4OQIA

Crystal structure of stabilized tem-1 beta-lactamase variant v.13 carrying r164s/g238s mutations
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGGRVGYIELDLASGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVGELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDSWEPELNEAIPNDERDTTTPVAMATTLRKLLTGELLTAASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGASERGSRGIIAALGPDGKPSRIVVIYMTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords TEM-94 ES-beta-lactamase
publication title Negative Epistasis and Evolvability in TEM-1 beta-Lactamase--The Thin Line between an Enzyme's Conformational Freedom and Disorder.
pubmed doi rcsb
source organism Escherichia coli
total genus 104
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2014-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4oqiA00
5DF9A 3IF6A 3N8LA 4X56A 2Z2MB 2WZXA 2C6WB 2DRWA 1BLSA 3A3JA 4KZ5A 1RP5A 4PMAA 4P0MA 5EOEA 2OV5A 1I5QA 5E43A 4KZ9A 4EV4A 1LHYA 4OP5A 5FAOA 3EQVA 2DNSA 5CERA 5GLAA 4C6YA 1SCWA 4QB8A 1W5DA 3N6IA 5JYPA 1YMSA 1K57C 3DW0A 4B4ZA 4QY6A 5CTMA 2A3UA 4GZBA 2HDSA 3IF6C 3HLBA 3WRZA 4GDNA 5CHMA 1EI5A 1XPBA 2FFFB 2EXAA 3EQUA 3UNWA 2OLUA 5D3OA 4XXRA 2ZJ9A 3UN7A 1K56A 3MBZA 2HP5A 1CEGA 4K91A 4OPZA 4BD0A 4D2OA 2B5RA 3JYIA 3GV9A 3Q7VA 3E2KA 3W8KA 4LCMA 1PWDA 5EVIB 3PBNA 2Y2KA 5EE8A 1ZKJA 4PM6A 3PAGA 2P9VB 1MWRA 2OLVA 2ZC4B 2ZC3B 2P74A 3OPHA 3UPNA 4B4XA 4B88A 4DE2A 2ZC5B 5GLBA 1XA1A 5GLCA 3MFDA 4RX3A 5FASA 4DDYA 2ZQ9A 4QU3A 1IYSA 2BG1A 4EBPA 1BT5A 1NY0A 3VFHA 4GNUA 5EVID 1IELA 1GHIA 1LL5A 3PBQA 2JC7A 1S6RA 4OLDA 4GN2A 1KGEA 2J9PA 1TVFA 2CC1A 4EUZA 1PW1A 1HVBA 3LY4A 1PWCA 1NYMA 2Y55A 3WWXA 1HZOA 1GA0A 4MBKA 4ZTKA 1Z6FA 3VSLA 3ZCZA 1E25A 5CEDA 1JTDA 5A91A 4DKIA 3FWLA 3BFGA 5EUAA 3CMZA 1NYYA 2WK0A 1ES5A 3ZG0A 2G2WA 3IHBA 4BD1A 1MWUA 3G4PA 4H8RA 2ZD8A 1E4DA 3BM6A 4MBFA 3GQZA 3IF6B 2WADA 5HAPA 3IQAA 2HP9A 4Y7PA 5U47A 3MZDA 1YLYA 3NC8A 5FATA 5DTTA 3CG5A 4GD8A 1RGZA 5A93A 5FI7A 4N9LA 1MPLA 3A3IA 4YINA 4ZJ1A 3HVFA 4DDSA 1ES2A 2JCHA 2XD5A 3UDIA 3GR2A 3IHAA 4JLFA 4QY5A 2WGIA 1IKIA 3MKEA 2IWDA 2PBYA 3TSGA 3C5AA 4GD6A 1QMFA 4E3KA 4KZ6A 3VFFA 4IVKA 4WBGA 3W4QA 3LY3A 1EROA 3RJUA 1DJCA 1VM1A 5FA7A 2HPBA 5EECA 1PYYA 4E3MA 4MNRA 4OQGA 3IH9A 4WYYA 5FQIA 5HAQA 3NCKA 4KZAA 3FKVA 3Q7VB 2EXBA 1JWPA 3GSGA 2J7VA 2ZM2A 5DF7A 5L2FA 5FI6A 2C5WB 3ZGAB 1MKIA 2Y2IA 3Q7ZA 5KZHA 4S2IA 1MY8A 1CK3A 1K56D 3IWQA 3UE1A 5CHUA 2J9OA 4E6WA 1RCJA 2JE5A 1TDLA 1K54A 1O07A 1ZC2A 5DVAA 5FQJA 4GOGA 3O88A 2Y59A 1U60A 1G6AA 2EX2A 5CHJA 1QMEA 5FQQA 4LV2A 1LI9A 4DE0A 1LL9A 1SDEA 2V2FF 3UPOA 1K4EA 1CEFA 2WKEA 1IKGA 2EFUA 1BULA 2FFYA 3WS2A 4FCFA 3IF5A 1PZPA 1K54C 4HESA 1EWZA 1YLJA 1W8QA 4LV3A 3IXDA 4XUZA 3ZVTA 4E3LA 4UAAA 4RX2A 3OPPA 3BFFA 3W4PA 5KMWA 5FDHA 4P85A 4RA7A 3NY4A 3HLCA 1NXYA 3BYDA 4OQHA 1AXBA 4OLGA 1N9BA 3OCLA 4N1HA 3V3RA 1BZAA 1ALQA 5J8XA 2Z2LB 5TGFA 1M6KA 2Y2LA 3BLMA 4DF6A 4K0XA 4Z9QA 2WYXA 4P87A 2PU4A 3ZDJA 4OP8A 3S1YA 1XKZA 2Y91A 1H5XA 4KQRA 3RXWA 1MBLA 4FH2A 4OOLA 1JVJA 2A49A 1TEMA 4JPMA 2WGVA 3ZNTA 4OH0A 3ZNYA 4EWFA 3BFCA 3N7WA 3M6BA 3C4OA 1NJ4A 1XGIA 3G32A 4MBHA 1FSYA 4BL3A 1KGFA 1HD8A 3HLGA 4R3BA 2Y2HA 3SOIA 1L0EA 4E3OA 1KVMA 3ITAA 5F82A 1L0FA 5HAIA 4QHCA 4S2LA 3O87A 4F94A 3N8SA 3S4XA 3G2YA 1BSGA 3IXBA 4ZDXA 3WS0A 4E3JA 1FQGA 3A3EA 3AGDA 4IEDA 4EBNA 2QZ6A 1G68A 1XXMA 3QHYA 1ERMA 1Y54A 3CJMA 1LI0A 3IT9A 1BLPA 4OPRA 4BJPA 5GLDA 4Y0TA 1XGJA 3VP4A 4DRTA 1IEMA 1DY6A 4JF4A 3B3XA 2ZMAA 1YT4A 1KE4A 4WEJA 5FQKA 3M2KA 3V50A 3PTEA 3BEBA 4FD8A 4EBLA 2ZQDA 2WAFA 4HBUA 4UA7A 5I94A 4WZ5C 1ES4A 4Q8IA 5FI2A 1FOFA 2RCXA 2VGKA 4DE1A 1PIOA 3O86A 4OOMA 4X6TA 4A5RA 4JXGA 4C75A 2BLSA 3P09A 5GHYA 2Y2OA 4QJGA 3G31A 1YLPA 2QPNA 1ONHA 3M2JA 4JF5A 4JXSA 4OVDA 4ZBEA 3HLFA 1WE4A 3OPLA 4IBRA 1XA7A 1FR1A 1LLBA 2R9WA 3AGEA 1I2WA 3HLEA 4KENB 1K25A 2H0TA 2H0YA 2HDRA 3Q1FA 2IWBA 3HUOA 1BLHA 4E6XA 3QNBA 4OKPA 3V3SA 1KDSA 4N9KA 1GHPA 3VP1A 5GHXA 4JBFA 2XQZA 5GHZA 3PBOA 2ZC7A 3G30A 4UA9A 1ERQA 2HDQA 3PAEA 4FSFA 4S2KA 3FKWA 4GB7A 2Y2GA 3HUMA 3MXRA 2ZLYA 3WS5A 3ZG5A 3NDEA 4E3NA 1E3UA 3AGFA 4JKTA 4OONA 4R4SA 1ZG6A 4EQIA 4KG6A 3ZHHA 1SDNA 5IHVA 3VOYA 1H8YA 2XF3A 1GCEA 3MZFA 1C3BA 1FCOA 4S2MA 5M1AA 4L0LA 4ID4A 4ZJ3A 4E3IA 4WMCA 1PZOA 4X68A 1NZUA 4LENA 4XUXA 1GHMA 2ZM8A 1K38A 2X01A 4KG2A 3BLSA 1I2SA 3MZEA 2GDNA 2XGNA 3PBTA 4R3JA 2XEPA 4WEKA 4ZJ2A 2ZQ8A 1JTGA 3ISGA 3NI9A 3Q82A 4U0XA 4Y0OA 5HL1A 3UE0A 1SHVA 4N1XA 1JWZA 2X71A 1J9MA 3VMAA 1FSWA 3FZCA 3NIAA 1W79A 4PM9A 5EPHA 1BTLA 4OQIA 5EOOA 3PBSA 4OPQA 1K55A 3WS4A 1YLWA 3WRTA 1H8ZA 3CZDA 3GRJA 5AQ7A 3RXXA 2EX8A 1BUEA 3SH7A 4R1GA 4OOYA 2WKIA 1NRFA 2ZQ7A 2H5SA 4X55A 5E2GA 2OSUA 3HUNA 3NBLA 4LCLA 4WELA 2ZQAA 5FQMA 3QNCA 1K55C 4S2OA 2XK1A 2XLNA 1KGGA 3IWOA 5TR7A 5HX9A 4IVIA 3BFEA 3S22A 1IYQA 5CTNA 2XFSA 2I72A 3Q81A 1ONGA 2Y2MA 2UWXA 2XFTA 3HL9A 2RL3A 1CI9A 3FYZA 4U3TA 3SS3A 1TDGA 1K4FA 2XR0A 1N4OA 3C7UA 3MKFA 1RGYA 4DE3A 3G2ZA 3IH8A 4R23A 2XDMA 3VOZA 2WGWA 5F1FA 3IXGA 1GA9A 4M3KA 4HEFA 1L0DA 3HLWA 1KDWA 2H10A 3OPRA 5CGSA 3A3DA 4KQQA 4N92A 3VP3A 4PM8A 2Q9MA 5FAPA 5CRFA 4KG5A 3UO9A 4WM9A 3FV7A 1K6SA 1YM1A 4ZAMA 3V39A 3IXHA 3Q07A 3GMWA 3UY6A 3DWKA 5E2EA 4S2PA 1L2SA 5AQ9A 3ZG8B 5A92A 1W8YA 4X69A 4BQMA 3GTCA 2JBFA 4WZ5A 2R9XA 3LO7A 4UA6A 2Y2JA 1YQSA 5FAQA 3ZG9B 3DTMA 3WS1A 5A90A 2J8YA 3HLDA 4LV0A 1NZOA 2E8IA 5AQBA 5KSHA 3VSKA 4Y0UA 1KE0A 4HBTA 4MLLA 2XD1A 1ZG4A 3LCEA 1E3UD 2WUQA 2Q9NA 4O7DA 4PM7A 1K6RA 1HTZA 5CGXA 1YLTA 1JWVA 4X53A 1S0WA 4R0QA 5FQ9A 1XP4A 5CXWA 4BL2A 4KZ8A 1WYBA 4PPRA 5M18A 3HBRA 3SS4A 3ZFZA 2EX6A 3ZVWA 4JXWA 1FCMA 3VP2A 5M19A 1ESIA 4WMCD 5DTSA 4GDBA 3UDFA 3BECA 2IWCA 1ES3A 4MEZA 4BLMA 4S2JA 3I7JA 3OC2A 4JF6A 3VP0A 1W7FA 1KVLA 3OCNA 4JXVA 5KSCA 5TFQA 1Q2QA 2ZM0A 3DWZA 4KQOA 3V5MA 5CGWA 1PW8A 2QMIA 2EFXA 1VQQA 2WKHA 3W4OA 5CECA 2V20A 3O3VA 1IYPA 2DCFA 4S2NA 2Y2NA 5CEBA 1L0GA 3TG9A 5EVLA 4BENA 3ITBA 1PI4A 4RVAA 3TOIA 2XH9A 1XX2A 3P98A 1KE3A 5HARA 3SH9A 3ZG7B 3UDXA 5BOHA 5FSRA 1MWSA 1DJBA 2X02A 3M6HA 5EVIA 3PBRA 3IWIA 1YMXA 2WGWB 1M40A 1MWTA 2P9VA 3BFDA 3C4PA 4S2NC 5E2FA 2WZZA 4C3QA 3A3FA 4KZ3A 1DJAA 3LEZA 2PU2A 2G2UA 2VGJA 3GVBA 4OQ0A 5G18A 1ESUA 4IBXA 4P6BA 2WAEA 2HDUA 3MXSA 1PI5A 2V1ZA 5DF8A 3SH8A 3NDGA 4UHUA 3N8RA 5AQAA 5EVIC 4DXBA 3OZHA 4QD4A 1YLZA 3G35A 1SKFA 4OPYA 4YFMA 3BRMA 5HFOA 1PWGA 4WZ4A 3UPPA 4RYEA 1OMEA 2HP6A 5JYOA 1Q2PA 1FR6A 4KZ7A 5F1GA 2ZQCA 4R4RA 2ZC6B 4K0WA 1IYOA 4KZ4A 3SS5A 3E2LA 3HREA 1FCNA 2Y2QA 4NETA 2EX9A 4NK3A 4GKUA 3N4IA 3G34A 2Y2PA 5HW3A 2Y4AA 4LV1A 1BLCA 4KZBA 5F83A 1CI8A 4PM5A 1MXOA 1O7EA 4FH4A 5GL9A 5DTKA 4CJNA 4DXCA 3D4FA 4CPKA 3C7VA 1WYCA 3UE3A 1K57A 4U0TA 5E2HA
chains in the Genus database with same CATH superfamily
