1YLJA

Atomic resolution structure of ctx-m-9 beta-lactamase
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
263
structure length
263
Chain Sequence
QTSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTAGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic Resolution Structures of CTX-M beta-Lactamases: Extended Spectrum Activities from Increased Mobility and Decreased Stability.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords beta-lactamase CTX-M-9a
total genus 101
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2005-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1yljA00
1PW1A 4GB7A 2A49A 2XH9A 3VOYA 3FYZA 4RVAA 2EX6A 1LI9A 3EQUA 4JPMA 1ZG6A 2Z2LB 4E3LA 3Q82A 2C5WB 1RGYA 1ZG4A 1EWZA 2JC7A 5HFOA 3VFFA 4LENA 1DJCA 2H10A 4OLDA 1LL5A 1PWGA 4Y0OA 1IELA 1BLSA 1AXBA 4IVIA 4B88A 3WS2A 5E2GA 3OPPA 4ZJ1A 3NC8A 5EOEA 4S2IA 3NDGA 3ISGA 2FFYA 1K55C 4GNUA 4XXRA 3N7WA 1G68A 3UE1A 4MEZA 2GDNA 1L0FA 3WS5A 1YLWA 3V3RA 1ESUA 4UA9A 2V20A 3HREA 5GLDA 5GL9A 1XXMA 5E2EA 3PBQA 4K0WA 1K38A 3N6IA 1MXOA 2WAFA 2XGNA 2WGVA 1KE0A 5FQ9A 3VSLA 1TEMA 4FH4A 4E6WA 2ZC5B 1JWVA 4P0MA 2EX8A 2I72A 5CXWA 3P98A 1O7EA 5A91A 4E3MA 4R1GA 5EVIA 2Y59A 2JE5A 2BG1A 2XLNA 4JLFA 3ITBA 4S2JA 5CHMA 4WMCA 4OLGA 1MPLA 3MXRA 4BD0A 5GLCA 4LV3A 5I94A 1I2WA 3OPRA 5EOOA 4FSFA 1H8YA 4KZ4A 2EX9A 5DTSA 4ZJ2A 1YLZA 3RXWA 1IKIA 3OPLA 1JWPA 3CMZA 4R3BA 2P9VA 3OZHA 4JXWA 5DTKA 3C5AA 5HW3A 1HZOA 2P9VB 1GHPA 2WAEA 2ZC3B 2WADA 4QU3A 2RCXA 1KE4A 1Z6FA 3M6HA 4ZDXA 3MXSA 3SH8A 5TGFA 2EFXA 2PU4A 2ZQAA 1YQSA 2ZQCA 5J8XA 3ZHHA 4S2KA 1ALQA 1DJBA 4GN2A 3W4PA 2V1ZA 3UDFA 1GHMA 2ZD8A 5D3OA 3IXHA 4X68A 5FQQA 3A3EA 3ITAA 2Q9NA 1CI8A 2EX2A 3A3IA 4NK3A 5E2FA 5IHVA 1K55A 1G6AA 4HBUA 5FI2A 1J9MA 3M2JA 5JYOA 4OOLA 2QPNA 1MKIA 1XKZA 2XQZA 3BEBA 3HLCA 3W4OA 2H0TA 