4IVKA

Crystal structure of a fammily viii carboxylesterase in a complex with cephalothin.
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
404
structure length
404
Chain Sequence
AEGPVTATKPKEAGFTSEGLARIDAYLKNEIQAKTMPGAVMMIKRNGETAYFSSFGLRDPDTKEPMTAETIFRIYSMSKPITTVAAMMLVEEGKLQLDEPVSKYIPSFANVKVGVETKGENGMALETGPVKRAITIQDLMRHTSGITYGFVGDGLVKKAYIASNLFDGDFDNAEFAERIAKLPLVYQPGTTWDYGHSTDILGRVVEVVSGKSLYQFEKERLLDPLGMKDTGFYVTDPAKKSLVAEAMPNDRKIGGSEMFDPRVQKKWEPGGQGMVSTIGDYARFTQMVLNGGTLDGKRYLSPKTIAYMGSNHIPQASGIVPGAYYLPGPGVGFGLGFAVRTEAGVTPVEGSVGDLSWGGAGGTVFWIDPKENLTVVFMAPMVSPRARVWRTLRNIVYGAFDRLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carboxylesterases
publication title Structural basis for the beta-lactamase activity of EstU1, a family VIII carboxylesterase.
pubmed doi rcsb
molecule tags Hydrolase
total genus 136
structure length 404
sequence length 404
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2013-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4ivkA00
1L2SA 5FQMA 4NK3A 3HLEA 5FQKA 2DNSA 4OONA 3PBRA 3WS4A 3W4QA 1YLWA 3M2KA 2WYXA 4U0XA 1PI4A 4WM9A 4HBUA 1CI8A 1VQQA 3WS5A 1GHMA 4WZ4A 3PAEA 4E3IA 3IF6A 1FCOA 2X02A 5AQBA 2X71A 3S4XA 3W4OA 5A93A 4DDYA 3AGDA 5M19A 2WKHA 2BLSA 5FI6A 3CG5A 1K56D 4HBTA 2HP6A 3TG9A 2ZM2A 5GHZA 4OVDA 3O86A 4C3QA 4KZAA 4ZJ3A 1O7EA 2XLNA 5CTNA 1WE4A 2DCFA 4UA9A 1ALQA 1N4OA 1GA0A 2ZC6B 1NYMA 1H8YA 4IBXA 5FQ9A 4OQHA 5FQIA 3HLCA 4RVAA 4S2KA 4BJPA 3ZCZA 1BLHA 1GA9A 2XQZA 1M40A 1FR1A 1G6AA 3C7VA 4Q8IA 4WMCA 3A3JA 5KSHA 1YQSA 3C7UA 3NIAA 2XFTA 3HLDA 3GR2A 4KZ6A 4QB8A 1IELA 4O7DA 1NZOA 1L0FA 1PZPA 1TEMA 2JBFA 1CI9A 3JYIA 4MNRA 4Z9QA 3Q7VA 3IH9A 4MBHA 4B4ZA 2ZC5B 2Y55A 3MKFA 3AGFA 2FFYA 3QHYA 4FSFA 4PM7A 5CGSA 5DF8A 3C4PA 5FDHA 1L0GA 1JWZA 2H0TA 3G34A 2IWDA 1EWZA 4N92A 3Q7ZA 3HUMA 4JXGA 3ZG7B 2PU4A 2P9VB 4X68A 3NDEA 3D4FA 4JBFA 3N8SA 1K57A 4DKIA 3UE1A 2R9WA 1KVLA 1FCMA 3B3XA 1O07A 3UPNA 1XA1A 1RGZA 3ZHHA 1Z6FA 1GHIA 5EE8A 2H10A 1K57C 4ZAMA 2QPNA 4PMAA 3Q1FA 4LENA 3IH8A 2P9VA 4GD6A 1ZG6A 4JLFA 4FCFA 3DWKA 4WEKA 4RX2A 3SS5A 1FR6A 3ZDJA 3PBOA 2XEPA 4F94A 4U0TA 2ZQ9A 3HUNA 4S2PA 5GLDA 3IT9A 4MBKA 1KGEA 3GVBA 1K4FA 5EVIC 2X01A 2QMIA 3OPLA 4B4XA 5DTTA 2Y2JA 1NY0A 2WGWA 4WYYA 5GHYA 2ZQDA 4UA7A 3VP2A 1Y54A 3UO9A 4BL3A 1ES4A 5HX9A 2HDUA 1M6KA 1FSWA 1ONHA 3GMWA 4KQOA 4S2MA 4RA7A 3TSGA 4CJNA 1W79A 2C5WB 4X6TA 5AQAA 5FSRA 2XGNA 3OPPA 3WWXA 1YLJA 4BL2A 4OLGA 5CECA 3P98A 4MEZA 3UY6A 5FASA 3HLBA 1G68A 4C6YA 1FOFA 2JE5A 3VOZA 5FI7A 2OLUA 4GD8A 4QU3A 1KVMA 2HDSA 4X56A 2DRWA 4DE2A 1AXBA 1K55A 1EI5A 2WK0A 4E6WA 1BSGA 1HD8A 3WRTA 4E6XA 1WYBA 5FQQA 4L0LA 4S2NC 4KG5A 4FD8A 4X55A 4EBPA 4OKPA 1K55C 4QY6A 2RCXA 4LCMA 1LHYA 4MBFA 1W8YA 5CHJA 1ERQA 3UDFA 1XXMA 1JWVA 1WYCA 4Y7PA 4KZ9A 5EECA 5L2FA 3N4IA 2Y2OA 1KDWA 3IWQA 1J9MA 4P85A 5GHXA 2HDQA 1KDSA 3P09A 1OMEA 4GZBA 4ID4A 4EBLA 1W7FA 2H0YA 1K6RA 3LCEA 5GLAA 1DJCA 2ZC3B 3BM6A 5EUAA 5FAOA 3GSGA 1IYQA 4XXRA 5E2FA 1E3UA 2XDMA 1ZKJA 3HLFA 3IQAA 4JXWA 3SOIA 1ZC2A 2FFFB 3DWZA 3A3DA 3E2LA 1ES2A 1ESUA 3NDGA 4JF6A 2EX6A 3BFEA 2G2UA 1MY8A 1MPLA 3IF6C 4GDNA 4WBGA 4DDSA 1YLPA 4WZ5A 3QNCA 4P87A 4R4SA 3IXHA 2EX8A 2EX9A 4KENB 5HAPA 4OH0A 1K4EA 4JF5A 4JXVA 3SS3A 5CTMA 4CPKA 3O88A 4IVIA 3M6HA 4C75A 4UAAA 2J9OA 3BECA 3RJUA 4QJGA 4WELA 1SHVA 1BTLA 4KQRA 2G2WA 5DF7A 3UNWA 3VSKA 3WS0A 3FWLA 4LV2A 3V3RA 4DRTA 4N9KA 3IHAA 4K0WA 5E2HA 3GV9A 4R4RA 3ZVTA 1KE3A 3SH9A 1IEMA 1PW1A 4R1GA 1TDGA 3O3VA 1RCJA 5E2GA 1XGIA 5EVID 2Y2GA 3W8KA 1ONGA 3OPHA 2BG1A 4LV1A 2IWCA 1YMXA 5CGWA 3N8RA 3CZDA 3G2ZA 3BEBA 1XPBA 4B88A 3O87A 2WZZA 1FSYA 5CHUA 1DY6A 2J7VA 3S1YA 1BLPA 2GDNA 5GLCA 3N8LA 3ZG9B 3OCLA 4FH4A 1I5QA 3MFDA 3SH7A 4YFMA 2HPBA 1IYOA 4BQMA 2Z2LB 4LV0A 4OPZA 1E4DA 3HREA 1N9BA 1LL5A 1JTDA 4WEJA 1MBLA 5CEDA 3FYZA 2ZLYA 1PWCA 3BFFA 1IYPA 2ZQ7A 4BD1A 3N7WA 5HARA 4KZ4A 4OQ0A 1K56A 2XD5A 2V20A 3E2KA 1QMFA 4ZTKA 2XD1A 2ZC7A 3FZCA 3G32A 4D2OA 1KE0A 2Y2LA 2ZC4B 2ZQCA 4EWFA 1W8QA 1Q2QA 3BRMA 2A3UA 3V3SA 3IXDA 5FQJA 2V1ZA 4R3JA 1C3BA 4DXBA 3W4PA 1Q2PA 4K91A 3ZG5A 3ZG8B 4KZ5A 4EUZA 3LY4A 4E3LA 3DTMA 5EPHA 3UPOA 4KG2A 2ZMAA 3VFHA 2IWBA 2WKIA 3WS1A 4JF4A 3ZG0A 4Y0OA 3IXBA 1HVBA 4PM6A 4JXSA 1ES3A 2WAFA 4ZBEA 1ESIA 1XA7A 3LO7A 4LCLA 4M3KA 4R3BA 4IBRA 3VP0A 3M6BA 5CRFA 1GCEA 1XP4A 4ZJ1A 1RGYA 4PM8A 1K25A 2WAEA 2P74A 1U60A 2EFXA 3N6IA 1BT5A 5E43A 2OSUA 2WKEA 4DE0A 2WGVA 4OPYA 2J9PA 2XF3A 3PBTA 4RYEA 1NXYA 5FAPA 4A5RA 3FKWA 3SH8A 3UDIA 1JVJA 1ERMA 4IVKA 4KZ3A 1SCWA 1MWTA 3CJMA 5G18A 2JC7A 4GN2A 5TFQA 3WRZA 1NRFA 3EQVA 1YM1A 5DF9A 1K54A 1HTZA 2Y4AA 3I7JA 3FV7A 4EV4A 1VM1A 1YLYA 1H8ZA 3MXRA 4KG6A 4N9LA 3ISGA 5FA7A 3GRJA 5HL1A 5TGFA 1BLSA 3PBQA 4R23A 1NZUA 4GOGA 4GNUA 4WMCD 3V39A 5A91A 1BLCA 4XUXA 4XUZA 3HVFA 3VP3A 2XK1A 5F82A 3BFDA 5FI2A 2PBYA 2Z2MB 4NETA 2Y2MA 4OOMA 5CEBA 3HLGA 1IKIA 1LI9A 1L0DA 2Q9NA 2ZD8A 5EVLA 3OCNA 3RXWA 3UPPA 1BULA 3IWOA 2Y91A 1JWPA 3IXGA 1S6RA 3MZDA 3NBLA 4Y0TA 5A92A 3SS4A 1DJAA 2H5SA 3OZHA 4X69A 5HW3A 1YLZA 5D3OA 3G35A 2Y2NA 4HESA 4JPMA 4S2IA 2UWXA 4WZ5C 4PM5A 5HAQA 3VMAA 2EXBA 2Q9MA 5CERA 3MKEA 3EQUA 3ITAA 2QZ6A 2ZM8A 5FATA 2Y2IA 2ZQ8A 2OLVA 3ITBA 5F83A 1MXOA 4OPQA 5DVAA 1CK3A 3FKVA 4GDBA 3BFGA 3PBNA 4E3OA 2EX2A 2OV5A 5M1AA 1FCNA 3BLSA 2CC1A 1KGGA 4PM9A 1KE4A 5I94A 3BLMA 2HP9A 1SDEA 5KSCA 2ZM0A 5GLBA 3GTCA 4KQQA 3GQZA 4E3KA 4RX3A 3QNBA 4P0MA 4E3JA 1YT4A 1JTGA 2WZXA 4UA6A 1KGFA 2WGIA 1TDLA 2Y2HA 1ZG4A 3RXXA 4N1HA 3G30A 1LL9A 3Q7VB 4U3TA 4FH2A 3UN7A 5E2EA 3G4PA 4ZJ2A 3HL9A 2PU2A 3G2YA 1BUEA 2J8YA 2E8IA 5AQ9A 1SDNA 1PWDA 1XGJA 1MWRA 1CEFA 1PYYA 2EFUA 1PWGA 4OP8A 5CGXA 1MKIA 1EROA 3MBZA 4QY5A 3UDXA 3OPRA 4OQIA 3UE0A 3UE3A 3MZFA 5DTSA 5KMWA 4H8RA 5M18A 4OPRA 3A3EA 5F1GA 2Y2KA 4LV3A 5J8XA 4MLLA 4E3NA 5EOEA 1YLTA 3C4OA 2C6WB 3Q07A 2XFSA 4K0XA 1H5XA 4KZBA 3NC8A 2A49A 2VGJA 2XH9A 3C5AA 4IEDA 1PI5A 3Q81A 1HZOA 5FAQA 1IKGA 5EVIB 5A90A 4DF6A 3VSLA 1GHPA 4BD0A 4S2OA 4EBNA 3S22A 4ZDXA 2XR0A 1LLBA 3M2JA 2HDRA 1I2SA 3BFCA 2WADA 4UHUA 2WGWB 3A3FA 3MXSA 3WS2A 5EVIA 4QHCA 3IWIA 2V2FF 5KZHA 1TVFA 1XX2A 2JCHA 3NI9A 5CHMA 2EXAA 5GL9A 1K38A 4P6BA 3ZNYA 3PTEA 5DTKA 5JYPA 3ZGAB 1E3UD 3HBRA 1RP5A 5U47A 1PIOA 4OLDA 1ES5A 3VFFA 1NJ4A 5CXWA 4E3MA 4S2LA 4OQGA 3TOIA 3ZVWA 1LI0A 4Y0UA 1SKFA 2Y2QA 5JYOA 4DXCA 5IHVA 3MZEA 4KZ7A 3VP4A 3PBSA 3VOYA 3NCKA 2VGKA 3HLWA 4GB7A 5EOOA 4DE1A 3NY4A 3HUOA 2Y2PA 2I72A 4QD4A 3G31A 1L0EA 3OC2A 3IF5A 2ZJ9A 4BENA 5BOHA 3LY3A 1K54C 2HP5A 4X53A 2R9XA 5F1FA 3LEZA 1MWSA 1S0WA 3Q82A 4HEFA 4S2NA 3DW0A 4S2JA 2B5RA 4DE3A 3PAGA 4N1XA 2ZQAA 4BLMA 4OOLA 3ZFZA 1E25A 5HAIA 3BYDA 3V5MA 3VP1A 4OOYA 3IHBA 1I2WA 1K6SA 4GKUA 4JKTA 1MWUA 1W5DA 4YINA 5TR7A 2Y59A 1YMSA 4KZ8A 3A3IA 5HFOA 1NYYA 4OP5A 3AGEA 1XKZA 1BZAA 1DJBA 4PPRA 1QMEA 1PZOA 5AQ7A 1CEGA 3V50A 2WUQA 3ZNTA 1PW8A 3CMZA 1FQGA 3IF6B 4EQIA 1IYSA 2RL3A 4R0QA
chains in the Genus database with same CATH superfamily
