1YLJA

Atomic resolution structure of ctx-m-9 beta-lactamase
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
263
structure length
263
Chain Sequence
b'QTSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTAGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords beta-lactamase CTX-M-9a
publication title Atomic Resolution Structures of CTX-M beta-Lactamases: Extended Spectrum Activities from Increased Mobility and Decreased Stability.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 101
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2005-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1yljA00
4WEJA 3CMZA 1EROA 4JF4A 4RYEA 1JWVA 1LHYA 4KQOA 5EECA 5IHVA 4OQIA 3VP1A 4RX3A 3G32A 4S2IA 5KSHA 1IKIA 1M40A 4OLDA 4S2LA 4LV1A 1YLTA 3NIAA 1GA0A 1W8QA 4GD8A 5G18A 3QNBA 4R3JA 5FDHA 3TG9A 1YMSA 3VP3A 5FQIA 3UPPA 3A3IA 1K25A 3LY3A 1J9MA 5CXWA 5KMWA 4YFMA 2ZC3B 1BUEA 4LCLA 4XXRA 1NRFA 4BENA 4ZTKA 2IWCA 4WZ5A 3A3FA 1L0DA 1FR1A 3IHAA 1L2SA 4DDSA 3GSGA 3DTMA 4DDYA 3OPHA 4WZ5C 4QU3A 4ZDXA 2Y55A 1PWDA 3ZFZA 2ZC4B 4WMCD 5FAPA 4OH0A 5CHMA 2WKEA 4QB8A 1N4OA 3O3VA 2VGJA 4X6TA 5EVLA 2WADA 2H10A 2DNSA 4JPMA 5FQMA 2H0TA 2XFTA 3FKWA 3ZG8B 4KZ4A 1K4EA 3HBRA 4H8RA 4S2JA 3E2KA 3BFDA 3ZG0A 3SH7A 2Y2OA 1MBLA 3BYDA 1I2SA 4GKUA 4WYYA 5E2GA 4Z9QA 3A3DA 5EOEA 3ZCZA 3V50A 5KZHA 1NZOA 1RGYA 1W79A 1XX2A 5M1AA 4RX2A 1JTDA 1MWUA 1SCWA 4E3KA 2X71A 4KZBA 4PM9A 4R4SA 4KZ6A 3JYIA 1VQQA 4HEFA 5F83A 2Y2LA 5EVIB 1K6RA 4GD6A 3GR2A 2Y59A 3HVFA 3IF6B 1BLHA 5E2FA 2OLVA 3ZG7B 3FV7A 1K54A 1KDWA 2X02A 3LO7A 2HPBA 1SKFA 1K54C 1SHVA 4JLFA 1VM1A 2WZXA 3UPNA 5FAQA 3NDGA 5EE8A 1XA1A 5AQ7A 1PWGA 4N1XA 5FQKA 3V3RA 4EQIA 4K0XA 4B88A 3M2KA 3VFHA 5J8XA 3O88A 4QJGA 3VP0A 1TDLA 2QMIA 3GMWA 3B3XA 3C7VA 5FASA 3OC2A 4CJNA 2A3UA 2ZQAA 3N4IA 3NY4A 3UN7A 1FCOA 5GLAA 1MWTA 4FSFA 3BFEA 3IWIA 1QMEA 1MXOA 1W8YA 2JE5A 5DF8A 2WAFA 4P87A 2Z2MB 1AXBA 3PAGA 3C5AA 2BG1A 4KG6A 2UWXA 1KGFA 4E3OA 3G35A 2WGIA 1YLWA 3LEZA 1PWCA 4KZAA 3PAEA 4OPRA 3UDFA 1NYMA 5TR7A 4KENB 3BECA 1CEGA 4BD1A 5FI6A 4MEZA 3MXSA 4X56A 1XKZA 2CC1A 4MBFA 2ZQDA 1DJAA 1JTGA 1BSGA 2XQZA 2G2WA 3UY6A 4JKTA 3TOIA 4R1GA 2EX9A 3ZG9B 1PI5A 3OPRA 5DTTA 1HD8A 3A3JA 3IXDA 3D4FA 3FWLA 3IF5A 3NDEA 4ZJ2A 3IHBA 4OP8A 5FQ9A 3ITAA 1K55A 1HVBA 2GDNA 2JBFA 5CGXA 1DJCA 1K55C 1MKIA 3UNWA 3W8KA 1H8YA 1QMFA 1MY8A 1MWSA 4JXVA 4UAAA 5AQAA 3ZVTA 4KG5A 3GQZA 3UDIA 1HZOA 4WEKA 2DRWA 4R4RA 3WWXA 4E3LA 1E4DA 1H8ZA 2EFUA 4NETA 2ZQ8A 1BLPA 1IEMA 3BLMA 3MZFA 4GN2A 1I2WA 1CI8A 4GZBA 4OVDA 5FQJA 4Y0OA 3DWKA 2ZC6B 2ZQ7A 4IBRA 2WKIA 2Z2LB 1XXMA 3VMAA 3ZVWA 1YLPA 4WELA 3IH8A 4ZAMA 4DKIA 5HW3A 2Y91A 3CZDA 2XR0A 2H5SA 3NC8A 2Y2KA 2J9PA 4IVIA 1PW1A 5CHJA 5GLDA 4GDNA 3WS4A 1YMXA 4NK3A 5HFOA 2C5WB 4B4ZA 4BL2A 3M2JA 5EOOA 2HDRA 4Y0TA 4L0LA 1WYBA 1IYQA 1K6SA 4P6BA 4EBNA 2ZQ9A 1FQGA 1NYYA 2VGKA 4PMAA 2E8IA 3E2LA 4EUZA 3V39A 4E6WA 5GHYA 3QHYA 1L0GA 2JC7A 1PZPA 2ZM0A 3AGEA 1BULA 3SS5A 4A5RA 1ES4A 2HP9A 5L2FA 1SDNA 4PM8A 1ZG6A 2R9XA 1N9BA 1KE0A 3HLEA 5A91A 1XP4A 5DTSA 3MKEA 5AQBA 4KZ8A 3W4OA 3WS0A 3LCEA 4U3TA 5HX9A 3ZHHA 2ZC7A 4EV4A 4QHCA 2WKHA 3W4PA 1BT5A 1CI9A 4FH2A 3BRMA 2G2UA 3UE1A 1E3UA 5CTNA 5CECA 1IKGA 1Q2QA 4R3BA 4DXBA 3UDXA 3I7JA 3A3EA 3PBRA 1Q2PA 1PI4A 4X68A 3GRJA 1WYCA 3NBLA 2A49A 4DF6A 4DRTA 1MPLA 3HL9A 2Y2HA 4N1HA 1KVLA 4OQHA 4S2NA 5A92A 3NCKA 2H0YA 2EX8A 5D3OA 4GOGA 1EWZA 2C6WB 4JF6A 1GCEA 4KG2A 4S2NC 3IXHA 3VP2A 1RCJA 2RL3A 2WZZA 4RVAA 4S2PA 3UO9A 3W4QA 4Q8IA 1PW8A 4O7DA 5FI7A 2ZQCA 3S1YA 4DE3A 2V1ZA 5EUAA 4U0XA 5GLCA 2HDUA 4DE0A 3CJMA 2WUQA 3C7UA 3MKFA 4FD8A 4JBFA 3ISGA 5FQQA 2QZ6A 2X01A 3WRTA 2PU2A 3PBTA 3SS3A 2Y2PA 1LLBA 2V2FF 1K57A 4KZ3A 4P0MA 5HL1A 3MZDA 3ZG5A 1CEFA 4N9LA 1BLSA 3N7WA 1IYSA 1K57C 1ONHA 3OCNA 1YLYA 2XF3A 4JXWA 3C4OA 1M6KA 5CERA 1FSYA 3BEBA 1KE3A 5F1GA 5A90A 1JWPA 3WS2A 3O86A 5CGWA 1LL9A 1NXYA 2ZD8A 4OLGA 3ZDJA 3Q7ZA 2JCHA 1C3BA 2P74A 3VSLA 5JYPA 2FFFB 5BOHA 4UA6A 2HDSA 3FKVA 1KVMA 5FSRA 4BD0A 4EWFA 1TEMA 4DE2A 2ZC5B 2Y4AA 5FI2A 3N6IA 1NZUA 3GV9A 3HUNA 4WM9A 2WGWA 3C4PA 5GHZA 4E6XA 5CEBA 5KSCA 3WS1A 5HAPA 3HREA 3OPPA 1GA9A 3HLGA 4R0QA 4XUZA 2XGNA 1G68A 4KQRA 4XUXA 3V5MA 3OZHA 3EQUA 3IXGA 2WAEA 2OSUA 4BLMA 1OMEA 3IQAA 1RGZA 3Q07A 3BM6A 3G2YA 1ALQA 4RA7A 1LI9A 1W7FA 4N92A 1XPBA 3PBOA 3Q7VA 1BZAA 5CHUA 2IWBA 3VOZA 2Q9MA 1S6RA 3Q81A 4KQQA 3SH9A 4N9KA 3IWOA 1K38A 4Y7PA 1PIOA 4OPYA 5CTMA 4GNUA 1ZG4A 1IYPA 4EBPA 1XGIA 3IWQA 2IWDA 2ZLYA 1JWZA 5TFQA 1K56A 3RXWA 1DJBA 5A93A 2P9VB 1ES3A 4ZJ1A 3ZNTA 4UA7A 3P09A 4LENA 1JVJA 3HLDA 3N8SA 4OKPA 1EI5A 3O87A 2Y2JA 5E2HA 3IXBA 1K4FA 5GL9A 4X55A 1O07A 1ONGA 1W5DA 2PU4A 2Y2MA 1FCMA 2P9VA 3UPOA 1ERQA 1BTLA 4M3KA 5DF7A 3V3SA 3NI9A 3M6BA 4EBLA 3BFGA 2EFXA 3P98A 4HBTA 1ZKJA 1NY0A 2XD1A 4ID4A 4LV3A 1GHIA 4WZ4A 3HLWA 4X69A 2OV5A 3TSGA 3VP4A 2ZMAA 5GLBA 4C3QA 2DCFA 5CGSA 4D2OA 3GTCA 1FSWA 1ERMA 1L0FA 3N8RA 3HLCA 4GB7A 4LV2A 2V20A 3VOYA 3ZGAB 4MNRA 4LV0A 2R9WA 3SOIA 2ZJ9A 5M18A 2ZM8A 4C75A 4E3NA 2Y2IA 4UHUA 5CRFA 5HAIA 4HBUA 5I94A 2J9OA 1H5XA 2WK0A 4WBGA 3IH9A 3M6HA 2XD5A 4K91A 3SH8A 4KZ9A 4OOLA 5FATA 2QPNA 4WMCA 3G2ZA 3PBQA 3HUOA 4OPQA 1MWRA 4KZ7A 2EXAA 3DWZA 4IVKA 3HUMA 3HLBA 4QY6A 1LL5A 1L0EA 1TVFA 5TGFA 3MFDA 2I72A 2FFYA 4FH4A 4PM7A 3ITBA 3S22A 1E3UD 4MBKA 5DTKA 4LCMA 3G4PA 2XH9A 4BL3A 3MBZA 4F94A 5HAQA 1E25A 1ESIA 2HP6A 1S0WA 1YLZA 4DE1A 4GDBA 4OOMA 4X53A 4YINA 5GHXA 5E43A 2EX6A 4E3MA 2B5RA 4R23A 4HESA 3FZCA 1U60A 1KE4A 3DW0A 3IT9A 3G31A 1GHPA 3HLFA 2Y2NA 3RXXA 3UE3A 4JF5A 5F82A 4BQMA 1Z6FA 2OLUA 4PM5A 5E2EA 1BLCA 4OONA 2PBYA 4OPZA 4E3IA 3PTEA 2HDQA 3OPLA 2XLNA 1XA7A 4OQ0A 1LI0A 3ZNYA 4BJPA 3RJUA 1TDGA 2J7VA 1YT4A 4OQGA 1IYOA 4OOYA 1RP5A 1G6AA 1I5QA 4S2MA 3VSKA 1WE4A 1ESUA 4C6YA 3S4XA 1ZC2A 1CK3A 1GHMA 2WGVA 2WGWB 3MZEA 2Y2QA 3OCLA 4OP5A 2EX2A 5EVIA 3SS4A 2Q9NA 3IF6A 2ZM2A 1NJ4A 2RCXA 3AGFA 1PYYA 3AGDA 3VFFA 3WS5A 1FR6A 4UA9A 5EVIC 4ZJ3A 5JYOA 1KDSA 3EQVA 3IF6C 4JXSA 5EPHA 5FAOA 4DXCA 1YQSA 1IELA 5EVID 3N8LA 4E3JA 2BLSA 4K0WA 1PZOA 1KGGA 4QY5A 4B4XA 1SDEA 3CG5A 3Q7VB 1ES5A 5CEDA 1ES2A 2Y2GA 3QNCA 2WYXA 2EXBA 4PM6A 2HP5A 4Y0UA 1FCNA 2XEPA 5U47A 1HTZA 3FYZA 1Y54A 4S2KA 5FA7A 5DF9A 4FCFA 1XGJA 4JXGA 4IBXA 3MXRA 4QD4A 3UE0A 3GVBA 3Q82A 3BFCA 4IEDA 5F1FA 4PPRA 5M19A 1YLJA 1DY6A 4MLLA 3G34A 2J8YA 4P85A 1O7EA 3Q1FA 4U0TA 4ZBEA 4MBHA 4S2OA 3LY4A 1YM1A 3PBSA 2XK1A 3BLSA 1FOFA 4CPKA 3WRZA 4KZ5A 2XDMA 3BFFA 1KGEA 3G30A 1K56D 5DVAA 5AQ9A 3PBNA 2XFSA 5HARA
chains in the Genus database with same CATH superfamily