1W8YA 4BJPA 2WKEA 3IF6B 4KZAA 5EVIB 1MWUA 1PZOA 3UO9A 4BL3A 1MWTA 4GOGA 3PAEA 1XX2A 5A92A 3C4PA 1N9BA 3G32A 3BLSA 5AQBA 2Y2MA 4K0XA 1EROA 2WGWA 4L0LA 1BTLA 1H8ZA 4PM8A 5EUAA 5HX9A 5M19A 3A3JA 1XGJA 2ZQ9A 2PU2A 4KENB 3BFCA 3PBSA 4MBKA 5DF9A 3RXXA 4JF6A 1XGIA 4ZTKA 3WS0A 3WRTA 4E3IA 1JTGA 4Y0TA 5AQ9A 3TSGA 3V3SA 3BFFA 3V50A 1GA0A 3QNCA 4LV0A 3SS5A 1DY6A 3ZCZA 1YMXA 2Y2OA 4QD4A 1FQGA 5FATA 4KG6A 1FCNA 4UA6A 5G18A 3TOIA 4BENA 4OVDA 1K54C 5CERA 2WKIA 3VMAA 4DDYA 5FASA 4OQGA 3LO7A 2A3UA 2HP9A 4WZ4A 1KGFA 1BT5A 2HP5A 1TDLA 3DTMA 1ES2A 2WK0A 4KZ7A 1N4OA 4QY6A 1ONGA 2JBFA 4KZ9A 5GLBA 2VGJA 2JCHA 3Q7VB 2PBYA 3IF6A 3NDEA 4K91A 4EUZA 3FKWA 5HL1A 1K57A 1SCWA 4QY5A 4KQQA 3PAGA 1BZAA 1W7FA 4N9LA 1KGEA 1K25A 5FQIA 3Q07A 3ZNYA 4JKTA 4UAAA 1VQQA 3PBOA 3FKVA 4OQIA 2ZQ7A 1PW8A 1K6RA 5FAPA 1BULA 1IKGA 4OOYA 1MY8A 4EQIA 3CG5A 5FAOA 1L2SA 3SOIA 3BLMA 2Q9MA 3G31A 4YINA 4CPKA 1XPBA 3HLFA 5AQ7A 1XA1A 1FCMA 4HEFA 1MWSA 1ES4A 3V5MA 4PM5A 3G35A 3RJUA 4B4ZA 1MBLA 1NJ4A 1I2SA 3O87A 4OPRA 4OOMA 4DE1A 3OC2A 1OMEA 2WYXA 5GHXA 2EXBA 1YM1A 4DXBA 1KDWA 1PYYA 3Q1FA 4H8RA 4GKUA 4DRTA 1E3UD 5FAQA 3ZG9B 1E25A 5KSCA 2Y2GA 3AGDA 1TVFA 1TDGA 3SS3A 4NETA 1XA7A 2J8YA 4BD1A 1KVMA 4Z9QA 2FFFB 2OLVA 1W79A 1CI9A 2ZJ9A 3VOZA 3MKEA 3TG9A 1FSYA 3GQZA 3UE0A 4XUZA 4R23A 5CTMA 5A93A 4N92A 4E3NA 3HVFA 3IXGA 3OPHA 3M6BA 1YT4A 3MBZA 3A3FA 2HDSA 1NY0A 1ONHA 2ZC7A 3NIAA 2HDQA 3IWOA 5CHJA 4MBHA 1QMEA 4OH0A 3ZNTA 1H5XA 4E3KA 3EQVA 5GHZA 1JVJA 2WZXA 2QZ6A 3BECA 4JBFA 4KZ5A 2J9OA 1NYYA 4OP8A 4PM9A 4UHUA 2OV5A 3O86A 4EV4A 3LCEA 2DRWA 5HAQA 3AGFA 2HDUA 2EFUA 5CGSA 1PZPA 3NY4A 3QNBA 1QMFA 1IYQA 4Y7PA 3UNWA 3VFHA 5CGWA 5TFQA 3ZFZA 2Y2IA 2P74A 3HLEA 2HDRA 5CECA 3HUOA 3BFDA 1MWRA 1BLCA 3Q81A 4WYYA 1KGGA 4BQMA 1KDSA 4A5RA 3NBLA 2UWXA 5A90A 4OPYA 1IYPA 1CK3A 4RA7A 4R3JA 1CEGA 3GSGA 