4IVKA

Crystal structure of a fammily viii carboxylesterase in a complex with cephalothin.
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
404
structure length
404
Chain Sequence
AEGPVTATKPKEAGFTSEGLARIDAYLKNEIQAKTMPGAVMMIKRNGETAYFSSFGLRDPDTKEPMTAETIFRIYSMSKPITTVAAMMLVEEGKLQLDEPVSKYIPSFANVKVGVETKGENGMALETGPVKRAITIQDLMRHTSGITYGFVGDGLVKKAYIASNLFDGDFDNAEFAERIAKLPLVYQPGTTWDYGHSTDILGRVVEVVSGKSLYQFEKERLLDPLGMKDTGFYVTDPAKKSLVAEAMPNDRKIGGSEMFDPRVQKKWEPGGQGMVSTIGDYARFTQMVLNGGTLDGKRYLSPKTIAYMGSNHIPQASGIVPGAYYLPGPGVGFGLGFAVRTEAGVTPVEGSVGDLSWGGAGGTVFWIDPKENLTVVFMAPMVSPRARVWRTLRNIVYGAFDRLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Carboxylesterases
publication title Structural basis for the beta-lactamase activity of EstU1, a family VIII carboxylesterase.
pubmed doi rcsb
total genus 136
structure length 404
sequence length 404
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2013-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4ivkA00
2XD1A 3SS3A 2P9VB 4KENB 1NYYA 4ZJ1A 5AQ9A 4BQMA 3UDIA 2PU4A 4WZ4A 4P6BA 1PW1A 1K56A 1KGFA 5HAQA 1Z6FA 5HAPA 4DE0A 4QD4A 1K6RA 5M19A 3PTEA 2JCHA 1Q2QA 3O86A 1K38A 2BLSA 5CHUA 4X55A 2XFTA 4HBTA 3ITBA 3GR2A 4PM5A 2EX9A 5FQJA 1KE3A 5HFOA 4NK3A 5GLAA 4S2NA 1GA0A 4WELA 2I72A 2QPNA 1MKIA 1M6KA 4OOMA 4BD0A 2Y55A 2ZC6B 2E8IA 1MPLA 3N8LA 1KE0A 3QNBA 4WMCD 3FZCA 3DWZA 1ZG6A 5GHXA 4EV4A 2ZQCA 4MLLA 2PU2A 1IKIA 2ZQDA 2Z2MB 5CXWA 2BG1A 4EBNA 1K6SA 1H8ZA 1MWUA 2JBFA 2XGNA 4OONA 4X56A 5FA7A 4CJNA 3N8RA 5AQBA 1TEMA 5EVIB 3SH9A 2X71A 4BENA 2WAEA 2G2WA 2EX2A 2WGWB 5CTNA 5FASA 1FR6A 3D4FA 3HLWA 5DF7A 4ZJ2A 4JF5A 1NYMA 3BFEA 3GTCA 4E3KA 3IF6A 5FATA 5A93A 4ZAMA 4MBKA 5CGSA 1FSWA 1GHPA 3VFHA 1IYSA 2JC7A 4OQIA 5GHYA 1FOFA 3OCNA 1VM1A 4UAAA 4IEDA 3CG5A 4E3OA 3IF5A 4KZ7A 1ESIA 2XFSA 4R4RA 5EVID 3TOIA 3W4PA 4X69A 2ZQAA 3HBRA 4OPQA 4B4XA 1C3BA 3Q1FA 3UO9A 1BULA 2Y4AA 3UNWA 2H10A 3IF6C 5FQQA 1W5DA 3O88A 3HVFA 4OPYA 1IELA 3IT9A 4BJPA 1E4DA 4C3QA 1PWDA 4S2PA 2Y2NA 2HDQA 1LI9A 3UN7A 3ZFZA 4R3BA 4DXCA 4LV2A 4N92A 5HL1A 3NBLA 3BFDA 3ITAA 1GCEA 3OC2A 3VMAA 2VGKA 3BLMA 3ZHHA 4MBHA 1L0GA 4JBFA 5FQIA 4KG5A 1YMXA 3QHYA 1LLBA 2WAFA 3IF6B 2HDSA 4N1XA 2WUQA 3S4XA 1K57A 3B3XA 3ZDJA 1OMEA 3HLEA 4WM9A 4JPMA 4S2KA 5EECA 3LY3A 1I2SA 4S2OA 1NZOA 3VSLA 2DRWA 1N9BA 4XXRA 5A90A 4HBUA 1L0FA 1XP4A 4WMCA 3GV9A 4DXBA 1XKZA 4OVDA 4XUXA 5A91A 1DJAA 1ZC2A 4M3KA 4LV3A 3MKEA 1LI0A 1EWZA 5EE8A 4WEKA 4S2MA 2ZQ7A 2XDMA 3ZG9B 1K57C 1ES3A 4NETA 3GSGA 2P74A 2XEPA 3IXHA 4OOYA 5GL9A 3AGEA 2B5RA 3VP0A 1SDNA 4EBLA 1SDEA 1BLPA 4JXWA 4C6YA 1NRFA 3HUNA 1NJ4A 1BT5A 3VSKA 1M40A 5DVAA 1K54C 5AQ7A 1TVFA 2PBYA 2WKIA 4S2LA 5F1GA 1HTZA 2Y2OA 5FI6A 1EROA 2C5WB 3BEBA 4PM6A 1PYYA 3N6IA 4OLGA 3WS2A 4P87A 1NZUA 4QJGA 3PBRA 1U60A 4WYYA 3WS1A 1CEGA 3SS4A 1ALQA 3NDGA 4BD1A 4E3MA 1NY0A 4DRTA 4GN2A 2QMIA 3ZG0A 3HUOA 4K0XA 2HDRA 3BYDA 5BOHA 1XXMA 1ES2A 2H0YA 4K91A 2OSUA 1YLYA 1PW8A 2C6WB 4LV0A 4X6TA 4R23A 4RYEA 3VP1A 4IVIA 5GLDA 3IXGA 3N7WA 2ZD8A 1SCWA 3CZDA 4PM7A 5HX9A 3SOIA 3UE3A 4MBFA 4BLMA 4KZ4A 4U0TA 4JLFA 1KDSA 1RGZA 4DDYA 2EXAA 4O7DA 1CEFA 3ZCZA 4EWFA 1O7EA 1JWPA 1KGGA 1YLJA 3PAEA 4LCMA 4U0XA 4ZBEA 2Z2LB 4GDNA 3ISGA 4S2JA 3GQZA 2H0TA 1W7FA 4Z9QA 3MZDA 3QNCA 4KZ9A 4FCFA 1TDGA 1LHYA 2J9PA 2ZJ9A 2XQZA 4HEFA 3FKVA 3OPHA 3C7UA 5FI7A 1DJCA 4S2NC 4QHCA 2ZC4B 2J9OA 1PWCA 1PIOA 5FSRA 3IXDA 4H8RA 3VFFA 5E2FA 1HVBA 1QMFA 3NC8A 1IYPA 5CGXA 3ZG5A 3HL9A 3FKWA 3RXXA 4OQGA 3DW0A 1BLSA 2HP6A 3NIAA 1EI5A 3ZVWA 2UWXA 5D3OA 3FWLA 3JYIA 2FFYA 1S0WA 1E25A 3HLBA 4E3IA 4JF4A 1WYCA 3G2YA 2Y2KA 1IKGA 4IBRA 1XA1A 3LEZA 3NDEA 4ZDXA 3WS0A 2Y2GA 3V50A 2ZM0A 3PBSA 1GA9A 3Q82A 5TFQA 1WYBA 4OKPA 4QU3A 5GLCA 2ZQ8A 2VGJA 1YLZA 3MXSA 5CECA 1KE4A 2X02A 5DTTA 2WKHA 4E3LA 3ZVTA 1FQGA 5EOEA 3NY4A 3HLGA 4N9LA 5DF9A 2OLVA 5IHVA 2ZC7A 4LCLA 4OP8A 3WS4A 3A3IA 3A3JA 4E3JA 5FAOA 4E6WA 4XUZA 1MBLA 1W8YA 2Y2PA 4Y0UA 1QMEA 2EFUA 3HUMA 4X53A 2WYXA 4DE3A 4GDBA 3A3FA 2FFFB 4DF6A 1CK3A 3VP4A 2QZ6A 4R1GA 1YT4A 1JWVA 4WZ5A 2WZXA 4K0WA 2V20A 5DF8A 4QY6A 1CI9A 5CHJA 5J8XA 1BLCA 3IQAA 1XX2A 1G6AA 1VQQA 1JTDA 3BLSA 1YLTA 5CTMA 3Q7VA 4R4SA 2Y2LA 1Y54A 4KZ5A 4DE2A 3N4IA 3DWKA 2EX8A 4KQRA 2WZZA 2ZM8A 4QY5A 3W8KA 3G31A 4N9KA 1IYOA 4GB7A 5U47A 1SHVA 3A3DA 3PAGA 5HAIA 3P09A 4GNUA 3AGDA 4U3TA 4BL3A 1Q2PA 2P9VA 1CI8A 4GD6A 5FAQA 2DNSA 4UHUA 4DE1A 2WADA 2XD5A 5TGFA 4OQHA 4WZ5C 1W79A 4EQIA 2EFXA 2R9XA 1IEMA 4A5RA 1RCJA 2HP9A 1KGEA 5KSHA 1YMSA 4ID4A 4OPZA 3C4OA 3IWIA 5CEDA 3O3VA 1HD8A 1L0DA 3Q07A 1TDLA 2WGIA 3O87A 1K4FA 1WE4A 2XK1A 1FCOA 4B88A 5EVLA 4E6XA 1IYQA 2H5SA 3MZFA 4L0LA 2WK0A 4RVAA 5A92A 5GLBA 4FH4A 4OOLA 4RX3A 4Y0TA 3ZG7B 3G2ZA 1FCNA 5KMWA 3E2KA 1JTGA 1XA7A 2J8YA 4KZ8A 4QB8A 5FAPA 5E2GA 3M2JA 2RL3A 3N8SA 2OLUA 5EVIA 1DJBA 4OP5A 3BECA 5KSCA 2ZMAA 3ZGAB 5F83A 3HREA 4KG6A 5HARA 3RJUA 3M6HA 2WGWA 2HDUA 2JE5A 3EQUA 3HLDA 4IVKA 3FYZA 4Y7PA 2DCFA 3E2LA 4KZ3A 3HLFA 4F94A 4OQ0A 2ZC3B 3P98A 4GKUA 4C75A 4GOGA 3C7VA 3DTMA 4R0QA 3IHBA 4JF6A 2Y2HA 3VP2A 5I94A 1J9MA 3UY6A 1GHIA 5F82A 1SKFA 5EVIC 1AXBA 2G2UA 1YLPA 4R3JA 3ZNTA 4HESA 1MY8A 1MWSA 3IHAA 3PBNA 3PBQA 4OH0A 3UPNA 1RP5A 3V5MA 4S2IA 3IH8A 3OPLA 1BTLA 3MFDA 1JWZA 3ZNYA 2OV5A 3MXRA 1E3UD 3V3RA 4GD8A 3UE1A 1PZPA 4UA9A 1MXOA 4P85A 4BL2A 3OCLA 3GMWA 2HP5A 5FQMA 3VOZA 2EX6A 3HLCA 3TG9A 1XGIA 2GDNA 3MZEA 3NCKA 1L0EA 2IWCA 4IBXA 4KQQA 4PM9A 2Y2QA 3TSGA 3IH9A 4KZ6A 1XGJA 3UDXA 3W4QA 5EPHA 5CEBA 1O07A 1KDWA 4N1HA 5M18A 4RA7A 5L2FA 4PMAA 1LL9A 1H8YA 3G4PA 3SH8A 4MEZA 1PWGA 4EBPA 1HZOA 4KQOA 2RCXA 1KVMA 2X01A 3SS5A 5CERA 1YQSA 2IWBA 4LV1A 3Q7ZA 2Y2JA 3A3EA 1N4OA 3GVBA 3IXBA 1ESUA 3BFFA 3C5AA 3M6BA 1S6RA 3BFCA 2IWDA 5JYPA 3AGFA 1H5XA 3G30A 4KG2A 1BUEA 4YFMA 5E43A 1K25A 3CJMA 1K56D 1YLWA 3S1YA 3WS5A 1G68A 5DTKA 3WRZA 2V2FF 5EOOA 1W8QA 4MNRA 3V39A 3C4PA 3I7JA 4UA7A 5GHZA 3SH7A 4CPKA 4Q8IA 4E3NA 5TR7A 1ZG4A 3OPPA 5FI2A 4YINA 3WWXA 1YM1A 4KZAA 3NI9A 4LENA 1ONGA 4WEJA 1FSYA 4JKTA 4D2OA 3VP3A 3EQVA 1BSGA 3UDFA 2J7VA 3LO7A 3W4OA 5E2HA 2HPBA 3UPPA 5KZHA 3PBTA 3G32A 5G18A 3M2KA 4DDSA 5FDHA 1BLHA 2A49A 2WKEA 5CRFA 4P0MA 1K4EA 2Q9MA 1K55A 2XLNA 2EXBA 1L2SA 1PZOA 3BM6A 3OPRA 4UA6A 1ZKJA 4DKIA 2ZC5B 1JVJA 1ONHA 4JXSA 4ZJ3A 1KVLA 1ES4A 5CGWA 1RGYA 5M1AA 3VOYA 3PBOA 3LY4A 3OZHA 4PPRA 1MWRA 4FD8A 5JYOA 4OLDA 2XR0A 4Y0OA 4KZBA 2Y59A 2Y2IA 3CMZA 4OPRA 4X68A 1PI4A 4B4ZA 3WRTA 2XH9A 5CHMA 4GZBA 4JXVA 2R9WA 3V3SA 3GRJA 1K54A 1E3UA 5F1FA 2XF3A 2ZLYA 2A3UA 1K55C 4RX2A 3LCEA 3BRMA 3G35A 1ES5A 2Q9NA 5E2EA 4ZTKA 4EUZA 1ERMA 1FR1A 2WGVA 1DY6A 4JXGA 3Q81A 5AQAA 5EUAA 2Y2MA 4FSFA 3RXWA 4FH2A 3FV7A 2CC1A 5FQKA 1PI5A 1ERQA 4PM8A 3IWOA 3IWQA 1LL5A 1I2WA 1I5QA 2V1ZA 3G34A 1NXYA 5DTSA 1FCMA 4WBGA 3MBZA 2ZQ9A 1GHMA 2ZM2A 3S22A 3UE0A 1MWTA 3MKFA 3Q7VB 1XPBA 3BFGA 2Y91A 3ZG8B 3UPOA 1BZAA 5HW3A 5FQ9A
chains in the Genus database with same CATH superfamily