3LR3A 4BMWA 2DRWA 3A3JA 4KZ5A 2XROA 2OV5A 1I5QA 4KZ9A 4OP5A 5FAOA 3EQVA 5AVEA 2DNSA 1SCWA 2A24B 1W5DA 5JYPA 1YMSA 3DW0A 4O8GA 2A3UA 4RQ9A 2QYBA 5CHMA 3JVVA 4DJ2A 3H82A 2W1TA 4XXRA 2ZJ9A 1S4SA 1FILA 2HP5A 2W27A 1CEGA 4R70A 4EESA 3JYIA 2VKSA 2ZL1B 3MQOA 2JKTM 3UPNA 2ZC4B 3HJKA 2W3FA 5GLBA 1XA1A 3T1RA 4HP4A 3UB6A 4RX3A 1Y4OA 2BTFP 4EBPA 1NY0A 4EU0A 4GNUA 1IELA 3RFBA 2PD7A 1LL5A 4OLDA 1S6RA 4GN2A 3LY4A 1NYMA 3WWXA 2K7SA 1JNUA 1Z6FA 4NKPA 5A91A 1OJGA 3FWLA 5EUAA 5DJTA 4H8RA 4BWIA 4GCZA 2DMWA 3GQZA 3IF6B 2WADA 1YPRA 4Y7PA 3CG5A 4WF0A 5HSQA 4MDZA 4YINA 4YNRA 3UDIA 1DP8A 2V8FA 2GNXA 2WGIA 5FDSA 3TSGA 4KZ6A 3W4QA 3LY3A 1SKOB 1DJCA 2JKRI 3TW8A 3P01A 3PR6A 5HAQA 5G4ZA 3Q7VB 2ZM2A 2C5WB 3ZGAB 2Q0OA 5KZHA 5IS1A 4S2IA 4ETZA 2J9OA 1RCJA 1UGUA 3O88A 1U60A 1G6AA 5CHJA 4LV2A 4JGOA 1SDEA 4NG2A 2EFUA 1EW0A 3WS2A 2PRFA 1PZPA 1PRQA 1K54C 4HESA 4E3LA 3IXDA 5TBMB 3OPPA 3U4LP 4XT2B 4RA7A 3NY4A 3HLCA 3KSFA 4OQHA 1OT6A 2WKQA 4Z9QA 4P87A 1IOUA 1H5XA 3RXWA 5J7EA 4FH2A 4OOLA 2CMNA 4JPMA 2WGVA 3L7HA 2KLIA 3N7WA 3LGOA 3P7NA 1STZA 3C4OA 1XGIA 4NXGA 4MBHA 1FSYA 1KGFA 1HD8A 1XJ6A 4R3BA 1L0EA 5F82A 4X1LA 3CAXA 1VB6A 4E3JA 2QZ6A 2VGLS 3CJMA 2FZ0A 1LI0A 1BLPA 4F3LB 1XGJA 3VP4A 1LSVA 1IEMA 1DY6A 2NUPC 4JF4A 3B3XA 1KE4A 1TS0A 4D60A 5FQKA 4HBUA 4WZ5C 3LIFA 1ES4A 2RCXA 3O86A 4JXGA 4QJGA 3G31A 3M2JA 1XJ4A 3VE3A 5A8BA 5G4YA 1XA7A 4KENB 3Q1FA 2H0YA 3QNBA 2G7UA 1PNEA 3T50A 5GHXA 1D7EA 5MC7A 2ZOHA 4UA9A 2HDQA 3MMHA 3FKWA 4EETB 4EXOA 2ZLYA 3ZG5A 1E3UA 4H6JB 4R4SA 4KG6A 5IHVA 1C3BA 1N9LA 4ZJ3A 2JHEA 3BLSA 1I2SA 2PBDP 3PBTA 2GDNA 2YKHA 3Q82A 1SHVA 4N1XA 1JWZA 2OAQ1 2X71A 4CQHA 4OPQA 3CZDA 3LUQA 3RXXA 2JKGA 2D01A 4R1GA 2WKIA 5HWTA 1NRFA 4LCLA 1K55C 2XK1A 2XLNA 4IVIA 2V1BA 1S66L 2M1CA 3Q81A 1ONGA 2Y2MA 2XFTA 4CLCB 2RL3A 3FYZA 1K4FA 2XR0A 3VOZA 2WGWA 5HWWA 3IXGA 1GA9A 4M3KA 3LR4A 2PR6A 3VOLA 2EWVA 1G6OA 3DTKA 4N92A 5CRFA 2R78A 3UO9A 1DRMA 4O0PA 2QKPA 3E4OA 5HPIA 3DWKA 5E2EA 1L2SA 5AQ9A 3LIEA 1W8YA 2XA7S 5L09A 1W63M 2R9XA 2A2LA 3LO7A 5FAQA 3ZG9B 3O5YA 4LV0A 5AQBA 4GHIA 2XD1A 1ZTUA 3LCEA 4O7DA 1K6RA 3E0YA 1YLTA 4I5SA 4HI4A 1XP4A 3QP8A 1WYBA 5M18A 2EX6A 4MCWA 4JXWA 3VP2A 4WMCD 5L8MA 2A24A 3T1QB 2L1MA 4JF6A 1W7FA 1KVLA 1Q2QA 1MC0A 3JVUA 3NOPC 3DWZA 5CGWA 1PW8A 2QMIA 1VQQA 3LYXA 4R6LA 1L0GA 4BENA 4EEUA 3CPTB 3A0SA 3P98A 3ZG7B 5BOHA 1MWSA 3KO6A 2X02A 1ZHHB 4G3KA 2ZL1A 2GX5A 3UB9A 3H7WB 1M40A 1DJAA 4IBXA 2WAEA 2HDUA 1PI5A 5EVIC 5F5YA 3DAVA 4QD4A 3BRMA 5HFOA 1PWGA 3UPPA 4RYEA 4Q0IA 2ZC6B 1SZVA 3NOTC 2PD8A 3SS5A 3HREA 1V9YA 4NK3A 4GKUA 2Y4AA 4LV1A 5F83A 1CI8A 4FH4A 3D4FA 4DMZA 2VV7A 4U0TA 1T1AA 2QWSA 3IF6A 4GS9B 3R7WB 2WZXA 1BLSA 4PAUA 4PMAA 4P0MA 2UV0E 5E43A 4EV4A 3BQAA 1LHYA 1K57C 1OJ5A 1OTDA 4QY6A 4GDNA 1EI5A 2VA0A 2EXAA 1SKOA 3KYQA 2J80A 2WKPA 4BD0A 4D2OA 2VV8A 3GV9A 3Q7VA 3E2KA 4LCMA 2E8JA 3PBNA 2P74A 3BW6A 4B4XA 4B88A 5GLCA 5FASA 3LFVA 5F69A 3VFHA 5HDSA 5EVID 2KX6A 4YOFA 2B02A 2J9PA 1F9IA 3E4PA 1PWCA 5TBMA 3TE8A 4CLCE 4XT2A 3VSLA 1E25A 4DN0A 4DKIA 3BFGA 3SW1A 2AVXA 3CMZA 2WK0A 3IHBA 5CX7A 3G4PA 4BBVA 3BM6A 1P9WA 3T4LA 4NXFA 5FI7A 5HPFA 2VEAA 4DDSA 4HIAA 3GR2A 2M7VA 4JLFA 3V67A 4GD6A 4IVKA 2K31A 5AJGA 4Y13A 3T1SA 1S1YA 5EECA 1PYYA 1JWPA 4F3LA 4LPZA 3BY9A 5DF7A 3LI8A 3T1XA 1MKIA 1NRJA 2Y2IA 1MY8A 1K56D 3IWQA 5CHUA 4E6WA 2JE5A 5DVAA 4GOGA 4P6ZS 2EX2A 4HOIA 1QMEA 5FQQA 1NLZA 2P04A 3QP1A 2WKEA 4FCFA 3IF5A 1YKDA 1YLJA 1W8QA 4XUZA 3ZVTA 2VK3A 3R4KA 5KMWA 1NXYA 3BYDA 1N9BA 4HJ3A 4HP9A 3T4JA 1ALQA 2Z2LB 4MN5A 2L0WA 4H6JA 2Y2LA 4DF6A 4K0XA 2WYXA 3ZDJA 2Y91A 2OOLA 3LEQA 4NXEA 1MBLA 2ZOIA 4FTXA 3ZNTA 3BFCA 3G32A 4BL3A 3SOIA 1KVMA 1P9RA 1L0FA 4QHCA 4S2LA 1GSWA 4F94A 3N8SA 3NJAA 3IT9A 5GLDA 4MN6A 2PHYA 4LFUA 3MFXA 4CLCA 2ZQDA 2VGKA 2VX8A 3JPUA 4A5RA 4C75A 2BLSA 5GHYA 1YLPA 4WUJA 4JF5A 4ZBEA 3HLFA 2H0TA 2HDRA 4E6XA 1BLHA 2ACGA 3NHQA 4JBFA 5GHZA 2ZC7A 3G30A 1ERQA 4R38A 4GB7A 1TS6A 3WS5A 2WKRA 1P97A 3NDEA 2W3HA 4JKTA 4EQIA 5F6AA 1GCEA 2O9CA 3K3DA 1FCOA 4S2MA 5M1AA 1L3LA 3LR5A 1NLYA 4E3IA 4X68A 2ZMFA 4LENA 1GHMA 2X01A 5IT5A 5IU1A 1JTGA 4U0XA 5HL6A 1J9MA 1BTLA 2VGLM 5EOOA 4HH2A 4ME4A 1H8ZA 2M7UA 3GRJA 5AQ7A 1F2KA 3SH7A 5J3WA 4OOYA 5E2GA 4UEYA 4WELA 4S2OA 1KGGA 3IWOA 5HX9A 3BFEA 5CTNA 2PYPA 2XFSA 2I72A 4X25A 3CPTA 3HL9A 1CI9A 2P08A 1VETB 3C7UA 5L07A 3H7WA 4HEFA 3C38A 2QJ5A 1L0DA 2D02A 1T18A 1LSWA 4KQQA 3VP3A 3C8CA 5FAPA 2ZBBA 1K6SA 1YM1A 4ZAMA 3V39A 4NXBA 1TS8A 3Q07A 4IUKA 5LBRA 1GSVA 3CITA 1TF1A 1XJ2A 4BQMA 3E98A 2O0YA 1MKMA 2Z6DA 4UA6A 2Y2JA 1VEUB 1OPXA 3WS1A 2J8YA 5KSHA 1YAXA 4Y0UA 5CGXA 4KQDA 4HBTA 1ZG4A 3UE6A 5J4EA 4GLQA 5FQ9A 4GS9A 5CXWA 3R7WA 2I9VA 2B95A 4PPRA 3LR0A 1OTIA 4UQIS 4GDBA 1T1CA 3DBAA 3UB8A 3UDFA 3BECA 2IWCA 3T4SA 3MQQA 3OLOA 3OC2A 3VP0A 4EUVA 2ZM0A 4II7A 3V5MA 2V0WA 2WKHA 5CECA 1IYPA 2VZWA 2Y2NA 1PFLA 1Y28A 4HHDA 3KSGA 2XH9A 1XX2A 1KE3A 3F1PB 3UDXA 1DJBA 3M6HA 3D3OA 3PBRA 3IWIA 1YMXA 3T12B 2GZAA 4S2NC 2WZZA 1OTBA 3FPWA 3LEZA 2PU2A 1GSXA 4OQ0A 5G18A 3CHWP 1J3WA 2V1ZA 2XA7M 3N8RA 3OZHA 3G35A 3MS6A 2QJ7A 4WZ4A 5JYOA 1OMEA 2HP6A 4JGQA 1Q2PA 4KZ7A 3E4QA 4KZ4A 4MN7A 3CUEC 4NETA 5HW3A 1BLCA 1MXOA 5EFWA 3C30A 3C7VA 5E2HA 5DF9A 4X56A 2Z2MB 2C6WB 1H3QA 1RP5A 2O9AA 1W63Q 5EOEA 3A0VA 4C6YA 4QB8A 3K2NA 4B4ZA 4O01A 4GZBA 5EVEA 2Y8HA 3WRZA 4MMNA 2FFFB 3UNWA 3EQUA 4Y2FA 3UN7A 2HGVA 2QHKA 1P0ZA 1N9NA 2B5RA 2L4RA 2PAVP 3W8KA 2YKFA 1PWDA 5EVIB 3UB5P 2Y2KA 5EE8A 4LLOB 3PAGA 1MWRA 2ZC3B 4DE2A 2HZ5A 2BASA 2ZQ9A 4QU3A 2LB9A 1GHIA 1YSPA 3PBQA 2JC7A 1T1BA 4PKYG 1KGEA 1TVFA 2CC1A 2PDRA 4Y3IA 1GA0A 3L9KA 4EQ1A 4ZTKA 3ZCZA 2O9BA 5FL3A 1T19A 2FH5A 1ES5A 3ZG0A 4BD1A 2ZD8A 1E4DA 3MF0A 5HAPA 2HP9A 3NC8A 1RGZA 3A3IA 4ZJ1A 2JKFA 3HVFA 2JCHA 3IHAA 1IKIA 3MKEA 2IWDA 2PBYA 1H8MA 3U2AA 1QMFA 1WA9A 3VFFA 5TJJA 3EGDC 4WBGA 3T4QA 2K2NA 2W3DA 1EROA 4E04A 1VM1A 3B47A 5FA7A 2HPBA 1NWZA 4E3MA 4MNRA 3S7OA 5FQIA 1DP9A 4I3IA 5EV0A 4KZAA 1DP6A 3FKVA 2EXBA 2HF6A 2J7VA 5L2FA 3PHYA 3Q7ZA 4WN5A 3UE1A 1K54A 1O07A 1ZC2A 3S7PA 2Y59A 4LRZE 1H0MA 1LI9A 4DE0A 1LL9A 2V2FF 1K4EA 1IKGA 1BULA 2FFYA 1EWZA 4LV3A 3ULFA 4PKYA 4RX2A 3BFFA 5FDHA 3OCLA 4K08A 4FUWA 4N1HA 1BZAA 3V3RA 5J8XA 3CI6A 1M6KA 2INWA 1YSQA 4WLAA 4OP8A 3S1YA 3IBJA 4KQRA 3CLOA 1TEMA 3DTEA 4OH0A 3M6BA 1NJ4A 1OTAA 4Q0HA 2Y2HA 4E3OA 5DKKA 5HAIA 3S4XA 1BSGA 3IXBA 5EM1A 4EEPA 3T4KA 3FPVA 3QHYA 1G68A 1XXMA 2ZMVA 1ERMA 1Y54A 4JGRA 4OPRA 3F1NB 3IBRA 2V1AA 4ARZB 4UA7A 1VETA 5FI2A 4Q8IA 1FOFA 4DE1A 1PIOA 4X6TA 3P09A 2Y2OA 2QPNA 4JXSA 3KSHA 3B33A 1WE4A 5I5LA 3AGEA 1LLBA 2R9WA 1I2WA 1K25A 2IWBA 3HUOA 4IHQA 4OKPA 1KDSA 3VP1A 1GHPA 3PBOA 3PAEA 4FSFA 2H28A 2LB5A 4E3NA 3EEAA 3AGFA 1ZG6A 3ZHHA 1SDNA 1H8YA 2XF3A 3CWFA 3MZFA 5FEFA 1LL8A 4JGPA 1VEUA 1G28A 4WMCA 1PZOA 2ZM8A 1K38A 2XRNA 4WEKA 2XGNA 4R3JA 2JN7A 2XEPA 4ZJ2A 2ZQ8A 3ISGA 3MR0A 4Y0OA 3UE0A 3VMAA 3W2ZA 1FSWA 3FZCA 5EPHA 5DKLA 4OQIA 3PBSA 3BY8A 1K55A 3WS4A 2JKRM 1BUEA 4KUKA 4Y15A 2ZQ7A 3NBLA 2PYRA 1IYQA 5HD3A 3MXQA 3H9WA 3FC7A 4LRYC 1X0OA 3F1PA 4U3TA 3SS3A 4DE3A 1N4OA 1RGYA 3G2ZA 3IH8A 2XDMA 5F1FA 3HLWA 3KSIA 2GJ3A 3GMWA 3IX4A 1Z09A 3UY6A 4S2PA 5HDDA 5A92A 3MJQA 4X69A 4ESPA 3GTCA 5HD5A 2JBFA 3DTMA 5HWVA 