4OQIA

Crystal structure of stabilized tem-1 beta-lactamase variant v.13 carrying r164s/g238s mutations
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
263
structure length
263
Chain Sequence
b'HPETLVKVKDAEDQLGGRVGYIELDLASGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVGELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDSWEPELNEAIPNDERDTTTPVAMATTLRKLLTGELLTAASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGASERGSRGIIAALGPDGKPSRIVVIYMTGSQATMDERNRQIAEIGASLIKHW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TEM-94 ES-beta-lactamase
publication title Negative Epistasis and Evolvability in TEM-1 beta-Lactamase--The Thin Line between an Enzyme's Conformational Freedom and Disorder.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase inhibitor
total genus 104
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2014-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4oqiA00
3FZCA 4LCMA 1ES4A 4E3NA 5EVIB 4S2OA 3CZDA 4OPRA 1ALQA 3VFFA 4GD8A 4KZ7A 4OP5A 4ZAMA 1NXYA 5A93A 1JWZA 4DDYA 1KDWA 3BFDA 3S1YA 3BFEA 4XUXA 5GLAA 4OOLA 2Q9MA 5GHZA 4UAAA 3WS5A 1YLJA 3O87A 1K6RA 2Q9NA 4OONA 4WEKA 1I2WA 5CERA 5A92A 4OOMA 3DWZA 2QZ6A 3DTMA 2VGKA 3PAEA 5GLCA 1NRFA 1KGFA 2XR0A 4MLLA 3PBRA 2DRWA 1MKIA 4QU3A 5EPHA 4GNUA 3TOIA 3EQVA 4X6TA 1H8ZA 4OKPA 4S2JA 3VP3A 3O3VA 5L2FA 1LI0A 1K54A 1OMEA 5FATA 1MY8A 1LI9A 4DXBA 3WRZA 5EVLA 2ZQ7A 4KZAA 1FCNA 2V2FF 2J8YA 1JTGA 2HDQA 2WZXA 1RGYA 5EE8A 2ZC3B 1ERQA 1TEMA 5EOEA 1W79A 1ONGA 4K91A 2EXAA 5FI2A 4OVDA 4WMCA 3ZG8B 4E3JA 1HTZA 5EVIA 2XK1A 2P9VB 5E43A 2WAEA 3N8SA 3WS0A 5TR7A 1TDLA 1XP4A 1BUEA 5I94A 1CI9A 5FQIA 1EROA 2WKIA 3WS4A 3BFCA 1XGJA 3IWQA 1PZPA 3OZHA 4UA6A 4EV4A 2XD1A 2ZD8A 4X53A 2HP6A 2ZM0A 1MXOA 4HBUA 3V50A 4M3KA 1XGIA 1ES5A 4WYYA 2X71A 4S2PA 3MFDA 3IF5A 5DTTA 3NCKA 1N9BA 1C3BA 2JBFA 4F94A 1E3UA 2HDSA 2A49A 1ESIA 1CK3A 4NETA 5D3OA 1XA7A 5HL1A 1K56D 4KZ8A 3ZG9B 3IF6B 1H8YA 4OP8A 2JC7A 2Y2QA 3HLWA 2Y2HA 4C6YA 5CRFA 1K4EA 3A3FA 4P6BA 3QNBA 1K57A 2Y55A 4IVIA 1K54C 1TVFA 3IXGA 1KGEA 2E8IA 2Z2LB 4Y0UA 4JLFA 4U0XA 3NDEA 2IWCA 4KZ6A 4N9KA 3VP2A 4KQRA 3O86A 4OLGA 3UNWA 4GD6A 3M6HA 3D4FA 2P9VA 2JCHA 3AGDA 4RX2A 1LL5A 4EBLA 4FSFA 4KQOA 4PM7A 3VP0A 5GHYA 3A3JA 3IHBA 1GHMA 3Q82A 3HLBA 4QY5A 5U47A 2H0YA 2PU2A 1QMFA 4UA9A 4XXRA 1ONHA 3HLCA 5TFQA 1ZC2A 3MKEA 1PWDA 4X68A 4EUZA 3GV9A 1PZOA 3G31A 1KDSA 1BTLA 4JF6A 2IWDA 4QJGA 5JYPA 2Y2GA 1E25A 3MBZA 3C4PA 3DW0A 2H5SA 3Q07A 4HESA 1PWGA 2WGWB 2ZQCA 4K0WA 2OLUA 1GCEA 1L2SA 2Y2PA 3IF6A 5A91A 3VOZA 2WYXA 3FWLA 1EI5A 2Y2JA 2XFTA 4R4SA 4PPRA 3CG5A 5CEDA 4E3MA 1KE0A 1N4OA 2FFFB 3UN7A 3S22A 1ZKJA 1K57C 1MBLA 2ZJ9A 2X01A 5F82A 1PIOA 4DE3A 3V3SA 3IQAA 1NZUA 2OSUA 1WYCA 4IVKA 3RJUA 3HLFA 5EUAA 3W4QA 1XPBA 2EFUA 3P09A 2ZQ9A 3UE3A 1PWCA 5KZHA 4DXCA 1YT4A 2PU4A 2R9XA 3A3DA 3AGEA 3OCNA 1QMEA 4P0MA 3VFHA 1NY0A 2ZC6B 1KVMA 3AGFA 1IYOA 3B3XA 5DTSA 3HUNA 2OV5A 1IELA 4RYEA 3VMAA 2Y2MA 3GSGA 1ZG4A 3LEZA 4EBNA 5HAPA 3QNCA 3NY4A 3ZDJA 3G2ZA 4KG2A 1PW1A 4OQHA 2WGWA 3ZG7B 4JPMA 3BEBA 1DY6A 2WKEA 5DF7A 4EBPA 1Q2QA 1BLSA 1EWZA 1NZOA 1YLZA 4KZ3A 2VGJA 5HARA 5CHMA 1M6KA 3M6BA 3OPHA 3IF6C 2Y2NA 5KMWA 3Q81A 4K0XA 4E6XA 3MZEA 5BOHA 2H0TA 3NDGA 4N9LA 3NI9A 1DJBA 3HUMA 2HDRA 3BM6A 1DJCA 4JF5A 3ISGA 3UDFA 1SDEA 4MBFA 4N1XA 1BLHA 2XQZA 2ZC5B 3MXSA 1JWPA 5CXWA 4FH2A 1Q2PA 1KGGA 3G2YA 1JTDA 1L0FA 1LLBA 2XH9A 4GZBA 5F1GA 1S0WA 4RVAA 3PBNA 3GRJA 4R23A 2X02A 3A3IA 3S4XA 4OPZA 1FOFA 3BFGA 1JVJA 4DE1A 4X56A 5IHVA 4ZTKA 3OCLA 2FFYA 4JXGA 5HAIA 2C6WB 2QPNA 3V5MA 2XEPA 4KQQA 1K55A 1PI5A 3FYZA 4BJPA 1HD8A 3IWIA 2H10A 1BULA 2ZQDA 5CGXA 1MWUA 4BD0A 3QHYA 1WE4A 4MBKA 2WZZA 5FI6A 3Q1FA 1K56A 3ZHHA 4R0QA 4QHCA 4KG5A 3HBRA 3GQZA 1W5DA 4MBHA 2UWXA 3LY3A 5FAOA 3GMWA 1K38A 2EX9A 3VP4A 1L0GA 4WMCD 1O07A 1HZOA 5FQMA 3W4PA 1K6SA 2XF3A 4U0TA 5EVID 4MEZA 3SOIA 2WADA 1NYMA 1YQSA 5E2EA 4LV0A 4LENA 4P85A 5KSHA 3PBQA 5FDHA 3NBLA 1TDGA 3HLGA 2RL3A 4FH4A 2I72A 4ZBEA 3SH8A 3SS3A 4JXVA 5J8XA 1IYQA 3PAGA 2XLNA 1LL9A 4E3LA 2J9OA 2WUQA 1KE3A 2Y91A 4MNRA 4XUZA 2ZQ8A 2B5RA 3V3RA 4BLMA 3PBSA 5FQ9A 3HUOA 4LV2A 3IXHA 2V20A 5HW3A 1AXBA 1PI4A 1S6RA 2WKHA 4B88A 1GHPA 3BECA 4P87A 1K55C 2ZM8A 4JF4A 4Y0OA 5F83A 1XX2A 4E3OA 1PW8A 4OPQA 5CEBA 5FA7A 4KZ9A 4GB7A 4R1GA 3TSGA 1BSGA 1YLWA 3N8LA 3UPNA 3IXDA 2HP9A 3OC2A 1IEMA 3UPPA 3RXXA 4PM9A 5FQJA 3JYIA 3MZDA 3SH7A 1DJAA 3WWXA 1YMXA 4BD1A 4Q8IA 3M2JA 2BG1A 5GHXA 1FCOA 4S2LA 5EECA 5GL9A 3FV7A 2ZC7A 1ESUA 5GLBA 5F1FA 2RCXA 4HBTA 1BT5A 4BL2A 5FSRA 3PBTA 4OLDA 1RCJA 3E2KA 4BL3A 1MPLA 4YFMA 1MWRA 4OQGA 4A5RA 4C3QA 3LO7A 1FSYA 3IH9A 3N6IA 5FASA 2G2WA 5KSCA 4DKIA 2EX6A 3VSLA 2ZC4B 3P98A 4S2IA 3G32A 1H5XA 3C7UA 3N7WA 3FKWA 3CJMA 1W8QA 3FKVA 4PMAA 3SS4A 3C5AA 3IXBA 2XD5A 1BLCA 4YINA 2G2UA 5GLDA 4ZJ2A 1FCMA 1BLPA 1CEFA 3MZFA 1L0DA 4QB8A 2ZMAA 4IEDA 3IWOA 5DF9A 3DWKA 5CHJA 3GTCA 5CGSA 5FQKA 2R9WA 2V1ZA 4BQMA 4N1HA 5CTMA 2CC1A 4KG6A 5CGWA 2Y2KA 3MKFA 1SDNA 2ZQAA 5M1AA 4JXWA 3UDIA 5AQBA 2J7VA 4S2MA 2XGNA 3EQUA 5DTKA 3V39A 4KENB 4KZ5A 3W8KA 5CTNA 5G18A 4ID4A 1I2SA 1BZAA 4HEFA 2GDNA 3WRTA 2BLSA 4PM8A 1O7EA 1G6AA 3E2LA 1VQQA 1YLTA 3BFFA 3ITBA 1YMSA 4KZ4A 4ZJ3A 2EXBA 1ES3A 3G30A 4LV1A 5FAQA 1GHIA 4O7DA 1MWSA 5HX9A 3VOYA 1Y54A 3I7JA 2EX8A 1IKIA 3GR2A 4E3IA 3ZNYA 2OLVA 3HL9A 3TG9A 3ZVTA 4S2NA 2XFSA 4FCFA 5AQ9A 3GVBA 1G68A 1YLPA 5JYOA 4C75A 3WS1A 2EX2A 5A90A 3A3EA 1YLYA 5AQ7A 3WS2A 4Y7PA 4BENA 3CMZA 3BRMA 1L0EA 2Y59A 3UO9A 5M18A 3LCEA 3OPPA 4Z9QA 4QD4A 4X55A 2Y4AA 4U3TA 1W7FA 4GDNA 1ES2A 4R3JA 1SCWA 4WZ5A 2Y2OA 4KZBA 4B4ZA 4LCLA 1W8YA 3G35A 4IBRA 3UPOA 4NK3A 3IT9A 4RX3A 1J9MA 5DF8A 4ZDXA 2C5WB 3C4OA 1FR6A 4OQIA 3RXWA 3ZG0A 3ZVWA 1IYPA 2HPBA 2ZLYA 3MXRA 1MWTA 3W4OA 2HP5A 3HLEA 4WEJA 5FQQA 2HDUA 2WGIA 2PBYA 4FD8A 4GKUA 4IBXA 5M19A 3M2KA 4L0LA 3ZGAB 2DCFA 1LHYA 1XA1A 3ITAA 3Q7VB 2Y2LA 4UHUA 4WELA 1XKZA 1KVLA 1E4DA 1M40A 4X69A 5HFOA 2EFXA 1KE4A 1I5QA 3BLSA 1K25A 4GN2A 5EOOA 4E3KA 1XXMA 4DF6A 2WK0A 1E3UD 3LY4A 4DE2A 1WYBA 4S2NC 4QY6A 2QMIA 3N8RA 3HREA 4JBFA 5FI7A 1RP5A 5HAQA 1SHVA 4OQ0A 2DNSA 4D2OA 3UE1A 1IKGA 3O88A 5AQAA 3VSKA 3PBOA 3UE0A 2P74A 3Q7ZA 4GOGA 4OH0A 1K4FA 1RGZA 4OOYA 4EWFA 3BYDA 4H8RA 3NC8A 5EVIC 4EQIA 1U60A 4CPKA 3C7VA 3OPLA 2IWBA 5CECA 1IYSA 4ZJ1A 4JXSA 3HLDA 3HVFA 4PM5A 4UA7A 4WZ5C 1FR1A 4WZ4A 1GA9A 1PYYA 3SH9A 2ZM2A 3IHAA 1Z6FA 3OPRA 5DVAA 3UY6A 3NIAA 3UDXA 3BLMA 5TGFA 3ZNTA 1FQGA 2JE5A 3ZFZA 2J9PA 4CJNA 3VP1A 4PM6A 2WGVA 3N4IA 4DRTA 3G4PA 4DDSA 5E2GA 3ZG5A 4GDBA 3PTEA 4S2KA 4WBGA 2A3UA 4R3BA 3Q7VA 1VM1A 3IH8A 3SS5A 1JWVA 1FSWA 1YM1A 4DE0A 4R4RA 3G34A 4JKTA 4RA7A 3ZCZA 4E6WA 1NJ4A 1CEGA 5CHUA 4LV3A 4B4XA 1CI8A 1GA0A 4OPYA 4Y0TA 1NYYA 5E2FA 1HVBA 2XDMA 1ERMA 4N92A 5E2HA 4WM9A 2WAFA 2Y2IA 2Z2MB 1SKFA 5FAPA 1ZG6A
chains in the Genus database with same CATH superfamily