4R6LA 4HIAA 2W3FA 3SS3A 5EVEA 1NYYA 5HPIA 3UB9A 4P6BA 4CLCB 1K6RA 2JCHA 5CHUA 3HCYA 2D02A 2HJ9C 1MKIA 3L7HA 4BD0A 1MPLA 5GHXA 1J3WA 4EV4A 1IFQA 2HGVA 2PU2A 1IKIA 2ZQDA 1K6SA 4OONA 2OWJA 1TEMA 4BMWA 3MQ0A 1ZHHB 5HZHA 2WAEA 3KSHA 5DF7A 4ZJ2A 4JF5A 3LYXA 2MJ6A 3BFEA 2KLIA 5A93A 4ZAMA 5CGSA 3T4SA 2JC7A 2W1TA 2ZL1A 3MXQA 2ACGA 3CG5A 4KZ7A 1ESIA 3TOIA 3R4KA 2QHKA 1ACFA 4X69A 2ZQAA 1X0OA 2PBDP 4IHQA 2L0WA 1NLYA 4OPYA 1IELA 3OLOA 1E4DA 3QP6A 2HDQA 4EERA 4R3BA 4N92A 4EETB 1GCEA 3LEQA 3VMAA 4MBHA 4LRZE 5FQIA 1H0MA 4KG5A 1YAXA 2OAQ1 2WAFA 3S4XA 3B3XA 3T1RA 1HLUP 1F5MA 4S2OA 1N9BA 4R3AA 2PHYA 1DP9A 4D60A 4WMCA 1SKOA 4OVDA 2V1BA 1ZC2A 1JNUA 2W3GA 3LIDA 2XEPA 2DMWA 1SDEA 4JXWA 3HUNA 4MN7A 1BT5A 4I3AA 1TVFA 2PBYA 1GSWA 4LGWA 2GZAA 2C5WB 2V1AA 3N6IA 4OLGA 3WS1A 2B95A 1ALQA 3NDGA 4DRTA 2QMIA 1ES2A 2NUTC 3F1NB 4R23A 3PR6A 4IVIA 1VHMA 4U0TA 4DDYA 4HY8A 4CLCE 1YLJA 3PAEA 5FEFA 4Z9QA 3MZDA 3QNCA 4FCFA 2XQZA 5L07A 2J3WA 3OPHA 1XFNA 4S2NC 3T1QB 2ZC4B 3CHWP 3VFFA 3NC8A 1DP8A 3HL9A 2M7UA 3EOIA 3DW0A 3ZVWA 2VLGA 4E3IA 4JF4A 4ME4A 3LR0A 3LEZA 2Y2GA 4FOFA 5DJUA 3CPTA 1GA9A 5TFQA 1WYBA 4OKPA 2HF6A 3BJNA 3MXSA 2PRFA 5CECA 5EOEA 3HLGA 5DF9A 3MR0A 1OTBA 4LCLA 5FAOA 3A0RA 3S7PA 4E6WA 4XUZA 2W0NA 4X53A 5FL3A 2WYXA 4GDBA 3A3FA 2FFFB 3UB8A 3VP4A 2QZ6A 4R1GA 5DF8A 4QY6A 1CI9A 5I5LA 1BLCA 3IQAA 1XX2A 1G6AA 1JTDA 1YLTA 4GHIB 3JPUA 4KZ5A 3N4IA 1LSVA 2WZZA 2ZM8A 2PYRA 4GW9A 4GB7A 3LGOA 1SHVA 3MQQA 4U3TA 4BL3A 2DNSA 4DE1A 4WZ5C 2VGLM 3UMDA 4OPZA 3IWIA 4GS9B 2XK1A 1N9NA 4B88A 2V0WA 1SZVA 3MZFA 1UWNX 5A92A 4FH4A 2B02A 3UB6A 3ZG7B 3RFBA 2OAP1 3N8SA 4OP5A 1P97A 3HREA 3M6HA 4IVKA 4Y7PA 3HLFA 4OQ0A 4C75A 2O9AA 4ARZB 1SKFA 4P6ZS 5EV0A 3LI9A 5EVIC 2P08A 4O0PA 1RP5A 2VKSA 1AWIA 3MFDA 1JWZA 1LSXA 4HQAA 3ZNYA 3MXRA 4GD8A 3UE1A 4UA9A 4P85A 3NHQA 3VOZA 2EX6A 3HLCA 3S7NA 2EWWA 1L0EA 2IWCA 3NCKA 4PM9A 3TSGA 3UDXA 4KZ6A 1XGJA 3LR5A 1O07A 5EM1A 3G4PA 3SH8A 4EBPA 3BY8A 1HZOA 4KQOA 2RCXA 1KVMA 1YQSA 4CQHA 3IXBA 3C5AA 4ZRRA 5EFWA 3G30A 1S1ZA 3CJMA 5L8MA 2V2FF 5EOOA 1W8QA 4G3KA 4MNRA 3T4JA 3I7JA 5GHZA 4K08A 1YKDA 4NG2A 3RH8B 1YM1A 2VEAA 3VP3A 3W4OA 3G32A 4Y13A 4DDSA 4MMNA 2Q9MA 2XLNA 3OPRA 2ZC5B 1JVJA 1T1CA 3C2WA 5CGWA 4DJ3A 1CQAA 2Y59A 4IUKA 4B4ZA 3WRTA 5CHMA 3F1NA 4WN5A 2O9BA 3V3SA 3GRJA 2XF3A 2ZLYA 4FTXA 4PKYG 1K55C 1YSPA 4L9GA 1UWPX 3LCEA 2QWSA 2Q9NA 4EUZA 1FR1A 2WGVA 3E98A 3Q81A 3H7WB 1OPXA 4PM8A 1LL5A 3E0YA 1NXYA 3TW8A 5A8BA 3UPOA 4IUHA 3LIAA 1V9YA 3BQAA 1XJ3A 4KENB 4ZJ1A 3UDIA 2PR5A 1KGFA 5HAQA 1Z6FA 2NUPC 2K7SA 3O86A 4X55A 2XFTA 3GR2A 2EX9A 2XROA 4NK3A 4S2NA 4CJNA 2Y55A 4WMCD 2E8IA 3N8LA 3QNBA 3FZCA 2Z2MB 4EBNA 2JBFA 2XGNA 3SH9A 2G2WA 2WGWB 5FASA 1TS7A 4WLAA 1GSXA 3D4FA 3HLWA 2JHEA 3LI8A 4MBKA 1OTIA 1GHPA 4LRXC 3T4QA 4GHIA 4ESPA 2VV6A 3HBRA 3DAVA 3FG8A 3MF0A 1BULA 2WKRA 3PXPA 3IF6C 5F68A 5FQQA 3HVFA 2VX8A 3ZFZA 4DXCA 3EEHA 4LV2A 3NBLA 3BFDA 3ITAA 3TJZC 3OC2A 3CUEC 4GS9A 3BLMA 1LLBA 3IF6B 5DJTA 4JPMA 1NZOA 2XRNA 2P7JA 4I3IA 3GV9A 3RTYA 4DXBA 3UMEA 4LV3A 4Q0HA 3MKEA 1LI0A 1EWZA 4I39A 3PYPA 2XDMA 1K57C 1N9LA 4NETA 3IXHA 2P74A 4NKPA 4ARZA 3AGEA 2PD7A 1ODVA 1MKMA 4BBVA 3VSKA 1K54C 3K2NA 3GDIA 2WKIA 3ULFA 1HTZA 2Y2OA 5FI6A 1EROA 1PYYA 3WS2A 4F3LB 4HNBA 3PBRA 4QJGA 1U60A 3MMHA 2GNXA 4BD1A 4E3MA 4X1MA 4GN2A 4K0XA 2HDRA 4K91A 2OSUA 4R70A 4RYEA 5GLDA 1SCWA 3CZDA 5HX9A 3SOIA 3UE3A 4MBFA 4KZ4A 4JLFA 1IOUA 4NEED 1KGGA 4LCMA 2Z2LB 4GDNA 3GQZA 4HJ6A 2H0TA 1W7FA 4CLCD 4KZ9A 3CWFA 4G3VA 1TDGA 1LHYA 2ZJ9A 5AJGA 4HEFA 1G5UA 2BTFP 1DJCA 4KQDA 1MZUA 1PIOA 1PWCA 5FSRA 4B93A 3IXDA 5E2FA 1IYPA 4OQGA 1EI5A 2M1CA 5D3OA 3JYIA 1S0WA 1W63M 1WYCA 2K31A 4NXGA 2KOIA 4IBRA 3NDEA 3PBSA 4IJGA 3Q82A 1XJ6A 5GLCA 3NECA 2GJ3A 2ZQ8A 1YLZA 4DMZA 3A3IA 4JGOA 1W8YA 4I3JA 1QMEA 2EFUA 3VV4A 3NOUC 3BW6A 3H7WA 5DFXA 1JWVA 1STZA 2V20A 5J8XA 3D3OA 1VQQA 3KX0X 5CTMA 2PDRA 4DE2A 3NJAA 2EX8A 4QY5A 3W8KA 3IX4A 3A3DA 3PAGA 1DRMA 4LLOB 1Q2PA 3EGDC 4HI4A 4GD6A 2XD5A 1NWZA 1W79A 2L1MA 4EQIA 2EFXA 4GCZA 2A2LA 1OJ5A 3LIBA 1YMSA 3O3VA 4Y15A 2VK3A 1TDLA 4O8GA 1LT0A 3C8CA 3NOTC 2HJEA 2VJWA 4E6XA 5DFYA 2O0YA 2JKRM 3KSIA 5FEGA 5GLBA 4Y0TA 5KMWA 3E2KA 1XA7A 2J8YA 4KZ8A 1DJBA 2JKGA 4HP9A 1S66L 4KG6A 4MDZA 5HARA 2WGWA 2JE5A 2V8FA 3FYZA 3E2LA 2PYPA 1F9IA 2XA7S 3C7VA 4R0QA 3IHBA 4JF6A 2Y2HA 4LRYC 2G2UA 3T4OA 4HESA 1MY8A 1MWSA 3IHAA 3PBQA 3UPNA 4S2IA 3OPLA 4BL2A 4II7A 2HP5A 4XT2B 5FQMA 2V0UA 5IT5A 3TG9A 2PT7A 2Y2QA 3IH9A 4B9OA 5M18A 5L2FA 2ZMFA 4PMAA 4KUKA 1PWGA 3BQ8A 2Y2JA 3A3EA 1F98A 1ESUA 3BFFA 2FH5A 3M6BA 1A0KA 1H5XA 4KG2A 4YFMA 5E43A 1BYWA 1K25A 3WS5A 3S1YA 2INWA 1G68A 1KOUA 2M7VA 4UA7A 2QJ7A 4Q8IA 1Z09A 4E3NA 2UV0E 3OPPA 4WF0A 3WWXA 4KZAA 1ONGA 2J7VA 3LO7A 1D7EA 3PBTA 4UQIS 5G18A 5FDHA 2XSSA 2WKEA 3IX8A 4P0MA 4H6JB 1L2SA 1PZOA 4AFIA 4F3LA 1H8MA 5M1AA 5HL6A 4CLCA 3OZHA 1MWRA 4NXFA 5JYOA 4OLDA 4Y0OA 1NRJA 4R38A 4JXVA 1K54A 4Z1WA 3CLOA 4RX2A 3ZQ5A 1ES5A 2V8CA 1ERMA 1D06A 5EUAA 3FV7A 5FQKA 1W63Q 1ERQA 3H82B 2V1ZA 1I5QA 3MBZA 2ZQ9A 1GHMA 2ZM2A 3UE0A 5HDCA 3Q7VB 4Q0IA 3IBRA 3IS2B 2JN7A 2XD1A 2P9VB 5AQ9A 4BQMA 3NULA 2PU4A 3PHYA 1K56A 4QD4A 5M19A 1K0KA 1Q2QA 5C5KA 4PM5A 5FQJA 4HJ3A 1KE3A 1LSWA 1ZTUA 3QP4A 4OOMA 2ZC6B 3T4KA 1D1JA 3DWZA 3DTEA 4L9EA 3MJQA 2GX5A 1H8ZA 4X56A 4WL9A 3N8RA 5AQBA 5EVIB 3UE6A 3KSGA 4BENA 5CTNA 4M4XA 3OOVA 2ZBBA 3GTCA 4E3KA 5FATA 1FSWA 4LPZA 3VFHA 1IYSA 1H3QA 3E4PA 4OQIA 5GHYA 3OCNA 4IEDA 3IBJA 3MSHA 2XFSA 5EVID 3W4PA 3Q1FA 3UO9A 3UNWA 4BBUA 1W5DA 3O88A 3KO6A 4C3QA 4S2PA 2Y2NA 1LI9A 3UN7A 1TD5A 3SZTA 2VGKA 3ZHHA 1L0GA 1V9ZA 1UGUA 3KYZA 1YMXA 1YSQA 5HD3A 2W1TB 3HLEA 4WM9A 3LY3A 3VSLA 1TS8A 5A90A 3HJKA 4HBUA 1L0FA 1XP4A 1XKZA 5A91A 1DJAA 3CAXA 4WEKA 4S2MA 3ZG9B 2HZ5A 4Y3IA 3B42A 3VP0A 4EBLA 1BLPA 1M40A 4S2LA 5F1GA 2OWHA 3BEBA 4P87A 1NZUA 5FDSA 4WYYA 4XT2A 1CEGA 1NY0A 3G6OA 5BOHA 2C6WB 4LV0A 2Z6CA 3VP1A 1S4RA 3N7WA 4PM7A 2J80A 4BLMA 3DTIA 1KDSA 1RGZA 2EXAA 4O7DA 4P6ZM 4DN0A 4EWFA 3T4LA 1O7EA 1JWPA 4BBTA 3LICA 2D01A 1CJFA 4S2JA 1XFQA 2J3TC 2AVXA 3DTKA 5J4EA 3W2ZA 3C30A 3C7UA 5FI7A 4QHCA 1HVBA 1QMFA 3QP1A 4NXBA 5CGXA 3ZG5A 4EUVA 3RXXA 1BLSA 2HP6A 2PAVP 3NIAA 3FWLA 3HLBA 1XJ4A 2QJ5A 2Y2KA 3MS6A 4ZDXA 3FC7A 5L09A 4H6JA 5J7EA 5F69A 3V67A 3E4OA 4QU3A 3D72A 1KE4A 3ZVTA 3QP2A 3NY4A 4N9LA 2OLVA 4OP8A 5TBMB 4E3JA 2LB5A 4EW7A 4Y0UA 3TE8A 3HUMA 4DE3A 1CK3A 3QP8A 4WZ5A 2WZXA 4JGQA 1WA9A 5CHJA 3H82A 3MFXA 3TRCA 1TF1A 2R78A 3Q7VA 4R4SA 2Y2LA 3IS2A 4LFUA 5HDSA 3K3CA 3DWKA 4NXEA 3G31A 4N9KA 1IYOA 1F2KA 5U47A 3CPTB 3AGDA 4Y2FA 2P9VA 1CI8A 3F1PB 4OQHA 1PFLA 2R9XA 4HH3A 4A5RA 1RCJA 2HP9A 1KGEA 2HV1A 5KSHA 5CEDA 1NLZA 3O87A 1OTEA 1K4FA 1FCOA 5EVLA 1IYQA 3VE3A 4RVAA 4RX3A 3G2ZA 1FCNA 1OT6A 1JTGA 5FAPA 4EU0A 5EVIA 2OLUA 1MC0A 5KSCA 3ZGAB 5F83A 3RJUA 3E4QA 4O01A 5AVFA 1L3LA 4F94A 3P98A 4GKUA 5J3WA 1J9MA 1GHIA 5F82A 4PKYA 4R3JA 4OH0A 5MC7A 3PBNA 3FPWA 3V5MA 3IH8A 1OTAA 2WKPA 3JVVA 2OV5A 1PZPA 1MXOA 2A24B 3OCLA 3GMWA 1S67L 4KQQA 4IBXA 3T1SA 5CEBA 4KUOA 4N1HA 4RA7A 1LL9A 2O99A 4MEZA 3SS5A 3ZYTA 1TS6A 3Q7ZA 1N4OA 3B47A 