1Y54A 2Y2LA 3A3DA 4OKPA 5CEBA 3VP0A 4P85A 2XD5A 1S6RA 4RX2A 3G2ZA 3O88A 1ESIA 3MKFA 4LCLA 3MZEA 2ZQDA 3E2LA 4KZ8A 2ZM8A 4JF4A 2Y4AA 1YMSA 2J7VA 3G30A 1WYCA 4HBTA 3HBRA 3PBNA 1K54A 3IF5A 4R4RA 2R9WA 2BLSA 4IEDA 1ES5A 2ZLYA 2H0YA 1BSGA 1FR6A 4LV1A 2E8IA 2IWCA 4S2LA 4KZ6A 5KMWA 3VP1A 1L0GA 4KQOA 1M40A 4DKIA 3IWIA 1RP5A 3S4XA 3GR2A 1PI5A 3Q7ZA 5KZHA 3WS4A 2X02A 4KG5A 4OONA 1K56D 1PIOA 4N9KA 2H5SA 4MLLA 5EPHA 1CEFA 2XFSA 1IEMA 5DF8A 4PMAA 4R4SA 5FQKA 4EBPA 4FD8A 3G34A 3ZDJA 4JXSA 4WM9A 4WELA 1JTDA 2RL3A 2VGKA 5FDHA 5FSRA 3O3VA 3CZDA 3I7JA 1S0WA 1E4DA 3P09A 4DXCA 4DE0A 1W8QA 2EXAA 3N8SA 1EI5A 1Q2QA 5HAPA 1E3UA 3CJMA 4ZBEA 4X53A 1GHIA 3VP4A 4MNRA 1K57C 3DW0A 1I5QA 1NRFA 3BYDA 1KVLA 3GV9A 1DJAA 4BLMA 2QMIA 2Y2PA 4OQHA 1LLBA 1RGZA 2ZQ8A 4P87A 4ZAMA 3PBRA 4S2PA 3HUMA 4F94A 4X56A 5F1FA 1K56A 3LEZA 1RCJA 1M6KA 4GDBA 4WEJA 3UDIA 4PM7A 3IWQA 5HARA 1WYBA 1NZOA 3C7UA 2OSUA 5GHYA 1IYOA 2WGWB 4WZ5A 4WZ5C 4U0TA 2OLUA 4P6BA 3S1YA 4DE2A 4Y0UA 4PPRA 4S2NC 3MZDA 5M18A 4FH2A 1ERQA 4OPZA 5GLAA 2CC1A 3GTCA 4EBNA 1LL9A 2Z2MB 2WZZA 1ZKJA 3NCKA 3MZFA 3UY6A 1SHVA 1C3BA 1K6SA 3IQAA 2G2WA 4LCMA 4M3KA 4DDSA 4EWFA 3IH8A 3PBTA 2Y2NA 3FZCA 4PM6A 5AQAA 2J9PA 3IXBA 3SH7A 3W8KA 3ZGAB 1VM1A 4C75A 1O07A 3E2KA 1BLPA 1ERMA 5BOHA 3QHYA 3HLGA 4MBFA 4X55A 4KZBA 1YLTA 5F1GA 2WGIA 4YFMA 4OPQA 5DF7A 5EVLA 5F82A 5F83A 4DF6A 4BL2A 1LHYA 4ZJ3A 2WKHA 1XP4A 5CTNA 1SDNA 4KZ3A 5DTTA 4D2OA 3IHBA 3UPOA 2DCFA 5FA7A 3ZVWA 3N8LA 4KQRA 2X01A 1HTZA 1WE4A 2Y2QA 2ZM0A 2ZM2A 3S22A 4X6TA 2Y2JA 1L0EA 2Y55A 3BRMA 3WWXA 5KSHA 5E43A 1PI4A 2B5RA 5EE8A 1BUEA 3VP3A 2ZC4B 4WEKA 2C6WB 3G2YA 4QJGA 3HLDA 5U47A 5EVIC 3BFEA 5TR7A 4IVKA 2XR0A 4X69A 3V39A 4GD6A 1FSWA 3G4PA 1BLHA 2G2UA 2Y2KA 3GMWA 3IH9A 3LY4A 3N4IA 4N1HA 5EVID 3UPNA 5CEDA 4JXGA 2WUQA 5CHUA 3N8RA 4IBXA 2ZMAA 4WBGA 2XDMA 