4R70A 2P7JA 4B93A 3W4QA 3M2KA 1VQQA 5TBMA 1GHMA 4WZ4A 3IF6A 1FCOA 3S4XA 5A93A 3W4OA 4DDYA 3AGDA 2WKHA 5FI6A 1K56D 5J4EA 2ZM2A 4MN7A 2XLNA 5CTNA 1N4OA 1GA0A 1NYMA 1H8YA 2NUTC 4IBXA 4RVAA 5C5KA 4S2KA 2HJEA 2K31A 3QP6A 1M40A 3C7VA 3A3JA 2GJ3A 2XFTA 3HLDA 1IELA 3FC7A 1L0FA 2JBFA 4HJ4A 3Q7VA 1L0GA 4FSFA 5DF8A 2H0TA 3G34A 4JXGA 4X68A 3NDEA 3D4FA 4JBFA 3T4KA 4WF0A 2V0WA 1XA1A 3UB6A 3ZHHA 2H10A 2QPNA 3Q1FA 4GD6A 2YKHA 1PNEA 4Q0JA 2B18A 4FCFA 5L10A 3F1PA 4U0TA 3HUNA 4Q0HA 4MBKA 1YAXA 5DKKA 2ZQDA 1Y54A 3UO9A 1CQAA 3QP5A 1FSWA 3TSGA 4X6TA 5AQAA 3CUEC 1F2KA 3OPPA 3WWXA 4OLGA 3HLBA 3EOIA 2JE5A 2L4RA 3VOZA 5FI7A 4X56A 2LB9A 5HD3A 2WK0A 3T4QA 4E6XA 4KG5A 4QY6A 2RCXA 2D02A 2PR5A 3TW8A 4Y7PA 5HDDA 3B33A 3N4IA 1KDWA 5DFYA 1OMEA 3CPTB 4XXRA 2W3HA 3DWZA 3A3DA 3E2LA 1ES2A 1ESUA 3NDGA 2G2UA 4NXFA 3IF6C 4R4SA 3IXHA 4Y2FA 4OH0A 1K4EA 5CTMA 1OT6A 4CPKA 4NKPA 4C75A 3UNWA 4EXOA 3WS0A 1KE3A 3SH9A 4R1GA 1TDGA 1P0ZA 5EVID 2Y2GA 2M7UA 1TS0A 2KOIA 4HH2A 4LV1A 5CGWA 5HWTA 3QP2A 3EEHA 3T4OA 5CHUA 2J7VA 4DN0A 4PKYG 1I5QA 4X1LA 4OPZA 1E4DA 4I3JA 5EVEA 4MN6A 2ZLYA 3ULFA 5HDCA 4ZTKA 2V20A 2XD1A 3G32A 2ZC4B 2ZQCA 1JNUA 1W8QA 1Q2QA 3V3SA 3IXDA 5FQJA 4R3JA 1C3BA 3QP4A 2IA2A 4K91A 3ZG8B 2GZAA 5EPHA 2KX6A 3VFHA 2IWBA 3IXBA 4JXSA 1ES3A 2WAFA 3R7WB 2OWHA 4ZBEA 2VGLM 4LCLA 4M3KA 3KYZA 2AVXA 1SKOA 2WAEA 2A2LA 3DTEA 1BT5A 3LR4A 4DE0A 2WGVA 3FG8A 1ERMA 1XJ2A 1MWTA 3PHYA 2JC7A 3WRZA 4LRYC 1K54A 5A8BA 2Y4AA 3I7JA 1BYWA 2VK3A 1N9OA 5FA7A 3GRJA 3PBQA 4GNUA 3C2WA 2WKRA 4GHIB 4OOMA 1LI9A 2VLGA 2ZD8A 2HJ9C 4FOFA 3RXWA 2O0YA 3IX3A 2PYRA 3PYPA 3IXGA 4IUKA 2O9CA 3OZHA 3OBFA 4S2IA 2Y2NA 4JPMA 3VMAA 4DJ3A 2Q9MA 3MKEA 2ZM8A 2ZQ8A 2OLVA 3BFGA 5L8MA 2PAVP 3PBNA 4YOFA 1Y4OA 5F5YA 5M1AA 2OV5A 2V1BA 3BLSA 1K0KA 5I94A 5FEGA 2ZM0A 3GQZA 4UA6A 2R78A 2W0NA 2WGIA 3G30A 3Q7VB 3G4PA 1AWIA 1J3WA 1OJ5A 2PDRA 2J8YA 5AQ9A 2ZMVA 3C38A 4Z1WA 1PWGA 3BJNA 1MKIA 2WKQA 4QY5A 3OPRA 4HOIA 3A3EA 3H9WA 4MMNA 4LV3A 4HHDA 4JGRA 2Y8HA 3A0RA 3LICA 5L09A 3VSLA 1S66L 5HWWA 1VHMA 1GHPA 2XR0A 3M2JA 4WL9A 1I2SA 1VB6A 3BFCA 2WADA 3B47A 3IWIA 5HPFA 1VETA 3PTEA 3IX4A 3LR3A 1E3UD 1GSVA 1PIOA 1NJ4A 1S67L 2JHEA 3TOIA 4Y0UA 3EWKA 5JYOA 3MZEA 1OTDA 2VGKA 3HLWA 1G5UA 2I72A 2YKFA 3VOLA 1L0EA 3OC2A 1K54C 4OOLA 3ZFZA 4KQDA 3V5MA 1WA9A 4LPZA 4JKTA 1MWUA 1P97A 2KDKA 4OP5A 3H82A 1DJBA 4PPRA 3ZQ5A 1PZOA 3EGXC 1CEGA 1FQGA 2W3FA 4R0QA 2JKTM 4GW9A 3JPUA 5FQMA 3HLEA 2JKRM 5FQKA 1YLWA 4U0XA 2WYXA 3RFBA 4HBUA 3S7OA 2X02A 2X71A 3F1OA 3QP1A 5M19A 4EEPA 2BLSA 4OVDA 3E0YA 4C3QA 3LI9A 2Y79A 2VEAA 2DCFA 2ZC6B 4QWOA 2XQZA 3C8CA 4DJ2A 1FR1A 4WMCA 3C7UA 3NIAA 3GR2A 5HD5A 4QB8A 1TEMA 5HWVA 4K08A 1YPRA 4B4ZA 2FFYA 4PM7A 5CGSA 5AVFA 1JWZA 1EWZA 1F9IA 2P9VB 3A0SA 4DKIA 2QHKA 1FCMA 1O07A 1Z6FA 3KSGA 1K57C 4ZAMA 4PMAA 4LENA 2ZL1A 4JLFA 3S7NA 1XFNA 3DWKA 3NJAA 2V1AA 4IUHA 3SS5A 4BBVA 3PBOA 3MQQA 4F94A 5GLDA 1KGEA 3GVBA 5DTTA 4WYYA 4UA7A 4BL3A 4EETB 1ES4A 2GX5A 1ONHA 1W79A 1XJ4A 5FSRA 4CLCC 5CECA 1FOFA 2VV6A 4QU3A 2DRWA 2FZ0A 3V67A 2O99A 1S1ZA 2J3TD 4L0LA 4FD8A 2J80A 1K55C 2Q0OA 2ZOIA 3T4TA 4MBFA 1W8YA 1ERQA 1XXMA 1JWVA 1WYCA 3TE8A 3IS2B 5K5BA 4KZ9A 5EECA 2Y2OA 4GS9A 3KO6A 1J9MA 3P09A 1K6RA 5GLAA 4HIAA 2W3EA 5HDSA 3BM6A 2B95A 3NOPC 4GCZA 3ZYTA 1N9NA 4JF6A 2MJ6A 4L9FA 1MY8A 1MPLA 4GDNA 4DDSA 3CITA 2PR6A 4CLCE 2HZ5A 4JF5A 4JXVA 4WLAA 3SS3A 1IFQA 3O88A 3M6HA 2J9OA 3BECA 5DF7A 2G2WA 2JKFA 2W3DA 4DRTA 5E2HA 1IEMA 1OTIA 1PW1A 3O3VA 5E2GA 1XGIA 4EESA 3W8KA 3HCYA 5DJTA 1NRJA 1XPBA 4B88A 3O87A 2WZZA 1DP6A 3LEQA 2GDNA 5GLCA 3N8LA 3OCLA 4G3WA 1LL5A 1JTDA 1MBLA 3U2AA 5CEDA 3UB9A 3FYZA 4NEED 3BFFA 1OTBA 4ARZA 2ZQ7A 4BD1A 4OQ0A 1K56A 2XD5A 3E2KA 1QMFA 1DRMA 4ME4A 3F1NA 1KE0A 4YWZA 2EWWA 2Y2LA 4EWFA 3CLOA 3BRMA 1NLYA 3UMDA 2VV8A 2OAP1 4DXBA 4Q0IA 3T1XA 4CQHA 4EQ1A 2ZMAA 3WS1A 4JF4A 3BQ8A 5J3WA 1HVBA 4PM6A 4B9OA 3R4KA 4HP4A 1ESIA 4IBRA 5CRFA 1GCEA 1LT0A 5DKLA 1XP4A 4ZJ1A 1U60A 4JGOA 1TD5A 2WKEA 4OPYA 4YNRA 2W27A 2J9PA 3JVVA 4Y17A 1NXYA 3UDIA 1JVJA 4IVKA 5G18A 4D60A 1KOUA 1A0KA 5KIZA 1HLUP 1NWZA 1VM1A 3MXRA 4N9LA 3LIFA 1BLSA 4GOGA 3H82B 4O0PA 1BLCA 1D7EA 3HVFA 3VP3A 2XK1A 3BFDA 5LBRA 1W63Q 1IKIA 5EVLA 3OCNA 4Y0TA 1FILA 3P01A 3G35A 2UWXA 4EEUA 5CERA 3H7WA 3E98A 2QZ6A 5EM0A 3ITBA 5F83A 1DP8A 3MXQA 4X25A 1OPXA 4E04A 3E4QA 2EX2A 3KX0X 1V9YA 2J3TC 3O5YA 1OTAA 2CC1A 1KGGA 1KE4A 2HP9A 3GTCA 4MN5A 4I3IA 4P0MA 4DMZA 1YT4A 1JTGA 5DJUA 1ZG4A 5HL6A 3BY9A 5G4YA 4F3LB 3T4LA 5F68A 3HL9A 1N9LA 3G2YA 2JKTI 1PWDA 1S4SA 3TJZC 1EROA 2LB5A 3UDXA 3UE0A 4OPRA 4ETXA 5F1GA 2ZL1B 5J8XA 4E3NA 2KLIA 5EOEA 1YLTA 3Q07A 1H0MA 2XFSA 1H5XA 4KZBA 3C5AA 4IEDA 3Q81A 1IKGA 4DF6A 4S2OA 4ZDXA 1LLBA 2VZWA 4RQ9A 3A3FA 5EVIA 4QHCA 5KZHA 4P6BA 3ZNYA 3HBRA 4AFIA 3VFFA 3ZVWA 1LI0A 1SKFA 3LIAA 4KZ7A 3HJIA 3PBSA 3VOYA 3NCKA 5EOOA 3G31A 3D72A 3IF5A 4BENA 3LGOA 3LY3A 2HP5A 2R9XA 3LEZA 4DE3A 4LRXC 3PAGA 2HV1A 2ZQAA 4HJ3A 4BLMA 1E25A 3VP1A 2XROA 1I2WA 2V8FA 4YINA 5TR7A 4KZ8A 3MR0A 1NYYA 3AGEA 1XKZA 1BZAA 3V50A 3P7NA 2WUQA 5TBMB 3IF6B 1L2SA 1XFQA 4NK3A 2DNSA 1PI4A 2VJWA 4WUJA 1CI8A 3PAEA 4E3IA 1F98A 1S1YA 3CG5A 2HP6A 3TG9A 2M7VA 5CX7A 3O86A 4KZAA 3KSHA 1O7EA 3U4LP 4UA9A 2O9BA 4JGPA 2INWA 5FQ9A 5HSQA 5FQIA 3T1RA 3VV4A 4IHQA 3T1QB 1BLHA 1GA9A 1LSXA 3KYEA 3CAXA 1G6AA 4Q8IA 5KSHA 1YQSA 4LRZE 2V0UA 1ZTUA 1CI9A 4Z9QA 3IH9A 2ZC5B 3AGFA 3QHYA 1YKDA 5AJGA 5FEFA 3C4PA 3Q7ZA 3HUMA 3L9KA 5FDSA 3N8SA 2M1CA 1K57A 4ARZB 1KVLA 3UPNA 3UMEA 4O01A 4QPRA 1GHIA 4G3KA 3DAVA 3F1NB 3F1PB 4JGQA 4RX2A 1FIKA 2UV0E 3BQAA 4S2PA 5EVIC 2X01A 3NOUC 4B4XA 1NY0A 5GHYA 5HX9A 1M6KA 4CLCA 4CJNA 4RA7A 5EFWA 3IX8A 2OAQ1 1XJ6A 2ACGA 2XGNA 4FUWA 3K3CA 4BL2A 3D3OA 3UY6A 5FASA 1G68A 2GNXA 4C6YA 2OLUA 3NULA 1KVMA 2HDSA 4DE2A 1AXBA 1K55A 3IBRA 1BSGA 1HD8A 4Y15A 3WRTA 1WYBA 3LYXA 5FQQA 3TRCA 4I5SA 4ETZA 1T18A 5CHJA 3KSIA 4R3AA 3UDFA 2QWSA 5L2FA 3IWQA 5GHXA 5IT5A 4GZBA 4EBLA 3PR6A 1W7FA 2H0YA 3LCEA 5IS1A 3E4OA 4ESPA 3LUQA 1TF1A 2ZC3B 5EUAA 5FAOA 3GSGA 1IYQA 5E2FA 1E3UA 2XDMA 1ZKJA 3HLFA 1F5MA 1ZC2A 1UWPX 4WBGA 1YLPA 3QNCA 4P87A 2EX8A 4KENB 5HAPA 4IVIA 3NHQA 3RJUA 4QJGA 1SHVA 1BTLA 4HY8A 3VSKA 4LV2A 4N9KA 3IHAA 3PXPA 4K0WA 3GV9A 4R4RA 5F6AA 1RCJA 1ONGA 3OPHA 1YSQA 2IWCA 1YMXA 2EWVA 3N8RA 3BEBA 1L3LA 1D06A 5G4ZA 2V8CA 1FSYA 2QYBA 1YSPA 1DY6A 3S1YA 1BLPA 1V9ZA 3JVUA 2O9AA 1ODVA 4YFMA 1LSVA 4NG2A 4BQMA 2Z2LB 3HREA 3MSHA 1W63M 3MQ0A 4WN5A 4WEJA 1PFLA 1D1JA 2VKSA 1PWCA 1IYPA 4HNBA 4IJGA 5HARA 3FZCA 4D2OA 2E8JA 2XSSA 2L1MA 2A3UA 1UGUA 2V1ZA 3W4PA 3ZG5A 4EUZA 3LY4A 3DTMA 3UPOA 4KG2A 3DTKA 2WKIA 1SKOB 4Y0OA 3KYQA 3UB5P 2PHYA 3LO7A 4R3BA 3M6BA 2VX8A 4PM8A 1K25A 4H6JA 2OSUA 4RYEA 5FAPA 3CJMA 1VEUA 4GN2A 5DF9A 3FV7A 4KG6A 3KSFA 3ISGA 5HL1A 1GSWA 4R23A 1NZUA 3UE6A 3V39A 2W1RA 1T1CA 4XUXA 5F82A 2PBYA 2Z2MB 5CEBA 2Q9NA 1L0DA 2Z6DA 2W3GA 1BULA 2Y91A 4GHIA 1S6RA 3NBLA 5A92A 4MDZA 3SS4A 2B02A 5HW3A 4HESA 5HAQA 2EXBA 3EQUA 3C30A 3MQOA 2Y2IA 1LL8A 5DVAA 1CK3A 3FKVA 3L7HA 4UQIS 4NXGA 1FCNA 4PM9A 3BLMA 5GLBA 4E3KA 3QNBA 4EW7A 4II7A 2WZXA 