4OQIA

Crystal structure of stabilized tem-1 beta-lactamase variant v.13 carrying r164s/g238s mutations
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
263
structure length
263
Chain Sequence
b'HPETLVKVKDAEDQLGGRVGYIELDLASGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVGELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDSWEPELNEAIPNDERDTTTPVAMATTLRKLLTGELLTAASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGASERGSRGIIAALGPDGKPSRIVVIYMTGSQATMDERNRQIAEIGASLIKHW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TEM-94 ES-beta-lactamase
molecule tags Hydrolase/hydrolase inhibitor
source organism Escherichia coli
publication title Negative Epistasis and Evolvability in TEM-1 beta-Lactamase--The Thin Line between an Enzyme's Conformational Freedom and Disorder.
pubmed doi rcsb
total genus 104
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2014-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4oqiA00
2JCHA 3VP4A 1E4DA 1L2SA 2J9PA 4Z9QA 4E6WA 2EXAA 5AQAA 3W4QA 1NXYA 2GDNA 2WADA 2WKHA 1RCJA 4ZTKA 1TDLA 5M19A 4R4RA 5CXWA 2ZQ9A 3DTMA 4IBRA 1ES2A 3MKFA 3BEBA 5DF9A 5F82A 4BD0A 1BLPA 4KQOA 5FQJA 1KE3A 2UWXA 3SH8A 3OC2A 4YINA 3OZHA 1WYCA 1ESUA 3BFCA 1K56A 1KGEA 3HLDA 3RJUA 4Y0TA 1LI9A 4LV3A 4S2NC 4Y0UA 1KGFA 5CGWA 2J9OA 1CEFA 3OCLA 4FD8A 4BLMA 3UNWA 3G4PA 3OPRA 4Y7PA 3UPNA 3BFEA 3ZFZA 3OPLA 2P9VA 2XR0A 3IQAA 3ITAA 1JTGA 4LCLA 4OOMA 1M6KA 3UE1A 1NYMA 2ZJ9A 4NK3A 1ESIA 3AGFA 3VFFA 3Q81A 3GTCA 3P98A 4UA7A 3O88A 4X56A 2QPNA 2Y2OA 2WKEA 3A3JA 3EQUA 2IWCA 1I5QA 1MWUA 5EVIC 5L2FA 3GR2A 3IF5A 5EVLA 4FH2A 3W4OA 1PZOA 4KZ3A 4Y0OA 2EFXA 1DY6A 4JF5A 4X53A 3OCNA 2ZQAA 2X71A 3G32A 4EUZA 4GDBA 5DVAA 1HZOA 2H5SA 4XUXA 4JXVA 4P85A 1W8YA 2V20A 1XA1A 3ZVWA 1YM1A 5HAPA 3V39A 2ZC6B 1KVMA 1L0EA 2EX6A 2JC7A 4JPMA 1JWPA 1TVFA 3HL9A 2WGVA 4R4SA 3TOIA 3VP3A 3WS1A 4GD6A 4C6YA 2HP6A 4E3IA 5HW3A 1GHMA 3BLSA 5GLDA 4OP8A 1DJAA 4KZAA 5CGSA 3ZHHA 4QHCA 5U47A 4S2OA 1S0WA 3LY3A 5DTKA 2QMIA 2ZQ8A 1YLTA 4U0XA 3ISGA 1ERMA 3ZGAB 4DXCA 3HLWA 1L0DA 1XPBA 5CERA 2RCXA 1K57C 4RX3A 1J9MA 5FI2A 1KE4A 1MY8A 3NCKA 1XGIA 4KZ7A 2Y2LA 1YQSA 2Y2GA 1ONHA 4DXBA 4DRTA 5E2GA 5CHMA 4S2JA 4BL2A 1H5XA 2WZZA 5D3OA 1IELA 1VQQA 1E25A 3VP1A 4EBPA 2Y2MA 5F1FA 4WZ5A 4X55A 4GNUA 4GZBA 4WBGA 1E3UD 2HDSA 1NY0A 1BLSA 3IF6A 5CHJA 3S1YA 4E3NA 2H10A 3UPOA 4JXWA 1XGJA 4FCFA 1CEGA 1MXOA 1ONGA 3LEZA 3M2KA 2A49A 4OPQA 4ZJ1A 1SDEA 3IHAA 4S2PA 3C7UA 4JXSA 3UPPA 4JLFA 5HAIA 5TR7A 1LI0A 3S22A 2XF3A 3ZG7B 4QY5A 4XUZA 4N9KA 3TSGA 1YMSA 4B88A 3NDGA 4EV4A 4R23A 4ZAMA 3E2LA 5GHZA 2QZ6A 1CK3A 1IYSA 4OVDA 4P87A 3IH9A 4PM9A 3W4PA 4FH4A 1H8YA 2JBFA 2ZC7A 3TG9A 5EOEA 1N4OA 4DE0A 4E3MA 5AQ9A 1KDSA 3HLEA 4WM9A 4K0WA 1FSYA 1NZUA 1RGZA 5A92A 4WZ4A 5EOOA 4U3TA 1GA9A 5KZHA 2EX2A 4MLLA 4N1XA 1LL5A 1FCOA 3UN7A 2OSUA 2WK0A 2ZC4B 3G34A 3MZFA 3HVFA 1BULA 1QMFA 5CEDA 5EPHA 2V2FF 3WS2A 3MXSA 3Q7VA 1JWVA 2ZMAA 3N8LA 4KG6A 1KGGA 4LENA 5JYOA 4RVAA 1L0FA 1IKIA 1RGYA 4WEKA 4KZ6A 3D4FA 4C75A 4KZ9A 1TEMA 4JBFA 2G2WA 2Y2NA 1OMEA 3G31A 4WYYA 2V1ZA 4EBNA 4X69A 3ZNTA 1K38A 2X02A 1MWSA 3NY4A 4NETA 4P0MA 5J8XA 4GOGA 4FSFA 3VFHA 1IYOA 2HPBA 3A3FA 3M6HA 1YLWA 4WMCA 2ZM0A 2OLVA 5DF7A 5FI6A 3IXDA 3FV7A 1FCNA 2Y91A 4ZJ3A 1EI5A 1BT5A 1PWCA 1Z6FA 3CJMA 2C6WB 3IH8A 2XQZA 3RXXA 1HVBA 1GA0A 2HDUA 4EQIA 4PPRA 3VP2A 3ZCZA 2XD5A 5KSHA 4QB8A 4P6BA 3NBLA 4XXRA 4JXGA 1LL9A 1E3UA 4MBFA 2R9WA 2ZLYA 3W8KA 5E2FA 1KDWA 2J7VA 4ID4A 3ZNYA 4ZBEA 1K4EA 2HDQA 1K4FA 4KQQA 1YLZA 5JYPA 1PZPA 3MFDA 5GLBA 2G2UA 5GHXA 4LV2A 4OQ0A 5E2EA 3E2KA 3GRJA 3SS4A 1FR6A 4K91A 4UA6A 3QNBA 4E6XA 4OQGA 2B5RA 4OLDA 4DF6A 4DDYA 2Z2MB 4KZ5A 2EX9A 4GD8A 5A93A 4BD1A 1WYBA 4ZJ2A 1XXMA 2BLSA 4M3KA 5F83A 2XEPA 2JE5A 1H8ZA 4IVIA 1CI9A 1YMXA 2HP5A 3S4XA 3IWQA 1M40A 4JF6A 2H0YA 2FFYA 5TGFA 1C3BA 3SH9A 4HEFA 4KG5A 3O87A 1K6RA 1YLPA 2A3UA 2I72A 4BJPA 1L0GA 4DE2A 1FQGA 1PWGA 3VP0A 3G30A 4QU3A 3HLGA 3PAGA 4C3QA 2XDMA 1SCWA 2Y59A 3BLMA 3LY4A 5E2HA 5GHYA 3CZDA 4S2MA 4PM5A 5KSCA 1W7FA 1PI5A 1I2WA 3Q07A 4OOLA 4EBLA 2ZM2A 3AGEA 2EFUA 4KZ8A 1NZOA 1PYYA 2ZD8A 3ZG9B 4QD4A 3LCEA 3V50A 4D2OA 3WS5A 1EROA 1DJCA 4QJGA 4S2LA 3C7VA 5HL1A 4E3JA 3PBOA 1ZG6A 2IWDA 3M2JA 4EWFA 4S2KA 3QNCA 1PW1A 3NIAA 5FI7A 2HP9A 1RP5A 2IWBA 4JKTA 5IHVA 5HARA 3DW0A 3ZDJA 3B3XA 1I2SA 1K55A 3MBZA 2WAFA 2EXBA 1BLCA 2XFSA 1PW8A 4LCMA 1JTDA 3PAEA 2XLNA 1Q2PA 2XD1A 4OQHA 3WRZA 4MEZA 3P09A 4L0LA 5TFQA 2Y2KA 1VM1A 5BOHA 4UAAA 1G68A 3G35A 1EWZA 1PI4A 4N1HA 3ITBA 5FAQA 1HD8A 1K6SA 2VGKA 3IF6C 4OP5A 3SH7A 3HUOA 1IYPA 2WYXA 4X68A 2Y55A 5EVID 5AQBA 3CMZA 2ZQDA 3DWZA 3Q7VB 1K54A 1HTZA 5M18A 3BFFA 1BLHA 2Q9NA 2P74A 3SOIA 1ZC2A 3GMWA 2ZC3B 3G2ZA 3VOYA 4IVKA 2HDRA 1K57A 1ALQA 2H0TA 3NDEA 3IXGA 3N6IA 3HUNA 2PBYA 3C4OA 3FYZA 3Q1FA 4GB7A 2WZXA 2WGWA 3SS3A 3HUMA 3CG5A 3IWOA 4O7DA 4K0XA 3VMAA 1ZKJA 3M6BA 4BQMA 1PIOA 2WGWB 1FSWA 4OONA 3BFDA 4OPYA 2WKIA 3VSKA 3IWIA 1MBLA 5HAQA 5KMWA 3A3IA 4IEDA 4DKIA 2EX8A 1N9BA 4N92A 3QHYA 1ES4A 1K25A 1XA7A 1ES3A 3JYIA 1YT4A 4OLGA 3I7JA 4OPZA 4HESA 3PBQA 1MWTA 2DCFA 4KQRA 4B4ZA 2XFTA 1SDNA 2Q9MA 2VGJA 3UDXA 4WZ5C 4S2IA 3OPHA 2J8YA 4R3JA 3V5MA 5EVIA 2Y2QA 1JWZA 5F1GA 4WELA 2ZC5B 3MZDA 3PBRA 4WMCD 1O7EA 3HBRA 4R0QA 5FDHA 4F94A 5FSRA 4PM8A 4MBKA 4RX2A 5M1AA 4OKPA 1IKGA 5FA7A 4GKUA 5FQIA 5DF8A 5GL9A 3SS5A 3ZG8B 1PWDA 4PM7A 2OLUA 1ERQA 1S6RA 3WWXA 3WS0A 3UY6A 1ZG4A 1CI8A 1U60A 1GHPA 4S2NA 5CTMA 5CEBA 3MZEA 5I94A 1BTLA 1O07A 4A5RA 1W8QA 5FQQA 3IHBA 2ZQ7A 1BUEA 4GN2A 4HBUA 5A91A 4DDSA 5G18A 1DJBA 2Z2LB 1SKFA 3WRTA 1MWRA 4LV1A 5FAPA 5HX9A 1MKIA 3O3VA 3RXWA 2DRWA 1FOFA 1G6AA 4IBXA 5FQ9A 3GSGA 2XK1A 5EE8A 2P9VB 3A3EA 4E3OA 1GCEA 4LV0A 5EVIB 5GLAA 1AXBA 3ZVTA 2PU4A 3FKVA 4KENB 4RA7A 4RYEA 4PMAA 1IYQA 5AQ7A 4Q8IA 1W5DA 3FWLA 4UA9A 3Q82A 3C4PA 5HFOA 2XGNA 3PTEA 3V3RA 3FKWA 4CJNA 3BYDA 5GLCA 3IF6B 3MXRA 3ZG5A 1YLJA 4HBTA 4E3KA 3GQZA 3EQVA 3HREA 3HLFA 1ES5A 1XP4A 2PU2A 1XKZA 4GDNA 4WEJA 3HLBA 1K54C 5FATA 3O86A 3UE0A 1XX2A 2Y2IA 3V3SA 1NYYA 3VOZA 3AGDA 3MKEA 1SHVA 2WAEA 2ZM8A 5FQMA 1NRFA 3N4IA 4DE1A 5EECA 4QY6A 5DTSA 3N7WA 4X6TA 1YLYA 3PBSA 1TDGA 2Y2HA 4KZ4A 1Y54A 5CTNA 3Q7ZA 3BM6A 1K56D 1LLBA 1WE4A 4PM6A 2Y4AA 3UE3A 4ZDXA 1BZAA 5DTTA 4YFMA 3NI9A 3PBTA 4R3BA 4DE3A 4KZBA 4OOYA 1BSGA 1IEMA 4H8RA 3A3DA 3FZCA 3N8RA 1K55C 3UDIA 5CECA 5FQKA 4MBHA 1FR1A 3DWKA 4E3LA 2DNSA 3C5AA 4MNRA 2FFFB 3IXBA 4OH0A 5CGXA 4N9LA 5CRFA 4U0TA 3ZG0A 3NC8A 3VSLA 4KG2A 5CHUA 2BG1A 3IXHA 1NJ4A 4OQIA 3G2YA 2Y2PA 3BRMA 5EUAA 1KVLA 3OPPA 4B4XA 3LO7A 1LHYA 3N8SA 3GVBA 5E43A 4R1GA 3BFGA 4BENA 4JF4A 2R9XA 3WS4A 3UO9A 4BL3A 1QMEA 2ZQCA 5FASA 1W79A 1KE0A 2RL3A 3IT9A 1JVJA 1FCMA 3GV9A 2E8IA 1Q2QA 2WGIA 1MPLA 2C5WB 5FAOA 5A90A 2X01A 2CC1A 2WUQA 2OV5A 1GHIA 3UDFA 3HLCA 2XH9A 4OPRA 4UHUA 4CPKA 3BECA 2Y2JA 3PBNA
chains in the Genus database with same CATH superfamily
