4OQIA

Crystal structure of stabilized tem-1 beta-lactamase variant v.13 carrying r164s/g238s mutations
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGGRVGYIELDLASGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVGELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDSWEPELNEAIPNDERDTTTPVAMATTLRKLLTGELLTAASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGASERGSRGIIAALGPDGKPSRIVVIYMTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TEM-94 ES-beta-lactamase
publication title Negative Epistasis and Evolvability in TEM-1 beta-Lactamase--The Thin Line between an Enzyme's Conformational Freedom and Disorder.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase inhibitor
total genus 104
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2014-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4oqiA00
1GHPA 4LENA 2J8YA 2WKIA 3E2KA 3QNCA 5GLCA 4XUZA 3UDIA 5A92A 4K91A 1K57C 4EBPA 2B5RA 3GSGA 1Y54A 1G68A 1FQGA 1BSGA 2J9PA 2WYXA 3HVFA 3PBOA 4N9KA 5CERA 5F83A 3UO9A 1K4FA 2X01A 4ZJ1A 1H8YA 1IYPA 2RCXA 4RA7A 4R3BA 3HLDA 3UPNA 1ES2A 1QMFA 4BLMA 5A90A 2ZQDA 3IH9A 3D4FA 3HL9A 1MWRA 1WYBA 4ZTKA 3MZDA 4HESA 4DE3A 3ZVTA 1TVFA 3S4XA 4OQGA 1XKZA 4R4RA 3IF6B 4HEFA 2OLUA 3IHAA 3P09A 3VSLA 1YMXA 4ZAMA 3FZCA 4XXRA 3G35A 3ZG5A 3Q7VB 3WS0A 1NYYA 1K25A 3IXGA 3Q7VA 1K55A 4OPQA 3HBRA 3NCKA 5GHZA 3VP1A 1NZUA 5CECA 1ERMA 3C7UA 4WZ4A 5HFOA 3SS3A 3N6IA 4B88A 3ISGA 4KENB 2VGJA 1SDEA 2WZXA 3C5AA 3VOZA 1S6RA 1NRFA 3NY4A 1L0FA 4K0XA 1YLWA 3WS1A 1PZPA 5TR7A 3M6HA 3NI9A 1FSWA 4PM9A 4LV2A 4N1XA 5DF9A 5FI2A 2EFUA 2WGIA 5GLDA 2WKEA 3BRMA 5D3OA 4IBXA 5FAPA 1GHIA 3IF5A 1Z6FA 2ZQCA 1MWUA 1L2SA 4B4XA 3ZG7B 1ES5A 1LLBA 1YLJA 3BM6A 3Q07A 1IYOA 3PAGA 2H0TA 2HDQA 5HW3A 1K57A 3ZNYA 5CGXA 4U3TA 2JBFA 1K56D 5G18A 3ZG9B 3GVBA 3VFHA 4KQQA 2HPBA 3GRJA 4GN2A 5DTTA 3UE3A 3ITAA 3VP2A 1K6RA 2E8IA 2H5SA 2IWCA 5CXWA 2ZC5B 3M2JA 5EOOA 1FSYA 1ONGA 1LL9A 4N1HA 1PW8A 4WZ5C 4WMCD 3CJMA 4N92A 5CGWA 2Z2LB 1LI9A 4OLGA 3V3RA 1XPBA 2ZM2A 3IWOA 5HX9A 1K54A 2HDSA 1KDWA 2P74A 4ZJ2A 4FH4A 4FH2A 3N8SA 3IWIA 5HL1A 5KSCA 1JVJA 1K38A 1WE4A 1M6KA 4OPZA 3MKFA 4UA7A 5FA7A 2Y91A 2Q9NA 5A91A 1CK3A 4S2JA 1FOFA 3BYDA 4S2PA 4BD0A 2Y2IA 3HLGA 4Y0OA 4C3QA 2WK0A 5EECA 1BZAA 5GLAA 3SOIA 3DWKA 3VFFA 2P9VB 2X02A 4MBKA 3G30A 3PBTA 2EXBA 4E6XA 5EVIC 4GD8A 3EQUA 3O87A 1ZG4A 4QU3A 4E6WA 3A3DA 1KE3A 5TFQA 4DXBA 4Y0TA 3BLMA 3ZGAB 1JWPA 1W5DA 4CJNA 4QHCA 1XA1A 1KE4A 2V20A 2Y2LA 3PAEA 2A3UA 3BECA 3HREA 3WRZA 3VSKA 4U0XA 4F94A 1IKIA 5L2FA 5HAQA 4JXWA 1IELA 4K0WA 5FI7A 4MLLA 1RGYA 2QPNA 1BLCA 4JPMA 3UY6A 1DJCA 4OQ0A 4KZ4A 3UPOA 4X53A 4C6YA 5AQ7A 1VQQA 3FKWA 4LCMA 2Y4AA 5GHYA 2Y2KA 4WEJA 4WZ5A 1O07A 2EX2A 4LV1A 1L0GA 3MFDA 2WAEA 2XFSA 3OCNA 4RYEA 1BUEA 4QY5A 2WUQA 4ID4A 3MXSA 1GA0A 3QNBA 5FQMA 4EBLA 2IWDA 1KGEA 4ZBEA 2H0YA 1L0DA 5CHJA 4YFMA 3OPRA 3V50A 1DY6A 4NETA 5CTNA 3UE1A 4BL2A 2ZQ7A 4M3KA 2CC1A 1BLSA 3B3XA 4OQIA 4Y7PA 5FQ9A 3ZG8B 3NIAA 1I2WA 5GL9A 2Z2MB 2WADA 2DCFA 3UE0A 1ES3A 4JKTA 5EVIB 5TGFA 1JWVA 2JE5A 5EVIA 5I94A 3ZVWA 2Y2PA 3LEZA 2WGWB 3Q1FA 4WBGA 5CHMA 5DF8A 2OV5A 5BOHA 1E4DA 1FR1A 2WGWA 3M2KA 1JTGA 4RX2A 4GB7A 4GDBA 3BFFA 2J7VA 2ZQ9A 5CTMA 3UPPA 4A5RA 5CEBA 1IEMA 2ZC6B 1KDSA 1MKIA 1DJAA 1FCMA 1QMEA 2HP5A 2RL3A 2Y2NA 4R3JA 3SH9A 4LV3A 3G32A 4P6BA 3IQAA 3N8RA 5DF7A 5FASA 1W8YA 3FV7A 4GD6A 1K56A 5HAPA 3GQZA 3UNWA 1NY0A 1IYQA 4BD1A 2ZLYA 3IXHA 4OKPA 4EBNA 4OVDA 2XEPA 2A49A 4EQIA 1EI5A 5CRFA 1XXMA 4HBTA 3G31A 5E2HA 1HZOA 1ALQA 5FDHA 4DDSA 1PWCA 4X6TA 2Y55A 1XGJA 3ZNTA 1CEGA 5E2FA 4FD8A 3C4PA 2XD5A 3NDEA 4KQRA 1YLYA 1MY8A 3A3EA 4MBHA 5FQIA 1E3UD 1N9BA 3MZFA 1LL5A 2XD1A 3OC2A 2WZZA 3NC8A 3ZG0A 3FWLA 4IEDA 3HLCA 4KQOA 2DNSA 1WYCA 5FQKA 2C6WB 3SH8A 1YMSA 4S2KA 3W4OA 3N8LA 1W8QA 2UWXA 2XK1A 3DWZA 3NBLA 2ZC4B 2ZJ9A 2OSUA 4MNRA 4E3MA 4X55A 3IH8A 4KZ3A 2XGNA 5FI6A 5KMWA 2ZM8A 1MWTA 4OPYA 3N4IA 3HLFA 3ZHHA 4DKIA 1EROA 5CHUA 3OPLA 3HUNA 3HLWA 4KZAA 3WS4A 4E3NA 1BTLA 1NXYA 3AGDA 2EX6A 1BULA 3W8KA 3VP3A 3OPPA 3TG9A 3DW0A 4Q8IA 5F82A 3UDFA 1GCEA 2J9OA 3CMZA 2JCHA 1K4EA 3VP4A 2OLVA 4QY6A 4X69A 2IWBA 1RCJA 3Q82A 1LHYA 2GDNA 4JF4A 2Y2JA 4RVAA 3I7JA 3GMWA 4E3KA 1M40A 4PPRA 1J9MA 1K6SA 3GR2A 5F1GA 1Q2PA 4RX3A 2HP6A 3O86A 3SS4A 1SDNA 2QMIA 1TEMA 4OOLA 3ITBA 4UA9A 3WWXA 4BENA 5KZHA 2XR0A 2V2FF 4R4SA 4PMAA 1I2SA 4L0LA 4Y0UA 3MXRA 2Y2QA 4S2LA 1PWGA 1E25A 4BJPA 5HAIA 1U60A 1SKFA 3BFEA 4P85A 4PM6A 3BFGA 1ZG6A 5JYOA 4U0TA 1EWZA 1ESUA 3C7VA 1ONHA 3TOIA 3AGEA 1NJ4A 2Y2GA 3IF6C 2EX9A 5EE8A 4IBRA 2VGKA 1JTDA 3NDGA 4KZ5A 1KE0A 3RXXA 2Y2MA 5U47A 2I72A 1YLTA 4KZ7A 3BFDA 3GTCA 3DTMA 1ES4A 4WYYA 1KVLA 1PI5A 4KZBA 4X56A 3AGFA 1HVBA 1ERQA 4E3LA 4JBFA 4NK3A 5IHVA 2WGVA 4R0QA 4GDNA 3RJUA 2XFTA 4E3JA 1PZOA 4JXVA 4FCFA 3G34A 4B4ZA 2ZC7A 3LY3A 1YLPA 1BT5A 5F1FA 1YQSA 4DDYA 1IYSA 4OQHA 4CPKA 3C4OA 4BL3A 5EUAA 5A93A 3LO7A 1SCWA 3UDXA 4GKUA 3G4PA 4P0MA 4OP5A 3JYIA 4E3OA 3HUMA 1H8ZA 3HUOA 4S2OA 2PBYA 2EX8A 2XQZA 3LY4A 2PU4A 3VOYA 2Q9MA 4EV4A 4PM8A 4QD4A 5FATA 5J8XA 3G2ZA 1CEFA 1W7FA 3PBNA 1XA7A 4JLFA 4PM7A 4GNUA 4GOGA 3V5MA 4WM9A 1HTZA 3W4QA 4DF6A 3A3IA 1S0WA 1XGIA 4O7DA 5AQBA 2QZ6A 2PU2A 1GA9A 2XF3A 4DE2A 5FAQA 1NYMA 1ZC2A 1W79A 1BLPA 2Y2HA 2Y2OA 4LV0A 1K54C 4UAAA 1AXBA 3S1YA 1E3UA 3MBZA 1HD8A 4PM5A 4X68A 4ZJ3A 5JYPA 3IF6A 3WS5A 4H8RA 3TSGA 3VMAA 3MZEA 2BG1A 1CI8A 4JF5A 3PBSA 2JC7A 3LCEA 4WMCA 1PYYA 1L0EA 3O88A 5E43A 1N4OA 4OH0A 1TDLA 4JF6A 1FCOA 4QB8A 1VM1A 3IWQA 5GLBA 4S2IA 3W4PA 4HBUA 5FSRA 5E2EA 3P98A 4OONA 1IKGA 5CGSA 5GHXA 3V39A 3ZCZA 1MBLA 4IVKA 3G2YA 4OOMA 1OMEA 3IT9A 4OPRA 5EVID 1G6AA 2ZQ8A 1MXOA 3FKVA 4P87A 1C3BA 4KZ8A 4D2OA 3Q7ZA 3CZDA 2C5WB 4DE1A 4JXSA 1NZOA 2G2WA 1DJBA 4OOYA 3SH7A 4N9LA 3BLSA 4UHUA 1KVMA 3Q81A 3OPHA 4WEKA 5M19A 3M6BA 4S2NC 5AQ9A 5M1AA 2ZQAA 1FR6A 1ZKJA 2EXAA 2WAFA 2FFFB 1H5XA 1XX2A 2ZC3B 3BFCA 1TDGA 1XP4A 4EUZA 4Z9QA 3FYZA 3ZDJA 3PBRA 4R1GA 3IXBA 4ZDXA 3VP0A 5FQQA 1GHMA 4UA6A 4QJGA 5EOEA 3HLBA 2DRWA 2XH9A 3PBQA 1I5QA 4JXGA 4KZ6A 1LI0A 3BEBA 5M18A 3ZFZA 1RP5A 2X71A 5DTSA 4DRTA 3CG5A 4GZBA 5DTKA 2BLSA 1BLHA 4DXCA 3O3VA 3IXDA 2ZD8A 2WKHA 3QHYA 2P9VA 4KG5A 3OCLA 4MEZA 5EVLA 3S22A 3A3JA 3HLEA 4IVIA 2V1ZA 3N7WA 3MKEA 4S2MA 3E2LA 4FSFA 4LCLA 5FAOA 1ESIA 3IHBA 3PTEA 3RXWA 1FCNA 2XDMA 4MBFA 5HARA 4KG6A 5CEDA 1Q2QA 2HDRA 4KZ9A 2ZMAA 3V3SA 1PIOA 4KG2A 1JWZA 4R23A 1K55C 1KGGA 4OLDA 4YINA 4E3IA 2HP9A 3WS2A 3A3FA 5E2GA 4C75A 4OP8A 1KGFA 2G2UA 1RGZA 1MPLA 3EQVA 3GV9A 4BQMA 4WELA 4S2NA 1PW1A 2FFYA 5AQAA 3WRTA 5FQJA 2ZM0A 5DVAA 2R9XA 5EPHA 2H10A 2EFXA 5KSHA 2XLNA 4DE0A 2Y59A 1CI9A 4EWFA 3SS5A 2HDUA 1SHVA 1YT4A 1PI4A 4XUXA 3UN7A 1MWSA 3OZHA 2R9WA 1O7EA 1YM1A 1YLZA 1PWDA
chains in the Genus database with same CATH superfamily