3BFCA 2IWDA 5JYPA 3AGFA 1BUEA 1K56D 5DTKA 3WRZA 1N9OA 2Z6DA 4MN6A 4CPKA 3SH7A 2W3DA 5TR7A 1ZG4A 4YINA 3NI9A 1FSYA 1BSGA 4HP4A 5E2HA 2HPBA 4ETZA 4YOFA 2W27A 3T12B 1BLHA 2JKRI 1OJGA 1S4SA 1K55A 3LR3A 3BM6A 4UA6A 5HD5A 1ZKJA 4DKIA 3KYEA 1ONHA 2KDKA 3LY4A 4PPRA 2XR0A 4FUWA 4X68A 3CMZA 4HH2A 3ICYA 2XH9A 1Y28A 4EEPA 2R9WA 2VGLS 5F1FA 1E3UA 3BRMA 2ZMVA 5E2EA 4ZTKA 4PAUA 4EESA 4JXGA 3LR4A 2L4RA 2Y2MA 4QWOA 5G4ZA 2CC1A 5AQAA 3IWOA 4WBGA 2V9AA 3S22A 4DJ2A 1XPBA 2Y8HA 3BFGA 2Y91A 3KSFA 3ZG8B 4RQ9A 3UB5P 5KIZA 1LL8A 4WZ4A 3R7WB 1PW1A 5HAPA 4DE0A 3P7NA 1VEUB 3PTEA 1K38A 2BLSA 3EWKA 4HBTA 3ITBA 5HFOA 5GLAA 1GA0A 4WELA 2I72A 2QPNA 1M6KA 5EE8A 1KE0A 4GJ4A 1ZG6A 1TS0A 2ZQCA 4MLLA 3LUQA 5CXWA 2BG1A 1MWUA 5FA7A 5TBMA 2X71A 2EX2A 3QP5A 3S7OA 3U4LP 1FR6A 1NYMA 3IF6A 3VE4A 3LFVA 4X25A 4BWIA 4UEYA 1FOFA 4UAAA 1VM1A 3H9WA 5LBRA 4E3OA 3IF5A 2B18A 4R4RA 2JKTI 3CUEA 1P9WA 5K5BA 4OPQA 4B4XA 1C3BA 2Y4AA 2H10A 3F1PA 3IT9A 4BJPA 2ZOIA 1PWDA 2G7UA 1S1YA 2JKFA 5HL1A 3F1OB 4JBFA 3QHYA 2HDSA 2JKTM 4N1XA 2WUQA 5CX7A 1K57A 3ZDJA 1OMEA 3BWLA 2CMNA 4S2KA 5EECA 1I2SA 2DRWA 4XXRA 4XUXA 4M3KA 2PD8A 3IX3A 2ZQ7A 1ES3A 3A0VA 3GSGA 4OOYA 5GL9A 2B5RA 1SDNA 4C6YA 4G3WA 1FIKA 1NRFA 3B33A 2QKPA 1NJ4A 5DVAA 5AQ7A 4L9FA 5EM0A 1OTDA 3L9KA 4PM6A 4X1LA 2FZ0A 3T4TA 2A24A 5DKKA 3SS4A 3ZG0A 3HUOA 3BYDA 1XXMA 2H0YA 1YLYA 1PW8A 4X6TA 3SW1A 3T1XA 1VETB 2XA7M 3IXGA 2ZD8A 5F5YA 2O9CA 3T50A 1CEFA 3ZCZA 4QPRA 4ZBEA 4U0XA 3S7QA 3ISGA 1YPRA 3HJIA 1T1BA 4MN5A 2J9PA 3OBFA 3A0SA 3FKVA 4EQ1A 1T18A 1DP6A 2J9OA 2YKFA 4H8RA 3GECA 3FKWA 5DKLA 4Q0JA 2BASA 2UWXA 3DBAA 2FFYA 1E25A 1G6OA 3G2YA 1IKGA 1XA1A 2W3EA 3WS0A 3EGXC 3V50A 2ZM0A 3K3DA 3EEAA 4JGPA 2VV8A 2LB9A 2VGJA 2OOLA 5AVEA 2X02A 5DTTA 2WKHA 4E3LA 1FQGA 4YNRA 5IHVA 2ZC7A 1P0ZA 4JGRA 3WS4A 3A3JA 5HSQA 1MBLA 2Y2PA 2EA9A 1XJ2A 5IU1A 4DF6A 3FPVA 4I5SA 2VV7A 4UQIM 1YT4A 4K0WA 2ZL1B 1VB6A 5F6AA 3BLSA 1Y54A 3JVUA 4KQRA 2QYBA 4GLQA 5HAIA 3P09A 4GNUA 1P9RA 5FAQA 4Y17A 4UHUA 2WADA 2W3HA 5TGFA 3R7WA 4WUJA 1IEMA 1VEUA 2E8JA 4ID4A 3C4OA 1PNEA 1HD8A 1L0DA 3Q07A 5G4YA 4I38A 2WGIA 2WKQA 3KYQA 3P01A 4EXOA 1G28A 1GSVA 1WE4A 2H5SA 4L0LA 2WK0A 1Y4OA 1EW0A 4OOLA 3NOPC 4QB8A 5E2GA 5HPFA 3M2JA 2RL3A 2W1RA 3BECA 2ZMAA 3CITA 2HDUA 3EQUA 1SKOB 3HLDA 2DCFA 2VZWA 4KZ3A 1T19A 5HDDA 2ZC3B 4E04A 4GOGA 3DTMA 3VP2A 5I94A 3UY6A 5TJJA 1AXBA 3ZNTA 1YLPA 3MQOA 2ZOHA 5L10A 1BTLA 3LIEA 1E3UD 3V3RA 5IS1A 1XGIA 2GDNA 3MZEA 3W4QA 4EEUA 5EPHA 1KDWA 3F1OA 1H8YA 4Y5FA 2KX6A 2X01A 2PR6A 5CERA 2VA0A 4HJ4A 4LV1A 2IWBA 4YWZA 2EWVA 3GVBA 1S6RA 3U2AA 5HWTA 3VOLA 1YLWA 2Q0OA 2J3TD 4HHDA 3V39A 3C4PA 1OT9A 2YKHA 2H28A 5FI2A 4LENA 4WEJA 4JKTA 2P04A 4D2OA 3EQVA 3UDFA 3UPPA 5KZHA 4MCWA 2K2NA 4HOIA 3M2KA 2IA2A 2A49A 5CRFA 1K4EA 2EXBA 2I9VA 4JXSA 4ZJ3A 1CF0A 1KVLA 1ES4A 1RGYA 3VOYA 3D9YA 1PRQA 3PBOA 4PHTA 2Y79A 4FD8A 5HWVA 3LIFA 4KZBA 2Y2IA 4OPRA 4ETXA 1PI4A 4GZBA 5HWWA 1T1AA 1VETA 2A3UA 3G35A 3C38A 1DY6A 1FILA 4FSFA 3RXWA 4FH2A 4CLCC 1PI5A 5DTSA 3IWQA 1I2WA 3G34A 3UB7A 3CI6A 1FCMA 1MWTA 3MKFA 3BY9A 1BZAA 3O5YA 5HW3A 5FQ9A
chains in the Genus database with same CATH topology
2XD1A 3SS3A 2P9VB 4KENB 1NYYA 4ZJ1A 5AQ9A 4BQMA 3UDIA 2PU4A 4WZ4A 4P6BA 1PW1A 1K56A 1KGFA 5HAQA 1Z6FA 5HAPA 4DE0A 4QD4A 1K6RA 5M19A 3PTEA 2JCHA 1Q2QA 3O86A 1K38A 2BLSA 5CHUA 4X55A 2XFTA 4HBTA 3ITBA 3GR2A 4PM5A 2EX9A 5FQJA 1KE3A 5HFOA 4NK3A 5GLAA 4S2NA 1GA0A 4WELA 2I72A 2QPNA 1MKIA 1M6KA 4OOMA 4BD0A 2Y55A 2ZC6B 2E8IA 1MPLA 3N8LA 1KE0A 3QNBA 4WMCD 3FZCA 3DWZA 1ZG6A 5GHXA 4EV4A 2ZQCA 4MLLA 2PU2A 1IKIA 2ZQDA 2Z2MB 5CXWA 2BG1A 4EBNA 1K6SA 1H8ZA 1MWUA 2JBFA 2XGNA 4OONA 4X56A 5FA7A 4CJNA 3N8RA 5AQBA 1TEMA 5EVIB 3SH9A 2X71A 4BENA 2WAEA 2G2WA 2EX2A 2WGWB 5CTNA 5FASA 1FR6A 3D4FA 3HLWA 5DF7A 4ZJ2A 4JF5A 1NYMA 3BFEA 3GTCA 4E3KA 3IF6A 5FATA 5A93A 4ZAMA 4MBKA 5CGSA 1FSWA 1GHPA 3VFHA 1IYSA 2JC7A 4OQIA 5GHYA 1FOFA 3OCNA 1VM1A 4UAAA 4IEDA 3CG5A 4E3OA 3IF5A 4KZ7A 1ESIA 2XFSA 4R4RA 5EVID 3TOIA 3W4PA 4X69A 2ZQAA 3HBRA 4OPQA 4B4XA 1C3BA 3Q1FA 3UO9A 1BULA 2Y4AA 3UNWA 2H10A 3IF6C 5FQQA 1W5DA 3O88A 3HVFA 4OPYA 1IELA 3IT9A 4BJPA 1E4DA 4C3QA 1PWDA 4S2PA 2Y2NA 2HDQA 1LI9A 3UN7A 3ZFZA 4R3BA 4DXCA 4LV2A 4N92A 5HL1A 3NBLA 3BFDA 3ITAA 1GCEA 3OC2A 3VMAA 2VGKA 3BLMA 3ZHHA 4MBHA 1L0GA 4JBFA 5FQIA 4KG5A 1YMXA 3QHYA 1LLBA 2WAFA 3IF6B 2HDSA 4N1XA 2WUQA 3S4XA 1K57A 3B3XA 3ZDJA 1OMEA 3HLEA 4WM9A 4JPMA 4S2KA 5EECA 3LY3A 1I2SA 4S2OA 1NZOA 3VSLA 2DRWA 1N9BA 4XXRA 5A90A 4HBUA 1L0FA 1XP4A 4WMCA 3GV9A 4DXBA 1XKZA 4OVDA 4XUXA 5A91A 1DJAA 1ZC2A 4M3KA 4LV3A 3MKEA 1LI0A 1EWZA 5EE8A 4WEKA 4S2MA 2ZQ7A 2XDMA 3ZG9B 1K57C 1ES3A 4NETA 3GSGA 2P74A 2XEPA 3IXHA 4OOYA 5GL9A 3AGEA 2B5RA 3VP0A 1SDNA 4EBLA 1SDEA 1BLPA 4JXWA 4C6YA 1NRFA 3HUNA 1NJ4A 1BT5A 3VSKA 1M40A 5DVAA 1K54C 5AQ7A 1TVFA 2PBYA 2WKIA 4S2LA 5F1GA 1HTZA 2Y2OA 5FI6A 1EROA 2C5WB 3BEBA 4PM6A 1PYYA 3N6IA 4OLGA 3WS2A 4P87A 1NZUA 4QJGA 3PBRA 1U60A 4WYYA 3WS1A 1CEGA 3SS4A 1ALQA 3NDGA 4BD1A 4E3MA 1NY0A 4DRTA 4GN2A 2QMIA 3ZG0A 3HUOA 4K0XA 2HDRA 3BYDA 5BOHA 1XXMA 1ES2A 2H0YA 4K91A 2OSUA 1YLYA 1PW8A 2C6WB 4LV0A 4X6TA 4R23A 4RYEA 3VP1A 4IVIA 5GLDA 3IXGA 3N7WA 2ZD8A 1SCWA 3CZDA 4PM7A 5HX9A 3SOIA 3UE3A 4MBFA 4BLMA 4KZ4A 4U0TA 4JLFA 1KDSA 1RGZA 4DDYA 2EXAA 4O7DA 1CEFA 3ZCZA 4EWFA 1O7EA 1JWPA 1KGGA 1YLJA 3PAEA 4LCMA 4U0XA 4ZBEA 2Z2LB 4GDNA 3ISGA 4S2JA 3GQZA 2H0TA 1W7FA 4Z9QA 3MZDA 3QNCA 4KZ9A 4FCFA 1TDGA 1LHYA 2J9PA 2ZJ9A 2XQZA 4HEFA 3FKVA 3OPHA 3C7UA 5FI7A 1DJCA 4S2NC 4QHCA 2ZC4B 2J9OA 1PWCA 1PIOA 5FSRA 3IXDA 4H8RA 3VFFA 5E2FA 1HVBA 1QMFA 3NC8A 1IYPA 5CGXA 3ZG5A 3HL9A 3FKWA 3RXXA 4OQGA 3DW0A 1BLSA 2HP6A 3NIAA 1EI5A 3ZVWA 2UWXA 5D3OA 3FWLA 3JYIA 2FFYA 1S0WA 1E25A 3HLBA 4E3IA 4JF4A 1WYCA 3G2YA 2Y2KA 1IKGA 4IBRA 1XA1A 3LEZA 3NDEA 4ZDXA 3WS0A 2Y2GA 3V50A 2ZM0A 3PBSA 1GA9A 3Q82A 5TFQA 1WYBA 4OKPA 4QU3A 5GLCA 2ZQ8A 2VGJA 1YLZA 3MXSA 5CECA 1KE4A 2X02A 5DTTA 2WKHA 4E3LA 3ZVTA 1FQGA 5EOEA 3NY4A 3HLGA 4N9LA 5DF9A 2OLVA 5IHVA 2ZC7A 4LCLA 4OP8A 3WS4A 3A3IA 3A3JA 4E3JA 5FAOA 4E6WA 4XUZA 1MBLA 1W8YA 2Y2PA 4Y0UA 1QMEA 2EFUA 3HUMA 4X53A 2WYXA 4DE3A 4GDBA 3A3FA 2FFFB 4DF6A 1CK3A 3VP4A 2QZ6A 4R1GA 1YT4A 1JWVA 4WZ5A 2WZXA 4K0WA 2V20A 5DF8A 4QY6A 1CI9A 5CHJA 5J8XA 1BLCA 3IQAA 1XX2A 1G6AA 1VQQA 1JTDA 3BLSA 1YLTA 5CTMA 3Q7VA 4R4SA 2Y2LA 1Y54A 4KZ5A 4DE2A 3N4IA 3DWKA 2EX8A 4KQRA 2WZZA 2ZM8A 4QY5A 3W8KA 3G31A 4N9KA 1IYOA 4GB7A 5U47A 1SHVA 3A3DA 3PAGA 5HAIA 3P09A 4GNUA 3AGDA 4U3TA 4BL3A 1Q2PA 2P9VA 1CI8A 4GD6A 5FAQA 2DNSA 4UHUA 4DE1A 2WADA 2XD5A 5TGFA 4OQHA 4WZ5C 1W79A 4EQIA 2EFXA 2R9XA 1IEMA 4A5RA 1RCJA 2HP9A 1KGEA 5KSHA 1YMSA 4ID4A 4OPZA 3C4OA 3IWIA 5CEDA 3O3VA 1HD8A 1L0DA 3Q07A 1TDLA 2WGIA 3O87A 1K4FA 1WE4A 2XK1A 1FCOA 4B88A 5EVLA 4E6XA 1IYQA 2H5SA 3MZFA 4L0LA 2WK0A 4RVAA 5A92A 5GLBA 4FH4A 4OOLA 4RX3A 4Y0TA 3ZG7B 3G2ZA 1FCNA 5KMWA 3E2KA 1JTGA 1XA7A 2J8YA 4KZ8A 4QB8A 5FAPA 5E2GA 3M2JA 2RL3A 3N8SA 2OLUA 5EVIA 1DJBA 4OP5A 3BECA 5KSCA 2ZMAA 3ZGAB 5F83A 3HREA 