4Y5FA 1KGFA 5FL3A 1PRQA 2Y2HA 3RXXA 1IOUA 4I38A 4N1HA 1OT9A 4PHTA 4BWIA 4ZJ2A 1MZUA 1MWRA 1CEFA 1PYYA 3UE3A 2I9VA 3NOTC 5KMWA 4H8RA 5M18A 1XJ3A 2Y2KA 1S4RA 1STZA 4K0XA 2A49A 4LLOB 2VGJA 2XH9A 2JKGA 5IU1A 1PI5A 1HZOA 2P04A 1MC0A 4BD0A 1T1BA 3T50A 1VETB 3LIEA 3RH8B 3UB7A 2XRNA 2V2FF 5GL9A 1K38A 4CLCB 5DTKA 3NECA 3E4PA 1RP5A 4OLDA 5CXWA 1OJGA 1UWNX 3VE4A 3GDIA 2Y2QA 3IBJA 4DXCA 5IHVA 3CWFA 4GB7A 3HUOA 2DMWA 1GSXA 4LGWA 5BOHA 2ZJ9A 4XT2A 5F1FA 4HEFA 4S2NA 1MWSA 1S0WA 2VV7A 3Q82A 3MJQA 3BYDA 4OOYA 2PT7A 2Y59A 2PRFA 4GJ4A 4Y13A 1QMEA 3BW6A 1PW8A 3CMZA 2L0WA 1MKMA 3T12B 3F1OB 3WS4A 4OONA 3PBRA 4M4XA 4WM9A 3WS5A 4O8GA 1Z09A 5AQBA 2JN7A 4EU0A 2QJ7A 4HBTA 3SW1A 1DP9A 3ICYA 3GECA 5GHZA 2J3WA 4ZJ3A 2W1TA 1WE4A 1ALQA 3A0VA 2NUPC 4OQHA 3HLCA 2ZBBA 3UB8A 4BJPA 4HI4A 3ZCZA 5EV0A 4KZ6A 4O7DA 1NZOA 1PZPA 3FPVA 3JYIA 4MNRA 4MBHA 2JKRI 2XA7S 2Y55A 3MKFA 5FDHA 2PYPA 2P08A 2IWDA 4N92A 3ZG7B 2PU4A 2A24A 3UE1A 2R9WA 3B3XA 1RGZA 5EE8A 3IH8A 3DBAA 2P9VA 2QKPA 1ZG6A 3QP8A 4WEKA 1FR6A 3ZDJA 1G28A 2XEPA 3T1SA 2ZQ9A 3IT9A 1K4FA 2QMIA 3OPLA 4ZRRA 3S7PA 2Y2JA 2WGWA 3VP2A 2K2NA 4PAUA 5F69A 2ZMFA 2HDUA 4DE1A 3GMWA 4S2MA 4KQOA 4L9EA 1G6OA 2C5WB 4FTXA 1T1AA 4UEYA 4H6JB 4P6ZS 3EGDC 4MCWA 4EUVA 1P9RA 1YLJA 3P98A 4MEZA 1ZHHB 3LR5A 1VEUB 4GD8A 1EI5A 4E6WA 4L9GA 3T4JA 4S2NC 4X55A 2K7SA 3B42A 2FH5A 4OKPA 4EBPA 4GS9B 4HP9A 4LCMA 1LHYA 1Y28A 4LFUA 5I5LA 3BY8A 4UQIM 4P85A 3K3DA 2HDQA 1KDSA 4ID4A 3IS2A 1DJCA 4JXWA 3IQAA 3SOIA 4G3VA 2FFFB 3CI6A 2EX6A 3BFEA 1LSWA 3MS6A 2H28A 4WZ5A 4BBUA 3K2NA 3SZTA 2EX9A 4BMWA 4GLQA 4UAAA 4NXEA 4WELA 4KQRA 3FWLA 3V3RA 3ZVTA 1NLZA 2WKPA 2HGVA 2BG1A 3LIBA 3CZDA 3G2ZA 5HPIA 1P9WA 3ZG9B 3RTYA 4FH4A 1SZVA 3MFDA 3SH7A 2HPBA 4CLCD 1IYOA 4LV0A 1N9BA 4PKYA 3N7WA 4KZ4A 3DTIA 2ZC7A 3LFVA 1OTEA 3LIDA 2QJ5A 3T4SA 5HZHA 3VE3A 1Q2PA 4KZ5A 4E3LA 1H3QA 3MMHA 3ZG0A 1CJFA 1XA7A 3VP0A 1RGYA 2P74A 2EFXA 3N6IA 5E43A 2XF3A 3PBTA 4A5RA 3FKWA 3SH8A 4XT2B 4KZ3A 1SCWA 5TFQA 2BTFP 1NRFA 3EQVA 1YM1A 4I3AA 1HTZA 3EEAA 1X0OA 4EV4A 1YLYA 1H8ZA 3OOVA 5TGFA 4BBTA 4WMCD 5A91A 4HQAA 4XUZA 4R38A 5FI2A 4NETA 2Y2MA 3HLGA 3BWLA 3UPPA 3IWOA 3CPTA 3H7WB 1JWPA 3MZDA 3W2ZA 3MFXA 2OWJA 1DJAA 2H5SA 2HF6A 4X69A 1YLZA 5D3OA 4PM5A 4WZ5C 2OOLA 2XA7M 3ITAA 4I39A 5FATA 2W1TB 4EERA 1MXOA 4OPQA 4GDBA 4E3OA 3CHWP 4KUOA 3HJKA 1SDEA 5KSCA 4KQQA 4RX3A 4E3JA 2PBDP 1TDLA 3OLOA 1EW0A 2PD7A 1LL9A 1TS8A 4U3TA 4FH2A 5J7EA 3UN7A 3FPWA 5E2EA 3LI8A 5EM1A 2PU2A 2D01A 1BUEA 4Y3IA 2E8IA 4F3LA 1SDNA 4R6LA 1XGJA 1TS7A 2EFUA 4OP8A 2A24B 5CGXA 2Z6CA 3MBZA 4OQIA 3MZFA 5DTSA 5L07A 3D9YA 4MLLA 1H8MA 5DFXA 2VA0A 4P6ZM 2CMNA 3C4OA 2C6WB 4NXBA 3NC8A 5FAQA 5EVIB 5A90A 4EBNA 3S22A 4HH3A 2HDRA 5TJJA 4UHUA 2WGWB 3MXSA 3WS2A 1TVFA 1XX2A 2JCHA 3NI9A 5CHMA 1T19A 2EXAA 5JYPA 2ZOHA 3ZGAB 1ACFA 2V9AA 5U47A 4HJ6A 1ES5A 3R7WA 3CUEA 1CF0A 4E3MA 4S2LA 4OQGA 2G7UA 3VP4A 3NY4A 2Y2PA 3LR0A 4QD4A 1TS6A 4X53A 3MF0A 3DW0A 2BASA 4S2JA 2B5RA 4N1XA 3G6OA 5HAIA 4X1MA 3IHBA 1K6SA 4GKUA 1W5DA 5AVEA 1YMSA 3A3IA 5HFOA 3S7QA 2VGLS 2PD8A 4KUKA 5AQ7A 2EA9A 3ZNTA 5MC7A 4EQIA 1IYSA 2RL3A
chains in the Genus database with same CATH topology
1L2SA 5FQMA 4NK3A 3HLEA 5FQKA 2DNSA 4OONA 3PBRA 3WS4A 3W4QA 1YLWA 3M2KA 2WYXA 4U0XA 1PI4A 4WM9A 4HBUA 1CI8A 1VQQA 3WS5A 1GHMA 4WZ4A 3PAEA 4E3IA 3IF6A 1FCOA 2X02A 5AQBA 2X71A 3S4XA 3W4OA 5A93A 4DDYA 3AGDA 5M19A 2WKHA 2BLSA 5FI6A 3CG5A 1K56D 4HBTA 2HP6A 3TG9A 2ZM2A 5GHZA 4OVDA 3O86A 4C3QA 4KZAA 4ZJ3A 1O7EA 2XLNA 5CTNA 1WE4A 2DCFA 4UA9A 1ALQA 1N4OA 1GA0A 2ZC6B 1NYMA 1H8YA 4IBXA 5FQ9A 4OQHA 5FQIA 3HLCA 4RVAA 4S2KA 4BJPA 3ZCZA 1BLHA 1GA9A 2XQZA 1M40A 1FR1A 1G6AA 3C7VA 4Q8IA 4WMCA 3A3JA 5KSHA 1YQSA 3C7UA 3NIAA 2XFTA 3HLDA 3GR2A 4KZ6A 4QB8A 1IELA 4O7DA 1NZOA 1L0FA 1PZPA 1TEMA 2JBFA 1CI9A 3JYIA 4MNRA 4Z9QA 3Q7VA 3IH9A 4MBHA 4B4ZA 2ZC5B 2Y55A 3MKFA 3AGFA 2FFYA 3QHYA 4FSFA 4PM7A 5CGSA 5DF8A 3C4PA 5FDHA 1L0GA 1JWZA 2H0TA 3G34A 2IWDA 1EWZA 4N92A 3Q7ZA 3HUMA 4JXGA 3ZG7B 2PU4A 2P9VB 4X68A 3NDEA 3D4FA 4JBFA 3N8SA 1K57A 4DKIA 3UE1A 2R9WA 1KVLA 1FCMA 3B3XA 1O07A 3UPNA 1XA1A 1RGZA 3ZHHA 1Z6FA 1GHIA 5EE8A 2H10A 1K57C 4ZAMA 2QPNA 4PMAA 3Q1FA 4LENA 3IH8A 2P9VA 4GD6A 1ZG6A 4JLFA 4FCFA 3DWKA 4WEKA 4RX2A 3SS5A 1FR6A 3ZDJA 3PBOA 2XEPA 4F94A 4U0TA 2ZQ9A 3HUNA 4S2PA 5GLDA 3IT9A 4MBKA 1KGEA 3GVBA 1K4FA 5EVIC 2X01A 2QMIA 3OPLA 4B4XA 5DTTA 2Y2JA 1NY0A 2WGWA 4WYYA 5GHYA 2ZQDA 4UA7A 3VP2A 1Y54A 3UO9A 4BL3A 1ES4A 5HX9A 2HDUA 1M6KA 1FSWA 1ONHA 3GMWA 4KQOA 4S2MA 4RA7A 3TSGA 4CJNA 1W79A 2C5WB 4X6TA 5AQAA 5FSRA 2XGNA 3OPPA 3WWXA 1YLJA 4BL2A 4OLGA 5CECA 3P98A 4MEZA 3UY6A 5FASA 3HLBA 1G68A 4C6YA 1FOFA 2JE5A 3VOZA 5FI7A 2OLUA 4GD8A 4QU3A 1KVMA 2HDSA 4X56A 2DRWA 4DE2A 1AXBA 1K55A 1EI5A 2WK0A 4E6WA 1BSGA 1HD8A 3WRTA 4E6XA 1WYBA 5FQQA 4L0LA 4S2NC 4KG5A 4FD8A 4X55A 4EBPA 4OKPA 1K55C 4QY6A 2RCXA 4LCMA 1LHYA 4MBFA 1W8YA 5CHJA 1ERQA 3UDFA 1XXMA 1JWVA 1WYCA 4Y7PA 4KZ9A 5EECA 5L2FA 3N4IA 2Y2OA 1KDWA 3IWQA 1J9MA 4P85A 5GHXA 2HDQA 1KDSA 3P09A 1OMEA 4GZBA 4ID4A 4EBLA 1W7FA 2H0YA 1K6RA 3LCEA 5GLAA 1DJCA 2ZC3B 3BM6A 5EUAA 5FAOA 3GSGA 1IYQA 4XXRA 5E2FA 1E3UA 2XDMA 1ZKJA 3HLFA 3IQAA 4JXWA 3SOIA 1ZC2A 2FFFB 3DWZA 3A3DA 3E2LA 1ES2A 1ESUA 3NDGA 4JF6A 2EX6A 3BFEA 2G2UA 1MY8A 1MPLA 3IF6C 4GDNA 4WBGA 4DDSA 1YLPA 4WZ5A 3QNCA 4P87A 4R4SA 3IXHA 2EX8A 2EX9A 4KENB 5HAPA 4OH0A 1K4EA 4JF5A 4JXVA 3SS3A 5CTMA 4CPKA 3O88A 4IVIA 3M6HA 4C75A 4UAAA 2J9OA 3BECA 3RJUA 4QJGA 4WELA 1SHVA 1BTLA 4KQRA 2G2WA 5DF7A 3UNWA 3VSKA 3WS0A 3FWLA 4LV2A 3V3RA 4DRTA 4N9KA 3IHAA 4K0WA 5E2HA 3GV9A 4R4RA 3ZVTA 1KE3A 3SH9A 1IEMA 1PW1A 4R1GA 1TDGA 3O3VA 1RCJA 5E2GA 1XGIA 5EVID 2Y2GA 3W8KA 1ONGA 3OPHA 2BG1A 4LV1A 2IWCA 1YMXA 5CGWA 3N8RA 3CZDA 3G2ZA 3BEBA 1XPBA 4B88A 3O87A 2WZZA 1FSYA 5CHUA 1DY6A 2J7VA 3S1YA 1BLPA 2GDNA 5GLCA 3N8LA 3ZG9B 3OCLA 4FH4A 1I5QA 3MFDA 3SH7A 4YFMA 2HPBA 1IYOA 4BQMA 2Z2LB 4LV0A 4OPZA 1E4DA 3HREA 1N9BA 1LL5A 1JTDA 4WEJA 1MBLA 5CEDA 3FYZA 2ZLYA 1PWCA 3BFFA 1IYPA 2ZQ7A 4BD1A 3N7WA 5HARA 4KZ4A 4OQ0A 1K56A 2XD5A 2V20A 3E2KA 1QMFA 4ZTKA 2XD1A 2ZC7A 3FZCA 3G32A 4D2OA 1KE0A 2Y2LA 2ZC4B 2ZQCA 4EWFA 1W8QA 1Q2QA 3BRMA 2A3UA 3V3SA 3IXDA 5FQJA 2V1ZA 4R3JA 1C3BA 4DXBA 3W4PA 1Q2PA 4K91A 3ZG5A 3ZG8B 4KZ5A 4EUZA 3LY4A 4E3LA 3DTMA 5EPHA 3UPOA 4KG2A 2ZMAA 3VFHA 2IWBA 2WKIA 3WS1A 4JF4A 3ZG0A 4Y0OA 3IXBA 1HVBA 4PM6A 4JXSA 1ES3A 2WAFA 4ZBEA 1ESIA 1XA7A 3LO7A 4LCLA 4M3KA 4R3BA 4IBRA 3VP0A 3M6BA 5CRFA 1GCEA 1XP4A 4ZJ1A 1RGYA 4PM8A 1K25A 2WAEA 2P74A 1U60A 2EFXA 3N6IA 1BT5A 5E43A 2OSUA 2WKEA 4DE0A 2WGVA 4OPYA 2J9PA 2XF3A 3PBTA 4RYEA 1NXYA 5FAPA 4A5RA 3FKWA 3SH8A 3UDIA 1JVJA 1ERMA 4IVKA 4KZ3A 1SCWA 1MWTA 3CJMA 5G18A 2JC7A 4GN2A 5TFQA 3WRZA 1NRFA 3EQVA 1YM1A 5DF9A 1K54A 1HTZA 2Y4AA 3I7JA 3FV7A 4EV4A 1VM1A 1YLYA 1H8ZA 3MXRA 4KG6A 4N9LA 3ISGA 5FA7A 3GRJA 5HL1A 5TGFA 1BLSA 3PBQA 4R23A 1NZUA 4GOGA 4GNUA 4WMCD 3V39A 5A91A 1BLCA 4XUXA 4XUZA 3HVFA 3VP3A 2XK1A 5F82A 3BFDA 5FI2A 2PBYA 2Z2MB 4NETA 2Y2MA 4OOMA 5CEBA 3HLGA 