1GHPA 2WKIA 4XUZA 4K91A 4EEPA 1ZTUA 4GS9A 5TBMB 5F83A 3UO9A 2L4RA 1H8YA 1OTBA 4R3BA 3UPNA 1D06A 1QMFA 4BLMA 2JHEA 4DE3A 3CPTA 4JGRA 3ZVTA 2JN7A 4HEFA 2OLUA 3K3DA 2HV1A 5J4EA 3D3OA 4XXRA 1VETB 3ZG5A 3HBRA 1NZUA 3IBJA 1SDEA 3PYPA 3KO6A 4ARZB 1NRFA 3RTYA 1YLWA 1PZPA 1FSWA 3UE6A 5DF9A 2A24B 3BRMA 3CWFA 4IBXA 5FAPA 4I3IA 4H6JA 3ZNYA 5CGXA 1K56D 5G18A 3GVBA 3VP2A 5DTTA 2H5SA 3JPUA 5CXWA 3M2JA 4IUKA 1FSYA 1ONGA 4WMCD 2Z2LB 4OLGA 4FUWA 3N8SA 3IWIA 4OPZA 4UA7A 3OBFA 1N9OA 4S2JA 3BYDA 4S2PA 3IX8A 2Y2IA 4Y0OA 3LYXA 2WK0A 5GLAA 3SOIA 3F1PB 2X02A 3G30A 1ZG4A 3E98A 2OAQ1 2PR6A 4Y0TA 1W5DA 2V20A 3PAEA 5DKKA 5HDCA 5F68A 3WRZA 3VSKA 1IKIA 3EEHA 5KIZA 4MLLA 4JPMA 3GDIA 4C6YA 5GHYA 4R3AA 4LRXC 2V1AA 2PHYA 2WAEA 2XFSA 4RYEA 1BUEA 3QNBA 5FQMA 4LRYC 5A8BA 3MQQA 1DY6A 4NXFA 1OJGA 3UB9A 4HY8A 2W1RA 3B3XA 3VOLA 4Y7PA 3LEQA 3NIAA 1S66L 2Z2MB 2DCFA 3B47A 1ES3A 1OTAA 2JE5A 5EVIA 2BASA 4RQ9A 3TW8A 2Y2PA 3LEZA 5CHMA 2OV5A 5DF8A 3R7WA 1E4DA 1FR1A 1JTGA 4RX2A 4A5RA 2G7UA 1MKIA 3P7NA 2QHKA 4HOIA 4LV3A 4P6BA 3N8RA 1W8YA 3FV7A 1K56A 3GQZA 1D7EA 2A49A 1GSXA 5CRFA 3G31A 4DDSA 1T1CA 1PWCA 3LI8A 3OOVA 3S7PA 3C4PA 2J3TC 4EUVA 2XD5A 1E3UD 3PHYA 3OC2A 2ZOHA 2V8CA 2GNXA 2XSSA 5MC7A 4BBVA 3DWZA 3NBLA 2ZJ9A 2OSUA 2VJWA 1Y28A 1NWZA 3IH8A 4KZ3A 3T4LA 1MWTA 1LL8A 3N4IA 4OPYA 3HLFA 2VV7A 4DKIA 5CHUA 3OPLA 1NXYA 3VP3A 2VGLM 5F82A 3CMZA 4O01A 4HNBA 1RCJA 5HPFA 1LHYA 2Y2JA 4YWZA 4RX3A 2HP6A 2QMIA 2YKHA 4OOLA 4UA9A 4R4SA 2W1TA 2PDRA 1SKOA 4S2LA 4BJPA 1ZG6A 2EA9A 3MXQA 1ONHA 3AGEA 1NJ4A 1H0MA 3E0YA 3NDGA 1KE0A 2I72A 2V0WA 4KZ7A 3DTMA 1KVLA 2V9AA 3AGFA 3RJUA 1BYWA 4UQIS 3EGXC 4Q0HA 4DDYA 1IYSA 2P04A 4QPRA 4YOFA 4P0MA 4OP5A 3JYIA 4E3OA 1H8ZA 4NEED 2PBYA 2EX8A 2QYBA 4EV4A 4PM8A 3PBNA 1HLUP 3A0VA 4GNUA 3W4QA 4WM9A 3A3IA 2PU2A 3L7HA 3MF0A 4HHDA 4UAAA 1AXBA 1E3UA 4PM5A 2VV6A 3IF6A 4H8RA 3VMAA 1LSWA 2BG1A 1CI8A 3PBSA 2JC7A 4G3KA 1N4OA 2O9BA 4EEUA 5HL6A 1L3LA 1FCOA 4QB8A 2H28A 3W4PA 3C8CA 4OONA 5CGSA 5GHXA 3V39A 2NUTC 4HJ4A 4NXGA 1MXOA 3FKVA 4P87A 4KZ8A 4D2OA 3Q7ZA 4DE1A 4MCWA 3T4SA 4HP4A 4PHTA 4UHUA 3ZQ5A 1KVMA 1S4SA 4WUJA 1TD5A 2EXAA 2Z6DA 5L10A 3LR0A 2ZC3B 1VEUB 4CLCE 2HF6A 3H82B 1TDGA 4Z9QA 4HQAA 1GHMA 1T19A 3BW6A 1G28A 5EOEA 3PBQA 1I5QA 4JXGA 5G4ZA 5DTSA 5DTKA 2D01A 1BLHA 3O3VA 2ZD8A 3QHYA 5EVLA 3S22A 3HLEA 3E2LA 4LCLA 4KQDA 4LLOB 5EM1A 1S1ZA 2ZBBA 2HDRA 4KG2A 4R23A 1DP6A 3UMDA 3WS2A 4HJ3A 1STZA 2G2UA 1RGZA 1VHMA 2H10A 2XLNA 1CI9A 4EWFA 1PI4A 4XUXA 3IBRA 2R9WA 1O7EA 1YLZA 1S4RA 4LENA 5EVEA 4EBPA 2B5RA 1Y54A 3QP5A 1G68A 4GS9B 1FQGA 2PRFA 2WYXA 1XJ4A 3HVFA 3PBOA 5CERA 2B95A 2X01A 1ES2A 2ZQDA 3IH9A 3TE8A 1WYBA 3CPTB 3MZDA 4XT2A 3IX4A 1XKZA 1MKMA 4R4RA 1S67L 4FOFA 2XA7S 4I5SA 4ZAMA 1NYYA 3NOTC 1K25A 3Q7VA 4WLAA 5C5KA 1XJ3A 3VP1A 2JKTI 1ERMA 3C7UA 5HFOA 4KENB 2VGJA 3C5AA 3VOZA 3NY4A 3WS1A 4HH3A 2KX6A 4N1XA 1ZHHB 2WGIA 2M1CA 5D3OA 1GHIA 3IF5A 1Z6FA 1TS7A 4HP9A 1L2SA 4H6JB 3ZG7B 1ES5A 1LLBA 1YLJA 3NOPC 3Q07A 3PAGA 2VLGA 5HW3A 1CJFA 4U3TA 3ZG9B 4MN5A 3GRJA 2JKFA 3ITAA 2E8IA 2IWCA 3K2NA 3QP8A 4N1HA 3CJMA 4LRZE 1XPBA 2W3GA 3SW1A 4ZJ2A 4FH4A 1UWPX 2B18A 5FA7A 4BD0A 4O0PA 1BZAA 1ACFA 3B33A 3VFFA 1J3WA 2P9VB 5TJJA 3PBTA 4E6XA 5EVIC 1OTEA 3LIFA 4QU3A 4E6WA 3A3DA 1KE3A 3ZGAB 4Y2FA 1XA1A 3LR5A 2Y2LA 1UWNX 1OTDA 1IOUA 3LIBA 4JGQA 4O8GA 4U0XA 5HDDA 4JXWA 3BQ8A 5EFWA 4NXBA 1BLCA 4NG2A 3UB8A 5HD5A 3V67A 2VZWA 1VQQA 4LCMA 4LPZA 4WZ5A 2CMNA 4LV1A 4QY5A 4GW9A 1GA0A 2H0YA 5CHJA 3OPRA 4AFIA 2R78A 2ZQ7A 4M3KA 1V9ZA 1YSPA 4OQIA 1I2WA 3C38A 5EVIB 4CLCD 1JWVA 3R7WB 1GSVA 2WGWA 3M2KA 4JGOA 4GB7A 3A0RA 3BFFA 2ZC6B 1KDSA 1QMEA 1FCMA 1VB6A 2HP5A 4BWIA 4R3JA 4ETXA 5DF7A 4GD6A 4EBNA 4OVDA 2XEPA 1XXMA 4NKPA 1ALQA 4GHIA 4IHQA 2W27A 4Q0IA 3OLOA 5HDSA 1XGJA 2WKQA 5E2FA 3NECA 1LL5A 2XD1A 3D72A 3SH8A 2C6WB 4S2KA 5F6AA 3W4OA 2XK1A 4E3MA 4UQIM 5KMWA 2ZM8A 3LIDA 4F3LA 1NLZA 4E3NA 4EU0A 1BTLA 3W8KA 3OPPA 2JKRI 3UDFA 1GCEA 2J9OA 5HZHA 1K4EA 3DAVA 3T1RA 4FTXA 3VP4A 3I7JA 4E3KA 4PPRA 3GR2A 1Q2PA 3SS4A 3O86A 1SDNA 1TEMA 3ITBA 4BENA 3IX3A 5KZHA 2L1MA 2W1TB 2V2FF 4PMAA 3MS6A 4L0LA 4Y0UA 3MXRA 1PWGA 3CLOA 4PM6A 4EXOA 1EWZA 3C7VA 2Z6CA 2Y2GA 3IF6C 5FEGA 1JTDA 2J80A 1WA9A 1F98A 3GTCA 2WKPA 4WYYA 1LSVA 1PI5A 4X56A 4CLCA 4MMNA 1ERQA 4JBFA 4NK3A 3BY9A 3F1NA 2XFTA 4FCFA 3KYZA 2ZC7A 5F1FA 1YLPA 4JGPA 4CPKA 4BL3A 3LO7A 3T4JA 4DJ3A 3G4PA 2KOIA 3HUMA 4S2OA 3SZTA 2XQZA 1P9WA 1TS6A 3EGDC 4QD4A 1CEFA 5CX7A 4JLFA 4B9OA 4PM7A 1HTZA 1XGIA 4O7DA 2QZ6A 2XF3A 4WL9A 1FILA 1NYMA 1ZC2A 1W79A 1BLPA 4LV0A 1F5MA 3MBZA 4ZJ3A 4BBTA 2MJ6A 3LCEA 4WMCA 1W63M 1VETA 5E43A 3H7WA 1TDLA 4S2IA 4HBUA 5E2EA 3P98A 3ZCZA 3T1QB 5DJUA 5FDSA 1OMEA 1NRJA 3L9KA 1G6AA 3CZDA 2C5WB 4JXSA 1NZOA 4IJGA 4ETZA 4HI4A 1ODVA 3Q81A 3OPHA 3ULFA 3M6BA 5AQ9A 2ZQAA 2FFFB 1XX2A 1CQAA 3HCYA 3C30A 1XP4A 2Q0OA 4Z1WA 4EUZA 4PKYG 2O99A 3FYZA 3ZDJA 3JVVA 4ZDXA 3NOUC 4KUOA 3KSHA 3HLBA 1N9NA 2DRWA 3FG8A 4KZ6A 1LI0A 1RP5A 2X71A 4DRTA 2BLSA 5HWVA 2K7SA 1LT0A 3F1PA 4KG5A 1H3QA 2XA7M 2VA0A 1T1BA 2V1ZA 3RFBA 1ESIA 3PTEA 5G4YA 4WN5A 1OPXA 4GCZA 5CEDA 4KZ9A 1XJ2A 2ZMAA 4E3IA 1PIOA 4I3AA 4OLDA 4YINA 2HP9A 5E2GA 3S7OA 1XFQA 2V8FA 3NJAA 3GV9A 3NHQA 3KSIA 3DTEA 4WELA 4S2NA 3H9WA 5AQAA 5EPHA 2R9XA 4B93A 2Y59A 3SS5A 2HDUA 1SHVA 4ZRRA 3UN7A 2INWA 3ZYTA 1YSQA 3GMWA 1PWDA 5A92A 3E2KA 4BMWA 1BSGA 2Y79A 2VKSA 4N9KA 1K4FA 2RCXA 4RA7A 3S7QA 3HLDA 1MWRA 4ZTKA 3T1SA 3FPVA 3S4XA 4OQGA 3KX0X 3IHAA 3P09A 3VSLA 1OTIA 1YMXA 3FZCA 3MFXA 3Q7VB 3WS0A 3IXGA 1K55A 3LIAA 4OPQA 3NCKA 1IFQA 5GHZA 5CECA 4LGWA 4B88A 1T1AA 3N6IA 2WZXA 1S6RA 1L0FA 1MZUA 4K0XA 5TR7A 3NI9A 4PM9A 4LV2A 5FI2A 2EFUA 2LB5A 2PBDP 2ZQCA 1MWUA 4B4XA 3S7NA 3P01A 2ZL1A 1K57A 3FPWA 2K31A 2W3EA 2VEAA 2QKPA 4G3VA 3UE3A 3E4PA 2ZC5B 4WZ5C 3DTKA 4N92A 2HJEA 3IWOA 5HX9A 2HDSA 1KDWA 4DJ2A 2DMWA 3TJZC 4FH2A 5HL1A 5KSCA 3MKFA 2Y91A 2GJ3A 1FOFA 4C3QA 2QJ5A 5EECA 3DWKA 4MBKA 2EXBA 4GD8A 2HZ5A 1W63Q 3LR3A 5TFQA 3BLMA 1JWPA 1KE4A 4EW7A 2FH5A 3BECA 4R6LA 5L2FA 4R70A 4K0WA 5FI7A 3UY6A 1DJCA 2QWSA 4KZ4A 4X53A 5AQ7A 2Y4AA 4M4XA 3KYEA 4EETB 4WEJA 1MC0A 5HWTA 2EX2A 3MFDA 4HIAA 2WUQA 4ID4A 3MXSA 2IA2A 1KGEA 1L0DA 3QP6A 4ESPA 1S1YA 3UE1A 1N9LA 1D1JA 3ZG8B 2O9CA 2WADA 2EWVA 3NULA 5I94A 3ZVWA 2WGWB 4WBGA 3D9YA 5CTMA 2RL3A 1DJAA 3SH9A 3IQAA 1P97A 1NLYA 5HAPA 3UNWA 1NY0A 4BD1A 2ZLYA 3IXHA 3KSGA 4L9EA 4EQIA 1EI5A 1CF0A 4GHIB 4HBTA 1HZOA 4L9FA 5FDHA 4X6TA 2Y55A 2HGVA 1CEGA 3NDEA 2UV0E 1MY8A 1N9BA 3IS2A 4E04A 2B02A 2WZZA 2W0NA 3NC8A 2DNSA 1WYCA 1YMSA 3T4QA 1W8QA 1EW0A 3MQOA 2ZC4B 4CLCC 4MNRA 4X55A 4F3LB 1EROA 3HJKA 3WS4A 2EX6A 1BULA 3TG9A 3DW0A 4Q8IA 3FC7A 2JCHA 2E8JA 2OLVA 4QY6A 4X69A 3BJNA 4I39A 3Q82A 2GDNA 4JF4A 1H8MA 5F1GA 1XJ6A 3WWXA 2PYPA 2W3HA 1I2SA 5EV0A 4I38A 2Y2QA 3MSHA 1E25A 3CITA 1U60A 3BFEA 4P85A 3BFGA 4U0TA 1ESUA 3TOIA 3DTIA 4IBRA 2Y2MA 5U47A 1YLTA 2PYRA 4CLCB 3BFDA 4Y15A 4KZBA 4E3LA 4EESA 3G6OA 2WGVA 3F1NB 4R0QA 1PZOA 3C2WA 3G34A 4Y5FA 3UB5P 1YQSA 4OQHA 2VK3A 3C4OA 5EUAA 1SCWA 3QP4A 3HUOA 4L9GA 2ZMVA 3VOYA 2Q9MA 2Y8HA 5FATA 1G6OA 3G2ZA 5J8XA 1W7FA 3RH8B 4KUKA 3T4TA 5FAQA 2GX5A 1DP8A 2Y2OA 1K54C 4MDZA 2FZ0A 3S1YA 3E4OA 5JYPA 4MN6A 2J3WA 