4JF5A 4O7DA 3DWZA 3SH9A 2R9XA 4KG2A 2IWBA 3M2KA 3IXDA 4Q8IA 3FWLA 3JYIA 1K4FA 1YLJA 2XD1A 3FV7A 4OQ0A 4JXVA 4OP5A 2XFTA 3SS4A 2HP6A 4N1XA 5DVAA 1GCEA 5M1AA 4C6YA 2ZC6B 4UA7A 3DWKA 3ZVTA 3ZG5A 4GD8A 1ZC2A 5FQJA 3ZG0A 3PTEA 3HL9A 2XF3A 3OCNA 4E3JA 4GZBA 2V2FF 4FCFA 2Y2HA 5FQMA 3HLWA 1L0DA 1YLPA 4IBRA 4ID4A 3UPPA 4U3TA 2XEPA 1IYSA 2DNSA 4GDNA 4EBLA 1FCOA 1JWZA 3IT9A 3AGEA 3HUNA 1ES3A 2Y91A 4QHCA 3Q7VA 5EECA 1HVBA 3BM6A 3ZG7B 3ZG8B 1PWCA 3WRZA 4C3QA 3HLBA 3NI9A 4S2NA 2X71A 4XUXA 4RYEA 1SDEA 3C4OA 5E2HA 3VP2A 3BFGA 3LY3A 4LV2A 4B4XA 1NYMA 1NXYA 5FI6A 1SKFA 2IWDA 3MFDA 4E3OA 1NZUA 4HESA 3WS1A 1W5DA 3UDXA 3W4QA 4E6XA 1FOFA 2XK1A 3B3XA 4U0XA 3C7VA 3D4FA 4QB8A 1U60A 1HD8A 1YLYA 1GA9A 4DE3A 1LI0A 1FR1A 5L2FA 3GRJA 3UN7A 3IF6C 3IHAA 4S2OA 5CGXA 4WMCD 1Q2PA 5FI7A 3UE3A 3VSKA 5JYPA 4RX3A 4CJNA 1K4EA 5HAIA 3GVBA 4R0QA 3OCLA 5CRFA 4S2MA 1PWDA 1KE3A 2HPBA
chains in the Genus database with same CATH superfamily
2A49A 3LR3A 3EQUA 5HPIA 1OTAA 3NULA 2C5WB 1ZG4A 4IUKA 4CLCB 1DJCA 1PWGA 3BY8A 1IELA 2QJ5A 4YNRA 3WS2A 1P9WA 3NDGA 2FFYA 1K55C 4XXRA 4MEZA 1L0FA 3HCYA 3MF0A 1MXOA 2WAFA 2XGNA 3R7WB 1T1BA 3UMDA 5DJUA 2B95A 4E6WA 2ZC5B 1JWVA 1ZTUA 4P0MA 2I72A 3LGOA 5A91A 1L3LA 2Y59A 2XLNA 2BG1A 5HDSA 3D3OA 4S2JA 3E4QA 4WMCA 5IS1A 4BD0A 5GLCA 2XSSA 1I2WA 2HV1A 4FSFA 1H8YA 2PHYA 2EX9A 4ZJ2A 4BBTA 1YLZA 1IKIA 4ARZB 2Q0OA 4PAUA 1KOUA 2ZC3B 4ZDXA 2WADA 2W3GA 3BJNA 4GN2A 3W4PA 2ZD8A 3A3EA 5E2FA 2HJEA 3A3IA 3CUEA 3UB7A 4I5SA 1G6AA 4HBUA 2ZL1B 3M2JA 5JYOA 2QPNA 3D72A 1W8YA 3IF6B 3IX3A 2K7SA 1UWPX 1MWUA 3UO9A 4BL3A 1XX2A 3S7PA 3BLSA 5AQBA 2HJ9C 4HP9A 3C2WA 4K0XA 1H8ZA 1OTBA 3WRTA 3SW1A 1JTGA 3ZCZA 4IUHA 2Z6CA 4H6JB 4G3KA 5CERA 4DDYA 4OQGA 4HJ4A 4WZ4A 2D01A 2AVXA 3PXPA 4P6ZM 4QY6A 1XFQA 2JCHA 3Q7VB 3B33A 2GJ3A 4EUZA 3FKWA 1SCWA 4QY5A 3FC7A 3GDIA 1D1JA 