4LCMA 1ALQA 1VB6A 2LB5A 4ZAMA 1NXYA 4O0PA 1JWZA 3BFDA 5GLAA 5GHZA 3WS5A 1YLJA 1Y4OA 1I2WA 5A92A 4GW9A 3DWZA 2XR0A 4MLLA 4QU3A 2DRWA 3NOPC 3VOLA 4GHIB 4OKPA 4S2JA 5FATA 2V1AA 4R3AA 3IBRA 1JTGA 1ERQA 4ME4A 4K91A 5FI2A 4OVDA 4E3JA 5TR7A 1XP4A 1UWNX 3MF0A 2QWSA 5L09A 4UA6A 5HZHA 4HOIA 3T12B 4WYYA 4O8GA 3IF5A 3F1NB 1N9BA 1C3BA 4GHIA 2A49A 4NETA 3K2NA 4CLCE 5HL1A 3T4JA 4KZ8A 3ZG9B 4OP8A 3HLWA 4II7A 1K4EA 1ACFA 3QNBA 2Y55A 4IVIA 5HDCA 3C38A 3UNWA 3LIFA 3AGDA 4PM7A 2VV8A 4HY8A 5I5LA 5GHYA 2H0YA 1QMFA 1ONHA 4PAUA 2WKPA 1PWDA 4EUZA 3BWLA 3F1NA 3C4PA 2ZQCA 4K0WA 2PYPA 1L2SA 2Y2PA 5HDSA 5A91A 5EV0A 3EEAA 2KDKA 1N4OA 3RFBA 1T19A 1ZKJA 4LFUA 2UV0E 3LUQA 1XJ6A 5KZHA 3ULFA 2PU4A 2R9XA 2ZC6B 1VHMA 1KVMA 4FTXA 5DTSA 2OV5A 1IELA 5HAPA 4X1MA 4X25A 3LICA 5DF7A 1EWZA 3HCYA 1NZOA 1A0KA 1M6KA 3OPHA 2OOLA 3Q81A 3MZEA 4N9LA 1DJBA 1F9IA 3ISGA 2A24B 4Y5FA 1KGGA 1TF1A 4HH2A 1JTDA 1LLBA 3LYXA 2XH9A 2X02A 3BFGA 4HI4A 4X56A 5IHVA 1N9OA 2J80A 4ZTKA 3OCLA 3UB6A 3JPUA 2XEPA 3FYZA 4BJPA 3KSHA 3E0YA 1IOUA 3IBJA 4MBKA 3P01A 3KSIA 3R4KA 4QHCA 3BQAA 3GQZA 3LY3A 4NEED 1K38A 3ICYA 4WMCD 4EESA 2XF3A 4U0TA 5EVID 1YQSA 2A24A 5KSHA 3PBQA 3NBLA 3HLGA 4IJGA 3U2AA 3UB7A 2I72A 3NULA 3SH8A 3PR6A 1IYQA 4E3LA 4PKYG 2J9OA 2PDRA 1KE3A 2Y91A 3RH8B 1FIKA 2B5RA 3PBSA 4LV2A 1DP9A 4NXBA 4R70A 1S6RA 3T1QB 3LR3A 4D60A 1G5UA 5FDSA 3TSGA 1YLWA 5L07A 1LSWA 1FCOA 5HPFA 5GLBA 1LSVA 4BL2A 4OLDA 1RCJA 4YFMA 4OQGA 4I5SA 3N6IA 1S1YA 1F98A 4DKIA 4MMNA 3DTKA 4WN5A 3G32A 1YAXA 1W8QA 5DFXA 4PMAA 1BLCA 4ZJ2A 2XSSA 1BLPA 2ZMAA 3QP5A 5DF9A 3DWKA 5FQKA 2CC1A 2ZQAA 4WUJA 2PAVP 4R38A 3EQUA 3SW1A 5HDDA 4ID4A 1TS0A 4EQ1A 1I2SA 2GDNA 1O7EA 3E2LA 5HSQA 3G30A 4LV1A 5FAQA 3VOYA 1MWSA 3GR2A 4E3IA 2OLVA 5AQ9A 1YLPA 2ZOIA 1LSXA 4C75A 2EX2A 1YLYA 4Y7PA 3CMZA 1MKMA 3LCEA 2FH5A 1IFQA 3S7PA 3OPPA 1YSQA 5HL6A 1T1BA 1ES2A 1SCWA 3CI6A 4KUKA 4LCLA 4LRYC 4QWOA 2QJ5A 3IT9A 4NG2A 1J9MA 4Q0IA 4ZDXA 3BJNA 3RXWA 1P9RA 3LIAA 2HPBA 3MXRA 4B9OA 4FD8A 2PBYA 3ZGAB 1XA1A 4GN2A 4E3KA 1K25A 5EOOA 1XXMA 1E3UD 1WYBA 1CQAA 2B18A 4Y13A 5FI7A 4D2OA 1VETB 1W63Q 5AQAA 4HJ4A 3PBOA 2P74A 3IS2B 4OH0A 3MFXA 4OOYA 2KX6A 4EQIA 4HJ3A 1U60A 2PYRA 3C7VA 2IWBA 4JXSA 4WLAA 1GA9A 2ZM2A 3OPRA 2PD8A 5DVAA 3NIAA 3UDXA 3BLMA 2JE5A 3ZFZA 4CJNA 5HWVA 3VP1A 2WGVA 4LPZA 3BY9A 4DRTA 3LR4A 4GDBA 2A3UA 5IU1A 4HNBA 4R4RA 4RA7A 2W27A 4E6WA 2MJ6A 3D72A 5CHUA 4Y0TA 1NYYA 2M7VA 3V67A 1HVBA 3LR5A 3QP1A 3O5YA 3IS2A 5E2HA 2Z2MB 5FAPA 3TW8A 3F1OB 2W3HA 2HJEA 5A93A 4DDYA 3S1YA 2ZBBA 2EWWA 1K6RA 4OONA 2YKHA 2QZ6A 3DTMA 5GLCA 3PBRA 1MKIA 1OTEA 3E4QA 4X6TA 1F5MA 2OWJA 2ZL1A 5L2FA 1BYWA 1YPRA 5EVLA 4ZRRA 2J8YA 2CMNA 3T4SA 1ONGA 2VKSA 3F1OA 5E43A 2WAEA 3WS0A 1TDLA 3IX3A 5FQIA 3MQOA 2WKIA 2PBDP 2V8CA 1PZPA 1T18A 1J3WA 2PR6A 2ZM0A 1V9ZA 2VX8A 4HBUA 2PHYA 2X71A 5DTTA 3T1RA 3LGOA 2B95A 1GSVA 4M4XA 4IHQA 4LRXC 1ESIA 3LIBA 5D3OA 1H8YA 5J7EA 4C6YA 5CRFA 2JKRM 4P6BA 3IXGA 1KGEA 4Y0UA 1DP6A 3NDEA 4KZ6A 4N9KA 3VP2A 4KQRA 3M6HA 2J3TC 5DJTA 2PRFA 4FSFA 1TS6A 3LFVA 3Q82A 3HLBA 4G3KA 3MKEA 4X68A 3G31A 1KDSA 4QJGA 3K3CA 5JYPA 3H7WB 1TS7A 4HESA 1GCEA 5J3WA 3VOZA 3FWLA 1EI5A 4CLCD 1OTAA 3B42A 1KE0A 2ZJ9A 4HIAA 2Q0OA 3V3SA 3IQAA 4H6JB 2OSUA 1WYCA 3HLFA 5EUAA 3W4QA 3UE3A 3P09A 4DXCA 3OCNA 3BQ8A 1QMEA 4P0MA 1NY0A 2OWHA 3MSHA 3MQ0A 3VMAA 2Z6DA 3H7WA 3ZDJA 3NHQA 4KG2A 4JPMA 3BEBA 2W3DA 1BLSA 1G6OA 2K7SA 5HARA 5CHMA 3M6BA 2Y2NA 4E6XA 4JGQA 4JGRA 3FPVA 3OOVA 1H3QA 2HDRA 3UDFA 1BLHA 2ZC5B 1JWPA 4FH2A 4H6JA 1Q2PA 3G2YA 1DP8A 4E04A 3PBNA 3S4XA 1FOFA 1N9LA 4LGWA 1K0KA 4DE1A 4ARZA 5HAIA 2C6WB 3V5MA 3CAXA 4KQQA 1K55A 4MCWA 3IWIA 2H10A 1BULA 2ZQDA 2JKTI 5CGXA 1WE4A 4BBTA 2L4RA 3ZHHA 3HBRA 1VEUB 3VP4A 1L0GA 1O07A 4RQ9A 3OBFA 1K6SA 2WADA 5E2EA 4LV0A 4P85A 5IS1A 2RL3A 5J8XA 3PAGA 2XLNA 3T1XA 3U4LP 1YKDA 1TS8A 4XUZA 5FQ9A 3HUOA 5DKKA 5HW3A 4B88A 4P87A 1K55C 2ZM8A 4PHTA 4E3OA 1XX2A 1PW8A 5CEBA 3F1PB 4KZ9A 4R1GA 3N8LA 3UPNA 3IXDA 3OC2A 1VEUA 4PM9A 5FQJA 3W2ZA 3SH7A 3QP2A 4BD1A 5EECA 2Y79A 3PHYA 3FV7A 4R6LA 5AVEA 4A5RA 3K3DA 3LO7A 1FSYA 5TJJA 5KSCA 2EX6A 3VSLA 3FC7A 4S2IA 3NOUC 3C7UA 3FKVA 3SS4A 3C5AA 2XD5A 4YINA 2G2UA 3F1PA 1CEFA 3MZFA 4QB8A 1DRMA 2IA2A 5CGSA 1STZA 3DBAA 4UQIM 4KG6A 5CGWA 2JKGA 5AQBA 2J7VA 2V0WA 2XGNA 3V39A 5G18A 3EGXC 3WRTA 2BLSA 3HJIA 1YLTA 3BFFA 2HV1A 2EXBA 3EGDC 4G3VA 2DMWA 1IKIA 3HJKA 5F5YA 3TG9A 3ZVTA 1S66L 2J3WA 3T50A 1JNUA 1G68A 3GECA 3WS1A 2GJ3A 5A90A 1Z09A 3A3EA 3R7WB 3WS2A 4Y17A 1XFNA 1L0EA 2Y59A 5M18A 4Z9QA 4EERA 2Y4AA 3MR0A 4U3TA 2EWVA 3G35A 4IBRA 3UPOA 5DF8A 1FR6A 3ZVWA 1D7EA 3HLEA 5FQQA 2WGIA 1HLUP 3Q7VB 4UHUA 1KVLA 2JKTM 1M40A 3BLSA 1I5QA 2WK0A 5J4EA 3R7WA 4JBFA 4ETZA 5HAQA 5IT5A 1IKGA 3UE0A 4GOGA 1RGZA 4EWFA 4NXFA 4H8RA 3NC8A 5EVIC 3FPWA 3HLDA 4UA7A 4NKPA 1FR1A 1PYYA 3SH9A 3LI8A 2W0NA 4GLQA 4PM6A 5HPIA 3G4PA 1NRJA 5E2GA 3ZYTA 3PTEA 2L1MA 3Q7VA 5FL3A 3IH8A 1JWVA 2W3GA 2KOIA 4I3IA 1NJ4A 1CEGA 2G7UA 4LV3A 4NXEA 1MZUA 3P7NA 4GS9A 2INWA 5CERA 4I39A 1ZG6A 3FZCA 2H28A 4E3NA 1PRQA 3CZDA 4OPRA 4OP5A 4YOFA 3BFEA 4XUXA 4OOLA 4UAAA 1N9NA 2VGKA 3PAEA 4IUHA 1NRFA 2HGVA 4GNUA 3EQVA 4EXOA 1H8ZA 3VP3A 4L9GA 4KUOA 1LI9A 3WRZA 3NJAA 2ZQ7A 4KZAA 1FCNA 2JKRI 3PXPA 2W3EA 5EE8A 5EOEA 1W79A 2EXAA 4L9FA 2XK1A 1BUEA 5I94A 2JKFA 1XFQA 2VA0A 1EROA 3WS4A 1UGUA 2L0WA 3IWQA 1XGJA 3OZHA 4EV4A 2ZD8A 4X53A 1MXOA 4M3KA 1ES5A 4S2PA 3NCKA 2JBFA 4F94A 1E3UA 2HDSA 3E4PA 4Q0JA 1K56D 3A0RA 2EA9A 2Y2QA 4IUKA 3A3FA 3T4LA 3G6OA 5FEFA 2E8IA 2Z2LB 4BMWA 2PR5A 4U0XA 2IWCA 4OLGA 3O86A 4Y3IA 4GD6A 4UQIS 4RX2A 4EBLA 5F69A 2VK3A 5G4ZA 3B33A 3A3JA 3IHBA 1GHMA 4KQDA 2PU2A 4UA9A 5C5KA 4XXRA 5TFQA 1ZC2A 2PD7A 4I38A 3SZTA 3S7OA 1BTLA 2IWDA 4MDZA 3MBZA 3Q07A 2H5SA 1PWGA 2WGWB 2WYXA 4R4SA 1P9WA 2ZL1B 4PPRA 3CG5A 2FFFB 3UN7A 3S22A 3UB8A 2VV6A 5F82A 3RJUA 3CWFA 1XPBA 1PWCA 3A3DA 3AGEA 3EWKA 3AGFA 1F2KA 3UMDA 2XA7S 2R78A 3HUNA 2Y2MA 3GSGA 2LB9A 3LEZA 3G2ZA 4EETB 2WGWA 2P7JA 3ZG7B 1DY6A 2WKEA 4EBPA 4BBVA 2PT7A 3A0SA 1YLZA 4KZ3A 3GDIA 5KMWA 4K0XA 2M7UA 3E4OA 2H0TA 3HUMA 1DJCA 4JF5A 4N1XA 4HJ6A 1L0FA 5F1GA 4GZBA 3GRJA 1WA9A 3A3IA 2W1TA 1JVJA 1L3LA 3H82B 4BD0A 1XJ4A 3QHYA 3VE4A 2WZZA 5FI6A 5DKLA 5G4YA 4AFIA 3IX4A 1W5DA 4CLCB 2UWXA 5FAOA 2EX9A 2J3TD 4JGOA 3SOIA 1T1CA 5CX7A 3UMEA 4LENA 3UB9A 5FDHA 1S4RA 5DFYA 4FH4A 4ZBEA 3SS3A 4JXVA 3LIDA 2O9BA 1LL9A 4MNRA 3S7NA 3V3RA 4O01A 3L9KA 3IXHA 2V20A 1AXBA 2WKHA 3H82A 4BWIA 1P0ZA 3BECA 2QKPA 5F6AA 4GB7A 1BSGA 3TRCA 4CLCA 2HP9A 4Y2FA 3UPPA 2O9AA 3KX0X 3MZDA 1DJAA 1YMXA 4EW7A 2BG1A 5GHXA 3ZQ5A 2ZC7A 4HBTA 4BBUA 5FSRA 4EEPA 3E2KA 1MPLA 1OJ5A 4C3QA 3UE6A 3H9WA 2G2WA 1W63M 3B47A 2ZC4B 3A0VA 3T4TA 4NXGA 3N7WA 3FKWA 3CJMA 4ARZB 3EOIA 3IXBA 3QP4A 1L0DA 3KYZA 3IWOA 3GTCA 2I9VA 2R9WA 4CLCC 4N1HA 5CTMA 2K31A 3MKFA 5HWWA 1SDNA 5M1AA 3UDIA 5MC7A 5DTKA 4KZ5A 5CTNA 1PNEA 1BZAA 4HEFA 2AVXA 1G6AA 4HHDA 3ITBA 4KZ4A 4ZJ3A 1ES3A 3OLOA 1GHIA 1SZVA 1Y54A 2EX8A 3ZNYA 2XFSA 4FCFA 4X1LA 1YSPA 3IX8A 2OAP1 4BENA 3BRMA 5EM1A 3CLOA 1W7FA 3BY8A 4WZ5A 1EW0A 4B4ZA 1W8YA 2BTFP 2GNXA 4NK3A 3L7HA 4LRZE 2C5WB 3C4OA 4OQIA 5A8BA 3ZG0A 