1EROA 3NOTC 3P7NA 5F6AA 4NXFA 5IHVA 2QJ5A 4NEED 4RX3A 3NHQA 1M40A 4S2LA 4GD8A 4PKYA 5G18A 4Y13A 1YMSA 3VP3A 1K25A 4HJ4A 5CXWA 2ZC3B 3LEQA 1BUEA 4XXRA 1NRFA 3BY9A 2IWCA 4WZ5A 3A3FA 1FR1A 1L2SA 4I3IA 2OWJA 2Z6DA 4QU3A 4K08A 3ZFZA 5G4ZA 5CHMA 4QB8A 5G4YA 3U4LP 4L9GA 2DNSA 3T1XA 3MSHA 2Y2OA 1MBLA 3BYDA 1I2SA 1ZTUA 2QJ7A 5E2GA 4HJ3A 2E8JA 4NG2A 1NZOA 4KQDA 4RX2A 1MWUA 1SCWA 4E3KA 2PAVP 2VZWA 4R4SA 1VEUA 2W3GA 2Y2LA 3T50A 3UB8A 4JGRA 5EVIB 1UWNX 4HIAA 3HVFA 1T1BA 3ZG7B 3FV7A 1K54A 2O99A 4I39A 3UPNA 5FAQA 2HZ5A 5AQ7A 4N1XA 4K0XA 5J8XA 3O88A 2ZL1A 1TDLA 2QMIA 3B3XA 1YSQA 4Y3IA 4CJNA 2A3UA 3UN7A 4FSFA 1MXOA 2JE5A 4X1MA 1AXBA 3C5AA 2OWHA 3B47A 2WGIA 3G35A 3LEZA 1PWCA 4X56A 2ZQDA 1DJAA 3JPUA 4R1GA 5DTTA 3A3JA 3FWLA 2GDNA 2ZMFA 2VV7A 5CGXA 1MY8A 3V67A 2VEAA 4WEKA 2DRWA 4MDZA 1H8ZA 2EFUA 1IEMA 3BLMA 4WUJA 3UB7A 4CLCB 2IA2A 1CI8A 3QP4A 4GZBA 2QWSA 2Z2LB 3ZVWA 4ZAMA 5CHJA 4ME4A 3WS4A 1YMXA 4NK3A 5EOOA 2OOLA 1Z09A 1NWZA 4P6BA 2ZQ9A 4PMAA 1L0GA 2W1TA 5L2FA 3NOUC 2R9XA 1KE0A 3MKEA 1LL8A 3WS0A 5HWTA 5HX9A 3W4PA 4FH2A 5CECA 3UE1A 1OT6A 3CLOA 1WYCA 3NBLA 2A49A 3HL9A 3LI8A 4HNBA 4N1HA 1KVLA 3KYQA 5D3OA 4GOGA 4KG2A 3E0YA 4S2NC 5IT5A 5DFYA 2RL3A 2WZZA 2KOIA 4B9OA 3W4QA 4Q8IA 4O7DA 4F3LA 2ZQCA 3LUQA 2V1ZA 4U0XA 4II7A 4JBFA 5FQQA 2QZ6A 2PU2A 5HL1A 2VK3A 1CEFA 1BLSA 3N7WA 1IYSA 3T1QB 3OCNA 1FSYA 1NRJA 5F1GA 2V0WA 1JWPA 5CGWA 4H6JB 3ZDJA 1XFNA 5JYPA 5BOHA 3LICA 2A2LA 4BD0A 4EWFA 3R4KA 1Y4OA 2W1RA 5FI2A 4E6XA 3HUNA 4WM9A 3C4PA 5GHZA 3WS1A 3OPPA 5HZHA 3IXGA 3BQAA 3IQAA 3RTYA 3BM6A 3G2YA 1ALQA 4RA7A 5CHUA 3VOZA 2Q9MA 4KQQA 2P04A 3SH9A 4N9KA 3IWOA 3LR3A 2UV0E 3NOPC 4OPYA 1CJFA 3IWQA 2ZLYA 1JWZA 5A93A 3MMHA 4R6LA 4UA7A 3P09A 1JVJA 3N8SA 4OKPA 2K31A 4UEYA 2Y2JA 5E2HA 3E98A 1W5DA 1FCMA 4BBUA 3H82B 5DF7A 5HSQA 3M6BA 4Q0JA 3BFGA 2EFXA 1ZKJA 4WZ4A 2OV5A 4WL9A 3F1PA 4Y2FA 1L0FA 3N8RA 3KSFA 1CQAA 4LV0A 2ZJ9A 2D01A 4MMNA 4C75A 4E3NA 1N9OA 5HAIA 2J9OA 5FEGA 2WK0A 4K91A 3SH8A 1MC0A 3PBQA 2KDKA 3HUMA 3HLBA 1S4RA 2I72A 4FH4A 5DJUA 3ITBA 1X0OA 3S22A 4O01A 4MBKA 4BL3A 1E25A 1ESIA 2HP6A 1YLZA 3TW8A 4DE1A 3LIDA 5GHXA 5E43A 2EX6A 4HESA 1KE4A 3DW0A 3G31A 3UE3A 2INWA 4JF5A 5F82A 1Z6FA 3QP1A 2OLUA 1BLCA 5TBMB 2PBYA 4E3IA 2Z6CA 2HDQA 2O0YA 2XLNA 4OQ0A 3VSKA 1ESUA 3S4XA 3SS4A 4OP5A 2Y2QA 2EX2A 3IF6A 3AGFA 5EVIC 4EXOA 4EU0A 4LFUA 5EPHA 5FAOA 5EVID 4BBVA 3TE8A 3KSGA 3CG5A 3QNCA 1FILA 3C30A 3LGOA 2EXBA 2HP5A 1HTZA 3FYZA 3FG8A 5DF9A 2JKRM 1H0MA 4HP9A 5F5YA 4Y5FA 4ZBEA 2J3WA 3PBSA 2XK1A 4DJ3A 4CPKA 3KYZA 3MR0A 3WRZA 1P97A 3IBRA 3EGDC 3PBNA 2XFSA 2CMNA 4RYEA 1S1YA 1LHYA 3G32A 4S2IA 5KSHA 1IKIA 4G3WA 4OLDA 4LV1A 3LR5A 4LPZA 3NIAA 1GA0A 2VX8A 1XFQA 3QNBA 3TG9A 4HH2A 3H9WA 3T4JA 4CLCC 5I5LA 5DFXA 2FZ0A 4LCLA 2JKTM 4ZTKA 2GNXA 4DDSA 3GSGA 3DTMA 3OPHA 4ZDXA 2Y55A 2ZC4B 5FAPA 1N4OA 3O3VA 2VGJA 2WADA 1OTAA 1IFQA 2XFTA 2D02A 4KZ4A 4H8RA 2JHEA 5K5BA 3ZG0A 3SH7A 3VE3A 4MN5A 2W3EA 5KZHA 2M7UA 5M1AA 1JTDA 3MQ0A 4KZBA 4PM9A 1YAXA 3JYIA 4CLCE 4HEFA 1K6RA 4GD6A 4RQ9A 2JN7A 3T4KA 3QP6A 2PD8A 2EA9A 3LO7A 4GHIA 2HPBA 1SKFA 2GJ3A 3BY8A 1SHVA 1VM1A 3CAXA 2WZXA 3NDGA 5EE8A 3PXPA 1XA1A 1PWGA 4PAUA 4B88A 3M2KA 4QJGA 3IS2B 3N4IA 1FCOA 5GLAA 1MWTA 3BFEA 2WAFA 5LBRA 1DP9A 1YLWA 3L9KA 3PAEA 4OPRA 3T1SA 1CEGA 3MXSA 1XKZA 2CC1A 1BSGA 2G2WA 3F1OB 4JKTA 3QP5A 3TOIA 2EX9A 3OPRA 1TS8A 3IXDA 2P08A 4LRZE 3IHBA 4OP8A 2JBFA 2LB5A 1DJCA 1K55C 3UNWA 5EM0A 1MWSA 5AQAA 3EWKA 3GQZA 4E3LA 3WWXA 3SW1A 5HD3A 4GS9A 3D9YA 1DP8A 3DWKA 2ZC6B 2WKIA 3VMAA 1YLPA 3NC8A 1TF1A 5J4EA 1LSVA 4XT2A 1WYBA 1IYQA 4EBNA 1FQGA 5HWVA 4Y15A 2E8IA 2BASA 4E6WA 5GHYA 3A0SA 3QHYA 2JC7A 3P01A 3SS5A 1ES4A 3RH8B 2O9CA 1SDNA 4PM8A 4X1LA 4M4XA 3LIBA 3W4OA 3ZHHA 1VEUB 4EV4A 4QHCA 1VETB 1CI9A 5CTNA 1PNEA 4DXBA 3PBRA 3A3EA 1PI4A 4X68A 3GRJA 1S4SA 3KX0X 3EGXC 3F1NA 3NCKA 1ACFA 1ODVA 2C6WB 4JF6A 4ESPA 1GCEA 1VETA 3A0VA 1RCJA 4IJGA 5FI7A 4DE3A 2ZL1B 5EUAA 2OAP1 2W27A 3C7UA 5MC7A 4FD8A 3ISGA 4EEPA 3PBTA 2Y2PA 1LLBA 2V2FF 4EETB 3ZG5A 1WA9A 2O9AA 3K3DA 1K57C 4JXWA 3VE4A 1NXYA 4OLGA 3Q7ZA 1C3BA 3VSLA 2HDSA 3FKVA 1KVMA 5FSRA 1OTDA 1MZUA 3N6IA 1NZUA 1VB6A 3EEHA 2WGWA 5CEBA 3K2NA 2WKRA 3E4PA 4MN7A 1G68A 1GSXA 4EEUA 2WAEA 4EW7A 3Q07A 4EESA 3LIEA 4N92A 1XPBA 3T4OA 3HJKA 3Q81A 4Y7PA 3MFXA 3BW6A 4EBPA 5FEFA 1XGIA 5TFQA 3RXWA 2R78A 1EI5A 3O87A 3BJNA 1K4FA 5GL9A 1O07A 2PU4A 2Y2MA 1V9YA 3LR4A 1ERQA 1BTLA 2W1TB 3V3SA 1GSVA 2JKFA 3K3CA 2WKQA 3MS6A 4X69A 1NY0A 1GHIA 2ZMAA 4C3QA 2DCFA 5CGSA 4D2OA 1K0KA 1ERMA 4LV2A 3TRCA 4MNRA 2HGVA 5M18A 2XSSA 5CRFA 1H5XA 4WBGA 3R7WA 3M6HA 2XD5A 4KZ9A 2QPNA 2FH5A 1F2KA 1MWRA 4KUKA 1W63Q 5TGFA 4F3LB 2FFYA 3MXQA 3UMDA 1Y28A 4F94A 4I5SA 2B5RA 4EERA 2ZMVA 1J3WA 4ARZA 1S67L 4PM5A 2YKFA 5E2EA 3NULA 3PHYA 3OPLA 5HDDA 4EQ1A 1XA7A 1LI0A 3ZNYA 2J7VA 1G6AA 4IUHA 2OAQ1 1WE4A 4C6YA 1ZC2A 2M1CA 1CK3A 2PR6A 3MZEA 3OCLA 2Q9NA 2L1MA 3VFFA 1NJ4A 1PYYA 1FR6A 5JYOA 1KDSA 4JXSA 4DXCA 4K0WA 4HH3A 4PM6A 4Y0UA 5U47A 1DP6A 4ZRRA 4S2KA 5FA7A 3S7PA 1XGJA 4HY8A 2L4RA 3MXRA 3GVBA 3Q82A 3FPVA 4PPRA 1YLJA 1DY6A 4MLLA 5M19A 1KOUA 3IX3A 4P85A 4R3AA 4S2OA 3BLSA 3LIAA 1FOFA 2W3HA 2JKGA 4AFIA 3BFFA 5C5KA 2QKPA 3CMZA 4E04A 4JF4A 3F1PB 1JWVA 5EECA 4OQIA 2W3DA 1YLTA 2PD7A 4PKYG 5FDHA 4DN0A 4IUKA 3UPPA 3A3IA 4UQIS 4YFMA 4CQHA 2V1BA 3BQ8A 3IHAA 5HDSA 4HP4A 4WZ5C 1PWDA 4WMCD 2ZOHA 3T4SA 2WKEA 2H10A 2VV6A 5FQMA 1LSWA 2H0TA 3CHWP 3IBJA 4G3VA 3ZG8B 3E2KA 4NXGA 3CWFA 4GKUA 4GCZA 2EWWA 4Z9QA 1FIKA 4DJ2A 4EUVA 3ZCZA 4WF0A 1W79A 1XX2A 4DMZA 2X71A 1VQQA 4HI4A 2MJ6A 3GR2A 3IF6B 2GX5A 1BLHA 5E2FA 2OLVA 1KDWA 2X02A 1K54C 2P7JA 2Y8HA 3JVUA 5FQKA 3VFHA 3GMWA 3C7VA 3NY4A 4BMWA 3IWIA 1QMEA 1W8YA 5DF8A 2KLIA 1XJ6A 4YWZA 4E3OA 4KZAA 3B42A 3CITA 5EVEA 4Q0HA 1NYMA 3IX8A 5FI6A 4MBFA 2YKHA 1LT0A 4LRYC 3ZG9B 4B93A 4UQIM 1HD8A 2EWVA 3IF5A 5FQ9A 3ITAA 1HVBA 1N9LA 1MKIA 3W8KA 4UAAA 1BYWA 1H8YA 1QMFA 2PYPA 2VJWA 1HZOA 5L09A 4R4RA 5HD5A 1N9NA 1OTEA 2I9VA 3NJAA 5HPIA 1I2WA 5FQJA 3LYXA 4IBRA 2ZQ7A 4YNRA 1OPXA 2Y91A 3DAVA 2XR0A 2H5SA 2J9PA 4IVIA 1PW1A 5HFOA 3D72A 2XA7S 4Y0TA 2W0NA 4L0LA 4CLCD 2VGKA 2A24A 5F68A 3V39A 5IU1A 4A5RA 1PZPA 3LIFA 3T4LA 1BULA 2HP9A 1ZG6A 3VOLA 5DTSA 1XJ4A 5AQBA 2J3TC 4KZ8A 1IOUA 3LCEA 4U3TA 2J3TD 4KUOA 4LGWA 2WKHA 1W63M 3UDXA 3I7JA 3S7QA 1Q2PA 4DF6A 4DRTA 2AVXA 1MPLA 2Y2HA 4OQHA 4S2NA 1P9RA 4GHIB 2EX8A 1EWZA 1V9ZA 3D3OA 4RVAA 4S2PA 3UO9A 3KO6A 3QP2A 3MQOA 2HV1A 1TS7A 4DE0A 3CJMA 2WUQA 2JKRI 3MKFA 2X01A 4MN6A 3DBAA 3SS3A 3UB9A 4KZ3A 4N9LA 3LR0A 4R70A 1ONHA 3KYEA 5TJJA 3BEBA 2ZD8A 2JCHA 1T1AA 4HOIA 2FFFB 2V8FA 4FOFA 2ZC5B 1UWPX 3GV9A 5HAPA 3HREA 4XUZA 4R0QA 2XGNA 3H7WA 4I3AA 3CPTB 4XUXA 3OZHA 2XA7M 3ZQ5A 2VLGA 4BLMA 1RGZA 1TS6A 2HJEA 3Q7VA 4GS9B 4IHQA 1S6RA 3QP8A 2LB9A 3CPTA 1OTIA 4JGPA 5CTMA 4GNUA 1ZG4A 2JKTI 2IWDA 5J7EA 2P9VB 4ZJ1A 3ZNTA 4LENA 4XT2B 3HLDA 3C8CA 1F9IA 2KX6A 1P9WA 2VV8A 5AVFA 3IXBA 4X55A 4FTXA 2P9VA 2NUTC 2K2NA 5A8BA 5AVEA 2V1AA 1SKOA 3NI9A 4HHDA 3ICYA 3TSGA 2XD1A 2K7SA 4ID4A 3GTCA 1FSWA 4GB7A 2V20A 3VOYA 5AJGA 2R9WA 3SOIA 2B95A 2Y2IA 4UHUA 1T18A 5HDCA 4OOLA 3F1NB 4WMCA 3G2ZA 3DTIA 2EXAA 3MQQA 1TVFA 3U2AA 4QPRA 4G3KA 3O5YA 3DTKA 1E3UD 5DTKA 4LCMA 3G4PA 5HAQA 3PYPA 4GDBA 4E3MA 4R23A 3FZCA 3IT9A 2Y2NA 3A0RA 4OPZA 2L0WA 1OTBA 1S66L 1YSPA 4BJPA 5DKKA 3RJUA 1TDGA 1G6OA 1IYOA 1I5QA 4S2MA 4Z1WA 