1PYYA 1L0EA 3H7WB 3O88A 4JF6A 1JNUA 5GLBA 3IWQA 5FSRA 4DMZA 4Q0JA 1P0ZA 1MBLA 3MJQA 1OT6A 3G2YA 4OOMA 5EVID 4OPRA 4P6ZS 2ZQ8A 1TS8A 3KYQA 5L09A 1C3BA 1SZVA 5AVFA 2G2WA 1DJBA 3TRCA 3EOIA 3EWKA 5M19A 4S2NC 5M1AA 1FR6A 1ZKJA 1LSXA 1H5XA 3DBAA 1G5UA 3BFCA 5HSQA 4R1GA 4UEYA 2ZMFA 3LGOA 5FQQA 4UA6A 1GSWA 2W3FA 3F1OA 3BEBA 4X25A 2K2NA 3CG5A 4GZBA 3LI9A 3CI6A 3VE3A 4DXCA 2WKHA 1SKOB 2P9VA 4MEZA 3OCLA 2O0YA 3A3JA 4IVIA 3UB7A 3MKEA 4S2MA 4FSFA 5FAOA 3IHBA 3RXWA 1FCNA 2XDMA 4CQHA 4KG6A 2KLIA 1Q2QA 3V3SA 1K55C 1A0KA 4OP8A 1KGFA 3BY8A 3T12B 4BQMA 2P08A 2FFYA 4DN0A 2HJ9C 3WRTA 2EFXA 4K08A 3LICA 1YT4A 3OZHA 1YM1A 2J8YA 3QNCA 5GLCA 3UDIA 2YKFA 3BQAA 5AJGA 1K57C 3GSGA 2J9PA 3CUEA 4HH2A 4ZJ1A 5TBMA 1IYPA 2NUPC 5A90A 1OJ5A 3D4FA 3HL9A 4PAUA 4HESA 1TVFA 1TS0A 3IF6B 3UMEA 2OAP1 3LFVA 4QWOA 3G35A 2V0UA 1PRQA 4WZ4A 3SS3A 3ISGA 3UB6A 4R38A 4ARZA 3M6HA 3QP1A 5GLDA 2WKEA 2A24A 1AWIA 4NXEA 2P7JA 4X1LA 1KOUA 4Y3IA 2ZL1B 2XRNA 3BM6A 5F69A 1IYOA 3T4OA 2H0TA 2HDQA 1PFLA 5DFXA 2JBFA 3VFHA 4KQQA 2HPBA 4GN2A 1K6RA 5IS1A 3U2AA 5EOOA 1LL9A 1PW8A 5CGWA 2M7VA 1LI9A 4I3JA 3V3RA 2ZM2A 1K54A 4WF0A 2P74A 5I5LA 3HJIA 3O5YA 1JVJA 1K38A 1WE4A 1M6KA 2Q9NA 2LB9A 5A91A 1CK3A 3HLGA 5HD3A 3PXPA 3EQUA 1P9RA 3O87A 4DXBA 4LFUA 4CJNA 4QHCA 2KDKA 2A3UA 3HREA 4Y17A 1DP9A 4F94A 5HAQA 1IELA 2JKTM 1RGYA 2QPNA 4MN7A 4OQ0A 3UPOA 2EWWA 5K5BA 3FKWA 2I9VA 2Y2KA 5IT5A 1O07A 3EEAA 1L0GA 4EERA 3OCNA 3PR6A 4EBLA 2IWDA 3JVUA 4ZBEA 1YAXA 4YFMA 2J3TD 3V50A 4NETA 2O9AA 5CTNA 4X1MA 4BL2A 3A0SA 2CC1A 1BLSA 4XT2B 5FQ9A 5GL9A 3UE0A 1DRMA 4JKTA 5DJTA 5IU1A 5TGFA 4BBUA 5FEFA 3Q1FA 5BOHA 4GDBA 3UPPA 2J7VA 2ZQ9A 5CEBA 1IEMA 2Y2NA 3G32A 2OWJA 5FASA 1UGUA 1IYQA 4OKPA 5E2HA 3MR0A 3ZNTA 5F5YA 4G3WA 1OT9A 4FD8A 2D02A 4KQRA 1YLYA 3A3EA 5FQIA 3IS2B 4MBHA 3MZFA 4ME4A 3ZG0A 3FWLA 4IEDA 3HLCA 4KQOA 5FQKA 3T1XA 3N8LA 1F2KA 2UWXA 2GZAA 3MMHA 3T50A 4IUHA 3R4KA 2XGNA 5FI6A 5L8MA 3ZHHA 1X0OA 5L07A 3HUNA 2PAVP 3HLWA 4II7A 4KZAA 2A2LA 3AGDA 3QP2A 4D60A 2OOLA 3ICYA 2V1BA 2JKGA 2IWBA 3E4QA 4RVAA 1PNEA 3CAXA 1M40A 1J9MA 1K6SA 1T18A 2L0WA 3T4KA 2XR0A 1Z09A 1K0KA 5HAIA 1SKFA 5J3WA 2PD8A 5JYOA 2BTFP 2EX9A 5EE8A 2VGKA 4KZ5A 3RXXA 2AVXA 2M7UA 1ES4A 3LUQA 1HVBA 3GECA 5IHVA 4P6ZM 4GDNA 2WKRA 3U4LP 4E3JA 3BWLA 4JXVA 4B4ZA 3LY3A 1BT5A 3LR4A 5A93A 3UDXA 4GKUA 2ACGA 4EQ1A 2VGLS 2W3DA 3LY4A 4GJ4A 2PU4A 5DKLA 1XA7A 4GOGA 3V5MA 4DF6A 1S0WA 5AQBA 1GA9A 4DE2A 3B42A 2Y2HA 2JKRM 5DFYA 1HD8A 4X68A 3WS5A 3TSGA 3MZEA 5HPIA 4JF5A 5LBRA 4OH0A 3W2ZA 1YKDA 1VM1A 3KSFA 1IKGA 4Y13A 4IVKA 1TF1A 3IT9A 1F9IA 3MQ0A 4YNRA 2XROA 4OOYA 3SH7A 4N9LA 3BLSA 4WEKA 5J7EA 2WAFA 2VV8A 1FIKA 1VEUA 3H82A 2QJ7A 3PBRA 3IXBA 3VP0A 2OWHA 4QJGA 2PR5A 3F1OB 1XFNA 2PD7A 2XH9A 5FL3A 5HWWA 5M18A 3ZFZA 3CUEC 1Y4OA 4GLQA 3IXDA 2ZOIA 3VE4A 3N7WA 5EM0A 1YPRA 4MBFA 5HARA 5AVEA 1JWZA 3VV4A 1KGGA 3A3FA 4C75A 1MPLA 4HJ6A 3K3CA 3EQVA 1PW1A 5FQJA 2ZM0A 5DVAA 2VX8A 5KSHA 4DE0A 4PKYA 2PT7A 3LIEA 1V9YA 1MWSA 3CHWP
chains in the Genus database with same CATH topology
1GHPA 4LENA 2J8YA 2WKIA 3E2KA 3QNCA 5GLCA 4XUZA 3UDIA 5A92A 4K91A 1K57C 4EBPA 2B5RA 3GSGA 1Y54A 1G68A 1FQGA 1BSGA 2J9PA 2WYXA 3HVFA 3PBOA 4N9KA 5CERA 5F83A 3UO9A 1K4FA 2X01A 4ZJ1A 1H8YA 1IYPA 2RCXA 4RA7A 4R3BA 3HLDA 3UPNA 1ES2A 1QMFA 4BLMA 5A90A 2ZQDA 3IH9A 3D4FA 3HL9A 1MWRA 1WYBA 4ZTKA 3MZDA 4HESA 4DE3A 3ZVTA 1TVFA 3S4XA 4OQGA 1XKZA 4R4RA 3IF6B 4HEFA 2OLUA 3IHAA 3P09A 3VSLA 1YMXA 4ZAMA 3FZCA 4XXRA 3G35A 3ZG5A 3Q7VB 3WS0A 1NYYA 1K25A 3IXGA 3Q7VA 1K55A 4OPQA 3HBRA 3NCKA 5GHZA 3VP1A 1NZUA 5CECA 1ERMA 3C7UA 4WZ4A 5HFOA 3SS3A 3N6IA 4B88A 3ISGA 4KENB 2VGJA 1SDEA 2WZXA 3C5AA 3VOZA 1S6RA 1NRFA 3NY4A 1L0FA 4K0XA 1YLWA 3WS1A 1PZPA 5TR7A 3M6HA 3NI9A 1FSWA 4PM9A 4LV2A 4N1XA 5DF9A 5FI2A 2EFUA 2WGIA 5GLDA 2WKEA 3BRMA 5D3OA 4IBXA 5FAPA 1GHIA 3IF5A 1Z6FA 2ZQCA 1MWUA 1L2SA 4B4XA 3ZG7B 1ES5A 1LLBA 1YLJA 3BM6A 3Q07A 1IYOA 3PAGA 2H0TA 2HDQA 5HW3A 1K57A 3ZNYA 5CGXA 4U3TA 2JBFA 1K56D 5G18A 3ZG9B 3GVBA 3VFHA 4KQQA 2HPBA 3GRJA 4GN2A 5DTTA 3UE3A 3ITAA 3VP2A 1K6RA 2E8IA 2H5SA 2IWCA 5CXWA 2ZC5B 3M2JA 5EOOA 1FSYA 1ONGA 1LL9A 4N1HA 1PW8A 4WZ5C 4WMCD 3CJMA 4N92A 5CGWA 2Z2LB 1LI9A 4OLGA 3V3RA 1XPBA 2ZM2A 3IWOA 5HX9A 1K54A 2HDSA 1KDWA 2P74A 4ZJ2A 4FH4A 4FH2A 3N8SA 3IWIA 5HL1A 5KSCA 1JVJA 1K38A 1WE4A 1M6KA 4OPZA 3MKFA 4UA7A 5FA7A 2Y91A 2Q9NA 5A91A 1CK3A 4S2JA 1FOFA 3BYDA 4S2PA 4BD0A 2Y2IA 3HLGA 4Y0OA 4C3QA 2WK0A 5EECA 1BZAA 5GLAA 3SOIA 3DWKA 3VFFA 2P9VB 2X02A 4MBKA 3G30A 3PBTA 2EXBA 4E6XA 5EVIC 4GD8A 3EQUA 3O87A 1ZG4A 4QU3A 4E6WA 3A3DA 1KE3A 5TFQA 4DXBA 4Y0TA 3BLMA 3ZGAB 1JWPA 1W5DA 4CJNA 4QHCA 1XA1A 1KE4A 2V20A 2Y2LA 3PAEA 2A3UA 3BECA 3HREA 3WRZA 3VSKA 4U0XA 4F94A 1IKIA 5L2FA 5HAQA 4JXWA 1IELA 4K0WA 5FI7A 4MLLA 1RGYA 2QPNA 1BLCA 4JPMA 3UY6A 1DJCA 4OQ0A 4KZ4A 3UPOA 4X53A 4C6YA 5AQ7A 1VQQA 3FKWA 4LCMA 2Y4AA 5GHYA 2Y2KA 4WEJA 4WZ5A 1O07A 2EX2A 4LV1A 1L0GA 3MFDA 2WAEA 2XFSA 3OCNA 4RYEA 1BUEA 4QY5A 2WUQA 4ID4A 3MXSA 1GA0A 3QNBA 5FQMA 4EBLA 2IWDA 1KGEA 4ZBEA 2H0YA 1L0DA 5CHJA 4YFMA 3OPRA 3V50A 1DY6A 4NETA 5CTNA 3UE1A 4BL2A 2ZQ7A 4M3KA 2CC1A 1BLSA 3B3XA 4OQIA 4Y7PA 5FQ9A 3ZG8B 3NIAA 1I2WA 5GL9A 2Z2MB 2WADA 2DCFA 3UE0A 1ES3A 4JKTA 5EVIB 5TGFA 1JWVA 2JE5A 5EVIA 5I94A 3ZVWA 2Y2PA 3LEZA 2WGWB 3Q1FA 4WBGA 5CHMA 5DF8A 2OV5A 5BOHA 1E4DA 1FR1A 2WGWA 3M2KA 1JTGA 4RX2A 4GB7A 4GDBA 3BFFA 2J7VA 2ZQ9A 5CTMA 3UPPA 4A5RA 5CEBA 1IEMA 2ZC6B 1KDSA 1MKIA 1DJAA 1FCMA 1QMEA 2HP5A 2RL3A 2Y2NA 4R3JA 3SH9A 4LV3A 3G32A 4P6BA 3IQAA 3N8RA 5DF7A 5FASA 1W8YA 3FV7A 4GD6A 1K56A 5HAPA 3GQZA 3UNWA 1NY0A 1IYQA 4BD1A 2ZLYA 3IXHA 4OKPA 4EBNA 4OVDA 2XEPA 2A49A 4EQIA 1EI5A 5CRFA 1XXMA 4HBTA 3G31A 5E2HA 1HZOA 1ALQA 5FDHA 4DDSA 1PWCA 4X6TA 2Y55A 1XGJA 3ZNTA 1CEGA 5E2FA 4FD8A 3C4PA 2XD5A 3NDEA 4KQRA 1YLYA 1MY8A 3A3EA 4MBHA 5FQIA 1E3UD 1N9BA 3MZFA 1LL5A 2XD1A 3OC2A 2WZZA 3NC8A 3ZG0A 3FWLA 4IEDA 3HLCA 4KQOA 2DNSA 1WYCA 5FQKA 2C6WB 3SH8A 1YMSA 4S2KA 3W4OA 3N8LA 1W8QA 2UWXA 2XK1A 3DWZA 3NBLA 2ZC4B 2ZJ9A 2OSUA 4MNRA 4E3MA 4X55A 3IH8A 4KZ3A 2XGNA 5FI6A 5KMWA 2ZM8A 1MWTA 4OPYA 3N4IA 3HLFA 3ZHHA 4DKIA 1EROA 5CHUA 3OPLA 3HUNA 3HLWA 4KZAA 3WS4A 4E3NA 1BTLA 1NXYA 3AGDA 2EX6A 1BULA 3W8KA 3VP3A 3OPPA 3TG9A 3DW0A 4Q8IA 5F82A 3UDFA 1GCEA 2J9OA 3CMZA 2JCHA 1K4EA 3VP4A 2OLVA 4QY6A 4X69A 2IWBA 1RCJA 3Q82A 1LHYA 2GDNA 4JF4A 2Y2JA 4RVAA 3I7JA 3GMWA 4E3KA 1M40A 4PPRA 1J9MA 1K6SA 3GR2A 5F1GA 1Q2PA 4RX3A 2HP6A 3O86A 3SS4A 1SDNA 2QMIA 1TEMA 4OOLA 3ITBA 4UA9A 3WWXA 4BENA 5KZHA 2XR0A 2V2FF 4R4SA 4PMAA 1I2SA 4L0LA 4Y0UA 3MXRA 2Y2QA 4S2LA 1PWGA 1E25A 4BJPA 5HAIA 1U60A 1SKFA 3BFEA 4P85A 4PM6A 3BFGA 1ZG6A 5JYOA 4U0TA 1EWZA 1ESUA 3C7VA 1ONHA 3TOIA 3AGEA 1NJ4A 2Y2GA 3IF6C 2EX9A 5EE8A 4IBRA 2VGKA 1JTDA 3NDGA 4KZ5A 1KE0A 3RXXA 2Y2MA 5U47A 2I72A 1YLTA 4KZ7A 3BFDA 3GTCA 3DTMA 1ES4A 4WYYA 1KVLA 1PI5A 4KZBA 4X56A 3AGFA 1HVBA 1ERQA 4E3LA 4JBFA 4NK3A 5IHVA 2WGVA 4R0QA 4GDNA 3RJUA 2XFTA 4E3JA 1PZOA 4JXVA 4FCFA 3G34A 