1IKIA 1LI9A 1L0DA 2Q9NA 2ZD8A 5EVLA 3OCNA 3RXWA 3UPPA 1BULA 3IWOA 2Y91A 1JWPA 3IXGA 1S6RA 3MZDA 3NBLA 4Y0TA 5A92A 3SS4A 1DJAA 2H5SA 3OZHA 4X69A 5HW3A 1YLZA 5D3OA 3G35A 2Y2NA 4HESA 4JPMA 4S2IA 2UWXA 4WZ5C 4PM5A 5HAQA 3VMAA 2EXBA 2Q9MA 5CERA 3MKEA 3EQUA 3ITAA 2QZ6A 2ZM8A 5FATA 2Y2IA 2ZQ8A 2OLVA 3ITBA 5F83A 1MXOA 4OPQA 5DVAA 1CK3A 3FKVA 4GDBA 3BFGA 3PBNA 4E3OA 2EX2A 2OV5A 5M1AA 1FCNA 3BLSA 2CC1A 1KGGA 4PM9A 1KE4A 5I94A 3BLMA 2HP9A 1SDEA 5KSCA 2ZM0A 5GLBA 3GTCA 4KQQA 3GQZA 4E3KA 4RX3A 3QNBA 4P0MA 4E3JA 1YT4A 1JTGA 2WZXA 4UA6A 1KGFA 2WGIA 1TDLA 2Y2HA 1ZG4A 3RXXA 4N1HA 3G30A 1LL9A 3Q7VB 4U3TA 4FH2A 3UN7A 5E2EA 3G4PA 4ZJ2A 3HL9A 2PU2A 3G2YA 1BUEA 2J8YA 2E8IA 5AQ9A 1SDNA 1PWDA 1XGJA 1MWRA 1CEFA 1PYYA 2EFUA 1PWGA 4OP8A 5CGXA 1MKIA 1EROA 3MBZA 4QY5A 3UDXA 3OPRA 4OQIA 3UE0A 3UE3A 3MZFA 5DTSA 5KMWA 4H8RA 5M18A 4OPRA 3A3EA 5F1GA 2Y2KA 4LV3A 5J8XA 4MLLA 4E3NA 5EOEA 1YLTA 3C4OA 2C6WB 3Q07A 2XFSA 4K0XA 1H5XA 4KZBA 3NC8A 2A49A 2VGJA 2XH9A 3C5AA 4IEDA 1PI5A 3Q81A 1HZOA 5FAQA 1IKGA 5EVIB 5A90A 4DF6A 3VSLA 1GHPA 4BD0A 4S2OA 4EBNA 3S22A 4ZDXA 2XR0A 1LLBA 3M2JA 2HDRA 1I2SA 3BFCA 2WADA 4UHUA 2WGWB 3A3FA 3MXSA 3WS2A 5EVIA 4QHCA 3IWIA 2V2FF 5KZHA 1TVFA 1XX2A 2JCHA 3NI9A 5CHMA 2EXAA 5GL9A 1K38A 4P6BA 3ZNYA 3PTEA 5DTKA 5JYPA 3ZGAB 1E3UD 3HBRA 1RP5A 5U47A 1PIOA 4OLDA 1ES5A 3VFFA 1NJ4A 5CXWA 4E3MA 4S2LA 4OQGA 3TOIA 3ZVWA 1LI0A 4Y0UA 1SKFA 2Y2QA 5JYOA 4DXCA 5IHVA 3MZEA 4KZ7A 3VP4A 3PBSA 3VOYA 3NCKA 2VGKA 3HLWA 4GB7A 5EOOA 4DE1A 3NY4A 3HUOA 2Y2PA 2I72A 4QD4A 3G31A 1L0EA 3OC2A 3IF5A 2ZJ9A 4BENA 5BOHA 3LY3A 1K54C 2HP5A 4X53A 2R9XA 5F1FA 3LEZA 1MWSA 1S0WA 3Q82A 4HEFA 4S2NA 3DW0A 4S2JA 2B5RA 4DE3A 3PAGA 4N1XA 2ZQAA 4BLMA 4OOLA 3ZFZA 1E25A 5HAIA 3BYDA 3V5MA 3VP1A 4OOYA 3IHBA 1I2WA 1K6SA 4GKUA 4JKTA 1MWUA 1W5DA 4YINA 5TR7A 2Y59A 1YMSA 4KZ8A 3A3IA 5HFOA 1NYYA 4OP5A 3AGEA 1XKZA 1BZAA 1DJBA 4PPRA 1QMEA 1PZOA 5AQ7A 1CEGA 3V50A 2WUQA 3ZNTA 1PW8A 3CMZA 1FQGA 3IF6B 4EQIA 1IYSA 2RL3A 4R0QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L2S A;  5FQM A;  4NK3 A;  3HLE A;  5FQK A;  2DNS A;  4OON A;  3PBR A;  3WS4 A;  3W4Q A;  1YLW A;  3M2K A;  2WYX A;  4U0X A;  1PI4 A;  4WM9 A;  4HBU A;  1CI8 A;  1VQQ A;  3WS5 A;  1GHM A;  4WZ4 A;  3PAE A;  4E3I A;  3IF6 A;  1FCO A;  2X02 A;  5AQB A;  2X71 A;  3S4X A;  3W4O A;  5A93 A;  4DDY A;  3AGD A;  5M19 A;  2WKH A;  2BLS A;  5FI6 A;  3CG5 A;  1K56 D;  4HBT A;  2HP6 A;  3TG9 A;  2ZM2 A;  5GHZ A;  4OVD A;  3O86 A;  4C3Q A;  4KZA A;  4ZJ3 A;  1O7E A;  2XLN A;  5CTN A;  1WE4 A;  2DCF A;  4UA9 A;  1ALQ A;  1N4O A;  1GA0 A;  2ZC6 B;  1NYM A;  1H8Y A;  4IBX A;  5FQ9 A;  4OQH A;  5FQI A;  3HLC A;  4RVA A;  4S2K A;  4BJP A;  3ZCZ A;  1BLH A;  1GA9 A;  2XQZ A;  1M40 A;  1FR1 A;  1G6A A;  3C7V A;  4Q8I A;  4WMC A;  3A3J A;  5KSH A;  1YQS A;  3C7U A;  3NIA A;  2XFT A;  3HLD A;  3GR2 A;  4KZ6 A;  4QB8 A;  1IEL A;  4O7D A;  1NZO A;  1L0F A;  1PZP A;  1TEM A;  2JBF A;  1CI9 A;  3JYI A;  4MNR A;  4Z9Q A;  3Q7V A;  3IH9 A;  4MBH A;  4B4Z A;  2ZC5 B;  2Y55 A;  3MKF A;  3AGF A;  2FFY A;  3QHY A;  4FSF A;  4PM7 A;  5CGS A;  5DF8 A;  3C4P A;  5FDH A;  1L0G A;  1JWZ A;  2H0T A;  3G34 A;  2IWD A;  1EWZ A;  4N92 A;  3Q7Z A;  3HUM A;  4JXG A;  3ZG7 B;  2PU4 A;  2P9V B;  4X68 A;  3NDE A;  3D4F A;  4JBF A;  3N8S A;  1K57 A;  4DKI A;  3UE1 A;  2R9W A;  1KVL A;  1FCM A;  3B3X A;  1O07 A;  3UPN A;  1XA1 A;  1RGZ A;  3ZHH A;  1Z6F A;  1GHI A;  5EE8 A;  2H10 A;  1K57 C;  4ZAM A;  2QPN A;  4PMA A;  3Q1F A;  4LEN A;  3IH8 A;  2P9V A;  4GD6 A;  1ZG6 A;  4JLF A;  4FCF A;  3DWK A;  4WEK A;  4RX2 A;  3SS5 A;  1FR6 A;  3ZDJ A;  3PBO A;  2XEP A;  4F94 A;  4U0T A;  2ZQ9 A;  3HUN A;  4S2P A;  5GLD A;  3IT9 A;  4MBK A;  1KGE A;  3GVB A;  1K4F A;  5EVI C;  2X01 A;  2QMI A;  3OPL A;  4B4X A;  5DTT A;  2Y2J A;  1NY0 A;  2WGW A;  4WYY A;  5GHY A;  2ZQD A;  4UA7 A;  3VP2 A;  1Y54 A;  3UO9 A;  4BL3 A;  1ES4 A;  5HX9 A;  2HDU A;  1M6K A;  1FSW A;  1ONH A;  3GMW A;  4KQO A;  4S2M A;  4RA7 A;  3TSG A;  4CJN A;  1W79 A;  2C5W B;  4X6T A;  5AQA A;  5FSR A;  2XGN A;  3OPP A;  3WWX A;  1YLJ A;  4BL2 A;  4OLG A;  5CEC A;  3P98 A;  4MEZ A;  3UY6 A;  5FAS A;  3HLB A;  1G68 A;  4C6Y A;  1FOF A;  2JE5 A;  3VOZ A;  5FI7 A;  2OLU A;  4GD8 A;  4QU3 A;  1KVM A;  2HDS A;  4X56 A;  2DRW A;  4DE2 A;  1AXB A;  1K55 A;  1EI5 A;  2WK0 A;  4E6W A;  1BSG A;  1HD8 A;  3WRT A;  4E6X A;  1WYB A;  5FQQ A;  4L0L A;  4S2N C;  4KG5 A;  4FD8 A;  4X55 A;  4EBP A;  4OKP A;  1K55 C;  4QY6 A;  2RCX A;  4LCM A;  1LHY A;  4MBF A;  1W8Y A;  5CHJ A;  1ERQ A;  3UDF A;  1XXM A;  1JWV A;  1WYC A;  4Y7P A;  4KZ9 A;  5EEC A;  5L2F A;  3N4I A;  2Y2O A;  1KDW A;  3IWQ A;  1J9M A;  4P85 A;  5GHX A;  2HDQ A;  1KDS A;  3P09 A;  1OME A;  4GZB A;  4ID4 A;  4EBL A;  1W7F A;  2H0Y A;  1K6R A;  3LCE A;  5GLA A;  1DJC A;  2ZC3 B;  3BM6 A;  5EUA A;  5FAO A;  3GSG A;  1IYQ A;  4XXR A;  5E2F A;  1E3U A;  2XDM A;  1ZKJ A;  3HLF A;  3IQA A;  4JXW A;  3SOI A;  1ZC2 A;  2FFF B;  3DWZ A;  3A3D A;  3E2L A;  1ES2 A;  1ESU A;  3NDG A;  4JF6 A;  2EX6 A;  3BFE A;  2G2U A;  1MY8 A;  1MPL A;  3IF6 C;  4GDN A;  4WBG A;  4DDS A;  1YLP A;  4WZ5 A;  3QNC A;  4P87 A;  4R4S A;  3IXH A;  2EX8 A;  2EX9 A;  4KEN B;  5HAP A;  4OH0 A;  1K4E A;  4JF5 A;  4JXV A;  3SS3 A;  5CTM A;  4CPK A;  3O88 A;  4IVI A;  3M6H A;  4C75 A;  4UAA A;  2J9O A;  3BEC A;  3RJU A;  4QJG A;  4WEL A;  1SHV A;  1BTL A;  4KQR A;  2G2W A;  5DF7 A;  3UNW A;  3VSK A;  3WS0 A;  3FWL A;  4LV2 A;  3V3R A;  4DRT A;  4N9K A;  3IHA A;  4K0W A;  5E2H A;  3GV9 A;  4R4R A;  3ZVT A;  1KE3 A;  3SH9 A;  1IEM A;  1PW1 A;  4R1G A;  1TDG A;  3O3V A;  1RCJ A;  5E2G A;  1XGI A;  5EVI D;  2Y2G A;  3W8K A;  1ONG A;  3OPH A;  2BG1 A;  4LV1 A;  2IWC A;  1YMX A;  5CGW A;  3N8R A;  3CZD A;  3G2Z A;  3BEB A;  1XPB A;  4B88 A;  3O87 A;  2WZZ A;  1FSY A;  5CHU A;  1DY6 A;  2J7V A;  3S1Y A;  1BLP A;  2GDN A;  5GLC A;  3N8L A;  3ZG9 B;  3OCL A;  4FH4 A;  1I5Q A;  3MFD A;  3SH7 A;  4YFM A;  2HPB A;  1IYO A;  4BQM A;  2Z2L B;  4LV0 A;  4OPZ A;  1E4D A;  3HRE A;  1N9B A;  1LL5 A;  1JTD A;  4WEJ A;  1MBL A;  5CED A;  3FYZ A;  2ZLY A;  1PWC A;  3BFF A;  1IYP A;  2ZQ7 A;  4BD1 A;  3N7W A;  5HAR A;  4KZ4 A;  4OQ0 A;  1K56 A;  2XD5 A;  2V20 A;  3E2K A;  1QMF A;  4ZTK A;  2XD1 A;  2ZC7 A;  3FZC A;  3G32 A;  4D2O A;  1KE0 A;  2Y2L A;  2ZC4 B;  2ZQC A;  4EWF A;  1W8Q A;  1Q2Q A;  3BRM A;  2A3U A;  3V3S A;  3IXD A;  5FQJ A;  2V1Z A;  4R3J A;  1C3B A;  4DXB A;  3W4P A;  1Q2P A;  4K91 A;  3ZG5 A;  3ZG8 B;  4KZ5 A;  4EUZ A;  3LY4 A;  4E3L A;  3DTM A;  5EPH A;  3UPO A;  4KG2 A;  2ZMA A;  3VFH A;  2IWB A;  2WKI A;  3WS1 A;  4JF4 A;  3ZG0 A;  4Y0O A;  3IXB A;  1HVB A;  4PM6 A;  4JXS A;  1ES3 A;  2WAF A;  4ZBE A;  1ESI A;  1XA7 A;  3LO7 A;  4LCL A;  4M3K A;  4R3B A;  4IBR A;  3VP0 A;  3M6B A;  5CRF A;  1GCE A;  1XP4 A;  4ZJ1 