1K25A 5FQIA 1GSWA 1V9YA 4UAAA 4OQIA 4WL9A 1PW8A 1K6RA 2V1AA 1BULA 3DTEA 3H9WA 4OOYA 4CPKA 4HEFA 4MN6A 4PKYG 1F98A 3O87A 4OOMA 2EXBA 1PYYA 2JN7A 2BASA 2J8YA 4NXGA 4BD1A 1KVMA 4MN5A 1YPRA 4Z9QA 5FDSA 3GQZA 3UE0A 2K31A 3CUEC 5HSQA 3OPHA 3MBZA 4MMNA 3A3FA 3NIAA 3EGXC 3LUQA 1NRJA 4CLCD 2J9OA 4OP8A 4YOFA 4PM9A 4EQ1A 3LCEA 4HP4A 5FEGA 2DRWA 2HDUA 2YKHA 1QMFA 1P9RA 4Y7PA 3ZFZA 2J3TD 3HLEA 1MWRA 3FG8A 1KGGA 1KDSA 4A5RA 5L09A 4R3JA 2JKRI 2XD5A 3MQQA 2PYRA 3O88A 4HJ6A 3IS2B 4R4RA 3IF5A 2R9WA 2VKSA 5K5BA 4KZ6A 2QHKA 5DFXA 3S4XA 3LYXA 5KZHA 4GHIB 4OONA 3MXQA 3PR6A 5EPHA 1CEFA 4GHIA 4Y3IA 3UB6A 5FQKA 4FD8A 2FZ0A 2K2NA 4WELA 2VGKA 1CJFA 1VETB 3I7JA 3P09A 2EXAA 3LIEA 2EWWA 1GHIA 1K57C 3BYDA 4GLQA 4OQHA 4WN5A 4ZAMA 4X56A 1RCJA 1HLUP 4GDBA 3IWQA 1WYBA 1XFNA 3T4QA 1XJ4A 2WGWB 4WZ5A 3ZYTA 4LPZA 4P6BA 3S1YA 3E4OA 4Y0UA 4FH2A 3GTCA 4EBNA 2WZZA 2PT7A 3NCKA 2WKPA 3CPTB 2G2WA 4LCMA 4M3KA 4DDSA 4Q0JA 4E04A 3VV4A 1S4RA 2Y2NA 4PM6A 2J9PA 3ZGAB 1VM1A 3RH8B 1LSXA 1ERMA 3HLGA 2Y79A 4I38A 1LL8A 4YFMA 4OPQA 5EVLA 5F82A 4BL2A 2WKHA 1XP4A 5CTNA 1SDNA 5DTTA 3IHBA 3UPOA 4KQRA 1HTZA 2Y2QA 2O9BA 4X6TA 2Y2JA 1L0EA 3C8CA 1PI4A 1YSQA 3T12B 5EE8A 3VP3A 4K08A 2C6WB 3CI6A 3IX8A 1S1ZA 2XR0A 5FASA 3G4PA 2G2UA 3IH9A 3UPNA 2XA7M 2D02A 4IHQA 5CHUA 2VV6A 2XRNA 2R9XA 2IWBA 3M2KA 3JYIA 2XD1A 3FV7A 4OQ0A 2V8CA 4JXVA 2HP6A 5DVAA 5M1AA 2E8JA 4UA7A 5KIZA 4GD8A 3QP4A 3LR0A 2V2FF 5FQMA 4IBRA 4U3TA 1OT9A 1FCOA 3IT9A 2GX5A 3HUNA 2ZMVA 3A0VA 3Q7VA 1S66L 4R38A 4C3QA 3EWKA 3NI9A 2PDRA 2X71A 1SDEA 3LY3A 5FI6A 1PNEA 4EERA 4E3OA 1W5DA 5F68A 3GECA 3W4QA 3C7VA 3D4FA 1YLYA 5A8BA 4I39A 5HD3A 4S2OA 4WMCD 3F1NA 3W2ZA 4RX3A 3LR4A 1YKDA 5CRFA 4JGOA 4EU0A 4S2MA 1KE3A 2XH9A 4RVAA 2EX6A 1ZG6A 1VB6A 1EWZA 3VFFA 4LENA 5HWTA 4OLDA 4Y0OA 1BLSA 4B88A 2A24A 5E2GA 3MR0A 3F1NB 1DP9A 1G68A 5AVFA 