5A90A 3HLDA 1NZOA 4WL9A 4MLLA 1S4RA 1E3UD 2WUQA 2Q9NA 4L9EA 1HTZA 4X53A 1JWVA 1S0WA 4BL2A 2HV1A 5AVFA 1S67L 3ZVWA 1FCMA 1ESIA 4MEZA 4BLMA 5KSCA 3DTIA 3W4OA 2V20A 3O3VA 4I3JA 1ACFA 4Q0JA 2DCFA 3ITBA 3TOIA 5EM0A 5FSRA 5EVIA 1S1ZA 4C3QA 2Z6CA 5E2FA 3A3FA 4KZ3A 3GECA 5HZHA 2G2UA 2VGJA 3LIDA 3MXSA 1D06A 3BQ8A 3NDGA 4UHUA 5AQAA 4DXBA 3IS2B 1YLZA 4GJ4A 2HJ9C 3LI9A 4HH3A 4OPYA 4YFMA 3BWLA 3PXPA 1FR6A 5F1GA 2J3WA 1IYOA 1FCNA 1TD5A 4I3AA 2EX9A 1XFNA 2Y2PA 4DJ3A 3NECA 4KZBA 4PM5A 4UQIM 5GL9A 1WYCA 3UE3A 1K57A 2EA9A 3N8LA 3BJNA 4AFIA 3LIAA 4EERA 2JKTI 4B93A 5CERA 5GLAA 3N6IA 1XJ3A 3MSHA 5CTMA 3PYPA 3MQ0A 2HDSA 3IF6C 3HLBA 1ODVA 1XPBA 3VE4A 2OLUA 5D3OA 1D1JA 1K56A 3MBZA 4LRXC 5HDCA 2EWWA 4K91A 3K3CA 4OPZA 3QP2A 2VLGA 3KYEA 1ZKJA 4PM6A 2P9VB 2OLVA 3OPHA 2ZC5B 4B9OA 3MFDA 4L9FA 4DDYA 1UWNX 1IYSA 2BG1A 1BT5A 1HLUP 3F1OB 3TJZC 3EOIA 2XSSA 4EUZA 1PW1A 1HVBA 2Y55A 1HZOA 3D72A 4MBKA 2P7JA 4HNBA 3UB7A 5CEDA 1JTDA 4M4XA 3OOVA 2KOIA 1NYYA 2G2WA 2OWHA 1MWUA 4MBFA 4HQAA 3IQAA 4IUHA 4ZRRA 3HJIA 5U47A 4YWZA 3MZDA 1YLYA 5FATA 5DTTA 4GD8A 5A93A 4I39A 4N9LA 1MPLA 1ES2A 2XD5A 4QY5A 3C5AA 4E3KA 3H82B 2W1TB 3RJUA 3NULA 3EWKA 4OQGA 3G6OA 3IH9A 4WYYA 3NCKA 3GSGA 4HJ6A 3QP6A 3A0RA 3F1NA 5FI6A 4QPRA 1CK3A 2KDKA 5C5KA 1TDLA 4ARZA 1MZUA 4BBTA 4Y17A 5FQJA 3QP5A 3ICYA 2HJEA 3LIBA 3UPOA 1CEFA 5L10A 1UWPX 4LGWA 4UAAA 3W4PA 1BYWA 4P85A 1AXBA 4OLGA 4ETXA 4I38A 1OTEA 5TGFA 3BLMA 2PU4A 1XKZA 1FIKA 1JVJA 2A49A 2O99A 3ZNYA 4EWFA 4BBUA 4L9GA 3HLGA 3T4TA 2OWJA 3ITAA 3O87A 3T4OA 3D9YA 3G2YA 3RH8B 1KOUA 5DFYA 4ZDXA 3WS0A 1FQGA 3A3EA 3AGDA 4IEDA 4EBNA 3QP4A 2PR5A 4BJPA 4Y0TA 2J3TC 4DRTA 4GW9A 1F5MA 1A0KA 2ZMAA 1YT4A 1LT0A 3ZYTA 4WEJA 3M2KA 3V50A 3PTEA 3BEBA 4FD8A 4EBLA 5I94A 2WAFA 4G3VA 3RTYA 4OOMA 3S7QA 1ONHA 4OVDA 3LICA 3OPLA 4IBRA 1FR1A 3HLEA 1N9OA 3KX0X 4CLCC 3V3SA 4N9KA 3VV4A 2XQZA 1LSXA 4S2KA 4Y5FA 2Y2GA 3EGXC 3HUMA 3MXRA 4OONA 1CJFA 3SZTA 3VOYA 5KIZA 4L0LA 4ID4A 4XUXA 1NZUA 4KG2A 3MZEA 3B42A 3NI9A 2MJ6A 1K0KA 5HL1A 3NIAA 2V9AA 1W79A 4PM9A 3NOUC 2PT7A 1YLWA 3WRTA 4EW7A 3FG8A 2EX8A 4G3WA 3GDIA 2H5SA 2W0NA 4X55A 2OSUA 3HUNA 2ZQAA 5FQMA 3QNCA 2J3TD 3S22A 5K5BA 5TR7A 2W1RA 4Z1WA 4IJGA 2UWXA 4FOFA 3IX8A 1TDGA 3MKFA 4R23A 4HY8A 1F98A 1AWIA 2Y79A 1KDWA 2H10A 3OPRA 5CGSA 3A3DA 4CLCD 4PM8A 2Q9MA 4KG5A 4WM9A 3IS2A 3FV7A 1V9ZA 3IXHA 1VHMA 5F68A 2IA2A 3ZG8B 3EEHA 4HJ4A 4WZ5A 3S7NA 1YQSA 4P6ZM 4QWOA 1XFQA 2B18A 2E8IA 3VSKA 1KE0A 2W3GA 4DXCA 4PM7A 2VV6A 3OBFA 4R0QA 2VJWA 4KZ8A 3HBRA 3SS4A 3ZFZA 5M19A 5DTSA 1ES3A 4S2JA 3I7JA 4JXVA 3OCNA 5TFQA 4KQOA 5FEGA 2OAP1 2EFXA 2V0UA 5DFXA 4S2NA 1IFQA 5CEBA 3TG9A 5EVLA 1PI4A 4RVAA 2V8CA 5DJUA 5HARA 3SH9A 3UMDA 3ZQ5A 3KYZA 2WGWB 1MWTA 2P9VA 3BFDA 3C4PA 4KUOA 3GVBA 1ESUA 4P6BA 1TS7A 3CUEA 5DF8A 3SH8A 3UMEA 3F1OA 4X1MA 2W3EA 3HCYA 2NUTC 1SKFA 4NEED 2ZQCA 4R4RA 4K0WA 1CF0A 3E2LA 2Y2QA 4R3AA 4PHTA 1CQAA 3N4IA 3G34A 1OT9A 3TRCA 1O7EA 5DTKA 4CJNA 4CPKA 3C2WA 4GHIB 3IX3A 1G5UA
chains in the Genus database with same CATH topology
5DF9A 3IF6A 3N8LA 4X56A 2Z2MB 2WZXA 2C6WB 2DRWA 1BLSA 3A3JA 4KZ5A 1RP5A 4PMAA 4P0MA 5EOEA 2OV5A 1I5QA 5E43A 4KZ9A 4EV4A 1LHYA 4OP5A 5FAOA 3EQVA 2DNSA 5CERA 5GLAA 4C6YA 1SCWA 4QB8A 1W5DA 3N6IA 5JYPA 1YMSA 1K57C 3DW0A 4B4ZA 4QY6A 5CTMA 2A3UA 4GZBA 2HDSA 3IF6C 3HLBA 3WRZA 4GDNA 5CHMA 1EI5A 1XPBA 2FFFB 2EXAA 3EQUA 3UNWA 2OLUA 5D3OA 4XXRA 2ZJ9A 3UN7A 1K56A 3MBZA 2HP5A 1CEGA 4K91A 4OPZA 4BD0A 4D2OA 2B5RA 3JYIA 3GV9A 3Q7VA 3E2KA 3W8KA 4LCMA 1PWDA 5EVIB 3PBNA 2Y2KA 5EE8A 1ZKJA 4PM6A 3PAGA 2P9VB 1MWRA 2OLVA 2ZC4B 2ZC3B 2P74A 3OPHA 3UPNA 4B4XA 4B88A 4DE2A 2ZC5B 5GLBA 1XA1A 5GLCA 3MFDA 4RX3A 5FASA 4DDYA 2ZQ9A 4QU3A 1IYSA 2BG1A 4EBPA 1BT5A 1NY0A 3VFHA 4GNUA 5EVID 1IELA 1GHIA 1LL5A 3PBQA 2JC7A 1S6RA 4OLDA 4GN2A 1KGEA 2J9PA 1TVFA 2CC1A 4EUZA 1PW1A 1HVBA 3LY4A 1PWCA 1NYMA 2Y55A 3WWXA 1HZOA 1GA0A 4MBKA 4ZTKA 1Z6FA 3VSLA 3ZCZA 1E25A 5CEDA 1JTDA 5A91A 4DKIA 3FWLA 3BFGA 5EUAA 3CMZA 1NYYA 2WK0A 1ES5A 3ZG0A 2G2WA 3IHBA 4BD1A 1MWUA 3G4PA 4H8RA 2ZD8A 1E4DA 3BM6A 4MBFA 3GQZA 3IF6B 2WADA 5HAPA 3IQAA 2HP9A 4Y7PA 5U47A 3MZDA 1YLYA 3NC8A 5FATA 5DTTA 3CG5A 4GD8A 1RGZA 5A93A 5FI7A 4N9LA 1MPLA 3A3IA 4YINA 4ZJ1A 3HVFA 4DDSA 1ES2A 2JCHA 2XD5A 3UDIA 3GR2A 3IHAA 4JLFA 4QY5A 2WGIA 1IKIA 3MKEA 2IWDA 2PBYA 3TSGA 3C5AA 4GD6A 1QMFA 4E3KA 4KZ6A 3VFFA 4IVKA 4WBGA 3W4QA 3LY3A 1EROA 3RJUA 1DJCA 1VM1A 5FA7A 2HPBA 5EECA 1PYYA 4E3MA 4MNRA 4OQGA 3IH9A 4WYYA 5FQIA 5HAQA 3NCKA 4KZAA 3FKVA 3Q7VB 2EXBA 1JWPA 3GSGA 2J7VA 2ZM2A 5DF7A 5L2FA 5FI6A 2C5WB 3ZGAB 1MKIA 2Y2IA 3Q7ZA 5KZHA 4S2IA 1MY8A 1CK3A 1K56D 3IWQA 3UE1A 5CHUA 2J9OA 4E6WA 1RCJA 2JE5A 1TDLA 1K54A 1O07A 1ZC2A 5DVAA 5FQJA 4GOGA 3O88A 2Y59A 1U60A 1G6AA 2EX2A 5CHJA 1QMEA 5FQQA 4LV2A 1LI9A 4DE0A 1LL9A 1SDEA 2V2FF 3UPOA 1K4EA 1CEFA 2WKEA 1IKGA 2EFUA 1BULA 2FFYA 3WS2A 4FCFA 3IF5A 1PZPA 1K54C 4HESA 1EWZA 1YLJA 1W8QA 4LV3A 3IXDA 4XUZA 3ZVTA 4E3LA 4UAAA 4RX2A 3OPPA 3BFFA 3W4PA 5KMWA 5FDHA 4P85A 4RA7A 3NY4A 3HLCA 1NXYA 3BYDA 4OQHA 1AXBA 4OLGA 1N9BA 3OCLA 4N1HA 3V3RA 1BZAA 1ALQA 5J8XA 2Z2LB 5TGFA 1M6KA 2Y2LA 3BLMA 4DF6A 4K0XA 4Z9QA 2WYXA 4P87A 2PU4A 3ZDJA 4OP8A 3S1YA 1XKZA 2Y91A 1H5XA 4KQRA 3RXWA 1MBLA 4FH2A 4OOLA 1JVJA 2A49A 1TEMA 4JPMA 2WGVA 3ZNTA 4OH0A 3ZNYA 4EWFA 3BFCA 3N7WA 3M6BA 3C4OA 1NJ4A 1XGIA 3G32A 4MBHA 1FSYA 4BL3A 1KGFA 1HD8A 3HLGA 4R3BA 2Y2HA 3SOIA 1L0EA 4E3OA 1KVMA 3ITAA 5F82A 1L0FA 5HAIA 4QHCA 4S2LA 3O87A 4F94A 3N8SA 3S4XA 3G2YA 1BSGA 3IXBA 4ZDXA 3WS0A 4E3JA 1FQGA 3A3EA 3AGDA 4IEDA 4EBNA 2QZ6A 1G68A 1XXMA 3QHYA 1ERMA 1Y54A 3CJMA 1LI0A 3IT9A 1BLPA 4OPRA 4BJPA 5GLDA 4Y0TA 1XGJA 3VP4A 4DRTA 1IEMA 1DY6A 4JF4A 3B3XA 2ZMAA 1YT4A 1KE4A 4WEJA 5FQKA 3M2KA 3V50A 3PTEA 3BEBA 4FD8A 4EBLA 2ZQDA 2WAFA 4HBUA 4UA7A 5I94A 4WZ5C 1ES4A 4Q8IA 5FI2A 1FOFA 2RCXA 2VGKA 4DE1A 1PIOA 3O86A 4OOMA 4X6TA 4A5RA 4JXGA 4C75A 2BLSA 3P09A 5GHYA 2Y2OA 4QJGA 3G31A 1YLPA 2QPNA 1ONHA 3M2JA 4JF5A 4JXSA 4OVDA 4ZBEA 3HLFA 1WE4A 3OPLA 4IBRA 1XA7A 1FR1A 1LLBA 2R9WA 3AGEA 1I2WA 3HLEA 4KENB 1K25A 2H0TA 2H0YA 2HDRA 3Q1FA 2IWBA 3HUOA 1BLHA 4E6XA 3QNBA 4OKPA 3V3SA 1KDSA 4N9KA 1GHPA 3VP1A 5GHXA 4JBFA 2XQZA 5GHZA 3PBOA 2ZC7A 3G30A 4UA9A 1ERQA 2HDQA 3PAEA 4FSFA 4S2KA 3FKWA 4GB7A 2Y2GA 3HUMA 3MXRA 2ZLYA 3WS5A 3ZG5A 3NDEA 4E3NA 1E3UA 3AGFA 4JKTA 4OONA 4R4SA 1ZG6A 4EQIA 4KG6A 3ZHHA 1SDNA 5IHVA 3VOYA 1H8YA 2XF3A 1GCEA 3MZFA 1C3BA 1FCOA 4S2MA 5M1AA 4L0LA 4ID4A 4ZJ3A 4E3IA 4WMCA 1PZOA 4X68A 1NZUA 4LENA 4XUXA 1GHMA 2ZM8A 1K38A 2X01A 4KG2A 3BLSA 1I2SA 3MZEA 2GDNA 2XGNA 3PBTA 4R3JA 2XEPA 4WEKA 4ZJ2A 2ZQ8A 1JTGA 3ISGA 3NI9A 3Q82A 4U0XA 4Y0OA 5HL1A 3UE0A 1SHVA 4N1XA 1JWZA 2X71A 1J9MA 3VMAA 1FSWA 3FZCA 3NIAA 1W79A 4PM9A 5EPHA 1BTLA 4OQIA 5EOOA 3PBSA 4OPQA 1K55A 3WS4A 1YLWA 3WRTA 1H8ZA 3CZDA 3GRJA 5AQ7A 3RXXA 2EX8A 1BUEA 3SH7A 4R1GA 4OOYA 2WKIA 1NRFA 2ZQ7A 2H5SA 4X55A 5E2GA 2OSUA 3HUNA 3NBLA 4LCLA 4WELA 2ZQAA 5FQMA 3QNCA 1K55C 4S2OA 2XK1A 2XLNA 1KGGA 3IWOA 5TR7A 