1IYPA 3QP6A 2ZLYA 1T1AA 1MWTA 2D02A 3W4OA 3CITA 5M19A 2HDUA 2ZOHA 4GKUA 3M2KA 1LHYA 2Y2LA 4GCZA 4EU0A 1XKZA 4X69A 1E4DA 5HFOA 1KE4A 4DF6A 3D3OA 4QY6A 2QMIA 3HREA 2ACGA 5L10A 3Q7ZA 5AVFA 3BYDA 5CECA 4CPKA 3OPLA 2M1CA 4ZJ1A 4PM5A 3HVFA 4WZ5C 1X0OA 3UY6A 1OT9A 3VV4A 2E8JA 5TGFA 2A2LA 1FQGA 3ZNTA 2J9PA 1D06A 3TE8A 1H0MA 5AJGA 4DDSA 4WBGA 3CUEA 1FSWA 4DE0A 1MC0A 3G34A 4JKTA 3ZCZA 3T4KA 3MQQA 4B4XA 1CI8A 1GA0A 4OPYA 2HJ9C 2XDMA 1OTDA 4N92A 2Y2IA 1SKFA 2VJWA 2ZMVA 1ES4A 2HF6A 3S7QA 5EVIB 4S2OA 3VFFA 4GD8A 4KZ7A 1KDWA 5EM0A 2Q9MA 3O87A 2Q9NA 4WEKA 4OOMA 5K5BA 1KGFA 5LBRA 3TOIA 5EPHA 1CJFA 3O3VA 4Z1WA 1LI0A 1K54A 3CUEC 1OMEA 1MY8A 4DXBA 1PFLA 4EUVA 2V2FF 1NLYA 2HDQA 2WZXA 1RGYA 2ZC3B 1TEMA 3MS6A 4WMCA 3ZG8B 2O0YA 1HTZA 5EVIA 2P9VB 3N8SA 2Y8HA 1CI9A 3BFCA 1XJ2A 2QJ7A 1OPXA 1FILA 2XD1A 1AWIA 2P04A 2HP6A 2XA7M 2HZ5A 3V50A 1XGIA 4GJ4A 3MFDA 1CK3A 1XA7A 2VV7A 3IF6B 4YWZA 2JC7A 2Y2HA 1NWZA 1K57A 1K54C 1TVFA 4WL9A 1S4SA 4JGPA 4JLFA 3MMHA 5EVEA 4G3WA 5F68A 3D4FA 4GS9B 2P9VA 2JCHA 1LL5A 4KQOA 2XRNA 4P6ZM 3VP0A 4I3AA 4QY5A 5U47A 1ZHHB 2O99A 3HLCA 2VGLM 1OTBA 2W1RA 1PZOA 3C2WA 3GV9A 4K08A 4JF6A 3BW6A 2Y2GA 1E25A 1S1ZA 4ETXA 3DW0A 2VLGA 4LLOB 2OLUA 3IF6A 3E98A 3C30A 3DTEA 2YKFA 2Y2JA 2XFTA 1LT0A 3KO6A 5CEDA 4E3MA 2D01A 1K57C 1MBLA 2X01A 4CQHA 1PIOA 4DE3A 1NZUA 4IVKA 1D1JA 3LR0A 2EFUA 2ZQ9A 1YT4A 3LI9A 4I3JA 3DAVA 3VFHA 1IYOA 3B3XA 4B93A 4Y15A 2P08A 3T4QA 4RYEA 2JN7A 1ZG4A 4DMZA 4EBNA 3QNCA 3NY4A 2GX5A 1PW1A 4OQHA 1GSWA 3RTYA 1Q2QA 2VGJA 2O9CA 3IF6C 5TBMB 5BOHA 3NDGA 3NI9A 3NECA 3BM6A 1SDEA 4MBFA 2XQZA 3MXSA 5CXWA 5HD5A 2NUTC 1S0WA 4RVAA 5HD3A 4R23A 2BASA 4OPZA 1KOUA 2V1BA 3QP8A 2FFYA 3JVVA 4JXGA 2QPNA 1PI5A 1HD8A 2KLIA 1MWUA 3D9YA 3Q1FA 4Q0HA 2OAQ1 1K56A 4XT2B 4R0QA 4KG5A 1ODVA 1G28A 4MBHA 3GMWA 1ZTUA 5TBMA 5FQMA 1HZOA 3W4PA 4MEZA 1NYMA 2QHKA 1H8MA 1TDGA 2XROA 1NLZA 2WUQA 3JVUA 2V8FA 1Y28A 2ZQ8A 3KYQA 4BLMA 3T4OA 1PI4A 3DTIA 1GHPA 4JF4A 4XT2A 4Y0OA 5F83A 4HH3A 4OPQA 5HWTA 5FA7A 1IEMA 4F3LB 3RXXA 2QYBA 3JYIA 1SKOB 3WWXA 3KSGA 4Q8IA 3M2JA 1V9YA 4MN6A 4S2LA 5GL9A 4UEYA 1UWPX 1ESUA 5F1FA 2RCXA 1BT5A 3PBTA 4BL3A 1MWRA 3IH9A 5FASA 2V9AA 1LL8A 4QPRA 5EFWA 4DN0A 2W1TB 2FZ0A 3P98A 2VEAA 1H5XA 5GLDA 1FCMA 1VETA 2JHEA 3NOTC 4WF0A 4F3LA 3LIEA 4IEDA 5CHJA 4EEUA 4BQMA 2V1ZA 1CF0A 1SKOA 2Y2KA 4JXWA 3MXQA 4S2MA 4KENB 3W8KA 3FG8A 4PM8A 4P6ZS 3MJQA 1VQQA 2WKQA 1YMSA 5DJUA 5HX9A 4O7DA 3EEHA 3I7JA 3HL9A 2VGLS 4L9EA 2GZAA 4S2NA 3GVBA 4MN7A 4PKYA 2WKRA 5JYOA 4HP4A 1P97A 5FEGA 3LEQA 5AQ7A 3UO9A 3CPTB 4QD4A 4X55A 2W3FA 3CHWP 4ESPA 4GDNA 4R3JA 2Y2OA 3TJZC 4KZBA 3KSFA 4YNRA 4RX3A 1TD5A 4MN5A 2ZMFA 4HP9A 1OJGA 4DJ3A 5L8MA 2HP5A 2V0UA 1OTIA 4WEJA 4FUWA 4FOFA 4IBXA 4L0LA 2B02A 2DCFA 3ITAA 4WELA 2EFXA 3LY4A 4DE2A 4S2NC 3N8RA 3KYEA 1RP5A 1SHVA 4OQ0A 2DNSA 3UE1A 1OT6A 3CPTA 3O88A 3VSKA 4HQAA 1K4FA 1IYSA 1XJ3A 4WZ4A 1GSXA 3IHAA 1Z6FA 2Z6CA 3C8CA 2K2NA 5KIZA 3T1SA 3N4IA 3ZG5A 2NUPC 4S2KA 4R3BA 4DJ2A 1VM1A 3SS5A 1YM1A 2VZWA 3UB5P 1S67L 5E2FA 3VE3A 1ERMA 3PYPA 4WM9A 2WAFA
chains in the Genus database with same CATH topology
3FZCA 4LCMA 1ES4A 4E3NA 5EVIB 4S2OA 3CZDA 4OPRA 1ALQA 3VFFA 4GD8A 4KZ7A 4OP5A 4ZAMA 1NXYA 5A93A 1JWZA 4DDYA 1KDWA 3BFDA 3S1YA 3BFEA 4XUXA 5GLAA 4OOLA 2Q9MA 5GHZA 4UAAA 3WS5A 1YLJA 3O87A 1K6RA 2Q9NA 4OONA 4WEKA 1I2WA 5CERA 5A92A 4OOMA 3DWZA 2QZ6A 3DTMA 2VGKA 3PAEA 5GLCA 1NRFA 1KGFA 2XR0A 4MLLA 3PBRA 2DRWA 1MKIA 4QU3A 5EPHA 4GNUA 3TOIA 3EQVA 4X6TA 1H8ZA 4OKPA 4S2JA 3VP3A 3O3VA 5L2FA 1LI0A 1K54A 1OMEA 5FATA 1MY8A 1LI9A 4DXBA 3WRZA 5EVLA 2ZQ7A 4KZAA 1FCNA 2V2FF 2J8YA 1JTGA 2HDQA 2WZXA 1RGYA 5EE8A 2ZC3B 1ERQA 1TEMA 5EOEA 1W79A 1ONGA 4K91A 2EXAA 5FI2A 4OVDA 4WMCA 3ZG8B 4E3JA 1HTZA 5EVIA 2XK1A 2P9VB 5E43A 2WAEA 3N8SA 3WS0A 5TR7A 1TDLA 1XP4A 1BUEA 5I94A 1CI9A 5FQIA 1EROA 2WKIA 3WS4A 3BFCA 1XGJA 3IWQA 1PZPA 3OZHA 4UA6A 4EV4A 2XD1A 2ZD8A 4X53A 2HP6A 2ZM0A 1MXOA 4HBUA 3V50A 4M3KA 1XGIA 1ES5A 4WYYA 2X71A 4S2PA 3MFDA 3IF5A 5DTTA 3NCKA 1N9BA 1C3BA 2JBFA 4F94A 1E3UA 2HDSA 2A49A 1ESIA 1CK3A 4NETA 5D3OA 1XA7A 5HL1A 1K56D 4KZ8A 3ZG9B 3IF6B 1H8YA 4OP8A 2JC7A 2Y2QA 3HLWA 2Y2HA 4C6YA 5CRFA 1K4EA 3A3FA 4P6BA 3QNBA 1K57A 2Y55A 4IVIA 1K54C 1TVFA 3IXGA 1KGEA 2E8IA 2Z2LB 4Y0UA 4JLFA 4U0XA 3NDEA 2IWCA 4KZ6A 4N9KA 3VP2A 4KQRA 3O86A 4OLGA 3UNWA 4GD6A 3M6HA 3D4FA 2P9VA 2JCHA 3AGDA 4RX2A 1LL5A 4EBLA 4FSFA 4KQOA 4PM7A 3VP0A 5GHYA 3A3JA 3IHBA 1GHMA 3Q82A 3HLBA 4QY5A 5U47A 2H0YA 2PU2A 1QMFA 4UA9A 4XXRA 1ONHA 3HLCA 5TFQA 1ZC2A 3MKEA 1PWDA 4X68A 4EUZA 3GV9A 1PZOA 3G31A 1KDSA 1BTLA 4JF6A 2IWDA 4QJGA 5JYPA 2Y2GA 1E25A 3MBZA 3C4PA 3DW0A 2H5SA 3Q07A 4HESA 1PWGA 2WGWB 2ZQCA 4K0WA 2OLUA 1GCEA 1L2SA 2Y2PA 3IF6A 5A91A 3VOZA 2WYXA 3FWLA 1EI5A 2Y2JA 2XFTA 4R4SA 4PPRA 3CG5A 5CEDA 4E3MA 1KE0A 1N4OA 2FFFB 3UN7A 3S22A 1ZKJA 1K57C 1MBLA 2ZJ9A 2X01A 5F82A 1PIOA 4DE3A 3V3SA 3IQAA 1NZUA 2OSUA 1WYCA 4IVKA 3RJUA 3HLFA 5EUAA 3W4QA 1XPBA 2EFUA 3P09A 2ZQ9A 3UE3A 1PWCA 5KZHA 4DXCA 1YT4A 2PU4A 2R9XA 3A3DA 3AGEA 3OCNA 1QMEA 4P0MA 3VFHA 1NY0A 2ZC6B 1KVMA 3AGFA 1IYOA 3B3XA 5DTSA 3HUNA 2OV5A 1IELA 4RYEA 3VMAA 2Y2MA 3GSGA 1ZG4A 3LEZA 4EBNA 5HAPA 3QNCA 3NY4A 3ZDJA 3G2ZA 4KG2A 1PW1A 4OQHA 2WGWA 3ZG7B 4JPMA 3BEBA 1DY6A 2WKEA 5DF7A 4EBPA 1Q2QA 1BLSA 1EWZA 1NZOA 1YLZA 4KZ3A 2VGJA 5HARA 5CHMA 1M6KA 3M6BA 3OPHA 3IF6C 2Y2NA 5KMWA 3Q81A 4K0XA 4E6XA 3MZEA 5BOHA 2H0TA 3NDGA 4N9LA 3NI9A 1DJBA 3HUMA 2HDRA 3BM6A 1DJCA 4JF5A 3ISGA 3UDFA 1SDEA 4MBFA 4N1XA 1BLHA 2XQZA 2ZC5B 3MXSA 1JWPA 5CXWA 4FH2A 1Q2PA 1KGGA 3G2YA 1JTDA 1L0FA 1LLBA 2XH9A 4GZBA 5F1GA 1S0WA 4RVAA 3PBNA 3GRJA 4R23A 2X02A 3A3IA 3S4XA 4OPZA 1FOFA 3BFGA 1JVJA 4DE1A 4X56A 5IHVA 4ZTKA 3OCLA 2FFYA 4JXGA 5HAIA 2C6WB 2QPNA 3V5MA 2XEPA 4KQQA 1K55A 1PI5A 3FYZA 4BJPA 1HD8A 3IWIA 2H10A 1BULA 2ZQDA 5CGXA 1MWUA 4BD0A 3QHYA 1WE4A 4MBKA 2WZZA 5FI6A 3Q1FA 1K56A 3ZHHA 4R0QA 4QHCA 4KG5A 3HBRA 3GQZA 1W5DA 4MBHA 2UWXA 3LY3A 5FAOA 3GMWA 1K38A 2EX9A 3VP4A 1L0GA 4WMCD 1O07A 1HZOA 5FQMA 3W4PA 1K6SA 2XF3A 4U0TA 5EVID 4MEZA 3SOIA 2WADA 1NYMA 1YQSA 5E2EA 4LV0A 4LENA 4P85A 5KSHA 3PBQA 5FDHA 3NBLA 1TDGA 3HLGA 2RL3A 4FH4A 2I72A 4ZBEA 3SH8A 3SS3A 4JXVA 5J8XA 1IYQA 3PAGA 2XLNA 1LL9A 4E3LA 2J9OA 2WUQA 1KE3A 2Y91A 4MNRA 4XUZA 2ZQ8A 2B5RA 3V3RA 4BLMA 3PBSA 5FQ9A 3HUOA 4LV2A 3IXHA 2V20A 5HW3A 1AXBA 1PI4A 1S6RA 2WKHA 4B88A 1GHPA 3BECA 4P87A 1K55C 2ZM8A 4JF4A 4Y0OA 5F83A 1XX2A 4E3OA 1PW8A 4OPQA 5CEBA 5FA7A 4KZ9A 4GB7A 4R1GA 3TSGA 1BSGA 1YLWA 3N8LA 3UPNA 3IXDA 2HP9A 3OC2A 1IEMA 3UPPA 3RXXA 4PM9A 5FQJA 3JYIA 3MZDA 3SH7A 1DJAA 3WWXA 1YMXA 4BD1A 4Q8IA 3M2JA 2BG1A 5GHXA 1FCOA 4S2LA 5EECA 5GL9A 3FV7A 2ZC7A 1ESUA 5GLBA 5F1FA 2RCXA 4HBTA 1BT5A 4BL2A 5FSRA 3PBTA 4OLDA 1RCJA 3E2KA 4BL3A 1MPLA 4YFMA 1MWRA 4OQGA 4A5RA 4C3QA 3LO7A 1FSYA 3IH9A 3N6IA 5FASA 2G2WA 5KSCA 4DKIA 2EX6A 3VSLA 2ZC4B 3P98A 4S2IA 3G32A 1H5XA 3C7UA 3N7WA 3FKWA 3CJMA 1W8QA 3FKVA 4PMAA 3SS4A 3C5AA 3IXBA 2XD5A 1BLCA 4YINA 2G2UA 5GLDA 4ZJ2A 1FCMA 1BLPA 