4KG6A 5HARA 3RJUA 3M6HA 2WGWA 2HDUA 2JE5A 3EQUA 3HLDA 4IVKA 3FYZA 4Y7PA 2DCFA 3E2LA 4KZ3A 3HLFA 4F94A 4OQ0A 2ZC3B 3P98A 4GKUA 4C75A 4GOGA 3C7VA 3DTMA 4R0QA 3IHBA 4JF6A 2Y2HA 3VP2A 5I94A 1J9MA 3UY6A 1GHIA 5F82A 1SKFA 5EVIC 1AXBA 2G2UA 1YLPA 4R3JA 3ZNTA 4HESA 1MY8A 1MWSA 3IHAA 3PBNA 3PBQA 4OH0A 3UPNA 1RP5A 3V5MA 4S2IA 3IH8A 3OPLA 1BTLA 3MFDA 1JWZA 3ZNYA 2OV5A 3MXRA 1E3UD 3V3RA 4GD8A 3UE1A 1PZPA 4UA9A 1MXOA 4P85A 4BL2A 3OCLA 3GMWA 2HP5A 5FQMA 3VOZA 2EX6A 3HLCA 3TG9A 1XGIA 2GDNA 3MZEA 3NCKA 1L0EA 2IWCA 4IBXA 4KQQA 4PM9A 2Y2QA 3TSGA 3IH9A 4KZ6A 1XGJA 3UDXA 3W4QA 5EPHA 5CEBA 1O07A 1KDWA 4N1HA 5M18A 4RA7A 5L2FA 4PMAA 1LL9A 1H8YA 3G4PA 3SH8A 4MEZA 1PWGA 4EBPA 1HZOA 4KQOA 2RCXA 1KVMA 2X01A 3SS5A 5CERA 1YQSA 2IWBA 4LV1A 3Q7ZA 2Y2JA 3A3EA 1N4OA 3GVBA 3IXBA 1ESUA 3BFFA 3C5AA 3M6BA 1S6RA 3BFCA 2IWDA 5JYPA 3AGFA 1H5XA 3G30A 4KG2A 1BUEA 4YFMA 5E43A 1K25A 3CJMA 1K56D 1YLWA 3S1YA 3WS5A 1G68A 5DTKA 3WRZA 2V2FF 5EOOA 1W8QA 4MNRA 3V39A 3C4PA 3I7JA 4UA7A 5GHZA 3SH7A 4CPKA 4Q8IA 4E3NA 5TR7A 1ZG4A 3OPPA 5FI2A 4YINA 3WWXA 1YM1A 4KZAA 3NI9A 4LENA 1ONGA 4WEJA 1FSYA 4JKTA 4D2OA 3VP3A 3EQVA 1BSGA 3UDFA 2J7VA 3LO7A 3W4OA 5E2HA 2HPBA 3UPPA 5KZHA 3PBTA 3G32A 5G18A 3M2KA 4DDSA 5FDHA 1BLHA 2A49A 2WKEA 5CRFA 4P0MA 1K4EA 2Q9MA 1K55A 2XLNA 2EXBA 1L2SA 1PZOA 3BM6A 3OPRA 4UA6A 1ZKJA 4DKIA 2ZC5B 1JVJA 1ONHA 4JXSA 4ZJ3A 1KVLA 1ES4A 5CGWA 1RGYA 5M1AA 3VOYA 3PBOA 3LY4A 3OZHA 4PPRA 1MWRA 4FD8A 5JYOA 4OLDA 2XR0A 4Y0OA 4KZBA 2Y59A 2Y2IA 3CMZA 4OPRA 4X68A 1PI4A 4B4ZA 3WRTA 2XH9A 5CHMA 4GZBA 4JXVA 2R9WA 3V3SA 3GRJA 1K54A 1E3UA 5F1FA 2XF3A 2ZLYA 2A3UA 1K55C 4RX2A 3LCEA 3BRMA 3G35A 1ES5A 2Q9NA 5E2EA 4ZTKA 4EUZA 1ERMA 1FR1A 2WGVA 1DY6A 4JXGA 3Q81A 5AQAA 5EUAA 2Y2MA 4FSFA 3RXWA 4FH2A 3FV7A 2CC1A 5FQKA 1PI5A 1ERQA 4PM8A 3IWOA 3IWQA 1LL5A 1I2WA 1I5QA 2V1ZA 3G34A 1NXYA 5DTSA 1FCMA 4WBGA 3MBZA 2ZQ9A 1GHMA 2ZM2A 3S22A 3UE0A 1MWTA 3MKFA 3Q7VB 1XPBA 3BFGA 2Y91A 3ZG8B 3UPOA 1BZAA 5HW3A 5FQ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XD1 A;  3SS3 A;  2P9V B;  4KEN B;  1NYY A;  4ZJ1 A;  5AQ9 A;  4BQM A;  3UDI A;  2PU4 A;  4WZ4 A;  4P6B A;  1PW1 A;  1K56 A;  1KGF A;  5HAQ A;  1Z6F A;  5HAP A;  4DE0 A;  4QD4 A;  1K6R A;  5M19 A;  3PTE A;  2JCH A;  1Q2Q A;  3O86 A;  1K38 A;  2BLS A;  5CHU A;  4X55 A;  2XFT A;  4HBT A;  3ITB A;  3GR2 A;  4PM5 A;  2EX9 A;  5FQJ A;  1KE3 A;  5HFO A;  4NK3 A;  5GLA A;  4S2N A;  1GA0 A;  4WEL A;  2I72 A;  2QPN A;  1MKI A;  1M6K A;  4OOM A;  4BD0 A;  2Y55 A;  2ZC6 B;  2E8I A;  1MPL A;  3N8L A;  1KE0 A;  3QNB A;  4WMC D;  3FZC A;  3DWZ A;  1ZG6 A;  5GHX A;  4EV4 A;  2ZQC A;  4MLL A;  2PU2 A;  1IKI A;  2ZQD A;  2Z2M B;  5CXW A;  2BG1 A;  4EBN A;  1K6S A;  1H8Z A;  1MWU A;  2JBF A;  2XGN A;  4OON A;  4X56 A;  5FA7 A;  4CJN A;  3N8R A;  5AQB A;  1TEM A;  5EVI B;  3SH9 A;  2X71 A;  4BEN A;  2WAE A;  2G2W A;  2EX2 A;  2WGW B;  5CTN A;  5FAS A;  1FR6 A;  3D4F A;  3HLW A;  5DF7 A;  4ZJ2 A;  4JF5 A;  1NYM A;  3BFE A;  3GTC A;  4E3K A;  3IF6 A;  5FAT A;  5A93 A;  4ZAM A;  4MBK A;  5CGS A;  1FSW A;  1GHP A;  3VFH A;  1IYS A;  2JC7 A;  4OQI A;  5GHY A;  1FOF A;  3OCN A;  1VM1 A;  4UAA A;  4IED A;  3CG5 A;  4E3O A;  3IF5 A;  4KZ7 A;  1ESI A;  2XFS A;  4R4R A;  5EVI D;  3TOI A;  3W4P A;  4X69 A;  2ZQA A;  3HBR A;  4OPQ A;  4B4X A;  1C3B A;  3Q1F A;  3UO9 A;  1BUL A;  2Y4A A;  3UNW A;  2H10 A;  3IF6 C;  5FQQ A;  1W5D A;  3O88 A;  3HVF A;  4OPY A;  1IEL A;  3IT9 A;  4BJP A;  1E4D A;  4C3Q A;  1PWD A;  4S2P A;  2Y2N A;  2HDQ A;  1LI9 A;  3UN7 A;  3ZFZ A;  4R3B A;  4DXC A;  4LV2 A;  4N92 A;  5HL1 A;  3NBL A;  3BFD A;  3ITA A;  1GCE A;  3OC2 A;  3VMA A;  2VGK A;  3BLM A;  3ZHH A;  4MBH A;  1L0G A;  4JBF A;  5FQI A;  4KG5 A;  1YMX A;  3QHY A;  1LLB A;  2WAF A;  3IF6 B;  2HDS A;  4N1X A;  2WUQ A;  3S4X A;  1K57 A;  3B3X A;  3ZDJ A;  1OME A;  3HLE A;  4WM9 A;  4JPM A;  4S2K A;  5EEC A;  3LY3 A;  1I2S A;  4S2O A;  1NZO A;  3VSL A;  2DRW A;  1N9B A;  4XXR A;  5A90 A;  4HBU A;  1L0F A;  1XP4 A;  4WMC A;  3GV9 A;  4DXB A;  1XKZ A;  4OVD A;  4XUX A;  5A91 A;  1DJA A;  1ZC2 A;  4M3K A;  4LV3 A;  3MKE A;  1LI0 A;  1EWZ A;  5EE8 A;  4WEK A;  4S2M A;  2ZQ7 A;  2XDM A;  3ZG9 B;  1K57 C;  1ES3 A;  4NET A;  3GSG A;  2P74 A;  2XEP A;  3IXH A;  4OOY A;  5GL9 A;  3AGE A;  2B5R A;  3VP0 A;  1SDN A;  4EBL A;  1SDE A;  1BLP A;  4JXW A;  4C6Y A;  1NRF A;  3HUN A;  1NJ4 A;  1BT5 A;  3VSK A;  1M40 A;  5DVA A;  1K54 C;  5AQ7 A;  1TVF A;  2PBY A;  2WKI A;  4S2L A;  5F1G A;  1HTZ A;  2Y2O A;  5FI6 A;  1ERO A;  2C5W B;  3BEB A;  4PM6 A;  1PYY A;  3N6I A;  4OLG A;  3WS2 A;  4P87 A;  1NZU A;  4QJG A;  3PBR A;  1U60 A;  4WYY A;  3WS1 A;  1CEG A;  3SS4 A;  1ALQ A;  3NDG A;  4BD1 A;  4E3M A;  1NY0 A;  4DRT A;  4GN2 A;  2QMI A;  3ZG0 A;  3HUO A;  4K0X A;  2HDR A;  3BYD A;  5BOH A;  1XXM A;  1ES2 A;  2H0Y A;  4K91 A;  2OSU A;  1YLY A;  1PW8 A;  2C6W B;  4LV0 A;  4X6T A;  4R23 A;  4RYE A;  3VP1 A;  4IVI A;  5GLD A;  3IXG A;  3N7W A;  2ZD8 A;  1SCW A;  3CZD A;  4PM7 A;  5HX9 A;  3SOI A;  3UE3 A;  4MBF A;  4BLM A;  4KZ4 A;  4U0T A;  4JLF A;  1KDS A;  1RGZ A;  4DDY A;  2EXA A;  4O7D A;  1CEF A;  3ZCZ A;  4EWF A;  1O7E A;  1JWP A;  1KGG A;  1YLJ A;  3PAE A;  4LCM A;  4U0X A;  4ZBE A;  2Z2L B;  4GDN A;  3ISG A;  4S2J A;  3GQZ A;  2H0T A;  1W7F A;  4Z9Q A;  3MZD A;  3QNC A;  4KZ9 A;  4FCF A;  1TDG A;  1LHY A;  2J9P A;  2ZJ9 A;  2XQZ A;  4HEF A;  3FKV A;  3OPH A;  3C7U A;  5FI7 A;  1DJC A;  4S2N C;  4QHC A;  2ZC4 B;  2J9O A;  1PWC A;  1PIO A;  5FSR A;  3IXD A;  4H8R A;  3VFF A;  5E2F A;  1HVB A;  1QMF A;  3NC8 A;  1IYP A;  5CGX A;  3ZG5 A;  3HL9 A;  3FKW A;  3RXX A;  4OQG A;  3DW0 A;  1BLS A;  2HP6 A;  3NIA A;  1EI5 A;  3ZVW A;  2UWX A;  5D3O A;  3FWL A;  3JYI A;  2FFY A;  1S0W A;  1E25 A;  3HLB A;  4E3I A;  4JF4 A;  1WYC A;  3G2Y A;  2Y2K A;  1IKG A;  4IBR A;  1XA1 A;  3LEZ A;  3NDE A;  4ZDX A;  3WS0 A;  2Y2G A;  3V50 A;  2ZM0 A;  3PBS A;  1GA9 A;  3Q82 A;  5TFQ A;  1WYB A;  4OKP A;  4QU3 A;  5GLC A;  2ZQ8 A;  2VGJ A;  1YLZ A;  3MXS A;  5CEC A;  1KE4 A;  2X02 A;  5DTT A;  2WKH A;  4E3L A;  3ZVT A;  1FQG A;  5EOE A;  3NY4 A;  3HLG A;  4N9L A;  5DF9 A;  2OLV A;  5IHV A;  2ZC7 A;  4LCL A;  4OP8 A;  3WS4 A;  3A3I A;  3A3J A;  4E3J A;  5FAO A;  4E6W A;  4XUZ A;  1MBL A;  1W8Y A;  2Y2P A;  4Y0U A;  1QME A;  2EFU A;  3HUM A;  4X53 A;  2WYX A;  4DE3 A;  4GDB A;  3A3F A;  2FFF B;  4DF6 A;  1CK3 A;  3VP4 A;  2QZ6 A;  4R1G A;  1YT4 A;  1JWV A;  4WZ5 A;  2WZX A;  4K0W A;  2V20 A;  5DF8 A;  4QY6 A;  1CI9 A;  5CHJ A;  5J8X A;  1BLC A;  3IQA A;  1XX2 A;  1G6A A;  1VQQ A;  1JTD A;  3BLS A;  1YLT A;  5CTM A;  3Q7V A;  4R4S A;  2Y2L A;  1Y54 A;  4KZ5 A;  4DE2 A;  3N4I A;  3DWK A;  2EX8 A;  4KQR A;  2WZZ A;  2ZM8 A;  4QY5 A;  3W8K A;  3G31 A;  4N9K A;  1IYO A;  4GB7 A;  5U47 A;  1SHV A;  3A3D A;  3PAG A;  5HAI A;  3P09 A;  