLW A;  5GHZ A;  5DF9 A;  5DF8 A;  2HP6 A;  4PM6 A;  5FA7 A;  2ZC5 B;  2HDQ A;  3M2K A;  3MZF A;  1KDS A;  1NRF A;  3A3J A;  1KE4 A;  2XFT A;  3OPH A;  2A49 A;  2UWX A;  4KZ3 A;  3UPP A;  3EQV A;  3SH7 A;  5FQQ A;  2DNS A;  3UY6 A;  1LLB A;  1ONH A;  1IYP A;  3BYD A;  1YLY A;  2ZJ9 A;  3LY3 A;  2ZQA A;  3CZD A;  3TOI A;  4EQI A;  4WMC A;  1NZU A;  2ZQ8 A;  4UAA A;  2OSU A;  3W4P A;  1JWZ A;  1NJ4 A;  1W5D A;  1YMX A;  4B88 A;  5A92 A;  3IF5 A;  1HZO A;  5CGS A;  3W4O A;  3IWQ A;  4B4Z A;  2Q9M A;  3MKF A;  3VMA A;  2IWD A;  4FH4 A;  4IED A;  2OV5 A;  4UA6 A;  1TDG A;  4OP5 A;  4RA7 A;  2WKE A;  4S2N C;  3GMW A;  3PBN A;  4QB8 A;  1W79 A;  3BFC A;  2Y2P A;  4HBU A;  3UE3 A;  3SS3 A;  1RGZ A;  2FFF B;  3ZCZ A;  4DE0 A;  1W7F A;  5A90 A;  3PAG A;  4CPK A;  5IHV A;  3M6B A;  1K4F A;  3IF6 A;  4R4R A;  1FSW A;  2EX9 A;  1BLC A;  2VGJ A;  1N4O A;  4IBX A;  2A3U A;  4KZA A;  3N7W A;  2V1Z A;  4DRT A;  3BLS A;  4NK3 A;  1GHI A;  5A91 A;  4IVK A;  1E3U A;  1KE3 A;  3ZG9 B;  3TG9 A;  1MKI A;  4X68 A;  5CED A;  4WBG A;  2J9P A;  2ZMA A;  3ZG5 A;  3NC8 A;  4RYE A;  3G32 A;  3UE0 A;  4JXW A;  3AGE A;  4XUX A;  1K54 A;  3N8R A;  3PBT A;  4MBF A;  1XA1 A;  2CC1 A;  3S22 A;  4EBL A;  3E2K A;  4DE3 A;  1HTZ A;  4DF6 A;  1MWU A;  4N9L A;  4LV2 A;  4OQ0 A;  2Y4A A;  3G30 A;  3HVF A;  4WEL A;  2ZC6 B;  5F1G A;  2JBF A;  3IF6 C;  4C6Y A;  3NDG A;  4B4X A;  3IXB A;  4KG5 A;  3P98 A;  3Q81 A;  4ZBE A;  3ZHH A;  5CHJ A;  1LI9 A;  4NET A;  2WAD A;  2IWC A;  2QZ6 A;  3VOZ A;  1IYS A;  4UA7 A;  1CEF A;  1FR1 A;  1LL5 A;  3UO9 A;  1PI5 A;  1C3B A;  3MXS A;  4N1X A;  5DF7 A;  5HW3 A;  5JYP A;  5J8X A;  4QY6 A;  4BD0 A;  5HAI A;  5FQM A;  3BEC A;  1PZO A;  2Y2M A;  1BLH A;  3C4O A;  2J8Y A;  1K54 C;  2XF3 A;  3ZG0 A;  1K38 A;  3SH9 A;  3WRT A;  3OCL A;  5F82 A;  1WE4 A;  1MWR A;  3RXX A;  4DDY A;  2XH9 A;  5KSC A;  4OLD A;  2Y91 A;  2XQZ A;  2HDS A;  2WKI A;  3Q7V A;  4OOY A;  3VSL A;  1PYY A;  4WM9 A;  4R3B A;  1BZA A;  3HLB A;  5I94 A;  3HL9 A;  4LV3 A;  3ZNT A;  5EVI A;  3PAE A;  1QME A;  5FI6 A;  5E2H A;  1CK3 A;  2HP5 A;  4QU3 A;  1H8Z A;  3G31 A;  3NY4 A;  3G35 A;  3IXH A;  4S2J A;  4EBN A;  2HDU A;  5EEC A;  1G68 A;  5FAQ A;  1RGY A;  5AQ7 A;  3GSG A;  1LI0 A;  2EX2 A;  3G2Z A;  5JYO A;  1IEM A;  4GB7 A;  3V3R A;  4QD4 A;  1BTL A;  2R9W A;  4LCM A;  4P6B A;  1ZG4 A;  3BLM A;  5AQA A;  4P87 A;  5HL1 A;  3IH9 A;  4HEF A;  2H0T A;  3Q07 A;  1ZKJ A;  5CGW A;  1SKF A;  5GLC A;  3ZFZ A;  4MBK A;  4KZ9 A;  1VM1 A;  2QPN A;  3WS4 A;  1FQG A;  3LO7 A;  4OPQ A;  1SHV A;  5EVI C;  2Q9N A;  2ZM0 A;  3W8K A;  1LHY A;  4S2L A;  5E2F A;  1FCO A;  5EPH A;  5GLA A;  3FWL A;  2EX8 A;  3V3S A;  3ZVT A;  5HAP A;  3O3V A;  1PW1 A;  1IKI A;  2PBY A;  3WS5 A;  2Y2L A;  3NCK A;  1Z6F A;  2WZX A;  5CHM A;  3IWO A;  2DCF A;  5TFQ A;  3IHB A;  1ZC2 A;  3MZD A;  4ID4 A;  4S2M A;  4KG6 A;  5FDH A;  5HFO A;  4S2N A;  3DWZ A;  3NBL A;  4EBP A;  4ZAM A;  2ZM2 A;  2ZQD A;  4BL2 A;  1MY8 A;  2V2F F;  1YMS A;  4XXR A;  4A5R A;  4RX3 A;  3DWK A;  3CJM A;  1XA7 A;  3IHA A;  1K57 A;  2OLV A;  3MZE A;  4OPR A;  3ZG8 B;  1ES4 A;  2XLN A;  3GVB A;  2EX6 A;  2RL3 A;  3N8S A;  1PW8 A;  3FYZ A;  3WS0 A;  2WGW B;  1ALQ A;  5CXW A;  1K56 D;  1VQQ A;  3UN7 A;  4BD1 A;  4LV0 A;  2G2U A;  4YFM A;  3BFG A;  4P0M A;  4PM8 A;  4DDS A;  4ZDX A;  3PBS A;  3OCN A;  4HBT A;  1GA9 A;  3VP3 A;  1S0W A;  1NXY A;  2Z2L B;  4JF4 A;  5F83 A;  1YQS A;  5KSH A;  5FQJ A;  1K57 C;  3N8L A;  5CGX A;  5M18 A;  4E3O A;  1XKZ A;  4X6T A;  1H8Y A;  1FCM A;  2P74 A;  2XD5 