1CEFA 3MZFA 1L0DA 4QB8A 2ZMAA 4IEDA 3IWOA 5DF9A 3DWKA 5CHJA 3GTCA 5CGSA 5FQKA 2R9WA 2V1ZA 4BQMA 4N1HA 5CTMA 2CC1A 4KG6A 5CGWA 2Y2KA 3MKFA 1SDNA 2ZQAA 5M1AA 4JXWA 3UDIA 5AQBA 2J7VA 4S2MA 2XGNA 3EQUA 5DTKA 3V39A 4KENB 4KZ5A 3W8KA 5CTNA 5G18A 4ID4A 1I2SA 1BZAA 4HEFA 2GDNA 3WRTA 2BLSA 4PM8A 1O7EA 1G6AA 3E2LA 1VQQA 1YLTA 3BFFA 3ITBA 1YMSA 4KZ4A 4ZJ3A 2EXBA 1ES3A 3G30A 4LV1A 5FAQA 1GHIA 4O7DA 1MWSA 5HX9A 3VOYA 1Y54A 3I7JA 2EX8A 1IKIA 3GR2A 4E3IA 3ZNYA 2OLVA 3HL9A 3TG9A 3ZVTA 4S2NA 2XFSA 4FCFA 5AQ9A 3GVBA 1G68A 1YLPA 5JYOA 4C75A 3WS1A 2EX2A 5A90A 3A3EA 1YLYA 5AQ7A 3WS2A 4Y7PA 4BENA 3CMZA 3BRMA 1L0EA 2Y59A 3UO9A 5M18A 3LCEA 3OPPA 4Z9QA 4QD4A 4X55A 2Y4AA 4U3TA 1W7FA 4GDNA 1ES2A 4R3JA 1SCWA 4WZ5A 2Y2OA 4KZBA 4B4ZA 4LCLA 1W8YA 3G35A 4IBRA 3UPOA 4NK3A 3IT9A 4RX3A 1J9MA 5DF8A 4ZDXA 2C5WB 3C4OA 1FR6A 4OQIA 3RXWA 3ZG0A 3ZVWA 1IYPA 2HPBA 2ZLYA 3MXRA 1MWTA 3W4OA 2HP5A 3HLEA 4WEJA 5FQQA 2HDUA 2WGIA 2PBYA 4FD8A 4GKUA 4IBXA 5M19A 3M2KA 4L0LA 3ZGAB 2DCFA 1LHYA 1XA1A 3ITAA 3Q7VB 2Y2LA 4UHUA 4WELA 1XKZA 1KVLA 1E4DA 1M40A 4X69A 5HFOA 2EFXA 1KE4A 1I5QA 3BLSA 1K25A 4GN2A 5EOOA 4E3KA 1XXMA 4DF6A 2WK0A 1E3UD 3LY4A 4DE2A 1WYBA 4S2NC 4QY6A 2QMIA 3N8RA 3HREA 4JBFA 5FI7A 1RP5A 5HAQA 1SHVA 4OQ0A 2DNSA 4D2OA 3UE1A 1IKGA 3O88A 5AQAA 3VSKA 3PBOA 3UE0A 2P74A 3Q7ZA 4GOGA 4OH0A 1K4FA 1RGZA 4OOYA 4EWFA 3BYDA 4H8RA 3NC8A 5EVIC 4EQIA 1U60A 4CPKA 3C7VA 3OPLA 2IWBA 5CECA 1IYSA 4ZJ1A 4JXSA 3HLDA 3HVFA 4PM5A 4UA7A 4WZ5C 1FR1A 4WZ4A 1GA9A 1PYYA 3SH9A 2ZM2A 3IHAA 1Z6FA 3OPRA 5DVAA 3UY6A 3NIAA 3UDXA 3BLMA 5TGFA 3ZNTA 1FQGA 2JE5A 3ZFZA 2J9PA 4CJNA 3VP1A 4PM6A 2WGVA 3N4IA 4DRTA 3G4PA 4DDSA 5E2GA 3ZG5A 4GDBA 3PTEA 4S2KA 4WBGA 2A3UA 4R3BA 3Q7VA 1VM1A 3IH8A 3SS5A 1JWVA 1FSWA 1YM1A 4DE0A 4R4RA 3G34A 4JKTA 4RA7A 3ZCZA 4E6WA 1NJ4A 1CEGA 5CHUA 4LV3A 4B4XA 1CI8A 1GA0A 4OPYA 4Y0TA 1NYYA 5E2FA 1HVBA 2XDMA 1ERMA 4N92A 5E2HA 4WM9A 2WAFA 2Y2IA 2Z2MB 1SKFA 5FAPA 1ZG6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FZC A;  4LCM A;  1ES4 A;  4E3N A;  5EVI B;  4S2O A;  3CZD A;  4OPR A;  1ALQ A;  3VFF A;  4GD8 A;  4KZ7 A;  4OP5 A;  4ZAM A;  1NXY A;  5A93 A;  1JWZ A;  4DDY A;  1KDW A;  3BFD A;  3S1Y A;  3BFE A;  4XUX A;  5GLA A;  4OOL A;  2Q9M A;  5GHZ A;  4UAA A;  3WS5 A;  1YLJ A;  3O87 A;  1K6R A;  2Q9N A;  4OON A;  4WEK A;  1I2W A;  5CER A;  5A92 A;  4OOM A;  3DWZ A;  2QZ6 A;  3DTM A;  2VGK A;  3PAE A;  5GLC A;  1NRF A;  1KGF A;  2XR0 A;  4MLL A;  3PBR A;  2DRW A;  1MKI A;  4QU3 A;  5EPH A;  4GNU A;  3TOI A;  3EQV A;  4X6T A;  1H8Z A;  4OKP A;  4S2J A;  3VP3 A;  3O3V A;  5L2F A;  1LI0 A;  1K54 A;  1OME A;  5FAT A;  1MY8 A;  1LI9 A;  4DXB A;  3WRZ A;  5EVL A;  2ZQ7 A;  4KZA A;  1FCN A;  2V2F F;  2J8Y A;  1JTG A;  2HDQ A;  2WZX A;  1RGY A;  5EE8 A;  2ZC3 B;  1ERQ A;  1TEM A;  5EOE A;  1W79 A;  1ONG A;  4K91 A;  2EXA A;  5FI2 A;  4OVD A;  4WMC A;  3ZG8 B;  4E3J A;  1HTZ A;  5EVI A;  2XK1 A;  2P9V B;  5E43 A;  2WAE A;  3N8S A;  3WS0 A;  5TR7 A;  1TDL A;  1XP4 A;  1BUE A;  5I94 A;  1CI9 A;  5FQI A;  1ERO A;  2WKI A;  3WS4 A;  3BFC A;  1XGJ A;  3IWQ A;  1PZP A;  3OZH A;  4UA6 A;  4EV4 A;  2XD1 A;  2ZD8 A;  4X53 A;  2HP6 A;  2ZM0 A;  1MXO A;  4HBU A;  3V50 A;  4M3K A;  1XGI A;  1ES5 A;  4WYY A;  2X71 A;  4S2P A;  3MFD A;  3IF5 A;  5DTT A;  3NCK A;  1N9B A;  1C3B A;  2JBF A;  4F94 A;  1E3U A;  2HDS A;  2A49 A;  1ESI A;  1CK3 A;  4NET A;  5D3O A;  1XA7 A;  5HL1 A;  1K56 D;  4KZ8 A;  3ZG9 B;  3IF6 B;  1H8Y A;  4OP8 A;  2JC7 A;  2Y2Q A;  3HLW A;  2Y2H A;  4C6Y A;  5CRF A;  1K4E A;  3A3F A;  4P6B A;  3QNB A;  1K57 A;  2Y55 A;  4IVI A;  1K54 C;  1TVF A;  3IXG A;  1KGE A;  2E8I A;  2Z2L B;  4Y0U A;  4JLF A;  4U0X A;  3NDE A;  2IWC A;  4KZ6 A;  4N9K A;  3VP2 A;  4KQR A;  3O86 A;  4OLG A;  3UNW A;  4GD6 A;  3M6H A;  3D4F A;  2P9V A;  2JCH A;  3AGD A;  4RX2 A;  1LL5 A;  4EBL A;  4FSF A;  4KQO A;  4PM7 A;  3VP0 A;  5GHY A;  3A3J A;  3IHB A;  1GHM A;  3Q82 A;  3HLB A;  4QY5 A;  5U47 A;  2H0Y A;  2PU2 A;  1QMF A;  4UA9 A;  4XXR A;  1ONH A;  3HLC A;  5TFQ A;  1ZC2 A;  3MKE A;  1PWD A;  4X68 A;  4EUZ A;  3GV9 A;  1PZO A;  3G31 A;  1KDS A;  1BTL A;  4JF6 A;  2IWD A;  4QJG A;  5JYP A;  2Y2G A;  1E25 A;  3MBZ A;  3C4P A;  3DW0 A;  2H5S A;  3Q07 A;  4HES A;  1PWG A;  2WGW B;  2ZQC A;  4K0W A;  2OLU A;  1GCE A;  1L2S A;  2Y2P A;  3IF6 A;  5A91 A;  3VOZ A;  2WYX A;  3FWL A;  1EI5 A;  2Y2J A;  2XFT A;  4R4S A;  4PPR A;  3CG5 A;  5CED A;  4E3M A;  1KE0 A;  1N4O A;  2FFF B;  3UN7 A;  3S22 A;  1ZKJ A;  1K57 C;  1MBL A;  2ZJ9 A;  2X01 A;  5F82 A;  1PIO A;  4DE3 A;  3V3S A;  3IQA A;  1NZU A;  2OSU A;  1WYC A;  4IVK A;  3RJU A;  3HLF A;  5EUA A;  3W4Q A;  1XPB A;  2EFU A;  3P09 A;  2ZQ9 A;  3UE3 A;  1PWC A;  5KZH A;  4DXC A;  1YT4 A;  2PU4 A;  2R9X A;  3A3D A;  3AGE A;  3OCN A;  1QME A;  4P0M A;  3VFH A;  1NY0 A;  2ZC6 B;  1KVM A;  3AGF A;  1IYO A;  3B3X A;  5DTS A;  3HUN A;  2OV5 A;  1IEL A;  4RYE A;  3VMA A;  2Y2M A;  3GSG A;  1ZG4 A;  3LEZ A;  4EBN A;  5HAP A;  3QNC A;  3NY4 A;  3ZDJ A;  3G2Z A;  4KG2 A;  1PW1 A;  4OQH A;  2WGW A;  3ZG7 B;  4JPM A;  3BEB A;  1DY6 A;  2WKE A;  5DF7 A;  4EBP A;  1Q2Q A;  1BLS A;  1EWZ A;  1NZO A;  1YLZ A;  4KZ3 A;  2VGJ A;  5HAR A;  5CHM A;  1M6K A;  3M6B A;  3OPH A;  3IF6 C;  2Y2N A;  5KMW A;  3Q81 A;  4K0X A;  4E6X A;  3MZE A;  5BOH A;  2H0T A;  3NDG A;  4N9L A;  3NI9 A;  1DJB A;  3HUM A;  2HDR A;  3BM6 A;  1DJC A;  4JF5 A;  3ISG A;  3UDF A;  1SDE A;  4MBF A;  4N1X A;  1BLH A;  2XQZ A;  2ZC5 B;  3MXS A;  1JWP A;  5CXW A;  4FH2 A;  1Q2P A;  1KGG A;  3G2Y A;  1JTD A;  1L0F A;  1LLB A;  2XH9 A;  4GZB A;  5F1G A;  1S0W A;  4RVA A;  3PBN A;  3GRJ A;  4R23 A;  2X02 A;  3A3I A;  3S4X A;  4OPZ A;  1FOF A;  3BFG A;  1JVJ A;  4DE1 A;  4X56 A;  5IHV A;  4ZTK A;  3OCL A;  2FFY A;  4JXG A;  5HAI A;  2C6W B;  2QPN A;  3V5M A;  2XEP A;  4KQQ A;  1K55 A;  1PI5 A;  3FYZ A;  4BJP A;  1HD8 A;  3IWI A;  2H10 A;  1BUL A;  2ZQD A;  5CGX A;  1MWU A;  4BD0 A;  3QHY A;  1WE4 A;  4MBK A;  2WZZ A;  5FI6 A;  3Q1F A;  1K56 A;  3ZHH A;  4R0Q A;  4QHC A;  4KG5 A;  3HBR A;  3GQZ A;  1W5D A;  4MBH A;  2UWX A;  3LY3 A;  5FAO A;  3GMW A;  1K38 A;  2EX9 A;  3VP4 A;  1L0G A;  4WMC D;  1O07 A;  1HZO A;  5FQM A;  3W4P A;  1K6S A;  2XF3 A;  4U0T A;  5EVI D;  4MEZ A;  3SOI A;  2WAD A;  1NYM A;  1YQS A;  5E2E A;  4LV0 A;  4LEN A;  4P85 A;  5KSH A;  3PBQ A;  5FDH A;  3NBL A;  1TDG A;  3HLG A;  2RL3 A;  4FH4 A;  2I72 A;  4ZBE A;  3SH8 A;  3SS3 A;  4JXV A;  5J8X A;  1IYQ A;  3PAG A;  2XLN A;  1LL9 A;  4E3L A;  2J9O A;  2WUQ A;  1KE3 A;  2Y91 A;  4MNR A;  4XUZ A;  2ZQ8 A;  2B5R A;  3V3R A;  4BLM A;  3PBS A;  5FQ9 A;  3HUO A;  4LV2 A;  3IXH A;  2V20 A;  5HW3 A;  1AXB A;  1PI4 A;  1S6R A;  2WKH A;  4B88 A;  1GHP A;  3BEC A;  4P87 A;  1K55 C;  2ZM8 A;  4JF4 A;  4Y0O A;  5F83 A;  1XX2 A;  4E3O A;  1PW8 A;  4OPQ A;  5CEB