4B4ZA 2ZC7A 3LY3A 1YLPA 1BT5A 5F1FA 1YQSA 4DDYA 1IYSA 4OQHA 4CPKA 3C4OA 4BL3A 5EUAA 5A93A 3LO7A 1SCWA 3UDXA 4GKUA 3G4PA 4P0MA 4OP5A 3JYIA 4E3OA 3HUMA 1H8ZA 3HUOA 4S2OA 2PBYA 2EX8A 2XQZA 3LY4A 2PU4A 3VOYA 2Q9MA 4EV4A 4PM8A 4QD4A 5FATA 5J8XA 3G2ZA 1CEFA 1W7FA 3PBNA 1XA7A 4JLFA 4PM7A 4GNUA 4GOGA 3V5MA 4WM9A 1HTZA 3W4QA 4DF6A 3A3IA 1S0WA 1XGIA 4O7DA 5AQBA 2QZ6A 2PU2A 1GA9A 2XF3A 4DE2A 5FAQA 1NYMA 1ZC2A 1W79A 1BLPA 2Y2HA 2Y2OA 4LV0A 1K54C 4UAAA 1AXBA 3S1YA 1E3UA 3MBZA 1HD8A 4PM5A 4X68A 4ZJ3A 5JYPA 3IF6A 3WS5A 4H8RA 3TSGA 3VMAA 3MZEA 2BG1A 1CI8A 4JF5A 3PBSA 2JC7A 3LCEA 4WMCA 1PYYA 1L0EA 3O88A 5E43A 1N4OA 4OH0A 1TDLA 4JF6A 1FCOA 4QB8A 1VM1A 3IWQA 5GLBA 4S2IA 3W4PA 4HBUA 5FSRA 5E2EA 3P98A 4OONA 1IKGA 5CGSA 5GHXA 3V39A 3ZCZA 1MBLA 4IVKA 3G2YA 4OOMA 1OMEA 3IT9A 4OPRA 5EVID 1G6AA 2ZQ8A 1MXOA 3FKVA 4P87A 1C3BA 4KZ8A 4D2OA 3Q7ZA 3CZDA 2C5WB 4DE1A 4JXSA 1NZOA 2G2WA 1DJBA 4OOYA 3SH7A 4N9LA 3BLSA 4UHUA 1KVMA 3Q81A 3OPHA 4WEKA 5M19A 3M6BA 4S2NC 5AQ9A 5M1AA 2ZQAA 1FR6A 1ZKJA 2EXAA 2WAFA 2FFFB 1H5XA 1XX2A 2ZC3B 3BFCA 1TDGA 1XP4A 4EUZA 4Z9QA 3FYZA 3ZDJA 3PBRA 4R1GA 3IXBA 4ZDXA 3VP0A 5FQQA 1GHMA 4UA6A 4QJGA 5EOEA 3HLBA 2DRWA 2XH9A 3PBQA 1I5QA 4JXGA 4KZ6A 1LI0A 3BEBA 5M18A 3ZFZA 1RP5A 2X71A 5DTSA 4DRTA 3CG5A 4GZBA 5DTKA 2BLSA 1BLHA 4DXCA 3O3VA 3IXDA 2ZD8A 2WKHA 3QHYA 2P9VA 4KG5A 3OCLA 4MEZA 5EVLA 3S22A 3A3JA 3HLEA 4IVIA 2V1ZA 3N7WA 3MKEA 4S2MA 3E2LA 4FSFA 4LCLA 5FAOA 1ESIA 3IHBA 3PTEA 3RXWA 1FCNA 2XDMA 4MBFA 5HARA 4KG6A 5CEDA 1Q2QA 2HDRA 4KZ9A 2ZMAA 3V3SA 1PIOA 4KG2A 1JWZA 4R23A 1K55C 1KGGA 4OLDA 4YINA 4E3IA 2HP9A 3WS2A 3A3FA 5E2GA 4C75A 4OP8A 1KGFA 2G2UA 1RGZA 1MPLA 3EQVA 3GV9A 4BQMA 4WELA 4S2NA 1PW1A 2FFYA 5AQAA 3WRTA 5FQJA 2ZM0A 5DVAA 2R9XA 5EPHA 2H10A 2EFXA 5KSHA 2XLNA 4DE0A 2Y59A 1CI9A 4EWFA 3SS5A 2HDUA 1SHVA 1YT4A 1PI4A 4XUXA 3UN7A 1MWSA 3OZHA 2R9WA 1O7EA 1YM1A 1YLZA 1PWDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GHP A;  4LEN A;  2J8Y A;  2WKI A;  3E2K A;  3QNC A;  5GLC A;  4XUZ A;  3UDI A;  5A92 A;  4K91 A;  1K57 C;  4EBP A;  2B5R A;  3GSG A;  1Y54 A;  1G68 A;  1FQG A;  1BSG A;  2J9P A;  2WYX A;  3HVF A;  3PBO A;  4N9K A;  5CER A;  5F83 A;  3UO9 A;  1K4F A;  2X01 A;  4ZJ1 A;  1H8Y A;  1IYP A;  2RCX A;  4RA7 A;  4R3B A;  3HLD A;  3UPN A;  1ES2 A;  1QMF A;  4BLM A;  5A90 A;  2ZQD A;  3IH9 A;  3D4F A;  3HL9 A;  1MWR A;  1WYB A;  4ZTK A;  3MZD A;  4HES A;  4DE3 A;  3ZVT A;  1TVF A;  3S4X A;  4OQG A;  1XKZ A;  4R4R A;  3IF6 B;  4HEF A;  2OLU A;  3IHA A;  3P09 A;  3VSL A;  1YMX A;  4ZAM A;  3FZC A;  4XXR A;  3G35 A;  3ZG5 A;  3Q7V B;  3WS0 A;  1NYY A;  1K25 A;  3IXG A;  3Q7V A;  1K55 A;  4OPQ A;  3HBR A;  3NCK A;  5GHZ A;  3VP1 A;  1NZU A;  5CEC A;  1ERM A;  3C7U A;  4WZ4 A;  5HFO A;  3SS3 A;  3N6I A;  4B88 A;  3ISG A;  4KEN B;  2VGJ A;  1SDE A;  2WZX A;  3C5A A;  3VOZ A;  1S6R A;  1NRF A;  3NY4 A;  1L0F A;  4K0X A;  1YLW A;  3WS1 A;  1PZP A;  5TR7 A;  3M6H A;  3NI9 A;  1FSW A;  4PM9 A;  4LV2 A;  4N1X A;  5DF9 A;  5FI2 A;  2EFU A;  2WGI A;  5GLD A;  2WKE A;  3BRM A;  5D3O A;  4IBX A;  5FAP A;  1GHI A;  3IF5 A;  1Z6F A;  2ZQC A;  1MWU A;  1L2S A;  4B4X A;  3ZG7 B;  1ES5 A;  1LLB A;  1YLJ A;  3BM6 A;  3Q07 A;  1IYO A;  3PAG A;  2H0T A;  2HDQ A;  5HW3 A;  1K57 A;  3ZNY A;  5CGX A;  4U3T A;  2JBF A;  1K56 D;  5G18 A;  3ZG9 B;  3GVB A;  3VFH A;  4KQQ A;  2HPB A;  3GRJ A;  4GN2 A;  5DTT A;  3UE3 A;  3ITA A;  3VP2 A;  1K6R A;  2E8I A;  2H5S A;  2IWC A;  5CXW A;  2ZC5 B;  3M2J A;  5EOO A;  1FSY A;  1ONG A;  1LL9 A;  4N1H A;  1PW8 A;  4WZ5 C;  4WMC D;  3CJM A;  4N92 A;  5CGW A;  2Z2L B;  1LI9 A;  4OLG A;  3V3R A;  1XPB A;  2ZM2 A;  3IWO A;  5HX9 A;  1K54 A;  2HDS A;  1KDW A;  2P74 A;  4ZJ2 A;  4FH4 A;  4FH2 A;  3N8S A;  3IWI A;  5HL1 A;  5KSC A;  1JVJ A;  1K38 A;  1WE4 A;  1M6K A;  4OPZ A;  3MKF A;  4UA7 A;  5FA7 A;  2Y91 A;  2Q9N A;  5A91 A;  1CK3 A;  4S2J A;  1FOF A;  3BYD A;  4S2P A;  4BD0 A;  2Y2I A;  3HLG A;  4Y0O A;  4C3Q A;  2WK0 A;  5EEC A;  1BZA A;  5GLA A;  3SOI A;  3DWK A;  3VFF A;  2P9V B;  2X02 A;  4MBK A;  3G30 A;  3PBT A;  2EXB A;  4E6X A;  5EVI C;  4GD8 A;  3EQU A;  3O87 A;  1ZG4 A;  4QU3 A;  4E6W A;  3A3D A;  1KE3 A;  5TFQ A;  4DXB A;  4Y0T A;  3BLM A;  3ZGA B;  1JWP A;  1W5D A;  4CJN A;  4QHC A;  1XA1 A;  1KE4 A;  2V20 A;  2Y2L A;  3PAE A;  2A3U A;  3BEC A;  3HRE A;  3WRZ A;  3VSK A;  4U0X A;  4F94 A;  1IKI A;  5L2F A;  5HAQ A;  4JXW A;  1IEL A;  4K0W A;  5FI7 A;  4MLL A;  1RGY A;  2QPN A;  1BLC A;  4JPM A;  3UY6 A;  1DJC A;  4OQ0 A;  4KZ4 A;  3UPO A;  4X53 A;  4C6Y A;  5AQ7 A;  1VQQ A;  3FKW A;  4LCM A;  2Y4A A;  5GHY A;  2Y2K A;  4WEJ A;  4WZ5 A;  1O07 A;  2EX2 A;  4LV1 A;  1L0G A;  3MFD A;  2WAE A;  2XFS A;  3OCN A;  4RYE A;  1BUE A;  4QY5 A;  2WUQ A;  4ID4 A;  3MXS A;  1GA0 A;  3QNB A;  5FQM A;  4EBL A;  2IWD A;  1KGE A;  4ZBE A;  2H0Y A;  1L0D A;  5CHJ A;  4YFM A;  3OPR A;  3V50 A;  1DY6 A;  4NET A;  5CTN A;  3UE1 A;  4BL2 A;  2ZQ7 A;  4M3K A;  2CC1 A;  1BLS A;  3B3X A;  4OQI A;  4Y7P A;  5FQ9 A;  3ZG8 B;  3NIA A;  1I2W A;  5GL9 A;  2Z2M B;  2WAD A;  2DCF A;  3UE0 A;  1ES3 A;  4JKT A;  5EVI B;  5TGF A;  1JWV A;  2JE5 A;  5EVI A;  5I94 A;  3ZVW A;  2Y2P A;  3LEZ A;  2WGW B;  3Q1F A;  4WBG A;  5CHM A;  5DF8 A;  2OV5 A;  5BOH A;  1E4D A;  1FR1 A;  2WGW A;  3M2K A;  1JTG A;  4RX2 A;  4GB7 A;  4GDB A;  3BFF A;  2J7V A;  2ZQ9 A;  5CTM A;  3UPP A;  4A5R A;  5CEB A;  1IEM A;  2ZC6 B;  1KDS A;  1MKI A;  1DJA A;  1FCM A;  1QME A;  2HP5 A;  2RL3 A;  2Y2N A;  4R3J A;  3SH9 A;  4LV3 A;  3G32 A;  4P6B A;  3IQA A;  3N8R A;  5DF7 A;  5FAS A;  1W8Y A;  3FV7 A;  4GD6 A;  1K56 A;  5HAP A;  3GQZ A;  3UNW A;  1NY0 A;  1IYQ A;  4BD1 A;  2ZLY A;  3IXH A;  4OKP A;  4EBN A;  4OVD A;  2XEP A;  2A49 A;  4EQI A;  1EI5 A;  5CRF A;  1XXM A;  4HBT A;  3G31 A;  5E2H A;  1HZO A;  1ALQ A;  5FDH A;  4DDS A;  1PWC A;  4X6T A;  2Y55 A;  1XGJ A;  3ZNT A;  1CEG A;  5E2F A;  4FD8 A;  3C4P A;  2XD5 A;  3NDE A;  4KQR A;  1YLY A;  1MY8 A;  3A3E A;  4MBH A;  5FQI A;  1E3U D;  1N9B A;  3MZF A;  1LL5 A;  2XD1 A;  3OC2 A;  2WZZ A;  3NC8 A;  3ZG0 A;  3FWL A;  4IED A;  3HLC A;  4KQO A;  2DNS A;  1WYC A;  5FQK A;  2C6W B;  3SH8 A;  1YMS A;  4S2K A;  3W4O A;  3N8L A;  1W8Q A;  2UWX A;  2XK1 A;  3DWZ A;  3NBL A;  2ZC4 B;  2ZJ9 A;  2OSU A;  4MNR A;  4E3M A;  4X55 A;  3IH8 A;  4KZ3 A;  2XGN A;  5FI6 A;  5KMW A;  2ZM8 A;  1MWT A;  4OPY A;  3N4I A;  3HLF A;  3ZHH A;  4DKI A;  1ERO A;  5CHU A;  3OPL A;  3HUN A;  3HLW A;  4KZA A;  3WS4 A;  4E3N A;  1BTL A;  1NXY A;  3AGD A;  2EX6 A;  1BUL A;  3W8K A;  3VP3 A;  3OPP A;  3TG9 A;  3DW0 A;  4Q8I A;  5F82 A;  3UDF A;  1GCE A;  2J9O A;  3CMZ A;  2JCH A;  1K4E A;  3VP4 A;  2OLV A;  4QY6 A;  4X69 A;  2IWB A;  1RCJ A;  3Q82 A;  1LHY A;  2GDN A;  4JF4 A;  2Y2J A;  4RVA A;  3I7J A;  3GMW A;  4E3K A;  1M40 A;  4PPR A;  