A;  1RGY A;  4PM8 A;  1K25 A;  2WAE A;  2P74 A;  1U60 A;  2EFX A;  3N6I A;  1BT5 A;  5E43 A;  2OSU A;  2WKE A;  4DE0 A;  2WGV A;  4OPY A;  2J9P A;  2XF3 A;  3PBT A;  4RYE A;  1NXY A;  5FAP A;  4A5R A;  3FKW A;  3SH8 A;  3UDI A;  1JVJ A;  1ERM A;  4IVK A;  4KZ3 A;  1SCW A;  1MWT A;  3CJM A;  5G18 A;  2JC7 A;  4GN2 A;  5TFQ A;  3WRZ A;  1NRF A;  3EQV A;  1YM1 A;  5DF9 A;  1K54 A;  1HTZ A;  2Y4A A;  3I7J A;  3FV7 A;  4EV4 A;  1VM1 A;  1YLY A;  1H8Z A;  3MXR A;  4KG6 A;  4N9L A;  3ISG A;  5FA7 A;  3GRJ A;  5HL1 A;  5TGF A;  1BLS A;  3PBQ A;  4R23 A;  1NZU A;  4GOG A;  4GNU A;  4WMC D;  3V39 A;  5A91 A;  1BLC A;  4XUX A;  4XUZ A;  3HVF A;  3VP3 A;  2XK1 A;  5F82 A;  3BFD A;  5FI2 A;  2PBY A;  2Z2M B;  4NET A;  2Y2M A;  4OOM A;  5CEB A;  3HLG A;  1IKI A;  1LI9 A;  1L0D A;  2Q9N A;  2ZD8 A;  5EVL A;  3OCN A;  3RXW A;  3UPP A;  1BUL A;  3IWO A;  2Y91 A;  1JWP A;  3IXG A;  1S6R A;  3MZD A;  3NBL A;  4Y0T A;  5A92 A;  3SS4 A;  1DJA A;  2H5S A;  3OZH A;  4X69 A;  5HW3 A;  1YLZ A;  5D3O A;  3G35 A;  2Y2N A;  4HES A;  4JPM A;  4S2I A;  2UWX A;  4WZ5 C;  4PM5 A;  5HAQ A;  3VMA A;  2EXB A;  2Q9M A;  5CER A;  3MKE A;  3EQU A;  3ITA A;  2QZ6 A;  2ZM8 A;  5FAT A;  2Y2I A;  2ZQ8 A;  2OLV A;  3ITB A;  5F83 A;  1MXO A;  4OPQ A;  5DVA A;  1CK3 A;  3FKV A;  4GDB A;  3BFG A;  3PBN A;  4E3O A;  2EX2 A;  2OV5 A;  5M1A A;  1FCN A;  3BLS A;  2CC1 A;  1KGG A;  4PM9 A;  1KE4 A;  5I94 A;  3BLM A;  2HP9 A;  1SDE A;  5KSC A;  2ZM0 A;  5GLB A;  3GTC A;  4KQQ A;  3GQZ A;  4E3K A;  4RX3 A;  3QNB A;  4P0M A;  4E3J A;  1YT4 A;  1JTG A;  2WZX A;  4UA6 A;  1KGF A;  2WGI A;  1TDL A;  2Y2H A;  1ZG4 A;  3RXX A;  4N1H A;  3G30 A;  1LL9 A;  3Q7V B;  4U3T A;  4FH2 A;  3UN7 A;  5E2E A;  3G4P A;  4ZJ2 A;  3HL9 A;  2PU2 A;  3G2Y A;  1BUE A;  2J8Y A;  2E8I A;  5AQ9 A;  1SDN A;  1PWD A;  1XGJ A;  1MWR A;  1CEF A;  1PYY A;  2EFU A;  1PWG A;  4OP8 A;  5CGX A;  1MKI A;  1ERO A;  3MBZ A;  4QY5 A;  3UDX A;  3OPR A;  4OQI A;  3UE0 A;  3UE3 A;  3MZF A;  5DTS A;  5KMW A;  4H8R A;  5M18 A;  4OPR A;  3A3E A;  5F1G A;  2Y2K A;  4LV3 A;  5J8X A;  4MLL A;  4E3N A;  5EOE A;  1YLT A;  3C4O A;  2C6W B;  3Q07 A;  2XFS A;  4K0X A;  1H5X A;  4KZB A;  3NC8 A;  2A49 A;  2VGJ A;  2XH9 A;  3C5A A;  4IED A;  1PI5 A;  3Q81 A;  1HZO A;  5FAQ A;  1IKG A;  5EVI B;  5A90 A;  4DF6 A;  3VSL A;  1GHP A;  4BD0 A;  4S2O A;  4EBN A;  3S22 A;  4ZDX A;  2XR0 A;  1LLB A;  3M2J A;  2HDR A;  1I2S A;  3BFC A;  2WAD A;  4UHU A;  2WGW B;  3A3F A;  3MXS A;  3WS2 A;  5EVI A;  4QHC A;  3IWI A;  2V2F F;  5KZH A;  1TVF A;  1XX2 A;  2JCH A;  3NI9 A;  5CHM A;  2EXA A;  5GL9 A;  1K38 A;  4P6B A;  3ZNY A;  3PTE A;  5DTK A;  5JYP A;  3ZGA B;  1E3U D;  3HBR A;  1RP5 A;  5U47 A;  1PIO A;  4OLD A;  1ES5 A;  3VFF A;  1NJ4 A;  5CXW A;  4E3M A;  4S2L A;  4OQG A;  3TOI A;  3ZVW A;  1LI0 A;  4Y0U A;  1SKF A;  2Y2Q A;  5JYO A;  4DXC A;  5IHV A;  3MZE A;  4KZ7 A;  3VP4 A;  3PBS A;  3VOY A;  3NCK A;  2VGK A;  3HLW A;  4GB7 A;  5EOO A;  4DE1 A;  3NY4 A;  3HUO A;  2Y2P A;  2I72 A;  4QD4 A;  3G31 A;  1L0E A;  3OC2 A;  3IF5 A;  2ZJ9 A;  4BEN A;  5BOH A;  3LY3 A;  1K54 C;  2HP5 A;  4X53 A;  2R9X A;  5F1F A;  3LEZ A;  1MWS A;  1S0W A;  3Q82 A;  4HEF A;  4S2N A;  3DW0 A;  4S2J A;  2B5R A;  4DE3 A;  3PAG A;  4N1X A;  2ZQA A;  4BLM A;  4OOL A;  3ZFZ A;  1E25 A;  5HAI A;  3BYD A;  3V5M A;  3VP1 A;  4OOY A;  3IHB A;  1I2W A;  1K6S A;  4GKU A;  4JKT A;  1MWU A;  1W5D A;  4YIN A;  5TR7 A;  2Y59 A;  1YMS A;  4KZ8 A;  3A3I A;  5HFO A;  1NYY A;  4OP5 A;  3AGE A;  1XKZ A;  1BZA A;  1DJB A;  4PPR A;  1QME A;  1PZO A;  5AQ7 A;  1CEG A;  3V50 A;  2WUQ A;  3ZNT A;  1PW8 A;  3CMZ A;  1FQG A;  3IF6 B;  4EQI A;  1IYS A;  2RL3 A;  4R0Q A; 
#chains in the Genus database with same CATH topology
 4R70 A;  2P7J A;  4B93 A;  3W4Q A;  3M2K A;  1VQQ A;  5TBM A;  1GHM A;  4WZ4 A;  3IF6 A;  1FCO A;  3S4X A;  5A93 A;  3W4O A;  4DDY A;  3AGD A;  2WKH A;  5FI6 A;  1K56 D;  5J4E A;  2ZM2 A;  4MN7 A;  2XLN A;  5CTN A;  1N4O A;  1GA0 A;  1NYM A;  1H8Y A;  2NUT C;  4IBX A;  4RVA A;  5C5K A;  4S2K A;  2HJE A;  2K31 A;  3QP6 A;  1M40 A;  3C7V A;  3A3J A;  2GJ3 A;  2XFT A;  3HLD A;  1IEL A;  3FC7 A;  1L0F A;  2JBF A;  4HJ4 A;  3Q7V A;  1L0G A;  4FSF A;  5DF8 A;  2H0T A;  3G34 A;  4JXG A;  4X68 A;  3NDE A;  3D4F A;  4JBF A;  3T4K A;  4WF0 A;  2V0W A;  1XA1 A;  3UB6 A;  3ZHH A;  2H10 A;  2QPN A;  3Q1F A;  4GD6 A;  2YKH A;  1PNE A;  4Q0J A;  2B18 A;  4FCF A;  5L10 A;  3F1P A;  4U0T A;  3HUN A;  4Q0H A;  4MBK A;  1YAX A;  5DKK A;  2ZQD A;  1Y54 A;  3UO9 A;  1CQA A;  3QP5 A;  1FSW A;  3TSG A;  4X6T A;  5AQA A;  3CUE C;  1F2K A;  3OPP A;  3WWX A;  4OLG A;  3HLB A;  3EOI A;  2JE5 A;  2L4R A;  3VOZ A;  5FI7 A;  4X56 A;  2LB9 A;  5HD3 A;  2WK0 A;  3T4Q A;  4E6X A;  4KG5 A;  4QY6 A;  2RCX A;  2D02 A;  2PR5 A;  3TW8 A;  4Y7P A;  5HDD A;  3B33 A;  3N4I A;  1KDW A;  5DFY A;  1OME A;  3CPT B;  4XXR A;  2W3H A;  3DWZ A;  3A3D A;  3E2L A;  1ES2 A;  1ESU A;  3NDG A;  2G2U A;  4NXF A;  3IF6 C;  4R4S A;  3IXH A;  4Y2F A;  4OH0 A;  1K4E A;  5CTM A;  1OT6 A;  4CPK A;  4NKP A;  4C75 A;  3UNW A;  4EXO A;  3WS0 A;  1KE3 A;  3SH9 A;  4R1G A;  1TDG A;  1P0Z A;  5EVI D;  2Y2G A;  2M7U A;  1TS0 A;  2KOI A;  4HH2 A;  4LV1 A;  5CGW A;  5HWT A;  3QP2 A;  3EEH A;  3T4O A;  5CHU A;  2J7V A;  4DN0 A;  4PKY G;  1I5Q A;  4X1L A;  4OPZ A;  1E4D A;  4I3J A;  5EVE A;  4MN6 A;  2ZLY A;  3ULF A;  5HDC A;  4ZTK A;  2V20 A;  2XD1 A;  3G32 A;  2ZC4 B;  2ZQC A;  1JNU A;  1W8Q A;  1Q2Q A;  3V3S A;  3IXD A;  5FQJ A;  4R3J A;  1C3B A;  3QP4 A;  2IA2 A;  4K91 A;  3ZG8 B;  2GZA A;  5EPH A;  2KX6 A;  3VFH A;  2IWB A;  3IXB A;  4JXS A;  1ES3 A;  2WAF A;  3R7W B;  2OWH A;  4ZBE A;  2VGL M;  4LCL A;  4M3K A;  3KYZ A;  2AVX A;  1SKO A;  2WAE A;  2A2L A;  3DTE A;  1BT5 A;  3LR4 A;  4DE0 A;  2WGV A;  3FG8 A;  1ERM A;  1XJ2 A;  1MWT A;  3PHY A;  2JC7 A;  3WRZ A;  4LRY C;  1K54 A;  5A8B A;  2Y4A A;  3I7J A;  1BYW A;  2VK3 A;  1N9O A;  5FA7 A;  3GRJ A;  3PBQ A;  4GNU A;  3C2W A;  2WKR A;  4GHI B;  4OOM A;  1LI9 A;  2VLG A;  2ZD8 A;  2HJ9 C;  4FOF A;  3RXW A;  2O0Y A;  3IX3 A;  2PYR A;  3PYP A;  3IXG A;  4IUK A;  2O9C A;  3OZH A;  3OBF A;  4S2I A;  2Y2N A;  4JPM A;  3VMA A;  4DJ3 A;  2Q9M A;  3MKE A;  2ZM8 A;  2ZQ8 A;  2OLV A;  3BFG A;  5L8M A;  2PAV P;  3PBN A;  4YOF A;  1Y4O A;  5F5Y A;  5M1A A;  2OV5 A;  2V1B A;  3BLS A;  1K0K A;  5I94 A;  5FEG A;  2ZM0 A;  3GQZ A;  4UA6 A;  2R78 A;  2W0N A;  2WGI A;  3G30 A;  3Q7V B;  3G4P A;  1AWI A;  1J3W A;  1OJ5 A;  2PDR A;  2J8Y A;  5AQ9 A;  2ZMV A;  3C38 A;  4Z1W A;  1PWG A;  3BJN A;  1MKI A;  2WKQ A;  4QY5 A;  3OPR A;  4HOI A;  3A3E A;  3H9W A;  4MMN A;  4LV3 A;  4HHD A;  4JGR A;  2Y8H A;  3A0R A;  3LIC A;  5L09 A;  3VSL A;  1S66 L;  5HWW A;  1VHM A;  1GHP A;  2XR0 A;  3M2J A;  4WL9 A;  1I2S