2M7VA 3E4OA 2WGWB 4P6ZS 5EVIA 2ZM2A 3WS5A 2O9BA 4ZJ3A 3IF6C 3EQVA 5HL6A 2B02A 1IELA 3N8LA 1PZOA 2VGLS 4O0PA 1ES5A 5CEDA 4D60A 2Y2GA 3NECA 5EV0A 2WYXA 5L10A 2QHKA 1FCNA 3ULFA 4FCFA 4JXGA 4QD4A 3S7NA 3ZYTA 5F1FA 2J8YA 1O7EA 5L8MA 4MBHA 3LY4A 1YM1A 2WKPA 1NLZA 3CUEC 4KZ5A 2XDMA 1KGEA 3G30A 1K56D 3UMEA 2ZBBA 4WEJA 1A0KA 1HLUP 5HARA 4JGOA 4KQOA 3VP1A 1JNUA 2PBDP 3R7WB 1XJ2A 1W8QA 3FPWA 4I38A 4HJ6A 1T19A 4R3JA 3RFBA 2J80A 4CLCA 2XRNA 5FQIA 3LY3A 1J9MA 5KMWA 3GDIA 3T4QA 1L3LA 4BENA 1EW0A 1L0DA 4ETZA 4WN5A 3EOIA 4DDYA 2B18A 4L9EA 5EM1A 4OH0A 2PHYA 4P6ZM 4X6TA 1VHMA 5EVLA 1D7EA 5HWWA 4JPMA 3FKWA 4ARZB 3LFVA 1K4EA 2Y79A 3HBRA 4S2JA 3BFDA 4QWOA 4Q0IA 2VGLM 4WYYA 3A3DA 5EOEA 4R38A 2XROA 3V50A 1H3QA 1RGYA 3UB6A 2HF6A 4KZ6A 1PFLA 5F83A 4O8GA 2H28A 2Q0OA 2Y59A 1G28A 4BWIA 1TS0A 4NXEA 4JLFA 3C2WA 5EFWA 3GECA 3V3RA 4EQIA 4NKPA 3VP0A 5FASA 3OC2A 2ZQAA 2PDRA 4HQAA 4GW9A 4P87A 2Z2MB 3PAGA 4KG6A 2BG1A 2UWXA 1G5UA 1KGFA 3W2ZA 2V8CA 3UDFA 5TR7A 4KENB 3BECA 4BD1A 2VA0A 4MEZA 3OBFA 1JTGA 2XQZA 3CI6A 3UY6A 4H6JA 1YPRA 1PI5A 1STZA 3MF0A 1H8MA 2PRFA 3D4FA 3NDEA 1TD5A 4ZJ2A 1K55A 3S7OA 5F69A 3ZVTA 4JXVA 3OOVA 4KG5A 3HJIA 3UDIA 2DMWA 1E4DA 4NETA 2ZQ8A 1BLPA 3MZFA 4GN2A 1PRQA 4OVDA 4Y0OA 1D06A 3KSHA 1XXMA 4Y17A 3EEAA 4WELA 3IH8A 4DKIA 5HW3A 3CZDA 1UGUA 2Y2KA 5GLDA 4GDNA 5DKLA 2C5WB 4B4ZA 4BL2A 3M2JA 2HDRA 1K6SA 4FUWA 1NYYA 3E2LA 4EUZA 2VKSA 3H82A 3AGEA 2ZM0A 5FL3A 1N9BA 3HLEA 5A91A 1XP4A 1OJ5A 1SZVA 2ZC7A 5DJTA 1BT5A 3BRMA 2G2UA 1E3UA 2BTFP 1IKGA 1Q2QA 4R3BA 4B4XA 3HCYA 4LRXC 5A92A 2H0YA 3IXHA 3VP2A 1CF0A 1PW8A 3S1YA 5GLCA 2HDUA 1LSXA 4GLQA 3PR6A 3WRTA 1D1JA 1K57A 4P0MA 3MZDA 3E4QA 1YLYA 3UE6A 5TBMA 2XF3A 3C4OA 1M6KA 5CERA 1KE3A 5A90A 3WS2A 3O86A 1LL9A 2P74A 3UB5P 4UA6A 2HJ9C 1TEMA 4DE2A 2Y4AA 3FC7A 3BWLA 1F5MA 5KSCA 3T12B 1GA9A 2G7UA 3HLGA 1P0ZA 4KQRA 1F98A 3V5MA 3EQUA 2OSUA 1ZHHB 1OMEA 4L9FA 2ACGA 1LI9A 1W7FA 3PBOA 1BZAA 2IWBA 2V9AA 4PHTA 4WLAA 3G6OA 1K38A 1PIOA 2W3FA 4NXBA 1IYPA 3CUEA 1K56A 1DJBA 1ES3A 3T4TA 4JGQA 5L07A 2A24B 1ONGA 3DTEA 3UPOA 3C38A 5IS1A 2PR5A 4M3KA 4EBLA 1OT9A 5FDSA 3P98A 4HBTA 4LV3A 3VP4A 3HLWA 1T1CA 5GLBA 3KSIA 4MCWA 3HLCA 5J3WA 4BBTA 3ZGAB 3LI9A 2ZM8A 4X25A 4HBUA 5CX7A 4ETXA 3IH9A 2QYBA 5FATA 1XJ3A 3HUOA 4OPQA 4KZ7A 3DWZA 1AWIA 4IVKA 4QY6A 1LL5A 1L0EA 3MFDA 4PM7A 3TJZC 5KIZA 3SZTA 2PT7A 2XH9A 3MBZA 1S0WA 1OJGA 4OOMA 4X53A 4YINA 1YKDA 1U60A 2PYRA 2ZOIA 4YOFA 3RXXA 1GHPA 3HLFA 1GSWA 1NLYA 4BQMA 3T1RA 1DRMA 4OONA 3PTEA 4I3JA 1YT4A 4OQGA 4OOYA 1RP5A 1GHMA 2WGVA 1MKMA 2V0UA 2RCXA 3AGDA 3H7WB 4UA9A 3JVVA 3IX4A 2NUPC 1YQSA 4E3JA 2BLSA 1KGGA 4QY5A 1SDEA 3OLOA 3Q7VB 1ES2A 3B33A 2XEPA 1Y54A 3IS2A 1S1ZA 4GJ4A 3VV4A 4IBXA 5HPFA 3L7HA 3UE0A 2GZAA 3BFCA 4IEDA 3G34A 3MJQA 3Q1FA 4U0TA 1SKOB 4LLOB 3F1OA 5DVAA 5AQ9A 5I94A
chains in the Genus database with same CATH topology
4WEJA 3CMZA 1EROA 4JF4A 4RYEA 1JWVA 1LHYA 4KQOA 5EECA 5IHVA 4OQIA 3VP1A 4RX3A 3G32A 4S2IA 5KSHA 1IKIA 1M40A 4OLDA 4S2LA 4LV1A 1YLTA 3NIAA 1GA0A 1W8QA 4GD8A 5G18A 3QNBA 4R3JA 5FDHA 3TG9A 1YMSA 3VP3A 5FQIA 3UPPA 3A3IA 1K25A 3LY3A 1J9MA 5CXWA 5KMWA 4YFMA 2ZC3B 1BUEA 4LCLA 4XXRA 1NRFA 4BENA 4ZTKA 2IWCA 4WZ5A 3A3FA 1L0DA 1FR1A 3IHAA 1L2SA 4DDSA 3GSGA 3DTMA 4DDYA 3OPHA 4WZ5C 4QU3A 4ZDXA 2Y55A 1PWDA 3ZFZA 2ZC4B 4WMCD 5FAPA 4OH0A 5CHMA 2WKEA 4QB8A 1N4OA 3O3VA 2VGJA 4X6TA 5EVLA 2WADA 2H10A 2DNSA 4JPMA 5FQMA 2H0TA 2XFTA 3FKWA 3ZG8B 4KZ4A 1K4EA 3HBRA 4H8RA 4S2JA 3E2KA 3BFDA 3ZG0A 3SH7A 2Y2OA 1MBLA 3BYDA 1I2SA 4GKUA 4WYYA 5E2GA 4Z9QA 3A3DA 5EOEA 3ZCZA 3V50A 5KZHA 1NZOA 1RGYA 1W79A 1XX2A 5M1AA 4RX2A 1JTDA 1MWUA 1SCWA 4E3KA 2X71A 4KZBA 4PM9A 4R4SA 4KZ6A 3JYIA 1VQQA 4HEFA 5F83A 2Y2LA 5EVIB 1K6RA 4GD6A 3GR2A 2Y59A 3HVFA 3IF6B 1BLHA 5E2FA 2OLVA 3ZG7B 3FV7A 1K54A 1KDWA 2X02A 3LO7A 2HPBA 1SKFA 1K54C 1SHVA 4JLFA 1VM1A 2WZXA 3UPNA 5FAQA 3NDGA 5EE8A 1XA1A 5AQ7A 1PWGA 4N1XA 5FQKA 3V3RA 4EQIA 4K0XA 4B88A 3M2KA 3VFHA 5J8XA 3O88A 4QJGA 3VP0A 1TDLA 2QMIA 3GMWA 3B3XA 3C7VA 5FASA 3OC2A 4CJNA 2A3UA 2ZQAA 3N4IA 3NY4A 3UN7A 1FCOA 5GLAA 1MWTA 4FSFA 3BFEA 3IWIA 1QMEA 1MXOA 1W8YA 2JE5A 5DF8A 2WAFA 4P87A 2Z2MB 1AXBA 3PAGA 3C5AA 2BG1A 4KG6A 2UWXA 1KGFA 4E3OA 3G35A 2WGIA 1YLWA 3LEZA 1PWCA 4KZAA 3PAEA 4OPRA 3UDFA 1NYMA 5TR7A 4KENB 3BECA 1CEGA 4BD1A 5FI6A 4MEZA 3MXSA 4X56A 1XKZA 2CC1A 4MBFA 2ZQDA 1DJAA 1JTGA 1BSGA 2XQZA 2G2WA 3UY6A 4JKTA 3TOIA 4R1GA 2EX9A 3ZG9B 1PI5A 3OPRA 5DTTA 1HD8A 3A3JA 3IXDA 3D4FA 3FWLA 3IF5A 3NDEA 4ZJ2A 3IHBA 4OP8A 5FQ9A 3ITAA 1K55A 1HVBA 2GDNA 2JBFA 5CGXA 1DJCA 1K55C 1MKIA 3UNWA 3W8KA 1H8YA 1QMFA 1MY8A 1MWSA 4JXVA 4UAAA 5AQAA 3ZVTA 4KG5A 3GQZA 3UDIA 1HZOA 4WEKA 2DRWA 4R4RA 3WWXA 4E3LA 1E4DA 1H8ZA 2EFUA 4NETA 2ZQ8A 1BLPA 1IEMA 3BLMA 3MZFA 4GN2A 1I2WA 1CI8A 4GZBA 4OVDA 5FQJA 4Y0OA 3DWKA 2ZC6B 2ZQ7A 4IBRA 2WKIA 2Z2LB 1XXMA 3VMAA 3ZVWA 1YLPA 4WELA 3IH8A 4ZAMA 4DKIA 5HW3A 2Y91A 3CZDA 2XR0A 2H5SA 3NC8A 2Y2KA 2J9PA 4IVIA 1PW1A 5CHJA 5GLDA 4GDNA 3WS4A 1YMXA 4NK3A 5HFOA 2C5WB 4B4ZA 4BL2A 3M2JA 5EOOA 2HDRA 4Y0TA 4L0LA 1WYBA 1IYQA 1K6SA 4P6BA 4EBNA 2ZQ9A 1FQGA 1NYYA 2VGKA 4PMAA 2E8IA 3E2LA 4EUZA 3V39A 4E6WA 5GHYA 3QHYA 1L0GA 2JC7A 1PZPA 2ZM0A 3AGEA 1BULA 3SS5A 4A5RA 1ES4A 2HP9A 5L2FA 1SDNA 4PM8A 1ZG6A 2R9XA 1N9BA 1KE0A 3HLEA 5A91A 1XP4A 5DTSA 3MKEA 5AQBA 4KZ8A 3W4OA 3WS0A 3LCEA 4U3TA 5HX9A 3ZHHA 2ZC7A 4EV4A 4QHCA 2WKHA 3W4PA 1BT5A 1CI9A 4FH2A 3BRMA 2G2UA 3UE1A 1E3UA 5CTNA 5CECA 1IKGA 1Q2QA 4R3BA 4DXBA 3UDXA 3I7JA 3A3EA 3PBRA 1Q2PA 1PI4A 4X68A 3GRJA 1WYCA 3NBLA 2A49A 4DF6A 4DRTA 1MPLA 3HL9A 2Y2HA 4N1HA 1KVLA 4OQHA 4S2NA 5A92A 3NCKA 2H0YA 2EX8A 5D3OA 4GOGA 1EWZA 2C6WB 4JF6A 1GCEA 4KG2A 4S2NC 3IXHA 3VP2A 1RCJA 2RL3A 2WZZA 4RVAA 4S2PA 3UO9A 3W4QA 4Q8IA 1PW8A 4O7DA 5FI7A 2ZQCA 3S1YA 4DE3A 2V1ZA 5EUAA 4U0XA 5GLCA 2HDUA 4DE0A 3CJMA 2WUQA 3C7UA 3MKFA 4FD8A 4JBFA 3ISGA 5FQQA 2QZ6A 2X01A 3WRTA 2PU2A 3PBTA 3SS3A 2Y2PA 1LLBA 2V2FF 1K57A 4KZ3A 4P0MA 5HL1A 3MZDA 3ZG5A 1CEFA 4N9LA 1BLSA 3N7WA 1IYSA 1K57C 1ONHA 3OCNA 1YLYA 2XF3A 4JXWA 3C4OA 1M6KA 5CERA 1FSYA 3BEBA 1KE3A 5F1GA 5A90A 1JWPA 3WS2A 3O86A 5CGWA 1LL9A 1NXYA 2ZD8A 4OLGA 3ZDJA 3Q7ZA 2JCHA 1C3BA 2P74A 3VSLA 5JYPA 2FFFB 5BOHA 4UA6A 2HDSA 3FKVA 1KVMA 5FSRA 4BD0A 4EWFA 1TEMA 4DE2A 2ZC5B 2Y4AA 5FI2A 3N6IA 1NZUA 3GV9A 3HUNA 4WM9A 2WGWA 3C4PA 5GHZA 4E6XA 5CEBA 5KSCA 3WS1A 5HAPA 3HREA 3OPPA 1GA9A 3HLGA 4R0QA 4XUZA 2XGNA 1G68A 4KQRA 4XUXA 3V5MA 3OZHA 3EQUA 3IXGA 2WAEA 2OSUA 4BLMA 1OMEA 3IQAA 1RGZA 3Q07A 3BM6A 3G2YA 1ALQA 4RA7A 1LI9A 1W7FA 4N92A 1XPBA 3PBOA 3Q7VA 1BZAA 5CHUA 2IWBA 3VOZA 2Q9MA 1S6RA 3Q81A 4KQQA 3SH9A 4N9KA 3IWOA 1K38A 4Y7PA 1PIOA 4OPYA 5CTMA 4GNUA 1ZG4A 1IYPA 4EBPA 1XGIA 3IWQA 2IWDA 2ZLYA 1JWZA 5TFQA 1K56A 3RXWA 1DJBA 5A93A 2P9VB 1ES3A 4ZJ1A 3ZNTA 4UA7A 3P09A 4LENA 1JVJA 3HLDA 3N8SA 4OKPA 1EI5A 3O87A 2Y2JA 5E2HA 3IXBA 1K4FA 5GL9A 4X55A 1O07A 1ONGA 1W5DA 2PU4A 2Y2MA 1FCMA 2P9VA 3UPOA 1ERQA 1BTLA 4M3KA 5DF7A 