3H82A 4R3AA 5AQAA 2WADA 4ZTKA 3BQ8A 5M19A 2J3TD 4IBRA 1G5UA 3MKFA 1WA9A 1OTDA 5FQJA 4G3WA 3BFCA 4Y0TA 5HWWA 4S2NC 3R7WB 1KGFA 2J9OA 2PD8A 3BFEA 3F1OA 4ETZA 2P9VA 5EFWA 4DMZA 3K2NA 1M6KA 4MDZA 3VFFA 3O88A 1N9NA 2Y2OA 4X56A 2IWCA 3ZQ5A 4PKYG 3IF5A 5EVLA 4Y0OA 2EFXA 2ZQAA 4GDBA 5DVAA 5F69A 2H5SA 4XUXA 1XFQA 5HAPA 2ZC6B 2EX6A 4UA7A 3HL9A 4GD6A 2HP6A 4E3IA 3IS2A 3BLSA 4P6ZS 5GLDA 4KZAA 4QHCA 3CPTA 5U47A 4S2OA 5DTKA 4U0XA 1YLTA 3ISGA 4DXCA 4XT2B 1XPBA 2RCXA 4KZ7A 1YQSA 1ONHA 3A0SA 2W3FA 4S2JA 3LR4A 2WZZA 1VQQA 5DKLA 3H7WA 3V67A 4NXBA 4X55A 4GNUA 2ZMFA 3IF6A 2H10A 3UPOA 4JXWA 4ZJ1A 4S2PA 3C7UA 1CJFA 4MN6A 3UPPA 4JLFA 2FZ0A 4XUZA 4N9KA 3NDGA 4EV4A 4R23A 4ZAMA 3E2LA 2QZ6A 1IYSA 4OVDA 3EGDC 4QPRA 4E3MA 4FOFA 2I9VA 4RQ9A 4ME4A 5F68A 5KZHA 3K3DA 3HVFA 5EPHA 3LFVA 4CLCD 3MXSA 4G3VA 5JYOA 1IKIA 4JBFA 3DBAA 4EBNA 3QP4A 4X69A 3NY4A 5J8XA 2W0NA 1F98A 4NETA 2HPBA 2O0YA 1F5MA 5FI6A 3FV7A 2Y91A 1BT5A 2C6WB 2A24B 2O9CA 5A8BA 2XD5A 4QB8A 4P6BA 3NBLA 2AVXA 4MBFA 5C5KA 3CUEA 3W8KA 5E2FA 1K4EA 4KQQA 5E2EA 3E2KA 2W27A 3FG8A 4E6XA 4DF6A 1D7EA 2EX9A 1WYBA 3IBJA 1XXMA 5IU1A 2XEPA 1PRQA 1H8ZA 3IS2B 3S7OA 2HP5A 1YMXA 3S4XA 3TJZC 2FFYA 1XJ4A 4KG5A 2OAQ1 4KUKA 2A3UA 2I72A 2O9AA 1L0GA 4DE2A 2K31A 3MSHA 1PWGA 4QU3A 3PAGA 1SCWA 2V1AA 3Q07A 3JVVA 4EBLA 3AGEA 4O8GA 2ZD8A 4M4XA 3LCEA 3V50A 3WS5A 1ZG6A 1CF0A 2ZL1B 3LI8A 4X1MA 3QNCA 1PW1A 1RP5A 4JKTA 2ZMVA 1DP8A 1VETA 1PW8A 4LCMA 4EU0A 4LRXC 5TFQA 4L0LA 2MJ6A 2Y2KA 1VM1A 1LSVA 4YWZA 1EWZA 4N1HA 4EW7A 3ITBA 5FAQA 4CLCB 3IF6C 3SH7A 4IJGA 2WYXA 4Y15A 2P7JA 3NOUC 3DAVA 5AQBA 2VV8A 1Y4OA 3MQ0A 1MZUA 3G2ZA 2WKQA 3VOYA 2HDRA 1K57A 2H0TA 2PD7A 4DN0A 4I5SA 3FYZA 2D02A 3HUMA 2V1BA 3EGXC 1FSWA 4OPYA 2PR5A 2PDRA 3GDIA 5HAQA 4DKIA 2EX8A 2J3WA 3QHYA 1A0KA 1UWNX 1ES3A 4OLGA 2ZOHA 3PBQA 2WKRA 3R7WA 2XFTA 4HP9A 2VGJA 2R78A 3LYXA 4WZ5C 3OPHA 4R3JA 2VEAA 2W1RA 4EERA 5F1GA 4WMCD 5FDHA 3LIFA 2JKTM 5FSRA 5FA7A 4GKUA 4GS9B 2V8FA 1PWDA 1N9LA 2OLUA 4BBVA 1ZG4A 2PT7A 3UMEA 3FC7A 5FQQA 1BUEA 1SKFA 3UB9A 3LUQA 1MWRA 4LV1A 5HX9A 2ACGA 3T50A 2XK1A 1LL8A 2Y8HA 5EVIB 3ZYTA 2LB9A 4XT2A 1AXBA 4KENB 1IYQA 1GSWA 1W5DA 3FWLA 3T4QA 4UA9A 2XGNA 5GLCA 3IF6B 4HBTA 4E3KA 3HREA 4HHDA 3HLFA 2PU2A 3JVUA 4WEJA 3E98A 3O86A 3IX4A 2QJ5A 2Y2IA 3V3SA 2XA7S 3AGDA 1TDGA 3T1SA 4BBUA 4ZDXA 4YFMA 3NI9A 3HCYA 3KSGA 3A3DA 3FZCA 5CECA 5FQKA 1FR1A 2DNSA 4EETB 2VGLS 3IXHA 3T4SA 2Z6DA 3BRMA 3OPPA 2JKRM 3LO7A 4YNRA 1TS6A 4IHQA 5E43A 3BFGA 4JF4A 2R9XA 3UO9A 1W79A 3LEQA 1ZTUA 4KQDA 1Q2QA 4KUOA 5FAOA 1T19A 2WUQA 2XH9A 2A24A 4UHUA 1GSVA 2Y2JA 3VP4A 4E6WA 1G6OA 2EXAA 1JNUA 1NXYA 1OJ5A 1RCJA 4GS9A 1H0MA 1TDLA 4HJ4A 4R4RA 2ZQ9A 3DTMA 3T1RA 5DF9A 3SZTA 4BD0A 3TW8A 1KE3A 2UWXA 1TF1A 3OZHA 1NRJA 2O99A 1KGEA 2K7SA 3HLDA 3RJUA 4Y0UA 3CITA 2H28A 2JKGA 2QHKA 3MS6A 4BLMA 3G4PA 3OPRA 3KSIA 3LIBA 5HSQA 2XR0A 3IQAA 1G28A 3ITAA 2ZJ9A 4NK3A 3AGFA 2DMWA 1P9WA 3EQUA 1MWUA 5L2FA 3GR2A 4FH2A 4CLCE 1PZOA 3OCNA 3C8CA 2X71A 3G32A 4EUZA 3E4PA 2VV7A 3V39A 1KVMA 1VETB 4C6YA 5HW3A 3IX3A 2KDKA 1W63M 3NULA 3ZGAB 1F2KA 1N9OA 4RX3A 1K57C 5FI2A 5E2GA 3H9WA 5D3OA 5L10A 3VP1A 4EBPA 4II7A 2Y2MA 5LBRA 3NECA 5J3WA 4ARZA 1E3UD 1NY0A 5HWVA 3S1YA 1XGJA 3M2KA 4OPQA 3CAXA 1SDEA 3IHAA 4I38A 4QY5A 4B88A 4PKYA 5GHZA 1LSXA 4P87A 4PM9A 1YKDA 2ZC7A 3TG9A 4UQIS 4DE0A 3LR5A 5F6AA 1KDSA 3HLEA 4WM9A 4K0WA 5A92A 2Q0OA 1AWIA 1FCOA 3UN7A 2ZC4B 1BULA 4KG6A 1JWVA 4EQ1A 4LENA 1Y28A 3D4FA 4KZ9A 1TEMA 2G2WA 1TD5A 5J4EA 2V1ZA 3PHYA 5HD5A 2J3TC 2XA7M 4Q0HA 4UEYA 5MC7A 3M6HA 5DF7A 2OLVA 3IXDA 3P7NA 4ZJ3A 1HVBA 5HDCA 5KSHA 2P04A 3CPTB 3VE3A 4WUJA 4L9GA 3ZNYA 4ZBEA 1YLZA 5HL6A 3MFDA 4OQ0A 3SS4A 3GRJA 2LB5A 4UA6A 3KYQA 2B5RA 4KZ5A 3OBFA 5A93A 4WLAA 3PYPA 4M3KA 2A2LA 4IVIA 1CI9A 3IWQA 1M40A 2H0YA 1XJ3A 4JGRA 1FQGA 3EEAA 4HY8A 2B95A 4R6LA 4D60A 1DP6A 2BTFP 3LY4A 1OJGA 3CZDA 2OOLA 4S2MA 3VOLA 1W7FA 1PI5A 1I2WA 2V0WA 2EA9A 1S66L 4OOLA 3VE4A 4ARZB 4KZ8A 3ZG9B 4MMNA 2KLIA 1DJCA 3T4OA 5HL1A 2IWDA 4GHIA 4L9FA 5FI7A 4GHIB 3B3XA 1I2SA 3MBZA 1YPRA 1BLCA 4P6ZM 1JTDA 3PAEA 3WRZA 4MN7A 3G35A 2PBDP 1PI4A 1NWZA 5DKKA 1HD8A 4OP5A 4Y17A 2Y55A 3CMZA 3CLOA 2EWVA 5G4ZA 3MQOA 1ZC2A 3GMWA 2ZC3B 4IVKA 1ALQA 3BWLA 3NDEA 3HUNA 1FIKA 2WZXA 3SS3A 3A0RA 3M6BA 1PIOA 4JGOA 3BFDA 1EW0A 1GSXA 1MBLA 5KMWA 4IEDA 5TJJA 4HOIA 4F3LB 3JYIA 3I7JA 4OPZA 2B02A 2DCFA 4H6JB 2Q9MA 3UDXA 3T1QB 2J8YA 3V5MA 5EVIA 2GZAA 2ZC5B 1O7EA 3HBRA 4MBKA 5FQIA 2K2NA 3LR3A 3SS5A 3ZG8B 3D3OA 4EUVA 3UY6A 1U60A 1GHPA 5CTMA 1KOUA 5CEBA 1O07A 3IHBA 1TS0A 4NG2A 2W3EA 4GN2A 4HBUA 5G18A 5DFXA 1VHMA 3GSGA 3QP5A 3ZVTA 2PU4A 3FKVA 4RA7A 4X1LA 5AQ7A 3C4PA 5HFOA 1STZA 3PTEA 3GQZA 4Y3IA 1XP4A 2W3HA 3VOZA 3UB8A 5FQMA 4HH3A 3DTEA 1TS7A 3LGOA 3N4IA 3PBSA 3BW6A 1Y54A 3Q7ZA 2IA2A 3BM6A 1K56D 3MQQA 5DTTA 4R3BA 3NJAA 4KZBA 4OOYA 4MNRA 3IXBA 5CRFA 4N9LA 3MR0A 3NC8A 3NOTC 1TS8A 3FPWA 5CHUA 2D01A 2PYPA 3EWKA 2Y2PA 3UB7A 1LHYA 5F5YA 3T12B 4BL3A 1KE0A 5FEFA 3F1PB 1JVJA 2J80A 1T1BA 4HJ3A 2WGIA 3QP8A 1MPLA 3CHWP 2OV5A 2PHYA 2B18A 5GLBA 1NLZA 1L2SA 2J9PA 3NOPC 3W4QA 3F1NB 2Z6CA 5CXWA 3RTYA 4GCZA 4WF0A 4Y2FA 2OAP1 5F82A 4KQOA 3BY8A 5DJUA 5EV0A 3R4KA 3LIAA 3UNWA 1PNEA 3OPLA 1ZHHB 4LCLA 1JTGA 4OOMA 2JKRI 1NYMA 3Q81A 3GTCA 1V9ZA 2QPNA 4LRZE 2WKEA 3UB5P 3A3JA 5K5BA 4HJ6A 1I5QA 5HDDA 4JF5A 1DY6A 3G6OA 4JXVA 1W8YA 3ZVWA 1XA1A 1YM1A 1L0EA 4R4SA 2JC7A 4JPMA 3TOIA 2WGVA 3VP3A 2V9AA 4OP8A 1DJAA 5CGSA 2VJWA 1T18A 1S0WA 3LY3A 2QMIA 3HLWA 1LSWA 1L0DA 4DJ3A 1J9MA 3L9KA 4E04A 3BJNA 1KE4A 1MY8A 3NCKA 2Y2LA 2Y2GA 2HF6A 5CHMA 4BL2A 3T1XA 5F1FA 4WZ5A 4WBGA 2HDSA 5CHJA 3S7NA 4E3NA 2L4RA 4HIAA 4FCFA 1ONGA 2A49A 2WKPA 3T4JA 2KX6A 1LI0A 1OT6A 1P9RA 5CX7A 3TSGA 4NKPA 1CK3A 3OOVA 3IH9A 3W4PA 4FH4A 3PR6A 1N4OA 4LRYC 5AQ9A 2HZ5A 1FSYA 1NZUA 4H6JA 4WZ4A 1P0ZA 4U3TA 1GA9A 2OSUA 3B42A 4PHTA 2KOIA 3G34A 3WS2A 4CQHA 3N8LA 1KGGA 4RVAA 1L0FA 4C75A 4R38A 4X25A 4NXEA 5FDSA 1OMEA 3G31A 4WYYA 2OWJA 3H7WB 5DFYA 3ZNTA 1K38A 3BQAA 4FSFA 3VFHA 1YLWA 2ZM0A 2W3GA 1FCNA 3CJMA 2XQZA 2HDUA 4EQIA 4PPRA 4HNBA 3VP2A 3ZCZA 4XXRA 1E3UA 2R9WA 3TE8A 3GECA 5HD3A 3KO6A 1K4FA 4Q0JA 5JYPA 1PZPA 2G2UA 4LV2A 5TBMA 4K91A 4OQGA 1ODVA 4OLDA 3D72A 3KYZA 1MKMA 4BD1A 4NXFA 4ZJ2A 2BLSA 5F83A 3EOIA 3CWFA 2GX5A 4HEFA 1K6RA 4Y13A 3T4LA 4AFIA 3MJQA 2BASA 3G30A 3HLGA 1CQAA 4C3QA 5E2HA 5KSCA 4K08A 2ZM2A 4I39A 1NZOA 1PYYA 3CUEC 4D2OA 4QJGA 2QWSA 3C7VA 4E3JA 3PBOA 3QP1A 3M2JA 4EWFA 2NUPC 2HP9A 1P97A 3LR0A 5IHVA 5HARA 3DW0A 3ZDJA 3S7QA 1S4RA 2XFSA 2XLNA 1Q2PA 4OQHA 4MEZA 3P09A 4UAAA 1G68A 3KYEA 2VGKA 2XRNA 1LT0A 1K54A 1HTZA 3BFFA 1BLHA 4I3JA 5HZHA 1OTEA 3O5YA 2P74A 3SOIA 2JKFA 3IXGA 3N6IA 3Q1FA 4GB7A 2WGWA 3KX0X 4O01A 1D06A 3IWOA 3VMAA 4K0XA 2WGWB 4OONA 2WKIA 3VSKA 2V8CA 3B47A 1H3QA 3A3IA 4Y5FA 1ES4A 1XA7A 3MFXA 4Q0IA 4HESA 4B4ZA 1SDNA 1DRMA 4WELA 1VEUB 3DTIA 4PM8A 1XJ2A 4RX2A 1IKGA 1UGUA 1S6RA 3WWXA 2QKPA 4EEPA 1T1CA 1CI8A 3C38A 3RH8B 1F9IA 3MZEA 5I94A 1BTLA 1S67L 5EM0A 4JGQA 3KSFA 2VZWA 4FTXA 1DJBA 2Z2LB 5FAPA 3O3VA 3RXWA 5FQ9A 1IFQA 3A3EA 1GCEA 4LV0A 5GLAA 4PMAA 3IX8A 4O0PA 3V3RA 