1J9M A;  1K6S A;  3GR2 A;  5F1G A;  1Q2P A;  4RX3 A;  2HP6 A;  3O86 A;  3SS4 A;  1SDN A;  2QMI A;  1TEM A;  4OOL A;  3ITB A;  4UA9 A;  3WWX A;  4BEN A;  5KZH A;  2XR0 A;  2V2F F;  4R4S A;  4PMA A;  1I2S A;  4L0L A;  4Y0U A;  3MXR A;  2Y2Q A;  4S2L A;  1PWG A;  1E25 A;  4BJP A;  5HAI A;  1U60 A;  1SKF A;  3BFE A;  4P85 A;  4PM6 A;  3BFG A;  1ZG6 A;  5JYO A;  4U0T A;  1EWZ A;  1ESU A;  3C7V A;  1ONH A;  3TOI A;  3AGE A;  1NJ4 A;  2Y2G A;  3IF6 C;  2EX9 A;  5EE8 A;  4IBR A;  2VGK A;  1JTD A;  3NDG A;  4KZ5 A;  1KE0 A;  3RXX A;  2Y2M A;  5U47 A;  2I72 A;  1YLT A;  4KZ7 A;  3BFD A;  3GTC A;  3DTM A;  1ES4 A;  4WYY A;  1KVL A;  1PI5 A;  4KZB A;  4X56 A;  3AGF A;  1HVB A;  1ERQ A;  4E3L A;  4JBF A;  4NK3 A;  5IHV A;  2WGV A;  4R0Q A;  4GDN A;  3RJU A;  2XFT A;  4E3J A;  1PZO A;  4JXV A;  4FCF A;  3G34 A;  4B4Z A;  2ZC7 A;  3LY3 A;  1YLP A;  1BT5 A;  5F1F A;  1YQS A;  4DDY A;  1IYS A;  4OQH A;  4CPK A;  3C4O A;  4BL3 A;  5EUA A;  5A93 A;  3LO7 A;  1SCW A;  3UDX A;  4GKU A;  3G4P A;  4P0M A;  4OP5 A;  3JYI A;  4E3O A;  3HUM A;  1H8Z A;  3HUO A;  4S2O A;  2PBY A;  2EX8 A;  2XQZ A;  3LY4 A;  2PU4 A;  3VOY A;  2Q9M A;  4EV4 A;  4PM8 A;  4QD4 A;  5FAT A;  5J8X A;  3G2Z A;  1CEF A;  1W7F A;  3PBN A;  1XA7 A;  4JLF A;  4PM7 A;  4GNU A;  4GOG A;  3V5M A;  4WM9 A;  1HTZ A;  3W4Q A;  4DF6 A;  3A3I A;  1S0W A;  1XGI A;  4O7D A;  5AQB A;  2QZ6 A;  2PU2 A;  1GA9 A;  2XF3 A;  4DE2 A;  5FAQ A;  1NYM A;  1ZC2 A;  1W79 A;  1BLP A;  2Y2H A;  2Y2O A;  4LV0 A;  1K54 C;  4UAA A;  1AXB A;  3S1Y A;  1E3U A;  3MBZ A;  1HD8 A;  4PM5 A;  4X68 A;  4ZJ3 A;  5JYP A;  3IF6 A;  3WS5 A;  4H8R A;  3TSG A;  3VMA A;  3MZE A;  2BG1 A;  1CI8 A;  4JF5 A;  3PBS A;  2JC7 A;  3LCE A;  4WMC A;  1PYY A;  1L0E A;  3O88 A;  5E43 A;  1N4O A;  4OH0 A;  1TDL A;  4JF6 A;  1FCO A;  4QB8 A;  1VM1 A;  3IWQ A;  5GLB A;  4S2I A;  3W4P A;  4HBU A;  5FSR A;  5E2E A;  3P98 A;  4OON A;  1IKG A;  5CGS A;  5GHX A;  3V39 A;  3ZCZ A;  1MBL A;  4IVK A;  3G2Y A;  4OOM A;  1OME A;  3IT9 A;  4OPR A;  5EVI D;  1G6A A;  2ZQ8 A;  1MXO A;  3FKV A;  4P87 A;  1C3B A;  4KZ8 A;  4D2O A;  3Q7Z A;  3CZD A;  2C5W B;  4DE1 A;  4JXS A;  1NZO A;  2G2W A;  1DJB A;  4OOY A;  3SH7 A;  4N9L A;  3BLS A;  4UHU A;  1KVM A;  3Q81 A;  3OPH A;  4WEK A;  5M19 A;  3M6B A;  4S2N C;  5AQ9 A;  5M1A A;  2ZQA A;  1FR6 A;  1ZKJ A;  2EXA A;  2WAF A;  2FFF B;  1H5X A;  1XX2 A;  2ZC3 B;  3BFC A;  1TDG A;  1XP4 A;  4EUZ A;  4Z9Q A;  3FYZ A;  3ZDJ A;  3PBR A;  4R1G A;  3IXB A;  4ZDX A;  3VP0 A;  5FQQ A;  1GHM A;  4UA6 A;  4QJG A;  5EOE A;  3HLB A;  2DRW A;  2XH9 A;  3PBQ A;  1I5Q A;  4JXG A;  4KZ6 A;  1LI0 A;  3BEB A;  5M18 A;  3ZFZ A;  1RP5 A;  2X71 A;  5DTS A;  4DRT A;  3CG5 A;  4GZB A;  5DTK A;  2BLS A;  1BLH A;  4DXC A;  3O3V A;  3IXD A;  2ZD8 A;  2WKH A;  3QHY A;  2P9V A;  4KG5 A;  3OCL A;  4MEZ A;  5EVL A;  3S22 A;  3A3J A;  3HLE A;  4IVI A;  2V1Z A;  3N7W A;  3MKE A;  4S2M A;  3E2L A;  4FSF A;  4LCL A;  5FAO A;  1ESI A;  3IHB A;  3PTE A;  3RXW A;  1FCN A;  2XDM A;  4MBF A;  5HAR A;  4KG6 A;  5CED A;  1Q2Q A;  2HDR A;  4KZ9 A;  2ZMA A;  3V3S A;  1PIO A;  4KG2 A;  1JWZ A;  4R23 A;  1K55 C;  1KGG A;  4OLD A;  4YIN A;  4E3I A;  2HP9 A;  3WS2 A;  3A3F A;  5E2G A;  4C75 A;  4OP8 A;  1KGF A;  2G2U A;  1RGZ A;  1MPL A;  3EQV A;  3GV9 A;  4BQM A;  4WEL A;  4S2N A;  1PW1 A;  2FFY A;  5AQA A;  3WRT A;  5FQJ A;  2ZM0 A;  5DVA A;  2R9X A;  5EPH A;  2H10 A;  2EFX A;  5KSH A;  2XLN A;  4DE0 A;  2Y59 A;  1CI9 A;  4EWF A;  3SS5 A;  2HDU A;  1SHV A;  1YT4 A;  1PI4 A;  4XUX A;  3UN7 A;  1MWS A;  3OZH A;  2R9W A;  1O7E A;  1YM1 A;  1YLZ A;  1PWD A; 
#chains in the Genus database with same CATH topology
 1GHP A;  2WKI A;  4XUZ A;  4K91 A;  4EEP A;  1ZTU A;  4GS9 A;  5TBM B;  5F83 A;  3UO9 A;  2L4R A;  1H8Y A;  1OTB A;  4R3B A;  3UPN A;  1D06 A;  1QMF A;  4BLM A;  2JHE A;  4DE3 A;  3CPT A;  4JGR A;  3ZVT A;  2JN7 A;  4HEF A;  2OLU A;  3K3D A;  2HV1 A;  5J4E A;  3D3O A;  4XXR A;  1VET B;  3ZG5 A;  3HBR A;  1NZU A;  3IBJ A;  1SDE A;  3PYP A;  3KO6 A;  4ARZ B;  1NRF A;  3RTY A;  1YLW A;  1PZP A;  1FSW A;  3UE6 A;  5DF9 A;  2A24 B;  3BRM A;  3CWF A;  4IBX A;  5FAP A;  4I3I A;  4H6J A;  3ZNY A;  5CGX A;  1K56 D;  5G18 A;  3GVB A;  3VP2 A;  5DTT A;  2H5S A;  3JPU A;  5CXW A;  3M2J A;  4IUK A;  1FSY A;  1ONG A;  4WMC D;  2Z2L B;  4OLG A;  4FUW A;  3N8S A;  3IWI A;  4OPZ A;  4UA7 A;  3OBF A;  1N9O A;  4S2J A;  3BYD A;  4S2P A;  3IX8 A;  2Y2I A;  4Y0O A;  3LYX A;  2WK0 A;  5GLA A;  3SOI A;  3F1P B;  2X02 A;  3G30 A;  1ZG4 A;  3E98 A;  2OAQ 1;  2PR6 A;  4Y0T A;  1W5D A;  2V20 A;  3PAE A;  5DKK A;  5HDC A;  5F68 A;  3WRZ A;  3VSK A;  1IKI A;  3EEH A;  5KIZ A;  4MLL A;  4JPM A;  3GDI A;  4C6Y A;  5GHY A;  4R3A A;  4LRX C;  2V1A A;  2PHY A;  2WAE A;  2XFS A;  4RYE A;  1BUE A;  3QNB A;  5FQM A;  4LRY C;  5A8B A;  3MQQ A;  1DY6 A;  4NXF A;  1OJG A;  3UB9 A;  4HY8 A;  2W1R A;  3B3X A;  3VOL A;  4Y7P A;  3LEQ A;  3NIA A;  1S66 L;  2Z2M B;  2DCF A;  3B47 A;  1ES3 A;  1OTA A;  2JE5 A;  5EVI A;  2BAS A;  4RQ9 A;  3TW8 A;  2Y2P A;  3LEZ A;  5CHM A;  2OV5 A;  5DF8 A;  3R7W A;  1E4D A;  1FR1 A;  1JTG A;  4RX2 A;  4A5R A;  2G7U A;  1MKI A;  3P7N A;  2QHK A;  4HOI A;  4LV3 A;  4P6B A;  3N8R A;  1W8Y A;  3FV7 A;  1K56 A;  3GQZ A;  1D7E A;  2A49 A;  1GSX A;  5CRF A;  3G31 A;  4DDS A;  1T1C A;  1PWC A;  3LI8 A;  3OOV A;  3S7P A;  3C4P A;  2J3T C;  4EUV A;  2XD5 A;  1E3U D;  3PHY A;  3OC2 A;  2ZOH A;  2V8C A;  2GNX A;  2XSS A;  5MC7 A;  4BBV A;  3DWZ A;  3NBL A;  2ZJ9 A;  2OSU A;  2VJW A;  1Y28 A;  1NWZ A;  3IH8 A;  4KZ3 A;  3T4L A;  1MWT A;  1LL8 A;  3N4I A;  4OPY A;  3HLF A;  2VV7 A;  4DKI A;  5CHU A;  3OPL A;  1NXY A;  3VP3 A;  2VGL M;  5F82 A;  3CMZ A;  4O01 A;  4HNB A;  1RCJ A;  5HPF A;  1LHY A;  2Y2J A;  4YWZ A;  4RX3 A;  2HP6 A;  2QMI A;  2YKH A;  4OOL A;  4UA9 A;  4R4S A;  2W1T A;  2PDR A;  1SKO A;  4S2L A;  4BJP A;  1ZG6 A;  2EA9 A;  3MXQ A;  1ONH A;  3AGE A;  1NJ4 A;  1H0M A;  3E0Y A;  3NDG A;  1KE0 A;  2I72 A;  2V0W A;  4KZ7 A;  3DTM A;  1KVL A;  2V9A A;  3AGF A;  3RJU A;  1BYW A;  4UQI S;  3EGX C;  4Q0H A;  4DDY A;  1IYS A;  2P04 A;  4QPR A;  4YOF A;  4P0M A;  4OP5 A;  3JYI A;  4E3O A;  1H8Z A;  4NEE D;  2PBY A;  2EX8 A;  2QYB A;  4EV4 A;  4PM8 A;  3PBN A;  1HLU P;  3A0V A;  4GNU A;  3W4Q A;  4WM9 A;  3A3I A;  2PU2 A;  3L7H A;  3MF0 A;  4HHD A;  4UAA A;  1AXB A;  1E3U A;  4PM5 A;  2VV6 A;  3IF6 A;  4H8R A;  3VMA A;  1LSW A;  2BG1 A;  1CI8 A;  3PBS A;  2JC7 A;  4G3K A;  1N4O A;  2O9B A;  4EEU A;  5HL6 A;  1L3L A;  1FCO A;  4QB8 A;  2H28 A;  3W4P A;  3C8C A;  4OON A;  5CGS A;  5GHX A;  3V39 A;  2NUT C;  4HJ4 A;  4NXG A;  1MXO A;  3FKV A;  4P87 A;  4KZ8 A;  4D2O A;  3Q7Z A;  4DE1 A;  4MCW A;  3T4S A;  4HP4 A;  4PHT A;  4UHU A;  3ZQ5 A;  1KVM A;  