3V3SA 3NI9A 3M6BA 4EBLA 3BFGA 2EFXA 3P98A 4HBTA 1ZKJA 1NY0A 2XD1A 4ID4A 4LV3A 1GHIA 4WZ4A 3HLWA 4X69A 2OV5A 3TSGA 3VP4A 2ZMAA 5GLBA 4C3QA 2DCFA 5CGSA 4D2OA 3GTCA 1FSWA 1ERMA 1L0FA 3N8RA 3HLCA 4GB7A 4LV2A 2V20A 3VOYA 3ZGAB 4MNRA 4LV0A 2R9WA 3SOIA 2ZJ9A 5M18A 2ZM8A 4C75A 4E3NA 2Y2IA 4UHUA 5CRFA 5HAIA 4HBUA 5I94A 2J9OA 1H5XA 2WK0A 4WBGA 3IH9A 3M6HA 2XD5A 4K91A 3SH8A 4KZ9A 4OOLA 5FATA 2QPNA 4WMCA 3G2ZA 3PBQA 3HUOA 4OPQA 1MWRA 4KZ7A 2EXAA 3DWZA 4IVKA 3HUMA 3HLBA 4QY6A 1LL5A 1L0EA 1TVFA 5TGFA 3MFDA 2I72A 2FFYA 4FH4A 4PM7A 3ITBA 3S22A 1E3UD 4MBKA 5DTKA 4LCMA 3G4PA 2XH9A 4BL3A 3MBZA 4F94A 5HAQA 1E25A 1ESIA 2HP6A 1S0WA 1YLZA 4DE1A 4GDBA 4OOMA 4X53A 4YINA 5GHXA 5E43A 2EX6A 4E3MA 2B5RA 4R23A 4HESA 3FZCA 1U60A 1KE4A 3DW0A 3IT9A 3G31A 1GHPA 3HLFA 2Y2NA 3RXXA 3UE3A 4JF5A 5F82A 4BQMA 1Z6FA 2OLUA 4PM5A 5E2EA 1BLCA 4OONA 2PBYA 4OPZA 4E3IA 3PTEA 2HDQA 3OPLA 2XLNA 1XA7A 4OQ0A 1LI0A 3ZNYA 4BJPA 3RJUA 1TDGA 2J7VA 1YT4A 4OQGA 1IYOA 4OOYA 1RP5A 1G6AA 1I5QA 4S2MA 3VSKA 1WE4A 1ESUA 4C6YA 3S4XA 1ZC2A 1CK3A 1GHMA 2WGVA 2WGWB 3MZEA 2Y2QA 3OCLA 4OP5A 2EX2A 5EVIA 3SS4A 2Q9NA 3IF6A 2ZM2A 1NJ4A 2RCXA 3AGFA 1PYYA 3AGDA 3VFFA 3WS5A 1FR6A 4UA9A 5EVIC 4ZJ3A 5JYOA 1KDSA 3EQVA 3IF6C 4JXSA 5EPHA 5FAOA 4DXCA 1YQSA 1IELA 5EVID 3N8LA 4E3JA 2BLSA 4K0WA 1PZOA 1KGGA 4QY5A 4B4XA 1SDEA 3CG5A 3Q7VB 1ES5A 5CEDA 1ES2A 2Y2GA 3QNCA 2WYXA 2EXBA 4PM6A 2HP5A 4Y0UA 1FCNA 2XEPA 5U47A 1HTZA 3FYZA 1Y54A 4S2KA 5FA7A 5DF9A 4FCFA 1XGJA 4JXGA 4IBXA 3MXRA 4QD4A 3UE0A 3GVBA 3Q82A 3BFCA 4IEDA 5F1FA 4PPRA 5M19A 1YLJA 1DY6A 4MLLA 3G34A 2J8YA 4P85A 1O7EA 3Q1FA 4U0TA 4ZBEA 4MBHA 4S2OA 3LY4A 1YM1A 3PBSA 2XK1A 3BLSA 1FOFA 4CPKA 3WRZA 4KZ5A 2XDMA 3BFFA 1KGEA 3G30A 1K56D 5DVAA 5AQ9A 3PBNA 2XFSA 5HARA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WEJ A;  3CMZ A;  1ERO A;  4JF4 A;  4RYE A;  1JWV A;  1LHY A;  4KQO A;  5EEC A;  5IHV A;  4OQI A;  3VP1 A;  4RX3 A;  3G32 A;  4S2I A;  5KSH A;  1IKI A;  1M40 A;  4OLD A;  4S2L A;  4LV1 A;  1YLT A;  3NIA A;  1GA0 A;  1W8Q A;  4GD8 A;  5G18 A;  3QNB A;  4R3J A;  5FDH A;  3TG9 A;  1YMS A;  3VP3 A;  5FQI A;  3UPP A;  3A3I A;  1K25 A;  3LY3 A;  1J9M A;  5CXW A;  5KMW A;  4YFM A;  2ZC3 B;  1BUE A;  4LCL A;  4XXR A;  1NRF A;  4BEN A;  4ZTK A;  2IWC A;  4WZ5 A;  3A3F A;  1L0D A;  1FR1 A;  3IHA A;  1L2S A;  4DDS A;  3GSG A;  3DTM A;  4DDY A;  3OPH A;  4WZ5 C;  4QU3 A;  4ZDX A;  2Y55 A;  1PWD A;  3ZFZ A;  2ZC4 B;  4WMC D;  5FAP A;  4OH0 A;  5CHM A;  2WKE A;  4QB8 A;  1N4O A;  3O3V A;  2VGJ A;  4X6T A;  5EVL A;  2WAD A;  2H10 A;  2DNS A;  4JPM A;  5FQM A;  2H0T A;  2XFT A;  3FKW A;  3ZG8 B;  4KZ4 A;  1K4E A;  3HBR A;  4H8R A;  4S2J A;  3E2K A;  3BFD A;  3ZG0 A;  3SH7 A;  2Y2O A;  1MBL A;  3BYD A;  1I2S A;  4GKU A;  4WYY A;  5E2G A;  4Z9Q A;  3A3D A;  5EOE A;  3ZCZ A;  3V50 A;  5KZH A;  1NZO A;  1RGY A;  1W79 A;  1XX2 A;  5M1A A;  4RX2 A;  1JTD A;  1MWU A;  1SCW A;  4E3K A;  2X71 A;  4KZB A;  4PM9 A;  4R4S A;  4KZ6 A;  3JYI A;  1VQQ A;  4HEF A;  5F83 A;  2Y2L A;  5EVI B;  1K6R A;  4GD6 A;  3GR2 A;  2Y59 A;  3HVF A;  3IF6 B;  1BLH A;  5E2F A;  2OLV A;  3ZG7 B;  3FV7 A;  1K54 A;  1KDW A;  2X02 A;  3LO7 A;  2HPB A;  1SKF A;  1K54 C;  1SHV A;  4JLF A;  1VM1 A;  2WZX A;  3UPN A;  5FAQ A;  3NDG A;  5EE8 A;  1XA1 A;  5AQ7 A;  1PWG A;  4N1X A;  5FQK A;  3V3R A;  4EQI A;  4K0X A;  4B88 A;  3M2K A;  3VFH A;  5J8X A;  3O88 A;  4QJG A;  3VP0 A;  1TDL A;  2QMI A;  3GMW A;  3B3X A;  3C7V A;  5FAS A;  3OC2 A;  4CJN A;  2A3U A;  2ZQA A;  3N4I A;  3NY4 A;  3UN7 A;  1FCO A;  5GLA A;  1MWT A;  4FSF A;  3BFE A;  3IWI A;  1QME A;  1MXO A;  1W8Y A;  2JE5 A;  5DF8 A;  2WAF A;  4P87 A;  2Z2M B;  1AXB A;  3PAG A;  3C5A A;  2BG1 A;  4KG6 A;  2UWX A;  1KGF A;  4E3O A;  3G35 A;  2WGI A;  1YLW A;  3LEZ A;  1PWC A;  4KZA A;  3PAE A;  4OPR A;  3UDF A;  1NYM A;  5TR7 A;  4KEN B;  3BEC A;  1CEG A;  4BD1 A;  5FI6 A;  4MEZ A;  3MXS A;  4X56 A;  1XKZ A;  2CC1 A;  4MBF A;  2ZQD A;  1DJA A;  1JTG A;  1BSG A;  2XQZ A;  2G2W A;  3UY6 A;  4JKT A;  3TOI A;  4R1G A;  2EX9 A;  3ZG9 B;  1PI5 A;  3OPR A;  5DTT A;  1HD8 A;  3A3J A;  3IXD A;  3D4F A;  3FWL A;  3IF5 A;  3NDE A;  4ZJ2 A;  3IHB A;  4OP8 A;  5FQ9 A;  3ITA A;  1K55 A;  1HVB A;  2GDN A;  2JBF A;  5CGX A;  1DJC A;  1K55 C;  1MKI A;  3UNW A;  3W8K A;  1H8Y A;  1QMF A;  1MY8 A;  1MWS A;  4JXV A;  4UAA A;  5AQA A;  3ZVT A;  4KG5 A;  3GQZ A;  3UDI A;  1HZO A;  4WEK A;  2DRW A;  4R4R A;  3WWX A;  4E3L A;  1E4D A;  1H8Z A;  2EFU A;  4NET A;  2ZQ8 A;  1BLP A;  1IEM A;  3BLM A;  3MZF A;  4GN2 A;  1I2W A;  1CI8 A;  4GZB A;  4OVD A;  5FQJ A;  4Y0O A;  3DWK A;  2ZC6 B;  2ZQ7 A;  4IBR A;  2WKI A;  2Z2L B;  1XXM A;  3VMA A;  3ZVW A;  1YLP A;  4WEL A;  3IH8 A;  4ZAM A;  4DKI A;  5HW3 A;  2Y91 A;  3CZD A;  2XR0 A;  2H5S A;  3NC8 A;  2Y2K A;  2J9P A;  4IVI A;  1PW1 A;  5CHJ A;  5GLD A;  4GDN A;  3WS4 A;  1YMX A;  4NK3 A;  5HFO A;  2C5W B;  4B4Z A;  4BL2 A;  3M2J A;  5EOO A;  2HDR A;  4Y0T A;  4L0L A;  1WYB A;  1IYQ A;  1K6S A;  4P6B A;  4EBN A;  2ZQ9 A;  1FQG A;  1NYY A;  2VGK A;  4PMA A;  2E8I A;  3E2L A;  4EUZ A;  3V39 A;  4E6W A;  5GHY A;  3QHY A;  1L0G A;  2JC7 A;  1PZP A;  2ZM0 A;  3AGE A;  1BUL A;  3SS5 A;  4A5R A;  1ES4 A;  2HP9 A;  5L2F A;  1SDN A;  4PM8 A;  1ZG6 A;  2R9X A;  1N9B A;  1KE0 A;  3HLE A;  5A91 A;  1XP4 A;  5DTS A;  3MKE A;  5AQB A;  4KZ8 A;  3W4O A;  3WS0 A;  3LCE A;  4U3T A;  5HX9 A;  3ZHH A;  2ZC7 A;  4EV4 A;  4QHC A;  2WKH A;  3W4P A;  1BT5 A;  1CI9 A;  4FH2 A;  3BRM A;  2G2U A;  3UE1 A;  1E3U A;  5CTN A;  5CEC A;  1IKG A;  1Q2Q A;  4R3B A;  4DXB A;  3UDX A;  3I7J A;  3A3E A;  3PBR A;  1Q2P A;  1PI4 A;  4X68 A;  3GRJ A;  1WYC A;  3NBL A;  2A49 A;  4DF6 A;  4DRT A;  1MPL A;  3HL9 A;  2Y2H A;  4N1H A;  1KVL A;  4OQH A;  4S2N A;  5A92 A;  3NCK A;  2H0Y A;  2EX8 A;  5D3O A;  4GOG A;  1EWZ A;  2C6W B;  4JF6 A;  1GCE A;  4KG2 A;  4S2N C;  3IXH A;  3VP2 A;  1RCJ A;  2RL3 A;  2WZZ A;  4RVA A;  4S2P A;  3UO9 A;  3W4Q A;  4Q8I A;  1PW8 A;  4O7D A;  5FI7 A;  2ZQC A;  3S1Y A;  4DE3 A;  2V1Z A;  5EUA A;  4U0X A;  5GLC A;  2HDU A;  4DE0 A;  3CJM A;  2WUQ A;  3C7U A;  3MKF A;  4FD8 A;  4JBF A;  3ISG A;  5FQQ A;  2QZ6 A;  2X01 A;  3WRT A;  2PU2 A;  3PBT A;  3SS3 A;  2Y2P A;  1LLB A;  2V2F F;  1K57 A;  4KZ3 A;  4P0M A;  5HL1 A;  3MZD A;  3ZG5 A;  1CEF A;  4N9L A;  1BLS A;  3N7W A;  1IYS A;  1K57 C;  1ONH A;  3OCN A;  1YLY A;  2XF3 A;  4JXW A;  3C4O A;  1M6K A;  5CER A;  1FSY A;  3BEB A;  1KE3 A;  5F1G A;  5A90 A;  1JWP A;  3WS2 A;  3O86 A;  5CGW A;  1LL9 A;  1NXY A;  2ZD8 A;  4OLG A;  3ZDJ A;  3Q7Z A;  2JCH A;  1C3B A;  2P74 A;  3VSL A;  5JYP A;  2FFF B;  5BOH A;  4UA6 A;  2HDS A;  3FKV A;  1KVM A;  5FSR A;  4BD0 A;  4EWF A;  1TEM A;  4DE2 A;  2ZC5 B;  2Y4A A;  5FI2 A;  3N6I A;  1NZU A;  3GV9 A;  3HUN A;  4WM9 