A;  5FA7 A;  4KZ9 A;  4GB7 A;  4R1G A;  3TSG A;  1BSG A;  1YLW A;  3N8L A;  3UPN A;  3IXD A;  2HP9 A;  3OC2 A;  1IEM A;  3UPP A;  3RXX A;  4PM9 A;  5FQJ A;  3JYI A;  3MZD A;  3SH7 A;  1DJA A;  3WWX A;  1YMX A;  4BD1 A;  4Q8I A;  3M2J A;  2BG1 A;  5GHX A;  1FCO A;  4S2L A;  5EEC A;  5GL9 A;  3FV7 A;  2ZC7 A;  1ESU A;  5GLB A;  5F1F A;  2RCX A;  4HBT A;  1BT5 A;  4BL2 A;  5FSR A;  3PBT A;  4OLD A;  1RCJ A;  3E2K A;  4BL3 A;  1MPL A;  4YFM A;  1MWR A;  4OQG A;  4A5R A;  4C3Q A;  3LO7 A;  1FSY A;  3IH9 A;  3N6I A;  5FAS A;  2G2W A;  5KSC A;  4DKI A;  2EX6 A;  3VSL A;  2ZC4 B;  3P98 A;  4S2I A;  3G32 A;  1H5X A;  3C7U A;  3N7W A;  3FKW A;  3CJM A;  1W8Q A;  3FKV A;  4PMA A;  3SS4 A;  3C5A A;  3IXB A;  2XD5 A;  1BLC A;  4YIN A;  2G2U A;  5GLD A;  4ZJ2 A;  1FCM A;  1BLP A;  1CEF A;  3MZF A;  1L0D A;  4QB8 A;  2ZMA A;  4IED A;  3IWO A;  5DF9 A;  3DWK A;  5CHJ A;  3GTC A;  5CGS A;  5FQK A;  2R9W A;  2V1Z A;  4BQM A;  4N1H A;  5CTM A;  2CC1 A;  4KG6 A;  5CGW A;  2Y2K A;  3MKF A;  1SDN A;  2ZQA A;  5M1A A;  4JXW A;  3UDI A;  5AQB A;  2J7V A;  4S2M A;  2XGN A;  3EQU A;  5DTK A;  3V39 A;  4KEN B;  4KZ5 A;  3W8K A;  5CTN A;  5G18 A;  4ID4 A;  1I2S A;  1BZA A;  4HEF A;  2GDN A;  3WRT A;  2BLS A;  4PM8 A;  1O7E A;  1G6A A;  3E2L A;  1VQQ A;  1YLT A;  3BFF A;  3ITB A;  1YMS A;  4KZ4 A;  4ZJ3 A;  2EXB A;  1ES3 A;  3G30 A;  4LV1 A;  5FAQ A;  1GHI A;  4O7D A;  1MWS A;  5HX9 A;  3VOY A;  1Y54 A;  3I7J A;  2EX8 A;  1IKI A;  3GR2 A;  4E3I A;  3ZNY A;  2OLV A;  3HL9 A;  3TG9 A;  3ZVT A;  4S2N A;  2XFS A;  4FCF A;  5AQ9 A;  3GVB A;  1G68 A;  1YLP A;  5JYO A;  4C75 A;  3WS1 A;  2EX2 A;  5A90 A;  3A3E A;  1YLY A;  5AQ7 A;  3WS2 A;  4Y7P A;  4BEN A;  3CMZ A;  3BRM A;  1L0E A;  2Y59 A;  3UO9 A;  5M18 A;  3LCE A;  3OPP A;  4Z9Q A;  4QD4 A;  4X55 A;  2Y4A A;  4U3T A;  1W7F A;  4GDN A;  1ES2 A;  4R3J A;  1SCW A;  4WZ5 A;  2Y2O A;  4KZB A;  4B4Z A;  4LCL A;  1W8Y A;  3G35 A;  4IBR A;  3UPO A;  4NK3 A;  3IT9 A;  4RX3 A;  1J9M A;  5DF8 A;  4ZDX A;  2C5W B;  3C4O A;  1FR6 A;  4OQI A;  3RXW A;  3ZG0 A;  3ZVW A;  1IYP A;  2HPB A;  2ZLY A;  3MXR A;  1MWT A;  3W4O A;  2HP5 A;  3HLE A;  4WEJ A;  5FQQ A;  2HDU A;  2WGI A;  2PBY A;  4FD8 A;  4GKU A;  4IBX A;  5M19 A;  3M2K A;  4L0L A;  3ZGA B;  2DCF A;  1LHY A;  1XA1 A;  3ITA A;  3Q7V B;  2Y2L A;  4UHU A;  4WEL A;  1XKZ A;  1KVL A;  1E4D A;  1M40 A;  4X69 A;  5HFO A;  2EFX A;  1KE4 A;  1I5Q A;  3BLS A;  1K25 A;  4GN2 A;  5EOO A;  4E3K A;  1XXM A;  4DF6 A;  2WK0 A;  1E3U D;  3LY4 A;  4DE2 A;  1WYB A;  4S2N C;  4QY6 A;  2QMI A;  3N8R A;  3HRE A;  4JBF A;  5FI7 A;  1RP5 A;  5HAQ A;  1SHV A;  4OQ0 A;  2DNS A;  4D2O A;  3UE1 A;  1IKG A;  3O88 A;  5AQA A;  3VSK A;  3PBO A;  3UE0 A;  2P74 A;  3Q7Z A;  4GOG A;  4OH0 A;  1K4F A;  1RGZ A;  4OOY A;  4EWF A;  3BYD A;  4H8R A;  3NC8 A;  5EVI C;  4EQI A;  1U60 A;  4CPK A;  3C7V A;  3OPL A;  2IWB A;  5CEC A;  1IYS A;  4ZJ1 A;  4JXS A;  3HLD A;  3HVF A;  4PM5 A;  4UA7 A;  4WZ5 C;  1FR1 A;  4WZ4 A;  1GA9 A;  1PYY A;  3SH9 A;  2ZM2 A;  3IHA A;  1Z6F A;  3OPR A;  5DVA A;  3UY6 A;  3NIA A;  3UDX A;  3BLM A;  5TGF A;  3ZNT A;  1FQG A;  2JE5 A;  3ZFZ A;  2J9P A;  4CJN A;  3VP1 A;  4PM6 A;  2WGV A;  3N4I A;  4DRT A;  3G4P A;  4DDS A;  5E2G A;  3ZG5 A;  4GDB A;  3PTE A;  4S2K A;  4WBG A;  2A3U A;  4R3B A;  3Q7V A;  1VM1 A;  3IH8 A;  3SS5 A;  1JWV A;  1FSW A;  1YM1 A;  4DE0 A;  4R4R A;  3G34 A;  4JKT A;  4RA7 A;  3ZCZ A;  4E6W A;  1NJ4 A;  1CEG A;  5CHU A;  4LV3 A;  4B4X A;  1CI8 A;  1GA0 A;  4OPY A;  4Y0T A;  1NYY A;  5E2F A;  1HVB A;  2XDM A;  1ERM A;  4N92 A;  5E2H A;  4WM9 A;  2WAF A;  2Y2I A;  2Z2M B;  1SKF A;  5FAP A;  1ZG6 A; 
#chains in the Genus database with same CATH topology
 4LCM A;  1ALQ A;  1VB6 A;  2LB5 A;  4ZAM A;  1NXY A;  4O0P A;  1JWZ A;  3BFD A;  5GLA A;  5GHZ A;  3WS5 A;  1YLJ A;  1Y4O A;  1I2W A;  5A92 A;  4GW9 A;  3DWZ A;  2XR0 A;  4MLL A;  4QU3 A;  2DRW A;  3NOP C;  3VOL A;  4GHI B;  4OKP A;  4S2J A;  5FAT A;  2V1A A;  4R3A A;  3IBR A;  1JTG A;  1ERQ A;  4ME4 A;  4K91 A;  5FI2 A;  4OVD A;  4E3J A;  5TR7 A;  1XP4 A;  1UWN X;  3MF0 A;  2QWS A;  5L09 A;  4UA6 A;  5HZH A;  4HOI A;  3T12 B;  4WYY A;  4O8G A;  3IF5 A;  3F1N B;  1N9B A;  1C3B A;  4GHI A;  2A49 A;  4NET A;  3K2N A;  4CLC E;  5HL1 A;  3T4J A;  4KZ8 A;  3ZG9 B;  4OP8 A;  3HLW A;  4II7 A;  1K4E A;  1ACF A;  3QNB A;  2Y55 A;  4IVI A;  5HDC A;  3C38 A;  3UNW A;  3LIF A;  3AGD A;  4PM7 A;  2VV8 A;  4HY8 A;  5I5L A;  5GHY A;  2H0Y A;  1QMF A;  1ONH A;  4PAU A;  2WKP A;  1PWD A;  4EUZ A;  3BWL A;  3F1N A;  3C4P A;  2ZQC A;  4K0W A;  2PYP A;  1L2S A;  2Y2P A;  5HDS A;  5A91 A;  5EV0 A;  3EEA A;  2KDK A;  1N4O A;  3RFB A;  1T19 A;  1ZKJ A;  4LFU A;  2UV0 E;  3LUQ A;  1XJ6 A;  5KZH A;  3ULF A;  2PU4 A;  2R9X A;  2ZC6 B;  1VHM A;  1KVM A;  4FTX A;  5DTS A;  2OV5 A;  1IEL A;  5HAP A;  4X1M A;  4X25 A;  3LIC A;  5DF7 A;  1EWZ A;  3HCY A;  1NZO A;  1A0K A;  1M6K A;  3OPH A;  2OOL A;  3Q81 A;  3MZE A;  4N9L A;  1DJB A;  1F9I A;  3ISG A;  2A24 B;  4Y5F A;  1KGG A;  1TF1 A;  4HH2 A;  1JTD A;  1LLB A;  3LYX A;  2XH9 A;  2X02 A;  3BFG A;  4HI4 A;  4X56 A;  5IHV A;  1N9O A;  2J80 A;  4ZTK A;  3OCL A;  3UB6 A;  3JPU A;  2XEP A;  3FYZ A;  4BJP A;  3KSH A;  3E0Y A;  1IOU A;  3IBJ A;  4MBK A;  3P01 A;  3KSI A;  3R4K A;  4QHC A;  3BQA A;  3GQZ A;  3LY3 A;  4NEE D;  1K38 A;  3ICY A;  4WMC D;  4EES A;  2XF3 A;  4U0T A;  5EVI D;  1YQS A;  2A24 A;  5KSH A;  3PBQ A;  3NBL A;  3HLG A;  4IJG A;  3U2A A;  3UB7 A;  2I72 A;  3NUL A;  3SH8 A;  3PR6 A;  1IYQ A;  4E3L A;  4PKY G;  2J9O A;  2PDR A;  1KE3 A;  2Y91 A;  3RH8 B;  1FIK A;  2B5R A;  3PBS A;  4LV2 A;  1DP9 A;  4NXB A;  4R70 A;  1S6R A;  3T1Q B;  3LR3 A;  4D60 A;  1G5U A;  5FDS A;  3TSG A;  1YLW A;  5L07 A;  1LSW A;  1FCO A;  5HPF A;  5GLB A;  1LSV A;  4BL2 A;  4OLD A;  1RCJ A;  4YFM A;  4OQG A;  4I5S A;  3N6I A;  1S1Y A;  1F98 A;  4DKI A;  4MMN A;  3DTK A;  4WN5 A;  3G32 A;  1YAX A;  1W8Q A;  5DFX A;  4PMA A;  1BLC A;  4ZJ2 A;  2XSS A;  1BLP A;  2ZMA A;  3QP5 A;  5DF9 A;  3DWK A;  5FQK A;  2CC1 A;  2ZQA A;  4WUJ A;  2PAV P;  4R38 A;  3EQU A;  3SW1 A;  5HDD A;  4ID4 A;  1TS0 A;  4EQ1 A;  1I2S A;  2GDN A;  1O7E A;  3E2L A;  5HSQ A;  3G30 A;  4LV1 A;  5FAQ A;  3VOY A;  1MWS A;  3GR2 A;  4E3I A;  2OLV A;  5AQ9 A;  1YLP A;  2ZOI A;  1LSX A;  4C75 A;  2EX2 A;  1YLY A;  4Y7P A;  3CMZ A;  1MKM A;  3LCE A;  2FH5 A;  1IFQ A;  3S7P A;  3OPP A;  1YSQ A;  5HL6 A;  1T1B A;  1ES2 A;  1SCW A;  3CI6 A;  4KUK A;  4LCL A;  4LRY C;  4QWO A;  2QJ5 A;  3IT9 A;  4NG2 A;  1J9M A;  4Q0I A;  4ZDX A;  3BJN A;  3RXW A;  1P9R A;  3LIA A;  2HPB A;  3MXR A;  4B9O A;  4FD8 A;  2PBY A;  3ZGA B;  1XA1 A;  4GN2 A;  4E3K A;  1K25 A;  5EOO A;  1XXM A;  1E3U D;  1WYB A;  1CQA A;  2B18 A;  4Y13 A;  5FI7 A;  4D2O