3BYDA 3MXRA 3EQVA 2VK3A 1ES5A 3HLBA 3F1PA 4IUKA 5HPFA 1XX2A 2OWHA 4GLQA 5AVEA 2P08A 4L9EA 1SHVA 4G3KA 1NRFA 5EECA 1H8MA 4QY6A 4X6TA 1YLYA 2M1CA 4KZ4A 3D9YA 2W1TB 5HPIA 5CTNA 3E0YA 3UE3A 3PBTA 2PRFA 4DE3A 2O9BA 3N8RA 4MBHA 3DWKA 5AVFA 3C5AA 4OH0A 5CGXA 4U0TA 3ZG0A 4KG2A 4LGWA 4OQIA 1NJ4A 3G2YA 5EUAA 1KVLA 3N8SA 3K3CA 4R1GA 1QMEA 5FASA 2RL3A 2ZBBA 1K0KA 3GV9A 2C5WB 5A90A 1GHIA 2CMNA 3HLCA 4DDYA 3HJKA 3BECA 3PBNA 2JCHA 1E4DA 4Z9QA 3LI9A 3RFBA 2YKFA 4B93A 4FUWA 2XROA 1VEUA 1OTAA 1T1AA 2GDNA 2WKHA 3KSHA 4BMWA 1OPXA 4IUHA 1ES2A 5TBMB 2FH5A 3BEBA 1HLUP 1BLPA 5IS1A 4BWIA 1FILA 1SZVA 1V9YA 3SH8A 3OC2A 1SKOA 4BBTA 4YINA 1WYCA 1ESUA 3P01A 1K56A 1LI9A 4LV3A 2HV1A 5CGWA 2VGLM 1CEFA 3OCLA 4FD8A 4Y7PA 3PXPA 3UPNA 3UE1A 5EVEA 2VA0A 1ESIA 3P98A 3E4QA 2NUTC 2M7VA 3QP6A 5EVIC 3OLOA 3W4OA 4LLOB 4KZ3A 4X53A 3UB6A 1HZOA 4P85A 2V20A 3VV4A 4ESPA 5I5LA 3ZFZA 1JWPA 1TVFA 3WS1A 3NHQA 4B9OA 1GHMA 3ZHHA 1YSPA 2ZQ8A 3E4OA 1ERMA 4F3LA 1OT9A 5CERA 5FL3A 1UWPX 2PYRA 2W3DA 1XGIA 2VV6A 4DXBA 4DRTA 1YAXA 2EWWA 1H5XA 2VLGA 5HWTA 4NEED 1IELA 1E25A 3LIDA 4LPZA 3F1NA 4GZBA 3MF0A 1BLSA 4MN5A 1CEGA 1MXOA 3LEZA 3QP2A 4JXSA 5HAIA 5TR7A 4WL9A 3S22A 2XF3A 3ZG7B 1YMSA 2JN7A 4I3AA 5IT5A 1J3WA 1H8YA 2JBFA 4HP4A 5EOEA 3U2AA 4ZRRA 1RGZA 5EOOA 2EX2A 4MLLA 4N1XA 1LL5A 2WK0A 3MZFA 1QMFA 5CEDA 2JKTI 2HJ9C 2V2FF 4DJ2A 3Q7VA 2ZMAA 4WEKA 1RGYA 4KZ6A 5FEGA 1VB6A 2Y2NA 1D1JA 5DJTA 3FPVA 2X02A 1MWSA 4P0MA 4GOGA 1IYOA 3A3FA 4WMCA 3DTKA 3H82B 4EESA 1EI5A 1PWCA 1Z6FA 3IH8A 3IBRA 3RXXA 4HI4A 1GA0A 3B33A 3L7HA 3SW1A 2L1MA 4I3IA 3BY9A 4JXGA 1LL9A 3UE6A 3HJIA 2ZLYA 1KDWA 2J7VA 4ID4A 2HDQA 3T4KA 5GHXA 4PAUA 1FR6A 3QNBA 4LFUA 1S4SA 2Z2MB 4GD8A 2VKSA 5L8MA 2XSSA 2JE5A 3ICYA 3C2WA 4JF6A 3LIEA 5TGFA 1C3BA 3SH9A 3O87A 2L0WA 1YLPA 4BJPA 3F1OB 2YKHA 3VP0A 1XJ6A 2XDMA 2Y59A 3TRCA 3BLMA 4GJ4A 1BYWA 5GHYA 3MMHA 4PM5A 4R70A 2W1TA 1X0OA 5G4YA 2EFUA 1W63Q 4QD4A 2V0UA 1EROA 4S2LA 1ACFA 3U4LP 1XFNA 4S2KA 3NIAA 2IWBA 1K55A 2WAFA 2EXBA 3EEHA 2XD1A 1S1YA 2HGVA 5BOHA 3MXQA 2VX8A 1K6SA 3A0VA 5L07A 2HJEA 3HUOA 1IYPA 4X68A 4EEUA 4YOFA 5EVID 5AJGA 2ZQDA 3DWZA 3Q7VB 5M18A 2Q9NA 3T4TA 1Z09A 3CI6A 4NXGA 2PBYA 3C4OA 4QWOA 4WN5A 2G7UA 3CG5A 4O7DA 5KIZA 1ZKJA 2QYBA 4BQMA 1OTBA 3IWIA 5HDSA 3ULFA 1SKOB 4UQIM 1N9BA 4N92A 1K25A 1YT4A 3S7PA 2PAVP 2M7UA 2ZOIA 1MWTA 1IOUA 4KQRA 5L09A 4S2IA 3W2ZA 1DP9A 1MC0A 2Y2QA 1JWZA 4JGPA 3MZDA 3PBRA 4R0QA 4F94A 4ETXA 5M1AA 4OKPA 5DF8A 5GL9A 2UV0E 4PM7A 1ERQA 3JPUA 2INWA 3WS0A 1PFLA 4S2NA 4A5RA 1W8QA 3C30A 2ZQ7A 3LICA 2E8JA 5A91A 4DDSA 2QJ7A 1NLYA 3WRTA 1MKIA 2DRWA 1FOFA 1G6AA 4IBXA 5EE8A 2P9VB 4E3OA 4GW9A 4HH2A 2GNXA 4RYEA 4Q8IA 3Q82A 5J7EA 1YSQA 1OTIA 3FKWA 4CJNA 3ZG5A 1YLJA 4CLCC 4MCWA 1XKZA 4GDNA 1K54C 5FATA 3UE0A 1NYYA 4HQAA 1L3LA 3MKEA 2WAEA 2ZM8A 4DE1A 5DTSA 3N7WA 2Y2HA 2Y79A 1LLBA 1WE4A 4PM6A 2Y4AA 1BZAA 1BSGA 1IEMA 4H8RA 5EM1A 1K55C 3UDIA 3UMDA 2ZL1A 4E3LA 2FFFB 3VSLA 2BG1A 4B4XA 3GVBA 4BENA 3WS4A 4EXOA 2GJ3A 2ZQCA 3IT9A 4Z1WA 1FCMA 2JHEA 2E8IA 2X01A 2CC1A 3UDFA 2PR6A 4OPRA 1S1ZA 4CLCA 4CPKA
chains in the Genus database with same CATH topology
2JCHA 3VP4A 1E4DA 1L2SA 2J9PA 4Z9QA 4E6WA 2EXAA 5AQAA 3W4QA 1NXYA 2GDNA 2WADA 2WKHA 1RCJA 4ZTKA 1TDLA 5M19A 4R4RA 5CXWA 2ZQ9A 3DTMA 4IBRA 1ES2A 3MKFA 3BEBA 5DF9A 5F82A 4BD0A 1BLPA 4KQOA 5FQJA 1KE3A 2UWXA 3SH8A 3OC2A 4YINA 3OZHA 1WYCA 1ESUA 3BFCA 1K56A 1KGEA 3HLDA 3RJUA 4Y0TA 1LI9A 4LV3A 4S2NC 4Y0UA 1KGFA 5CGWA 2J9OA 1CEFA 3OCLA 4FD8A 4BLMA 3UNWA 3G4PA 3OPRA 4Y7PA 3UPNA 3BFEA 3ZFZA 3OPLA 2P9VA 2XR0A 3IQAA 3ITAA 1JTGA 4LCLA 4OOMA 1M6KA 3UE1A 1NYMA 2ZJ9A 4NK3A 1ESIA 3AGFA 3VFFA 3Q81A 3GTCA 3P98A 4UA7A 3O88A 4X56A 2QPNA 2Y2OA 2WKEA 3A3JA 3EQUA 2IWCA 1I5QA 1MWUA 5EVIC 5L2FA 3GR2A 3IF5A 5EVLA 4FH2A 3W4OA 1PZOA 4KZ3A 4Y0OA 2EFXA 1DY6A 4JF5A 4X53A 3OCNA 2ZQAA 2X71A 3G32A 4EUZA 4GDBA 5DVAA 1HZOA 2H5SA 4XUXA 4JXVA 4P85A 1W8YA 2V20A 1XA1A 3ZVWA 1YM1A 5HAPA 3V39A 2ZC6B 1KVMA 1L0EA 2EX6A 2JC7A 4JPMA 1JWPA 1TVFA 3HL9A 2WGVA 4R4SA 3TOIA 3VP3A 3WS1A 4GD6A 4C6YA 2HP6A 4E3IA 5HW3A 1GHMA 3BLSA 5GLDA 4OP8A 1DJAA 4KZAA 5CGSA 3ZHHA 4QHCA 5U47A 4S2OA 1S0WA 3LY3A 5DTKA 2QMIA 2ZQ8A 1YLTA 4U0XA 3ISGA 1ERMA 3ZGAB 4DXCA 3HLWA 1L0DA 1XPBA 5CERA 2RCXA 1K57C 4RX3A 1J9MA 5FI2A 1KE4A 1MY8A 3NCKA 1XGIA 4KZ7A 2Y2LA 1YQSA 2Y2GA 1ONHA 4DXBA 4DRTA 5E2GA 5CHMA 4S2JA 4BL2A 1H5XA 2WZZA 5D3OA 1IELA 1VQQA 1E25A 3VP1A 4EBPA 2Y2MA 5F1FA 4WZ5A 4X55A 4GNUA 4GZBA 4WBGA 1E3UD 2HDSA 1NY0A 1BLSA 3IF6A 5CHJA 3S1YA 4E3NA 2H10A 3UPOA 4JXWA 1XGJA 4FCFA 1CEGA 1MXOA 1ONGA 3LEZA 3M2KA 2A49A 4OPQA 4ZJ1A 1SDEA 3IHAA 4S2PA 3C7UA 4JXSA 3UPPA 4JLFA 5HAIA 5TR7A 1LI0A 3S22A 2XF3A 3ZG7B 4QY5A 4XUZA 4N9KA 3TSGA 1YMSA 4B88A 3NDGA 4EV4A 4R23A 4ZAMA 3E2LA 5GHZA 2QZ6A 1CK3A 1IYSA 4OVDA 4P87A 3IH9A 4PM9A 3W4PA 4FH4A 1H8YA 2JBFA 2ZC7A 3TG9A 5EOEA 1N4OA 4DE0A 4E3MA 5AQ9A 1KDSA 3HLEA 4WM9A 4K0WA 1FSYA 1NZUA 1RGZA 5A92A 4WZ4A 5EOOA 4U3TA 1GA9A 5KZHA 2EX2A 4MLLA 4N1XA 1LL5A 1FCOA 3UN7A 2OSUA 2WK0A 2ZC4B 3G34A 3MZFA 3HVFA 1BULA 1QMFA 5CEDA 5EPHA 2V2FF 3WS2A 3MXSA 3Q7VA 1JWVA 2ZMAA 3N8LA 4KG6A 1KGGA 4LENA 5JYOA 4RVAA 1L0FA 1IKIA 1RGYA 4WEKA 4KZ6A 3D4FA 4C75A 4KZ9A 1TEMA 4JBFA 2G2WA 2Y2NA 1OMEA 3G31A 4WYYA 2V1ZA 4EBNA 4X69A 3ZNTA 1K38A 2X02A 1MWSA 3NY4A 4NETA 4P0MA 5J8XA 4GOGA 4FSFA 3VFHA 1IYOA 2HPBA 3A3FA 3M6HA 1YLWA 4WMCA 2ZM0A 2OLVA 5DF7A 5FI6A 3IXDA 3FV7A 1FCNA 2Y91A 4ZJ3A 1EI5A 1BT5A 1PWCA 1Z6FA 3CJMA 2C6WB 3IH8A 2XQZA 3RXXA 1HVBA 1GA0A 2HDUA 4EQIA 4PPRA 3VP2A 3ZCZA 2XD5A 5KSHA 4QB8A 4P6BA 3NBLA 4XXRA 4JXGA 1LL9A 1E3UA 4MBFA 2R9WA 2ZLYA 3W8KA 5E2FA 1KDWA 2J7VA 4ID4A 3ZNYA 4ZBEA 1K4EA 2HDQA 1K4FA 4KQQA 1YLZA 5JYPA 1PZPA 3MFDA 5GLBA 2G2UA 5GHXA 4LV2A 4OQ0A 5E2EA 3E2KA 3GRJA 3SS4A 1FR6A 4K91A 4UA6A 3QNBA 4E6XA 4OQGA 2B5RA 4OLDA 4DF6A 4DDYA 2Z2MB 4KZ5A 2EX9A 4GD8A 5A93A 4BD1A 1WYBA 4ZJ2A 1XXMA 2BLSA 4M3KA 5F83A 2XEPA 2JE5A 1H8ZA 4IVIA 1CI9A 1YMXA 2HP5A 3S4XA 3IWQA 1M40A 4JF6A 2H0YA 2FFYA 5TGFA 1C3BA 3SH9A 4HEFA 4KG5A 3O87A 1K6RA 1YLPA 2A3UA 2I72A 4BJPA 1L0GA 4DE2A 1FQGA 1PWGA 3VP0A 3G30A 4QU3A 3HLGA 3PAGA 4C3QA 2XDMA 1SCWA 2Y59A 3BLMA 3LY4A 5E2HA 5GHYA 3CZDA 4S2MA 4PM5A 5KSCA 1W7FA 1PI5A 1I2WA 3Q07A 4OOLA 4EBLA 2ZM2A 3AGEA 2EFUA 4KZ8A 1NZOA 1PYYA 2ZD8A 3ZG9B 4QD4A 3LCEA 3V50A 4D2OA 3WS5A 1EROA 1DJCA 4QJGA 4S2LA 3C7VA 5HL1A 4E3JA 3PBOA 1ZG6A 2IWDA 3M2JA 4EWFA 4S2KA 3QNCA 1PW1A 3NIAA 5FI7A 2HP9A 1RP5A 2IWBA 4JKTA 5IHVA 5HARA 3DW0A 3ZDJA 3B3XA 1I2SA 1K55A 3MBZA 2WAFA 2EXBA 1BLCA 2XFSA 1PW8A 4LCMA 1JTDA 3PAEA 2XLNA 1Q2PA 2XD1A 4OQHA 3WRZA 4MEZA 3P09A 4L0LA 5TFQA 2Y2KA 1VM1A 5BOHA 4UAAA 1G68A 3G35A 1EWZA 1PI4A 4N1HA 3ITBA 5FAQA 1HD8A 1K6SA 2VGKA 3IF6C 4OP5A 3SH7A 3HUOA 1IYPA 2WYXA 4X68A 2Y55A 5EVID 5AQBA 3CMZA 2ZQDA 3DWZA 3Q7VB 1K54A 1HTZA 5M18A 3BFFA 1BLHA 2Q9NA 2P74A 3SOIA 1ZC2A 3GMWA 2ZC3B 3G2ZA 3VOYA 4IVKA 2HDRA 1K57A 1ALQA 2H0TA 3NDEA 3IXGA 3N6IA 3HUNA 2PBYA 3C4OA 3FYZA 3Q1FA 4GB7A 2WZXA 2WGWA 3SS3A 3HUMA 3CG5A 