1S4S A;  4WUJ A;  1TD5 A;  2EXA A;  2Z6D A;  5L10 A;  3LR0 A;  2ZC3 B;  1VEU B;  4CLC E;  2HF6 A;  3H82 B;  1TDG A;  4Z9Q A;  4HQA A;  1GHM A;  1T19 A;  3BW6 A;  1G28 A;  5EOE A;  3PBQ A;  1I5Q A;  4JXG A;  5G4Z A;  5DTS A;  5DTK A;  2D01 A;  1BLH A;  3O3V A;  2ZD8 A;  3QHY A;  5EVL A;  3S22 A;  3HLE A;  3E2L A;  4LCL A;  4KQD A;  4LLO B;  5EM1 A;  1S1Z A;  2ZBB A;  2HDR A;  4KG2 A;  4R23 A;  1DP6 A;  3UMD A;  3WS2 A;  4HJ3 A;  1STZ A;  2G2U A;  1RGZ A;  1VHM A;  2H10 A;  2XLN A;  1CI9 A;  4EWF A;  1PI4 A;  4XUX A;  3IBR A;  2R9W A;  1O7E A;  1YLZ A;  1S4R A;  4LEN A;  5EVE A;  4EBP A;  2B5R A;  1Y54 A;  3QP5 A;  1G68 A;  4GS9 B;  1FQG A;  2PRF A;  2WYX A;  1XJ4 A;  3HVF A;  3PBO A;  5CER A;  2B95 A;  2X01 A;  1ES2 A;  2ZQD A;  3IH9 A;  3TE8 A;  1WYB A;  3CPT B;  3MZD A;  4XT2 A;  3IX4 A;  1XKZ A;  1MKM A;  4R4R A;  1S67 L;  4FOF A;  2XA7 S;  4I5S A;  4ZAM A;  1NYY A;  3NOT C;  1K25 A;  3Q7V A;  4WLA A;  5C5K A;  1XJ3 A;  3VP1 A;  2JKT I;  1ERM A;  3C7U A;  5HFO A;  4KEN B;  2VGJ A;  3C5A A;  3VOZ A;  3NY4 A;  3WS1 A;  4HH3 A;  2KX6 A;  4N1X A;  1ZHH B;  2WGI A;  2M1C A;  5D3O A;  1GHI A;  3IF5 A;  1Z6F A;  1TS7 A;  4HP9 A;  1L2S A;  4H6J B;  3ZG7 B;  1ES5 A;  1LLB A;  1YLJ A;  3NOP C;  3Q07 A;  3PAG A;  2VLG A;  5HW3 A;  1CJF A;  4U3T A;  3ZG9 B;  4MN5 A;  3GRJ A;  2JKF A;  3ITA A;  2E8I A;  2IWC A;  3K2N A;  3QP8 A;  4N1H A;  3CJM A;  4LRZ E;  1XPB A;  2W3G A;  3SW1 A;  4ZJ2 A;  4FH4 A;  1UWP X;  2B18 A;  5FA7 A;  4BD0 A;  4O0P A;  1BZA A;  1ACF A;  3B33 A;  3VFF A;  1J3W A;  2P9V B;  5TJJ A;  3PBT A;  4E6X A;  5EVI C;  1OTE A;  3LIF A;  4QU3 A;  4E6W A;  3A3D A;  1KE3 A;  3ZGA B;  4Y2F A;  1XA1 A;  3LR5 A;  2Y2L A;  1UWN X;  1OTD A;  1IOU A;  3LIB A;  4JGQ A;  4O8G A;  4U0X A;  5HDD A;  4JXW A;  3BQ8 A;  5EFW A;  4NXB A;  1BLC A;  4NG2 A;  3UB8 A;  5HD5 A;  3V67 A;  2VZW A;  1VQQ A;  4LCM A;  4LPZ A;  4WZ5 A;  2CMN A;  4LV1 A;  4QY5 A;  4GW9 A;  1GA0 A;  2H0Y A;  5CHJ A;  3OPR A;  4AFI A;  2R78 A;  2ZQ7 A;  4M3K A;  1V9Z A;  1YSP A;  4OQI A;  1I2W A;  3C38 A;  5EVI B;  4CLC D;  1JWV A;  3R7W B;  1GSV A;  2WGW A;  3M2K A;  4JGO A;  4GB7 A;  3A0R A;  3BFF A;  2ZC6 B;  1KDS A;  1QME A;  1FCM A;  1VB6 A;  2HP5 A;  4BWI A;  4R3J A;  4ETX A;  5DF7 A;  4GD6 A;  4EBN A;  4OVD A;  2XEP A;  1XXM A;  4NKP A;  1ALQ A;  4GHI A;  4IHQ A;  2W27 A;  4Q0I A;  3OLO A;  5HDS A;  1XGJ A;  2WKQ A;  5E2F A;  3NEC A;  1LL5 A;  2XD1 A;  3D72 A;  3SH8 A;  2C6W B;  4S2K A;  5F6A A;  3W4O A;  2XK1 A;  4E3M A;  4UQI M;  5KMW A;  2ZM8 A;  3LID A;  4F3L A;  1NLZ A;  4E3N A;  4EU0 A;  1BTL A;  3W8K A;  3OPP A;  2JKR I;  3UDF A;  1GCE A;  2J9O A;  5HZH A;  1K4E A;  3DAV A;  3T1R A;  4FTX A;  3VP4 A;  3I7J A;  4E3K A;  4PPR A;  3GR2 A;  1Q2P A;  3SS4 A;  3O86 A;  1SDN A;  1TEM A;  3ITB A;  4BEN A;  3IX3 A;  5KZH A;  2L1M A;  2W1T B;  2V2F F;  4PMA A;  3MS6 A;  4L0L A;  4Y0U A;  3MXR A;  1PWG A;  3CLO A;  4PM6 A;  4EXO A;  1EWZ A;  3C7V A;  2Z6C A;  2Y2G A;  3IF6 C;  5FEG A;  1JTD A;  2J80 A;  1WA9 A;  1F98 A;  3GTC A;  2WKP A;  4WYY A;  1LSV A;  1PI5 A;  4X56 A;  4CLC A;  4MMN A;  1ERQ A;  4JBF A;  4NK3 A;  3BY9 A;  3F1N A;  2XFT A;  4FCF A;  3KYZ A;  2ZC7 A;  5F1F A;  1YLP A;  4JGP A;  4CPK A;  4BL3 A;  3LO7 A;  3T4J A;  4DJ3 A;  3G4P A;  2KOI A;  3HUM A;  4S2O A;  3SZT A;  2XQZ A;  1P9W A;  1TS6 A;  3EGD C;  4QD4 A;  1CEF A;  5CX7 A;  4JLF A;  4B9O A;  4PM7 A;  1HTZ A;  1XGI A;  4O7D A;  2QZ6 A;  2XF3 A;  4WL9 A;  1FIL A;  1NYM A;  1ZC2 A;  1W79 A;  1BLP A;  4LV0 A;  1F5M A;  3MBZ A;  4ZJ3 A;  4BBT A;  2MJ6 A;  3LCE A;  4WMC A;  1W63 M;  1VET A;  5E43 A;  3H7W A;  1TDL A;  4S2I A;  4HBU A;  5E2E A;  3P98 A;  3ZCZ A;  3T1Q B;  5DJU A;  5FDS A;  1OME A;  1NRJ A;  3L9K A;  1G6A A;  3CZD A;  2C5W B;  4JXS A;  1NZO A;  4IJG A;  4ETZ A;  4HI4 A;  1ODV A;  3Q81 A;  3OPH A;  3ULF A;  3M6B A;  5AQ9 A;  2ZQA A;  2FFF B;  1XX2 A;  1CQA A;  3HCY A;  3C30 A;  1XP4 A;  2Q0O A;  4Z1W A;  4EUZ A;  4PKY G;  2O99 A;  3FYZ A;  3ZDJ A;  3JVV A;  4ZDX A;  3NOU C;  4KUO A;  3KSH A;  3HLB A;  1N9N A;  2DRW A;  3FG8 A;  4KZ6 A;  1LI0 A;  1RP5 A;  2X71 A;  4DRT A;  2BLS A;  5HWV A;  2K7S A;  1LT0 A;  3F1P A;  4KG5 A;  1H3Q A;  2XA7 M;  2VA0 A;  1T1B A;  2V1Z A;  3RFB A;  1ESI A;  3PTE A;  5G4Y A;  4WN5 A;  1OPX A;  4GCZ A;  5CED A;  4KZ9 A;  1XJ2 A;  2ZMA A;  4E3I A;  1PIO A;  4I3A A;  4OLD A;  4YIN A;  2HP9 A;  5E2G A;  3S7O A;  1XFQ A;  2V8F A;  3NJA A;  3GV9 A;  3NHQ A;  3KSI A;  3DTE A;  4WEL A;  4S2N A;  3H9W A;  5AQA A;  5EPH A;  2R9X A;  4B93 A;  2Y59 A;  3SS5 A;  2HDU A;  1SHV A;  4ZRR A;  3UN7 A;  2INW A;  3ZYT A;  1YSQ A;  3GMW A;  1PWD A;  5A92 A;  3E2K A;  4BMW A;  1BSG A;  2Y79 A;  2VKS A;  4N9K A;  1K4F A;  2RCX A;  4RA7 A;  3S7Q A;  3HLD A;  1MWR A;  4ZTK A;  3T1S A;  3FPV A;  3S4X A;  4OQG A;  3KX0 X;  3IHA A;  3P09 A;  3VSL A;  1OTI A;  1YMX A;  3FZC A;  3MFX A;  3Q7V B;  3WS0 A;  3IXG A;  1K55 A;  3LIA A;  4OPQ A;  3NCK A;  1IFQ A;  5GHZ A;  5CEC A;  4LGW A;  4B88 A;  1T1A A;  3N6I A;  2WZX A;  1S6R A;  1L0F A;  1MZU A;  4K0X A;  5TR7 A;  3NI9 A;  4PM9 A;  4LV2 A;  5FI2 A;  2EFU A;  2LB5 A;  2PBD P;  2ZQC A;  1MWU A;  4B4X A;  3S7N A;  3P01 A;  2ZL1 A;  1K57 A;  3FPW A;  2K31 A;  2W3E A;  2VEA A;  2QKP A;  4G3V A;  3UE3 A;  3E4P A;  2ZC5 B;  4WZ5 C;  3DTK A;  4N92 A;  2HJE A;  3IWO A;  5HX9 A;  2HDS A;  1KDW A;  4DJ2 A;  2DMW A;  3TJZ C;  4FH2 A;  5HL1 A;  5KSC A;  3MKF A;  2Y91 A;  2GJ3 A;  1FOF A;  4C3Q A;  2QJ5 A;  5EEC A;  3DWK A;  4MBK A;  2EXB A;  4GD8 A;  2HZ5 A;  1W63 Q;  3LR3 A;  5TFQ A;  3BLM A;  1JWP A;  1KE4 A;  4EW7 A;  2FH5 A;  3BEC A;  4R6L A;  5L2F A;  4R70 A;  4K0W A;  5FI7 A;  3UY6 A;  1DJC A;  2QWS A;  4KZ4 A;  4X53 A;  5AQ7 A;  2Y4A A;  4M4X A;  3KYE A;  4EET B;  4WEJ A;  1MC0 A;  5HWT A;  2EX2 A;  3MFD A;  4HIA A;  2WUQ A;  4ID4 A;  3MXS A;  2IA2 A;  1KGE A;  1L0D A;  3QP6 A;  4ESP A;  1S1Y A;  3UE1 A;  1N9L A;  1D1J A;  3ZG8 B;  2O9C A;  2WAD A;  2EWV A;  3NUL A;  5I94 A;  3ZVW A;  2WGW B;  4WBG A;  3D9Y A;  5CTM A;  2RL3 A;  1DJA A;  3SH9 A;  3IQA A;  1P97 A;  1NLY A;  5HAP A;  3UNW A;  1NY0 A;  4BD1 A;  2ZLY A;  3IXH A;  3KSG A;  4L9E A;  4EQI A;  1EI5 A;  1CF0 A;  4GHI B;  4HBT A;  1HZO A;  4L9F A;  5FDH A;  4X6T A;  2Y55 A;  2HGV A;  1CEG A;  3NDE A;  2UV0 E;  1MY8 A;  1N9B A;  3IS2 A;  4E04 A;  2B02 A;  2WZZ A;  2W0N A;  3NC8 A;  2DNS A;  1WYC A;  1YMS A;  3T4Q A;  1W8Q A;  1EW0 A;  3MQO A;  2ZC4 B;  4CLC C;  4MNR A;  4X55 A;  4F3L B;  1ERO A;  3HJK A;  3WS4 A;  2EX6 A;  1BUL A;  3TG9 A;  3DW0 A;  4Q8I A;  3FC7 A;  2JCH A;  2E8J A;  2OLV A;  4QY6 A;  4X69 A;  3BJN A;  4I39 A;  3Q82 A;  2GDN A;  4JF4 A;  1H8M A;  5F1G A;  1XJ6 A;  3WWX A;  2PYP A;  2W3H A;  1I2S A;  5EV0 A;  4I38 A;  2Y2Q A;  3MSH A;  1E25 A;  