A;  1J9M A;  1MWS A;  1TDL A;  3ITB A;  4GOG A;  4CJN A;  1JVJ A;  2B5R A;  5AQB A;  4S2I A;  3ZNY A;  3Q7V B;  4WEK A;  3DTM A;  1GA0 A;  1OME A;  2EXB A;  4RVA A;  4R23 A;  1IYQ A;  4FH2 A;  5CHU A;  3HUN A;  3LY4 A;  1YLJ A;  3A3I A;  2PU2 A;  1L0G A;  1ZG6 A;  4WMC D;  2Y2K A;  1Q2P A;  3BEB A;  3C7U A;  3G2Y A;  3SS5 A;  2C6W B;  4WEJ A;  3MXR A;  2DRW A;  4ZTK A;  4E6X A;  1JTG A;  4KZ8 A;  3V39 A;  3VFF A;  3N4I A;  1G6A A;  2OLU A;  5E43 A;  3WS2 A;  1XX2 A;  4OQG A;  1ERQ A;  2VGK A;  3ITA A;  3VP1 A;  3OPR A;  5FI2 A;  4YIN A;  4RX2 A;  3AGF A;  2RCX A;  4OLG A;  1XGJ A;  1QMF A;  4FCF A;  5GHY A;  2ZLY A;  2J9O A;  1YM1 A;  3C4P A;  2WZZ A;  1DJB A;  4GDN A;  2V20 A;  1L2S A;  4BQM A;  4KZ7 A;  1JTD A;  2P9V A;  4EV4 A;  1CEG A;  1KGG A;  4DXB A;  2BG1 A;  1M6K A;  3BFF A;  4E3J A;  4P85 A;  2BLS A;  1E3U D;  2G2W A;  2WAE A;  2IWB A;  1N9B A;  1ERO A;  3O88 A;  5FSR A;  4Y0T A;  1IKG A;  2WYX A;  3B3X A;  1FSY A;  5GLD A;  4QJG A;  4S2O A;  4JLF A;  4JBF A;  4FSF A;  3O86 A;  3OC2 A;  2ZD8 A;  1ESU A;  3MFD A;  3N6I A;  1E4D A;  1YLZ A;  1BT5 A;  1NYY A;  4QY5 A;  2XEP A;  3HLC A;  2JCH A;  4JF6 A;  1K6S A;  3FKW A;  4GNU A;  1SDN A;  2E8I A;  3BFD A;  3UNW A;  1PWD A;  4PMA A;  4OON A;  4BL3 A;  5G18 A;  1JWV A;  5CTM A;  1BSG A;  2XK1 A;  4KQQ A;  4ZJ1 A;  3CG5 A;  2FFY A;  1M40 A;  3WS1 A;  4HES A;  3S4X A;  2Y2O A;  4GKU A;  2EFU A;  2Y55 A;  3DW0 A;  1MXO A;  1TVF A;  1FR6 A;  5GHX A;  4U0T A;  1L0F A;  2PU4 A;  3HLG A;  4U3T A;  5E2E A; 
#chains in the Genus database with same CATH topology
 3BWL A;  1YLT A;  4BBT A;  4EQ1 A;  4XT2 A;  4KEN B;  4E3M A;  3PHY A;  1W63 M;  4MNR A;  3C5A A;  3HLD A;  4KZ5 A;  3IF6 B;  3HLF A;  3LIB A;  1ES5 A;  1ONG A;  2Y2H A;  4DE2 A;  1T19 A;  3VP2 A;  3LIF A;  3G4P A;  1RP5 A;  4JXS A;  4LRY C;  5TBM B;  4Y0U A;  4S2P A;  1S6R A;  2JC7 A;  4S2K A;  4WZ4 A;  2V8C A;  3T12 B;  4HI4 A;  5GL9 A;  2ZQ9 A;  2X71 A;  4IVI A;  1OT6 A;  1TEM A;  2Y2G A;  3A3D A;  3UPN A;  3LUQ A;  3IXD A;  4OQH A;  2VLG A;  2PRF A;  3HBR A;  3C38 A;  3M2J A;  3P09 A;  1CF0 A;  4HP9 A;  3VOL A;  4HH2 A;  1EW0 A;  3MS6 A;  3VE4 A;  4BLM A;  1LSV A;  3MBZ A;  4AFI A;  1Y4O A;  2Z2M B;  3UDI A;  1WYC A;  1YLP A;  3NI9 A;  1NYM A;  3GRJ A;  3TRC A;  3UPO A;  3SZT A;  4YNR A;  2Y2Q A;  5CER A;  2XA7 S;  4X69 A;  1H5X A;  1DRM A;  2O9C A;  2XFS A;  3LIC A;  2V1B A;  3VP0 A;  2JE5 A;  1FIL A;  3OLO A;  4EUZ A;  1FOF A;  4MLL A;  1ZTU A;  3HRE A;  2HPB A;  1NY0 A;  3HLE A;  4D60 A;  2ZC7 A;  3A0S A;  3T4Q A;  3PBR A;  3BY9 A;  3RXW A;  1KVM A;  3EEA A;  4O7D A;  1E25 A;  2CMN A;  4G3V A;  3UDF A;  3ZVW A;  4ARZ A;  3LEZ A;  1KOU A;  4P6Z S;  5TGF A;  1S1Z A;  4QHC A;  3VOY A;  3S7N A;  5HSQ A;  5J7E A;  2AVX A;  5IU1 A;  3DTE A;  3D9Y A;  2EFX A;  3LCE A;  3QHY A;  1ESI A;  4JKT A;  1VHM A;  5CRF A;  3BM6 A;  5EUA A;  4ESP A;  2JN7 A;  1BLS A;  3A3E A;  1XGI A;  5HAQ A;  4GZB A;  3H7W A;  4OOL A;  4JXG A;  4WYY A;  5HWT A;  5DVA A;  3UB6 A;  4K91 A;  4R4S A;  3H82 A;  1KE0 A;  3FZC A;  4UEY A;  2O9B A;  3S1Y A;  4DXC A;  4LRX C;  3WRZ A;  3KX0 X;  4KZB A;  2BAS A;  2HP6 A;  5FA7 A;  2ZC5 B;  1LSW A;  2HDQ A;  4PKY G;  4LFU A;  3A0R A;  3C8C A;  4EEP A;  2OAP 1;  2UWX A;  2QKP A;  3EQV A;  2O9A A;  3LI8 A;  1YLY A;  2ZQA A;  4EQI A;  3TOI A;  2ZQ8 A;  1JWZ A;  3IF5 A;  4LPZ A;  5CGS A;  4PHT A;  3MKF A;  2IWD A;  4UA6 A;  4RA7 A;  2WKE A;  4H6J B;  4HBU A;  2INW A;  4DE0 A;  1W7F A;  3MQO A;  1K4F A;  1FSW A;  1N4O A;  4G3K A;  4KZA A;  1GHI A;  5A91 A;  4IVK