3IWOA 4O7DA 4K0XA 3VMAA 1ZKJA 3M6BA 4BQMA 1PIOA 2WGWB 1FSWA 4OONA 3BFDA 4OPYA 2WKIA 3VSKA 3IWIA 1MBLA 5HAQA 5KMWA 3A3IA 4IEDA 4DKIA 2EX8A 1N9BA 4N92A 3QHYA 1ES4A 1K25A 1XA7A 1ES3A 3JYIA 1YT4A 4OLGA 3I7JA 4OPZA 4HESA 3PBQA 1MWTA 2DCFA 4KQRA 4B4ZA 2XFTA 1SDNA 2Q9MA 2VGJA 3UDXA 4WZ5C 4S2IA 3OPHA 2J8YA 4R3JA 3V5MA 5EVIA 2Y2QA 1JWZA 5F1GA 4WELA 2ZC5B 3MZDA 3PBRA 4WMCD 1O7EA 3HBRA 4R0QA 5FDHA 4F94A 5FSRA 4PM8A 4MBKA 4RX2A 5M1AA 4OKPA 1IKGA 5FA7A 4GKUA 5FQIA 5DF8A 5GL9A 3SS5A 3ZG8B 1PWDA 4PM7A 2OLUA 1ERQA 1S6RA 3WWXA 3WS0A 3UY6A 1ZG4A 1CI8A 1U60A 1GHPA 4S2NA 5CTMA 5CEBA 3MZEA 5I94A 1BTLA 1O07A 4A5RA 1W8QA 5FQQA 3IHBA 2ZQ7A 1BUEA 4GN2A 4HBUA 5A91A 4DDSA 5G18A 1DJBA 2Z2LB 1SKFA 3WRTA 1MWRA 4LV1A 5FAPA 5HX9A 1MKIA 3O3VA 3RXWA 2DRWA 1FOFA 1G6AA 4IBXA 5FQ9A 3GSGA 2XK1A 5EE8A 2P9VB 3A3EA 4E3OA 1GCEA 4LV0A 5EVIB 5GLAA 1AXBA 3ZVTA 2PU4A 3FKVA 4KENB 4RA7A 4RYEA 4PMAA 1IYQA 5AQ7A 4Q8IA 1W5DA 3FWLA 4UA9A 3Q82A 3C4PA 5HFOA 2XGNA 3PTEA 3V3RA 3FKWA 4CJNA 3BYDA 5GLCA 3IF6B 3MXRA 3ZG5A 1YLJA 4HBTA 4E3KA 3GQZA 3EQVA 3HREA 3HLFA 1ES5A 1XP4A 2PU2A 1XKZA 4GDNA 4WEJA 3HLBA 1K54C 5FATA 3O86A 3UE0A 1XX2A 2Y2IA 3V3SA 1NYYA 3VOZA 3AGDA 3MKEA 1SHVA 2WAEA 2ZM8A 5FQMA 1NRFA 3N4IA 4DE1A 5EECA 4QY6A 5DTSA 3N7WA 4X6TA 1YLYA 3PBSA 1TDGA 2Y2HA 4KZ4A 1Y54A 5CTNA 3Q7ZA 3BM6A 1K56D 1LLBA 1WE4A 4PM6A 2Y4AA 3UE3A 4ZDXA 1BZAA 5DTTA 4YFMA 3NI9A 3PBTA 4R3BA 4DE3A 4KZBA 4OOYA 1BSGA 1IEMA 4H8RA 3A3DA 3FZCA 3N8RA 1K55C 3UDIA 5CECA 5FQKA 4MBHA 1FR1A 3DWKA 4E3LA 2DNSA 3C5AA 4MNRA 2FFFB 3IXBA 4OH0A 5CGXA 4N9LA 5CRFA 4U0TA 3ZG0A 3NC8A 3VSLA 4KG2A 5CHUA 2BG1A 3IXHA 1NJ4A 4OQIA 3G2YA 2Y2PA 3BRMA 5EUAA 1KVLA 3OPPA 4B4XA 3LO7A 1LHYA 3N8SA 3GVBA 5E43A 4R1GA 3BFGA 4BENA 4JF4A 2R9XA 3WS4A 3UO9A 4BL3A 1QMEA 2ZQCA 5FASA 1W79A 1KE0A 2RL3A 3IT9A 1JVJA 1FCMA 3GV9A 2E8IA 1Q2QA 2WGIA 1MPLA 2C5WB 5FAOA 5A90A 2X01A 2CC1A 2WUQA 2OV5A 1GHIA 3UDFA 3HLCA 2XH9A 4OPRA 4UHUA 4CPKA 3BECA 2Y2JA 3PBNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JCH A;  3VP4 A;  1E4D A;  1L2S A;  2J9P A;  4Z9Q A;  4E6W A;  2EXA A;  5AQA A;  3W4Q A;  1NXY A;  2GDN A;  2WAD A;  2WKH A;  1RCJ A;  4ZTK A;  1TDL A;  5M19 A;  4R4R A;  5CXW A;  2ZQ9 A;  3DTM A;  4IBR A;  1ES2 A;  3MKF A;  3BEB A;  5DF9 A;  5F82 A;  4BD0 A;  1BLP A;  4KQO A;  5FQJ A;  1KE3 A;  2UWX A;  3SH8 A;  3OC2 A;  4YIN A;  3OZH A;  1WYC A;  1ESU A;  3BFC A;  1K56 A;  1KGE A;  3HLD A;  3RJU A;  4Y0T A;  1LI9 A;  4LV3 A;  4S2N C;  4Y0U A;  1KGF A;  5CGW A;  2J9O A;  1CEF A;  3OCL A;  4FD8 A;  4BLM A;  3UNW A;  3G4P A;  3OPR A;  4Y7P A;  3UPN A;  3BFE A;  3ZFZ A;  3OPL A;  2P9V A;  2XR0 A;  3IQA A;  3ITA A;  1JTG A;  4LCL A;  4OOM A;  1M6K A;  3UE1 A;  1NYM A;  2ZJ9 A;  4NK3 A;  1ESI A;  3AGF A;  3VFF A;  3Q81 A;  3GTC A;  3P98 A;  4UA7 A;  3O88 A;  4X56 A;  2QPN A;  2Y2O A;  2WKE A;  3A3J A;  3EQU A;  2IWC A;  1I5Q A;  1MWU A;  5EVI C;  5L2F A;  3GR2 A;  3IF5 A;  5EVL A;  4FH2 A;  3W4O A;  1PZO A;  4KZ3 A;  4Y0O A;  2EFX A;  1DY6 A;  4JF5 A;  4X53 A;  3OCN A;  2ZQA A;  2X71 A;  3G32 A;  4EUZ A;  4GDB A;  5DVA A;  1HZO A;  2H5S A;  4XUX A;  4JXV A;  4P85 A;  1W8Y A;  2V20 A;  1XA1 A;  3ZVW A;  1YM1 A;  5HAP A;  3V39 A;  2ZC6 B;  1KVM A;  1L0E A;  2EX6 A;  2JC7 A;  4JPM A;  1JWP A;  1TVF A;  3HL9 A;  2WGV A;  4R4S A;  3TOI A;  3VP3 A;  3WS1 A;  4GD6 A;  4C6Y A;  2HP6 A;  4E3I A;  5HW3 A;  1GHM A;  3BLS A;  5GLD A;  4OP8 A;  1DJA A;  4KZA A;  5CGS A;  3ZHH A;  4QHC A;  5U47 A;  4S2O A;  1S0W A;  3LY3 A;  5DTK A;  2QMI A;  2ZQ8 A;  1YLT A;  4U0X A;  3ISG A;  1ERM A;  3ZGA B;  4DXC A;  3HLW A;  1L0D A;  1XPB A;  5CER A;  2RCX A;  1K57 C;  4RX3 A;  1J9M A;  5FI2 A;  1KE4 A;  1MY8 A;  3NCK A;  1XGI A;  4KZ7 A;  2Y2L A;  1YQS A;  2Y2G A;  1ONH A;  4DXB A;  4DRT A;  5E2G A;  5CHM A;  4S2J A;  4BL2 A;  1H5X A;  2WZZ A;  5D3O A;  1IEL A;  1VQQ A;  1E25 A;  3VP1 A;  4EBP A;  2Y2M A;  5F1F A;  4WZ5 A;  4X55 A;  4GNU A;  4GZB A;  4WBG A;  1E3U D;  2HDS A;  1NY0 A;  1BLS A;  3IF6 A;  5CHJ A;  3S1Y A;  4E3N A;  2H10 A;  3UPO A;  4JXW A;  1XGJ A;  4FCF A;  1CEG A;  1MXO A;  1ONG A;  3LEZ A;  3M2K A;  2A49 A;  4OPQ A;  4ZJ1 A;  1SDE A;  3IHA A;  4S2P A;  3C7U A;  4JXS A;  3UPP A;  4JLF A;  5HAI A;  5TR7 A;  1LI0 A;  3S22 A;  2XF3 A;  3ZG7 B;  4QY5 A;  4XUZ A;  4N9K A;  3TSG A;  1YMS A;  4B88 A;  3NDG A;  4EV4 A;  4R23 A;  4ZAM A;  3E2L A;  5GHZ A;  2QZ6 A;  1CK3 A;  1IYS A;  4OVD A;  4P87 A;  3IH9 A;  4PM9 A;  3W4P A;  4FH4 A;  1H8Y A;  2JBF A;  2ZC7 A;  3TG9 A;  5EOE A;  1N4O A;  4DE0 A;  4E3M A;  5AQ9 A;  1KDS A;  3HLE A;  4WM9 A;  4K0W A;  1FSY A;  1NZU A;  1RGZ A;  5A92 A;  4WZ4 A;  5EOO A;  4U3T A;  1GA9 A;  5KZH A;  2EX2 A;  4MLL A;  4N1X A;  1LL5 A;  1FCO A;  3UN7 A;  2OSU A;  2WK0 A;  2ZC4 B;  3G34 A;  3MZF A;  3HVF A;  1BUL A;  1QMF A;  5CED A;  5EPH A;  2V2F F;  3WS2 A;  3MXS A;  3Q7V A;  1JWV A;  2ZMA A;  3N8L A;  4KG6 A;  1KGG A;  4LEN A;  5JYO A;  4RVA A;  1L0F A;  1IKI A;  1RGY A;  4WEK A;  4KZ6 A;  3D4F A;  4C75 A;  4KZ9 A;  1TEM A;  4JBF A;  2G2W A;  2Y2N A;  1OME A;  3G31 A;  4WYY A;  2V1Z A;  4EBN A;  4X69 A;  3ZNT A;  1K38 A;  2X02 A;  1MWS A;  3NY4 A;  4NET A;  4P0M A;  5J8X A;  4GOG A;  4FSF A;  3VFH A;  1IYO A;  2HPB A;  3A3F A;  3M6H A;  1YLW A;  4WMC A;  2ZM0 A;  2OLV A;  5DF7 A;  5FI6 A;  3IXD A;  3FV7 A;  1FCN A;  2Y91 A;  4ZJ3 A;  1EI5 A;  1BT5 A;  1PWC A;  1Z6F A;  3CJM A;  2C6W B;  3IH8 A;  2XQZ A;  3RXX A;  1HVB A;  1GA0 A;  2HDU A;  4EQI A;  4PPR A;  3VP2 A;  3ZCZ A;  2XD5 A;  5KSH A;  4QB8 A;  4P6B A;  3NBL A;  4XXR A;  4JXG A;  1LL9 A;  1E3U A;  4MBF A;  2R9W A;  2ZLY A;  3W8K A;  5E2F A;  1KDW A;  2J7V A;  4ID4 A;  3ZNY A;  4ZBE A;  1K4E A;  2HDQ A;  1K4F A;  4KQQ A;  1YLZ A;  5JYP A;  1PZP A;  3MFD A;  5GLB A;  2G2U A;  5GHX A;  4LV2 A;  4OQ0 A;  5E2E A;  3E2K A;  3GRJ A;  3SS4 A;  1FR6 A;  4K91 A;  4UA6 A;  3QNB A;  4E6X A;  4OQG A;  2B5R A;  4OLD A;  4DF6 A;  4DDY A;  2Z2M B;  4KZ5 A;  2EX9 A;  4GD8 A;  5A93 A;  4BD1 A;  1WYB A;  4ZJ2 A;  1XXM A;  2BLS A;  4M3K A;  5F83 A;  2XEP A;  2JE5 A;  1H8Z A;  4IVI A;  1CI9 A;  1YMX A;  2HP5 A;  3S4X A;  3IWQ A;  1M40 A;  4JF6 A;  2H0Y A;  2FFY A;  5TGF A;  1C3B A;  3SH9 A;  4HEF A;  4KG5 A;  3O87 A;  1K6R A;  1YLP A;  2A3U A;  2I72 A;  4BJP A;  1L0G A;  4DE2 A;  1FQG A;  1PWG A;  3VP0 A;  3G30 A;  4QU3 A;  3HLG A;  3PAG A;  4C3Q A;  2XDM A;  1SCW A;  2Y59 A;  3BLM A;  3LY4 A;  5E2H A;  5GHY A;  3CZD A;  4S2M A;  4PM5 A;  5KSC A;  1W7F A;  1PI5 A;  1I2W A;  3Q07 A;  4OOL A;  4EBL A;  2ZM2 A;  3AGE A;  2EFU A;  4KZ8 A;  1NZO A;  1PYY A;  2ZD8 A;  3ZG9 B;  4QD4 A;  3LCE A;  3V50 A;  4D2O A;  3WS5 A;  1ERO A;  1DJC A;  4QJG A;  4S2L A;  3C7V A;  5HL1 A;  4E3J A;  3PBO A;  1ZG6 A;  2IWD A;  3M2J A;  4EWF A;  4S2K A;  3QNC A;  1PW1 A;  3NIA A;  5FI7 A;  2HP9 A;  1RP5 A;  2IWB A;  4JKT A;  