3CIT A;  1U60 A;  3BFE A;  4P85 A;  3BFG A;  4U0T A;  1ESU A;  3TOI A;  3DTI A;  4IBR A;  2Y2M A;  5U47 A;  1YLT A;  2PYR A;  4CLC B;  3BFD A;  4Y15 A;  4KZB A;  4E3L A;  4EES A;  3G6O A;  2WGV A;  3F1N B;  4R0Q A;  1PZO A;  3C2W A;  3G34 A;  4Y5F A;  3UB5 P;  1YQS A;  4OQH A;  2VK3 A;  3C4O A;  5EUA A;  1SCW A;  3QP4 A;  3HUO A;  4L9G A;  2ZMV A;  3VOY A;  2Q9M A;  2Y8H A;  5FAT A;  1G6O A;  3G2Z A;  5J8X A;  1W7F A;  3RH8 B;  4KUK A;  3T4T A;  5FAQ A;  2GX5 A;  1DP8 A;  2Y2O A;  1K54 C;  4MDZ A;  2FZ0 A;  3S1Y A;  3E4O A;  5JYP A;  4MN6 A;  2J3W A;  1PYY A;  1L0E A;  3H7W B;  3O88 A;  4JF6 A;  1JNU A;  5GLB A;  3IWQ A;  5FSR A;  4DMZ A;  4Q0J A;  1P0Z A;  1MBL A;  3MJQ A;  1OT6 A;  3G2Y A;  4OOM A;  5EVI D;  4OPR A;  4P6Z S;  2ZQ8 A;  1TS8 A;  3KYQ A;  5L09 A;  1C3B A;  1SZV A;  5AVF A;  2G2W A;  1DJB A;  3TRC A;  3EOI A;  3EWK A;  5M19 A;  4S2N C;  5M1A A;  1FR6 A;  1ZKJ A;  1LSX A;  1H5X A;  3DBA A;  1G5U A;  3BFC A;  5HSQ A;  4R1G A;  4UEY A;  2ZMF A;  3LGO A;  5FQQ A;  4UA6 A;  1GSW A;  2W3F A;  3F1O A;  3BEB A;  4X25 A;  2K2N A;  3CG5 A;  4GZB A;  3LI9 A;  3CI6 A;  3VE3 A;  4DXC A;  2WKH A;  1SKO B;  2P9V A;  4MEZ A;  3OCL A;  2O0Y A;  3A3J A;  4IVI A;  3UB7 A;  3MKE A;  4S2M A;  4FSF A;  5FAO A;  3IHB A;  3RXW A;  1FCN A;  2XDM A;  4CQH A;  4KG6 A;  2KLI A;  1Q2Q A;  3V3S A;  1K55 C;  1A0K A;  4OP8 A;  1KGF A;  3BY8 A;  3T12 B;  4BQM A;  2P08 A;  2FFY A;  4DN0 A;  2HJ9 C;  3WRT A;  2EFX A;  4K08 A;  3LIC A;  1YT4 A;  3OZH A;  1YM1 A;  2J8Y A;  3QNC A;  5GLC A;  3UDI A;  2YKF A;  3BQA A;  5AJG A;  1K57 C;  3GSG A;  2J9P A;  3CUE A;  4HH2 A;  4ZJ1 A;  5TBM A;  1IYP A;  2NUP C;  5A90 A;  1OJ5 A;  3D4F A;  3HL9 A;  4PAU A;  4HES A;  1TVF A;  1TS0 A;  3IF6 B;  3UME A;  2OAP 1;  3LFV A;  4QWO A;  3G35 A;  2V0U A;  1PRQ A;  4WZ4 A;  3SS3 A;  3ISG A;  3UB6 A;  4R38 A;  4ARZ A;  3M6H A;  3QP1 A;  5GLD A;  2WKE A;  2A24 A;  1AWI A;  4NXE A;  2P7J A;  4X1L A;  1KOU A;  4Y3I A;  2ZL1 B;  2XRN A;  3BM6 A;  5F69 A;  1IYO A;  3T4O A;  2H0T A;  2HDQ A;  1PFL A;  5DFX A;  2JBF A;  3VFH A;  4KQQ A;  2HPB A;  4GN2 A;  1K6R A;  5IS1 A;  3U2A A;  5EOO A;  1LL9 A;  1PW8 A;  5CGW A;  2M7V A;  1LI9 A;  4I3J A;  3V3R A;  2ZM2 A;  1K54 A;  4WF0 A;  2P74 A;  5I5L A;  3HJI A;  3O5Y A;  1JVJ A;  1K38 A;  1WE4 A;  1M6K A;  2Q9N A;  2LB9 A;  5A91 A;  1CK3 A;  3HLG A;  5HD3 A;  3PXP A;  3EQU A;  1P9R A;  3O87 A;  4DXB A;  4LFU A;  4CJN A;  4QHC A;  2KDK A;  2A3U A;  3HRE A;  4Y17 A;  1DP9 A;  4F94 A;  5HAQ A;  1IEL A;  2JKT M;  1RGY A;  2QPN A;  4MN7 A;  4OQ0 A;  3UPO A;  2EWW A;  5K5B A;  3FKW A;  2I9V A;  2Y2K A;  5IT5 A;  1O07 A;  3EEA A;  1L0G A;  4EER A;  3OCN A;  3PR6 A;  4EBL A;  2IWD A;  3JVU A;  4ZBE A;  1YAX A;  4YFM A;  2J3T D;  3V50 A;  4NET A;  2O9A A;  5CTN A;  4X1M A;  4BL2 A;  3A0S A;  2CC1 A;  1BLS A;  4XT2 B;  5FQ9 A;  5GL9 A;  3UE0 A;  1DRM A;  4JKT A;  5DJT A;  5IU1 A;  5TGF A;  4BBU A;  5FEF A;  3Q1F A;  5BOH A;  4GDB A;  3UPP A;  2J7V A;  2ZQ9 A;  5CEB A;  1IEM A;  2Y2N A;  3G32 A;  2OWJ A;  5FAS A;  1UGU A;  1IYQ A;  4OKP A;  5E2H A;  3MR0 A;  3ZNT A;  5F5Y A;  4G3W A;  1OT9 A;  4FD8 A;  2D02 A;  4KQR A;  1YLY A;  3A3E A;  5FQI A;  3IS2 B;  4MBH A;  3MZF A;  4ME4 A;  3ZG0 A;  3FWL A;  4IED A;  3HLC A;  4KQO A;  5FQK A;  3T1X A;  3N8L A;  1F2K A;  2UWX A;  2GZA A;  3MMH A;  3T50 A;  4IUH A;  3R4K A;  2XGN A;  5FI6 A;  5L8M A;  3ZHH A;  1X0O A;  5L07 A;  3HUN A;  2PAV P;  3HLW A;  4II7 A;  4KZA A;  2A2L A;  3AGD A;  3QP2 A;  4D60 A;  2OOL A;  3ICY A;  2V1B A;  2JKG A;  2IWB A;  3E4Q A;  4RVA A;  1PNE A;  3CAX A;  1M40 A;  1J9M A;  1K6S A;  1T18 A;  2L0W A;  3T4K A;  2XR0 A;  1Z09 A;  1K0K A;  5HAI A;  1SKF A;  5J3W A;  2PD8 A;  5JYO A;  2BTF P;  2EX9 A;  5EE8 A;  2VGK A;  4KZ5 A;  3RXX A;  2AVX A;  2M7U A;  1ES4 A;  3LUQ A;  1HVB A;  3GEC A;  5IHV A;  4P6Z M;  4GDN A;  2WKR A;  3U4L P;  4E3J A;  3BWL A;  4JXV A;  4B4Z A;  3LY3 A;  1BT5 A;  3LR4 A;  5A93 A;  3UDX A;  4GKU A;  2ACG A;  4EQ1 A;  2VGL S;  2W3D A;  3LY4 A;  4GJ4 A;  2PU4 A;  5DKL A;  1XA7 A;  4GOG A;  3V5M A;  4DF6 A;  1S0W A;  5AQB A;  1GA9 A;  4DE2 A;  3B42 A;  2Y2H A;  2JKR M;  5DFY A;  1HD8 A;  4X68 A;  3WS5 A;  3TSG A;  3MZE A;  5HPI A;  4JF5 A;  5LBR A;  4OH0 A;  3W2Z A;  1YKD A;  1VM1 A;  3KSF A;  1IKG A;  4Y13 A;  4IVK A;  1TF1 A;  3IT9 A;  1F9I A;  3MQ0 A;  4YNR A;  2XRO A;  4OOY A;  3SH7 A;  4N9L A;  3BLS A;  4WEK A;  5J7E A;  2WAF A;  2VV8 A;  1FIK A;  1VEU A;  3H82 A;  2QJ7 A;  3PBR A;  3IXB A;  3VP0 A;  2OWH A;  4QJG A;  2PR5 A;  3F1O B;  1XFN A;  2PD7 A;  2XH9 A;  5FL3 A;  5HWW A;  5M18 A;  3ZFZ A;  3CUE C;  1Y4O A;  4GLQ A;  3IXD A;  2ZOI A;  3VE4 A;  3N7W A;  5EM0 A;  1YPR A;  4MBF A;  5HAR A;  5AVE A;  1JWZ A;  3VV4 A;  1KGG A;  3A3F A;  4C75 A;  1MPL A;  4HJ6 A;  3K3C A;  3EQV A;  1PW1 A;  5FQJ A;  2ZM0 A;  5DVA A;  2VX8 A;  5KSH A;  4DE0 A;  4PKY A;  2PT7 A;  3LIE A;  1V9Y A;  1MWS A;  3CHW P; 
#chains in the Genus database with same CATH homology
 1GHP A;  4LEN A;  2J8Y A;  2WKI A;  3E2K A;  3QNC A;  5GLC A;  4XUZ A;  3UDI A;  5A92 A;  4K91 A;  1K57 C;  4EBP A;  2B5R A;  3GSG A;  1Y54 A;  1G68 A;  1FQG A;  1BSG A;  2J9P A;  2WYX A;  3HVF A;  3PBO A;  4N9K A;  5CER A;  5F83 A;  3UO9 A;  1K4F A;  2X01 A;  4ZJ1 A;  1H8Y A;  1IYP A;  2RCX A;  4RA7 A;  4R3B A;  3HLD A;  3UPN A;  1ES2 A;  1QMF A;  4BLM A;  5A90 A;  2ZQD A;  3IH9 A;  3D4F A;  3HL9 A;  1MWR A;  1WYB A;  4ZTK A;  3MZD A;  4HES A;  4DE3 A;  3ZVT A;  1TVF A;  3S4X A;  4OQG A;  1XKZ A;  4R4R A;  3IF6 B;  4HEF A;  2OLU A;  3IHA A;  3P09 A;  3VSL A;  1YMX A;  4ZAM A;  3FZC A;  4XXR A;  3G35 A;  3ZG5 A;  3Q7V B;  3WS0 A;  1NYY A;  1K25 A;  3IXG A;  3Q7V A;  1K55 A;  4OPQ A;  3HBR A;  3NCK A;  5GHZ A;  3VP1 A;  1NZU A;  5CEC A;  1ERM A;  3C7U A;  4WZ4 A;  5HFO A;  3SS3 A;  3N6I A;  4B88 A;  3ISG A;  4KEN B;  2VGJ A;  1SDE A;  2WZX A;  3C5A A;  3VOZ A;  1S6R A;  1NRF A;  3NY4 A;  1L0F A;  4K0X A;  1YLW A;  3WS1 A;  1PZP A;  5TR7 A;  3M6H A;  3NI9 A;  1FSW A;  4PM9 A;  4LV2 A;  4N1X A;  5DF9 A;  5FI2 A;  2EFU A;  2WGI A;  5GLD A;  2WKE A;  3BRM A;  5D3O A;  4IBX A;  5FAP A;  1GHI A;  3IF5 A;  1Z6F A;  2ZQC A;  1MWU A;  1L2S A;  4B4X A;  3ZG7 B;  1ES5 A;  1LLB A;  1YLJ A;  3BM6 A;  3Q07 A;  1IYO A;  3PAG A;  2H0T A;  2HDQ A;  5HW3 A;  1K57 A;  3ZNY A;  5CGX A;  4U3T A;  2JBF A;  1K56 D;  5G18 A;  3ZG9 B;  3GVB A;  3VFH A;  4KQQ A;  2HPB A;  3GRJ A;  4GN2 A;  5DTT A;  3UE3 A;  3ITA A;  3VP2 A;  1K6R A;  2E8I A;  2H5S A;  2IWC A;  5CXW A;  2ZC5 B;  3M2J A;  5EOO A;  1FSY A;  1ONG A;  1LL9 A;  4N1H A;  1PW8 A;  4WZ5 C;  4WMC D;  3CJM A;  4N92 A;  5CGW A;  2Z2L B;  1LI9 A;  4OLG A;  3V3R A;  1XPB A;  2ZM2 A;  3IWO A;  5HX9 A;  1K54 A;  2HDS A;  1KDW A;  2P74 A;  4ZJ2 A;  4FH4 