A;  4IHQ A;  1YAX A;  4X68 A;  2J9P A;  2JKF A;  3AGE A;  1K54 A;  2CC1 A;  3S22 A;  3E2K A;  4DE3 A;  1HTZ A;  3PYP A;  4F3L B;  2Y4A A;  3CWF A;  4WEL A;  4XT2 B;  4KG5 A;  3P98 A;  3Q81 A;  3KSG A;  5HL6 A;  1T18 A;  3UE6 A;  3KYQ A;  3KYZ A;  5HW3 A;  5JYP A;  1G6O A;  5HAI A;  1PZO A;  1K54 C;  3FPW A;  4RQ9 A;  3RXX A;  5KSC A;  2XQZ A;  3BQ8 A;  5K5B A;  1PFL A;  2BTF P;  4R3B A;  2HJ9 C;  2KLI A;  1CK3 A;  2HP5 A;  4QU3 A;  3IS2 A;  1RGY A;  3GSG A;  3G2Z A;  5HL1 A;  5CGW A;  1SKF A;  3WS4 A;  2QPN A;  3TE8 A;  1FQG A;  1F9I A;  3W8K A;  5E2F A;  3ZVT A;  4GHI A;  2WKP A;  3DBA A;  3T1R A;  2DCF A;  5TFQ A;  5HZH A;  2HJE A;  3MZD A;  2K31 A;  5FDH A;  5J4E A;  4S2N A;  3IX4 A;  2PYP A;  2ZQD A;  4BL2 A;  1L3L A;  1MY8 A;  1NWZ A;  2XLN A;  3N8S A;  4GW9 A;  5EV0 A;  2LB5 A;  4DDS A;  2EWW A;  1MC0 A;  3VP3 A;  1TS7 A;  5CGX A;  4ARZ B;  3MFX A;  1JVJ A;  4S2I A;  5HWW A;  1OME A;  4R23 A;  5IS1 A;  4FH2 A;  3NUL A;  3HUN A;  3LY4 A;  3A3I A;  1H0M A;  1Q2P A;  3C7U A;  3MXR A;  1JTG A;  2OLU A;  5HPF A;  3VP1 A;  3H7W B;  4HP4 A;  2QHK A;  3AGF A;  4OLG A;  1XGJ A;  4FCF A;  2ACG A;  2J3T C;  3DTK A;  3C4P A;  3H82 B;  4LGW A;  4GDN A;  5AVF A;  4Y2F A;  2Y8H A;  4KZ7 A;  4UQI S;  5DKK A;  4P85 A;  2VK3 A;  1XJ4 A;  2WAE A;  1N9L A;  2IWB A;  5FSR A;  1IKG A;  5FEF A;  3P01 A;  1OTD A;  3OC2 A;  2A24 A;  1E4D A;  3BQA A;  2PHY A;  4DMZ A;  3H9W A;  1SDN A;  3CUE A;  4WN5 A;  4HJ4 A;  4IUK A;  3CG5 A;  3NOP C;  2Y2O A;  3MJQ A;  1L0F A;  3HLG A;  2FH5 A;  5E2E A;  5GLB A;  2J80 A;  3U4L P;  4Q8I A;  1HD8 A;  3GV9 A;  1UWP X;  1ES2 A;  4KZ6 A;  1G5U A;  3FKV A;  1XPB A;  1XXM A;  2XD1 A;  2ZMV A;  1Y54 A;  3OZH A;  5A93 A;  2ZMF A;  3EEH A;  4WZ5 A;  3IXG A;  3QNB A;  1OTA A;  4X56 A;  4E3I A;  3RTY A;  2WK0 A;  5EE8 A;  1MBL A;  4OOM A;  1W8Y A;  2QWS A;  2ZC3 B;  1BUE A;  1HLU P;  1PI4 A;  4R0Q A;  2QJ7 A;  3A0V A;  4B93 A;  3PTE A;  4X25 A;  1VEU A;  3T4O A;  4N92 A;  1W63 Q;  4WZ5 C;  3R4K A;  3CLO A;  3NJA A;  1F5M A;  2XSS A;  3UE1 A;  2VJW A;  4L9G A;  3NOT C;  5F6A A;  2ZQ7 A;  3RJU A;  3ICY A;  1KVL A;  3MKE A;  2Y2I A;  4EXO A;  1LSX A;  1NZO A;  3ZGA B;  3OPP A;  4R3J A;  1DY6 A;  1ODV A;  1U60 A;  5E2G A;  5EOO A;  3MSH A;  4JF5 A;  4YOF A;  4K0W A;  1DJA A;  5AJG A;  2ZC4 B;  2H0Y A;  4II7 A;  5FQ9 A;  5TR7 A;  4ZJ2 A;  1SCW A;  4OP8 A;  1ERM A;  1XFQ A;  3IQA A;  1IYO A;  1PWC A;  4LV1 A;  4LCL A;  1Q2Q A;  4GHI B;  2LB9 A;  2JKR I;  4H6J A;  2VGL M;  4OPY A;  2VX8 A;  3NHQ A;  3IH8 A;  3NOU C;  5BOH A;  4GN2 A;  4Q0J A;  3RFB A;  2P04 A;  3VSK A;  3T4T A;  2HP9 A;  4LEN A;  1GHP A;  4Z9Q A;  2Y2J A;  4GDB A;  4PPR A;  4R6L A;  4DKI A;  2R9X A;  4BMW A;  4NKP A;  5FAT A;  4I39 A;  1ACF A;  4F3L A;  1K0K A;  4R1G A;  2I72 A;  5M1A A;  4QPR A;  3JVV A;  4ZJ3 A;  1CI9 A;  1EWZ A;  3EOI A;  2W3D A;  3PBO A;  5HAR A;  4C3Q A;  3E0Y A;  1PIO A;  1YLW A;  4MDZ A;  1YSQ A;  1KDW A;  3PR6 A;  3HLW A;  5GHZ A;  3T1X A;  5DF8 A;  3M2K A;  1P0Z A;  2A49 A;  4KZ3 A;  1TF1 A;  3UPP A;  1ONH A;  5CX7 A;  1IYP A;  2ZJ9 A;  3CZD A;  1NZU A;  4UAA A;  4FUW A;  2JKT M;  2OSU A;  1NJ4 A;  4B88 A;  2W1T A;  1HZO A;  4B4Z A;  3VMA A;  2OV5 A;  2GX5 A;  1TDG A;  2ZL1 B;  3SS3 A;  4WL9 A;  3E4O A;  2A24 B;  4BWI A;  4L9E A;  4B9O A;  4DRT A;  1KE3 A;  3ZG9 B;  4JGP A;  1MKI A;  5CED A;  4WBG A;  2ZMA A;  3TJZ C;  3ZG5 A;  3CHW P;  4JXW A;  4XUX A;  3N8R A;  4MBF A;  3D3O A;  4EBL A;  1GSX A;  4DF6 A;  4LV2 A;  3HVF A;  2J3T D;  5F1G A;  2JBF A;  2Y79 A;  5CHJ A;  1LI9 A;  4NET A;  