5IHV A;  5HAR A;  3DW0 A;  3ZDJ A;  3B3X A;  1I2S A;  1K55 A;  3MBZ A;  2WAF A;  2EXB A;  1BLC A;  2XFS A;  1PW8 A;  4LCM A;  1JTD A;  3PAE A;  2XLN A;  1Q2P A;  2XD1 A;  4OQH A;  3WRZ A;  4MEZ A;  3P09 A;  4L0L A;  5TFQ A;  2Y2K A;  1VM1 A;  5BOH A;  4UAA A;  1G68 A;  3G35 A;  1EWZ A;  1PI4 A;  4N1H A;  3ITB A;  5FAQ A;  1HD8 A;  1K6S A;  2VGK A;  3IF6 C;  4OP5 A;  3SH7 A;  3HUO A;  1IYP A;  2WYX A;  4X68 A;  2Y55 A;  5EVI D;  5AQB A;  3CMZ A;  2ZQD A;  3DWZ A;  3Q7V B;  1K54 A;  1HTZ A;  5M18 A;  3BFF A;  1BLH A;  2Q9N A;  2P74 A;  3SOI A;  1ZC2 A;  3GMW A;  2ZC3 B;  3G2Z A;  3VOY A;  4IVK A;  2HDR A;  1K57 A;  1ALQ A;  2H0T A;  3NDE A;  3IXG A;  3N6I A;  3HUN A;  2PBY A;  3C4O A;  3FYZ A;  3Q1F A;  4GB7 A;  2WZX A;  2WGW A;  3SS3 A;  3HUM A;  3CG5 A;  3IWO A;  4O7D A;  4K0X A;  3VMA A;  1ZKJ A;  3M6B A;  4BQM A;  1PIO A;  2WGW B;  1FSW A;  4OON A;  3BFD A;  4OPY A;  2WKI A;  3VSK A;  3IWI A;  1MBL A;  5HAQ A;  5KMW A;  3A3I A;  4IED A;  4DKI A;  2EX8 A;  1N9B A;  4N92 A;  3QHY A;  1ES4 A;  1K25 A;  1XA7 A;  1ES3 A;  3JYI A;  1YT4 A;  4OLG A;  3I7J A;  4OPZ A;  4HES A;  3PBQ A;  1MWT A;  2DCF A;  4KQR A;  4B4Z A;  2XFT A;  1SDN A;  2Q9M A;  2VGJ A;  3UDX A;  4WZ5 C;  4S2I A;  3OPH A;  2J8Y A;  4R3J A;  3V5M A;  5EVI A;  2Y2Q A;  1JWZ A;  5F1G A;  4WEL A;  2ZC5 B;  3MZD A;  3PBR A;  4WMC D;  1O7E A;  3HBR A;  4R0Q A;  5FDH A;  4F94 A;  5FSR A;  4PM8 A;  4MBK A;  4RX2 A;  5M1A A;  4OKP A;  1IKG A;  5FA7 A;  4GKU A;  5FQI A;  5DF8 A;  5GL9 A;  3SS5 A;  3ZG8 B;  1PWD A;  4PM7 A;  2OLU A;  1ERQ A;  1S6R A;  3WWX A;  3WS0 A;  3UY6 A;  1ZG4 A;  1CI8 A;  1U60 A;  1GHP A;  4S2N A;  5CTM A;  5CEB A;  3MZE A;  5I94 A;  1BTL A;  1O07 A;  4A5R A;  1W8Q A;  5FQQ A;  3IHB A;  2ZQ7 A;  1BUE A;  4GN2 A;  4HBU A;  5A91 A;  4DDS A;  5G18 A;  1DJB A;  2Z2L B;  1SKF A;  3WRT A;  1MWR A;  4LV1 A;  5FAP A;  5HX9 A;  1MKI A;  3O3V A;  3RXW A;  2DRW A;  1FOF A;  1G6A A;  4IBX A;  5FQ9 A;  3GSG A;  2XK1 A;  5EE8 A;  2P9V B;  3A3E A;  4E3O A;  1GCE A;  4LV0 A;  5EVI B;  5GLA A;  1AXB A;  3ZVT A;  2PU4 A;  3FKV A;  4KEN B;  4RA7 A;  4RYE A;  4PMA A;  1IYQ A;  5AQ7 A;  4Q8I A;  1W5D A;  3FWL A;  4UA9 A;  3Q82 A;  3C4P A;  5HFO A;  2XGN A;  3PTE A;  3V3R A;  3FKW A;  4CJN A;  3BYD A;  5GLC A;  3IF6 B;  3MXR A;  3ZG5 A;  1YLJ A;  4HBT A;  4E3K A;  3GQZ A;  3EQV A;  3HRE A;  3HLF A;  1ES5 A;  1XP4 A;  2PU2 A;  1XKZ A;  4GDN A;  4WEJ A;  3HLB A;  1K54 C;  5FAT A;  3O86 A;  3UE0 A;  1XX2 A;  2Y2I A;  3V3S A;  1NYY A;  3VOZ A;  3AGD A;  3MKE A;  1SHV A;  2WAE A;  2ZM8 A;  5FQM A;  1NRF A;  3N4I A;  4DE1 A;  5EEC A;  4QY6 A;  5DTS A;  3N7W A;  4X6T A;  1YLY A;  3PBS A;  1TDG A;  2Y2H A;  4KZ4 A;  1Y54 A;  5CTN A;  3Q7Z A;  3BM6 A;  1K56 D;  1LLB A;  1WE4 A;  4PM6 A;  2Y4A A;  3UE3 A;  4ZDX A;  1BZA A;  5DTT A;  4YFM A;  3NI9 A;  3PBT A;  4R3B A;  4DE3 A;  4KZB A;  4OOY A;  1BSG A;  1IEM A;  4H8R A;  3A3D A;  3FZC A;  3N8R A;  1K55 C;  3UDI A;  5CEC A;  5FQK A;  4MBH A;  1FR1 A;  3DWK A;  4E3L A;  2DNS A;  3C5A A;  4MNR A;  2FFF B;  3IXB A;  4OH0 A;  5CGX A;  4N9L A;  5CRF A;  4U0T A;  3ZG0 A;  3NC8 A;  3VSL A;  4KG2 A;  5CHU A;  2BG1 A;  3IXH A;  1NJ4 A;  4OQI A;  3G2Y A;  2Y2P A;  3BRM A;  5EUA A;  1KVL A;  3OPP A;  4B4X A;  3LO7 A;  1LHY A;  3N8S A;  3GVB A;  5E43 A;  4R1G A;  3BFG A;  4BEN A;  4JF4 A;  2R9X A;  3WS4 A;  3UO9 A;  4BL3 A;  1QME A;  2ZQC A;  5FAS A;  1W79 A;  1KE0 A;  2RL3 A;  3IT9 A;  1JVJ A;  1FCM A;  3GV9 A;  2E8I A;  1Q2Q A;  2WGI A;  1MPL A;  2C5W B;  5FAO A;  5A90 A;  2X01 A;  2CC1 A;  2WUQ A;  2OV5 A;  1GHI A;  3UDF A;  3HLC A;  2XH9 A;  4OPR A;  4UHU A;  4CPK A;  3BEC A;  2Y2J A;  3PBN A; 
#chains in the Genus database with same CATH topology
 3H82 A;  4R3A A;  5AQA A;  2WAD A;  4ZTK A;  3BQ8 A;  5M19 A;  2J3T D;  4IBR A;  1G5U A;  3MKF A;  1WA9 A;  1OTD A;  5FQJ A;  4G3W A;  3BFC A;  4Y0T A;  5HWW A;  4S2N C;  3R7W B;  1KGF A;  2J9O A;  2PD8 A;  3BFE A;  3F1O A;  4ETZ A;  2P9V A;  5EFW A;  4DMZ A;  3K2N A;  1M6K A;  4MDZ A;  3VFF A;  3O88 A;  1N9N A;  2Y2O A;  4X56 A;  2IWC A;  3ZQ5 A;  4PKY G;  3IF5 A;  5EVL A;  4Y0O A;  2EFX A;  2ZQA A;  4GDB A;  5DVA A;  5F69 A;  2H5S A;  4XUX A;  1XFQ A;  5HAP A;  2ZC6 B;  2EX6 A;  4UA7 A;  3HL9 A;  4GD6 A;  2HP6 A;  4E3I A;  3IS2 A;  3BLS A;  4P6Z S;  5GLD A;  4KZA A;  4QHC A;  3CPT A;  5U47 A;  4S2O A;  5DTK A;  4U0X A;  1YLT A;  3ISG A;  4DXC A;  4XT2 B;  1XPB A;  2RCX A;  4KZ7 A;  1YQS A;  1ONH A;  3A0S A;  2W3F A;  4S2J A;  3LR4 A;  2WZZ A;  1VQQ A;  5DKL A;  3H7W A;  3V67 A;  4NXB A;  4X55 A;  4GNU A;  2ZMF A;  3IF6 A;  2H10 A;  3UPO A;  4JXW A;  4ZJ1 A;  4S2P A;  3C7U A;  1CJF A;  4MN6 A;  3UPP A;  4JLF A;  2FZ0 A;  4XUZ A;  4N9K A;  3NDG A;  4EV4 A;  4R23 A;  4ZAM A;  3E2L A;  2QZ6 A;  1IYS A;  4OVD A;  3EGD C;  4QPR A;  4E3M A;  4FOF A;  2I9V A;  4RQ9 A;  4ME4 A;  5F68 A;  5KZH A;  3K3D A;  3HVF A;  5EPH A;  3LFV A;  4CLC D;  3MXS A;  4G3V A;  5JYO A;  1IKI A;  4JBF A;  3DBA A;  4EBN A;  3QP4 A;  4X69 A;  3NY4 A;  5J8X A;  2W0N A;  1F98 A;  4NET A;  2HPB A;  2O0Y A;  1F5M A;  5FI6 A;  3FV7 A;  2Y91 A;  1BT5 A;  2C6W B;  2A24 B;  2O9C A;  5A8B A;  2XD5 A;  4QB8 A;  4P6B A;  3NBL A;  2AVX A;  4MBF A;  5C5K A;  3CUE A;  3W8K A;  5E2F A;  1K4E A;  4KQQ A;  5E2E A;  3E2K A;  2W27 A;  3FG8 A;  4E6X A;  4DF6 A;  1D7E A;  2EX9 A;  1WYB A;  3IBJ A;  1XXM A;  5IU1 A;  2XEP A;  1PRQ A;  1H8Z A;  3IS2 B;  3S7O A;  2HP5 A;  1YMX A;  3S4X A;  3TJZ C;  2FFY A;  1XJ4 A;  4KG5 A;  2OAQ 1;  4KUK A;  2A3U A;  2I72 A;  2O9A A;  1L0G A;  4DE2 A;  2K31 A;  3MSH A;  1PWG A;  4QU3 A;  3PAG A;  1SCW A;  2V1A A;  3Q07 A;  3JVV A;  4EBL A;  3AGE A;  4O8G A;  2ZD8 A;  4M4X A;  3LCE A;  3V50 A;  3WS5 A;  1ZG6 A;  1CF0 A;  2ZL1 B;  3LI8 A;  4X1M A;  3QNC A;  1PW1 A;  1RP5 A;  4JKT A;  2ZMV A;  1DP8 A;  1VET A;  1PW8 A;  4LCM A;  4EU0 A;  4LRX C;  5TFQ A;  4L0L A;  2MJ6 A;  2Y2K A;  1VM1 A;  1LSV A;  4YWZ A;  1EWZ A;  4N1H A;  4EW7 A;  3ITB A;  5FAQ A;  4CLC B;  3IF6 C;  3SH7 A;  4IJG A;  2WYX A;  4Y15 A;  2P7J A;  3NOU C;  3DAV A;  5AQB A;  2VV8 A;  1Y4O A;  3MQ0 A;  1MZU A;  3G2Z A;  2WKQ A;  3VOY A;  2HDR A;  1K57 A;  2H0T A;  2PD7 A;  4DN0 A;  4I5S A;  3FYZ A;  2D02 A;  3HUM A;  2V1B A;  3EGX C;  1FSW A;  4OPY A;  2PR5 A;  2PDR A;  3GDI A;  5HAQ A;  4DKI A;  2EX8 A;  2J3W A;  3QHY A;  1A0K A;  1UWN X;  1ES3 A;  4OLG A;  2ZOH A;  3PBQ A;  2WKR A;  3R7W A;  2XFT A;  4HP9 A;  2VGJ A;  2R78 A;  3LYX A;  4WZ5 C;  3OPH A;  4R3J A;  2VEA A;  2W1R A;  4EER A;  5F1G A;  4WMC D;  5FDH A;  3LIF A;  2JKT M;  5FSR A;  5FA7 A;  4GKU A;  4GS9 B;  2V8F A;  1PWD A;  1N9L A;  2OLU A;  4BBV A;  1ZG4 A;  2PT7 A;  3UME A;  3FC7 A;  5FQQ A;  1BUE A;  1SKF A;  3UB9 A;  3LUQ A;  1MWR A;  4LV1 A;  5HX9 A;  2ACG A;  3T50 A;  2XK1 