A;  2WGW A;  3C4P A;  5GHZ A;  4E6X A;  5CEB A;  5KSC A;  3WS1 A;  5HAP A;  3HRE A;  3OPP A;  1GA9 A;  3HLG A;  4R0Q A;  4XUZ A;  2XGN A;  1G68 A;  4KQR A;  4XUX A;  3V5M A;  3OZH A;  3EQU A;  3IXG A;  2WAE A;  2OSU A;  4BLM A;  1OME A;  3IQA A;  1RGZ A;  3Q07 A;  3BM6 A;  3G2Y A;  1ALQ A;  4RA7 A;  1LI9 A;  1W7F A;  4N92 A;  1XPB A;  3PBO A;  3Q7V A;  1BZA A;  5CHU A;  2IWB A;  3VOZ A;  2Q9M A;  1S6R A;  3Q81 A;  4KQQ A;  3SH9 A;  4N9K A;  3IWO A;  1K38 A;  4Y7P A;  1PIO A;  4OPY A;  5CTM A;  4GNU A;  1ZG4 A;  1IYP A;  4EBP A;  1XGI A;  3IWQ A;  2IWD A;  2ZLY A;  1JWZ A;  5TFQ A;  1K56 A;  3RXW A;  1DJB A;  5A93 A;  2P9V B;  1ES3 A;  4ZJ1 A;  3ZNT A;  4UA7 A;  3P09 A;  4LEN A;  1JVJ A;  3HLD A;  3N8S A;  4OKP A;  1EI5 A;  3O87 A;  2Y2J A;  5E2H A;  3IXB A;  1K4F A;  5GL9 A;  4X55 A;  1O07 A;  1ONG A;  1W5D A;  2PU4 A;  2Y2M A;  1FCM A;  2P9V A;  3UPO A;  1ERQ A;  1BTL A;  4M3K A;  5DF7 A;  3V3S A;  3NI9 A;  3M6B A;  4EBL A;  3BFG A;  2EFX A;  3P98 A;  4HBT A;  1ZKJ A;  1NY0 A;  2XD1 A;  4ID4 A;  4LV3 A;  1GHI A;  4WZ4 A;  3HLW A;  4X69 A;  2OV5 A;  3TSG A;  3VP4 A;  2ZMA A;  5GLB A;  4C3Q A;  2DCF A;  5CGS A;  4D2O A;  3GTC A;  1FSW A;  1ERM A;  1L0F A;  3N8R A;  3HLC A;  4GB7 A;  4LV2 A;  2V20 A;  3VOY A;  3ZGA B;  4MNR A;  4LV0 A;  2R9W A;  3SOI A;  2ZJ9 A;  5M18 A;  2ZM8 A;  4C75 A;  4E3N A;  2Y2I A;  4UHU A;  5CRF A;  5HAI A;  4HBU A;  5I94 A;  2J9O A;  1H5X A;  2WK0 A;  4WBG A;  3IH9 A;  3M6H A;  2XD5 A;  4K91 A;  3SH8 A;  4KZ9 A;  4OOL A;  5FAT A;  2QPN A;  4WMC A;  3G2Z A;  3PBQ A;  3HUO A;  4OPQ A;  1MWR A;  4KZ7 A;  2EXA A;  3DWZ A;  4IVK A;  3HUM A;  3HLB A;  4QY6 A;  1LL5 A;  1L0E A;  1TVF A;  5TGF A;  3MFD A;  2I72 A;  2FFY A;  4FH4 A;  4PM7 A;  3ITB A;  3S22 A;  1E3U D;  4MBK A;  5DTK A;  4LCM A;  3G4P A;  2XH9 A;  4BL3 A;  3MBZ A;  4F94 A;  5HAQ A;  1E25 A;  1ESI A;  2HP6 A;  1S0W A;  1YLZ A;  4DE1 A;  4GDB A;  4OOM A;  4X53 A;  4YIN A;  5GHX A;  5E43 A;  2EX6 A;  4E3M A;  2B5R A;  4R23 A;  4HES A;  3FZC A;  1U60 A;  1KE4 A;  3DW0 A;  3IT9 A;  3G31 A;  1GHP A;  3HLF A;  2Y2N A;  3RXX A;  3UE3 A;  4JF5 A;  5F82 A;  4BQM A;  1Z6F A;  2OLU A;  4PM5 A;  5E2E A;  1BLC A;  4OON A;  2PBY A;  4OPZ A;  4E3I A;  3PTE A;  2HDQ A;  3OPL A;  2XLN A;  1XA7 A;  4OQ0 A;  1LI0 A;  3ZNY A;  4BJP A;  3RJU A;  1TDG A;  2J7V A;  1YT4 A;  4OQG A;  1IYO A;  4OOY A;  1RP5 A;  1G6A A;  1I5Q A;  4S2M A;  3VSK A;  1WE4 A;  1ESU A;  4C6Y A;  3S4X A;  1ZC2 A;  1CK3 A;  1GHM A;  2WGV A;  2WGW B;  3MZE A;  2Y2Q A;  3OCL A;  4OP5 A;  2EX2 A;  5EVI A;  3SS4 A;  2Q9N A;  3IF6 A;  2ZM2 A;  1NJ4 A;  2RCX A;  3AGF A;  1PYY A;  3AGD A;  3VFF A;  3WS5 A;  1FR6 A;  4UA9 A;  5EVI C;  4ZJ3 A;  5JYO A;  1KDS A;  3EQV A;  3IF6 C;  4JXS A;  5EPH A;  5FAO A;  4DXC A;  1YQS A;  1IEL A;  5EVI D;  3N8L A;  4E3J A;  2BLS A;  4K0W A;  1PZO A;  1KGG A;  4QY5 A;  4B4X A;  1SDE A;  3CG5 A;  3Q7V B;  1ES5 A;  5CED A;  1ES2 A;  2Y2G A;  3QNC A;  2WYX A;  2EXB A;  4PM6 A;  2HP5 A;  4Y0U A;  1FCN A;  2XEP A;  5U47 A;  1HTZ A;  3FYZ A;  1Y54 A;  4S2K A;  5FA7 A;  5DF9 A;  4FCF A;  1XGJ A;  4JXG A;  4IBX A;  3MXR A;  4QD4 A;  3UE0 A;  3GVB A;  3Q82 A;  3BFC A;  4IED A;  5F1F A;  4PPR A;  5M19 A;  1YLJ A;  1DY6 A;  4MLL A;  3G34 A;  2J8Y A;  4P85 A;  1O7E A;  3Q1F A;  4U0T A;  4ZBE A;  4MBH A;  4S2O A;  3LY4 A;  1YM1 A;  3PBS A;  2XK1 A;  3BLS A;  1FOF A;  4CPK A;  3WRZ A;  4KZ5 A;  2XDM A;  3BFF A;  1KGE A;  3G30 A;  1K56 D;  5DVA A;  5AQ9 A;  3PBN A;  2XFS A;  5HAR A; 
#chains in the Genus database with same CATH topology
 1ERO A;  3NOT C;  3P7N A;  5F6A A;  4NXF A;  5IHV A;  2QJ5 A;  4NEE D;  4RX3 A;  3NHQ A;  1M40 A;  4S2L A;  4GD8 A;  4PKY A;  5G18 A;  4Y13 A;  1YMS A;  3VP3 A;  1K25 A;  4HJ4 A;  5CXW A;  2ZC3 B;  3LEQ A;  1BUE A;  4XXR A;  1NRF A;  3BY9 A;  2IWC A;  4WZ5 A;  3A3F A;  1FR1 A;  1L2S A;  4I3I A;  2OWJ A;  2Z6D A;  4QU3 A;  4K08 A;  3ZFZ A;  5G4Z A;  5CHM A;  4QB8 A;  5G4Y A;  3U4L P;  4L9G A;  2DNS A;  3T1X A;  3MSH A;  2Y2O A;  1MBL A;  3BYD A;  1I2S A;  1ZTU A;  2QJ7 A;  5E2G A;  4HJ3 A;  2E8J A;  4NG2 A;  1NZO A;  4KQD A;  4RX2 A;  1MWU A;  1SCW A;  4E3K A;  2PAV P;  2VZW A;  4R4S A;  1VEU A;  2W3G A;  2Y2L A;  3T50 A;  3UB8 A;  4JGR A;  5EVI B;  1UWN X;  4HIA A;  3HVF A;  1T1B A;  3ZG7 B;  3FV7 A;  1K54 A;  2O99 A;  4I39 A;  3UPN A;  5FAQ A;  2HZ5 A;  5AQ7 A;  4N1X A;  4K0X A;  5J8X A;  3O88 A;  2ZL1 A;  1TDL A;  2QMI A;  3B3X A;  1YSQ A;  4Y3I A;  4CJN A;  2A3U A;  3UN7 A;  4FSF A;  1MXO A;  2JE5 A;  4X1M A;  1AXB A;  3C5A A;  2OWH A;  3B47 A;  2WGI A;  3G35 A;  3LEZ A;  1PWC A;  4X56 A;  2ZQD A;  1DJA A;  3JPU A;  4R1G A;  5DTT A;  3A3J A;  3FWL A;  2GDN A;  2ZMF A;  2VV7 A;  5CGX A;  1MY8 A;  3V67 A;  2VEA A;  4WEK A;  2DRW A;  4MDZ A;  1H8Z A;  2EFU A;  1IEM A;  3BLM A;  4WUJ A;  3UB7 A;  4CLC B;  2IA2 A;  1CI8 A;  3QP4 A;  4GZB A;  2QWS A;  2Z2L B;  3ZVW A;  4ZAM A;  5CHJ A;  4ME4 A;  3WS4 A;  1YMX A;  4NK3 A;  5EOO A;  2OOL A;  1Z09 A;  1NWZ A;  4P6B A;  2ZQ9 A;  4PMA A;  1L0G A;  2W1T A;  5L2F A;  3NOU C;  2R9X A;  1KE0 A;  3MKE A;  1LL8 A;  3WS0 A;  5HWT A;  5HX9 A;  3W4P A;  4FH2 A;  5CEC A;  3UE1 A;  1OT6 A;  3CLO A;  1WYC A;  3NBL A;  2A49 A;  3HL9 A;  3LI8 A;  4HNB A;  4N1H A;  1KVL A;  3KYQ A;  5D3O A;  4GOG A;  4KG2 A;  3E0Y A;  4S2N C;  5IT5 A;  5DFY A;  2RL3 A;  2WZZ A;  2KOI A;  4B9O A;  3W4Q A;  4Q8I A;  4O7D A;  4F3L A;  2ZQC A;  3LUQ A;  2V1Z A;  4U0X A;  4II7 A;  4JBF A;  5FQQ A;  2QZ6 A;  2PU2 A;  5HL1 A;  2VK3 A;  1CEF A;  1BLS A;  3N7W A;  1IYS A;  3T1Q B;  3OCN A;  1FSY A;  1NRJ A;  5F1G A;  2V0W A;  1JWP A;  5CGW A;  4H6J B;  3ZDJ A;  1XFN A;  5JYP A;  5BOH A;  3LIC A;  2A2L A;  4BD0 A;  4EWF A;  3R4K A;  1Y4O A;  2W1R A;  5FI2 A;  4E6X A;  3HUN A;  4WM9 A;  3C4P A;  5GHZ A;  3WS1 A;  3OPP A;  5HZH A;  3IXG A;  3BQA A;  3IQA A;  3RTY A;  3BM6 A;  3G2Y A;  1ALQ A;  4RA7 A;  5CHU A;  3VOZ A;  2Q9M A;  4KQQ A;  2P04 A;  3SH9 A;  4N9K A;  3IWO A;  3LR3 A;  2UV0 E;  3NOP C;  4OPY A;  1CJF A;  3IWQ A;  2ZLY A;  1JWZ A;  5A93 A;  3MMH A;  4R6L A;  4UA7 A;  3P09 A;  1JVJ A;  3N8S A;  4OKP A;  2K31 A;  4UEY A;  2Y2J A;  5E2H A;  3E98 A;  1W5D A;  1FCM A;  4BBU A;  3H82 B;  5DF7 A;  5HSQ A;  3M6B A;  4Q0J A;  3BFG A;  2EFX A;  1ZKJ A;  4WZ4 A;  2OV5 A;  4WL9 A;  3F1P A;  4Y2F A;  1L0F A;  3N8R A;  3KSF A;  1CQA A;  4LV0 A;  2ZJ9 A;  2D01 A;  4MMN A;  4C75 A;  4E3N A;  1N9O A;  5HAI A;  2J9O A;  5FEG A;  2WK0 A;  4K91 A;  3SH8 A;  1MC0 A;  3PBQ A;  2KDK A;  3HUM A;  3HLB A;  1S4R A;  2I72 A;  4FH4 A;  5DJU A;  3ITB A;  1X0O A;  3S22 A;  4O01 A;  4MBK A;  4BL3 A;  1E25 A;  1ESI A;  2HP6 A;  1YLZ A;  3TW8 A;  4DE1 A;  3LID A;  5GHX A;  5E43 A;  2EX6 A;  4HES A;  1KE4 A;  3DW0 A;  3G31 