4GNU A;  3AGD A;  4U3T A;  4BL3 A;  1Q2P A;  2P9V A;  1CI8 A;  4GD6 A;  5FAQ A;  2DNS A;  4UHU A;  4DE1 A;  2WAD A;  2XD5 A;  5TGF A;  4OQH A;  4WZ5 C;  1W79 A;  4EQI A;  2EFX A;  2R9X A;  1IEM A;  4A5R A;  1RCJ A;  2HP9 A;  1KGE A;  5KSH A;  1YMS A;  4ID4 A;  4OPZ A;  3C4O A;  3IWI A;  5CED A;  3O3V A;  1HD8 A;  1L0D A;  3Q07 A;  1TDL A;  2WGI A;  3O87 A;  1K4F A;  1WE4 A;  2XK1 A;  1FCO A;  4B88 A;  5EVL A;  4E6X A;  1IYQ A;  2H5S A;  3MZF A;  4L0L A;  2WK0 A;  4RVA A;  5A92 A;  5GLB A;  4FH4 A;  4OOL A;  4RX3 A;  4Y0T A;  3ZG7 B;  3G2Z A;  1FCN A;  5KMW A;  3E2K A;  1JTG A;  1XA7 A;  2J8Y A;  4KZ8 A;  4QB8 A;  5FAP A;  5E2G A;  3M2J A;  2RL3 A;  3N8S A;  2OLU A;  5EVI A;  1DJB A;  4OP5 A;  3BEC A;  5KSC A;  2ZMA A;  3ZGA B;  5F83 A;  3HRE A;  4KG6 A;  5HAR A;  3RJU A;  3M6H A;  2WGW A;  2HDU A;  2JE5 A;  3EQU A;  3HLD A;  4IVK A;  3FYZ A;  4Y7P A;  2DCF A;  3E2L A;  4KZ3 A;  3HLF A;  4F94 A;  4OQ0 A;  2ZC3 B;  3P98 A;  4GKU A;  4C75 A;  4GOG A;  3C7V A;  3DTM A;  4R0Q A;  3IHB A;  4JF6 A;  2Y2H A;  3VP2 A;  5I94 A;  1J9M A;  3UY6 A;  1GHI A;  5F82 A;  1SKF A;  5EVI C;  1AXB A;  2G2U A;  1YLP A;  4R3J A;  3ZNT A;  4HES A;  1MY8 A;  1MWS A;  3IHA A;  3PBN A;  3PBQ A;  4OH0 A;  3UPN A;  1RP5 A;  3V5M A;  4S2I A;  3IH8 A;  3OPL A;  1BTL A;  3MFD A;  1JWZ A;  3ZNY A;  2OV5 A;  3MXR A;  1E3U D;  3V3R A;  4GD8 A;  3UE1 A;  1PZP A;  4UA9 A;  1MXO A;  4P85 A;  4BL2 A;  3OCL A;  3GMW A;  2HP5 A;  5FQM A;  3VOZ A;  2EX6 A;  3HLC A;  3TG9 A;  1XGI A;  2GDN A;  3MZE A;  3NCK A;  1L0E A;  2IWC A;  4IBX A;  4KQQ A;  4PM9 A;  2Y2Q A;  3TSG A;  3IH9 A;  4KZ6 A;  1XGJ A;  3UDX A;  3W4Q A;  5EPH A;  5CEB A;  1O07 A;  1KDW A;  4N1H A;  5M18 A;  4RA7 A;  5L2F A;  4PMA A;  1LL9 A;  1H8Y A;  3G4P A;  3SH8 A;  4MEZ A;  1PWG A;  4EBP A;  1HZO A;  4KQO A;  2RCX A;  1KVM A;  2X01 A;  3SS5 A;  5CER A;  1YQS A;  2IWB A;  4LV1 A;  3Q7Z A;  2Y2J A;  3A3E A;  1N4O A;  3GVB A;  3IXB A;  1ESU A;  3BFF A;  3C5A A;  3M6B A;  1S6R A;  3BFC A;  2IWD A;  5JYP A;  3AGF A;  1H5X A;  3G30 A;  4KG2 A;  1BUE A;  4YFM A;  5E43 A;  1K25 A;  3CJM A;  1K56 D;  1YLW A;  3S1Y A;  3WS5 A;  1G68 A;  5DTK A;  3WRZ A;  2V2F F;  5EOO A;  1W8Q A;  4MNR A;  3V39 A;  3C4P A;  3I7J A;  4UA7 A;  5GHZ A;  3SH7 A;  4CPK A;  4Q8I A;  4E3N A;  5TR7 A;  1ZG4 A;  3OPP A;  5FI2 A;  4YIN A;  3WWX A;  1YM1 A;  4KZA A;  3NI9 A;  4LEN A;  1ONG A;  4WEJ A;  1FSY A;  4JKT A;  4D2O A;  3VP3 A;  3EQV A;  1BSG A;  3UDF A;  2J7V A;  3LO7 A;  3W4O A;  5E2H A;  2HPB A;  3UPP A;  5KZH A;  3PBT A;  3G32 A;  5G18 A;  3M2K A;  4DDS A;  5FDH A;  1BLH A;  2A49 A;  2WKE A;  5CRF A;  4P0M A;  1K4E A;  2Q9M A;  1K55 A;  2XLN A;  2EXB A;  1L2S A;  1PZO A;  3BM6 A;  3OPR A;  4UA6 A;  1ZKJ A;  4DKI A;  2ZC5 B;  1JVJ A;  1ONH A;  4JXS A;  4ZJ3 A;  1KVL A;  1ES4 A;  5CGW A;  1RGY A;  5M1A A;  3VOY A;  3PBO A;  3LY4 A;  3OZH A;  4PPR A;  1MWR A;  4FD8 A;  5JYO A;  4OLD A;  2XR0 A;  4Y0O A;  4KZB A;  2Y59 A;  2Y2I A;  3CMZ A;  4OPR A;  4X68 A;  1PI4 A;  4B4Z A;  3WRT A;  2XH9 A;  5CHM A;  4GZB A;  4JXV A;  2R9W A;  3V3S A;  3GRJ A;  1K54 A;  1E3U A;  5F1F A;  2XF3 A;  2ZLY A;  2A3U A;  1K55 C;  4RX2 A;  3LCE A;  3BRM A;  3G35 A;  1ES5 A;  2Q9N A;  5E2E A;  4ZTK A;  4EUZ A;  1ERM A;  1FR1 A;  2WGV A;  1DY6 A;  4JXG A;  3Q81 A;  5AQA A;  5EUA A;  2Y2M A;  4FSF A;  3RXW A;  4FH2 A;  3FV7 A;  2CC1 A;  5FQK A;  1PI5 A;  1ERQ A;  4PM8 A;  3IWO A;  3IWQ A;  1LL5 A;  1I2W A;  1I5Q A;  2V1Z A;  3G34 A;  1NXY A;  5DTS A;  1FCM A;  4WBG A;  3MBZ A;  2ZQ9 A;  1GHM A;  2ZM2 A;  3S22 A;  3UE0 A;  1MWT A;  3MKF A;  3Q7V B;  1XPB A;  3BFG A;  2Y91 A;  3ZG8 B;  3UPO A;  1BZA A;  5HW3 A;  5FQ9 A; 
#chains in the Genus database with same CATH topology
 4R6L A;  4HIA A;  2W3F A;  3SS3 A;  5EVE A;  1NYY A;  5HPI A;  3UB9 A;  4P6B A;  4CLC B;  1K6R A;  2JCH A;  5CHU A;  3HCY A;  2D02 A;  2HJ9 C;  1MKI A;  3L7H A;  4BD0 A;  1MPL A;  5GHX A;  1J3W A;  4EV4 A;  1IFQ A;  2HGV A;  2PU2 A;  1IKI A;  2ZQD A;  1K6S A;  4OON A;  2OWJ A;  1TEM A;  4BMW A;  3MQ0 A;  1ZHH B;  5HZH A;  2WAE A;  3KSH A;  5DF7 A;  4ZJ2 A;  4JF5 A;  3LYX A;  2MJ6 A;  3BFE A;  2KLI A;  5A93 A;  4ZAM A;  5CGS A;  3T4S A;  2JC7 A;  2W1T A;  2ZL1 A;  3MXQ A;  2ACG A;  3CG5 A;  4KZ7 A;  1ESI A;  3TOI A;  3R4K A;  2QHK A;  1ACF A;  4X69 A;  2ZQA A;  1X0O A;  2PBD P;  4IHQ A;  2L0W A;  1NLY A;  4OPY A;  1IEL A;  3OLO A;  1E4D A;  3QP6 A;  2HDQ A;  4EER A;  4R3B A;  4N92 A;  4EET B;  1GCE A;  3LEQ A;  3VMA A;  4MBH A;  4LRZ E;  5FQI A;  1H0M A;  4KG5 A;  1YAX A;  2OAQ 1;  2WAF A;  3S4X A;  3B3X A;  3T1R A;  1HLU P;  1F5M A;  4S2O A;  1N9B A;  4R3A A;  2PHY A;  1DP9 A;  4D60 A;  4WMC A;  1SKO A;  4OVD A;  2V1B A;  1ZC2 A;  1JNU A;  2W3G A;  3LID A;  2XEP A;  2DMW A;  1SDE A;  4JXW A;  3HUN A;  4MN7 A;  1BT5 A;  4I3A A;  1TVF A;  2PBY A;  1GSW A;  4LGW A;  2GZA A;  2C5W B;  2V1A A;  3N6I A;  4OLG A;  3WS1 A;  2B95 A;  1ALQ A;  3NDG A;  4DRT A;  2QMI A;  1ES2 A;  2NUT C;  3F1N B;  4R23 A;  3PR6 A;  4IVI A;  1VHM A;  4U0T A;  4DDY A;  4HY8 A;  4CLC E;  1YLJ A;  3PAE A;  5FEF A;  4Z9Q A;  3MZD A;  3QNC A;  4FCF A;  2XQZ A;  5L07 A;  2J3W A;  3OPH A;  1XFN A;  4S2N C;  3T1Q B;  2ZC4 B;  3CHW P;  3VFF A;  3NC8 A;  1DP8 A;  3HL9 A;  2M7U A;  3EOI A;  3DW0 A;  3ZVW A;  2VLG A;  4E3I A;  4JF4 A;  4ME4 A;  3LR0 A;  3LEZ A;  2Y2G A;  4FOF A;  5DJU A;  3CPT A;  1GA9 A;  5TFQ A;  1WYB A;  4OKP A;  2HF6 A;  3BJN A;  3MXS A;  2PRF A;  5CEC A;  5EOE A;  3HLG A;  5DF9 A;  3MR0 A;  1OTB A;  4LCL A;  5FAO A;  3A0R A;  3S7P A;  4E6W A;  4XUZ A;  2W0N A;  4X53 A;  5FL3 A;  2WYX A;  4GDB A;  3A3F A;  2FFF B;  3UB8 A;  3VP4 A;  2QZ6 A;  4R1G A;  5DF8 A;  4QY6 A;  1CI9 A;  5I5L A;  1BLC A;  3IQA A;  1XX2 A;  1G6A A;  1JTD A;  1YLT A;  4GHI B;  3JPU A;  4KZ5 A;  3N4I A;  1LSV A;  2WZZ A;  2ZM8 A;  2PYR A;  4GW9 A;  4GB7 A;  3LGO A;  1SHV A;  3MQQ A;  4U3T A;  4BL3 A;  2DNS A;  4DE1 A;  4WZ5 C;  2VGL M;  3UMD A;  4OPZ A;  3IWI A;  4GS9 B;  2XK1 A;  1N9N A;  4B88 A;  2V0W A;  1SZV A;  3MZF A;  1UWN X;  5A92 A;  4FH4 A;  2B02 A;  3UB6 A;  3ZG7 B;  3RFB A;  2OAP 1;  3N8S A;  4OP5 A;  1P97 A;  3HRE A;  3M6H A;  4IVK A;  4Y7P A;  3HLF A;  4OQ0 A;  4C75 A;  2O9A A;  4ARZ B;  1SKF A;  4P6Z S;  5EV0 A;  3LI9 A;  5EVI C;  2P08 A;  4O0P A;  1RP5 A;  2VKS A;  1AWI A;  3MFD A;  1JWZ A;  1LSX A;  4HQA A;  3ZNY A;  3MXR A;  4GD8 A;  3UE1 A;  4UA9 A;  4P85 A;  3NHQ A;  3VOZ A;  2EX6 A;  3HLC A;  3S7N A;  2EWW A;  1L0E A;  2IWC A;  3NCK A;  4PM9 A;  3TSG A;  3UDX A;  4KZ6 A;  1XGJ A;  3LR5 A;  1O07 A;  5EM1 A;  3G4P A;  3SH8 A;  4EBP A;  3BY8 A;  1HZO A;  4KQO A;  2RCX A;  1KVM A;  1YQS A;  4CQH A;  3IXB A;  3C5A A;  4ZRR A;  5EFW A;  3G30 A;  1S1Z A;  3CJM A;  5L8M A;  2V2F F;  5EOO A;  1W8Q A;  4G3K A;  4MNR