3UB8 A;  2QZ6 A;  3B42 A;  4UA7 A;  1LL5 A;  1PI5 A;  3L9K A;  3MXS A;  2UV0 E;  4N1X A;  5DF7 A;  5FQM A;  2Y2M A;  1BLH A;  3C4O A;  2J8Y A;  3ZG0 A;  2EWV A;  3WRT A;  3OCL A;  2Y91 A;  2HDS A;  4WM9 A;  2VEA A;  3HL9 A;  4LV3 A;  3ZNT A;  5EVI A;  2NUT C;  1H8Z A;  3G31 A;  2ZOI A;  1XJ6 A;  3NY4 A;  2PD8 A;  2PDR A;  2VA0 A;  1VEU B;  1G68 A;  4KQD A;  4MN6 A;  3FPV A;  1BTL A;  2R9W A;  4LCM A;  4P6B A;  3BLM A;  5AQA A;  4HEF A;  4OPQ A;  2V8F A;  1SHV A;  5EVI C;  2ZM0 A;  5TJJ A;  1OTB A;  3V3S A;  3O3V A;  2J3W A;  1IKI A;  3UB5 P;  3NCK A;  3MF0 A;  1Z6F A;  4HOI A;  5CHM A;  3IWO A;  1FIK A;  3EWK A;  3IHB A;  4O8G A;  2O0Y A;  4ZAM A;  4BBV A;  2ZM2 A;  1DP8 A;  2PBD P;  3MQQ A;  1XA7 A;  3ZG8 B;  1ES4 A;  2B95 A;  3GVB A;  1S1Y A;  1PW8 A;  3UB7 A;  2OWJ A;  5CXW A;  2OOL A;  3UN7 A;  4BD1 A;  4X1L A;  4ZDX A;  3OCN A;  4HBT A;  4PAU A;  3GEC A;  5FQJ A;  2ZBB A;  2QYB A;  1BYW A;  4E3O A;  1H8Y A;  3JVU A;  2XD5 A;  4CJN A;  4R70 A;  3JPU A;  2EXB A;  5FDS A;  2Z6D A;  1V9Z A;  2PU2 A;  1P97 A;  3SS5 A;  4ZTK A;  4KZ8 A;  3V39 A;  1GSW A;  3VFF A;  2L4R A;  1G6A A;  5E43 A;  1XX2 A;  2VGK A;  3OPR A;  5FI2 A;  4YIN A;  4RX2 A;  2RCX A;  2ZLY A;  2J9O A;  1YM1 A;  1DJB A;  4MMN A;  2V20 A;  4EV4 A;  4NEE D;  2L1M A;  2QJ5 A;  1M6K A;  2O99 A;  5HDD A;  3T1S A;  2BLS A;  1E3U D;  1DP9 A;  2HF6 A;  1FSY A;  4QJG A;  1T1C A;  2Q0O A;  4FSF A;  4GCZ A;  3O86 A;  2NUP C;  1YLZ A;  3HLC A;  1PWD A;  5CTM A;  1BSG A;  1MKM A;  2XK1 A;  4KQQ A;  4ZJ1 A;  3T4L A;  2FFY A;  3LIE A;  1M40 A;  4HES A;  2W1T B;  4HIA A;  3S4X A;  4GKU A;  1FR6 A;  5GHX A;  4U0T A;  5M19 A;  5EVL A;  4OQI A;  2EXA A;  3GTC A;  1YKD A;  3ZG7 B;  3M6H A;  4H8R A;  4IJG A;  1DP6 A;  4KQR A;  5HDS A;  3E2L A;  3CMZ A;  1VB6 A;  2YKH A;  4JGO A;  4N9K A;  1CI8 A;  1OJG A;  3SS4 A;  4EWF A;  1IOU A;  1K55 A;  2H10 A;  4NXE A;  5AVE A;  4JPM A;  3FG8 A;  2L0W A;  3QP1 A;  3GQZ A;  1JWP A;  3UB9 A;  1BUL A;  4HHD A;  1I2S A;  1XP4 A;  4ETX A;  1I5Q A;  1L0E A;  5FEG A;  4E3N A;  2W1R A;  1YT4 A;  1K25 A;  2R78 A;  4GLQ A;  1H3Q A;  3D4F A;  1HVB A;  3LGO A;  1K55 C;  4KQO A;  4MEZ A;  3WWX A;  3KO6 A;  1RCJ A;  2H5S A;  4PM9 A;  3LFV A;  3DTI A;  4UA9 A;  4L9F A;  4OH0 A;  4Y7P A;  2Y2N A;  1S4R A;  5D3O A;  3VP4 A;  2J7V A;  3OPL A;  4D2O A;  3S7O A;  5EVI B;  2MJ6 A;  1LL9 A;  4FD8 A;  3E4Q A;  5FQI A;  3IWI A;  2GDN A;  2W3E A;  2W3G A;  4E3K A;  4IBR A;  2QMI A;  4XUZ A;  1SDE A;  3HUO A;  1SKO B;  3UDX A;  4HJ3 A;  1KGE A;  3Q1F A;  5FQK A;  5CEB A;  2WGW A;  3C2W A;  2XDM A;  3IX8 A;  3OOV A;  3JYI A;  1L0D A;  2WUQ A;  3QP5 A;  4X55 A;  4BEN A;  2V0U A;  3I7J A;  3GDI A;  4DE1 A;  2ZL1 A;  4BJP A;  2XA7 M;  1A0K A;  3PBQ A;  4NXF A;  3BFE A;  2D02 A;  2V0W A;  3BY8 A;  1MPL A;  3W4Q A;  3T1Q B;  3HUM A;  1VET A;  1EI5 A;  5KMW A;  1CQA A;  4P6Z M;  3O5Y A;  4OPZ A;  4Y15 A;  1DJC A;  5DTK A;  1I2W A;  2W3H A;  3QP6 A;  5EVE A;  4E6W A;  5EVI D;  5FAS A;  1O7E A;  4GD6 A;  3V5M A;  3EQU A;  3TSG A;  1T1B A;  4PM5 A;  4M3K A;  2G7U A;  1K6R A;  4MN7 A;  4WLA A;  1ZHH B;  4MBH A;  4GD8 A;  3UMD A;  4IUH A;  4LLO B;  4PM6 A;  3LI9 A;  1NRF A;  3A3J A;  1KE4 A;  2XFT A;  3OPH A;  2DNS A;  1LLB A;  5HD3 A;  5DJT A;  3G6O A;  3W4P A;  5HWV A;  5G4Z A;  4WUJ A;  3CPT A;  3W4O A;  4HNB A;  4OP5 A;  2KOI A;  1W79 A;  3BFC A;  1RGZ A;  3ZCZ A;  5C5K A;  1D06 A;  3M6B A;  4R4R A;  5DFX A;  3C30 A;  2A3U A;  4CLC A;  1E3U A;  3TG9 A;  1TS8 A;  3NC8 A;  4RYE A;  3UE0 A;  1D7E A;  5HDC A;  1F98 A;  4NXB A;  1XA1 