5HX9A 4IVIA 3BFEA 3S22A 1IYQA 5CTNA 2XFSA 2I72A 3Q81A 1ONGA 2Y2MA 2UWXA 2XFTA 3HL9A 2RL3A 1CI9A 3FYZA 4U3TA 3SS3A 1TDGA 1K4FA 2XR0A 1N4OA 3C7UA 3MKFA 1RGYA 4DE3A 3G2ZA 3IH8A 4R23A 2XDMA 3VOZA 2WGWA 5F1FA 3IXGA 1GA9A 4M3KA 4HEFA 1L0DA 3HLWA 1KDWA 2H10A 3OPRA 5CGSA 3A3DA 4KQQA 4N92A 3VP3A 4PM8A 2Q9MA 5FAPA 5CRFA 4KG5A 3UO9A 4WM9A 3FV7A 1K6SA 1YM1A 4ZAMA 3V39A 3IXHA 3Q07A 3GMWA 3UY6A 3DWKA 5E2EA 4S2PA 1L2SA 5AQ9A 3ZG8B 5A92A 1W8YA 4X69A 4BQMA 3GTCA 2JBFA 4WZ5A 2R9XA 3LO7A 4UA6A 2Y2JA 1YQSA 5FAQA 3ZG9B 3DTMA 3WS1A 5A90A 2J8YA 3HLDA 4LV0A 1NZOA 2E8IA 5AQBA 5KSHA 3VSKA 4Y0UA 1KE0A 4HBTA 4MLLA 2XD1A 1ZG4A 3LCEA 1E3UD 2WUQA 2Q9NA 4O7DA 4PM7A 1K6RA 1HTZA 5CGXA 1YLTA 1JWVA 4X53A 1S0WA 4R0QA 5FQ9A 1XP4A 5CXWA 4BL2A 4KZ8A 1WYBA 4PPRA 5M18A 3HBRA 3SS4A 3ZFZA 2EX6A 3ZVWA 4JXWA 1FCMA 3VP2A 5M19A 1ESIA 4WMCD 5DTSA 4GDBA 3UDFA 3BECA 2IWCA 1ES3A 4MEZA 4BLMA 4S2JA 3I7JA 3OC2A 4JF6A 3VP0A 1W7FA 1KVLA 3OCNA 4JXVA 5KSCA 5TFQA 1Q2QA 2ZM0A 3DWZA 4KQOA 3V5MA 5CGWA 1PW8A 2QMIA 2EFXA 1VQQA 2WKHA 3W4OA 5CECA 2V20A 3O3VA 1IYPA 2DCFA 4S2NA 2Y2NA 5CEBA 1L0GA 3TG9A 5EVLA 4BENA 3ITBA 1PI4A 4RVAA 3TOIA 2XH9A 1XX2A 3P98A 1KE3A 5HARA 3SH9A 3ZG7B 3UDXA 5BOHA 5FSRA 1MWSA 1DJBA 2X02A 3M6HA 5EVIA 3PBRA 3IWIA 1YMXA 2WGWB 1M40A 1MWTA 2P9VA 3BFDA 3C4PA 4S2NC 5E2FA 2WZZA 4C3QA 3A3FA 4KZ3A 1DJAA 3LEZA 2PU2A 2G2UA 2VGJA 3GVBA 4OQ0A 5G18A 1ESUA 4IBXA 4P6BA 2WAEA 2HDUA 3MXSA 1PI5A 2V1ZA 5DF8A 3SH8A 3NDGA 4UHUA 3N8RA 5AQAA 5EVIC 4DXBA 3OZHA 4QD4A 1YLZA 3G35A 1SKFA 4OPYA 4YFMA 3BRMA 5HFOA 1PWGA 4WZ4A 3UPPA 4RYEA 1OMEA 2HP6A 5JYOA 1Q2PA 1FR6A 4KZ7A 5F1GA 2ZQCA 4R4RA 2ZC6B 4K0WA 1IYOA 4KZ4A 3SS5A 3E2LA 3HREA 1FCNA 2Y2QA 4NETA 2EX9A 4NK3A 4GKUA 3N4IA 3G34A 2Y2PA 5HW3A 2Y4AA 4LV1A 1BLCA 4KZBA 5F83A 1CI8A 4PM5A 1MXOA 1O7EA 4FH4A 5GL9A 5DTKA 4CJNA 4DXCA 3D4FA 4CPKA 3C7VA 1WYCA 3UE3A 1K57A 4U0TA 5E2HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DF9 A;  3IF6 A;  3N8L A;  4X56 A;  2Z2M B;  2WZX A;  2C6W B;  2DRW A;  1BLS A;  3A3J A;  4KZ5 A;  1RP5 A;  4PMA A;  4P0M A;  5EOE A;  2OV5 A;  1I5Q A;  5E43 A;  4KZ9 A;  4EV4 A;  1LHY A;  4OP5 A;  5FAO A;  3EQV A;  2DNS A;  5CER A;  5GLA A;  4C6Y A;  1SCW A;  4QB8 A;  1W5D A;  3N6I A;  5JYP A;  1YMS A;  1K57 C;  3DW0 A;  4B4Z A;  4QY6 A;  5CTM A;  2A3U A;  4GZB A;  2HDS A;  3IF6 C;  3HLB A;  3WRZ A;  4GDN A;  5CHM A;  1EI5 A;  1XPB A;  2FFF B;  2EXA A;  3EQU A;  3UNW A;  2OLU A;  5D3O A;  4XXR A;  2ZJ9 A;  3UN7 A;  1K56 A;  3MBZ A;  2HP5 A;  1CEG A;  4K91 A;  4OPZ A;  4BD0 A;  4D2O A;  2B5R A;  3JYI A;  3GV9 A;  3Q7V A;  3E2K A;  3W8K A;  4LCM A;  1PWD A;  5EVI B;  3PBN A;  2Y2K A;  5EE8 A;  1ZKJ A;  4PM6 A;  3PAG A;  2P9V B;  1MWR A;  2OLV A;  2ZC4 B;  2ZC3 B;  2P74 A;  3OPH A;  3UPN A;  4B4X A;  4B88 A;  4DE2 A;  2ZC5 B;  5GLB A;  1XA1 A;  5GLC A;  3MFD A;  4RX3 A;  5FAS A;  4DDY A;  2ZQ9 A;  4QU3 A;  1IYS A;  2BG1 A;  4EBP A;  1BT5 A;  1NY0 A;  3VFH A;  4GNU A;  5EVI D;  1IEL A;  1GHI A;  1LL5 A;  3PBQ A;  2JC7 A;  1S6R A;  4OLD A;  4GN2 A;  1KGE A;  2J9P A;  1TVF A;  2CC1 A;  4EUZ A;  1PW1 A;  1HVB A;  3LY4 A;  1PWC A;  1NYM A;  2Y55 A;  3WWX A;  1HZO A;  1GA0 A;  4MBK A;  4ZTK A;  1Z6F A;  3VSL A;  3ZCZ A;  1E25 A;  5CED A;  1JTD A;  5A91 A;  4DKI A;  3FWL A;  3BFG A;  5EUA A;  3CMZ A;  1NYY A;  2WK0 A;  1ES5 A;  3ZG0 A;  2G2W A;  3IHB A;  4BD1 A;  1MWU A;  3G4P A;  4H8R A;  2ZD8 A;  1E4D A;  3BM6 A;  4MBF A;  3GQZ A;  3IF6 B;  2WAD A;  5HAP A;  3IQA A;  2HP9 A;  4Y7P A;  5U47 A;  3MZD A;  1YLY A;  3NC8 A;  5FAT A;  5DTT A;  3CG5 A;  4GD8 A;  1RGZ A;  5A93 A;  5FI7 A;  4N9L A;  1MPL A;  3A3I A;  4YIN A;  4ZJ1 A;  3HVF A;  4DDS A;  1ES2 A;  2JCH A;  2XD5 A;  3UDI A;  3GR2 A;  3IHA A;  4JLF A;  4QY5 A;  2WGI A;  1IKI A;  3MKE A;  2IWD A;  2PBY A;  3TSG A;  3C5A A;  4GD6 A;  1QMF A;  4E3K A;  4KZ6 A;  3VFF A;  4IVK A;  4WBG A;  3W4Q A;  3LY3 A;  1ERO A;  3RJU A;  1DJC A;  1VM1 A;  5FA7 A;  2HPB A;  5EEC A;  1PYY A;  4E3M A;  4MNR A;  4OQG A;  3IH9 A;  4WYY A;  5FQI A;  5HAQ A;  3NCK A;  4KZA A;  3FKV A;  3Q7V B;  2EXB A;  1JWP A;  3GSG A;  2J7V A;  2ZM2 A;  5DF7 A;  5L2F A;  5FI6 A;  2C5W B;  3ZGA B;  1MKI A;  2Y2I A;  3Q7Z A;  5KZH A;  4S2I A;  1MY8 A;  1CK3 A;  1K56 D;  3IWQ A;  3UE1 A;  5CHU A;  2J9O A;  4E6W A;  1RCJ A;  2JE5 A;  1TDL A;  1K54 A;  1O07 A;  1ZC2 A;  5DVA A;  5FQJ A;  4GOG A;  3O88 A;  2Y59 A;  1U60 A;  1G6A A;  2EX2 A;  5CHJ A;  1QME A;  5FQQ A;  4LV2 A;  1LI9 A;  4DE0 A;  1LL9 A;  1SDE A;  2V2F F;  3UPO A;  1K4E A;  1CEF A;  2WKE A;  1IKG A;  2EFU A;  1BUL A;  2FFY A;  3WS2 A;  4FCF A;  3IF5 A;  1PZP A;  1K54 C;  4HES A;  1EWZ A;  1YLJ A;  1W8Q A;  4LV3 A;  3IXD A;  4XUZ A;  3ZVT A;  4E3L A;  4UAA A;  4RX2 A;  3OPP A;  3BFF A;  3W4P A;  5KMW A;  5FDH A;  4P85 A;  4RA7 A;  3NY4 A;  3HLC A;  1NXY A;  3BYD A;  4OQH A;  1AXB A;  4OLG A;  1N9B A;  3OCL A;  4N1H A;  3V3R A;  1BZA A;  1ALQ A;  5J8X A;  2Z2L B;  5TGF A;  1M6K A;  2Y2L A;  3BLM A;  4DF6 A;  4K0X A;  4Z9Q A;  2WYX A;  4P87 A;  2PU4 A;  3ZDJ A;  4OP8 A;  3S1Y A;  1XKZ A;  2Y91 A;  1H5X A;  4KQR A;  3RXW A;  1MBL A;  4FH2 A;  4OOL A;  1JVJ A;  2A49 A;  1TEM A;  4JPM A;  2WGV A;  3ZNT A;  4OH0 A;  3ZNY A;  4EWF A;  3BFC A;  3N7W A;  3M6B A;  3C4O A;  1NJ4 A;  1XGI A;  3G32 A;  4MBH A;  1FSY A;  4BL3 A;  1KGF A;  1HD8 A;  3HLG A;  4R3B A;  2Y2H A;  3SOI A;  1L0E A;  4E3O A;  1KVM A;  3ITA A;  5F82 A;  1L0F A;  5HAI A;  4QHC A;  4S2L A;  3O87 A;  4F94 A;  3N8S A;  3S4X A;  3G2Y A;  1BSG A;  3IXB A;  4ZDX A;  3WS0 A;  4E3J A;  1FQG A;  3A3E A;  3AGD A;  4IED A;  4EBN A;  2QZ6 A;  1G68 A;  1XXM A;  3QHY A;  1ERM A;  1Y54 A;  3CJM A;  1LI0 A;  3IT9 A;  1BLP A;  4OPR A;  4BJP A;  5GLD A;  4Y0T A;  1XGJ A;  3VP4 A;  4DRT A;  1IEM A;  1DY6 A;  4JF4 A;  3B3X A;  2ZMA A;  1YT4 A;  1KE4 A;  4WEJ A;  5FQK A;  3M2K A;  3V50 A;  3PTE A;  3BEB A;  4FD8 A;  4EBL A;  2ZQD A;  2WAF A;  4HBU A;  4UA7 A;  5I94 A;  4WZ5 C;  1ES4 A;  4Q8I A;  5FI2 A;  1FOF A;  2RCX A;  2VGK A;  4DE1 A;  1PIO A;  3O86 A;  4OOM A;  4X6T A;  4A5R A;  4JXG A;  4C75 A;  2BLS A;  3P09 A;  5GHY A;  2Y2O A;  4QJG A;  3G31 A;  1YLP A;  2QPN A;  1ONH A;  3M2J A;  4JF5 A;  4JXS A;  4OVD A;  4ZBE A;  3HLF A;  1WE4 A;  3OPL A;  4IBR A;  1XA7 A;  1FR1 A;  1LLB A;  2R9W A;  3AGE A;  1I2W A;  3HLE A;  4KEN B;  1K25 A;  2H0T A;  2H0Y A;  2HDR A;  3Q1F A;  2IWB A;  3HUO A;  1BLH A;  4E6X A;  3QNB A;  4OKP A;  3V3S A;  1KDS A;  4N9K A;  1GHP A;  3VP1 A;  5GHX A;  4JBF A;  2XQZ A;  5GHZ A;  3PBO A;  2ZC7 A;  3G30 A;  4UA9 A;  1ERQ A;  2HDQ A;  3PAE A;  4FSF A;  4S2K A;  3FKW A;  4GB7 A;  2Y2G A;  3HUM A;  3MXR A;  2ZLY A;  3WS5 A;  3ZG5 A;  3NDE A;  4E3N A;  1E3U A;  3AGF A;  4JKT A;  4OON A;  4R4S A;  1ZG6 A;  4EQI A;  4KG6 A;  3ZHH A;  1SDN A;  5IHV A;  3VOY A;  1H8Y A;  2XF3 A;  1GCE