A;  1VET B;  1W63 Q;  5AQA A;  4HJ4 A;  3PBO A;  2P74 A;  3IS2 B;  4OH0 A;  3MFX A;  4OOY A;  2KX6 A;  4EQI A;  4HJ3 A;  1U60 A;  2PYR A;  3C7V A;  2IWB A;  4JXS A;  4WLA A;  1GA9 A;  2ZM2 A;  3OPR A;  2PD8 A;  5DVA A;  3NIA A;  3UDX A;  3BLM A;  2JE5 A;  3ZFZ A;  4CJN A;  5HWV A;  3VP1 A;  2WGV A;  4LPZ A;  3BY9 A;  4DRT A;  3LR4 A;  4GDB A;  2A3U A;  5IU1 A;  4HNB A;  4R4R A;  4RA7 A;  2W27 A;  4E6W A;  2MJ6 A;  3D72 A;  5CHU A;  4Y0T A;  1NYY A;  2M7V A;  3V67 A;  1HVB A;  3LR5 A;  3QP1 A;  3O5Y A;  3IS2 A;  5E2H A;  2Z2M B;  5FAP A;  3TW8 A;  3F1O B;  2W3H A;  2HJE A;  5A93 A;  4DDY A;  3S1Y A;  2ZBB A;  2EWW A;  1K6R A;  4OON A;  2YKH A;  2QZ6 A;  3DTM A;  5GLC A;  3PBR A;  1MKI A;  1OTE A;  3E4Q A;  4X6T A;  1F5M A;  2OWJ A;  2ZL1 A;  5L2F A;  1BYW A;  1YPR A;  5EVL A;  4ZRR A;  2J8Y A;  2CMN A;  3T4S A;  1ONG A;  2VKS A;  3F1O A;  5E43 A;  2WAE A;  3WS0 A;  1TDL A;  3IX3 A;  5FQI A;  3MQO A;  2WKI A;  2PBD P;  2V8C A;  1PZP A;  1T18 A;  1J3W A;  2PR6 A;  2ZM0 A;  1V9Z A;  2VX8 A;  4HBU A;  2PHY A;  2X71 A;  5DTT A;  3T1R A;  3LGO A;  2B95 A;  1GSV A;  4M4X A;  4IHQ A;  4LRX C;  1ESI A;  3LIB A;  5D3O A;  1H8Y A;  5J7E A;  4C6Y A;  5CRF A;  2JKR M;  4P6B A;  3IXG A;  1KGE A;  4Y0U A;  1DP6 A;  3NDE A;  4KZ6 A;  4N9K A;  3VP2 A;  4KQR A;  3M6H A;  2J3T C;  5DJT A;  2PRF A;  4FSF A;  1TS6 A;  3LFV A;  3Q82 A;  3HLB A;  4G3K A;  3MKE A;  4X68 A;  3G31 A;  1KDS A;  4QJG A;  3K3C A;  5JYP A;  3H7W B;  1TS7 A;  4HES A;  1GCE A;  5J3W A;  3VOZ A;  3FWL A;  1EI5 A;  4CLC D;  1OTA A;  3B42 A;  1KE0 A;  2ZJ9 A;  4HIA A;  2Q0O A;  3V3S A;  3IQA A;  4H6J B;  2OSU A;  1WYC A;  3HLF A;  5EUA A;  3W4Q A;  3UE3 A;  3P09 A;  4DXC A;  3OCN A;  3BQ8 A;  1QME A;  4P0M A;  1NY0 A;  2OWH A;  3MSH A;  3MQ0 A;  3VMA A;  2Z6D A;  3H7W A;  3ZDJ A;  3NHQ A;  4KG2 A;  4JPM A;  3BEB A;  2W3D A;  1BLS A;  1G6O A;  2K7S A;  5HAR A;  5CHM A;  3M6B A;  2Y2N A;  4E6X A;  4JGQ A;  4JGR A;  3FPV A;  3OOV A;  1H3Q A;  2HDR A;  3UDF A;  1BLH A;  2ZC5 B;  1JWP A;  4FH2 A;  4H6J A;  1Q2P A;  3G2Y A;  1DP8 A;  4E04 A;  3PBN A;  3S4X A;  1FOF A;  1N9L A;  4LGW A;  1K0K A;  4DE1 A;  4ARZ A;  5HAI A;  2C6W B;  3V5M A;  3CAX A;  4KQQ A;  1K55 A;  4MCW A;  3IWI A;  2H10 A;  1BUL A;  2ZQD A;  2JKT I;  5CGX A;  1WE4 A;  4BBT A;  2L4R A;  3ZHH A;  3HBR A;  1VEU B;  3VP4 A;  1L0G A;  1O07 A;  4RQ9 A;  3OBF A;  1K6S A;  2WAD A;  5E2E A;  4LV0 A;  4P85 A;  5IS1 A;  2RL3 A;  5J8X A;  3PAG A;  2XLN A;  3T1X A;  3U4L P;  1YKD A;  1TS8 A;  4XUZ A;  5FQ9 A;  3HUO A;  5DKK A;  5HW3 A;  4B88 A;  4P87 A;  1K55 C;  2ZM8 A;  4PHT A;  4E3O A;  1XX2 A;  1PW8 A;  5CEB A;  3F1P B;  4KZ9 A;  4R1G A;  3N8L A;  3UPN A;  3IXD A;  3OC2 A;  1VEU A;  4PM9 A;  5FQJ A;  3W2Z A;  3SH7 A;  3QP2 A;  4BD1 A;  5EEC A;  2Y79 A;  3PHY A;  3FV7 A;  4R6L A;  5AVE A;  4A5R A;  3K3D A;  3LO7 A;  1FSY A;  5TJJ A;  5KSC A;  2EX6 A;  3VSL A;  3FC7 A;  4S2I A;  3NOU C;  3C7U A;  3FKV A;  3SS4 A;  3C5A A;  2XD5 A;  4YIN A;  2G2U A;  3F1P A;  1CEF A;  3MZF A;  4QB8 A;  1DRM A;  2IA2 A;  5CGS A;  1STZ A;  3DBA A;  4UQI M;  4KG6 A;  5CGW A;  2JKG A;  5AQB A;  2J7V A;  2V0W A;  2XGN A;  3V39 A;  5G18 A;  3EGX C;  3WRT A;  2BLS A;  3HJI A;  1YLT A;  3BFF A;  2HV1 A;  2EXB A;  3EGD C;  4G3V A;  2DMW A;  1IKI A;  3HJK A;  5F5Y A;  3TG9 A;  3ZVT A;  1S66 L;  2J3W A;  3T50 A;  1JNU A;  1G68 A;  3GEC A;  3WS1 A;  2GJ3 A;  5A90 A;  1Z09 A;  3A3E A;  3R7W B;  3WS2 A;  4Y17 A;  1XFN A;  1L0E A;  2Y59 A;  5M18 A;  4Z9Q A;  4EER A;  2Y4A A;  3MR0 A;  4U3T A;  2EWV A;  3G35 A;  4IBR A;  3UPO A;  5DF8 A;  1FR6 A;  3ZVW A;  1D7E A;  3HLE A;  5FQQ A;  2WGI A;  1HLU P;  3Q7V B;  4UHU A;  1KVL A;  2JKT M;  1M40 A;  3BLS A;  1I5Q A;  2WK0 A;  5J4E A;  3R7W A;  4JBF A;  4ETZ A;  5HAQ A;  5IT5 A;  1IKG A;  3UE0 A;  4GOG A;  1RGZ A;  4EWF A;  4NXF A;  4H8R A;  3NC8 A;  5EVI C;  3FPW A;  3HLD A;  4UA7 A;  4NKP A;  1FR1 A;  1PYY A;  3SH9 A;  3LI8 A;  2W0N A;  4GLQ A;  4PM6 A;  5HPI A;  3G4P A;  1NRJ A;  5E2G A;  3ZYT A;  3PTE A;  2L1M A;  3Q7V A;  5FL3 A;  3IH8 A;  1JWV A;  2W3G A;  2KOI A;  4I3I A;  1NJ4 A;  1CEG A;  2G7U A;  4LV3 A;  4NXE A;  1MZU A;  3P7N A;  4GS9 A;  2INW A;  5CER A;  4I39 A;  1ZG6 A;  3FZC A;  2H28 A;  4E3N A;  1PRQ A;  3CZD A;  4OPR A;  4OP5 A;  4YOF A;  3BFE A;  4XUX A;  4OOL A;  4UAA A;  1N9N A;  2VGK A;  3PAE A;  4IUH A;  1NRF A;  2HGV A;  4GNU A;  3EQV A;  4EXO A;  1H8Z A;  3VP3 A;  4L9G A;  4KUO A;  1LI9 A;  3WRZ A;  3NJA A;  2ZQ7 A;  4KZA A;  1FCN A;  2JKR I;  3PXP A;  2W3E A;  5EE8 A;  5EOE A;  1W79 A;  2EXA A;  4L9F A;  2XK1 A;  1BUE A;  5I94 A;  2JKF A;  1XFQ A;  2VA0 A;  1ERO A;  3WS4 A;  1UGU A;  2L0W A;  3IWQ A;  1XGJ A;  3OZH A;  4EV4 A;  2ZD8 A;  4X53 A;  1MXO A;  4M3K A;  1ES5 A;  4S2P A;  3NCK A;  2JBF A;  4F94 A;  1E3U A;  2HDS A;  3E4P A;  4Q0J A;  1K56 D;  3A0R A;  2EA9 A;  2Y2Q A;  4IUK A;  3A3F A;  3T4L A;  3G6O A;  5FEF A;  2E8I A;  2Z2L B;  4BMW A;  2PR5 A;  4U0X A;  2IWC A;  4OLG A;  3O86 A;  4Y3I A;  4GD6 A;  4UQI S;  4RX2 A;  4EBL A;  5F69 A;  2VK3 A;  5G4Z A;  3B33 A;  3A3J A;  3IHB A;  1GHM A;  4KQD A;  2PU2 A;  4UA9 A;  5C5K A;  4XXR A;  5TFQ A;  1ZC2 A;  2PD7 A;  4I38 A;  3SZT A;  3S7O A;  1BTL A;  2IWD A;  4MDZ A;  3MBZ A;  3Q07 A;  2H5S A;  1PWG A;  2WGW B;  2WYX A;  4R4S A;  1P9W A;  2ZL1 B;  4PPR A;  3CG5 A;  2FFF B;  3UN7 A;  3S22 A;  3UB8 A;  2VV6 A;  5F82 A;  3RJU A;  3CWF A;  1XPB A;  1PWC A;  3A3D A;  3AGE A;  3EWK A;  3AGF A;  1F2K A;  3UMD A;  2XA7 S;  2R78 A;  3HUN A;  2Y2M A;  3GSG A;  2LB9 A;  3LEZ A;  3G2Z A;  4EET B;  2WGW A;  2P7J A;  3ZG7 B;  1DY6 A;  2WKE A;  4EBP A;  4BBV A;  2PT7 A;  3A0S A;  1YLZ A;  4KZ3 A;  3GDI A;  5KMW A;  4K0X A;  2M7U A;  3E4O A;  2H0T A;  3HUM A;  1DJC A;  4JF5 A;  4N1X A;  4HJ6 A;  1L0F A;  5F1G A;  4GZB A;  3GRJ A;  1WA9 A;  3A3I A;  2W1T A;  1JVJ A;  1L3L A;  3H82 B;  4BD0 A;  1XJ4 A;  3QHY A;  3VE4 A;  2WZZ A;  5FI6 A;  5DKL A;  5G4Y A;  4AFI A;  3IX4 A;  1W5D A;  4CLC B;  2UWX A;  5FAO A;  2EX9 A;  2J3T D;  4JGO A;  3SOI A;  1T1C A;  5CX7 A;  3UME A;  4LEN A;  3UB9 A;  5FDH A;  1S4R A;  5DFY A;  4FH4 A;  4ZBE A;  3SS3 A;  4JXV A;  3LID A;  2O9B A;  1LL9 A;  4MNR A;  3S7N A;  3V3R A;  4O01 A;  3L9K A;  3IXH A;  2V20 A;  1AXB A;  2WKH A;  3H82 A;  4BWI A;  1P0Z A;  3BEC A;  2QKP A;  5F6A A;  4GB7 A;  1BSG A;  3TRC A;  4CLC A;  2HP9 A;  4Y2F A;  3UPP A;  2O9A A;  3KX0 X;  3MZD A;  1DJA A;  1YMX A;  4EW7 A;  2BG1 A;  5GHX A;  3ZQ5 A;  2ZC7 A;  4HBT A;  4BBU A;  5FSR A;  4EEP A;  3E2K A;  1MPL A;  1OJ5 A;  4C3Q A;  3UE6 A;  3H9W A;  2G2W A;  1W63 M;  3B47 A;  2ZC4 B;  3A0V A;  3T4T A;  4NXG A;  3N7W A;  3FKW A;  3CJM A;  4ARZ B;  3EOI A;  3IXB A;  3QP4 A;  1L0D A;  3KYZ A;  3IWO A;  3GTC A;  2I9V A;  2R9W A;  4CLC C;  4N1H