A;  3T4J A;  3I7J A;  5GHZ A;  4K08 A;  1YKD A;  4NG2 A;  3RH8 B;  1YM1 A;  2VEA A;  3VP3 A;  3W4O A;  3G32 A;  4Y13 A;  4DDS A;  4MMN A;  2Q9M A;  2XLN A;  3OPR A;  2ZC5 B;  1JVJ A;  1T1C A;  3C2W A;  5CGW A;  4DJ3 A;  1CQA A;  2Y59 A;  4IUK A;  4B4Z A;  3WRT A;  5CHM A;  3F1N A;  4WN5 A;  2O9B A;  3V3S A;  3GRJ A;  2XF3 A;  2ZLY A;  4FTX A;  4PKY G;  1K55 C;  1YSP A;  4L9G A;  1UWP X;  3LCE A;  2QWS A;  2Q9N A;  4EUZ A;  1FR1 A;  2WGV A;  3E98 A;  3Q81 A;  3H7W B;  1OPX A;  4PM8 A;  1LL5 A;  3E0Y A;  1NXY A;  3TW8 A;  5A8B A;  3UPO A;  4IUH A;  3LIA A;  1V9Y A;  3BQA A;  1XJ3 A;  4KEN B;  4ZJ1 A;  3UDI A;  2PR5 A;  1KGF A;  5HAQ A;  1Z6F A;  2NUP C;  2K7S A;  3O86 A;  4X55 A;  2XFT A;  3GR2 A;  2EX9 A;  2XRO A;  4NK3 A;  4S2N A;  4CJN A;  2Y55 A;  4WMC D;  2E8I A;  3N8L A;  3QNB A;  3FZC A;  2Z2M B;  4EBN A;  2JBF A;  2XGN A;  3SH9 A;  2G2W A;  2WGW B;  5FAS A;  1TS7 A;  4WLA A;  1GSX A;  3D4F A;  3HLW A;  2JHE A;  3LI8 A;  4MBK A;  1OTI A;  1GHP A;  4LRX C;  3T4Q A;  4GHI A;  4ESP A;  2VV6 A;  3HBR A;  3DAV A;  3FG8 A;  3MF0 A;  1BUL A;  2WKR A;  3PXP A;  3IF6 C;  5F68 A;  5FQQ A;  3HVF A;  2VX8 A;  3ZFZ A;  4DXC A;  3EEH A;  4LV2 A;  3NBL A;  3BFD A;  3ITA A;  3TJZ C;  3OC2 A;  3CUE C;  4GS9 A;  3BLM A;  1LLB A;  3IF6 B;  5DJT A;  4JPM A;  1NZO A;  2XRN A;  2P7J A;  4I3I A;  3GV9 A;  3RTY A;  4DXB A;  3UME A;  4LV3 A;  4Q0H A;  3MKE A;  1LI0 A;  1EWZ A;  4I39 A;  3PYP A;  2XDM A;  1K57 C;  1N9L A;  4NET A;  3IXH A;  2P74 A;  4NKP A;  4ARZ A;  3AGE A;  2PD7 A;  1ODV A;  1MKM A;  4BBV A;  3VSK A;  1K54 C;  3K2N A;  3GDI A;  2WKI A;  3ULF A;  1HTZ A;  2Y2O A;  5FI6 A;  1ERO A;  1PYY A;  3WS2 A;  4F3L B;  4HNB A;  3PBR A;  4QJG A;  1U60 A;  3MMH A;  2GNX A;  4BD1 A;  4E3M A;  4X1M A;  4GN2 A;  4K0X A;  2HDR A;  4K91 A;  2OSU A;  4R70 A;  4RYE A;  5GLD A;  1SCW A;  3CZD A;  5HX9 A;  3SOI A;  3UE3 A;  4MBF A;  4KZ4 A;  4JLF A;  1IOU A;  4NEE D;  1KGG A;  4LCM A;  2Z2L B;  4GDN A;  3GQZ A;  4HJ6 A;  2H0T A;  1W7F A;  4CLC D;  4KZ9 A;  3CWF A;  4G3V A;  1TDG A;  1LHY A;  2ZJ9 A;  5AJG A;  4HEF A;  1G5U A;  2BTF P;  1DJC A;  4KQD A;  1MZU A;  1PIO A;  1PWC A;  5FSR A;  4B93 A;  3IXD A;  5E2F A;  1IYP A;  4OQG A;  1EI5 A;  2M1C A;  5D3O A;  3JYI A;  1S0W A;  1W63 M;  1WYC A;  2K31 A;  4NXG A;  2KOI A;  4IBR A;  3NDE A;  3PBS A;  4IJG A;  3Q82 A;  1XJ6 A;  5GLC A;  3NEC A;  2GJ3 A;  2ZQ8 A;  1YLZ A;  4DMZ A;  3A3I A;  4JGO A;  1W8Y A;  4I3J A;  1QME A;  2EFU A;  3VV4 A;  3NOU C;  3BW6 A;  3H7W A;  5DFX A;  1JWV A;  1STZ A;  2V20 A;  5J8X A;  3D3O A;  1VQQ A;  3KX0 X;  5CTM A;  2PDR A;  4DE2 A;  3NJA A;  2EX8 A;  4QY5 A;  3W8K A;  3IX4 A;  3A3D A;  3PAG A;  1DRM A;  4LLO B;  1Q2P A;  3EGD C;  4HI4 A;  4GD6 A;  2XD5 A;  1NWZ A;  1W79 A;  2L1M A;  4EQI A;  2EFX A;  4GCZ A;  2A2L A;  1OJ5 A;  3LIB A;  1YMS A;  3O3V A;  4Y15 A;  2VK3 A;  1TDL A;  4O8G A;  1LT0 A;  3C8C A;  3NOT C;  2HJE A;  2VJW A;  4E6X A;  5DFY A;  2O0Y A;  2JKR M;  3KSI A;  5FEG A;  5GLB A;  4Y0T A;  5KMW A;  3E2K A;  1XA7 A;  2J8Y A;  4KZ8 A;  1DJB A;  2JKG A;  4HP9 A;  1S66 L;  4KG6 A;  4MDZ A;  5HAR A;  2WGW A;  2JE5 A;  2V8F A;  3FYZ A;  3E2L A;  2PYP A;  1F9I A;  2XA7 S;  3C7V A;  4R0Q A;  3IHB A;  4JF6 A;  2Y2H A;  4LRY C;  2G2U A;  3T4O A;  4HES A;  1MY8 A;  1MWS A;  3IHA A;  3PBQ A;  3UPN A;  4S2I A;  3OPL A;  4BL2 A;  4II7 A;  2HP5 A;  4XT2 B;  5FQM A;  2V0U A;  5IT5 A;  3TG9 A;  2PT7 A;  2Y2Q A;  3IH9 A;  4B9O A;  5M18 A;  5L2F A;  2ZMF A;  4PMA A;  4KUK A;  1PWG A;  3BQ8 A;  2Y2J A;  3A3E A;  1F98 A;  1ESU A;  3BFF A;  2FH5 A;  3M6B A;  1A0K A;  1H5X A;  4KG2 A;  4YFM A;  5E43 A;  1BYW A;  1K25 A;  3WS5 A;  3S1Y A;  2INW A;  1G68 A;  1KOU A;  2M7V A;  4UA7 A;  2QJ7 A;  4Q8I A;  1Z09 A;  4E3N A;  2UV0 E;  3OPP A;  4WF0 A;  3WWX A;  4KZA A;  1ONG A;  2J7V A;  3LO7 A;  1D7E A;  3PBT A;  4UQI S;  5G18 A;  5FDH A;  2XSS A;  2WKE A;  3IX8 A;  4P0M A;  4H6J B;  1L2S A;  1PZO A;  4AFI A;  4F3L A;  1H8M A;  5M1A A;  5HL6 A;  4CLC A;  3OZH A;  1MWR A;  4NXF A;  5JYO A;  4OLD A;  4Y0O A;  1NRJ A;  4R38 A;  4JXV A;  1K54 A;  4Z1W A;  3CLO A;  4RX2 A;  3ZQ5 A;  1ES5 A;  2V8C A;  1ERM A;  1D06 A;  5EUA A;  3FV7 A;  5FQK A;  1W63 Q;  1ERQ A;  3H82 B;  2V1Z A;  1I5Q A;  3MBZ A;  2ZQ9 A;  1GHM A;  2ZM2 A;  3UE0 A;  5HDC A;  3Q7V B;  4Q0I A;  3IBR A;  3IS2 B;  2JN7 A;  2XD1 A;  2P9V B;  5AQ9 A;  4BQM A;  3NUL A;  2PU4 A;  3PHY A;  1K56 A;  4QD4 A;  5M19 A;  1K0K A;  1Q2Q A;  5C5K A;  4PM5 A;  5FQJ A;  4HJ3 A;  1KE3 A;  1LSW A;  1ZTU A;  3QP4 A;  4OOM A;  2ZC6 B;  3T4K A;  1D1J A;  3DWZ A;  3DTE A;  4L9E A;  3MJQ A;  2GX5 A;  1H8Z A;  4X56 A;  4WL9 A;  3N8R A;  5AQB A;  5EVI B;  3UE6 A;  3KSG A;  4BEN A;  5CTN A;  4M4X A;  3OOV A;  2ZBB A;  3GTC A;  4E3K A;  5FAT A;  1FSW A;  4LPZ A;  3VFH A;  1IYS A;  1H3Q A;  3E4P A;  4OQI A;  5GHY A;  3OCN A;  4IED A;  3IBJ A;  3MSH A;  2XFS A;  5EVI D;  3W4P A;  3Q1F A;  3UO9 A;  3UNW A;  4BBU A;  1W5D A;  3O88 A;  3KO6 A;  4C3Q A;  4S2P A;  2Y2N A;  1LI9 A;  3UN7 A;  1TD5 A;  3SZT A;  2VGK A;  3ZHH A;  1L0G A;  1V9Z A;  1UGU A;  3KYZ A;  1YMX A;  1YSQ A;  5HD3 A;  2W1T B;  3HLE A;  4WM9 A;  3LY3 A;  3VSL A;  1TS8 A;  5A90 A;  3HJK A;  4HBU A;  1L0F A;  1XP4 A;  1XKZ A;  5A91 A;  1DJA A;  3CAX A;  4WEK A;  4S2M A;  3ZG9 B;  2HZ5 A;  4Y3I A;  3B42 A;  3VP0 A;  4EBL A;  1BLP A;  1M40 A;  4S2L A;  5F1G A;  2OWH A;  3BEB A;  4P87 A;  1NZU A;  5FDS A;  4WYY A;  4XT2 A;  1CEG A;  1NY0 A;  3G6O A;  5BOH A;  2C6W B;  4LV0 A;  2Z6C A;  3VP1 A;  1S4R A;  3N7W A;  4PM7 A;  2J80 A;  4BLM A;  3DTI A;  1KDS A;  1RGZ A;  2EXA A;  4O7D A;  4P6Z M;  4DN0 A;  4EWF A;  3T4L A;  1O7E A;  1JWP A;  4BBT A;  3LIC A;  2D01 A;  1CJF A;  4S2J A;  1XFQ A;  2J3T C;  2AVX A;  3DTK A;  5J4E A;  3W2Z A;  3C30 A;  3C7U A;  5FI7 A;  4QHC A;  1HVB A;  1QMF A;  3QP1 A;  4NXB A;  5CGX A;  3ZG5 A;  4EUV A;  3RXX A;  1BLS A;  2HP6 A;  2PAV P;  3NIA A;  3FWL A;  3HLB A;  1XJ4 A;  2QJ5 A;  2Y2K A;  3MS6 A;  4ZDX A;  3FC7 A;  5L09 A;  4H6J A;  5J7E A;  5F69 A;  3V67 A;  3E4O A;  4QU3 A;  3D72 A;  1KE4 A;  3ZVT A;  3QP2 A;  3NY4 A;  4N9L A;  2OLV A;  4OP8 A;  5TBM B;  4E3J A;  2LB5 A;  4EW7 A;  4Y0U A;  3TE8 A;  3HUM A;  4DE3 A;  1CK3 A;  3QP8 A;  4WZ5 A;  2WZX A;  4JGQ A;  1WA9 A;  5CHJ A;  3H82 A;  3MFX A;  3TRC A;  1TF1 A;  2R78 A;  3Q7V A;  4R4S A;  2Y2L A;  3IS2 A;  4LFU A;  5HDS A;  3K3C A;  3DWK A;  4NXE A;  3G31 A;  4N9K A;  1IYO A;  1F2K A;  5U47 A;  3CPT B;  3AGD A;  4Y2F A;  2P9V A;  1CI8 A;  3F1P B;  4OQH A;  1PFL A;  2R9X A;  4HH3 A;  4A5R A;  1RCJ A;  2HP9 A;  1KGE A;  2HV1 A;  5KSH A;  5CED A;  1NLZ A;  3O87 A;  1OTE A;  1K4F A;  1FCO A;  5EVL A;  1IYQ A;  3VE3 A;  4RVA A;  4RX3 A;  3G2Z A;  1FCN A;  1OT6 A;  1JTG A;  5FAP A;  4EU0 A;  5EVI A;  2OLU A;  