A;  1VB6 A;  3BFC A;  2WAD A;  3B47 A;  3IWI A;  5HPF A;  1VET A;  3PTE A;  3IX4 A;  3LR3 A;  1E3U D;  1GSV A;  1PIO A;  1NJ4 A;  1S67 L;  2JHE A;  3TOI A;  4Y0U A;  3EWK A;  5JYO A;  3MZE A;  1OTD A;  2VGK A;  3HLW A;  1G5U A;  2I72 A;  2YKF A;  3VOL A;  1L0E A;  3OC2 A;  1K54 C;  4OOL A;  3ZFZ A;  4KQD A;  3V5M A;  1WA9 A;  4LPZ A;  4JKT A;  1MWU A;  1P97 A;  2KDK A;  4OP5 A;  3H82 A;  1DJB A;  4PPR A;  3ZQ5 A;  1PZO A;  3EGX C;  1CEG A;  1FQG A;  2W3F A;  4R0Q A;  2JKT M;  4GW9 A;  3JPU A;  5FQM A;  3HLE A;  2JKR M;  5FQK A;  1YLW A;  4U0X A;  2WYX A;  3RFB A;  4HBU A;  3S7O A;  2X02 A;  2X71 A;  3F1O A;  3QP1 A;  5M19 A;  4EEP A;  2BLS A;  4OVD A;  3E0Y A;  4C3Q A;  3LI9 A;  2Y79 A;  2VEA A;  2DCF A;  2ZC6 B;  4QWO A;  2XQZ A;  3C8C A;  4DJ2 A;  1FR1 A;  4WMC A;  3C7U A;  3NIA A;  3GR2 A;  5HD5 A;  4QB8 A;  1TEM A;  5HWV A;  4K08 A;  1YPR A;  4B4Z A;  2FFY A;  4PM7 A;  5CGS A;  5AVF A;  1JWZ A;  1EWZ A;  1F9I A;  2P9V B;  3A0S A;  4DKI A;  2QHK A;  1FCM A;  1O07 A;  1Z6F A;  3KSG A;  1K57 C;  4ZAM A;  4PMA A;  4LEN A;  2ZL1 A;  4JLF A;  3S7N A;  1XFN A;  3DWK A;  3NJA A;  2V1A A;  4IUH A;  3SS5 A;  4BBV A;  3PBO A;  3MQQ A;  4F94 A;  5GLD A;  1KGE A;  3GVB A;  5DTT A;  4WYY A;  4UA7 A;  4BL3 A;  4EET B;  1ES4 A;  2GX5 A;  1ONH A;  1W79 A;  1XJ4 A;  5FSR A;  4CLC C;  5CEC A;  1FOF A;  2VV6 A;  4QU3 A;  2DRW A;  2FZ0 A;  3V67 A;  2O99 A;  1S1Z A;  2J3T D;  4L0L A;  4FD8 A;  2J80 A;  1K55 C;  2Q0O A;  2ZOI A;  3T4T A;  4MBF A;  1W8Y A;  1ERQ A;  1XXM A;  1JWV A;  1WYC A;  3TE8 A;  3IS2 B;  5K5B A;  4KZ9 A;  5EEC A;  2Y2O A;  4GS9 A;  3KO6 A;  1J9M A;  3P09 A;  1K6R A;  5GLA A;  4HIA A;  2W3E A;  5HDS A;  3BM6 A;  2B95 A;  3NOP C;  4GCZ A;  3ZYT A;  1N9N A;  4JF6 A;  2MJ6 A;  4L9F A;  1MY8 A;  1MPL A;  4GDN A;  4DDS A;  3CIT A;  2PR6 A;  4CLC E;  2HZ5 A;  4JF5 A;  4JXV A;  4WLA A;  3SS3 A;  1IFQ A;  3O88 A;  3M6H A;  2J9O A;  3BEC A;  5DF7 A;  2G2W A;  2JKF A;  2W3D A;  4DRT A;  5E2H A;  1IEM A;  1OTI A;  1PW1 A;  3O3V A;  5E2G A;  1XGI A;  4EES A;  3W8K A;  3HCY A;  5DJT A;  1NRJ A;  1XPB A;  4B88 A;  3O87 A;  2WZZ A;  1DP6 A;  3LEQ A;  2GDN A;  5GLC A;  3N8L A;  3OCL A;  4G3W A;  1LL5 A;  1JTD A;  1MBL A;  3U2A A;  5CED A;  3UB9 A;  3FYZ A;  4NEE D;  3BFF A;  1OTB A;  4ARZ A;  2ZQ7 A;  4BD1 A;  4OQ0 A;  1K56 A;  2XD5 A;  3E2K A;  1QMF A;  1DRM A;  4ME4 A;  3F1N A;  1KE0 A;  4YWZ A;  2EWW A;  2Y2L A;  4EWF A;  3CLO A;  3BRM A;  1NLY A;  3UMD A;  2VV8 A;  2OAP 1;  4DXB A;  4Q0I A;  3T1X A;  4CQH A;  4EQ1 A;  2ZMA A;  3WS1 A;  4JF4 A;  3BQ8 A;  5J3W A;  1HVB A;  4PM6 A;  4B9O A;  3R4K A;  4HP4 A;  1ESI A;  4IBR A;  5CRF A;  1GCE A;  1LT0 A;  5DKL A;  1XP4 A;  4ZJ1 A;  1U60 A;  4JGO A;  1TD5 A;  2WKE A;  4OPY A;  4YNR A;  2W27 A;  2J9P A;  3JVV A;  4Y17 A;  1NXY A;  3UDI A;  1JVJ A;  4IVK A;  5G18 A;  4D60 A;  1KOU A;  1A0K A;  5KIZ A;  1HLU P;  1NWZ A;  1VM1 A;  3MXR A;  4N9L A;  3LIF A;  1BLS A;  4GOG A;  3H82 B;  4O0P A;  1BLC A;  1D7E A;  3HVF A;  3VP3 A;  2XK1 A;  3BFD A;  5LBR A;  1W63 Q;  1IKI A;  5EVL A;  3OCN A;  4Y0T A;  1FIL A;  3P01 A;  3G35 A;  2UWX A;  4EEU A;  5CER A;  3H7W A;  3E98 A;  2QZ6 A;  5EM0 A;  3ITB A;  5F83 A;  1DP8 A;  3MXQ A;  4X25 A;  1OPX A;  4E04 A;  3E4Q A;  2EX2 A;  3KX0 X;  1V9Y A;  2J3T C;  3O5Y A;  1OTA A;  2CC1 A;  1KGG A;  1KE4 A;  2HP9 A;  3GTC A;  4MN5 A;  4I3I A;  4P0M A;  4DMZ A;  1YT4 A;  1JTG A;  5DJU A;  1ZG4 A;  5HL6 A;  3BY9 A;  5G4Y A;  4F3L B;  3T4L A;  5F68 A;  3HL9 A;  1N9L A;  3G2Y A;  2JKT I;  1PWD A;  1S4S A;  3TJZ C;  1ERO A;  2LB5 A;  3UDX A;  3UE0 A;  4OPR A;  4ETX A;  5F1G A;  2ZL1 B;  5J8X A;  4E3N A;  2KLI A;  5EOE A;  1YLT A;  3Q07 A;  1H0M A;  2XFS A;  1H5X A;  4KZB A;  3C5A A;  4IED A;  3Q81 A;  1IKG A;  4DF6 A;  4S2O A;  4ZDX A;  1LLB A;  2VZW A;  4RQ9 A;  3A3F A;  5EVI A;  4QHC A;  5KZH A;  4P6B A;  3ZNY A;  3HBR A;  4AFI A;  3VFF A;  3ZVW A;  1LI0 A;  1SKF A;  3LIA A;  4KZ7 A;  3HJI A;  3PBS A;  3VOY A;  3NCK A;  5EOO A;  3G31 A;  3D72 A;  3IF5 A;  4BEN A;  3LGO A;  3LY3 A;  2HP5 A;  2R9X A;  3LEZ A;  4DE3 A;  4LRX C;  3PAG A;  2HV1 A;  2ZQA A;  4HJ3 A;  4BLM A;  1E25 A;  3VP1 A;  2XRO A;  1I2W A;  2V8F A;  4YIN A;  5TR7 A;  4KZ8 A;  3MR0 A;  1NYY A;  3AGE A;  1XKZ A;  1BZA A;  3V50 A;  3P7N A;  2WUQ A;  5TBM B;  3IF6 B;  1L2S A;  1XFQ A;  4NK3 A;  2DNS A;  1PI4 A;  2VJW A;  4WUJ A;  1CI8 A;  3PAE A;  4E3I A;  1F98 A;  1S1Y A;  3CG5 A;  2HP6 A;  3TG9 A;  2M7V A;  5CX7 A;  3O86 A;  4KZA A;  3KSH A;  1O7E A;  3U4L P;  4UA9 A;  2O9B A;  4JGP A;  2INW A;  5FQ9 A;  5HSQ A;  5FQI A;  3T1R A;  3VV4 A;  4IHQ A;  3T1Q B;  1BLH A;  1GA9 A;  1LSX A;  3KYE A;  3CAX A;  1G6A A;  4Q8I A;  5KSH A;  1YQS A;  4LRZ E;  2V0U A;  1ZTU A;  1CI9 A;  4Z9Q A;  3IH9 A;  2ZC5 B;  3AGF A;  3QHY A;  1YKD A;  5AJG A;  5FEF A;  3C4P A;  3Q7Z A;  3HUM A;  3L9K A;  5FDS A;  3N8S A;  2M1C A;  1K57 A;  4ARZ B;  1KVL A;  3UPN A;  3UME A;  4O01 A;  4QPR A;  1GHI A;  4G3K A;  3DAV A;  3F1N B;  3F1P B;  4JGQ A;  4RX2 A;  1FIK A;  2UV0 E;  3BQA A;  4S2P A;  5EVI C;  2X01 A;  3NOU C;  4B4X A;  1NY0 A;  5GHY A;  5HX9 A;  1M6K A;  4CLC A;  4CJN A;  4RA7 A;  5EFW A;  3IX8 A;  2OAQ 1;  1XJ6 A;  2ACG A;  2XGN A;  4FUW A;  3K3C A;  4BL2 A;  3D3O A;  3UY6 A;  5FAS A;  1G68 A;  2GNX A;  4C6Y A;  2OLU A;  3NUL A;  1KVM A;  2HDS A;  4DE2 A;  1AXB A;  1K55 A;  3IBR A;  1BSG A;  1HD8 A;  4Y15 A;  3WRT A;  1WYB A;  3LYX A;  5FQQ A;  3TRC A;  4I5S A;  4ETZ A;  1T18 A;  5CHJ A;  3KSI A;  4R3A A;  3UDF A;  2QWS A;  5L2F A;  3IWQ A;  5GHX A;  5IT5 A;  4GZB A;  4EBL A;  3PR6 A;  1W7F A;  2H0Y A;  3LCE A;  5IS1 A;  3E4O A;  4ESP A;  3LUQ A;  1TF1 A;  2ZC3 B;  5EUA A;  5FAO A;  3GSG A;  1IYQ A;  5E2F A;  1E3U A;  2XDM A;  1ZKJ A;  3HLF A;  1F5M A;  1ZC2 A;  1UWP X;  4WBG A;  1YLP A;  3QNC A;  4P87 A;  2EX8 A;  4KEN B;  5HAP A;  4IVI A;  3NHQ A;  3RJU A;  4QJG A;  1SHV A;  1BTL A;  4HY8 A;  3VSK A;  4LV2 A;  4N9K A;  3IHA A;  3PXP A;  4K0W A;  3GV9 A;  4R4R A;  5F6A A;  1RCJ A;  1ONG A;  3OPH A;  1YSQ A;  2IWC A;  1YMX A;  2EWV A;  3N8R A;  3BEB A;  1L3L A;  1D06 A;  5G4Z A;  2V8C A;  1FSY A;  2QYB A;  1YSP A;  1DY6 A;  3S1Y A;  1BLP A;  1V9Z A;  3JVU A;  2O9A A;  1ODV A;  4YFM A;  1LSV A;  4NG2 A;  4BQM A;  2Z2L B;  3HRE A;  3MSH A;  1W63 M;  3MQ0 A;  4WN5 A;  4WEJ A;  1PFL A;  1D1J A;  2VKS A;  1PWC A;  1IYP A;  4HNB A;  4IJG A;  5HAR A;  3FZC A;  4D2O A;  2E8J A;  2XSS A;  2L1M A;  2A3U A;  1UGU A;  2V1Z A;  3W4P A;  3ZG5 A;  4EUZ A;  3LY4 A;  3DTM A;  3UPO A;  4KG2 A;  3DTK A;  2WKI A;  1SKO B;  4Y0O A;  3KYQ A;  3UB5 P;  2PHY A;  3LO7 A;  4R3B A;  3M6B A;  2VX8 A;  4PM8 A;  1K25 A;  4H6J A;  2OSU A;  4RYE A;  5FAP A;  3CJM A;  1VEU A;  4GN2 A;  5DF9 A;  3FV7 A;  4KG6 A;  3KSF A;  3ISG A;  5HL1 A;  1GSW A;  4R23 