A;  5CTM A;  2K31 A;  3MKF A;  5HWW A;  1SDN A;  5M1A A;  3UDI A;  5MC7 A;  5DTK A;  4KZ5 A;  5CTN A;  1PNE A;  1BZA A;  4HEF A;  2AVX A;  1G6A A;  4HHD A;  3ITB A;  4KZ4 A;  4ZJ3 A;  1ES3 A;  3OLO A;  1GHI A;  1SZV A;  1Y54 A;  2EX8 A;  3ZNY A;  2XFS A;  4FCF A;  4X1L A;  1YSP A;  3IX8 A;  2OAP 1;  4BEN A;  3BRM A;  5EM1 A;  3CLO A;  1W7F A;  3BY8 A;  4WZ5 A;  1EW0 A;  4B4Z A;  1W8Y A;  2BTF P;  2GNX A;  4NK3 A;  3L7H A;  4LRZ E;  2C5W B;  3C4O A;  4OQI A;  5A8B A;  3ZG0 A;  1IYP A;  3QP6 A;  2ZLY A;  1T1A A;  1MWT A;  2D02 A;  3W4O A;  3CIT A;  5M19 A;  2HDU A;  2ZOH A;  4GKU A;  3M2K A;  1LHY A;  2Y2L A;  4GCZ A;  4EU0 A;  1XKZ A;  4X69 A;  1E4D A;  5HFO A;  1KE4 A;  4DF6 A;  3D3O A;  4QY6 A;  2QMI A;  3HRE A;  2ACG A;  5L10 A;  3Q7Z A;  5AVF A;  3BYD A;  5CEC A;  4CPK A;  3OPL A;  2M1C A;  4ZJ1 A;  4PM5 A;  3HVF A;  4WZ5 C;  1X0O A;  3UY6 A;  1OT9 A;  3VV4 A;  2E8J A;  5TGF A;  2A2L A;  1FQG A;  3ZNT A;  2J9P A;  1D06 A;  3TE8 A;  1H0M A;  5AJG A;  4DDS A;  4WBG A;  3CUE A;  1FSW A;  4DE0 A;  1MC0 A;  3G34 A;  4JKT A;  3ZCZ A;  3T4K A;  3MQQ A;  4B4X A;  1CI8 A;  1GA0 A;  4OPY A;  2HJ9 C;  2XDM A;  1OTD A;  4N92 A;  2Y2I A;  1SKF A;  2VJW A;  2ZMV A;  1ES4 A;  2HF6 A;  3S7Q A;  5EVI B;  4S2O A;  3VFF A;  4GD8 A;  4KZ7 A;  1KDW A;  5EM0 A;  2Q9M A;  3O87 A;  2Q9N A;  4WEK A;  4OOM A;  5K5B A;  1KGF A;  5LBR A;  3TOI A;  5EPH A;  1CJF A;  3O3V A;  4Z1W A;  1LI0 A;  1K54 A;  3CUE C;  1OME A;  1MY8 A;  4DXB A;  1PFL A;  4EUV A;  2V2F F;  1NLY A;  2HDQ A;  2WZX A;  1RGY A;  2ZC3 B;  1TEM A;  3MS6 A;  4WMC A;  3ZG8 B;  2O0Y A;  1HTZ A;  5EVI A;  2P9V B;  3N8S A;  2Y8H A;  1CI9 A;  3BFC A;  1XJ2 A;  2QJ7 A;  1OPX A;  1FIL A;  2XD1 A;  1AWI A;  2P04 A;  2HP6 A;  2XA7 M;  2HZ5 A;  3V50 A;  1XGI A;  4GJ4 A;  3MFD A;  1CK3 A;  1XA7 A;  2VV7 A;  3IF6 B;  4YWZ A;  2JC7 A;  2Y2H A;  1NWZ A;  1K57 A;  1K54 C;  1TVF A;  4WL9 A;  1S4S A;  4JGP A;  4JLF A;  3MMH A;  5EVE A;  4G3W A;  5F68 A;  3D4F A;  4GS9 B;  2P9V A;  2JCH A;  1LL5 A;  4KQO A;  2XRN A;  4P6Z M;  3VP0 A;  4I3A A;  4QY5 A;  5U47 A;  1ZHH B;  2O99 A;  3HLC A;  2VGL M;  1OTB A;  2W1R A;  1PZO A;  3C2W A;  3GV9 A;  4K08 A;  4JF6 A;  3BW6 A;  2Y2G A;  1E25 A;  1S1Z A;  4ETX A;  3DW0 A;  2VLG A;  4LLO B;  2OLU A;  3IF6 A;  3E98 A;  3C30 A;  3DTE A;  2YKF A;  2Y2J A;  2XFT A;  1LT0 A;  3KO6 A;  5CED A;  4E3M A;  2D01 A;  1K57 C;  1MBL A;  2X01 A;  4CQH A;  1PIO A;  4DE3 A;  1NZU A;  4IVK A;  1D1J A;  3LR0 A;  2EFU A;  2ZQ9 A;  1YT4 A;  3LI9 A;  4I3J A;  3DAV A;  3VFH A;  1IYO A;  3B3X A;  4B93 A;  4Y15 A;  2P08 A;  3T4Q A;  4RYE A;  2JN7 A;  1ZG4 A;  4DMZ A;  4EBN A;  3QNC A;  3NY4 A;  2GX5 A;  1PW1 A;  4OQH A;  1GSW A;  3RTY A;  1Q2Q A;  2VGJ A;  2O9C A;  3IF6 C;  5TBM B;  5BOH A;  3NDG A;  3NI9 A;  3NEC A;  3BM6 A;  1SDE A;  4MBF A;  2XQZ A;  3MXS A;  5CXW A;  5HD5 A;  2NUT C;  1S0W A;  4RVA A;  5HD3 A;  4R23 A;  2BAS A;  4OPZ A;  1KOU A;  2V1B A;  3QP8 A;  2FFY A;  3JVV A;  4JXG A;  2QPN A;  1PI5 A;  1HD8 A;  2KLI A;  1MWU A;  3D9Y A;  3Q1F A;  4Q0H A;  2OAQ 1;  1K56 A;  4XT2 B;  4R0Q A;  4KG5 A;  1ODV A;  1G28 A;  4MBH A;  3GMW A;  1ZTU A;  5TBM A;  5FQM A;  1HZO A;  3W4P A;  4MEZ A;  1NYM A;  2QHK A;  1H8M A;  1TDG A;  2XRO A;  1NLZ A;  2WUQ A;  3JVU A;  2V8F A;  1Y28 A;  2ZQ8 A;  3KYQ A;  4BLM A;  3T4O A;  1PI4 A;  3DTI A;  1GHP A;  4JF4 A;  4XT2 A;  4Y0O A;  5F83 A;  4HH3 A;  4OPQ A;  5HWT A;  5FA7 A;  1IEM A;  4F3L B;  3RXX A;  2QYB A;  3JYI A;  1SKO B;  3WWX A;  3KSG A;  4Q8I A;  3M2J A;  1V9Y A;  4MN6 A;  4S2L A;  5GL9 A;  4UEY A;  1UWP X;  1ESU A;  5F1F A;  2RCX A;  1BT5 A;  3PBT A;  4BL3 A;  1MWR A;  3IH9 A;  5FAS A;  2V9A A;  1LL8 A;  4QPR A;  5EFW A;  4DN0 A;  2W1T B;  2FZ0 A;  3P98 A;  2VEA A;  1H5X A;  5GLD A;  1FCM A;  1VET A;  2JHE A;  3NOT C;  4WF0 A;  4F3L A;  3LIE A;  4IED A;  5CHJ A;  4EEU A;  4BQM A;  2V1Z A;  1CF0 A;  1SKO A;  2Y2K A;  4JXW A;  3MXQ A;  4S2M A;  4KEN B;  3W8K A;  3FG8 A;  4PM8 A;  4P6Z S;  3MJQ A;  1VQQ A;  2WKQ A;  1YMS A;  5DJU A;  5HX9 A;  4O7D A;  3EEH A;  3I7J A;  3HL9 A;  2VGL S;  4L9E A;  2GZA A;  4S2N A;  3GVB A;  4MN7 A;  4PKY A;  2WKR A;  5JYO A;  4HP4 A;  1P97 A;  5FEG A;  3LEQ A;  5AQ7 A;  3UO9 A;  3CPT B;  4QD4 A;  4X55 A;  2W3F A;  3CHW P;  4ESP A;  4GDN A;  4R3J A;  2Y2O A;  3TJZ C;  4KZB A;  3KSF A;  4YNR A;  4RX3 A;  1TD5 A;  4MN5 A;  2ZMF A;  4HP9 A;  1OJG A;  4DJ3 A;  5L8M A;  2HP5 A;  2V0U A;  1OTI A;  4WEJ A;  4FUW A;  4FOF A;  4IBX A;  4L0L A;  2B02 A;  2DCF A;  3ITA A;  4WEL A;  2EFX A;  3LY4 A;  4DE2 A;  4S2N C;  3N8R A;  3KYE A;  1RP5 A;  1SHV A;  4OQ0 A;  2DNS A;  3UE1 A;  1OT6 A;  3CPT A;  3O88 A;  3VSK A;  4HQA A;  1K4F A;  1IYS A;  1XJ3 A;  4WZ4 A;  1GSX A;  3IHA A;  1Z6F A;  2Z6C A;  3C8C A;  2K2N A;  5KIZ A;  3T1S A;  3N4I A;  3ZG5 A;  2NUP C;  4S2K A;  4R3B A;  4DJ2 A;  1VM1 A;  3SS5 A;  1YM1 A;  2VZW A;  3UB5 P;  1S67 L;  5E2F A;  3VE3 A;  1ERM A;  3PYP A;  4WM9 A;  2WAF A; 
#chains in the Genus database with same CATH homology
 3FZC A;  4LCM A;  1ES4 A;  4E3N A;  5EVI B;  4S2O A;  3CZD A;  4OPR A;  1ALQ A;  3VFF A;  4GD8 A;  4KZ7 A;  4OP5 A;  4ZAM A;  1NXY A;  5A93 A;  1JWZ A;  4DDY A;  1KDW A;  3BFD A;  3S1Y A;  3BFE A;  4XUX A;  5GLA A;  4OOL A;  2Q9M A;  5GHZ A;  4UAA A;  3WS5 A;  1YLJ A;  3O87 A;  1K6R A;  2Q9N A;  4OON A;  4WEK A;  1I2W A;  5CER A;  5A92 A;  4OOM A;  3DWZ A;  2QZ6 A;  3DTM A;  2VGK A;  3PAE A;  5GLC A;  1NRF A;  1KGF A;  2XR0 A;  4MLL A;  3PBR A;  2DRW A;  1MKI A;  4QU3 A;  5EPH A;  4GNU A;  3TOI A;  3EQV A;  4X6T A;  1H8Z A;  4OKP A;  4S2J A;  3VP3 A;  3O3V A;  5L2F A;  1LI0 A;  1K54 A;  1OME A;  5FAT A;  1MY8 A;  1LI9 A;  4DXB A;  3WRZ A;  5EVL A;  2ZQ7 A;  4KZA A;  1FCN A;  2V2F F;  2J8Y A;  1JTG A;  2HDQ A;  2WZX A;  1RGY A;  5EE8 A;  2ZC3 B;  1ERQ A;  1TEM A;  5EOE A;  1W79 A;  1ONG A;  4K91 A;  2EXA A;  5FI2 A;  4OVD A;  4WMC A;  3ZG8 B;  4E3J A;  1HTZ A;  5EVI A;  2XK1 A;  2P9V B;  5E43 A;  2WAE A;  3N8S A;  3WS0 A;  5TR7 A;  1TDL A;  1XP4 A;  1BUE A;  5I94 A;  1CI9 A;  5FQI A;  1ERO A;  2WKI A;  3WS4 A;  3BFC A;  1XGJ A;  3IWQ A;  1PZP A;  3OZH A;  4UA6 A;  4EV4 A;  2XD1 A;  2ZD8 A;  4X53 A;  2HP6 A;  2ZM0 A;  1MXO A;  4HBU A;  3V50 A;  4M3K A;  1XGI A;  1ES5 A;  4WYY A;  2X71 A;  4S2P A;  3MFD A;  3IF5 A;  5DTT A;  3NCK A;  1N9B A;  1C3B A;  2JBF A;  4F94 A;  1E3U A;  2HDS A;  2A49 A;  1ESI A;  1CK3 A;  4NET A;  5D3O A;  1XA7 A;  5HL1 A;  1K56 D;  4KZ8 A;  3ZG9 B;  3IF6 B;  1H8Y A;  4OP8 A;  2JC7 A;  2Y2Q A;  3HLW A;  2Y2H A;  4C6Y A;  5CRF A;  1K4E A;  3A3F A;  4P6B A;  3QNB A;  1K57 A;  2Y55 A;  4IVI A;  1K54 C;  1TVF A;  3IXG A;  1KGE A;  2E8I A;  2Z2L B;  4Y0U A;  4JLF A;  4U0X A;  3NDE A;  2IWC A;  4KZ6 A;  4N9K A;  3VP2 A;  4KQR A;  3O86 A;  4OLG A;  3UNW