A;  3UE3 A;  2INW A;  4JF5 A;  5F82 A;  1Z6F A;  3QP1 A;  2OLU A;  1BLC A;  5TBM B;  2PBY A;  4E3I A;  2Z6C A;  2HDQ A;  2O0Y A;  2XLN A;  4OQ0 A;  3VSK A;  1ESU A;  3S4X A;  3SS4 A;  4OP5 A;  2Y2Q A;  2EX2 A;  3IF6 A;  3AGF A;  5EVI C;  4EXO A;  4EU0 A;  4LFU A;  5EPH A;  5FAO A;  5EVI D;  4BBV A;  3TE8 A;  3KSG A;  3CG5 A;  3QNC A;  1FIL A;  3C30 A;  3LGO A;  2EXB A;  2HP5 A;  1HTZ A;  3FYZ A;  3FG8 A;  5DF9 A;  2JKR M;  1H0M A;  4HP9 A;  5F5Y A;  4Y5F A;  4ZBE A;  2J3W A;  3PBS A;  2XK1 A;  4DJ3 A;  4CPK A;  3KYZ A;  3MR0 A;  3WRZ A;  1P97 A;  3IBR A;  3EGD C;  3PBN A;  2XFS A;  2CMN A;  4RYE A;  1S1Y A;  1LHY A;  3G32 A;  4S2I A;  5KSH A;  1IKI A;  4G3W A;  4OLD A;  4LV1 A;  3LR5 A;  4LPZ A;  3NIA A;  1GA0 A;  2VX8 A;  1XFQ A;  3QNB A;  3TG9 A;  4HH2 A;  3H9W A;  3T4J A;  4CLC C;  5I5L A;  5DFX A;  2FZ0 A;  4LCL A;  2JKT M;  4ZTK A;  2GNX A;  4DDS A;  3GSG A;  3DTM A;  3OPH A;  4ZDX A;  2Y55 A;  2ZC4 B;  5FAP A;  1N4O A;  3O3V A;  2VGJ A;  2WAD A;  1OTA A;  1IFQ A;  2XFT A;  2D02 A;  4KZ4 A;  4H8R A;  2JHE A;  5K5B A;  3ZG0 A;  3SH7 A;  3VE3 A;  4MN5 A;  2W3E A;  5KZH A;  2M7U A;  5M1A A;  1JTD A;  3MQ0 A;  4KZB A;  4PM9 A;  1YAX A;  3JYI A;  4CLC E;  4HEF A;  1K6R A;  4GD6 A;  4RQ9 A;  2JN7 A;  3T4K A;  3QP6 A;  2PD8 A;  2EA9 A;  3LO7 A;  4GHI A;  2HPB A;  1SKF A;  2GJ3 A;  3BY8 A;  1SHV A;  1VM1 A;  3CAX A;  2WZX A;  3NDG A;  5EE8 A;  3PXP A;  1XA1 A;  1PWG A;  4PAU A;  4B88 A;  3M2K A;  4QJG A;  3IS2 B;  3N4I A;  1FCO A;  5GLA A;  1MWT A;  3BFE A;  2WAF A;  5LBR A;  1DP9 A;  1YLW A;  3L9K A;  3PAE A;  4OPR A;  3T1S A;  1CEG A;  3MXS A;  1XKZ A;  2CC1 A;  1BSG A;  2G2W A;  3F1O B;  4JKT A;  3QP5 A;  3TOI A;  2EX9 A;  3OPR A;  1TS8 A;  3IXD A;  2P08 A;  4LRZ E;  3IHB A;  4OP8 A;  2JBF A;  2LB5 A;  1DJC A;  1K55 C;  3UNW A;  5EM0 A;  1MWS A;  5AQA A;  3EWK A;  3GQZ A;  4E3L A;  3WWX A;  3SW1 A;  5HD3 A;  4GS9 A;  3D9Y A;  1DP8 A;  3DWK A;  2ZC6 B;  2WKI A;  3VMA A;  1YLP A;  3NC8 A;  1TF1 A;  5J4E A;  1LSV A;  4XT2 A;  1WYB A;  1IYQ A;  4EBN A;  1FQG A;  5HWV A;  4Y15 A;  2E8I A;  2BAS A;  4E6W A;  5GHY A;  3A0S A;  3QHY A;  2JC7 A;  3P01 A;  3SS5 A;  1ES4 A;  3RH8 B;  2O9C A;  1SDN A;  4PM8 A;  4X1L A;  4M4X A;  3LIB A;  3W4O A;  3ZHH A;  1VEU B;  4EV4 A;  4QHC A;  1VET B;  1CI9 A;  5CTN A;  1PNE A;  4DXB A;  3PBR A;  3A3E A;  1PI4 A;  4X68 A;  3GRJ A;  1S4S A;  3KX0 X;  3EGX C;  3F1N A;  3NCK A;  1ACF A;  1ODV A;  2C6W B;  4JF6 A;  4ESP A;  1GCE A;  1VET A;  3A0V A;  1RCJ A;  4IJG A;  5FI7 A;  4DE3 A;  2ZL1 B;  5EUA A;  2OAP 1;  2W27 A;  3C7U A;  5MC7 A;  4FD8 A;  3ISG A;  4EEP A;  3PBT A;  2Y2P A;  1LLB A;  2V2F F;  4EET B;  3ZG5 A;  1WA9 A;  2O9A A;  3K3D A;  1K57 C;  4JXW A;  3VE4 A;  1NXY A;  4OLG A;  3Q7Z A;  1C3B A;  3VSL A;  2HDS A;  3FKV A;  1KVM A;  5FSR A;  1OTD A;  1MZU A;  3N6I A;  1NZU A;  1VB6 A;  3EEH A;  2WGW A;  5CEB A;  3K2N A;  2WKR A;  3E4P A;  4MN7 A;  1G68 A;  1GSX A;  4EEU A;  2WAE A;  4EW7 A;  3Q07 A;  4EES A;  3LIE A;  4N92 A;  1XPB A;  3T4O A;  3HJK A;  3Q81 A;  4Y7P A;  3MFX A;  3BW6 A;  4EBP A;  5FEF A;  1XGI A;  5TFQ A;  3RXW A;  2R78 A;  1EI5 A;  3O87 A;  3BJN A;  1K4F A;  5GL9 A;  1O07 A;  2PU4 A;  2Y2M A;  1V9Y A;  3LR4 A;  1ERQ A;  1BTL A;  2W1T B;  3V3S A;  1GSV A;  2JKF A;  3K3C A;  2WKQ A;  3MS6 A;  4X69 A;  1NY0 A;  1GHI A;  2ZMA A;  4C3Q A;  2DCF A;  5CGS A;  4D2O A;  1K0K A;  1ERM A;  4LV2 A;  3TRC A;  4MNR A;  2HGV A;  5M18 A;  2XSS A;  5CRF A;  1H5X A;  4WBG A;  3R7W A;  3M6H A;  2XD5 A;  4KZ9 A;  2QPN A;  2FH5 A;  1F2K A;  1MWR A;  4KUK A;  1W63 Q;  5TGF A;  4F3L B;  2FFY A;  3MXQ A;  3UMD A;  1Y28 A;  4F94 A;  4I5S A;  2B5R A;  4EER A;  2ZMV A;  1J3W A;  4ARZ A;  1S67 L;  4PM5 A;  2YKF A;  5E2E A;  3NUL A;  3PHY A;  3OPL A;  5HDD A;  4EQ1 A;  1XA7 A;  1LI0 A;  3ZNY A;  2J7V A;  1G6A A;  4IUH A;  2OAQ 1;  1WE4 A;  4C6Y A;  1ZC2 A;  2M1C A;  1CK3 A;  2PR6 A;  3MZE A;  3OCL A;  2Q9N A;  2L1M A;  3VFF A;  1NJ4 A;  1PYY A;  1FR6 A;  5JYO A;  1KDS A;  4JXS A;  4DXC A;  4K0W A;  4HH3 A;  4PM6 A;  4Y0U A;  5U47 A;  1DP6 A;  4ZRR A;  4S2K A;  5FA7 A;  3S7P A;  1XGJ A;  4HY8 A;  2L4R A;  3MXR A;  3GVB A;  3Q82 A;  3FPV A;  4PPR A;  1YLJ A;  1DY6 A;  4MLL A;  5M19 A;  1KOU A;  3IX3 A;  4P85 A;  4R3A A;  4S2O A;  3BLS A;  3LIA A;  1FOF A;  2W3H A;  2JKG A;  4AFI A;  3BFF A;  5C5K A;  2QKP A;  3CMZ A;  4E04 A;  4JF4 A;  3F1P B;  1JWV A;  5EEC A;  4OQI A;  2W3D A;  1YLT A;  2PD7 A;  4PKY G;  5FDH A;  4DN0 A;  4IUK A;  3UPP A;  3A3I A;  4UQI S;  4YFM A;  4CQH A;  2V1B A;  3BQ8 A;  3IHA A;  5HDS A;  4HP4 A;  4WZ5 C;  1PWD A;  4WMC D;  2ZOH A;  3T4S A;  2WKE A;  2H10 A;  2VV6 A;  5FQM A;  1LSW A;  2H0T A;  3CHW P;  3IBJ A;  4G3V A;  3ZG8 B;  3E2K A;  4NXG A;  3CWF A;  4GKU A;  4GCZ A;  2EWW A;  4Z9Q A;  1FIK A;  4DJ2 A;  4EUV A;  3ZCZ A;  4WF0 A;  1W79 A;  1XX2 A;  4DMZ A;  2X71 A;  1VQQ A;  4HI4 A;  2MJ6 A;  3GR2 A;  3IF6 B;  2GX5 A;  1BLH A;  5E2F A;  2OLV A;  1KDW A;  2X02 A;  1K54 C;  2P7J A;  2Y8H A;  3JVU A;  5FQK A;  3VFH A;  3GMW A;  3C7V A;  3NY4 A;  4BMW A;  3IWI A;  1QME A;  1W8Y A;  5DF8 A;  2KLI A;  1XJ6 A;  4YWZ A;  4E3O A;  4KZA A;  3B42 A;  3CIT A;  5EVE A;  4Q0H A;  1NYM A;  3IX8 A;  5FI6 A;  4MBF A;  2YKH A;  1LT0 A;  4LRY C;  3ZG9 B;  4B93 A;  4UQI M;  1HD8 A;  2EWV A;  3IF5 A;  5FQ9 A;  3ITA A;  1HVB A;  1N9L A;  1MKI A;  3W8K A;  4UAA A;  1BYW A;  1H8Y A;  1QMF A;  2PYP A;  2VJW A;  1HZO A;  5L09 A;  4R4R A;  5HD5 A;  1N9N A;  1OTE A;  2I9V A;  3NJA A;  5HPI A;  1I2W A;  5FQJ A;  3LYX A;  4IBR A;  2ZQ7 A;  4YNR A;  1OPX A;  2Y91 A;  3DAV A;  2XR0 A;  2H5S A;  2J9P A;  4IVI A;  1PW1 A;  5HFO A;  3D72 A;  2XA7 S;  4Y0T A;  2W0N A;  4L0L A;  4CLC D;  2VGK A;  2A24 A;  5F68 A;  3V39 A;  5IU1 A;  4A5R A;  1PZP A;  3LIF A;  3T4L A;  1BUL A;  2HP9 A;  1ZG6 A;  3VOL A;  5DTS A;  1XJ4 A;  5AQB A;  2J3T C;  4KZ8 A;  1IOU A;  3LCE A;  4U3T A;  2J3T D;  4KUO A;  4LGW A;  2WKH A;  1W63 M;  3UDX A;  3I7J A;  3S7Q A;  1Q2P A;  4DF6 A;  4DRT A;  2AVX A;  1MPL A;  2Y2H A;  4OQH A;  4S2N A;  1P9R A;  4GHI B;  2EX8 A;  1EWZ A;  1V9Z A;  3D3O A;  4RVA A;  4S2P A;  3UO9 A;  3KO6 A;  3QP2 A;  3MQO A;  2HV1 A;  1TS7 A;  4DE0 A;  3CJM A;  2WUQ A;  2JKR I;  3MKF A;  2X01 A;  4MN6 A;  3DBA A;  3SS3 A;  3UB9 A;  4KZ3 A;  4N9L A;  3LR0 A;  4R70 A;  1ONH A;  3KYE A;  5TJJ A;  3BEB A;  2ZD8 A;  2JCH A;  1T1A A;  4HOI A;  2FFF B;  2V8F A;  4FOF A;  2ZC5 B;  1UWP X;  3GV9 A;  5HAP A;  3HRE A;  4XUZ A;  4R0Q A;  2XGN A;  3H7W A;  4I3A A;  3CPT B;  4XUX A;  3OZH A;  2XA7 M;  3ZQ5 A;  2VLG A;  4BLM A;  1RGZ A;  1TS6 A;  2HJE A;  3Q7V A;  4GS9 B;  4IHQ A;  1S6R A;  3QP8 A;  2LB9 A;  3CPT A;  1OTI A;  4JGP A;  5CTM A;  4GNU A;  1ZG4 A;  2JKT I;  2IWD A;  5J7E