A;  3MZF A;  1C3B A;  1FCO A;  4S2M A;  5M1A A;  4L0L A;  4ID4 A;  4ZJ3 A;  4E3I A;  4WMC A;  1PZO A;  4X68 A;  1NZU A;  4LEN A;  4XUX A;  1GHM A;  2ZM8 A;  1K38 A;  2X01 A;  4KG2 A;  3BLS A;  1I2S A;  3MZE A;  2GDN A;  2XGN A;  3PBT A;  4R3J A;  2XEP A;  4WEK A;  4ZJ2 A;  2ZQ8 A;  1JTG A;  3ISG A;  3NI9 A;  3Q82 A;  4U0X A;  4Y0O A;  5HL1 A;  3UE0 A;  1SHV A;  4N1X A;  1JWZ A;  2X71 A;  1J9M A;  3VMA A;  1FSW A;  3FZC A;  3NIA A;  1W79 A;  4PM9 A;  5EPH A;  1BTL A;  4OQI A;  5EOO A;  3PBS A;  4OPQ A;  1K55 A;  3WS4 A;  1YLW A;  3WRT A;  1H8Z A;  3CZD A;  3GRJ A;  5AQ7 A;  3RXX A;  2EX8 A;  1BUE A;  3SH7 A;  4R1G A;  4OOY A;  2WKI A;  1NRF A;  2ZQ7 A;  2H5S A;  4X55 A;  5E2G A;  2OSU A;  3HUN A;  3NBL A;  4LCL A;  4WEL A;  2ZQA A;  5FQM A;  3QNC A;  1K55 C;  4S2O A;  2XK1 A;  2XLN A;  1KGG A;  3IWO A;  5TR7 A;  5HX9 A;  4IVI A;  3BFE A;  3S22 A;  1IYQ A;  5CTN A;  2XFS A;  2I72 A;  3Q81 A;  1ONG A;  2Y2M A;  2UWX A;  2XFT A;  3HL9 A;  2RL3 A;  1CI9 A;  3FYZ A;  4U3T A;  3SS3 A;  1TDG A;  1K4F A;  2XR0 A;  1N4O A;  3C7U A;  3MKF A;  1RGY A;  4DE3 A;  3G2Z A;  3IH8 A;  4R23 A;  2XDM A;  3VOZ A;  2WGW A;  5F1F A;  3IXG A;  1GA9 A;  4M3K A;  4HEF A;  1L0D A;  3HLW A;  1KDW A;  2H10 A;  3OPR A;  5CGS A;  3A3D A;  4KQQ A;  4N92 A;  3VP3 A;  4PM8 A;  2Q9M A;  5FAP A;  5CRF A;  4KG5 A;  3UO9 A;  4WM9 A;  3FV7 A;  1K6S A;  1YM1 A;  4ZAM A;  3V39 A;  3IXH A;  3Q07 A;  3GMW A;  3UY6 A;  3DWK A;  5E2E A;  4S2P A;  1L2S A;  5AQ9 A;  3ZG8 B;  5A92 A;  1W8Y A;  4X69 A;  4BQM A;  3GTC A;  2JBF A;  4WZ5 A;  2R9X A;  3LO7 A;  4UA6 A;  2Y2J A;  1YQS A;  5FAQ A;  3ZG9 B;  3DTM A;  3WS1 A;  5A90 A;  2J8Y A;  3HLD A;  4LV0 A;  1NZO A;  2E8I A;  5AQB A;  5KSH A;  3VSK A;  4Y0U A;  1KE0 A;  4HBT A;  4MLL A;  2XD1 A;  1ZG4 A;  3LCE A;  1E3U D;  2WUQ A;  2Q9N A;  4O7D A;  4PM7 A;  1K6R A;  1HTZ A;  5CGX A;  1YLT A;  1JWV A;  4X53 A;  1S0W A;  4R0Q A;  5FQ9 A;  1XP4 A;  5CXW A;  4BL2 A;  4KZ8 A;  1WYB A;  4PPR A;  5M18 A;  3HBR A;  3SS4 A;  3ZFZ A;  2EX6 A;  3ZVW A;  4JXW A;  1FCM A;  3VP2 A;  5M19 A;  1ESI A;  4WMC D;  5DTS A;  4GDB A;  3UDF A;  3BEC A;  2IWC A;  1ES3 A;  4MEZ A;  4BLM A;  4S2J A;  3I7J A;  3OC2 A;  4JF6 A;  3VP0 A;  1W7F A;  1KVL A;  3OCN A;  4JXV A;  5KSC A;  5TFQ A;  1Q2Q A;  2ZM0 A;  3DWZ A;  4KQO A;  3V5M A;  5CGW A;  1PW8 A;  2QMI A;  2EFX A;  1VQQ A;  2WKH A;  3W4O A;  5CEC A;  2V20 A;  3O3V A;  1IYP A;  2DCF A;  4S2N A;  2Y2N A;  5CEB A;  1L0G A;  3TG9 A;  5EVL A;  4BEN A;  3ITB A;  1PI4 A;  4RVA A;  3TOI A;  2XH9 A;  1XX2 A;  3P98 A;  1KE3 A;  5HAR A;  3SH9 A;  3ZG7 B;  3UDX A;  5BOH A;  5FSR A;  1MWS A;  1DJB A;  2X02 A;  3M6H A;  5EVI A;  3PBR A;  3IWI A;  1YMX A;  2WGW B;  1M40 A;  1MWT A;  2P9V A;  3BFD A;  3C4P A;  4S2N C;  5E2F A;  2WZZ A;  4C3Q A;  3A3F A;  4KZ3 A;  1DJA A;  3LEZ A;  2PU2 A;  2G2U A;  2VGJ A;  3GVB A;  4OQ0 A;  5G18 A;  1ESU A;  4IBX A;  4P6B A;  2WAE A;  2HDU A;  3MXS A;  1PI5 A;  2V1Z A;  5DF8 A;  3SH8 A;  3NDG A;  4UHU A;  3N8R A;  5AQA A;  5EVI C;  4DXB A;  3OZH A;  4QD4 A;  1YLZ A;  3G35 A;  1SKF A;  4OPY A;  4YFM A;  3BRM A;  5HFO A;  1PWG A;  4WZ4 A;  3UPP A;  4RYE A;  1OME A;  2HP6 A;  5JYO A;  1Q2P A;  1FR6 A;  4KZ7 A;  5F1G A;  2ZQC A;  4R4R A;  2ZC6 B;  4K0W A;  1IYO A;  4KZ4 A;  3SS5 A;  3E2L A;  3HRE A;  1FCN A;  2Y2Q A;  4NET A;  2EX9 A;  4NK3 A;  4GKU A;  3N4I A;  3G34 A;  2Y2P A;  5HW3 A;  2Y4A A;  4LV1 A;  1BLC A;  4KZB A;  5F83 A;  1CI8 A;  4PM5 A;  1MXO A;  1O7E A;  4FH4 A;  5GL9 A;  5DTK A;  4CJN A;  4DXC A;  3D4F A;  4CPK A;  3C7V A;  1WYC A;  3UE3 A;  1K57 A;  4U0T A;  5E2H A; 
#chains in the Genus database with same CATH topology
 3LR3 A;  4BMW A;  2DRW A;  3A3J A;  4KZ5 A;  2XRO A;  2OV5 A;  1I5Q A;  4KZ9 A;  4OP5 A;  5FAO A;  3EQV A;  5AVE A;  2DNS A;  1SCW A;  2A24 B;  1W5D A;  5JYP A;  1YMS A;  3DW0 A;  4O8G A;  2A3U A;  4RQ9 A;  2QYB A;  5CHM A;  3JVV A;  4DJ2 A;  3H82 A;  2W1T A;  4XXR A;  2ZJ9 A;  1S4S A;  1FIL A;  2HP5 A;  2W27 A;  1CEG A;  4R70 A;  4EES A;  3JYI A;  2VKS A;  2ZL1 B;  3MQO A;  2JKT M;  3UPN A;  2ZC4 B;  3HJK A;  2W3F A;  5GLB A;  1XA1 A;  3T1R A;  4HP4 A;  3UB6 A;  4RX3 A;  1Y4O A;  2BTF P;  4EBP A;  1NY0 A;  4EU0 A;  4GNU A;  1IEL A;  3RFB A;  2PD7 A;  1LL5 A;  4OLD A;  1S6R A;  4GN2 A;  3LY4 A;  1NYM A;  3WWX A;  2K7S A;  1JNU A;  1Z6F A;  4NKP A;  5A91 A;  1OJG A;  3FWL A;  5EUA A;  5DJT A;  4H8R A;  4BWI A;  4GCZ A;  2DMW A;  3GQZ A;  3IF6 B;  2WAD A;  1YPR A;  4Y7P A;  3CG5 A;  4WF0 A;  5HSQ A;  4MDZ A;  4YIN A;  4YNR A;  3UDI A;  1DP8 A;  2V8F A;  2GNX A;  2WGI A;  5FDS A;  3TSG A;  4KZ6 A;  3W4Q A;  3LY3 A;  1SKO B;  1DJC A;  2JKR I;  3TW8 A;  3P01 A;  3PR6 A;  5HAQ A;  5G4Z A;  3Q7V B;  2ZM2 A;  2C5W B;  3ZGA B;  2Q0O A;  5KZH A;  5IS1 A;  4S2I A;  4ETZ A;  2J9O A;  1RCJ A;  1UGU A;  3O88 A;  1U60 A;  1G6A A;  5CHJ A;  4LV2 A;  4JGO A;  1SDE A;  4NG2 A;  2EFU A;  1EW0 A;  3WS2 A;  2PRF A;  1PZP A;  1PRQ A;  1K54 C;  4HES A;  4E3L A;  3IXD A;  5TBM B;  3OPP A;  3U4L P;  4XT2 B;  4RA7 A;  3NY4 A;  3HLC A;  3KSF A;  4OQH A;  1OT6 A;  2WKQ A;  4Z9Q A;  4P87 A;  1IOU A;  1H5X A;  3RXW A;  5J7E A;  4FH2 A;  4OOL A;  2CMN A;  4JPM A;  2WGV A;  3L7H A;  2KLI A;  3N7W A;  3LGO A;  3P7N A;  1STZ A;  3C4O A;  1XGI A;  4NXG A;  4MBH A;  1FSY A;  1KGF A;  1HD8 A;  1XJ6 A;  4R3B A;  1L0E A;  5F82 A;  4X1L A;  3CAX A;  1VB6 A;  4E3J A;  2QZ6 A;  2VGL S;  3CJM A;  2FZ0 A;  1LI0 A;  1BLP A;  4F3L B;  1XGJ A;  3VP4 A;  1LSV A;  1IEM A;  1DY6 A;  2NUP C;  4JF4 A;  3B3X A;  1KE4 A;  1TS0 A;  4D60 A;  5FQK A;  4HBU A;  4WZ5 C;  3LIF A;  1ES4 A;  2RCX A;  3O86 A;  4JXG A;  4QJG A;  3G31 A;  3M2J A;  1XJ4 A;  3VE3 A;  5A8B A;  5G4Y A;  1XA7 A;  4KEN B;  3Q1F A;  2H0Y A;  3QNB A;  2G7U A;  1PNE A;  3T50 A;  5GHX A;  1D7E A;  5MC7 A;  2ZOH A;  4UA9 A;  2HDQ A;  3MMH A;  3FKW A;  4EET B;  4EXO A;  2ZLY A;  3ZG5 A;  1E3U A;  4H6J B;  4R4S A;  4KG6 A;  5IHV A;  1C3B A;  1N9L A;  4ZJ3 A;  2JHE A;  3BLS A;  1I2S A;  2PBD P;  3PBT A;  2GDN A;  2YKH A;  3Q82 A;  1SHV A;  4N1X A;  1JWZ A;  2OAQ 1;  2X71 A;  4CQH A;  4OPQ A;  3CZD A;  3LUQ A;  3RXX A;  2JKG A;  2D01 A;  4R1G A;  2WKI A;  5HWT A;  1NRF A;  4LCL A;  1K55 C;  2XK1 A;  2XLN A;  4IVI A;  2V1B A;  1S66 L;  2M1C A;  3Q81 A;  1ONG A;  2Y2M A;  2XFT A;  4CLC B;  2RL3 A;  3FYZ A;  1K4F A;  2XR0 A;  3VOZ A;  2WGW A;  5HWW A;  3IXG A;  1GA9 A;  4M3K A;  3LR4 A;  2PR6 A;  3VOL A;  2EWV A;  1G6O A;  3DTK A;  4N92 A;  5CRF A;  2R78 A;  3UO9 A;  1DRM A;  4O0P A;  2QKP A;  3E4O A;  5HPI A;  3DWK A;  5E2E A;  1L2S A;  5AQ9 A;  3LIE A;  1W8Y A;  2XA7 S;  5L09 A;  1W63 M;  2R9X A;  2A2L A;  3LO7 A;  5FAQ A;  3ZG9 B;  3O5Y A;  4LV0 A;  5AQB A;  4GHI A;  2XD1 A;  1ZTU A;  3LCE A;  4O7D A;  1K6R A;  3E0Y A;  1YLT