A;  1NZU A;  3UE6 A;  3V39 A;  2W1R A;  1T1C A;  4XUX A;  5F82 A;  2PBY A;  2Z2M B;  5CEB A;  2Q9N A;  1L0D A;  2Z6D A;  2W3G A;  1BUL A;  2Y91 A;  4GHI A;  1S6R A;  3NBL A;  5A92 A;  4MDZ A;  3SS4 A;  2B02 A;  5HW3 A;  4HES A;  5HAQ A;  2EXB A;  3EQU A;  3C30 A;  3MQO A;  2Y2I A;  1LL8 A;  5DVA A;  1CK3 A;  3FKV A;  3L7H A;  4UQI S;  4NXG A;  1FCN A;  4PM9 A;  3BLM A;  5GLB A;  4E3K A;  3QNB A;  4EW7 A;  4II7 A;  2WZX A;  4Y5F A;  1KGF A;  5FL3 A;  1PRQ A;  2Y2H A;  3RXX A;  1IOU A;  4I38 A;  4N1H A;  1OT9 A;  4PHT A;  4BWI A;  4ZJ2 A;  1MZU A;  1MWR A;  1CEF A;  1PYY A;  3UE3 A;  2I9V A;  3NOT C;  5KMW A;  4H8R A;  5M18 A;  1XJ3 A;  2Y2K A;  1S4R A;  1STZ A;  4K0X A;  2A49 A;  4LLO B;  2VGJ A;  2XH9 A;  2JKG A;  5IU1 A;  1PI5 A;  1HZO A;  2P04 A;  1MC0 A;  4BD0 A;  1T1B A;  3T50 A;  1VET B;  3LIE A;  3RH8 B;  3UB7 A;  2XRN A;  2V2F F;  5GL9 A;  1K38 A;  4CLC B;  5DTK A;  3NEC A;  3E4P A;  1RP5 A;  4OLD A;  5CXW A;  1OJG A;  1UWN X;  3VE4 A;  3GDI A;  2Y2Q A;  3IBJ A;  4DXC A;  5IHV A;  3CWF A;  4GB7 A;  3HUO A;  2DMW A;  1GSX A;  4LGW A;  5BOH A;  2ZJ9 A;  4XT2 A;  5F1F A;  4HEF A;  4S2N A;  1MWS A;  1S0W A;  2VV7 A;  3Q82 A;  3MJQ A;  3BYD A;  4OOY A;  2PT7 A;  2Y59 A;  2PRF A;  4GJ4 A;  4Y13 A;  1QME A;  3BW6 A;  1PW8 A;  3CMZ A;  2L0W A;  1MKM A;  3T12 B;  3F1O B;  3WS4 A;  4OON A;  3PBR A;  4M4X A;  4WM9 A;  3WS5 A;  4O8G A;  1Z09 A;  5AQB A;  2JN7 A;  4EU0 A;  2QJ7 A;  4HBT A;  3SW1 A;  1DP9 A;  3ICY A;  3GEC A;  5GHZ A;  2J3W A;  4ZJ3 A;  2W1T A;  1WE4 A;  1ALQ A;  3A0V A;  2NUP C;  4OQH A;  3HLC A;  2ZBB A;  3UB8 A;  4BJP A;  4HI4 A;  3ZCZ A;  5EV0 A;  4KZ6 A;  4O7D A;  1NZO A;  1PZP A;  3FPV A;  3JYI A;  4MNR A;  4MBH A;  2JKR I;  2XA7 S;  2Y55 A;  3MKF A;  5FDH A;  2PYP A;  2P08 A;  2IWD A;  4N92 A;  3ZG7 B;  2PU4 A;  2A24 A;  3UE1 A;  2R9W A;  3B3X A;  1RGZ A;  5EE8 A;  3IH8 A;  3DBA A;  2P9V A;  2QKP A;  1ZG6 A;  3QP8 A;  4WEK A;  1FR6 A;  3ZDJ A;  1G28 A;  2XEP A;  3T1S A;  2ZQ9 A;  3IT9 A;  1K4F A;  2QMI A;  3OPL A;  4ZRR A;  3S7P A;  2Y2J A;  2WGW A;  3VP2 A;  2K2N A;  4PAU A;  5F69 A;  2ZMF A;  2HDU A;  4DE1 A;  3GMW A;  4S2M A;  4KQO A;  4L9E A;  1G6O A;  2C5W B;  4FTX A;  1T1A A;  4UEY A;  4H6J B;  4P6Z S;  3EGD C;  4MCW A;  4EUV A;  1P9R A;  1YLJ A;  3P98 A;  4MEZ A;  1ZHH B;  3LR5 A;  1VEU B;  4GD8 A;  1EI5 A;  4E6W A;  4L9G A;  3T4J A;  4S2N C;  4X55 A;  2K7S A;  3B42 A;  2FH5 A;  4OKP A;  4EBP A;  4GS9 B;  4HP9 A;  4LCM A;  1LHY A;  1Y28 A;  4LFU A;  5I5L A;  3BY8 A;  4UQI M;  4P85 A;  3K3D A;  2HDQ A;  1KDS A;  4ID4 A;  3IS2 A;  1DJC A;  4JXW A;  3IQA A;  3SOI A;  4G3V A;  2FFF B;  3CI6 A;  2EX6 A;  3BFE A;  1LSW A;  3MS6 A;  2H28 A;  4WZ5 A;  4BBU A;  3K2N A;  3SZT A;  2EX9 A;  4BMW A;  4GLQ A;  4UAA A;  4NXE A;  4WEL A;  4KQR A;  3FWL A;  3V3R A;  3ZVT A;  1NLZ A;  2WKP A;  2HGV A;  2BG1 A;  3LIB A;  3CZD A;  3G2Z A;  5HPI A;  1P9W A;  3ZG9 B;  3RTY A;  4FH4 A;  1SZV A;  3MFD A;  3SH7 A;  2HPB A;  4CLC D;  1IYO A;  4LV0 A;  1N9B A;  4PKY A;  3N7W A;  4KZ4 A;  3DTI A;  2ZC7 A;  3LFV A;  1OTE A;  3LID A;  2QJ5 A;  3T4S A;  5HZH A;  3VE3 A;  1Q2P A;  4KZ5 A;  4E3L A;  1H3Q A;  3MMH A;  3ZG0 A;  1CJF A;  1XA7 A;  3VP0 A;  1RGY A;  2P74 A;  2EFX A;  3N6I A;  5E43 A;  2XF3 A;  3PBT A;  4A5R A;  3FKW A;  3SH8 A;  4XT2 B;  4KZ3 A;  1SCW A;  5TFQ A;  2BTF P;  1NRF A;  3EQV A;  1YM1 A;  4I3A A;  1HTZ A;  3EEA A;  1X0O A;  4EV4 A;  1YLY A;  1H8Z A;  3OOV A;  5TGF A;  4BBT A;  4WMC D;  5A91 A;  4HQA A;  4XUZ A;  4R38 A;  5FI2 A;  4NET A;  2Y2M A;  3HLG A;  3BWL A;  3UPP A;  3IWO A;  3CPT A;  3H7W B;  1JWP A;  3MZD A;  3W2Z A;  3MFX A;  2OWJ A;  1DJA A;  2H5S A;  2HF6 A;  4X69 A;  1YLZ A;  5D3O A;  4PM5 A;  4WZ5 C;  2OOL A;  2XA7 M;  3ITA A;  4I39 A;  5FAT A;  2W1T B;  4EER A;  1MXO A;  4OPQ A;  4GDB A;  4E3O A;  3CHW P;  4KUO A;  3HJK A;  1SDE A;  5KSC A;  4KQQ A;  4RX3 A;  4E3J A;  2PBD P;  1TDL A;  3OLO A;  1EW0 A;  2PD7 A;  1LL9 A;  1TS8 A;  4U3T A;  4FH2 A;  5J7E A;  3UN7 A;  3FPW A;  5E2E A;  3LI8 A;  5EM1 A;  2PU2 A;  2D01 A;  1BUE A;  4Y3I A;  2E8I A;  4F3L A;  1SDN A;  4R6L A;  1XGJ A;  1TS7 A;  2EFU A;  4OP8 A;  2A24 B;  5CGX A;  2Z6C A;  3MBZ A;  4OQI A;  3MZF A;  5DTS A;  5L07 A;  3D9Y A;  4MLL A;  1H8M A;  5DFX A;  2VA0 A;  4P6Z M;  2CMN A;  3C4O A;  2C6W B;  4NXB A;  3NC8 A;  5FAQ A;  5EVI B;  5A90 A;  4EBN A;  3S22 A;  4HH3 A;  2HDR A;  5TJJ A;  4UHU A;  2WGW B;  3MXS A;  3WS2 A;  1TVF A;  1XX2 A;  2JCH A;  3NI9 A;  5CHM A;  1T19 A;  2EXA A;  5JYP A;  2ZOH A;  3ZGA B;  1ACF A;  2V9A A;  5U47 A;  4HJ6 A;  1ES5 A;  3R7W A;  3CUE A;  1CF0 A;  4E3M A;  4S2L A;  4OQG A;  2G7U A;  3VP4 A;  3NY4 A;  2Y2P A;  3LR0 A;  4QD4 A;  1TS6 A;  4X53 A;  3MF0 A;  3DW0 A;  2BAS A;  4S2J A;  2B5R A;  4N1X A;  3G6O A;  5HAI A;  4X1M A;  3IHB A;  1K6S A;  4GKU A;  1W5D A;  5AVE A;  1YMS A;  3A3I A;  5HFO A;  3S7Q A;  2VGL S;  2PD8 A;  4KUK A;  5AQ7 A;  2EA9 A;  3ZNT A;  5MC7 A;  4EQI A;  1IYS A;  2RL3 A; 
#chains in the Genus database with same CATH homology
 1L2S A;  5FQM A;  4NK3 A;  3HLE A;  5FQK A;  2DNS A;  4OON A;  3PBR A;  3WS4 A;  3W4Q A;  1YLW A;  3M2K A;  2WYX A;  4U0X A;  1PI4 A;  4WM9 A;  4HBU A;  1CI8 A;  1VQQ A;  3WS5 A;  1GHM A;  4WZ4 A;  3PAE A;  4E3I A;  3IF6 A;  1FCO A;  2X02 A;  5AQB A;  2X71 A;  3S4X A;  3W4O A;  5A93 A;  4DDY A;  3AGD A;  5M19 A;  2WKH A;  2BLS A;  5FI6 A;  3CG5 A;  1K56 D;  4HBT A;  2HP6 A;  3TG9 A;  2ZM2 A;  5GHZ A;  4OVD A;  3O86 A;  4C3Q A;  4KZA A;  4ZJ3 A;  1O7E A;  2XLN A;  5CTN A;  1WE4 A;  2DCF A;  4UA9 A;  1ALQ A;  1N4O A;  1GA0 A;  2ZC6 B;  1NYM A;  1H8Y A;  4IBX A;  5FQ9 A;  4OQH A;  5FQI A;  3HLC A;  4RVA A;  4S2K A;  4BJP A;  3ZCZ A;  1BLH A;  1GA9 A;  2XQZ A;  1M40 A;  1FR1 A;  1G6A A;  3C7V A;  4Q8I A;  4WMC A;  3A3J A;  5KSH A;  1YQS A;  3C7U A;  3NIA A;  2XFT A;  3HLD A;  3GR2 A;  4KZ6 A;  4QB8 A;  1IEL A;  4O7D A;  1NZO A;  1L0F A;  1PZP A;  1TEM A;  2JBF A;  1CI9 A;  3JYI A;  4MNR A;  4Z9Q A;  3Q7V A;  3IH9 A;  4MBH A;  4B4Z A;  2ZC5 B;  2Y55 A;  3MKF A;  3AGF A;  2FFY A;  3QHY A;  4FSF A;  4PM7 A;  5CGS A;  5DF8 A;  3C4P A;  5FDH A;  1L0G A;  1JWZ A;  2H0T A;  3G34 A;  2IWD A;  1EWZ A;  4N92 A;  3Q7Z A;  3HUM A;  4JXG A;  3ZG7 B;  2PU4 A;  2P9V B;  4X68 A;  3NDE A;  3D4F A;  4JBF A;  3N8S A;  1K57 A;  4DKI A;  3UE1 A;  2R9W A;  1KVL A;  1FCM A;  3B3X A;  1O07 A;  3UPN A;  1XA1 A;  1RGZ A;  3ZHH A;  1Z6F A;  1GHI A;  5EE8 A;  2H10 A;  1K57 C;  4ZAM A;  2QPN A;  4PMA A;  3Q1F A;  4LEN A;  3IH8 A;  2P9V A;  4GD6 A;  1ZG6 A;  4JLF A;  4FCF A;  3DWK A;  4WEK A;  4RX2 A;  3SS5 A;  1FR6 A;  3ZDJ A;  3PBO A;  2XEP A;  4F94 A;  4U0T A;  2ZQ9 A;  3HUN A;  4S2P A;  5GLD A;  3IT9 A;  4MBK A;  1KGE A;  3GVB A;  1K4F A;  5EVI C;  2X01 A;  2QMI A;  3OPL A;  4B4X A;  5DTT