A;  1LL8 A;  2Y8H A;  5EVI B;  3ZYT A;  2LB9 A;  4XT2 A;  1AXB A;  4KEN B;  1IYQ A;  1GSW A;  1W5D A;  3FWL A;  3T4Q A;  4UA9 A;  2XGN A;  5GLC A;  3IF6 B;  4HBT A;  4E3K A;  3HRE A;  4HHD A;  3HLF A;  2PU2 A;  3JVU A;  4WEJ A;  3E98 A;  3O86 A;  3IX4 A;  2QJ5 A;  2Y2I A;  3V3S A;  2XA7 S;  3AGD A;  1TDG A;  3T1S A;  4BBU A;  4ZDX A;  4YFM A;  3NI9 A;  3HCY A;  3KSG A;  3A3D A;  3FZC A;  5CEC A;  5FQK A;  1FR1 A;  2DNS A;  4EET B;  2VGL S;  3IXH A;  3T4S A;  2Z6D A;  3BRM A;  3OPP A;  2JKR M;  3LO7 A;  4YNR A;  1TS6 A;  4IHQ A;  5E43 A;  3BFG A;  4JF4 A;  2R9X A;  3UO9 A;  1W79 A;  3LEQ A;  1ZTU A;  4KQD A;  1Q2Q A;  4KUO A;  5FAO A;  1T19 A;  2WUQ A;  2XH9 A;  2A24 A;  4UHU A;  1GSV A;  2Y2J A;  3VP4 A;  4E6W A;  1G6O A;  2EXA A;  1JNU A;  1NXY A;  1OJ5 A;  1RCJ A;  4GS9 A;  1H0M A;  1TDL A;  4HJ4 A;  4R4R A;  2ZQ9 A;  3DTM A;  3T1R A;  5DF9 A;  3SZT A;  4BD0 A;  3TW8 A;  1KE3 A;  2UWX A;  1TF1 A;  3OZH A;  1NRJ A;  2O99 A;  1KGE A;  2K7S A;  3HLD A;  3RJU A;  4Y0U A;  3CIT A;  2H28 A;  2JKG A;  2QHK A;  3MS6 A;  4BLM A;  3G4P A;  3OPR A;  3KSI A;  3LIB A;  5HSQ A;  2XR0 A;  3IQA A;  1G28 A;  3ITA A;  2ZJ9 A;  4NK3 A;  3AGF A;  2DMW A;  1P9W A;  3EQU A;  1MWU A;  5L2F A;  3GR2 A;  4FH2 A;  4CLC E;  1PZO A;  3OCN A;  3C8C A;  2X71 A;  3G32 A;  4EUZ A;  3E4P A;  2VV7 A;  3V39 A;  1KVM A;  1VET B;  4C6Y A;  5HW3 A;  3IX3 A;  2KDK A;  1W63 M;  3NUL A;  3ZGA B;  1F2K A;  1N9O A;  4RX3 A;  1K57 C;  5FI2 A;  5E2G A;  3H9W A;  5D3O A;  5L10 A;  3VP1 A;  4EBP A;  4II7 A;  2Y2M A;  5LBR A;  3NEC A;  5J3W A;  4ARZ A;  1E3U D;  1NY0 A;  5HWV A;  3S1Y A;  1XGJ A;  3M2K A;  4OPQ A;  3CAX A;  1SDE A;  3IHA A;  4I38 A;  4QY5 A;  4B88 A;  4PKY A;  5GHZ A;  1LSX A;  4P87 A;  4PM9 A;  1YKD A;  2ZC7 A;  3TG9 A;  4UQI S;  4DE0 A;  3LR5 A;  5F6A A;  1KDS A;  3HLE A;  4WM9 A;  4K0W A;  5A92 A;  2Q0O A;  1AWI A;  1FCO A;  3UN7 A;  2ZC4 B;  1BUL A;  4KG6 A;  1JWV A;  4EQ1 A;  4LEN A;  1Y28 A;  3D4F A;  4KZ9 A;  1TEM A;  2G2W A;  1TD5 A;  5J4E A;  2V1Z A;  3PHY A;  5HD5 A;  2J3T C;  2XA7 M;  4Q0H A;  4UEY A;  5MC7 A;  3M6H A;  5DF7 A;  2OLV A;  3IXD A;  3P7N A;  4ZJ3 A;  1HVB A;  5HDC A;  5KSH A;  2P04 A;  3CPT B;  3VE3 A;  4WUJ A;  4L9G A;  3ZNY A;  4ZBE A;  1YLZ A;  5HL6 A;  3MFD A;  4OQ0 A;  3SS4 A;  3GRJ A;  2LB5 A;  4UA6 A;  3KYQ A;  2B5R A;  4KZ5 A;  3OBF A;  5A93 A;  4WLA A;  3PYP A;  4M3K A;  2A2L A;  4IVI A;  1CI9 A;  3IWQ A;  1M40 A;  2H0Y A;  1XJ3 A;  4JGR A;  1FQG A;  3EEA A;  4HY8 A;  2B95 A;  4R6L A;  4D60 A;  1DP6 A;  2BTF P;  3LY4 A;  1OJG A;  3CZD A;  2OOL A;  4S2M A;  3VOL A;  1W7F A;  1PI5 A;  1I2W A;  2V0W A;  2EA9 A;  1S66 L;  4OOL A;  3VE4 A;  4ARZ B;  4KZ8 A;  3ZG9 B;  4MMN A;  2KLI A;  1DJC A;  3T4O A;  5HL1 A;  2IWD A;  4GHI A;  4L9F A;  5FI7 A;  4GHI B;  3B3X A;  1I2S A;  3MBZ A;  1YPR A;  1BLC A;  4P6Z M;  1JTD A;  3PAE A;  3WRZ A;  4MN7 A;  3G35 A;  2PBD P;  1PI4 A;  1NWZ A;  5DKK A;  1HD8 A;  4OP5 A;  4Y17 A;  2Y55 A;  3CMZ A;  3CLO A;  2EWV A;  5G4Z A;  3MQO A;  1ZC2 A;  3GMW A;  2ZC3 B;  4IVK A;  1ALQ A;  3BWL A;  3NDE A;  3HUN A;  1FIK A;  2WZX A;  3SS3 A;  3A0R A;  3M6B A;  1PIO A;  4JGO A;  3BFD A;  1EW0 A;  1GSX A;  1MBL A;  5KMW A;  4IED A;  5TJJ A;  4HOI A;  4F3L B;  3JYI A;  3I7J A;  4OPZ A;  2B02 A;  2DCF A;  4H6J B;  2Q9M A;  3UDX A;  3T1Q B;  2J8Y A;  3V5M A;  5EVI A;  2GZA A;  2ZC5 B;  1O7E A;  3HBR A;  4MBK A;  5FQI A;  2K2N A;  3LR3 A;  3SS5 A;  3ZG8 B;  3D3O A;  4EUV A;  3UY6 A;  1U60 A;  1GHP A;  5CTM A;  1KOU A;  5CEB A;  1O07 A;  3IHB A;  1TS0 A;  4NG2 A;  2W3E A;  4GN2 A;  4HBU A;  5G18 A;  5DFX A;  1VHM A;  3GSG A;  3QP5 A;  3ZVT A;  2PU4 A;  3FKV A;  4RA7 A;  4X1L A;  5AQ7 A;  3C4P A;  5HFO A;  1STZ A;  3PTE A;  3GQZ A;  4Y3I A;  1XP4 A;  2W3H A;  3VOZ A;  3UB8 A;  5FQM A;  4HH3 A;  3DTE A;  1TS7 A;  3LGO A;  3N4I A;  3PBS A;  3BW6 A;  1Y54 A;  3Q7Z A;  2IA2 A;  3BM6 A;  1K56 D;  3MQQ A;  5DTT A;  4R3B A;  3NJA A;  4KZB A;  4OOY A;  4MNR A;  3IXB A;  5CRF A;  4N9L A;  3MR0 A;  3NC8 A;  3NOT C;  1TS8 A;  3FPW A;  5CHU A;  2D01 A;  2PYP A;  3EWK A;  2Y2P A;  3UB7 A;  1LHY A;  5F5Y A;  3T12 B;  4BL3 A;  1KE0 A;  5FEF A;  3F1P B;  1JVJ A;  2J80 A;  1T1B A;  4HJ3 A;  2WGI A;  3QP8 A;  1MPL A;  3CHW P;  2OV5 A;  2PHY A;  2B18 A;  5GLB A;  1NLZ A;  1L2S A;  2J9P A;  3NOP C;  3W4Q A;  3F1N B;  2Z6C A;  5CXW A;  3RTY A;  4GCZ A;  4WF0 A;  4Y2F A;  2OAP 1;  5F82 A;  4KQO A;  3BY8 A;  5DJU A;  5EV0 A;  3R4K A;  3LIA A;  3UNW A;  1PNE A;  3OPL A;  1ZHH B;  4LCL A;  1JTG A;  4OOM A;  2JKR I;  1NYM A;  3Q81 A;  3GTC A;  1V9Z A;  2QPN A;  4LRZ E;  2WKE A;  3UB5 P;  3A3J A;  5K5B A;  4HJ6 A;  1I5Q A;  5HDD A;  4JF5 A;  1DY6 A;  3G6O A;  4JXV A;  1W8Y A;  3ZVW A;  1XA1 A;  1YM1 A;  1L0E A;  4R4S A;  2JC7 A;  4JPM A;  3TOI A;  2WGV A;  3VP3 A;  2V9A A;  4OP8 A;  1DJA A;  5CGS A;  2VJW A;  1T18 A;  1S0W A;  3LY3 A;  2QMI A;  3HLW A;  1LSW A;  1L0D A;  4DJ3 A;  1J9M A;  3L9K A;  4E04 A;  3BJN A;  1KE4 A;  1MY8 A;  3NCK A;  2Y2L A;  2Y2G A;  2HF6 A;  5CHM A;  4BL2 A;  3T1X A;  5F1F A;  4WZ5 A;  4WBG A;  2HDS A;  5CHJ A;  3S7N A;  4E3N A;  2L4R A;  4HIA A;  4FCF A;  1ONG A;  2A49 A;  2WKP A;  3T4J A;  2KX6 A;  1LI0 A;  1OT6 A;  1P9R A;  5CX7 A;  3TSG A;  4NKP A;  1CK3 A;  3OOV A;  3IH9 A;  3W4P A;  4FH4 A;  3PR6 A;  1N4O A;  4LRY C;  5AQ9 A;  2HZ5 A;  1FSY A;  1NZU A;  4H6J A;  4WZ4 A;  1P0Z A;  4U3T A;  1GA9 A;  2OSU A;  3B42 A;  4PHT A;  2KOI A;  3G34 A;  3WS2 A;  4CQH A;  3N8L A;  1KGG A;  4RVA A;  1L0F A;  4C75 A;  4R38 A;  4X25 A;  4NXE A;  5FDS A;  1OME A;  3G31 A;  4WYY A;  2OWJ A;  3H7W B;  5DFY A;  3ZNT A;  1K38 A;  3BQA A;  4FSF A;  3VFH A;  1YLW A;  2ZM0 A;  2W3G A;  1FCN A;  3CJM A;  2XQZ A;  2HDU A;  4EQI A;  4PPR A;  4HNB A;  3VP2 A;  3ZCZ A;  4XXR A;  1E3U A;  2R9W A;  3TE8 A;  3GEC A;  5HD3 A;  3KO6 A;  1K4F A;  4Q0J A;  5JYP A;  1PZP A;  2G2U A;  4LV2 A;  5TBM A;  4K91 A;  4OQG A;  1ODV A;  4OLD A;  3D72 A;  3KYZ A;  1MKM A;  4BD1 A;  4NXF A;  4ZJ2 A;  2BLS A;  5F83 A;  3EOI A;  3CWF A;  2GX5 A;  4HEF A;  1K6R A;  4Y13 A;  3T4L A;  4AFI A;  3MJQ A;  2BAS A;  3G30 A;  3HLG A;  1CQA A;  4C3Q A;  5E2H A;  5KSC A;  4K08 A;  2ZM2 A;  4I39 A;  1NZO A;  1PYY A;  3CUE C;  4D2O A;  4QJG A;  2QWS A;  3C7V A;  4E3J A;  3PBO A;  3QP1 A;  3M2J A;  4EWF A;  2NUP C;  2HP9 A;  1P97 A;  3LR0 A;  5IHV A;  5HAR A;  3DW0 A;  3ZDJ A;  3S7Q A;  1S4R A;  2XFS A;  2XLN A;  1Q2P A;  4OQH A;  4MEZ A;  3P09 A;  4UAA A;  1G68 A;  3KYE A;  2VGK A;  2XRN A;  1LT0 A;  1K54 A;  1HTZ A;  3BFF A;  1BLH A;  4I3J A;  5HZH A;  1OTE A;  3O5Y A;  2P74 A;  3SOI A;  2JKF A;  3IXG A;  3N6I A;  3Q1F A;  4GB7 A;  2WGW A;  3KX0 X;  4O01 A;  1D06 A;  3IWO A;  3VMA A;  4K0X A;  2WGW B;  4OON A;  2WKI A;  3VSK A;  2V8C A;  3B47 A;  1H3Q A;  3A3I A;  4Y5F A;  1ES4 A;  1XA7 A;  3MFX A;  4Q0I A;  4HES A;  4B4Z A;  1SDN A;  1DRM A;  4WEL A;  1VEU B;  3DTI A;  4PM8 A;  1XJ2 A;  4RX2 A;  1IKG A;  1UGU A;  1S6R A;  3WWX A;  2QKP A;  4EEP A;  1T1C A;  1CI8 A;  3C38 A;  3RH8 B;  1F9I A;  3MZE A;  5I94 A;  1BTL A;  1S67 L;  5EM0 A;  4JGQ A;  3KSF A;  2VZW A;  4FTX A;  1DJB A;  2Z2L B;  5FAP A;  3O3V A;  3RXW A;  5FQ9 A;  1IFQ A;  3A3E A;  1GCE A;  4LV0 A;  5GLA A;  4PMA A;  3IX8 A;  4O0P A;  3V3R A;  3BYD A;  3MXR A;  3EQV A;  2VK3 A;  1ES5 A;  3HLB A;  3F1P A;  4IUK A;  5HPF A;  1XX2 A;  2OWH A;  4GLQ A;  5AVE A;  2P08 A;  4L9E A;  1SHV A;  4G3K A;  1NRF A;  5EEC A;  1H8M A;  4QY6 A;  4X6T A;  1YLY A;  2M1C A;  4KZ4 A;  3D9Y A;  2W1T B;  5HPI A;  5CTN A;  3E0Y A;  3UE3 A;  3PBT A;  2PRF A;  4DE3 A;  2O9B A;  3N8R A;  4MBH A;  3DWK A;  5AVF A;  3C5A A;  4OH0 A;  5CGX A;  4U0T A;  3ZG0 A;  4KG2 A;  4LGW A;  4OQI A;  1NJ4 A;  3G2Y A;  5EUA A;  1KVL A;  3N8S A;  3K3C A;  4R1G A;  1QME A;  5FAS A;  2RL3 A;  2ZBB A;  1K0K A;  3GV9 A;  2C5W B;  5A90 A;  1GHI A;  2CMN A;  3HLC A;  4DDY A;  3HJK A;  3BEC A;  3PBN A;  2JCH A;  1E4D A;  4Z9Q A;  3LI9 A;  3RFB A;  2YKF A;  4B93 A;  4FUW A;  2XRO A;  1VEU A;  1OTA A;  1T1A A;  2GDN A;  2WKH A;  3KSH A;  4BMW A;  1OPX A;  4IUH A;  1ES2 A;  5TBM B;  2FH5 A;  3BEB A;  1HLU P;  1BLP A;  5IS1 A;  4BWI A;  1FIL A;  1SZV A;  1V9Y A;  3SH8 A;  3OC2 A;  1SKO A;  4BBT A;  4YIN A;  1WYC A;  1ESU A;  3P01 A;  1K56 A;  1LI9 A;  4LV3 A;  2HV1 A;  5CGW A;  2VGL M;  1CEF A;  3OCL A;  4FD8 A;  4Y7P A;  3PXP A;  3UPN A;  3UE1 A;  5EVE A;  2VA0 A;  1ESI A;  3P98 A;  3E4Q A;  2NUT C;  2M7V A;  3QP6 A;  5EVI C;  3OLO A;  3W4O A;  4LLO B;  4KZ3 A;  4X53 A;  3UB6 A;  1HZO A;  4P85 A;  2V20 A;  3VV4 A;  4ESP A;  5I5L A;  3ZFZ A;  1JWP A;  1TVF A;  3WS1 A;  3NHQ A;  4B9O A;  1GHM A;  3ZHH A;  1YSP A;  2ZQ8 A;  3E4O A;  1ERM A;  4F3L A;  1OT9 A;  5CER A;  5FL3 A;  1UWP X;  2PYR A;  2W3D A;  1XGI A;  2VV6 A;  4DXB A;  4DRT A;  1YAX A;  2EWW A;  1H5X A;  2VLG A;  5HWT A;  4NEE D;  1IEL A;  1E25 A;  3LID A;  4LPZ A;  3F1N A;  4GZB A;  3MF0 A;  1BLS A;  4MN5 A;  1CEG A;  1MXO A;  3LEZ A;  3QP2 A;  4JXS A;  5HAI A;  5TR7 A;  4WL9 A;  3S22 A;  2XF3 A;  3ZG7 B;  1YMS A;  2JN7 A;  4I3A A;  5IT5 A;  1J3W A;  1H8Y A;  2JBF A;  4HP4 A;  5EOE A;  3U2A A;  4ZRR A;  1RGZ A;  5EOO A;  2EX2 A;  4MLL A;  4N1X A;  1LL5 A;  2WK0 A;  3MZF A;  1QMF A;  5CED A;  2JKT I;  2HJ9 C;  2V2F F;  4DJ2 A;  3Q7V A;  2ZMA A;  4WEK A;  1RGY A;  4KZ6 A;  5FEG A;  1VB6 A;  2Y2N A;  1D1J A;  5DJT A;  3FPV A;  2X02 A;  1MWS A;  4P0M A;  4GOG A;  1IYO A;  3A3F A;  4WMC A;  3DTK A;  3H82 B;  4EES A;  1EI5 A;  1PWC A;  1Z6F A;  3IH8 A;  3IBR A;  3RXX A;  4HI4 A;  1GA0 A;  3B33 A;  3L7H A;  3SW1 A;  2L1M A;  4I3I A;  3BY9 A;  4JXG A;  1LL9 A;  3UE6 A;  3HJI A;  2ZLY A;  1KDW A;  2J7V A;  4ID4 A;  2HDQ A;  3T4K A;  5GHX A;  4PAU A;  1FR6 A;  3QNB A;  4LFU A;  1S4S A;  2Z2M B;  4GD8 A;  2VKS A;  5L8M A;  2XSS A;  2JE5 A;  3ICY A;  3C2W A;  4JF6 A;  3LIE A;  5TGF A;  1C3B A;  3SH9 A;  3O87 A;  2L0W A;  1YLP A;  4BJP A;  3F1O B;  2YKH A;  3VP0 A;  1XJ6 A;  2XDM A;  2Y59 A;  3TRC A;  3BLM A;  4GJ4 A;  1BYW A;  5GHY A;  3MMH A;  4PM5 A;  4R70 A;  2W1T A;  1X0O A;  5G4Y A;  2EFU A;  1W63 Q;  4QD4 A;  2V0U A;  1ERO A;  4S2L A;  1ACF A;  3U4L P;  1XFN A;  4S2K A;  3NIA A;  2IWB A;  1K55 A;  2WAF A;  2EXB A;  3EEH A;  2XD1 A;  1S1Y A;  2HGV A;  5BOH A;  3MXQ A;  2VX8 A;  1K6S A;  3A0V A;  5L07 A;  2HJE A;  3HUO A;  1IYP A;  4X68 A;  4EEU A;  4YOF A;  5EVI D;  5AJG A;  2ZQD A;  3DWZ A;  3Q7V B;  5M18 A;  2Q9N A;  3T4T A;  1Z09 A;  3CI6 A;  4NXG A;  2PBY A;  3C4O A;  4QWO A;  4WN5 A;  2G7U A;  3CG5 A;  4O7D A;  5KIZ A;  1ZKJ A;  2QYB A;  4BQM A;  1OTB A;  3IWI A;  5HDS A;  3ULF A;  1SKO B;  4UQI M;  1N9B A;  4N92 A;  1K25 A;  1YT4 A;  3S7P A;  2PAV P;  2M7U A;  2ZOI A;  1MWT A;  1IOU A;  4KQR A;  5L09 A;  4S2I A;  3W2Z A;  1DP9 A;  1MC0 A;  2Y2Q A;  1JWZ A;  4JGP A;  3MZD A;  3PBR A;  4R0Q A;  4F94 A;  4ETX A;  5M1A A;  4OKP A;  5DF8 A;  5GL9 A;  2UV0 E;  4PM7 A;  1ERQ A;  3JPU A;  2INW A;  3WS0 A;  1PFL A;  4S2N A;  4A5R A;  1W8Q A;  3C30 A;  2ZQ7 A;  3LIC A;  2E8J A;  5A91 A;  4DDS A;  2QJ7 A;  1NLY A;  3WRT A;  1MKI A;  2DRW A;  1FOF A;  1G6A A;  4IBX A;  5EE8 A;  2P9V B;  4E3O A;  4GW9 A;  4HH2 A;  2GNX A;  4RYE A;  4Q8I A;  3Q82 A;  5J7E A;  1YSQ A;  1OTI A;  3FKW A;  4CJN A;  3ZG5 A;  1YLJ A;  4CLC C;  4MCW A;  1XKZ A;  4GDN A;  1K54 C;  5FAT A;  3UE0 A;  1NYY A;  4HQA A;  1L3L A;  3MKE A;  2WAE A;  2ZM8 A;  4DE1 A;  5DTS A;  3N7W A;  2Y2H A;  2Y79 A;  1LLB A;  1WE4 A;  4PM6 A;  2Y4A A;  1BZA A;  1BSG A;  1IEM A;  4H8R A;  5EM1 A;  1K55 C;  3UDI A;  3UMD A;  2ZL1 A;  4E3L A;  2FFF B;  3VSL A;  2BG1 A;  4B4X A;  3GVB A;  4BEN A;  3WS4 A;  4EXO A;  2GJ3 A;  2ZQC A;  3IT9 A;  4Z1W A;  1FCM A;  2JHE A;  2E8I A;  2X01 A;  2CC1 A;  3UDF A;  2PR6 A;  4OPR A;  1S1Z A;  4CLC A;  4CPK A; 
#chains in the Genus database with same CATH homology
 2JCH A;  3VP4 A;  1E4D A;  1L2S A;  2J9P A;  4Z9Q A;  4E6W A;  2EXA A;  5AQA A;  3W4Q A;  1NXY A;  2GDN A;  2WAD A;  2WKH A;  1RCJ A;  4ZTK A;  1TDL A;  5M19 A;  4R4R A;  5CXW A;  2ZQ9 A;  3DTM A;  4IBR A;  1ES2 A;  3MKF A;  3BEB A;  5DF9 A;  5F82 A;  4BD0 A;  1BLP A;  4KQO A;  5FQJ A;  1KE3 A;  2UWX A;  3SH8 A;  3OC2 A;  4YIN A;  3OZH A;  1WYC A;  1ESU A;  3BFC A;  1K56 A;  1KGE A;  3HLD A;  3RJU A;  4Y0T A;  1LI9 A;  4LV3 A;  4S2N C;  4Y0U A;  1KGF A;  5CGW A;  2J9O A;  1CEF A;  3OCL A;  4FD8 A;  4BLM A;  3UNW A;  3G4P A;  3OPR A;  4Y7P A;  3UPN A;  3BFE A;  3ZFZ A;  3OPL A;  2P9V A;  2XR0 A;  3IQA A;  3ITA A;  1JTG A;  4LCL A;  4OOM A;  1M6K A;  3UE1 A;  1NYM A;  2ZJ9 A;  4NK3 A;  1ESI A;  3AGF A;  3VFF A;  3Q81 A;  3GTC A;  3P98 A;  4UA7 A;  3O88 A;  4X56 A;  2QPN A;  2Y2O A;  2WKE A;  3A3J A;  3EQU A;  2IWC A;  1I5Q A;  1MWU A;  5EVI C;  5L2F A;  3GR2 A;  3IF5 A;  5EVL A;  4FH2 A;  3W4O A;  1PZO A;  4KZ3 A;  4Y0O A;  2EFX A;  1DY6 A;  4JF5 A;  4X53 A;  3OCN A;  2ZQA A;  2X71 A;  3G32 A;  4EUZ A;  4GDB A;  5DVA A;  1HZO A;  2H5S A;  4XUX A;  4JXV A;  4P85 A;  1W8Y A;  2V20 A;  1XA1 A;  3ZVW A;  1YM1 A;  5HAP A;  3V39 A;  2ZC6 B;  1KVM A;  1L0E A;  2EX6 A;  2JC7 A;  4JPM A;  1JWP A;  1TVF A;  3HL9 A;  2WGV A;  4R4S A;  3TOI A;  3VP3 A;  3WS1 A;  4GD6 A;  4C6Y A;  2HP6 A;  4E3I A;  5HW3 A;  1GHM A;  3BLS A;  5GLD A;  4OP8 A;  1DJA A;  4KZA A;  5CGS A;  3ZHH A;  4QHC A;  5U47 A;  4S2O A;  1S0W A;  3LY3 A;  5DTK A;  2QMI A;  2ZQ8 A;  1YLT A;  4U0X A;  3ISG A;  1ERM A;  3ZGA B;  4DXC A;  3HLW A;  1L0D A;  1XPB A;  5CER A;  2RCX A;  1K57 C;  4RX3 A;  1J9M A;  5FI2 A;  1KE4 A;  1MY8 A;  3NCK A;  1XGI A;  4KZ7 A;  2Y2L A;  1YQS A;  2Y2G A;  1ONH A;  4DXB A;  4DRT A;  