A;  2P9V B;  4ZJ1 A;  3ZNT A;  4LEN A;  4XT2 B;  3HLD A;  3C8C A;  1F9I A;  2KX6 A;  1P9W A;  2VV8 A;  5AVF A;  3IXB A;  4X55 A;  4FTX A;  2P9V A;  2NUT C;  2K2N A;  5A8B A;  5AVE A;  2V1A A;  1SKO A;  3NI9 A;  4HHD A;  3ICY A;  3TSG A;  2XD1 A;  2K7S A;  4ID4 A;  3GTC A;  1FSW A;  4GB7 A;  2V20 A;  3VOY A;  5AJG A;  2R9W A;  3SOI A;  2B95 A;  2Y2I A;  4UHU A;  1T18 A;  5HDC A;  4OOL A;  3F1N B;  4WMC A;  3G2Z A;  3DTI A;  2EXA A;  3MQQ A;  1TVF A;  3U2A A;  4QPR A;  4G3K A;  3O5Y A;  3DTK A;  1E3U D;  5DTK A;  4LCM A;  3G4P A;  5HAQ A;  3PYP A;  4GDB A;  4E3M A;  4R23 A;  3FZC A;  3IT9 A;  2Y2N A;  3A0R A;  4OPZ A;  2L0W A;  1OTB A;  1S66 L;  1YSP A;  4BJP A;  5DKK A;  3RJU A;  1TDG A;  1G6O A;  1IYO A;  1I5Q A;  4S2M A;  4Z1W A;  2M7V A;  3E4O A;  2WGW B;  4P6Z S;  5EVI A;  2ZM2 A;  3WS5 A;  2O9B A;  4ZJ3 A;  3IF6 C;  3EQV A;  5HL6 A;  2B02 A;  1IEL A;  3N8L A;  1PZO A;  2VGL S;  4O0P A;  1ES5 A;  5CED A;  4D60 A;  2Y2G A;  3NEC A;  5EV0 A;  2WYX A;  5L10 A;  2QHK A;  1FCN A;  3ULF A;  4FCF A;  4JXG A;  4QD4 A;  3S7N A;  3ZYT A;  5F1F A;  2J8Y A;  1O7E A;  5L8M A;  4MBH A;  3LY4 A;  1YM1 A;  2WKP A;  1NLZ A;  3CUE C;  4KZ5 A;  2XDM A;  1KGE A;  3G30 A;  1K56 D;  3UME A;  2ZBB A;  4WEJ A;  1A0K A;  1HLU P;  5HAR A;  4JGO A;  4KQO A;  3VP1 A;  1JNU A;  2PBD P;  3R7W B;  1XJ2 A;  1W8Q A;  3FPW A;  4I38 A;  4HJ6 A;  1T19 A;  4R3J A;  3RFB A;  2J80 A;  4CLC A;  2XRN A;  5FQI A;  3LY3 A;  1J9M A;  5KMW A;  3GDI A;  3T4Q A;  1L3L A;  4BEN A;  1EW0 A;  1L0D A;  4ETZ A;  4WN5 A;  3EOI A;  4DDY A;  2B18 A;  4L9E A;  5EM1 A;  4OH0 A;  2PHY A;  4P6Z M;  4X6T A;  1VHM A;  5EVL A;  1D7E A;  5HWW A;  4JPM A;  3FKW A;  4ARZ B;  3LFV A;  1K4E A;  2Y79 A;  3HBR A;  4S2J A;  3BFD A;  4QWO A;  4Q0I A;  2VGL M;  4WYY A;  3A3D A;  5EOE A;  4R38 A;  2XRO A;  3V50 A;  1H3Q A;  1RGY A;  3UB6 A;  2HF6 A;  4KZ6 A;  1PFL A;  5F83 A;  4O8G A;  2H28 A;  2Q0O A;  2Y59 A;  1G28 A;  4BWI A;  1TS0 A;  4NXE A;  4JLF A;  3C2W A;  5EFW A;  3GEC A;  3V3R A;  4EQI A;  4NKP A;  3VP0 A;  5FAS A;  3OC2 A;  2ZQA A;  2PDR A;  4HQA A;  4GW9 A;  4P87 A;  2Z2M B;  3PAG A;  4KG6 A;  2BG1 A;  2UWX A;  1G5U A;  1KGF A;  3W2Z A;  2V8C A;  3UDF A;  5TR7 A;  4KEN B;  3BEC A;  4BD1 A;  2VA0 A;  4MEZ A;  3OBF A;  1JTG A;  2XQZ A;  3CI6 A;  3UY6 A;  4H6J A;  1YPR A;  1PI5 A;  1STZ A;  3MF0 A;  1H8M A;  2PRF A;  3D4F A;  3NDE A;  1TD5 A;  4ZJ2 A;  1K55 A;  3S7O A;  5F69 A;  3ZVT A;  4JXV A;  3OOV A;  4KG5 A;  3HJI A;  3UDI A;  2DMW A;  1E4D A;  4NET A;  2ZQ8 A;  1BLP A;  3MZF A;  4GN2 A;  1PRQ A;  4OVD A;  4Y0O A;  1D06 A;  3KSH A;  1XXM A;  4Y17 A;  3EEA A;  4WEL A;  3IH8 A;  4DKI A;  5HW3 A;  3CZD A;  1UGU A;  2Y2K A;  5GLD A;  4GDN A;  5DKL A;  2C5W B;  4B4Z A;  4BL2 A;  3M2J A;  2HDR A;  1K6S A;  4FUW A;  1NYY A;  3E2L A;  4EUZ A;  2VKS A;  3H82 A;  3AGE A;  2ZM0 A;  5FL3 A;  1N9B A;  3HLE A;  5A91 A;  1XP4 A;  1OJ5 A;  1SZV A;  2ZC7 A;  5DJT A;  1BT5 A;  3BRM A;  2G2U A;  1E3U A;  2BTF P;  1IKG A;  1Q2Q A;  4R3B A;  4B4X A;  3HCY A;  4LRX C;  5A92 A;  2H0Y A;  3IXH A;  3VP2 A;  1CF0 A;  1PW8 A;  3S1Y A;  5GLC A;  2HDU A;  1LSX A;  4GLQ A;  3PR6 A;  3WRT A;  1D1J A;  1K57 A;  4P0M A;  3MZD A;  3E4Q A;  1YLY A;  3UE6 A;  5TBM A;  2XF3 A;  3C4O A;  1M6K A;  5CER A;  1KE3 A;  5A90 A;  3WS2 A;  3O86 A;  1LL9 A;  2P74 A;  3UB5 P;  4UA6 A;  2HJ9 C;  1TEM A;  4DE2 A;  2Y4A A;  3FC7 A;  3BWL A;  1F5M A;  5KSC A;  3T12 B;  1GA9 A;  2G7U A;  3HLG A;  1P0Z A;  4KQR A;  1F98 A;  3V5M A;  3EQU A;  2OSU A;  1ZHH B;  1OME A;  4L9F A;  2ACG A;  1LI9 A;  1W7F A;  3PBO A;  1BZA A;  2IWB A;  2V9A A;  4PHT A;  4WLA A;  3G6O A;  1K38 A;  1PIO A;  2W3F A;  4NXB A;  1IYP A;  3CUE A;  1K56 A;  1DJB A;  1ES3 A;  3T4T A;  4JGQ A;  5L07 A;  2A24 B;  1ONG A;  3DTE A;  3UPO A;  3C38 A;  5IS1 A;  2PR5 A;  4M3K A;  4EBL A;  1OT9 A;  5FDS A;  3P98 A;  4HBT A;  4LV3 A;  3VP4 A;  3HLW A;  1T1C A;  5GLB A;  3KSI A;  4MCW A;  3HLC A;  5J3W A;  4BBT A;  3ZGA B;  3LI9 A;  2ZM8 A;  4X25 A;  4HBU A;  5CX7 A;  4ETX A;  3IH9 A;  2QYB A;  5FAT A;  1XJ3 A;  3HUO A;  4OPQ A;  4KZ7 A;  3DWZ A;  1AWI A;  4IVK A;  4QY6 A;  1LL5 A;  1L0E A;  3MFD A;  4PM7 A;  3TJZ C;  5KIZ A;  3SZT A;  2PT7 A;  2XH9 A;  3MBZ A;  1S0W A;  1OJG A;  4OOM A;  4X53 A;  4YIN A;  1YKD A;  1U60 A;  2PYR A;  2ZOI A;  4YOF A;  3RXX A;  1GHP A;  3HLF A;  1GSW A;  1NLY A;  4BQM A;  3T1R A;  1DRM A;  4OON A;  3PTE A;  4I3J A;  1YT4 A;  4OQG A;  4OOY A;  1RP5 A;  1GHM A;  2WGV A;  1MKM A;  2V0U A;  2RCX A;  3AGD A;  3H7W B;  4UA9 A;  3JVV A;  3IX4 A;  2NUP C;  1YQS A;  4E3J A;  2BLS A;  1KGG A;  4QY5 A;  1SDE A;  3OLO A;  3Q7V B;  1ES2 A;  3B33 A;  2XEP A;  1Y54 A;  3IS2 A;  1S1Z A;  4GJ4 A;  3VV4 A;  4IBX A;  5HPF A;  3L7H A;  3UE0 A;  2GZA A;  3BFC A;  4IED A;  3G34 A;  3MJQ A;  3Q1F A;  4U0T A;  1SKO B;  4LLO B;  3F1O A;  5DVA A;  5AQ9 A;  5I94 A; 
#chains in the Genus database with same CATH homology
 4WEJ A;  3CMZ A;  1ERO A;  4JF4 A;  4RYE A;  1JWV A;  1LHY A;  4KQO A;  5EEC A;  5IHV A;  4OQI A;  3VP1 A;  4RX3 A;  3G32 A;  4S2I A;  5KSH A;  1IKI A;  1M40 A;  4OLD A;  4S2L A;  4LV1 A;  1YLT A;  3NIA A;  1GA0 A;  1W8Q A;  4GD8 A;  5G18 A;  3QNB A;  4R3J A;  5FDH A;  3TG9 A;  1YMS A;  3VP3 A;  5FQI A;  3UPP A;  3A3I A;  1K25 A;  3LY3 A;  1J9M A;  5CXW A;  5KMW A;  4YFM A;  2ZC3 B;  1BUE A;  4LCL A;  4XXR A;  1NRF A;  4BEN A;  4ZTK A;  2IWC A;  4WZ5 A;  3A3F A;  1L0D A;  1FR1 A;  3IHA A;  1L2S A;  4DDS A;  3GSG A;  3DTM A;  4DDY A;  3OPH A;  4WZ5 C;  4QU3 A;  4ZDX A;  2Y55 A;  1PWD A;  3ZFZ A;  2ZC4 B;  4WMC D;  5FAP A;  4OH0 A;  5CHM A;  2WKE A;  4QB8 A;  1N4O A;  3O3V A;  2VGJ A;  4X6T A;  5EVL A;  2WAD A;  2H10 A;  2DNS A;  4JPM A;  5FQM A;  2H0T A;  2XFT A;  3FKW A;  3ZG8 B;  4KZ4 A;  1K4E A;  3HBR A;  4H8R A;  4S2J A;  3E2K A;  3BFD A;  3ZG0 A;  3SH7 A;  2Y2O A;  1MBL A;  3BYD A;  1I2S A;  4GKU A;  4WYY A;  5E2G A;  4Z9Q A;  3A3D A;  5EOE A;  3ZCZ A;  3V50 A;  5KZH A;  1NZO A;  1RGY A;  1W79 A;  1XX2 A;  5M1A A;  4RX2 A;  1JTD A;  1MWU A;  1SCW A;  4E3K A;  2X71 A;  4KZB A;  4PM9 A;  4R4S A;  4KZ6 A;  3JYI A;  1VQQ A;  4HEF A;  5F83 A;  2Y2L A;  5EVI B;  1K6R A;  4GD6 A;  3GR2 A;  2Y59 A;  3HVF A;  3IF6 B;  1BLH A;  5E2F A;  2OLV A;  3ZG7 B;  3FV7 A;  1K54 A;  1KDW A;  2X02 A;  3LO7 A;  2HPB A;  1SKF A;  1K54 C;  1SHV A;  4JLF A;  1VM1 A;  2WZX A;  3UPN A;  5FAQ A;  3NDG A;  5EE8 A;  1XA1 A;  5AQ7 A;  1PWG A;  4N1X A;  5FQK A;  3V3R A;  4EQI A;  4K0X A;  4B88 A;  3M2K A;  3VFH A;  5J8X A;  3O88 A;  4QJG A;  3VP0 A;  1TDL A;  2QMI A;  3GMW A;  3B3X A;  3C7V A;  5FAS A;  3OC2 A;  4CJN A;  2A3U A;  2ZQA A;  3N4I A;  3NY4 A;  3UN7 A;  1FCO A;  5GLA A;  1MWT A;  4FSF A;  3BFE A;  3IWI A;  1QME A;  1MXO