A;  4FH2 A;  3N8S A;  3IWI A;  5HL1 A;  5KSC A;  1JVJ A;  1K38 A;  1WE4 A;  1M6K A;  4OPZ A;  3MKF A;  4UA7 A;  5FA7 A;  2Y91 A;  2Q9N A;  5A91 A;  1CK3 A;  4S2J A;  1FOF A;  3BYD A;  4S2P A;  4BD0 A;  2Y2I A;  3HLG A;  4Y0O A;  4C3Q A;  2WK0 A;  5EEC A;  1BZA A;  5GLA A;  3SOI A;  3DWK A;  3VFF A;  2P9V B;  2X02 A;  4MBK A;  3G30 A;  3PBT A;  2EXB A;  4E6X A;  5EVI C;  4GD8 A;  3EQU A;  3O87 A;  1ZG4 A;  4QU3 A;  4E6W A;  3A3D A;  1KE3 A;  5TFQ A;  4DXB A;  4Y0T A;  3BLM A;  3ZGA B;  1JWP A;  1W5D A;  4CJN A;  4QHC A;  1XA1 A;  1KE4 A;  2V20 A;  2Y2L A;  3PAE A;  2A3U A;  3BEC A;  3HRE A;  3WRZ A;  3VSK A;  4U0X A;  4F94 A;  1IKI A;  5L2F A;  5HAQ A;  4JXW A;  1IEL A;  4K0W A;  5FI7 A;  4MLL A;  1RGY A;  2QPN A;  1BLC A;  4JPM A;  3UY6 A;  1DJC A;  4OQ0 A;  4KZ4 A;  3UPO A;  4X53 A;  4C6Y A;  5AQ7 A;  1VQQ A;  3FKW A;  4LCM A;  2Y4A A;  5GHY A;  2Y2K A;  4WEJ A;  4WZ5 A;  1O07 A;  2EX2 A;  4LV1 A;  1L0G A;  3MFD A;  2WAE A;  2XFS A;  3OCN A;  4RYE A;  1BUE A;  4QY5 A;  2WUQ A;  4ID4 A;  3MXS A;  1GA0 A;  3QNB A;  5FQM A;  4EBL A;  2IWD A;  1KGE A;  4ZBE A;  2H0Y A;  1L0D A;  5CHJ A;  4YFM A;  3OPR A;  3V50 A;  1DY6 A;  4NET A;  5CTN A;  3UE1 A;  4BL2 A;  2ZQ7 A;  4M3K A;  2CC1 A;  1BLS A;  3B3X A;  4OQI A;  4Y7P A;  5FQ9 A;  3ZG8 B;  3NIA A;  1I2W A;  5GL9 A;  2Z2M B;  2WAD A;  2DCF A;  3UE0 A;  1ES3 A;  4JKT A;  5EVI B;  5TGF A;  1JWV A;  2JE5 A;  5EVI A;  5I94 A;  3ZVW A;  2Y2P A;  3LEZ A;  2WGW B;  3Q1F A;  4WBG A;  5CHM A;  5DF8 A;  2OV5 A;  5BOH A;  1E4D A;  1FR1 A;  2WGW A;  3M2K A;  1JTG A;  4RX2 A;  4GB7 A;  4GDB A;  3BFF A;  2J7V A;  2ZQ9 A;  5CTM A;  3UPP A;  4A5R A;  5CEB A;  1IEM A;  2ZC6 B;  1KDS A;  1MKI A;  1DJA A;  1FCM A;  1QME A;  2HP5 A;  2RL3 A;  2Y2N A;  4R3J A;  3SH9 A;  4LV3 A;  3G32 A;  4P6B A;  3IQA A;  3N8R A;  5DF7 A;  5FAS A;  1W8Y A;  3FV7 A;  4GD6 A;  1K56 A;  5HAP A;  3GQZ A;  3UNW A;  1NY0 A;  1IYQ A;  4BD1 A;  2ZLY A;  3IXH A;  4OKP A;  4EBN A;  4OVD A;  2XEP A;  2A49 A;  4EQI A;  1EI5 A;  5CRF A;  1XXM A;  4HBT A;  3G31 A;  5E2H A;  1HZO A;  1ALQ A;  5FDH A;  4DDS A;  1PWC A;  4X6T A;  2Y55 A;  1XGJ A;  3ZNT A;  1CEG A;  5E2F A;  4FD8 A;  3C4P A;  2XD5 A;  3NDE A;  4KQR A;  1YLY A;  1MY8 A;  3A3E A;  4MBH A;  5FQI A;  1E3U D;  1N9B A;  3MZF A;  1LL5 A;  2XD1 A;  3OC2 A;  2WZZ A;  3NC8 A;  3ZG0 A;  3FWL A;  4IED A;  3HLC A;  4KQO A;  2DNS A;  1WYC A;  5FQK A;  2C6W B;  3SH8 A;  1YMS A;  4S2K A;  3W4O A;  3N8L A;  1W8Q A;  2UWX A;  2XK1 A;  3DWZ A;  3NBL A;  2ZC4 B;  2ZJ9 A;  2OSU A;  4MNR A;  4E3M A;  4X55 A;  3IH8 A;  4KZ3 A;  2XGN A;  5FI6 A;  5KMW A;  2ZM8 A;  1MWT A;  4OPY A;  3N4I A;  3HLF A;  3ZHH A;  4DKI A;  1ERO A;  5CHU A;  3OPL A;  3HUN A;  3HLW A;  4KZA A;  3WS4 A;  4E3N A;  1BTL A;  1NXY A;  3AGD A;  2EX6 A;  1BUL A;  3W8K A;  3VP3 A;  3OPP A;  3TG9 A;  3DW0 A;  4Q8I A;  5F82 A;  3UDF A;  1GCE A;  2J9O A;  3CMZ A;  2JCH A;  1K4E A;  3VP4 A;  2OLV A;  4QY6 A;  4X69 A;  2IWB A;  1RCJ A;  3Q82 A;  1LHY A;  2GDN A;  4JF4 A;  2Y2J A;  4RVA A;  3I7J A;  3GMW A;  4E3K A;  1M40 A;  4PPR A;  1J9M A;  1K6S A;  3GR2 A;  5F1G A;  1Q2P A;  4RX3 A;  2HP6 A;  3O86 A;  3SS4 A;  1SDN A;  2QMI A;  1TEM A;  4OOL A;  3ITB A;  4UA9 A;  3WWX A;  4BEN A;  5KZH A;  2XR0 A;  2V2F F;  4R4S A;  4PMA A;  1I2S A;  4L0L A;  4Y0U A;  3MXR A;  2Y2Q A;  4S2L A;  1PWG A;  1E25 A;  4BJP A;  5HAI A;  1U60 A;  1SKF A;  3BFE A;  4P85 A;  4PM6 A;  3BFG A;  1ZG6 A;  5JYO A;  4U0T A;  1EWZ A;  1ESU A;  3C7V A;  1ONH A;  3TOI A;  3AGE A;  1NJ4 A;  2Y2G A;  3IF6 C;  2EX9 A;  5EE8 A;  4IBR A;  2VGK A;  1JTD A;  3NDG A;  4KZ5 A;  1KE0 A;  3RXX A;  2Y2M A;  5U47 A;  2I72 A;  1YLT A;  4KZ7 A;  3BFD A;  3GTC A;  3DTM A;  1ES4 A;  4WYY A;  1KVL A;  1PI5 A;  4KZB A;  4X56 A;  3AGF A;  1HVB A;  1ERQ A;  4E3L A;  4JBF A;  4NK3 A;  5IHV A;  2WGV A;  4R0Q A;  4GDN A;  3RJU A;  2XFT A;  4E3J A;  1PZO A;  4JXV A;  4FCF A;  3G34 A;  4B4Z A;  2ZC7 A;  3LY3 A;  1YLP A;  1BT5 A;  5F1F A;  1YQS A;  4DDY A;  1IYS A;  4OQH A;  4CPK A;  3C4O A;  4BL3 A;  5EUA A;  5A93 A;  3LO7 A;  1SCW A;  3UDX A;  4GKU A;  3G4P A;  4P0M A;  4OP5 A;  3JYI A;  4E3O A;  3HUM A;  1H8Z A;  3HUO A;  4S2O A;  2PBY A;  2EX8 A;  2XQZ A;  3LY4 A;  2PU4 A;  3VOY A;  2Q9M A;  4EV4 A;  4PM8 A;  4QD4 A;  5FAT A;  5J8X A;  3G2Z A;  1CEF A;  1W7F A;  3PBN A;  1XA7 A;  4JLF A;  4PM7 A;  4GNU A;  4GOG A;  3V5M A;  4WM9 A;  1HTZ A;  3W4Q A;  4DF6 A;  3A3I A;  1S0W A;  1XGI A;  4O7D A;  5AQB A;  2QZ6 A;  2PU2 A;  1GA9 A;  2XF3 A;  4DE2 A;  5FAQ A;  1NYM A;  1ZC2 A;  1W79 A;  1BLP A;  2Y2H A;  2Y2O A;  4LV0 A;  1K54 C;  4UAA A;  1AXB A;  3S1Y A;  1E3U A;  3MBZ A;  1HD8 A;  4PM5 A;  4X68 A;  4ZJ3 A;  5JYP A;  3IF6 A;  3WS5 A;  4H8R A;  3TSG A;  3VMA A;  3MZE A;  2BG1 A;  1CI8 A;  4JF5 A;  3PBS A;  2JC7 A;  3LCE A;  4WMC A;  1PYY A;  1L0E A;  3O88 A;  5E43 A;  1N4O A;  4OH0 A;  1TDL A;  4JF6 A;  1FCO A;  4QB8 A;  1VM1 A;  3IWQ A;  5GLB A;  4S2I A;  3W4P A;  4HBU A;  5FSR A;  5E2E A;  3P98 A;  4OON A;  1IKG A;  5CGS A;  5GHX A;  3V39 A;  3ZCZ A;  1MBL A;  4IVK A;  3G2Y A;  4OOM A;  1OME A;  3IT9 A;  4OPR A;  5EVI D;  1G6A A;  2ZQ8 A;  1MXO A;  3FKV A;  4P87 A;  1C3B A;  4KZ8 A;  4D2O A;  3Q7Z A;  3CZD A;  2C5W B;  4DE1 A;  4JXS A;  1NZO A;  2G2W A;  1DJB A;  4OOY A;  3SH7 A;  4N9L A;  3BLS A;  4UHU A;  1KVM A;  3Q81 A;  3OPH A;  4WEK A;  5M19 A;  3M6B A;  4S2N C;  5AQ9 A;  5M1A A;  2ZQA A;  1FR6 A;  1ZKJ A;  2EXA A;  2WAF A;  2FFF B;  1H5X A;  1XX2 A;  2ZC3 B;  3BFC A;  1TDG A;  1XP4 A;  4EUZ A;  4Z9Q A;  3FYZ A;  3ZDJ A;  3PBR A;  4R1G A;  3IXB A;  4ZDX A;  3VP0 A;  5FQQ A;  1GHM A;  4UA6 A;  4QJG A;  5EOE A;  3HLB A;  2DRW A;  2XH9 A;  3PBQ A;  1I5Q A;  4JXG A;  4KZ6 A;  1LI0 A;  3BEB A;  5M18 A;  3ZFZ A;  1RP5 A;  2X71 A;  5DTS A;  4DRT A;  3CG5 A;  4GZB A;  5DTK A;  2BLS A;  1BLH A;  4DXC A;  3O3V A;  3IXD A;  2ZD8 A;  2WKH A;  3QHY A;  2P9V A;  4KG5 A;  3OCL A;  4MEZ A;  5EVL A;  3S22 A;  3A3J A;  3HLE A;  4IVI A;  2V1Z A;  3N7W A;  3MKE A;  4S2M A;  3E2L A;  4FSF A;  4LCL A;  5FAO A;  1ESI A;  3IHB A;  3PTE A;  3RXW A;  1FCN A;  2XDM A;  4MBF A;  5HAR A;  4KG6 A;  5CED A;  1Q2Q A;  2HDR A;  4KZ9 A;  2ZMA A;  3V3S A;  1PIO A;  4KG2 A;  1JWZ A;  4R23 A;  1K55 C;  1KGG A;  4OLD A;  4YIN A;  4E3I A;  2HP9 A;  3WS2 A;  3A3F A;  5E2G A;  4C75 A;  4OP8 A;  1KGF A;  2G2U A;  1RGZ A;  1MPL A;  3EQV A;  3GV9 A;  4BQM A;  4WEL A;  4S2N A;  1PW1 A;  2FFY A;  5AQA A;  3WRT A;  5FQJ A;  2ZM0 A;  5DVA A;  2R9X A;  5EPH A;  2H10 A;  2EFX A;  5KSH A;  2XLN A;  4DE0 A;  2Y59 A;  1CI9 A;  4EWF A;  3SS5 A;  2HDU A;  1SHV A;  1YT4 A;  1PI4 A;  4XUX A;  3UN7 A;  1MWS A;  3OZH A;  2R9W A;  1O7E A;  1YM1 A;  1YLZ A;  1PWD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...