5E2G A;  5CHM A;  4S2J A;  4BL2 A;  1H5X A;  2WZZ A;  5D3O A;  1IEL A;  1VQQ A;  1E25 A;  3VP1 A;  4EBP A;  2Y2M A;  5F1F A;  4WZ5 A;  4X55 A;  4GNU A;  4GZB A;  4WBG A;  1E3U D;  2HDS A;  1NY0 A;  1BLS A;  3IF6 A;  5CHJ A;  3S1Y A;  4E3N A;  2H10 A;  3UPO A;  4JXW A;  1XGJ A;  4FCF A;  1CEG A;  1MXO A;  1ONG A;  3LEZ A;  3M2K A;  2A49 A;  4OPQ A;  4ZJ1 A;  1SDE A;  3IHA A;  4S2P A;  3C7U A;  4JXS A;  3UPP A;  4JLF A;  5HAI A;  5TR7 A;  1LI0 A;  3S22 A;  2XF3 A;  3ZG7 B;  4QY5 A;  4XUZ A;  4N9K A;  3TSG A;  1YMS A;  4B88 A;  3NDG A;  4EV4 A;  4R23 A;  4ZAM A;  3E2L A;  5GHZ A;  2QZ6 A;  1CK3 A;  1IYS A;  4OVD A;  4P87 A;  3IH9 A;  4PM9 A;  3W4P A;  4FH4 A;  1H8Y A;  2JBF A;  2ZC7 A;  3TG9 A;  5EOE A;  1N4O A;  4DE0 A;  4E3M A;  5AQ9 A;  1KDS A;  3HLE A;  4WM9 A;  4K0W A;  1FSY A;  1NZU A;  1RGZ A;  5A92 A;  4WZ4 A;  5EOO A;  4U3T A;  1GA9 A;  5KZH A;  2EX2 A;  4MLL A;  4N1X A;  1LL5 A;  1FCO A;  3UN7 A;  2OSU A;  2WK0 A;  2ZC4 B;  3G34 A;  3MZF A;  3HVF A;  1BUL A;  1QMF A;  5CED A;  5EPH A;  2V2F F;  3WS2 A;  3MXS A;  3Q7V A;  1JWV A;  2ZMA A;  3N8L A;  4KG6 A;  1KGG A;  4LEN A;  5JYO A;  4RVA A;  1L0F A;  1IKI A;  1RGY A;  4WEK A;  4KZ6 A;  3D4F A;  4C75 A;  4KZ9 A;  1TEM A;  4JBF A;  2G2W A;  2Y2N A;  1OME A;  3G31 A;  4WYY A;  2V1Z A;  4EBN A;  4X69 A;  3ZNT A;  1K38 A;  2X02 A;  1MWS A;  3NY4 A;  4NET A;  4P0M A;  5J8X A;  4GOG A;  4FSF A;  3VFH A;  1IYO A;  2HPB A;  3A3F A;  3M6H A;  1YLW A;  4WMC A;  2ZM0 A;  2OLV A;  5DF7 A;  5FI6 A;  3IXD A;  3FV7 A;  1FCN A;  2Y91 A;  4ZJ3 A;  1EI5 A;  1BT5 A;  1PWC A;  1Z6F A;  3CJM A;  2C6W B;  3IH8 A;  2XQZ A;  3RXX A;  1HVB A;  1GA0 A;  2HDU A;  4EQI A;  4PPR A;  3VP2 A;  3ZCZ A;  2XD5 A;  5KSH A;  4QB8 A;  4P6B A;  3NBL A;  4XXR A;  4JXG A;  1LL9 A;  1E3U A;  4MBF A;  2R9W A;  2ZLY A;  3W8K A;  5E2F A;  1KDW A;  2J7V A;  4ID4 A;  3ZNY A;  4ZBE A;  1K4E A;  2HDQ A;  1K4F A;  4KQQ A;  1YLZ A;  5JYP A;  1PZP A;  3MFD A;  5GLB A;  2G2U A;  5GHX A;  4LV2 A;  4OQ0 A;  5E2E A;  3E2K A;  3GRJ A;  3SS4 A;  1FR6 A;  4K91 A;  4UA6 A;  3QNB A;  4E6X A;  4OQG A;  2B5R A;  4OLD A;  4DF6 A;  4DDY A;  2Z2M B;  4KZ5 A;  2EX9 A;  4GD8 A;  5A93 A;  4BD1 A;  1WYB A;  4ZJ2 A;  1XXM A;  2BLS A;  4M3K A;  5F83 A;  2XEP A;  2JE5 A;  1H8Z A;  4IVI A;  1CI9 A;  1YMX A;  2HP5 A;  3S4X A;  3IWQ A;  1M40 A;  4JF6 A;  2H0Y A;  2FFY A;  5TGF A;  1C3B A;  3SH9 A;  4HEF A;  4KG5 A;  3O87 A;  1K6R A;  1YLP A;  2A3U A;  2I72 A;  4BJP A;  1L0G A;  4DE2 A;  1FQG A;  1PWG A;  3VP0 A;  3G30 A;  4QU3 A;  3HLG A;  3PAG A;  4C3Q A;  2XDM A;  1SCW A;  2Y59 A;  3BLM A;  3LY4 A;  5E2H A;  5GHY A;  3CZD A;  4S2M A;  4PM5 A;  5KSC A;  1W7F A;  1PI5 A;  1I2W A;  3Q07 A;  4OOL A;  4EBL A;  2ZM2 A;  3AGE A;  2EFU A;  4KZ8 A;  1NZO A;  1PYY A;  2ZD8 A;  3ZG9 B;  4QD4 A;  3LCE A;  3V50 A;  4D2O A;  3WS5 A;  1ERO A;  1DJC A;  4QJG A;  4S2L A;  3C7V A;  5HL1 A;  4E3J A;  3PBO A;  1ZG6 A;  2IWD A;  3M2J A;  4EWF A;  4S2K A;  3QNC A;  1PW1 A;  3NIA A;  5FI7 A;  2HP9 A;  1RP5 A;  2IWB A;  4JKT A;  5IHV A;  5HAR A;  3DW0 A;  3ZDJ A;  3B3X A;  1I2S A;  1K55 A;  3MBZ A;  2WAF A;  2EXB A;  1BLC A;  2XFS A;  1PW8 A;  4LCM A;  1JTD A;  3PAE A;  2XLN A;  1Q2P A;  2XD1 A;  4OQH A;  3WRZ A;  4MEZ A;  3P09 A;  4L0L A;  5TFQ A;  2Y2K A;  1VM1 A;  5BOH A;  4UAA A;  1G68 A;  3G35 A;  1EWZ A;  1PI4 A;  4N1H A;  3ITB A;  5FAQ A;  1HD8 A;  1K6S A;  2VGK A;  3IF6 C;  4OP5 A;  3SH7 A;  3HUO A;  1IYP A;  2WYX A;  4X68 A;  2Y55 A;  5EVI D;  5AQB A;  3CMZ A;  2ZQD A;  3DWZ A;  3Q7V B;  1K54 A;  1HTZ A;  5M18 A;  3BFF A;  1BLH A;  2Q9N A;  2P74 A;  3SOI A;  1ZC2 A;  3GMW A;  2ZC3 B;  3G2Z A;  3VOY A;  4IVK A;  2HDR A;  1K57 A;  1ALQ A;  2H0T A;  3NDE A;  3IXG A;  3N6I A;  3HUN A;  2PBY A;  3C4O A;  3FYZ A;  3Q1F A;  4GB7 A;  2WZX A;  2WGW A;  3SS3 A;  3HUM A;  3CG5 A;  3IWO A;  4O7D A;  4K0X A;  3VMA A;  1ZKJ A;  3M6B A;  4BQM A;  1PIO A;  2WGW B;  1FSW A;  4OON A;  3BFD A;  4OPY A;  2WKI A;  3VSK A;  3IWI A;  1MBL A;  5HAQ A;  5KMW A;  3A3I A;  4IED A;  4DKI A;  2EX8 A;  1N9B A;  4N92 A;  3QHY A;  1ES4 A;  1K25 A;  1XA7 A;  1ES3 A;  3JYI A;  1YT4 A;  4OLG A;  3I7J A;  4OPZ A;  4HES A;  3PBQ A;  1MWT A;  2DCF A;  4KQR A;  4B4Z A;  2XFT A;  1SDN A;  2Q9M A;  2VGJ A;  3UDX A;  4WZ5 C;  4S2I A;  3OPH A;  2J8Y A;  4R3J A;  3V5M A;  5EVI A;  2Y2Q A;  1JWZ A;  5F1G A;  4WEL A;  2ZC5 B;  3MZD A;  3PBR A;  4WMC D;  1O7E A;  3HBR A;  4R0Q A;  5FDH A;  4F94 A;  5FSR A;  4PM8 A;  4MBK A;  4RX2 A;  5M1A A;  4OKP A;  1IKG A;  5FA7 A;  4GKU A;  5FQI A;  5DF8 A;  5GL9 A;  3SS5 A;  3ZG8 B;  1PWD A;  4PM7 A;  2OLU A;  1ERQ A;  1S6R A;  3WWX A;  3WS0 A;  3UY6 A;  1ZG4 A;  1CI8 A;  1U60 A;  1GHP A;  4S2N A;  5CTM A;  5CEB A;  3MZE A;  5I94 A;  1BTL A;  1O07 A;  4A5R A;  1W8Q A;  5FQQ A;  3IHB A;  2ZQ7 A;  1BUE A;  4GN2 A;  4HBU A;  5A91 A;  4DDS A;  5G18 A;  1DJB A;  2Z2L B;  1SKF A;  3WRT A;  1MWR A;  4LV1 A;  5FAP A;  5HX9 A;  1MKI A;  3O3V A;  3RXW A;  2DRW A;  1FOF A;  1G6A A;  4IBX A;  5FQ9 A;  3GSG A;  2XK1 A;  5EE8 A;  2P9V B;  3A3E A;  4E3O A;  1GCE A;  4LV0 A;  5EVI B;  5GLA A;  1AXB A;  3ZVT A;  2PU4 A;  3FKV A;  4KEN B;  4RA7 A;  4RYE A;  4PMA A;  1IYQ A;  5AQ7 A;  4Q8I A;  1W5D A;  3FWL A;  4UA9 A;  3Q82 A;  3C4P A;  5HFO A;  2XGN A;  3PTE A;  3V3R A;  3FKW A;  4CJN A;  3BYD A;  5GLC A;  3IF6 B;  3MXR A;  3ZG5 A;  1YLJ A;  4HBT A;  4E3K A;  3GQZ A;  3EQV A;  3HRE A;  3HLF A;  1ES5 A;  1XP4 A;  2PU2 A;  1XKZ A;  4GDN A;  4WEJ A;  3HLB A;  1K54 C;  5FAT A;  3O86 A;  3UE0 A;  1XX2 A;  2Y2I A;  3V3S A;  1NYY A;  3VOZ A;  3AGD A;  3MKE A;  1SHV A;  2WAE A;  2ZM8 A;  5FQM A;  1NRF A;  3N4I A;  4DE1 A;  5EEC A;  4QY6 A;  5DTS A;  3N7W A;  4X6T A;  1YLY A;  3PBS A;  1TDG A;  2Y2H A;  4KZ4 A;  1Y54 A;  5CTN A;  3Q7Z A;  3BM6 A;  1K56 D;  1LLB A;  1WE4 A;  4PM6 A;  2Y4A A;  3UE3 A;  4ZDX A;  1BZA A;  5DTT A;  4YFM A;  3NI9 A;  3PBT A;  4R3B A;  4DE3 A;  4KZB A;  4OOY A;  1BSG A;  1IEM A;  4H8R A;  3A3D A;  3FZC A;  3N8R A;  1K55 C;  3UDI A;  5CEC A;  5FQK A;  4MBH A;  1FR1 A;  3DWK A;  4E3L A;  2DNS A;  3C5A A;  4MNR A;  2FFF B;  3IXB A;  4OH0 A;  5CGX A;  4N9L A;  5CRF A;  4U0T A;  3ZG0 A;  3NC8 A;  3VSL A;  4KG2 A;  5CHU A;  2BG1 A;  3IXH A;  1NJ4 A;  4OQI A;  3G2Y A;  2Y2P A;  3BRM A;  5EUA A;  1KVL A;  3OPP A;  4B4X A;  3LO7 A;  1LHY A;  3N8S A;  3GVB A;  5E43 A;  4R1G A;  3BFG A;  4BEN A;  4JF4 A;  2R9X A;  3WS4 A;  3UO9 A;  4BL3 A;  1QME A;  2ZQC A;  5FAS A;  1W79 A;  1KE0 A;  2RL3 A;  3IT9 A;  1JVJ A;  1FCM A;  3GV9 A;  2E8I A;  1Q2Q A;  2WGI A;  1MPL A;  2C5W B;  5FAO A;  5A90 A;  2X01 A;  2CC1 A;  2WUQ A;  2OV5 A;  1GHI A;  3UDF A;  3HLC A;  2XH9 A;  4OPR A;  4UHU A;  4CPK A;  3BEC A;  2Y2J A;  3PBN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...