A;  2Y2J A;  1NY0 A;  2WGW A;  4WYY A;  5GHY A;  2ZQD A;  4UA7 A;  3VP2 A;  1Y54 A;  3UO9 A;  4BL3 A;  1ES4 A;  5HX9 A;  2HDU A;  1M6K A;  1FSW A;  1ONH A;  3GMW A;  4KQO A;  4S2M A;  4RA7 A;  3TSG A;  4CJN A;  1W79 A;  2C5W B;  4X6T A;  5AQA A;  5FSR A;  2XGN A;  3OPP A;  3WWX A;  1YLJ A;  4BL2 A;  4OLG A;  5CEC A;  3P98 A;  4MEZ A;  3UY6 A;  5FAS A;  3HLB A;  1G68 A;  4C6Y A;  1FOF A;  2JE5 A;  3VOZ A;  5FI7 A;  2OLU A;  4GD8 A;  4QU3 A;  1KVM A;  2HDS A;  4X56 A;  2DRW A;  4DE2 A;  1AXB A;  1K55 A;  1EI5 A;  2WK0 A;  4E6W A;  1BSG A;  1HD8 A;  3WRT A;  4E6X A;  1WYB A;  5FQQ A;  4L0L A;  4S2N C;  4KG5 A;  4FD8 A;  4X55 A;  4EBP A;  4OKP A;  1K55 C;  4QY6 A;  2RCX A;  4LCM A;  1LHY A;  4MBF A;  1W8Y A;  5CHJ A;  1ERQ A;  3UDF A;  1XXM A;  1JWV A;  1WYC A;  4Y7P A;  4KZ9 A;  5EEC A;  5L2F A;  3N4I A;  2Y2O A;  1KDW A;  3IWQ A;  1J9M A;  4P85 A;  5GHX A;  2HDQ A;  1KDS A;  3P09 A;  1OME A;  4GZB A;  4ID4 A;  4EBL A;  1W7F A;  2H0Y A;  1K6R A;  3LCE A;  5GLA A;  1DJC A;  2ZC3 B;  3BM6 A;  5EUA A;  5FAO A;  3GSG A;  1IYQ A;  4XXR A;  5E2F A;  1E3U A;  2XDM A;  1ZKJ A;  3HLF A;  3IQA A;  4JXW A;  3SOI A;  1ZC2 A;  2FFF B;  3DWZ A;  3A3D A;  3E2L A;  1ES2 A;  1ESU A;  3NDG A;  4JF6 A;  2EX6 A;  3BFE A;  2G2U A;  1MY8 A;  1MPL A;  3IF6 C;  4GDN A;  4WBG A;  4DDS A;  1YLP A;  4WZ5 A;  3QNC A;  4P87 A;  4R4S A;  3IXH A;  2EX8 A;  2EX9 A;  4KEN B;  5HAP A;  4OH0 A;  1K4E A;  4JF5 A;  4JXV A;  3SS3 A;  5CTM A;  4CPK A;  3O88 A;  4IVI A;  3M6H A;  4C75 A;  4UAA A;  2J9O A;  3BEC A;  3RJU A;  4QJG A;  4WEL A;  1SHV A;  1BTL A;  4KQR A;  2G2W A;  5DF7 A;  3UNW A;  3VSK A;  3WS0 A;  3FWL A;  4LV2 A;  3V3R A;  4DRT A;  4N9K A;  3IHA A;  4K0W A;  5E2H A;  3GV9 A;  4R4R A;  3ZVT A;  1KE3 A;  3SH9 A;  1IEM A;  1PW1 A;  4R1G A;  1TDG A;  3O3V A;  1RCJ A;  5E2G A;  1XGI A;  5EVI D;  2Y2G A;  3W8K A;  1ONG A;  3OPH A;  2BG1 A;  4LV1 A;  2IWC A;  1YMX A;  5CGW A;  3N8R A;  3CZD A;  3G2Z A;  3BEB A;  1XPB A;  4B88 A;  3O87 A;  2WZZ A;  1FSY A;  5CHU A;  1DY6 A;  2J7V A;  3S1Y A;  1BLP A;  2GDN A;  5GLC A;  3N8L A;  3ZG9 B;  3OCL A;  4FH4 A;  1I5Q A;  3MFD A;  3SH7 A;  4YFM A;  2HPB A;  1IYO A;  4BQM A;  2Z2L B;  4LV0 A;  4OPZ A;  1E4D A;  3HRE A;  1N9B A;  1LL5 A;  1JTD A;  4WEJ A;  1MBL A;  5CED A;  3FYZ A;  2ZLY A;  1PWC A;  3BFF A;  1IYP A;  2ZQ7 A;  4BD1 A;  3N7W A;  5HAR A;  4KZ4 A;  4OQ0 A;  1K56 A;  2XD5 A;  2V20 A;  3E2K A;  1QMF A;  4ZTK A;  2XD1 A;  2ZC7 A;  3FZC A;  3G32 A;  4D2O A;  1KE0 A;  2Y2L A;  2ZC4 B;  2ZQC A;  4EWF A;  1W8Q A;  1Q2Q A;  3BRM A;  2A3U A;  3V3S A;  3IXD A;  5FQJ A;  2V1Z A;  4R3J A;  1C3B A;  4DXB A;  3W4P A;  1Q2P A;  4K91 A;  3ZG5 A;  3ZG8 B;  4KZ5 A;  4EUZ A;  3LY4 A;  4E3L A;  3DTM A;  5EPH A;  3UPO A;  4KG2 A;  2ZMA A;  3VFH A;  2IWB A;  2WKI A;  3WS1 A;  4JF4 A;  3ZG0 A;  4Y0O A;  3IXB A;  1HVB A;  4PM6 A;  4JXS A;  1ES3 A;  2WAF A;  4ZBE A;  1ESI A;  1XA7 A;  3LO7 A;  4LCL A;  4M3K A;  4R3B A;  4IBR A;  3VP0 A;  3M6B A;  5CRF A;  1GCE A;  1XP4 A;  4ZJ1 A;  1RGY A;  4PM8 A;  1K25 A;  2WAE A;  2P74 A;  1U60 A;  2EFX A;  3N6I A;  1BT5 A;  5E43 A;  2OSU A;  2WKE A;  4DE0 A;  2WGV A;  4OPY A;  2J9P A;  2XF3 A;  3PBT A;  4RYE A;  1NXY A;  5FAP A;  4A5R A;  3FKW A;  3SH8 A;  3UDI A;  1JVJ A;  1ERM A;  4IVK A;  4KZ3 A;  1SCW A;  1MWT A;  3CJM A;  5G18 A;  2JC7 A;  4GN2 A;  5TFQ A;  3WRZ A;  1NRF A;  3EQV A;  1YM1 A;  5DF9 A;  1K54 A;  1HTZ A;  2Y4A A;  3I7J A;  3FV7 A;  4EV4 A;  1VM1 A;  1YLY A;  1H8Z A;  3MXR A;  4KG6 A;  4N9L A;  3ISG A;  5FA7 A;  3GRJ A;  5HL1 A;  5TGF A;  1BLS A;  3PBQ A;  4R23 A;  1NZU A;  4GOG A;  4GNU A;  4WMC D;  3V39 A;  5A91 A;  1BLC A;  4XUX A;  4XUZ A;  3HVF A;  3VP3 A;  2XK1 A;  5F82 A;  3BFD A;  5FI2 A;  2PBY A;  2Z2M B;  4NET A;  2Y2M A;  4OOM A;  5CEB A;  3HLG A;  1IKI A;  1LI9 A;  1L0D A;  2Q9N A;  2ZD8 A;  5EVL A;  3OCN A;  3RXW A;  3UPP A;  1BUL A;  3IWO A;  2Y91 A;  1JWP A;  3IXG A;  1S6R A;  3MZD A;  3NBL A;  4Y0T A;  5A92 A;  3SS4 A;  1DJA A;  2H5S A;  3OZH A;  4X69 A;  5HW3 A;  1YLZ A;  5D3O A;  3G35 A;  2Y2N A;  4HES A;  4JPM A;  4S2I A;  2UWX A;  4WZ5 C;  4PM5 A;  5HAQ A;  3VMA A;  2EXB A;  2Q9M A;  5CER A;  3MKE A;  3EQU A;  3ITA A;  2QZ6 A;  2ZM8 A;  5FAT A;  2Y2I A;  2ZQ8 A;  2OLV A;  3ITB A;  5F83 A;  1MXO A;  4OPQ A;  5DVA A;  1CK3 A;  3FKV A;  4GDB A;  3BFG A;  3PBN A;  4E3O A;  2EX2 A;  2OV5 A;  5M1A A;  1FCN A;  3BLS A;  2CC1 A;  1KGG A;  4PM9 A;  1KE4 A;  5I94 A;  3BLM A;  2HP9 A;  1SDE A;  5KSC A;  2ZM0 A;  5GLB A;  3GTC A;  4KQQ A;  3GQZ A;  4E3K A;  4RX3 A;  3QNB A;  4P0M A;  4E3J A;  1YT4 A;  1JTG A;  2WZX A;  4UA6 A;  1KGF A;  2WGI A;  1TDL A;  2Y2H A;  1ZG4 A;  3RXX A;  4N1H A;  3G30 A;  1LL9 A;  3Q7V B;  4U3T A;  4FH2 A;  3UN7 A;  5E2E A;  3G4P A;  4ZJ2 A;  3HL9 A;  2PU2 A;  3G2Y A;  1BUE A;  2J8Y A;  2E8I A;  5AQ9 A;  1SDN A;  1PWD A;  1XGJ A;  1MWR A;  1CEF A;  1PYY A;  2EFU A;  1PWG A;  4OP8 A;  5CGX A;  1MKI A;  1ERO A;  3MBZ A;  4QY5 A;  3UDX A;  3OPR A;  4OQI A;  3UE0 A;  3UE3 A;  3MZF A;  5DTS A;  5KMW A;  4H8R A;  5M18 A;  4OPR A;  3A3E A;  5F1G A;  2Y2K A;  4LV3 A;  5J8X A;  4MLL A;  4E3N A;  5EOE A;  1YLT A;  3C4O A;  2C6W B;  3Q07 A;  2XFS A;  4K0X A;  1H5X A;  4KZB A;  3NC8 A;  2A49 A;  2VGJ A;  2XH9 A;  3C5A A;  4IED A;  1PI5 A;  3Q81 A;  1HZO A;  5FAQ A;  1IKG A;  5EVI B;  5A90 A;  4DF6 A;  3VSL A;  1GHP A;  4BD0 A;  4S2O A;  4EBN A;  3S22 A;  4ZDX A;  2XR0 A;  1LLB A;  3M2J A;  2HDR A;  1I2S A;  3BFC A;  2WAD A;  4UHU A;  2WGW B;  3A3F A;  3MXS A;  3WS2 A;  5EVI A;  4QHC A;  3IWI A;  2V2F F;  5KZH A;  1TVF A;  1XX2 A;  2JCH A;  3NI9 A;  5CHM A;  2EXA A;  5GL9 A;  1K38 A;  4P6B A;  3ZNY A;  3PTE A;  5DTK A;  5JYP A;  3ZGA B;  1E3U D;  3HBR A;  1RP5 A;  5U47 A;  1PIO A;  4OLD A;  1ES5 A;  3VFF A;  1NJ4 A;  5CXW A;  4E3M A;  4S2L A;  4OQG A;  3TOI A;  3ZVW A;  1LI0 A;  4Y0U A;  1SKF A;  2Y2Q A;  5JYO A;  4DXC A;  5IHV A;  3MZE A;  4KZ7 A;  3VP4 A;  3PBS A;  3VOY A;  3NCK A;  2VGK A;  3HLW A;  4GB7 A;  5EOO A;  4DE1 A;  3NY4 A;  3HUO A;  2Y2P A;  2I72 A;  4QD4 A;  3G31 A;  1L0E A;  3OC2 A;  3IF5 A;  2ZJ9 A;  4BEN A;  5BOH A;  3LY3 A;  1K54 C;  2HP5 A;  4X53 A;  2R9X A;  5F1F A;  3LEZ A;  1MWS A;  1S0W A;  3Q82 A;  4HEF A;  4S2N A;  3DW0 A;  4S2J A;  2B5R A;  4DE3 A;  3PAG A;  4N1X A;  2ZQA A;  4BLM A;  4OOL A;  3ZFZ A;  1E25 A;  5HAI A;  3BYD A;  3V5M A;  3VP1 A;  4OOY A;  3IHB A;  1I2W A;  1K6S A;  4GKU A;  4JKT A;  1MWU A;  1W5D A;  4YIN A;  5TR7 A;  2Y59 A;  1YMS A;  4KZ8 A;  3A3I A;  5HFO A;  1NYY A;  4OP5 A;  3AGE A;  1XKZ A;  1BZA A;  1DJB A;  4PPR A;  1QME A;  1PZO A;  5AQ7 A;  1CEG A;  3V50 A;  2WUQ A;  3ZNT A;  1PW8 A;  3CMZ A;  1FQG A;  3IF6 B;  4EQI A;  1IYS A;  2RL3 A;  4R0Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...