A;  1W8Y A;  2JE5 A;  5DF8 A;  2WAF A;  4P87 A;  2Z2M B;  1AXB A;  3PAG A;  3C5A A;  2BG1 A;  4KG6 A;  2UWX A;  1KGF A;  4E3O A;  3G35 A;  2WGI A;  1YLW A;  3LEZ A;  1PWC A;  4KZA A;  3PAE A;  4OPR A;  3UDF A;  1NYM A;  5TR7 A;  4KEN B;  3BEC A;  1CEG A;  4BD1 A;  5FI6 A;  4MEZ A;  3MXS A;  4X56 A;  1XKZ A;  2CC1 A;  4MBF A;  2ZQD A;  1DJA A;  1JTG A;  1BSG A;  2XQZ A;  2G2W A;  3UY6 A;  4JKT A;  3TOI A;  4R1G A;  2EX9 A;  3ZG9 B;  1PI5 A;  3OPR A;  5DTT A;  1HD8 A;  3A3J A;  3IXD A;  3D4F A;  3FWL A;  3IF5 A;  3NDE A;  4ZJ2 A;  3IHB A;  4OP8 A;  5FQ9 A;  3ITA A;  1K55 A;  1HVB A;  2GDN A;  2JBF A;  5CGX A;  1DJC A;  1K55 C;  1MKI A;  3UNW A;  3W8K A;  1H8Y A;  1QMF A;  1MY8 A;  1MWS A;  4JXV A;  4UAA A;  5AQA A;  3ZVT A;  4KG5 A;  3GQZ A;  3UDI A;  1HZO A;  4WEK A;  2DRW A;  4R4R A;  3WWX A;  4E3L A;  1E4D A;  1H8Z A;  2EFU A;  4NET A;  2ZQ8 A;  1BLP A;  1IEM A;  3BLM A;  3MZF A;  4GN2 A;  1I2W A;  1CI8 A;  4GZB A;  4OVD A;  5FQJ A;  4Y0O A;  3DWK A;  2ZC6 B;  2ZQ7 A;  4IBR A;  2WKI A;  2Z2L B;  1XXM A;  3VMA A;  3ZVW A;  1YLP A;  4WEL A;  3IH8 A;  4ZAM A;  4DKI A;  5HW3 A;  2Y91 A;  3CZD A;  2XR0 A;  2H5S A;  3NC8 A;  2Y2K A;  2J9P A;  4IVI A;  1PW1 A;  5CHJ A;  5GLD A;  4GDN A;  3WS4 A;  1YMX A;  4NK3 A;  5HFO A;  2C5W B;  4B4Z A;  4BL2 A;  3M2J A;  5EOO A;  2HDR A;  4Y0T A;  4L0L A;  1WYB A;  1IYQ A;  1K6S A;  4P6B A;  4EBN A;  2ZQ9 A;  1FQG A;  1NYY A;  2VGK A;  4PMA A;  2E8I A;  3E2L A;  4EUZ A;  3V39 A;  4E6W A;  5GHY A;  3QHY A;  1L0G A;  2JC7 A;  1PZP A;  2ZM0 A;  3AGE A;  1BUL A;  3SS5 A;  4A5R A;  1ES4 A;  2HP9 A;  5L2F A;  1SDN A;  4PM8 A;  1ZG6 A;  2R9X A;  1N9B A;  1KE0 A;  3HLE A;  5A91 A;  1XP4 A;  5DTS A;  3MKE A;  5AQB A;  4KZ8 A;  3W4O A;  3WS0 A;  3LCE A;  4U3T A;  5HX9 A;  3ZHH A;  2ZC7 A;  4EV4 A;  4QHC A;  2WKH A;  3W4P A;  1BT5 A;  1CI9 A;  4FH2 A;  3BRM A;  2G2U A;  3UE1 A;  1E3U A;  5CTN A;  5CEC A;  1IKG A;  1Q2Q A;  4R3B A;  4DXB A;  3UDX A;  3I7J A;  3A3E A;  3PBR A;  1Q2P A;  1PI4 A;  4X68 A;  3GRJ A;  1WYC A;  3NBL A;  2A49 A;  4DF6 A;  4DRT A;  1MPL A;  3HL9 A;  2Y2H A;  4N1H A;  1KVL A;  4OQH A;  4S2N A;  5A92 A;  3NCK A;  2H0Y A;  2EX8 A;  5D3O A;  4GOG A;  1EWZ A;  2C6W B;  4JF6 A;  1GCE A;  4KG2 A;  4S2N C;  3IXH A;  3VP2 A;  1RCJ A;  2RL3 A;  2WZZ A;  4RVA A;  4S2P A;  3UO9 A;  3W4Q A;  4Q8I A;  1PW8 A;  4O7D A;  5FI7 A;  2ZQC A;  3S1Y A;  4DE3 A;  2V1Z A;  5EUA A;  4U0X A;  5GLC A;  2HDU A;  4DE0 A;  3CJM A;  2WUQ A;  3C7U A;  3MKF A;  4FD8 A;  4JBF A;  3ISG A;  5FQQ A;  2QZ6 A;  2X01 A;  3WRT A;  2PU2 A;  3PBT A;  3SS3 A;  2Y2P A;  1LLB A;  2V2F F;  1K57 A;  4KZ3 A;  4P0M A;  5HL1 A;  3MZD A;  3ZG5 A;  1CEF A;  4N9L A;  1BLS A;  3N7W A;  1IYS A;  1K57 C;  1ONH A;  3OCN A;  1YLY A;  2XF3 A;  4JXW A;  3C4O A;  1M6K A;  5CER A;  1FSY A;  3BEB A;  1KE3 A;  5F1G A;  5A90 A;  1JWP A;  3WS2 A;  3O86 A;  5CGW A;  1LL9 A;  1NXY A;  2ZD8 A;  4OLG A;  3ZDJ A;  3Q7Z A;  2JCH A;  1C3B A;  2P74 A;  3VSL A;  5JYP A;  2FFF B;  5BOH A;  4UA6 A;  2HDS A;  3FKV A;  1KVM A;  5FSR A;  4BD0 A;  4EWF A;  1TEM A;  4DE2 A;  2ZC5 B;  2Y4A A;  5FI2 A;  3N6I A;  1NZU A;  3GV9 A;  3HUN A;  4WM9 A;  2WGW A;  3C4P A;  5GHZ A;  4E6X A;  5CEB A;  5KSC A;  3WS1 A;  5HAP A;  3HRE A;  3OPP A;  1GA9 A;  3HLG A;  4R0Q A;  4XUZ A;  2XGN A;  1G68 A;  4KQR A;  4XUX A;  3V5M A;  3OZH A;  3EQU A;  3IXG A;  2WAE A;  2OSU A;  4BLM A;  1OME A;  3IQA A;  1RGZ A;  3Q07 A;  3BM6 A;  3G2Y A;  1ALQ A;  4RA7 A;  1LI9 A;  1W7F A;  4N92 A;  1XPB A;  3PBO A;  3Q7V A;  1BZA A;  5CHU A;  2IWB A;  3VOZ A;  2Q9M A;  1S6R A;  3Q81 A;  4KQQ A;  3SH9 A;  4N9K A;  3IWO A;  1K38 A;  4Y7P A;  1PIO A;  4OPY A;  5CTM A;  4GNU A;  1ZG4 A;  1IYP A;  4EBP A;  1XGI A;  3IWQ A;  2IWD A;  2ZLY A;  1JWZ A;  5TFQ A;  1K56 A;  3RXW A;  1DJB A;  5A93 A;  2P9V B;  1ES3 A;  4ZJ1 A;  3ZNT A;  4UA7 A;  3P09 A;  4LEN A;  1JVJ A;  3HLD A;  3N8S A;  4OKP A;  1EI5 A;  3O87 A;  2Y2J A;  5E2H A;  3IXB A;  1K4F A;  5GL9 A;  4X55 A;  1O07 A;  1ONG A;  1W5D A;  2PU4 A;  2Y2M A;  1FCM A;  2P9V A;  3UPO A;  1ERQ A;  1BTL A;  4M3K A;  5DF7 A;  3V3S A;  3NI9 A;  3M6B A;  4EBL A;  3BFG A;  2EFX A;  3P98 A;  4HBT A;  1ZKJ A;  1NY0 A;  2XD1 A;  4ID4 A;  4LV3 A;  1GHI A;  4WZ4 A;  3HLW A;  4X69 A;  2OV5 A;  3TSG A;  3VP4 A;  2ZMA A;  5GLB A;  4C3Q A;  2DCF A;  5CGS A;  4D2O A;  3GTC A;  1FSW A;  1ERM A;  1L0F A;  3N8R A;  3HLC A;  4GB7 A;  4LV2 A;  2V20 A;  3VOY A;  3ZGA B;  4MNR A;  4LV0 A;  2R9W A;  3SOI A;  2ZJ9 A;  5M18 A;  2ZM8 A;  4C75 A;  4E3N A;  2Y2I A;  4UHU A;  5CRF A;  5HAI A;  4HBU A;  5I94 A;  2J9O A;  1H5X A;  2WK0 A;  4WBG A;  3IH9 A;  3M6H A;  2XD5 A;  4K91 A;  3SH8 A;  4KZ9 A;  4OOL A;  5FAT A;  2QPN A;  4WMC A;  3G2Z A;  3PBQ A;  3HUO A;  4OPQ A;  1MWR A;  4KZ7 A;  2EXA A;  3DWZ A;  4IVK A;  3HUM A;  3HLB A;  4QY6 A;  1LL5 A;  1L0E A;  1TVF A;  5TGF A;  3MFD A;  2I72 A;  2FFY A;  4FH4 A;  4PM7 A;  3ITB A;  3S22 A;  1E3U D;  4MBK A;  5DTK A;  4LCM A;  3G4P A;  2XH9 A;  4BL3 A;  3MBZ A;  4F94 A;  5HAQ A;  1E25 A;  1ESI A;  2HP6 A;  1S0W A;  1YLZ A;  4DE1 A;  4GDB A;  4OOM A;  4X53 A;  4YIN A;  5GHX A;  5E43 A;  2EX6 A;  4E3M A;  2B5R A;  4R23 A;  4HES A;  3FZC A;  1U60 A;  1KE4 A;  3DW0 A;  3IT9 A;  3G31 A;  1GHP A;  3HLF A;  2Y2N A;  3RXX A;  3UE3 A;  4JF5 A;  5F82 A;  4BQM A;  1Z6F A;  2OLU A;  4PM5 A;  5E2E A;  1BLC A;  4OON A;  2PBY A;  4OPZ A;  4E3I A;  3PTE A;  2HDQ A;  3OPL A;  2XLN A;  1XA7 A;  4OQ0 A;  1LI0 A;  3ZNY A;  4BJP A;  3RJU A;  1TDG A;  2J7V A;  1YT4 A;  4OQG A;  1IYO A;  4OOY A;  1RP5 A;  1G6A A;  1I5Q A;  4S2M A;  3VSK A;  1WE4 A;  1ESU A;  4C6Y A;  3S4X A;  1ZC2 A;  1CK3 A;  1GHM A;  2WGV A;  2WGW B;  3MZE A;  2Y2Q A;  3OCL A;  4OP5 A;  2EX2 A;  5EVI A;  3SS4 A;  2Q9N A;  3IF6 A;  2ZM2 A;  1NJ4 A;  2RCX A;  3AGF A;  1PYY A;  3AGD A;  3VFF A;  3WS5 A;  1FR6 A;  4UA9 A;  5EVI C;  4ZJ3 A;  5JYO A;  1KDS A;  3EQV A;  3IF6 C;  4JXS A;  5EPH A;  5FAO A;  4DXC A;  1YQS A;  1IEL A;  5EVI D;  3N8L A;  4E3J A;  2BLS A;  4K0W A;  1PZO A;  1KGG A;  4QY5 A;  4B4X A;  1SDE A;  3CG5 A;  3Q7V B;  1ES5 A;  5CED A;  1ES2 A;  2Y2G A;  3QNC A;  2WYX A;  2EXB A;  4PM6 A;  2HP5 A;  4Y0U A;  1FCN A;  2XEP A;  5U47 A;  1HTZ A;  3FYZ A;  1Y54 A;  4S2K A;  5FA7 A;  5DF9 A;  4FCF A;  1XGJ A;  4JXG A;  4IBX A;  3MXR A;  4QD4 A;  3UE0 A;  3GVB A;  3Q82 A;  3BFC A;  4IED A;  5F1F A;  4PPR A;  5M19 A;  1YLJ A;  1DY6 A;  4MLL A;  3G34 A;  2J8Y A;  4P85 A;  1O7E A;  3Q1F A;  4U0T A;  4ZBE A;  4MBH A;  4S2O A;  3LY4 A;  1YM1 A;  3PBS A;  2XK1 A;  3BLS A;  1FOF A;  4CPK A;  3WRZ A;  4KZ5 A;  2XDM A;  3BFF A;  1KGE A;  3G30 A;  1K56 D;  5DVA A;  5AQ9 A;  3PBN A;  2XFS A;  5HAR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...