1MC0 A;  5KSC A;  3ZGA B;  5F83 A;  3RJU A;  3E4Q A;  4O01 A;  5AVF A;  1L3L A;  4F94 A;  3P98 A;  4GKU A;  5J3W A;  1J9M A;  1GHI A;  5F82 A;  4PKY A;  4R3J A;  4OH0 A;  5MC7 A;  3PBN A;  3FPW A;  3V5M A;  3IH8 A;  1OTA A;  2WKP A;  3JVV A;  2OV5 A;  1PZP A;  1MXO A;  2A24 B;  3OCL A;  3GMW A;  1S67 L;  4KQQ A;  4IBX A;  3T1S A;  5CEB A;  4KUO A;  4N1H A;  4RA7 A;  1LL9 A;  2O99 A;  4MEZ A;  3SS5 A;  3ZYT A;  1TS6 A;  3Q7Z A;  1N4O A;  3B47 A;  3BFC A;  2IWD A;  5JYP A;  3AGF A;  1BUE A;  1K56 D;  5DTK A;  3WRZ A;  1N9O A;  2Z6D A;  4MN6 A;  4CPK A;  3SH7 A;  2W3D A;  5TR7 A;  1ZG4 A;  4YIN A;  3NI9 A;  1FSY A;  1BSG A;  4HP4 A;  5E2H A;  2HPB A;  4ETZ A;  4YOF A;  2W27 A;  3T12 B;  1BLH A;  2JKR I;  1OJG A;  1S4S A;  1K55 A;  3LR3 A;  3BM6 A;  4UA6 A;  5HD5 A;  1ZKJ A;  4DKI A;  3KYE A;  1ONH A;  2KDK A;  3LY4 A;  4PPR A;  2XR0 A;  4FUW A;  4X68 A;  3CMZ A;  4HH2 A;  3ICY A;  2XH9 A;  1Y28 A;  4EEP A;  2R9W A;  2VGL S;  5F1F A;  1E3U A;  3BRM A;  2ZMV A;  5E2E A;  4ZTK A;  4PAU A;  4EES A;  4JXG A;  3LR4 A;  2L4R A;  2Y2M A;  4QWO A;  5G4Z A;  2CC1 A;  5AQA A;  3IWO A;  4WBG A;  2V9A A;  3S22 A;  4DJ2 A;  1XPB A;  2Y8H A;  3BFG A;  2Y91 A;  3KSF A;  3ZG8 B;  4RQ9 A;  3UB5 P;  5KIZ A;  1LL8 A;  4WZ4 A;  3R7W B;  1PW1 A;  5HAP A;  4DE0 A;  3P7N A;  1VEU B;  3PTE A;  1K38 A;  2BLS A;  3EWK A;  4HBT A;  3ITB A;  5HFO A;  5GLA A;  1GA0 A;  4WEL A;  2I72 A;  2QPN A;  1M6K A;  5EE8 A;  1KE0 A;  4GJ4 A;  1ZG6 A;  1TS0 A;  2ZQC A;  4MLL A;  3LUQ A;  5CXW A;  2BG1 A;  1MWU A;  5FA7 A;  5TBM A;  2X71 A;  2EX2 A;  3QP5 A;  3S7O A;  3U4L P;  1FR6 A;  1NYM A;  3IF6 A;  3VE4 A;  3LFV A;  4X25 A;  4BWI A;  4UEY A;  1FOF A;  4UAA A;  1VM1 A;  3H9W A;  5LBR A;  4E3O A;  3IF5 A;  2B18 A;  4R4R A;  2JKT I;  3CUE A;  1P9W A;  5K5B A;  4OPQ A;  4B4X A;  1C3B A;  2Y4A A;  2H10 A;  3F1P A;  3IT9 A;  4BJP A;  2ZOI A;  1PWD A;  2G7U A;  1S1Y A;  2JKF A;  5HL1 A;  3F1O B;  4JBF A;  3QHY A;  2HDS A;  2JKT M;  4N1X A;  2WUQ A;  5CX7 A;  1K57 A;  3ZDJ A;  1OME A;  3BWL A;  2CMN A;  4S2K A;  5EEC A;  1I2S A;  2DRW A;  4XXR A;  4XUX A;  4M3K A;  2PD8 A;  3IX3 A;  2ZQ7 A;  1ES3 A;  3A0V A;  3GSG A;  4OOY A;  5GL9 A;  2B5R A;  1SDN A;  4C6Y A;  4G3W A;  1FIK A;  1NRF A;  3B33 A;  2QKP A;  1NJ4 A;  5DVA A;  5AQ7 A;  4L9F A;  5EM0 A;  1OTD A;  3L9K A;  4PM6 A;  4X1L A;  2FZ0 A;  3T4T A;  2A24 A;  5DKK A;  3SS4 A;  3ZG0 A;  3HUO A;  3BYD A;  1XXM A;  2H0Y A;  1YLY A;  1PW8 A;  4X6T A;  3SW1 A;  3T1X A;  1VET B;  2XA7 M;  3IXG A;  2ZD8 A;  5F5Y A;  2O9C A;  3T50 A;  1CEF A;  3ZCZ A;  4QPR A;  4ZBE A;  4U0X A;  3S7Q A;  3ISG A;  1YPR A;  3HJI A;  1T1B A;  4MN5 A;  2J9P A;  3OBF A;  3A0S A;  3FKV A;  4EQ1 A;  1T18 A;  1DP6 A;  2J9O A;  2YKF A;  4H8R A;  3GEC A;  3FKW A;  5DKL A;  4Q0J A;  2BAS A;  2UWX A;  3DBA A;  2FFY A;  1E25 A;  1G6O A;  3G2Y A;  1IKG A;  1XA1 A;  2W3E A;  3WS0 A;  3EGX C;  3V50 A;  2ZM0 A;  3K3D A;  3EEA A;  4JGP A;  2VV8 A;  2LB9 A;  2VGJ A;  2OOL A;  5AVE A;  2X02 A;  5DTT A;  2WKH A;  4E3L A;  1FQG A;  4YNR A;  5IHV A;  2ZC7 A;  1P0Z A;  4JGR A;  3WS4 A;  3A3J A;  5HSQ A;  1MBL A;  2Y2P A;  2EA9 A;  1XJ2 A;  5IU1 A;  4DF6 A;  3FPV A;  4I5S A;  2VV7 A;  4UQI M;  1YT4 A;  4K0W A;  2ZL1 B;  1VB6 A;  5F6A A;  3BLS A;  1Y54 A;  3JVU A;  4KQR A;  2QYB A;  4GLQ A;  5HAI A;  3P09 A;  4GNU A;  1P9R A;  5FAQ A;  4Y17 A;  4UHU A;  2WAD A;  2W3H A;  5TGF A;  3R7W A;  4WUJ A;  1IEM A;  1VEU A;  2E8J A;  4ID4 A;  3C4O A;  1PNE A;  1HD8 A;  1L0D A;  3Q07 A;  5G4Y A;  4I38 A;  2WGI A;  2WKQ A;  3KYQ A;  3P01 A;  4EXO A;  1G28 A;  1GSV A;  1WE4 A;  2H5S A;  4L0L A;  2WK0 A;  1Y4O A;  1EW0 A;  4OOL A;  3NOP C;  4QB8 A;  5E2G A;  5HPF A;  3M2J A;  2RL3 A;  2W1R A;  3BEC A;  2ZMA A;  3CIT A;  2HDU A;  3EQU A;  1SKO B;  3HLD A;  2DCF A;  2VZW A;  4KZ3 A;  1T19 A;  5HDD A;  2ZC3 B;  4E04 A;  4GOG A;  3DTM A;  3VP2 A;  5I94 A;  3UY6 A;  5TJJ A;  1AXB A;  3ZNT A;  1YLP A;  3MQO A;  2ZOH A;  5L10 A;  1BTL A;  3LIE A;  1E3U D;  3V3R A;  5IS1 A;  1XGI A;  2GDN A;  3MZE A;  3W4Q A;  4EEU A;  5EPH A;  1KDW A;  3F1O A;  1H8Y A;  4Y5F A;  2KX6 A;  2X01 A;  2PR6 A;  5CER A;  2VA0 A;  4HJ4 A;  4LV1 A;  2IWB A;  4YWZ A;  2EWV A;  3GVB A;  1S6R A;  3U2A A;  5HWT A;  3VOL A;  1YLW A;  2Q0O A;  2J3T D;  4HHD A;  3V39 A;  3C4P A;  1OT9 A;  2YKH A;  2H28 A;  5FI2 A;  4LEN A;  4WEJ A;  4JKT A;  2P04 A;  4D2O A;  3EQV A;  3UDF A;  3UPP A;  5KZH A;  4MCW A;  2K2N A;  4HOI A;  3M2K A;  2IA2 A;  2A49 A;  5CRF A;  1K4E A;  2EXB A;  2I9V A;  4JXS A;  4ZJ3 A;  1CF0 A;  1KVL A;  1ES4 A;  1RGY A;  3VOY A;  3D9Y A;  1PRQ A;  3PBO A;  4PHT A;  2Y79 A;  4FD8 A;  5HWV A;  3LIF A;  4KZB A;  2Y2I A;  4OPR A;  4ETX A;  1PI4 A;  4GZB A;  5HWW A;  1T1A A;  1VET A;  2A3U A;  3G35 A;  3C38 A;  1DY6 A;  1FIL A;  4FSF A;  3RXW A;  4FH2 A;  4CLC C;  1PI5 A;  5DTS A;  3IWQ A;  1I2W A;  3G34 A;  3UB7 A;  3CI6 A;  1FCM A;  1MWT A;  3MKF A;  3BY9 A;  1BZA A;  3O5Y A;  5HW3 A;  5FQ9 A; 
#chains in the Genus database with same CATH homology
 2XD1 A;  3SS3 A;  2P9V B;  4KEN B;  1NYY A;  4ZJ1 A;  5AQ9 A;  4BQM A;  3UDI A;  2PU4 A;  4WZ4 A;  4P6B A;  1PW1 A;  1K56 A;  1KGF A;  5HAQ A;  1Z6F A;  5HAP A;  4DE0 A;  4QD4 A;  1K6R A;  5M19 A;  3PTE A;  2JCH A;  1Q2Q A;  3O86 A;  1K38 A;  2BLS A;  5CHU A;  4X55 A;  2XFT A;  4HBT A;  3ITB A;  3GR2 A;  4PM5 A;  2EX9 A;  5FQJ A;  1KE3 A;  5HFO A;  4NK3 A;  5GLA A;  4S2N A;  1GA0 A;  4WEL A;  2I72 A;  2QPN A;  1MKI A;  1M6K A;  4OOM A;  4BD0 A;  2Y55 A;  2ZC6 B;  2E8I A;  1MPL A;  3N8L A;  1KE0 A;  3QNB A;  4WMC D;  3FZC A;  3DWZ A;  1ZG6 A;  5GHX A;  4EV4 A;  2ZQC A;  4MLL A;  2PU2 A;  1IKI A;  2ZQD A;  2Z2M B;  5CXW A;  2BG1 A;  4EBN A;  1K6S A;  1H8Z A;  1MWU A;  2JBF A;  2XGN A;  4OON A;  4X56 A;  5FA7 A;  4CJN A;  3N8R A;  5AQB A;  1TEM A;  5EVI B;  3SH9 A;  2X71 A;  4BEN A;  2WAE A;  2G2W A;  2EX2 A;  2WGW B;  5CTN A;  5FAS A;  1FR6 A;  3D4F A;  3HLW A;  5DF7 A;  4ZJ2 A;  4JF5 A;  1NYM A;  3BFE A;  3GTC A;  4E3K A;  3IF6 A;  5FAT A;  5A93 A;  4ZAM A;  4MBK A;  5CGS A;  1FSW A;  1GHP A;  3VFH A;  1IYS A;  2JC7 A;  4OQI A;  5GHY A;  1FOF A;  3OCN A;  1VM1 A;  4UAA A;  4IED A;  3CG5 A;  4E3O A;  3IF5 A;  4KZ7 A;  1ESI A;  2XFS A;  4R4R A;  5EVI D;  3TOI A;  3W4P A;  4X69 A;  2ZQA A;  3HBR A;  4OPQ A;  4B4X A;  1C3B A;  3Q1F A;  3UO9 A;  1BUL A;  2Y4A A;  3UNW A;  2H10 A;  3IF6 C;  5FQQ A;  1W5D A;  3O88 A;  3HVF A;  4OPY A;  1IEL A;  3IT9 A;  4BJP A;  1E4D A;  4C3Q A;  1PWD A;  4S2P A;  2Y2N A;  2HDQ A;  1LI9 A;  3UN7 A;  3ZFZ A;  4R3B A;  4DXC A;  4LV2 A;  4N92 A;  5HL1 A;  3NBL A;  3BFD A;  3ITA A;  1GCE A;  3OC2 A;  3VMA A;  2VGK A;  3BLM A;  3ZHH A;  4MBH A;  1L0G A;  4JBF A;  5FQI A;  4KG5 A;  1YMX A;  3QHY A;  1LLB A;  2WAF A;  3IF6 B;  2HDS A;  4N1X A;  