A;  4I5S A;  4HI4 A;  1XP4 A;  3QP8 A;  1WYB A;  5M18 A;  2EX6 A;  4MCW A;  4JXW A;  3VP2 A;  4WMC D;  5L8M A;  2A24 A;  3T1Q B;  2L1M A;  4JF6 A;  1W7F A;  1KVL A;  1Q2Q A;  1MC0 A;  3JVU A;  3NOP C;  3DWZ A;  5CGW A;  1PW8 A;  2QMI A;  1VQQ A;  3LYX A;  4R6L A;  1L0G A;  4BEN A;  4EEU A;  3CPT B;  3A0S A;  3P98 A;  3ZG7 B;  5BOH A;  1MWS A;  3KO6 A;  2X02 A;  1ZHH B;  4G3K A;  2ZL1 A;  2GX5 A;  3UB9 A;  3H7W B;  1M40 A;  1DJA A;  4IBX A;  2WAE A;  2HDU A;  1PI5 A;  5EVI C;  5F5Y A;  3DAV A;  4QD4 A;  3BRM A;  5HFO A;  1PWG A;  3UPP A;  4RYE A;  4Q0I A;  2ZC6 B;  1SZV A;  3NOT C;  2PD8 A;  3SS5 A;  3HRE A;  1V9Y A;  4NK3 A;  4GKU A;  2Y4A A;  4LV1 A;  5F83 A;  1CI8 A;  4FH4 A;  3D4F A;  4DMZ A;  2VV7 A;  4U0T A;  1T1A A;  2QWS A;  3IF6 A;  4GS9 B;  3R7W B;  2WZX A;  1BLS A;  4PAU A;  4PMA A;  4P0M A;  2UV0 E;  5E43 A;  4EV4 A;  3BQA A;  1LHY A;  1K57 C;  1OJ5 A;  1OTD A;  4QY6 A;  4GDN A;  1EI5 A;  2VA0 A;  2EXA A;  1SKO A;  3KYQ A;  2J80 A;  2WKP A;  4BD0 A;  4D2O A;  2VV8 A;  3GV9 A;  3Q7V A;  3E2K A;  4LCM A;  2E8J A;  3PBN A;  2P74 A;  3BW6 A;  4B4X A;  4B88 A;  5GLC A;  5FAS A;  3LFV A;  5F69 A;  3VFH A;  5HDS A;  5EVI D;  2KX6 A;  4YOF A;  2B02 A;  2J9P A;  1F9I A;  3E4P A;  1PWC A;  5TBM A;  3TE8 A;  4CLC E;  4XT2 A;  3VSL A;  1E25 A;  4DN0 A;  4DKI A;  3BFG A;  3SW1 A;  2AVX A;  3CMZ A;  2WK0 A;  3IHB A;  5CX7 A;  3G4P A;  4BBV A;  3BM6 A;  1P9W A;  3T4L A;  4NXF A;  5FI7 A;  5HPF A;  2VEA A;  4DDS A;  4HIA A;  3GR2 A;  2M7V A;  4JLF A;  3V67 A;  4GD6 A;  4IVK A;  2K31 A;  5AJG A;  4Y13 A;  3T1S A;  1S1Y A;  5EEC A;  1PYY A;  1JWP A;  4F3L A;  4LPZ A;  3BY9 A;  5DF7 A;  3LI8 A;  3T1X A;  1MKI A;  1NRJ A;  2Y2I A;  1MY8 A;  1K56 D;  3IWQ A;  5CHU A;  4E6W A;  2JE5 A;  5DVA A;  4GOG A;  4P6Z S;  2EX2 A;  4HOI A;  1QME A;  5FQQ A;  1NLZ A;  2P04 A;  3QP1 A;  2WKE A;  4FCF A;  3IF5 A;  1YKD A;  1YLJ A;  1W8Q A;  4XUZ A;  3ZVT A;  2VK3 A;  3R4K A;  5KMW A;  1NXY A;  3BYD A;  1N9B A;  4HJ3 A;  4HP9 A;  3T4J A;  1ALQ A;  2Z2L B;  4MN5 A;  2L0W A;  4H6J A;  2Y2L A;  4DF6 A;  4K0X A;  2WYX A;  3ZDJ A;  2Y91 A;  2OOL A;  3LEQ A;  4NXE A;  1MBL A;  2ZOI A;  4FTX A;  3ZNT A;  3BFC A;  3G32 A;  4BL3 A;  3SOI A;  1KVM A;  1P9R A;  1L0F A;  4QHC A;  4S2L A;  1GSW A;  4F94 A;  3N8S A;  3NJA A;  3IT9 A;  5GLD A;  4MN6 A;  2PHY A;  4LFU A;  3MFX A;  4CLC A;  2ZQD A;  2VGK A;  2VX8 A;  3JPU A;  4A5R A;  4C75 A;  2BLS A;  5GHY A;  1YLP A;  4WUJ A;  4JF5 A;  4ZBE A;  3HLF A;  2H0T A;  2HDR A;  4E6X A;  1BLH A;  2ACG A;  3NHQ A;  4JBF A;  5GHZ A;  2ZC7 A;  3G30 A;  1ERQ A;  4R38 A;  4GB7 A;  1TS6 A;  3WS5 A;  2WKR A;  1P97 A;  3NDE A;  2W3H A;  4JKT A;  4EQI A;  5F6A A;  1GCE A;  2O9C A;  3K3D A;  1FCO A;  4S2M A;  5M1A A;  1L3L A;  3LR5 A;  1NLY A;  4E3I A;  4X68 A;  2ZMF A;  4LEN A;  1GHM A;  2X01 A;  5IT5 A;  5IU1 A;  1JTG A;  4U0X A;  5HL6 A;  1J9M A;  1BTL A;  2VGL M;  5EOO A;  4HH2 A;  4ME4 A;  1H8Z A;  2M7U A;  3GRJ A;  5AQ7 A;  1F2K A;  3SH7 A;  5J3W A;  4OOY A;  5E2G A;  4UEY A;  4WEL A;  4S2O A;  1KGG A;  3IWO A;  5HX9 A;  3BFE A;  5CTN A;  2PYP A;  2XFS A;  2I72 A;  4X25 A;  3CPT A;  3HL9 A;  1CI9 A;  2P08 A;  1VET B;  3C7U A;  5L07 A;  3H7W A;  4HEF A;  3C38 A;  2QJ5 A;  1L0D A;  2D02 A;  1T18 A;  1LSW A;  4KQQ A;  3VP3 A;  3C8C A;  5FAP A;  2ZBB A;  1K6S A;  1YM1 A;  4ZAM A;  3V39 A;  4NXB A;  1TS8 A;  3Q07 A;  4IUK A;  5LBR A;  1GSV A;  3CIT A;  1TF1 A;  1XJ2 A;  4BQM A;  3E98 A;  2O0Y A;  1MKM A;  2Z6D A;  4UA6 A;  2Y2J A;  1VEU B;  1OPX A;  3WS1 A;  2J8Y A;  5KSH A;  1YAX A;  4Y0U A;  5CGX A;  4KQD A;  4HBT A;  1ZG4 A;  3UE6 A;  5J4E A;  4GLQ A;  5FQ9 A;  4GS9 A;  5CXW A;  3R7W A;  2I9V A;  2B95 A;  4PPR A;  3LR0 A;  1OTI A;  4UQI S;  4GDB A;  1T1C A;  3DBA A;  3UB8 A;  3UDF A;  3BEC A;  2IWC A;  3T4S A;  3MQQ A;  3OLO A;  3OC2 A;  3VP0 A;  4EUV A;  2ZM0 A;  4II7 A;  3V5M A;  2V0W A;  2WKH A;  5CEC A;  1IYP A;  2VZW A;  2Y2N A;  1PFL A;  1Y28 A;  4HHD A;  3KSG A;  2XH9 A;  1XX2 A;  1KE3 A;  3F1P B;  3UDX A;  1DJB A;  3M6H A;  3D3O A;  3PBR A;  3IWI A;  1YMX A;  3T12 B;  2GZA A;  4S2N C;  2WZZ A;  1OTB A;  3FPW A;  3LEZ A;  2PU2 A;  1GSX A;  4OQ0 A;  5G18 A;  3CHW P;  1J3W A;  2V1Z A;  2XA7 M;  3N8R A;  3OZH A;  3G35 A;  3MS6 A;  2QJ7 A;  4WZ4 A;  5JYO A;  1OME A;  2HP6 A;  4JGQ A;  1Q2P A;  4KZ7 A;  3E4Q A;  4KZ4 A;  4MN7 A;  3CUE C;  4NET A;  5HW3 A;  1BLC A;  1MXO A;  5EFW A;  3C30 A;  3C7V A;  5E2H A;  5DF9 A;  4X56 A;  2Z2M B;  2C6W B;  1H3Q A;  1RP5 A;  2O9A A;  1W63 Q;  5EOE A;  3A0V A;  4C6Y A;  4QB8 A;  3K2N A;  4B4Z A;  4O01 A;  4GZB A;  5EVE A;  2Y8H A;  3WRZ A;  4MMN A;  2FFF B;  3UNW A;  3EQU A;  4Y2F A;  3UN7 A;  2HGV A;  2QHK A;  1P0Z A;  1N9N A;  2B5R A;  2L4R A;  2PAV P;  3W8K A;  2YKF A;  1PWD A;  5EVI B;  3UB5 P;  2Y2K A;  5EE8 A;  4LLO B;  3PAG A;  1MWR A;  2ZC3 B;  4DE2 A;  2HZ5 A;  2BAS A;  2ZQ9 A;  4QU3 A;  2LB9 A;  1GHI A;  1YSP A;  3PBQ A;  2JC7 A;  1T1B A;  4PKY G;  1KGE A;  1TVF A;  2CC1 A;  2PDR A;  4Y3I A;  1GA0 A;  3L9K A;  4EQ1 A;  4ZTK A;  3ZCZ A;  2O9B A;  5FL3 A;  1T19 A;  2FH5 A;  1ES5 A;  3ZG0 A;  4BD1 A;  2ZD8 A;  1E4D A;  3MF0 A;  5HAP A;  2HP9 A;  3NC8 A;  1RGZ A;  3A3I A;  4ZJ1 A;  2JKF A;  3HVF A;  2JCH A;  3IHA A;  1IKI A;  3MKE A;  2IWD A;  2PBY A;  1H8M A;  3U2A A;  1QMF A;  1WA9 A;  3VFF A;  5TJJ A;  3EGD C;  4WBG A;  3T4Q A;  2K2N A;  2W3D A;  1ERO A;  4E04 A;  1VM1 A;  3B47 A;  5FA7 A;  2HPB A;  1NWZ A;  4E3M A;  4MNR A;  3S7O A;  5FQI A;  1DP9 A;  4I3I A;  5EV0 A;  4KZA A;  1DP6 A;  3FKV A;  2EXB A;  2HF6 A;  2J7V A;  5L2F A;  3PHY A;  3Q7Z A;  4WN5 A;  3UE1 A;  1K54 A;  1O07 A;  1ZC2 A;  3S7P A;  2Y59 A;  4LRZ E;  1H0M A;  1LI9 A;  4DE0 A;  1LL9 A;  2V2F F;  1K4E A;  1IKG A;  1BUL A;  2FFY A;  1EWZ A;  4LV3 A;  3ULF A;  4PKY A;  4RX2 A;  3BFF A;  5FDH A;  3OCL A;  4K08 A;  4FUW A;  4N1H A;  1BZA A;  3V3R A;  5J8X A;  3CI6 A;  1M6K A;  2INW A;  1YSQ A;  4WLA A;  4OP8 A;  3S1Y A;  3IBJ A;  4KQR A;  3CLO A;  1TEM A;  3DTE A;  4OH0 A;  3M6B A;  1NJ4 A;  1OTA A;  4Q0H A;  2Y2H A;  4E3O A;  5DKK A;  5HAI A;  3S4X A;  1BSG A;  3IXB A;  5EM1 A;  4EEP A;  3T4K A;  3FPV A;  3QHY A;  1G68 A;  1XXM A;  2ZMV A;  1ERM A;  1Y54 A;  4JGR A;  4OPR A;  3F1N B;  3IBR A;  2V1A A;  4ARZ B;  4UA7 A;  1VET A;  5FI2 A;  4Q8I A;  1FOF A;  4DE1 A;  1PIO A;  4X6T A;  3P09 A;  2Y2O A;  2QPN A;  4JXS A;  3KSH A;  3B33 A;  1WE4 A;  5I5L A;  3AGE A;  1LLB A;  2R9W A;  1I2W A;  1K25 A;  2IWB A;  3HUO A;  4IHQ A;  4OKP A;  1KDS A;  3VP1 A;  1GHP A;  3PBO A;  3PAE A;  4FSF A;  2H28 A;  2LB5 A;  4E3N A;  3EEA A;  3AGF A;  1ZG6 A;  3ZHH A;  1SDN A;  1H8Y A;  2XF3 A;  3CWF A;  3MZF A;  5FEF A;  1LL8 A;  4JGP A;  1VEU A;  1G28 A;  4WMC A;  1PZO A;  2ZM8 A;  1K38 A;  2XRN A;  4WEK A;  