A;  4NG2 A;  1NRJ A;  1XJ2 A;  4N9L A;  3P7N A;  2ZC6 B;  1S67 L;  3IXB A;  1MZU A;  3KYE A;  4ZBE A;  2WAD A;  2IWC A;  3VOZ A;  1IYS A;  1FR1 A;  4CLC C;  1C3B A;  4R3A A;  1OPX A;  3KSF A;  4I3J A;  2XF3 A;  1K38 A;  3SH9 A;  3DAV A;  5F82 A;  2XH9 A;  4OLD A;  3QP4 A;  2WKI A;  4OOY A;  2JHE A;  3HLB A;  5I94 A;  3PAE A;  2PAV P;  5L09 A;  3LR3 A;  5FI6 A;  5E2H A;  4EEU A;  3ZQ5 A;  1LT0 A;  1LL8 A;  1Y28 A;  4EBN A;  2HDU A;  5EEC A;  5FAQ A;  5G4Y A;  1X0O A;  1GSV A;  1LI0 A;  5JYO A;  4EER A;  3V3R A;  4QD4 A;  4I38 A;  4NXG A;  4P87 A;  3IH9 A;  2H0T A;  1ZKJ A;  3D72 A;  5GLC A;  4MBK A;  1VM1 A;  5FL3 A;  3LO7 A;  2Q9N A;  4QWO A;  1LHY A;  1WA9 A;  3EGX C;  3FWL A;  5F5Y A;  3LIA A;  2PBY A;  4HH3 A;  2Y2L A;  2WZX A;  1ZC2 A;  4ID4 A;  4S2M A;  4KG6 A;  5HFO A;  3NBL A;  2K2N A;  2HZ5 A;  4G3W A;  4Y13 A;  2VV6 A;  3MR0 A;  1N9O A;  1YMS A;  4XXR A;  4A5R A;  4RX3 A;  3IHA A;  1K57 A;  2EX6 A;  2RL3 A;  2WGW B;  1ALQ A;  4R38 A;  3W2Z A;  1K56 D;  1VQQ A;  4JGQ A;  2G2U A;  4YFM A;  4PM8 A;  3ZYT A;  4ME4 A;  4DJ2 A;  2I9V A;  1OTE A;  2W3F A;  3CI6 A;  1UGU A;  1NXY A;  4JF4 A;  1YQS A;  5KSH A;  5DJU A;  1K57 C;  4X6T A;  3RH8 B;  3LID A;  2P74 A;  1OT9 A;  1J9M A;  1MWS A;  1TDL A;  3Q7V B;  2D01 A;  4WEK A;  4RVA A;  1VET B;  1YLJ A;  1L0G A;  4WMC D;  4X1M A;  2IA2 A;  4MN5 A;  2FZ0 A;  3G2Y A;  2C6W B;  4WEJ A;  4DJ3 A;  2P08 A;  3N4I A;  2JKT I;  4PKY A;  2KX6 A;  3WS2 A;  4OQG A;  2K7S A;  4WF0 A;  3ITA A;  1NLY A;  2WZZ A;  2XRN A;  1L2S A;  1JTD A;  2V1A A;  1CEG A;  4DXB A;  2WKR A;  3BFF A;  2G2W A;  3O88 A;  1ERO A;  4Y0T A;  3F1N A;  3B3X A;  2WYX A;  1TS6 A;  2W27 A;  4S2O A;  4JBF A;  1NLZ A;  2ZD8 A;  4Z1W A;  3MFD A;  4UQI M;  1S66 L;  2XEP A;  2M7U A;  4O01 A;  4JF6 A;  4CLC E;  4EES A;  1K6S A;  3BFD A;  4PMA A;  3QP2 A;  4BL3 A;  5G18 A;  1SKO A;  4ETZ A;  3F1P B;  1TVF A;  3CPT B;  2PU4 A;  4LRZ E;  1O07 A;  3F1O B;  4Q0H A;  3K3D A;  5KZH A;  2OAQ 1;  2WKH A;  5F68 A;  4U0X A;  4EU0 A;  5FAO A;  2XGN A;  4OVD A;  2C5W B;  2M7V A;  1STZ A;  3O87 A;  4CLC B;  2Z6C A;  3QNC A;  1SZV A;  3TW8 A;  2W0N A;  3IT9 A;  1T1A A;  3CAX A;  3QP8 A;  2Y59 A;  2YKF A;  1PZP A;  1W8Q A;  2WGI A;  3C7V A;  3T4J A;  1IFQ A;  4DN0 A;  1S4S A;  2OWH A;  2KDK A;  5A8B A;  5FAP A;  1GHM A;  4KG2 A;  3ISG A;  2P9V B;  4PM7 A;  2X01 A;  2VKS A;  3G34 A;  3AGD A;  3LYX A;  3HJI A;  4EUV A;  4K0X A;  5LBR A;  2X02 A;  5F69 A;  1FCN A;  5DTT A;  2A2L A;  1BLP A;  2PR6 A;  4F94 A;  3FC7 A;  1ES3 A;  3T50 A;  3SH8 A;  1WYB A;  4OKP A;  3IX3 A;  4E04 A;  1MWT A;  3MQ0 A;  3VE3 A;  1TS0 A;  2VGL S;  2XR0 A;  5F1F A;  3Q82 A;  4GS9 B;  4I3I A;  4Y0O A;  5U47 A;  3L7H A;  1YPR A;  2JKG A;  4X53 A;  1PWG A;  4EW7 A;  1D1J A;  5HX9 A;  1AXB A;  1K4E A;  4L0L A;  2ZM8 A;  5CTN A;  4CLC D;  2VV7 A;  4JGR A;  4ZRR A;  4Y17 A;  3V50 A;  3GR2 A;  4N1H A;  4JXV A;  4KZ4 A;  2WAF A;  2ZQC A;  5DTS A;  3A3F A;  5KIZ A;  3ZDJ A;  2HGV A;  2WGV A;  1P9R A;  3IBJ A;  3IBR A;  5EOE A;  2H28 A;  3NIA A;  5AQ9 A;  2HDR A;  5L10 A;  3VFH A;  2XRO A;  3MMH A;  5L2F A;  1F2K A;  4E3L A;  5CEC A;  3K3C A;  1TD5 A;  3LR0 A;  2E8J A;  3LEQ A;  5FI7 A;  4C75 A;  2V9A A;  3FV7 A;  2P7J A;  1GCE A;  3Q7Z A;  1XJ3 A;  1KGF A;  1K56 A;  3SOI A;  5L8M A;  2PD7 A;  3NDE A;  3BJN A;  2DMW A;  3R7W A;  4UHU A;  1IEL A;  3BRM A;  2HV1 A;  5DF9 A;  3S7Q A;  3MZF A;  1KDS A;  3NEC A;  3HCY A;  3SH7 A;  5FQQ A;  3UY6 A;  3BYD A;  3LY3 A;  4WMC A;  5A92 A;  1OTI A;  1W5D A;  5L07 A;  1YMX A;  2GNX A;  3IWQ A;  2Q9M A;  2GJ3 A;  4FH4 A;  4IED A;  3F1N B;  4S2N C;  3GMW A;  3PBN A;  4QB8 A;  2Y2P A;  3UE3 A;  2WKQ A;  2FFF B;  5A90 A;  3PAG A;  4CPK A;  5IHV A;  3IF6 A;  2EX9 A;  1BLC A;  2VGJ A;  1P9W A;  4IBX A;  3N7W A;  2V1Z A;  2VV8 A;  3BLS A;  4NK3 A;  5TBM A;  3U2A A;  4O0P A;  3G32 A;  3PBT A;  1JNU A;  5EFW A;  1N9N A;  1MWU A;  4OQ0 A;  3G30 A;  4GJ4 A;  3IF6 C;  4C6Y A;  3NDG A;  4B4X A;  4HY8 A;  3KSI A;  1J3W A;  3ZHH A;  3BW6 A;  1CEF A;  3UO9 A;  2ZOH A;  4HJ6 A;  3S7P A;  1YSP A;  5J8X A;  4QY6 A;  4BD0 A;  3BEC A;  1OJ5 A;  4DDY A;  1WE4 A;  1MWR A;  3LR4 A;  4YWZ A;  3ULF A;  3EGD C;  3Q7V A;  3VSL A;  1PYY A;  1BZA A;  3V67 A;  1QME A;  3K2N A;  3G35 A;  3IXH A;  4Y5F A;  4S2J A;  5AQ7 A;  2B18 A;  2EX2 A;  3UME A;  4I5S A;  1IEM A;  4GB7 A;  4KUO A;  1ZG4 A;  3Q07 A;  4KUK A;  5EM0 A;  3ZFZ A;  4KZ9 A;  3SW1 A;  3PXP A;  5EM1 A;  4CQH A;  4S2L A;  5EPH A;  1FCO A;  5GLA A;  2EX8 A;  3B47 A;  1PNE A;  5HAP A;  3WS5 A;  1PW1 A;  5HPI A;  3CUE C;  3T4K A;  3DWZ A;  4EBP A;  4Y3I A;  1UWN X;  1CJF A;  2V2F F;  3DWK A;  3CJM A;  2OLV A;  3MZE A;  4OPR A;  2VZW A;  5HD5 A;  4MCW A;  3FYZ A;  3LR5 A;  3WS0 A;  4FTX A;  3F1P A;  4LV0 A;  3BFG A;  4P0M A;  3PBS A;  3F1O A;  4Q0I A;  1GA9 A;  2M1C A;  1S0W A;  2PT7 A;  2Z2L B;  5F83 A;  2EA9 A;  5I5L A;  5M18 A;  3N8L A;  1XKZ A;  1Z09 A;  1FCM A;  2JKR M;  5DFY A;  4GOG A;  3ITB A;  2B5R A;  5AQB A;  3ZNY A;  3DTM A;  1GA0 A;  3T4S A;  2GZA A;  1IYQ A;  4FOF A;  5CHU A;  1ZG6 A;  2Y2K A;  3BEB A;  3IS2 B;  4I3A A;  2DRW A;  3B33 A;  4E6X A;  2B02 A;  1AWI A;  1ERQ A;  2PYR A;  3MXQ A;  5DKL A;  1QMF A;  4M4X A;  5GHY A;  3KSH A;  5J3W A;  1XFN A;  4BQM A;  2P9V A;  3CIT A;  3HJK A;  1KGG A;  2BG1 A;  4E3J A;  3R7W B;  3E4P A;  3OBF A;  4HQA A;  1N9B A;  4K08 A;  5GLD A;  4JLF A;  5IT5 A;  1ESU A;  3N6I A;  1PRQ A;  1BT5 A;  1NYY A;  1G28 A;  1H8M A;  3E98 A;  4QY5 A;  2PR5 A;  2JCH A;  4BBU A;  3FKW A;  4GNU A;  2E8I A;  3UNW A;  4OON A;  3VV4 A;  1JWV A;  4GS9 A;  4EET B;  3WS1 A;  1V9Y A;  2EFU A;  2Y55 A;  3DW0 A;  1MXO A;  5MC7 A;  4U3T A; 
#chains in the Genus database with same CATH homology
 5M19 A;  5EVL A;  1O07 A;  1YLT A;  4Q8I A;  5KZH A;  4OQI A;  1HD8 A;  2EXA A;  3GV9 A;  4KEN B;  4E3M A;  3GTC A;  1ES2 A;  4KZ6 A;  4MNR A;  3ZG7 B;  2WKH A;  3FKV A;  3M6H A;  1XPB A;  1XXM A;  2XD1 A;  3C5A A;  4H8R A;  4U0X A;  3HLD A;  4KQR A;  4KZ5 A;  5GLB A;  3IF6 B;  3E2L A;  3CMZ A;  1Y54 A;  3OZH A;  5FAO A;  2XGN A;  4OVD A;  3HLF A;  2C5W B;  5A93 A;  1ES5 A;  1ONG A;  2Y2H A;  4WZ5 A;  4DE2 A;  3O87 A;  4N9K A;  1CI8 A;  3VP2 A;  3SS4 A;  4EWF A;  3IXG A;  3QNB A;  1K55 A;  3G4P A;  1RP5 A;  4X56 A;  4E3I A;  4JXS A;  2H10 A;  3QNC A;  2WK0 A;  4Y0U A;  4JPM A;  5EE8 A;  4S2P A;  1MBL A;  3GQZ A;  1JWP A;  1S6R A;  2JC7 A;  1BUL A;  4S2K A;  4WZ4 A;  3IT9 A;  1W8Y A;  4OOM A;  1I2S A;  2ZC3 B;  1BUE A;  1XP4 A;  1I5Q A;  1L0E A;  1PI4 A;  5GL9 A;  2Y59 A;  4E3N A;  4R0Q A;  2ZQ9 A;  1YT4 A;  2X71 A;  4IVI A;  1K25 A;  3PTE A;  1PZP A;  3A3D A;  1TEM A;  2Y2G A;  3UPN A;  1W8Q A;  2WGI A;  4N92 A;  3C7V A;  3D4F A;  3IXD A;  1HVB A;  4OQH A;  4WZ5 C;  3HBR A;  3M2J A;  3P09 A;  1K55 C;  5FAP A;  1GHM A;  4KG2 A;  3ISG A;  2P9V B;  4KQO A;  4PM7 A;  3UE1 A;  2X01 A;  4MEZ A;  3WWX A;  4BLM A;  1RCJ A;  3G34 A;  2H5S A;  3AGD A;  4PM9 A;  2ZQ7 A;  3RJU A;  1KVL A;  3MKE A;  4K0X A;  4UA9 A;  3MBZ A;  2Y2I A;  2X02 A;  4OH0 A;  4Y7P A;  1FCN A;  2Y2N A;  5DTT A;  5D3O A;  3VP4 A;  1NZO A;  3ZGA B;  2Z2M B;  3UDI A;  