A;  4GD6 A;  3M6H A;  3D4F A;  2P9V A;  2JCH A;  3AGD A;  4RX2 A;  1LL5 A;  4EBL A;  4FSF A;  4KQO A;  4PM7 A;  3VP0 A;  5GHY A;  3A3J A;  3IHB A;  1GHM A;  3Q82 A;  3HLB A;  4QY5 A;  5U47 A;  2H0Y A;  2PU2 A;  1QMF A;  4UA9 A;  4XXR A;  1ONH A;  3HLC A;  5TFQ A;  1ZC2 A;  3MKE A;  1PWD A;  4X68 A;  4EUZ A;  3GV9 A;  1PZO A;  3G31 A;  1KDS A;  1BTL A;  4JF6 A;  2IWD A;  4QJG A;  5JYP A;  2Y2G A;  1E25 A;  3MBZ A;  3C4P A;  3DW0 A;  2H5S A;  3Q07 A;  4HES A;  1PWG A;  2WGW B;  2ZQC A;  4K0W A;  2OLU A;  1GCE A;  1L2S A;  2Y2P A;  3IF6 A;  5A91 A;  3VOZ A;  2WYX A;  3FWL A;  1EI5 A;  2Y2J A;  2XFT A;  4R4S A;  4PPR A;  3CG5 A;  5CED A;  4E3M A;  1KE0 A;  1N4O A;  2FFF B;  3UN7 A;  3S22 A;  1ZKJ A;  1K57 C;  1MBL A;  2ZJ9 A;  2X01 A;  5F82 A;  1PIO A;  4DE3 A;  3V3S A;  3IQA A;  1NZU A;  2OSU A;  1WYC A;  4IVK A;  3RJU A;  3HLF A;  5EUA A;  3W4Q A;  1XPB A;  2EFU A;  3P09 A;  2ZQ9 A;  3UE3 A;  1PWC A;  5KZH A;  4DXC A;  1YT4 A;  2PU4 A;  2R9X A;  3A3D A;  3AGE A;  3OCN A;  1QME A;  4P0M A;  3VFH A;  1NY0 A;  2ZC6 B;  1KVM A;  3AGF A;  1IYO A;  3B3X A;  5DTS A;  3HUN A;  2OV5 A;  1IEL A;  4RYE A;  3VMA A;  2Y2M A;  3GSG A;  1ZG4 A;  3LEZ A;  4EBN A;  5HAP A;  3QNC A;  3NY4 A;  3ZDJ A;  3G2Z A;  4KG2 A;  1PW1 A;  4OQH A;  2WGW A;  3ZG7 B;  4JPM A;  3BEB A;  1DY6 A;  2WKE A;  5DF7 A;  4EBP A;  1Q2Q A;  1BLS A;  1EWZ A;  1NZO A;  1YLZ A;  4KZ3 A;  2VGJ A;  5HAR A;  5CHM A;  1M6K A;  3M6B A;  3OPH A;  3IF6 C;  2Y2N A;  5KMW A;  3Q81 A;  4K0X A;  4E6X A;  3MZE A;  5BOH A;  2H0T A;  3NDG A;  4N9L A;  3NI9 A;  1DJB A;  3HUM A;  2HDR A;  3BM6 A;  1DJC A;  4JF5 A;  3ISG A;  3UDF A;  1SDE A;  4MBF A;  4N1X A;  1BLH A;  2XQZ A;  2ZC5 B;  3MXS A;  1JWP A;  5CXW A;  4FH2 A;  1Q2P A;  1KGG A;  3G2Y A;  1JTD A;  1L0F A;  1LLB A;  2XH9 A;  4GZB A;  5F1G A;  1S0W A;  4RVA A;  3PBN A;  3GRJ A;  4R23 A;  2X02 A;  3A3I A;  3S4X A;  4OPZ A;  1FOF A;  3BFG A;  1JVJ A;  4DE1 A;  4X56 A;  5IHV A;  4ZTK A;  3OCL A;  2FFY A;  4JXG A;  5HAI A;  2C6W B;  2QPN A;  3V5M A;  2XEP A;  4KQQ A;  1K55 A;  1PI5 A;  3FYZ A;  4BJP A;  1HD8 A;  3IWI A;  2H10 A;  1BUL A;  2ZQD A;  5CGX A;  1MWU A;  4BD0 A;  3QHY A;  1WE4 A;  4MBK A;  2WZZ A;  5FI6 A;  3Q1F A;  1K56 A;  3ZHH A;  4R0Q A;  4QHC A;  4KG5 A;  3HBR A;  3GQZ A;  1W5D A;  4MBH A;  2UWX A;  3LY3 A;  5FAO A;  3GMW A;  1K38 A;  2EX9 A;  3VP4 A;  1L0G A;  4WMC D;  1O07 A;  1HZO A;  5FQM A;  3W4P A;  1K6S A;  2XF3 A;  4U0T A;  5EVI D;  4MEZ A;  3SOI A;  2WAD A;  1NYM A;  1YQS A;  5E2E A;  4LV0 A;  4LEN A;  4P85 A;  5KSH A;  3PBQ A;  5FDH A;  3NBL A;  1TDG A;  3HLG A;  2RL3 A;  4FH4 A;  2I72 A;  4ZBE A;  3SH8 A;  3SS3 A;  4JXV A;  5J8X A;  1IYQ A;  3PAG A;  2XLN A;  1LL9 A;  4E3L A;  2J9O A;  2WUQ A;  1KE3 A;  2Y91 A;  4MNR A;  4XUZ A;  2ZQ8 A;  2B5R A;  3V3R A;  4BLM A;  3PBS A;  5FQ9 A;  3HUO A;  4LV2 A;  3IXH A;  2V20 A;  5HW3 A;  1AXB A;  1PI4 A;  1S6R A;  2WKH A;  4B88 A;  1GHP A;  3BEC A;  4P87 A;  1K55 C;  2ZM8 A;  4JF4 A;  4Y0O A;  5F83 A;  1XX2 A;  4E3O A;  1PW8 A;  4OPQ A;  5CEB A;  5FA7 A;  4KZ9 A;  4GB7 A;  4R1G A;  3TSG A;  1BSG A;  1YLW A;  3N8L A;  3UPN A;  3IXD A;  2HP9 A;  3OC2 A;  1IEM A;  3UPP A;  3RXX A;  4PM9 A;  5FQJ A;  3JYI A;  3MZD A;  3SH7 A;  1DJA A;  3WWX A;  1YMX A;  4BD1 A;  4Q8I A;  3M2J A;  2BG1 A;  5GHX A;  1FCO A;  4S2L A;  5EEC A;  5GL9 A;  3FV7 A;  2ZC7 A;  1ESU A;  5GLB A;  5F1F A;  2RCX A;  4HBT A;  1BT5 A;  4BL2 A;  5FSR A;  3PBT A;  4OLD A;  1RCJ A;  3E2K A;  4BL3 A;  1MPL A;  4YFM A;  1MWR A;  4OQG A;  4A5R A;  4C3Q A;  3LO7 A;  1FSY A;  3IH9 A;  3N6I A;  5FAS A;  2G2W A;  5KSC A;  4DKI A;  2EX6 A;  3VSL A;  2ZC4 B;  3P98 A;  4S2I A;  3G32 A;  1H5X A;  3C7U A;  3N7W A;  3FKW A;  3CJM A;  1W8Q A;  3FKV A;  4PMA A;  3SS4 A;  3C5A A;  3IXB A;  2XD5 A;  1BLC A;  4YIN A;  2G2U A;  5GLD A;  4ZJ2 A;  1FCM A;  1BLP A;  1CEF A;  3MZF A;  1L0D A;  4QB8 A;  2ZMA A;  4IED A;  3IWO A;  5DF9 A;  3DWK A;  5CHJ A;  3GTC A;  5CGS A;  5FQK A;  2R9W A;  2V1Z A;  4BQM A;  4N1H A;  5CTM A;  2CC1 A;  4KG6 A;  5CGW A;  2Y2K A;  3MKF A;  1SDN A;  2ZQA A;  5M1A A;  4JXW A;  3UDI A;  5AQB A;  2J7V A;  4S2M A;  2XGN A;  3EQU A;  5DTK A;  3V39 A;  4KEN B;  4KZ5 A;  3W8K A;  5CTN A;  5G18 A;  4ID4 A;  1I2S A;  1BZA A;  4HEF A;  2GDN A;  3WRT A;  2BLS A;  4PM8 A;  1O7E A;  1G6A A;  3E2L A;  1VQQ A;  1YLT A;  3BFF A;  3ITB A;  1YMS A;  4KZ4 A;  4ZJ3 A;  2EXB A;  1ES3 A;  3G30 A;  4LV1 A;  5FAQ A;  1GHI A;  4O7D A;  1MWS A;  5HX9 A;  3VOY A;  1Y54 A;  3I7J A;  2EX8 A;  1IKI A;  3GR2 A;  4E3I A;  3ZNY A;  2OLV A;  3HL9 A;  3TG9 A;  3ZVT A;  4S2N A;  2XFS A;  4FCF A;  5AQ9 A;  3GVB A;  1G68 A;  1YLP A;  5JYO A;  4C75 A;  3WS1 A;  2EX2 A;  5A90 A;  3A3E A;  1YLY A;  5AQ7 A;  3WS2 A;  4Y7P A;  4BEN A;  3CMZ A;  3BRM A;  1L0E A;  2Y59 A;  3UO9 A;  5M18 A;  3LCE A;  3OPP A;  4Z9Q A;  4QD4 A;  4X55 A;  2Y4A A;  4U3T A;  1W7F A;  4GDN A;  1ES2 A;  4R3J A;  1SCW A;  4WZ5 A;  2Y2O A;  4KZB A;  4B4Z A;  4LCL A;  1W8Y A;  3G35 A;  4IBR A;  3UPO A;  4NK3 A;  3IT9 A;  4RX3 A;  1J9M A;  5DF8 A;  4ZDX A;  2C5W B;  3C4O A;  1FR6 A;  4OQI A;  3RXW A;  3ZG0 A;  3ZVW A;  1IYP A;  2HPB A;  2ZLY A;  3MXR A;  1MWT A;  3W4O A;  2HP5 A;  3HLE A;  4WEJ A;  5FQQ A;  2HDU A;  2WGI A;  2PBY A;  4FD8 A;  4GKU A;  4IBX A;  5M19 A;  3M2K A;  4L0L A;  3ZGA B;  2DCF A;  1LHY A;  1XA1 A;  3ITA A;  3Q7V B;  2Y2L A;  4UHU A;  4WEL A;  1XKZ A;  1KVL A;  1E4D A;  1M40 A;  4X69 A;  5HFO A;  2EFX A;  1KE4 A;  1I5Q A;  3BLS A;  1K25 A;  4GN2 A;  5EOO A;  4E3K A;  1XXM A;  4DF6 A;  2WK0 A;  1E3U D;  3LY4 A;  4DE2 A;  1WYB A;  4S2N C;  4QY6 A;  2QMI A;  3N8R A;  3HRE A;  4JBF A;  5FI7 A;  1RP5 A;  5HAQ A;  1SHV A;  4OQ0 A;  2DNS A;  4D2O A;  3UE1 A;  1IKG A;  3O88 A;  5AQA A;  3VSK A;  3PBO A;  3UE0 A;  2P74 A;  3Q7Z A;  4GOG A;  4OH0 A;  1K4F A;  1RGZ A;  4OOY A;  4EWF A;  3BYD A;  4H8R A;  3NC8 A;  5EVI C;  4EQI A;  1U60 A;  4CPK A;  3C7V A;  3OPL A;  2IWB A;  5CEC A;  1IYS A;  4ZJ1 A;  4JXS A;  3HLD A;  3HVF A;  4PM5 A;  4UA7 A;  4WZ5 C;  1FR1 A;  4WZ4 A;  1GA9 A;  1PYY A;  3SH9 A;  2ZM2 A;  3IHA A;  1Z6F A;  3OPR A;  5DVA A;  3UY6 A;  3NIA A;  3UDX A;  3BLM A;  5TGF A;  3ZNT A;  1FQG A;  2JE5 A;  3ZFZ A;  2J9P A;  4CJN A;  3VP1 A;  4PM6 A;  2WGV A;  3N4I A;  4DRT A;  3G4P A;  4DDS A;  5E2G A;  3ZG5 A;  4GDB A;  3PTE A;  4S2K A;  4WBG A;  2A3U A;  4R3B A;  3Q7V A;  1VM1 A;  3IH8 A;  3SS5 A;  1JWV A;  1FSW A;  1YM1 A;  4DE0 A;  4R4R A;  3G34 A;  4JKT A;  4RA7 A;  3ZCZ A;  4E6W A;  1NJ4 A;  1CEG A;  5CHU A;  4LV3 A;  4B4X A;  1CI8 A;  1GA0 A;  4OPY A;  4Y0T A;  1NYY A;  5E2F A;  1HVB A;  2XDM A;  1ERM A;  4N92 A;  5E2H A;  4WM9 A;  2WAF A;  2Y2I A;  2Z2M B;  1SKF A;  5FAP A;  1ZG6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...