2XGN A;  4R3J A;  2JN7 A;  2XEP A;  4ZJ2 A;  2ZQ8 A;  3ISG A;  3MR0 A;  4Y0O A;  3UE0 A;  3VMA A;  3W2Z A;  1FSW A;  3FZC A;  5EPH A;  5DKL A;  4OQI A;  3PBS A;  3BY8 A;  1K55 A;  3WS4 A;  2JKR M;  1BUE A;  4KUK A;  4Y15 A;  2ZQ7 A;  3NBL A;  2PYR A;  1IYQ A;  5HD3 A;  3MXQ A;  3H9W A;  3FC7 A;  4LRY C;  1X0O A;  3F1P A;  4U3T A;  3SS3 A;  4DE3 A;  1N4O A;  1RGY A;  3G2Z A;  3IH8 A;  2XDM A;  5F1F A;  3HLW A;  3KSI A;  2GJ3 A;  3GMW A;  3IX4 A;  1Z09 A;  3UY6 A;  4S2P A;  5HDD A;  5A92 A;  3MJQ A;  4X69 A;  4ESP A;  3GTC A;  5HD5 A;  2JBF A;  3DTM A;  5HWV A;  5A90 A;  3HLD A;  1NZO A;  4WL9 A;  4MLL A;  1S4R A;  1E3U D;  2WUQ A;  2Q9N A;  4L9E A;  1HTZ A;  4X53 A;  1JWV A;  1S0W A;  4BL2 A;  2HV1 A;  5AVF A;  1S67 L;  3ZVW A;  1FCM A;  1ESI A;  4MEZ A;  4BLM A;  5KSC A;  3DTI A;  3W4O A;  2V20 A;  3O3V A;  4I3J A;  1ACF A;  4Q0J A;  2DCF A;  3ITB A;  3TOI A;  5EM0 A;  5FSR A;  5EVI A;  1S1Z A;  4C3Q A;  2Z6C A;  5E2F A;  3A3F A;  4KZ3 A;  3GEC A;  5HZH A;  2G2U A;  2VGJ A;  3LID A;  3MXS A;  1D06 A;  3BQ8 A;  3NDG A;  4UHU A;  5AQA A;  4DXB A;  3IS2 B;  1YLZ A;  4GJ4 A;  2HJ9 C;  3LI9 A;  4HH3 A;  4OPY A;  4YFM A;  3BWL A;  3PXP A;  1FR6 A;  5F1G A;  2J3W A;  1IYO A;  1FCN A;  1TD5 A;  4I3A A;  2EX9 A;  1XFN A;  2Y2P A;  4DJ3 A;  3NEC A;  4KZB A;  4PM5 A;  4UQI M;  5GL9 A;  1WYC A;  3UE3 A;  1K57 A;  2EA9 A;  3N8L A;  3BJN A;  4AFI A;  3LIA A;  4EER A;  2JKT I;  4B93 A;  5CER A;  5GLA A;  3N6I A;  1XJ3 A;  3MSH A;  5CTM A;  3PYP A;  3MQ0 A;  2HDS A;  3IF6 C;  3HLB A;  1ODV A;  1XPB A;  3VE4 A;  2OLU A;  5D3O A;  1D1J A;  1K56 A;  3MBZ A;  4LRX C;  5HDC A;  2EWW A;  4K91 A;  3K3C A;  4OPZ A;  3QP2 A;  2VLG A;  3KYE A;  1ZKJ A;  4PM6 A;  2P9V B;  2OLV A;  3OPH A;  2ZC5 B;  4B9O A;  3MFD A;  4L9F A;  4DDY A;  1UWN X;  1IYS A;  2BG1 A;  1BT5 A;  1HLU P;  3F1O B;  3TJZ C;  3EOI A;  2XSS A;  4EUZ A;  1PW1 A;  1HVB A;  2Y55 A;  1HZO A;  3D72 A;  4MBK A;  2P7J A;  4HNB A;  3UB7 A;  5CED A;  1JTD A;  4M4X A;  3OOV A;  2KOI A;  1NYY A;  2G2W A;  2OWH A;  1MWU A;  4MBF A;  4HQA A;  3IQA A;  4IUH A;  4ZRR A;  3HJI A;  5U47 A;  4YWZ A;  3MZD A;  1YLY A;  5FAT A;  5DTT A;  4GD8 A;  5A93 A;  4I39 A;  4N9L A;  1MPL A;  1ES2 A;  2XD5 A;  4QY5 A;  3C5A A;  4E3K A;  3H82 B;  2W1T B;  3RJU A;  3NUL A;  3EWK A;  4OQG A;  3G6O A;  3IH9 A;  4WYY A;  3NCK A;  3GSG A;  4HJ6 A;  3QP6 A;  3A0R A;  3F1N A;  5FI6 A;  4QPR A;  1CK3 A;  2KDK A;  5C5K A;  1TDL A;  4ARZ A;  1MZU A;  4BBT A;  4Y17 A;  5FQJ A;  3QP5 A;  3ICY A;  2HJE A;  3LIB A;  3UPO A;  1CEF A;  5L10 A;  1UWP X;  4LGW A;  4UAA A;  3W4P A;  1BYW A;  4P85 A;  1AXB A;  4OLG A;  4ETX A;  4I38 A;  1OTE A;  5TGF A;  3BLM A;  2PU4 A;  1XKZ A;  1FIK A;  1JVJ A;  2A49 A;  2O99 A;  3ZNY A;  4EWF A;  4BBU A;  4L9G A;  3HLG A;  3T4T A;  2OWJ A;  3ITA A;  3O87 A;  3T4O A;  3D9Y A;  3G2Y A;  3RH8 B;  1KOU A;  5DFY A;  4ZDX A;  3WS0 A;  1FQG A;  3A3E A;  3AGD A;  4IED A;  4EBN A;  3QP4 A;  2PR5 A;  4BJP A;  4Y0T A;  2J3T C;  4DRT A;  4GW9 A;  1F5M A;  1A0K A;  2ZMA A;  1YT4 A;  1LT0 A;  3ZYT A;  4WEJ A;  3M2K A;  3V50 A;  3PTE A;  3BEB A;  4FD8 A;  4EBL A;  5I94 A;  2WAF A;  4G3V A;  3RTY A;  4OOM A;  3S7Q A;  1ONH A;  4OVD A;  3LIC A;  3OPL A;  4IBR A;  1FR1 A;  3HLE A;  1N9O A;  3KX0 X;  4CLC C;  3V3S A;  4N9K A;  3VV4 A;  2XQZ A;  1LSX A;  4S2K A;  4Y5F A;  2Y2G A;  3EGX C;  3HUM A;  3MXR A;  4OON A;  1CJF A;  3SZT A;  3VOY A;  5KIZ A;  4L0L A;  4ID4 A;  4XUX A;  1NZU A;  4KG2 A;  3MZE A;  3B42 A;  3NI9 A;  2MJ6 A;  1K0K A;  5HL1 A;  3NIA A;  2V9A A;  1W79 A;  4PM9 A;  3NOU C;  2PT7 A;  1YLW A;  3WRT A;  4EW7 A;  3FG8 A;  2EX8 A;  4G3W A;  3GDI A;  2H5S A;  2W0N A;  4X55 A;  2OSU A;  3HUN A;  2ZQA A;  5FQM A;  3QNC A;  2J3T D;  3S22 A;  5K5B A;  5TR7 A;  2W1R A;  4Z1W A;  4IJG A;  2UWX A;  4FOF A;  3IX8 A;  1TDG A;  3MKF A;  4R23 A;  4HY8 A;  1F98 A;  1AWI A;  2Y79 A;  1KDW A;  2H10 A;  3OPR A;  5CGS A;  3A3D A;  4CLC D;  4PM8 A;  2Q9M A;  4KG5 A;  4WM9 A;  3IS2 A;  3FV7 A;  1V9Z A;  3IXH A;  1VHM A;  5F68 A;  2IA2 A;  3ZG8 B;  3EEH A;  4HJ4 A;  4WZ5 A;  3S7N A;  1YQS A;  4P6Z M;  4QWO A;  1XFQ A;  2B18 A;  2E8I A;  3VSK A;  1KE0 A;  2W3G A;  4DXC A;  4PM7 A;  2VV6 A;  3OBF A;  4R0Q A;  2VJW A;  4KZ8 A;  3HBR A;  3SS4 A;  3ZFZ A;  5M19 A;  5DTS A;  1ES3 A;  4S2J A;  3I7J A;  4JXV A;  3OCN A;  5TFQ A;  4KQO A;  5FEG A;  2OAP 1;  2EFX A;  2V0U A;  5DFX A;  4S2N A;  1IFQ A;  5CEB A;  3TG9 A;  5EVL A;  1PI4 A;  4RVA A;  2V8C A;  5DJU A;  5HAR A;  3SH9 A;  3UMD A;  3ZQ5 A;  3KYZ A;  2WGW B;  1MWT A;  2P9V A;  3BFD A;  3C4P A;  4KUO A;  3GVB A;  1ESU A;  4P6B A;  1TS7 A;  3CUE A;  5DF8 A;  3SH8 A;  3UME A;  3F1O A;  4X1M A;  2W3E A;  3HCY A;  2NUT C;  1SKF A;  4NEE D;  2ZQC A;  4R4R A;  4K0W A;  1CF0 A;  3E2L A;  2Y2Q A;  4R3A A;  4PHT A;  1CQA A;  3N4I A;  3G34 A;  1OT9 A;  3TRC A;  1O7E A;  5DTK A;  4CJN A;  4CPK A;  3C2W A;  4GHI B;  3IX3 A;  1G5U A; 
#chains in the Genus database with same CATH homology
 5DF9 A;  3IF6 A;  3N8L A;  4X56 A;  2Z2M B;  2WZX A;  2C6W B;  2DRW A;  1BLS A;  3A3J A;  4KZ5 A;  1RP5 A;  4PMA A;  4P0M A;  5EOE A;  2OV5 A;  1I5Q A;  5E43 A;  4KZ9 A;  4EV4 A;  1LHY A;  4OP5 A;  5FAO A;  3EQV A;  2DNS A;  5CER A;  5GLA A;  4C6Y A;  1SCW A;  4QB8 A;  1W5D A;  3N6I A;  5JYP A;  1YMS A;  1K57 C;  3DW0 A;  4B4Z A;  4QY6 A;  5CTM A;  2A3U A;  4GZB A;  2HDS A;  3IF6 C;  3HLB A;  3WRZ A;  4GDN A;  5CHM A;  1EI5 A;  1XPB A;  2FFF B;  2EXA A;  3EQU A;  3UNW A;  2OLU A;  5D3O A;  4XXR A;  2ZJ9 A;  3UN7 A;  1K56 A;  3MBZ A;  2HP5 A;  1CEG A;  4K91 A;  4OPZ A;  4BD0 A;  4D2O A;  2B5R A;  3JYI A;  3GV9 A;  3Q7V A;  3E2K A;  3W8K A;  4LCM A;  1PWD A;  5EVI B;  3PBN A;  2Y2K A;  5EE8 A;  1ZKJ A;  4PM6 A;  3PAG A;  2P9V B;  1MWR A;  2OLV A;  2ZC4 B;  2ZC3 B;  2P74 A;  3OPH A;  3UPN A;  4B4X A;  4B88 A;  4DE2 A;  2ZC5 B;  5GLB A;  1XA1 A;  5GLC A;  3MFD A;  4RX3 A;  5FAS A;  4DDY A;  2ZQ9 A;  4QU3 A;  1IYS A;  2BG1 A;  4EBP A;  1BT5 A;  1NY0 A;  3VFH A;  4GNU A;  5EVI D;  1IEL A;  1GHI A;  1LL5 A;  3PBQ A;  2JC7 A;  1S6R A;  4OLD A;  4GN2 A;  1KGE A;  2J9P A;  1TVF A;  2CC1 A;  4EUZ A;  1PW1 A;  1HVB A;  3LY4 A;  1PWC A;  1NYM A;  2Y55 A;  3WWX A;  1HZO A;  1GA0 A;  4MBK A;  4ZTK A;  1Z6F A;  3VSL A;  3ZCZ A;  1E25 A;  5CED A;  1JTD A;  5A91 A;  4DKI A;  3FWL A;  3BFG A;  5EUA A;  3CMZ A;  1NYY A;  2WK0 A;  1ES5 A;  3ZG0 A;  2G2W A;  3IHB A;  4BD1 A;  1MWU A;  3G4P A;  4H8R A;  2ZD8 A;  1E4D A;  3BM6 A;  4MBF A;  3GQZ A;  3IF6 B;  2WAD A;  5HAP A;  3IQA A;  2HP9 A;  4Y7P A;  5U47 A;  3MZD A;  1YLY A;  3NC8 A;  5FAT A;  5DTT A;  3CG5 A;  4GD8 A;  1RGZ A;  5A93 A;  5FI7 A;  4N9L A;  1MPL A;  3A3I A;  4YIN A;  4ZJ1 A;  3HVF A;  4DDS A;  1ES2 A;  2JCH A;  2XD5 A;  3UDI A;  3GR2 A;  