2J7V A;  3OPL A;  3OPP A;  1WYC A;  1BLP A;  4D2O A;  4R3J A;  5EVI B;  4F94 A;  1DY6 A;  1U60 A;  5E2G A;  1YLP A;  1LL9 A;  4FD8 A;  5EOO A;  3NI9 A;  1ES3 A;  5FQI A;  3IWI A;  2GDN A;  1NYM A;  3GRJ A;  3SH8 A;  3UPO A;  4JF5 A;  1WYB A;  4E3K A;  4IBR A;  2QMI A;  2Y2Q A;  4XUZ A;  4OKP A;  1SDE A;  4K0W A;  3HUO A;  1DJA A;  1MWT A;  2ZC4 B;  2H0Y A;  5CER A;  2XR0 A;  4X69 A;  1H5X A;  1KGE A;  3UDX A;  3Q1F A;  3Q82 A;  5F1F A;  5FQ9 A;  5FQK A;  5CEB A;  4Y0O A;  5TR7 A;  5U47 A;  2XFS A;  4ZJ2 A;  3VP0 A;  2JE5 A;  1SCW A;  4OP8 A;  4EUZ A;  1ERM A;  4X53 A;  1PWG A;  2WGW A;  1FOF A;  4MLL A;  2XDM A;  3IQA A;  5HX9 A;  1IYO A;  1AXB A;  1PWC A;  2HPB A;  1NY0 A;  1L0D A;  3HLE A;  3HRE A;  1K4E A;  3JYI A;  4L0L A;  2WUQ A;  4LCL A;  2ZM8 A;  4LV1 A;  2ZC7 A;  5CTN A;  1Q2Q A;  4X55 A;  4BEN A;  3I7J A;  3PBR A;  3V50 A;  4DE1 A;  3GR2 A;  4N1H A;  4OPY A;  4JXV A;  4BJP A;  3RXW A;  4KZ4 A;  1KVM A;  3IH8 A;  4O7D A;  1E25 A;  2WAF A;  5BOH A;  4GN2 A;  2ZQC A;  3PBQ A;  3UDF A;  5DTS A;  3ZVW A;  3BFE A;  3A3F A;  3ZDJ A;  3LEZ A;  3VSK A;  5TGF A;  4QHC A;  3VOY A;  2HP9 A;  4LEN A;  2WGV A;  1GHP A;  1MPL A;  3W4Q A;  5EOE A;  3HUM A;  4Z9Q A;  3NIA A;  2Y2J A;  1EI5 A;  4GDB A;  4PPR A;  5KMW A;  2EFX A;  3LCE A;  2HDR A;  5AQ9 A;  3VFH A;  4DKI A;  2R9X A;  3QHY A;  1ESI A;  4JKT A;  5FAT A;  5CRF A;  5L2F A;  3BM6 A;  4E3L A;  5CEC A;  4OPZ A;  5EUA A;  1BLS A;  4R1G A;  3A3E A;  1DJC A;  1XGI A;  5DTK A;  1I2W A;  2I72 A;  5FI7 A;  5M1A A;  4C75 A;  5HAQ A;  4GZB A;  4ZJ3 A;  1CI9 A;  4OOL A;  4E6W A;  5EVI D;  3FV7 A;  5FAS A;  1EWZ A;  4JXG A;  4WYY A;  1GCE A;  5DVA A;  3Q7Z A;  1O7E A;  4GD6 A;  3V5M A;  1KGF A;  3EQU A;  1K56 A;  3PBO A;  4K91 A;  5HAR A;  4R4S A;  3TSG A;  1KE0 A;  3SOI A;  4C3Q A;  4PM5 A;  3FZC A;  4M3K A;  3NDE A;  3S1Y A;  4DXC A;  1K6R A;  3WRZ A;  1PIO A;  1YLW A;  4MBH A;  4GD8 A;  4UHU A;  1KDW A;  1IEL A;  3BRM A;  4KZB A;  3HLW A;  5GHZ A;  5DF9 A;  5DF8 A;  2HP6 A;  4PM6 A;  5FA7 A;  2ZC5 B;  2HDQ A;  3M2K A;  3MZF A;  1KDS A;  1NRF A;  3A3J A;  1KE4 A;  2XFT A;  3OPH A;  2A49 A;  2UWX A;  4KZ3 A;  3UPP A;  3EQV A;  3SH7 A;  5FQQ A;  2DNS A;  3UY6 A;  1LLB A;  1ONH A;  1IYP A;  3BYD A;  1YLY A;  2ZJ9 A;  3LY3 A;  2ZQA A;  3CZD A;  3TOI A;  4EQI A;  4WMC A;  1NZU A;  2ZQ8 A;  4UAA A;  2OSU A;  3W4P A;  1JWZ A;  1NJ4 A;  1W5D A;  1YMX A;  4B88 A;  5A92 A;  3IF5 A;  1HZO A;  5CGS A;  3W4O A;  3IWQ A;  4B4Z A;  2Q9M A;  3MKF A;  3VMA A;  2IWD A;  4FH4 A;  4IED A;  2OV5 A;  4UA6 A;  1TDG A;  4OP5 A;  4RA7 A;  2WKE A;  4S2N C;  3GMW A;  3PBN A;  4QB8 A;  1W79 A;  3BFC A;  2Y2P A;  4HBU A;  3UE3 A;  3SS3 A;  1RGZ A;  2FFF B;  3ZCZ A;  4DE0 A;  1W7F A;  5A90 A;  3PAG A;  4CPK A;  5IHV A;  3M6B A;  1K4F A;  3IF6 A;  4R4R A;  1FSW A;  2EX9 A;  1BLC A;  2VGJ A;  1N4O A;  4IBX A;  2A3U A;  4KZA A;  3N7W A;  2V1Z A;  4DRT A;  3BLS A;  4NK3 A;  1GHI A;  5A91 A;  4IVK A;  1E3U A;  1KE3 A;  3ZG9 B;  3TG9 A;  1MKI A;  4X68 A;  5CED A;  4WBG A;  2J9P A;  2ZMA A;  3ZG5 A;  3NC8 A;  4RYE A;  3G32 A;  3UE0 A;  4JXW A;  3AGE A;  4XUX A;  1K54 A;  3N8R A;  3PBT A;  4MBF A;  1XA1 A;  2CC1 A;  3S22 A;  4EBL A;  3E2K A;  4DE3 A;  1HTZ A;  4DF6 A;  1MWU A;  4N9L A;  4LV2 A;  4OQ0 A;  2Y4A A;  3G30 A;  3HVF A;  4WEL A;  2ZC6 B;  5F1G A;  2JBF A;  3IF6 C;  4C6Y A;  3NDG A;  4B4X A;  3IXB A;  4KG5 A;  3P98 A;  3Q81 A;  4ZBE A;  3ZHH A;  5CHJ A;  1LI9 A;  4NET A;  2WAD A;  2IWC A;  2QZ6 A;  3VOZ A;  1IYS A;  4UA7 A;  1CEF A;  1FR1 A;  1LL5 A;  3UO9 A;  1PI5 