2WUQ A;  3S4X A;  1K57 A;  3B3X A;  3ZDJ A;  1OME A;  3HLE A;  4WM9 A;  4JPM A;  4S2K A;  5EEC A;  3LY3 A;  1I2S A;  4S2O A;  1NZO A;  3VSL A;  2DRW A;  1N9B A;  4XXR A;  5A90 A;  4HBU A;  1L0F A;  1XP4 A;  4WMC A;  3GV9 A;  4DXB A;  1XKZ A;  4OVD A;  4XUX A;  5A91 A;  1DJA A;  1ZC2 A;  4M3K A;  4LV3 A;  3MKE A;  1LI0 A;  1EWZ A;  5EE8 A;  4WEK A;  4S2M A;  2ZQ7 A;  2XDM A;  3ZG9 B;  1K57 C;  1ES3 A;  4NET A;  3GSG A;  2P74 A;  2XEP A;  3IXH A;  4OOY A;  5GL9 A;  3AGE A;  2B5R A;  3VP0 A;  1SDN A;  4EBL A;  1SDE A;  1BLP A;  4JXW A;  4C6Y A;  1NRF A;  3HUN A;  1NJ4 A;  1BT5 A;  3VSK A;  1M40 A;  5DVA A;  1K54 C;  5AQ7 A;  1TVF A;  2PBY A;  2WKI A;  4S2L A;  5F1G A;  1HTZ A;  2Y2O A;  5FI6 A;  1ERO A;  2C5W B;  3BEB A;  4PM6 A;  1PYY A;  3N6I A;  4OLG A;  3WS2 A;  4P87 A;  1NZU A;  4QJG A;  3PBR A;  1U60 A;  4WYY A;  3WS1 A;  1CEG A;  3SS4 A;  1ALQ A;  3NDG A;  4BD1 A;  4E3M A;  1NY0 A;  4DRT A;  4GN2 A;  2QMI A;  3ZG0 A;  3HUO A;  4K0X A;  2HDR A;  3BYD A;  5BOH A;  1XXM A;  1ES2 A;  2H0Y A;  4K91 A;  2OSU A;  1YLY A;  1PW8 A;  2C6W B;  4LV0 A;  4X6T A;  4R23 A;  4RYE A;  3VP1 A;  4IVI A;  5GLD A;  3IXG A;  3N7W A;  2ZD8 A;  1SCW A;  3CZD A;  4PM7 A;  5HX9 A;  3SOI A;  3UE3 A;  4MBF A;  4BLM A;  4KZ4 A;  4U0T A;  4JLF A;  1KDS A;  1RGZ A;  4DDY A;  2EXA A;  4O7D A;  1CEF A;  3ZCZ A;  4EWF A;  1O7E A;  1JWP A;  1KGG A;  1YLJ A;  3PAE A;  4LCM A;  4U0X A;  4ZBE A;  2Z2L B;  4GDN A;  3ISG A;  4S2J A;  3GQZ A;  2H0T A;  1W7F A;  4Z9Q A;  3MZD A;  3QNC A;  4KZ9 A;  4FCF A;  1TDG A;  1LHY A;  2J9P A;  2ZJ9 A;  2XQZ A;  4HEF A;  3FKV A;  3OPH A;  3C7U A;  5FI7 A;  1DJC A;  4S2N C;  4QHC A;  2ZC4 B;  2J9O A;  1PWC A;  1PIO A;  5FSR A;  3IXD A;  4H8R A;  3VFF A;  5E2F A;  1HVB A;  1QMF A;  3NC8 A;  1IYP A;  5CGX A;  3ZG5 A;  3HL9 A;  3FKW A;  3RXX A;  4OQG A;  3DW0 A;  1BLS A;  2HP6 A;  3NIA A;  1EI5 A;  3ZVW A;  2UWX A;  5D3O A;  3FWL A;  3JYI A;  2FFY A;  1S0W A;  1E25 A;  3HLB A;  4E3I A;  4JF4 A;  1WYC A;  3G2Y A;  2Y2K A;  1IKG A;  4IBR A;  1XA1 A;  3LEZ A;  3NDE A;  4ZDX A;  3WS0 A;  2Y2G A;  3V50 A;  2ZM0 A;  3PBS A;  1GA9 A;  3Q82 A;  5TFQ A;  1WYB A;  4OKP A;  4QU3 A;  5GLC A;  2ZQ8 A;  2VGJ A;  1YLZ A;  3MXS A;  5CEC A;  1KE4 A;  2X02 A;  5DTT A;  2WKH A;  4E3L A;  3ZVT A;  1FQG A;  5EOE A;  3NY4 A;  3HLG A;  4N9L A;  5DF9 A;  2OLV A;  5IHV A;  2ZC7 A;  4LCL A;  4OP8 A;  3WS4 A;  3A3I A;  3A3J A;  4E3J A;  5FAO A;  4E6W A;  4XUZ A;  1MBL A;  1W8Y A;  2Y2P A;  4Y0U A;  1QME A;  2EFU A;  3HUM A;  4X53 A;  2WYX A;  4DE3 A;  4GDB A;  3A3F A;  2FFF B;  4DF6 A;  1CK3 A;  3VP4 A;  2QZ6 A;  4R1G A;  1YT4 A;  1JWV A;  4WZ5 A;  2WZX A;  4K0W A;  2V20 A;  5DF8 A;  4QY6 A;  1CI9 A;  5CHJ A;  5J8X A;  1BLC A;  3IQA A;  1XX2 A;  1G6A A;  1VQQ A;  1JTD A;  3BLS A;  1YLT A;  5CTM A;  3Q7V A;  4R4S A;  2Y2L A;  1Y54 A;  4KZ5 A;  4DE2 A;  3N4I A;  3DWK A;  2EX8 A;  4KQR A;  2WZZ A;  2ZM8 A;  4QY5 A;  3W8K A;  3G31 A;  4N9K A;  1IYO A;  4GB7 A;  5U47 A;  1SHV A;  3A3D A;  3PAG A;  5HAI A;  3P09 A;  4GNU A;  3AGD A;  4U3T A;  4BL3 A;  1Q2P A;  2P9V A;  1CI8 A;  4GD6 A;  5FAQ A;  2DNS A;  4UHU A;  4DE1 A;  2WAD A;  2XD5 A;  5TGF A;  4OQH A;  4WZ5 C;  1W79 A;  4EQI A;  2EFX A;  2R9X A;  1IEM A;  4A5R A;  1RCJ A;  2HP9 A;  1KGE A;  5KSH A;  1YMS A;  4ID4 A;  4OPZ A;  3C4O A;  3IWI A;  5CED A;  3O3V A;  1HD8 A;  1L0D A;  3Q07 A;  1TDL A;  2WGI A;  3O87 A;  1K4F A;  1WE4 A;  2XK1 A;  1FCO A;  4B88 A;  5EVL A;  4E6X A;  1IYQ A;  2H5S A;  3MZF A;  4L0L A;  2WK0 A;  4RVA A;  5A92 A;  5GLB A;  4FH4 A;  4OOL A;  4RX3 A;  4Y0T A;  3ZG7 B;  3G2Z A;  1FCN A;  5KMW A;  3E2K A;  1JTG A;  1XA7 A;  2J8Y A;  4KZ8 A;  4QB8 A;  5FAP A;  5E2G A;  3M2J A;  2RL3 A;  3N8S A;  2OLU A;  5EVI A;  1DJB A;  4OP5 A;  3BEC A;  5KSC A;  2ZMA A;  3ZGA B;  5F83 A;  3HRE A;  4KG6 A;  5HAR A;  3RJU A;  3M6H A;  2WGW A;  2HDU A;  2JE5 A;  3EQU A;  3HLD A;  4IVK A;  3FYZ A;  4Y7P A;  2DCF A;  3E2L A;  4KZ3 A;  3HLF A;  4F94 A;  4OQ0 A;  2ZC3 B;  3P98 A;  4GKU A;  4C75 A;  4GOG A;  3C7V A;  3DTM A;  4R0Q A;  3IHB A;  4JF6 A;  2Y2H A;  3VP2 A;  5I94 A;  1J9M A;  3UY6 A;  1GHI A;  5F82 A;  1SKF A;  5EVI C;  1AXB A;  2G2U A;  1YLP A;  4R3J A;  3ZNT A;  4HES A;  1MY8 A;  1MWS A;  3IHA A;  3PBN A;  3PBQ A;  4OH0 A;  3UPN A;  1RP5 A;  3V5M A;  4S2I A;  3IH8 A;  3OPL A;  1BTL A;  3MFD A;  1JWZ A;  3ZNY A;  2OV5 A;  3MXR A;  1E3U D;  3V3R A;  4GD8 A;  3UE1 A;  1PZP A;  4UA9 A;  1MXO A;  4P85 A;  4BL2 A;  3OCL A;  3GMW A;  2HP5 A;  5FQM A;  3VOZ A;  2EX6 A;  3HLC A;  3TG9 A;  1XGI A;  2GDN A;  3MZE A;  3NCK A;  1L0E A;  2IWC A;  4IBX A;  4KQQ A;  4PM9 A;  2Y2Q A;  3TSG A;  3IH9 A;  4KZ6 A;  1XGJ A;  3UDX A;  3W4Q A;  5EPH A;  5CEB A;  1O07 A;  1KDW A;  4N1H A;  5M18 A;  4RA7 A;  5L2F A;  4PMA A;  1LL9 A;  1H8Y A;  3G4P A;  3SH8 A;  4MEZ A;  1PWG A;  4EBP A;  1HZO A;  4KQO A;  2RCX A;  1KVM A;  2X01 A;  3SS5 A;  5CER A;  1YQS A;  2IWB A;  4LV1 A;  3Q7Z A;  2Y2J A;  3A3E A;  1N4O A;  3GVB A;  3IXB A;  1ESU A;  3BFF A;  3C5A A;  3M6B A;  1S6R A;  3BFC A;  2IWD A;  5JYP A;  3AGF A;  1H5X A;  3G30 A;  4KG2 A;  1BUE A;  4YFM A;  5E43 A;  1K25 A;  3CJM A;  1K56 D;  1YLW A;  3S1Y A;  3WS5 A;  1G68 A;  5DTK A;  3WRZ A;  2V2F F;  5EOO A;  1W8Q A;  4MNR A;  3V39 A;  3C4P A;  3I7J A;  4UA7 A;  5GHZ A;  3SH7 A;  4CPK A;  4Q8I A;  4E3N A;  5TR7 A;  1ZG4 A;  3OPP A;  5FI2 A;  4YIN A;  3WWX A;  1YM1 A;  4KZA A;  3NI9 A;  4LEN A;  1ONG A;  4WEJ A;  1FSY A;  4JKT A;  4D2O A;  3VP3 A;  3EQV A;  1BSG A;  3UDF A;  2J7V A;  3LO7 A;  3W4O A;  5E2H A;  2HPB A;  3UPP A;  5KZH A;  3PBT A;  3G32 A;  5G18 A;  3M2K A;  4DDS A;  5FDH A;  1BLH A;  2A49 A;  2WKE A;  5CRF A;  4P0M A;  1K4E A;  2Q9M A;  1K55 A;  2XLN A;  2EXB A;  1L2S A;  1PZO A;  3BM6 A;  3OPR A;  4UA6 A;  1ZKJ A;  4DKI A;  2ZC5 B;  1JVJ A;  1ONH A;  4JXS A;  4ZJ3 A;  1KVL A;  1ES4 A;  5CGW A;  1RGY A;  5M1A A;  3VOY A;  3PBO A;  3LY4 A;  3OZH A;  4PPR A;  1MWR A;  4FD8 A;  5JYO A;  4OLD A;  2XR0 A;  4Y0O A;  4KZB A;  2Y59 A;  2Y2I A;  3CMZ A;  4OPR A;  4X68 A;  1PI4 A;  4B4Z A;  3WRT A;  2XH9 A;  5CHM A;  4GZB A;  4JXV A;  2R9W A;  3V3S A;  3GRJ A;  1K54 A;  1E3U A;  5F1F A;  2XF3 A;  2ZLY A;  2A3U A;  1K55 C;  4RX2 A;  3LCE A;  3BRM A;  3G35 A;  1ES5 A;  2Q9N A;  5E2E A;  4ZTK A;  4EUZ A;  1ERM A;  1FR1 A;  2WGV A;  1DY6 A;  4JXG A;  3Q81 A;  5AQA A;  5EUA A;  2Y2M A;  4FSF A;  3RXW A;  4FH2 A;  3FV7 A;  2CC1 A;  5FQK A;  1PI5 A;  1ERQ A;  4PM8 A;  3IWO A;  3IWQ A;  1LL5 A;  1I2W A;  1I5Q A;  2V1Z A;  3G34 A;  1NXY A;  5DTS A;  1FCM A;  4WBG A;  3MBZ A;  2ZQ9 A;  1GHM A;  2ZM2 A;  3S22 A;  3UE0 A;  1MWT A;  3MKF A;  3Q7V B;  1XPB A;  3BFG A;  2Y91 A;  3ZG8 B;  3UPO A;  1BZA A;  5HW3 A;  5FQ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...