3IHA A;  4JLF A;  4QY5 A;  2WGI A;  1IKI A;  3MKE A;  2IWD A;  2PBY A;  3TSG A;  3C5A A;  4GD6 A;  1QMF A;  4E3K A;  4KZ6 A;  3VFF A;  4IVK A;  4WBG A;  3W4Q A;  3LY3 A;  1ERO A;  3RJU A;  1DJC A;  1VM1 A;  5FA7 A;  2HPB A;  5EEC A;  1PYY A;  4E3M A;  4MNR A;  4OQG A;  3IH9 A;  4WYY A;  5FQI A;  5HAQ A;  3NCK A;  4KZA A;  3FKV A;  3Q7V B;  2EXB A;  1JWP A;  3GSG A;  2J7V A;  2ZM2 A;  5DF7 A;  5L2F A;  5FI6 A;  2C5W B;  3ZGA B;  1MKI A;  2Y2I A;  3Q7Z A;  5KZH A;  4S2I A;  1MY8 A;  1CK3 A;  1K56 D;  3IWQ A;  3UE1 A;  5CHU A;  2J9O A;  4E6W A;  1RCJ A;  2JE5 A;  1TDL A;  1K54 A;  1O07 A;  1ZC2 A;  5DVA A;  5FQJ A;  4GOG A;  3O88 A;  2Y59 A;  1U60 A;  1G6A A;  2EX2 A;  5CHJ A;  1QME A;  5FQQ A;  4LV2 A;  1LI9 A;  4DE0 A;  1LL9 A;  1SDE A;  2V2F F;  3UPO A;  1K4E A;  1CEF A;  2WKE A;  1IKG A;  2EFU A;  1BUL A;  2FFY A;  3WS2 A;  4FCF A;  3IF5 A;  1PZP A;  1K54 C;  4HES A;  1EWZ A;  1YLJ A;  1W8Q A;  4LV3 A;  3IXD A;  4XUZ A;  3ZVT A;  4E3L A;  4UAA A;  4RX2 A;  3OPP A;  3BFF A;  3W4P A;  5KMW A;  5FDH A;  4P85 A;  4RA7 A;  3NY4 A;  3HLC A;  1NXY A;  3BYD A;  4OQH A;  1AXB A;  4OLG A;  1N9B A;  3OCL A;  4N1H A;  3V3R A;  1BZA A;  1ALQ A;  5J8X A;  2Z2L B;  5TGF A;  1M6K A;  2Y2L A;  3BLM A;  4DF6 A;  4K0X A;  4Z9Q A;  2WYX A;  4P87 A;  2PU4 A;  3ZDJ A;  4OP8 A;  3S1Y A;  1XKZ A;  2Y91 A;  1H5X A;  4KQR A;  3RXW A;  1MBL A;  4FH2 A;  4OOL A;  1JVJ A;  2A49 A;  1TEM A;  4JPM A;  2WGV A;  3ZNT A;  4OH0 A;  3ZNY A;  4EWF A;  3BFC A;  3N7W A;  3M6B A;  3C4O A;  1NJ4 A;  1XGI A;  3G32 A;  4MBH A;  1FSY A;  4BL3 A;  1KGF A;  1HD8 A;  3HLG A;  4R3B A;  2Y2H A;  3SOI A;  1L0E A;  4E3O A;  1KVM A;  3ITA A;  5F82 A;  1L0F A;  5HAI A;  4QHC A;  4S2L A;  3O87 A;  4F94 A;  3N8S A;  3S4X A;  3G2Y A;  1BSG A;  3IXB A;  4ZDX A;  3WS0 A;  4E3J A;  1FQG A;  3A3E A;  3AGD A;  4IED A;  4EBN A;  2QZ6 A;  1G68 A;  1XXM A;  3QHY A;  1ERM A;  1Y54 A;  3CJM A;  1LI0 A;  3IT9 A;  1BLP A;  4OPR A;  4BJP A;  5GLD A;  4Y0T A;  1XGJ A;  3VP4 A;  4DRT A;  1IEM A;  1DY6 A;  4JF4 A;  3B3X A;  2ZMA A;  1YT4 A;  1KE4 A;  4WEJ A;  5FQK A;  3M2K A;  3V50 A;  3PTE A;  3BEB A;  4FD8 A;  4EBL A;  2ZQD A;  2WAF A;  4HBU A;  4UA7 A;  5I94 A;  4WZ5 C;  1ES4 A;  4Q8I A;  5FI2 A;  1FOF A;  2RCX A;  2VGK A;  4DE1 A;  1PIO A;  3O86 A;  4OOM A;  4X6T A;  4A5R A;  4JXG A;  4C75 A;  2BLS A;  3P09 A;  5GHY A;  2Y2O A;  4QJG A;  3G31 A;  1YLP A;  2QPN A;  1ONH A;  3M2J A;  4JF5 A;  4JXS A;  4OVD A;  4ZBE A;  3HLF A;  1WE4 A;  3OPL A;  4IBR A;  1XA7 A;  1FR1 A;  1LLB A;  2R9W A;  3AGE A;  1I2W A;  3HLE A;  4KEN B;  1K25 A;  2H0T A;  2H0Y A;  2HDR A;  3Q1F A;  2IWB A;  3HUO A;  1BLH A;  4E6X A;  3QNB A;  4OKP A;  3V3S A;  1KDS A;  4N9K A;  1GHP A;  3VP1 A;  5GHX A;  4JBF A;  2XQZ A;  5GHZ A;  3PBO A;  2ZC7 A;  3G30 A;  4UA9 A;  1ERQ A;  2HDQ A;  3PAE A;  4FSF A;  4S2K A;  3FKW A;  4GB7 A;  2Y2G A;  3HUM A;  3MXR A;  2ZLY A;  3WS5 A;  3ZG5 A;  3NDE A;  4E3N A;  1E3U A;  3AGF A;  4JKT A;  4OON A;  4R4S A;  1ZG6 A;  4EQI A;  4KG6 A;  3ZHH A;  1SDN A;  5IHV A;  3VOY A;  1H8Y A;  2XF3 A;  1GCE A;  3MZF A;  1C3B A;  1FCO A;  4S2M A;  5M1A A;  4L0L A;  4ID4 A;  4ZJ3 A;  4E3I A;  4WMC A;  1PZO A;  4X68 A;  1NZU A;  4LEN A;  4XUX A;  1GHM A;  2ZM8 A;  1K38 A;  2X01 A;  4KG2 A;  3BLS A;  1I2S A;  3MZE A;  2GDN A;  2XGN A;  3PBT A;  4R3J A;  2XEP A;  4WEK A;  4ZJ2 A;  2ZQ8 A;  1JTG A;  3ISG A;  3NI9 A;  3Q82 A;  4U0X A;  4Y0O A;  5HL1 A;  3UE0 A;  1SHV A;  4N1X A;  1JWZ A;  2X71 A;  1J9M A;  3VMA A;  1FSW A;  3FZC A;  3NIA A;  1W79 A;  4PM9 A;  5EPH A;  1BTL A;  4OQI A;  5EOO A;  3PBS A;  4OPQ A;  1K55 A;  3WS4 A;  1YLW A;  3WRT A;  1H8Z A;  3CZD A;  3GRJ A;  5AQ7 A;  3RXX A;  2EX8 A;  1BUE A;  3SH7 A;  4R1G A;  4OOY A;  2WKI A;  1NRF A;  2ZQ7 A;  2H5S A;  4X55 A;  5E2G A;  2OSU A;  3HUN A;  3NBL A;  4LCL A;  4WEL A;  2ZQA A;  5FQM A;  3QNC A;  1K55 C;  4S2O A;  2XK1 A;  2XLN A;  1KGG A;  3IWO A;  5TR7 A;  5HX9 A;  4IVI A;  3BFE A;  3S22 A;  1IYQ A;  5CTN A;  2XFS A;  2I72 A;  3Q81 A;  1ONG A;  2Y2M A;  2UWX A;  2XFT A;  3HL9 A;  2RL3 A;  1CI9 A;  3FYZ A;  4U3T A;  3SS3 A;  1TDG A;  1K4F A;  2XR0 A;  1N4O A;  3C7U A;  3MKF A;  1RGY A;  4DE3 A;  3G2Z A;  3IH8 A;  4R23 A;  2XDM A;  3VOZ A;  2WGW A;  5F1F A;  3IXG A;  1GA9 A;  4M3K A;  4HEF A;  1L0D A;  3HLW A;  1KDW A;  2H10 A;  3OPR A;  5CGS A;  3A3D A;  4KQQ A;  4N92 A;  3VP3 A;  4PM8 A;  2Q9M A;  5FAP A;  5CRF A;  4KG5 A;  3UO9 A;  4WM9 A;  3FV7 A;  1K6S A;  1YM1 A;  4ZAM A;  3V39 A;  3IXH A;  3Q07 A;  3GMW A;  3UY6 A;  3DWK A;  5E2E A;  4S2P A;  1L2S A;  5AQ9 A;  3ZG8 B;  5A92 A;  1W8Y A;  4X69 A;  4BQM A;  3GTC A;  2JBF A;  4WZ5 A;  2R9X A;  3LO7 A;  4UA6 A;  2Y2J A;  1YQS A;  5FAQ A;  3ZG9 B;  3DTM A;  3WS1 A;  5A90 A;  2J8Y A;  3HLD A;  4LV0 A;  1NZO A;  2E8I A;  5AQB A;  5KSH A;  3VSK A;  4Y0U A;  1KE0 A;  4HBT A;  4MLL A;  2XD1 A;  1ZG4 A;  3LCE A;  1E3U D;  2WUQ A;  2Q9N A;  4O7D A;  4PM7 A;  1K6R A;  1HTZ A;  5CGX A;  1YLT A;  1JWV A;  4X53 A;  1S0W A;  4R0Q A;  5FQ9 A;  1XP4 A;  5CXW A;  4BL2 A;  4KZ8 A;  1WYB A;  4PPR A;  5M18 A;  3HBR A;  3SS4 A;  3ZFZ A;  2EX6 A;  3ZVW A;  4JXW A;  1FCM A;  3VP2 A;  5M19 A;  1ESI A;  4WMC D;  5DTS A;  4GDB A;  3UDF A;  3BEC A;  2IWC A;  1ES3 A;  4MEZ A;  4BLM A;  4S2J A;  3I7J A;  3OC2 A;  4JF6 A;  3VP0 A;  1W7F A;  1KVL A;  3OCN A;  4JXV A;  5KSC A;  5TFQ A;  1Q2Q A;  2ZM0 A;  3DWZ A;  4KQO A;  3V5M A;  5CGW A;  1PW8 A;  2QMI A;  2EFX A;  1VQQ A;  2WKH A;  3W4O A;  5CEC A;  2V20 A;  3O3V A;  1IYP A;  2DCF A;  4S2N A;  2Y2N A;  5CEB A;  1L0G A;  3TG9 A;  5EVL A;  4BEN A;  3ITB A;  1PI4 A;  4RVA A;  3TOI A;  2XH9 A;  1XX2 A;  3P98 A;  1KE3 A;  5HAR A;  3SH9 A;  3ZG7 B;  3UDX A;  5BOH A;  5FSR A;  1MWS A;  1DJB A;  2X02 A;  3M6H A;  5EVI A;  3PBR A;  3IWI A;  1YMX A;  2WGW B;  1M40 A;  1MWT A;  2P9V A;  3BFD A;  3C4P A;  4S2N C;  5E2F A;  2WZZ A;  4C3Q A;  3A3F A;  4KZ3 A;  1DJA A;  3LEZ A;  2PU2 A;  2G2U A;  2VGJ A;  3GVB A;  4OQ0 A;  5G18 A;  1ESU A;  4IBX A;  4P6B A;  2WAE A;  2HDU A;  3MXS A;  1PI5 A;  2V1Z A;  5DF8 A;  3SH8 A;  3NDG A;  4UHU A;  3N8R A;  5AQA A;  5EVI C;  4DXB A;  3OZH A;  4QD4 A;  1YLZ A;  3G35 A;  1SKF A;  4OPY A;  4YFM A;  3BRM A;  5HFO A;  1PWG A;  4WZ4 A;  3UPP A;  4RYE A;  1OME A;  2HP6 A;  5JYO A;  1Q2P A;  1FR6 A;  4KZ7 A;  5F1G A;  2ZQC A;  4R4R A;  2ZC6 B;  4K0W A;  1IYO A;  4KZ4 A;  3SS5 A;  3E2L A;  3HRE A;  1FCN A;  2Y2Q A;  4NET A;  2EX9 A;  4NK3 A;  4GKU A;  3N4I A;  3G34 A;  2Y2P A;  5HW3 A;  2Y4A A;  4LV1 A;  1BLC A;  4KZB A;  5F83 A;  1CI8 A;  4PM5 A;  1MXO A;  1O7E A;  4FH4 A;  5GL9 A;  5DTK A;  4CJN A;  4DXC A;  3D4F A;  4CPK A;  3C7V A;  1WYC A;  3UE3 A;  1K57 A;  4U0T A;  5E2H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...