A;  1C3B A;  3MXS A;  4N1X A;  5DF7 A;  5HW3 A;  5JYP A;  5J8X A;  4QY6 A;  4BD0 A;  5HAI A;  5FQM A;  3BEC A;  1PZO A;  2Y2M A;  1BLH A;  3C4O A;  2J8Y A;  1K54 C;  2XF3 A;  3ZG0 A;  1K38 A;  3SH9 A;  3WRT A;  3OCL A;  5F82 A;  1WE4 A;  1MWR A;  3RXX A;  4DDY A;  2XH9 A;  5KSC A;  4OLD A;  2Y91 A;  2XQZ A;  2HDS A;  2WKI A;  3Q7V A;  4OOY A;  3VSL A;  1PYY A;  4WM9 A;  4R3B A;  1BZA A;  3HLB A;  5I94 A;  3HL9 A;  4LV3 A;  3ZNT A;  5EVI A;  3PAE A;  1QME A;  5FI6 A;  5E2H A;  1CK3 A;  2HP5 A;  4QU3 A;  1H8Z A;  3G31 A;  3NY4 A;  3G35 A;  3IXH A;  4S2J A;  4EBN A;  2HDU A;  5EEC A;  1G68 A;  5FAQ A;  1RGY A;  5AQ7 A;  3GSG A;  1LI0 A;  2EX2 A;  3G2Z A;  5JYO A;  1IEM A;  4GB7 A;  3V3R A;  4QD4 A;  1BTL A;  2R9W A;  4LCM A;  4P6B A;  1ZG4 A;  3BLM A;  5AQA A;  4P87 A;  5HL1 A;  3IH9 A;  4HEF A;  2H0T A;  3Q07 A;  1ZKJ A;  5CGW A;  1SKF A;  5GLC A;  3ZFZ A;  4MBK A;  4KZ9 A;  1VM1 A;  2QPN A;  3WS4 A;  1FQG A;  3LO7 A;  4OPQ A;  1SHV A;  5EVI C;  2Q9N A;  2ZM0 A;  3W8K A;  1LHY A;  4S2L A;  5E2F A;  1FCO A;  5EPH A;  5GLA A;  3FWL A;  2EX8 A;  3V3S A;  3ZVT A;  5HAP A;  3O3V A;  1PW1 A;  1IKI A;  2PBY A;  3WS5 A;  2Y2L A;  3NCK A;  1Z6F A;  2WZX A;  5CHM A;  3IWO A;  2DCF A;  5TFQ A;  3IHB A;  1ZC2 A;  3MZD A;  4ID4 A;  4S2M A;  4KG6 A;  5FDH A;  5HFO A;  4S2N A;  3DWZ A;  3NBL A;  4EBP A;  4ZAM A;  2ZM2 A;  2ZQD A;  4BL2 A;  1MY8 A;  2V2F F;  1YMS A;  4XXR A;  4A5R A;  4RX3 A;  3DWK A;  3CJM A;  1XA7 A;  3IHA A;  1K57 A;  2OLV A;  3MZE A;  4OPR A;  3ZG8 B;  1ES4 A;  2XLN A;  3GVB A;  2EX6 A;  2RL3 A;  3N8S A;  1PW8 A;  3FYZ A;  3WS0 A;  2WGW B;  1ALQ A;  5CXW A;  1K56 D;  1VQQ A;  3UN7 A;  4BD1 A;  4LV0 A;  2G2U A;  4YFM A;  3BFG A;  4P0M A;  4PM8 A;  4DDS A;  4ZDX A;  3PBS A;  3OCN A;  4HBT A;  1GA9 A;  3VP3 A;  1S0W A;  1NXY A;  2Z2L B;  4JF4 A;  5F83 A;  1YQS A;  5KSH A;  5FQJ A;  1K57 C;  3N8L A;  5CGX A;  5M18 A;  4E3O A;  1XKZ A;  4X6T A;  1H8Y A;  1FCM A;  2P74 A;  2XD5 A;  1J9M A;  1MWS A;  1TDL A;  3ITB A;  4GOG A;  4CJN A;  1JVJ A;  2B5R A;  5AQB A;  4S2I A;  3ZNY A;  3Q7V B;  4WEK A;  3DTM A;  1GA0 A;  1OME A;  2EXB A;  4RVA A;  4R23 A;  1IYQ A;  4FH2 A;  5CHU A;  3HUN A;  3LY4 A;  1YLJ A;  3A3I A;  2PU2 A;  1L0G A;  1ZG6 A;  4WMC D;  2Y2K A;  1Q2P A;  3BEB A;  3C7U A;  3G2Y A;  3SS5 A;  2C6W B;  4WEJ A;  3MXR A;  2DRW A;  4ZTK A;  4E6X A;  1JTG A;  4KZ8 A;  3V39 A;  3VFF A;  3N4I A;  1G6A A;  2OLU A;  5E43 A;  3WS2 A;  1XX2 A;  4OQG A;  1ERQ A;  2VGK A;  3ITA A;  3VP1 A;  3OPR A;  5FI2 A;  4YIN A;  4RX2 A;  3AGF A;  2RCX A;  4OLG A;  1XGJ A;  1QMF A;  4FCF A;  5GHY A;  2ZLY A;  2J9O A;  1YM1 A;  3C4P A;  2WZZ A;  1DJB A;  4GDN A;  2V20 A;  1L2S A;  4BQM A;  4KZ7 A;  1JTD A;  2P9V A;  4EV4 A;  1CEG A;  1KGG A;  4DXB A;  2BG1 A;  1M6K A;  3BFF A;  4E3J A;  4P85 A;  2BLS A;  1E3U D;  2G2W A;  2WAE A;  2IWB A;  1N9B A;  1ERO A;  3O88 A;  5FSR A;  4Y0T A;  1IKG A;  2WYX A;  3B3X A;  1FSY A;  5GLD A;  4QJG A;  4S2O A;  4JLF A;  4JBF A;  4FSF A;  3O86 A;  3OC2 A;  2ZD8 A;  1ESU A;  3MFD A;  3N6I A;  1E4D A;  1YLZ A;  1BT5 A;  1NYY A;  4QY5 A;  2XEP A;  3HLC A;  2JCH A;  4JF6 A;  1K6S A;  3FKW A;  4GNU A;  1SDN A;  2E8I A;  3BFD A;  3UNW A;  1PWD A;  4PMA A;  4OON A;  4BL3 A;  5G18 A;  1JWV A;  5CTM A;  1BSG A;  2XK1 A;  4KQQ A;  4ZJ1 A;  3CG5 A;  2FFY A;  1M40 A;  3WS1 A;  4HES A;  3S4X A;  2Y2O A;  4GKU A;  2EFU A;  2Y55 A;  3DW0 A;  1MXO A;  1TVF A;  1FR6 A;  5GHX A;  4U0T A;  1L0F A;  2PU4 A;  3HLG A;  4U3T A;  5E2E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...