3WS5A 3T4KA 2V20A 5GLDA 5GL9A 1XXMA 1KE0A 2W3DA 5FQ9A 1NLYA 5CXWA 1O7EA 4E3MA 5EVIA 4JLFA 3ITBA 2J3TC 3MXRA 3RTYA 5F6AA 4D60A 5I94A 3CITA 4R3BA 2P9VA 4Y13A 2PAVP 1HZOA 3TRCA 2P9VB 1GHPA 4QU3A 1Z6FA 3M6HA 3MXSA 5TGFA 3KO6A 1YQSA 4I3AA 3BWLA 4WLAA 3NECA 3IXHA 5D3OA 3VE4A 5FQQA 3ITAA 3VOYA 1CI8A 5IHVA 4NK3A 2KOIA 5HDCA 5FI2A 5HPFA 4PHTA 1MKIA 3HLCA 2PD7A 2VJWA 1PZOA 2A2LA 4GOGA 3G32A 2ZMFA 3NHQA 4L0LA 4IJGA 1H8MA 1Y4OA 4ZRRA 1LT0A 2ZQ9A 4MBKA 5DF9A 3RXXA 3WS0A 1XGIA 4ZTKA 2QKPA 4Y0TA 2PYPA 3JVVA 3SS5A 1YMXA 2NUPC 2Y2OA 4QD4A 2B18A 5FATA 3LIDA 2Y8HA 5HWWA 3H7WA 3BQ8A 3T1RA 4BENA 2P7JA 3QP1A 2WKIA 2A3UA 1KGFA 1TDLA 2W1TB 3DTMA 1N4OA 2GZAA 2PBYA 3NDEA 4K91A 5HL1A 3HJKA 1K57A 3KYQA 1BZAA 1NLZA 1W7FA 1KGEA 4JGQA 4I3IA 1VQQA 2V8FA 4WF0A 4LLOB 1IKGA 4EQIA 1L2SA 2Q9MA 3G31A 1XPBA 4HI4A 1XA1A 1T19A 4PM5A 4OPRA 2EWVA 1T18A 3CLOA 1KDWA 4H8RA 4GKUA 4DRTA 5FAQA 3ZG9B 1E25A 3AGDA 3SS3A 2FFFB 2VV8A 1W79A 1CI9A 2HF6A 5CTMA 1D7EA 3IXGA 2HDSA 5CHJA 4OH0A 1DP6A 4E3KA 2WZXA 2QZ6A 3FPWA 1NYYA 3O86A 4EV4A 5LBRA 1PZPA 5F5YA 2JKGA 4R6LA 5CGWA 2VZWA 2Y2IA 1WA9A 2P74A 4EEPA 3Q81A 1BLCA 4HHDA 4NKPA 2OAP1 1CK3A 4RA7A 1CEGA 3U2AA 3BY9A 3A3DA 4P85A 4RX2A 4MCWA 1ESIA 4LCLA 3MZEA 4KZ8A 1F2KA 2V0UA 1WYCA 3E0YA 3HBRA 3MQ0A 4IEDA 1ES5A 5HWVA 1ACFA 2E8IA 3VP1A 4KQOA 4DKIA 1RP5A 1PI5A 4DJ3A 3Q7ZA 3WS4A 2DMWA 4MLLA 5DF8A 4EBPA 4H6JA 1E4DA 4DE0A 3N8SA 3VP4A 1I5QA 3T1XA 1TS0A 3GV9A 1DJAA 4BLMA 2QMIA 1LLBA 3F1PB 1K56A 3EGDC 2INWA 3T4LA 2OLUA 4PPRA 2M7VA 3V67A 2CC1A 1LL9A 3MZFA 2JKTI 3UB5P 1SHVA 4ME4A 3IQAA 3PBTA 5IU1A 2KDKA 3SH7A 3W8KA 1O07A 4BBUA 3E2KA 5IT5A 5BOHA 1W63Q 5G4ZA 1P0ZA 2O99A 3S7NA 3T1SA 2WGIA 2YKFA 4GS9A 4KZ3A 3LI9A 5FA7A 3ZVWA 3EOIA 1BYWA 3S22A 3LI8A 5KSHA 2B5RA 3DTIA 1BUEA 2Z6DA 3G2YA 3HLDA 5EVIC 3BFEA 4GD6A 1FSWA 2Y2KA 3GMWA 5EVID 3C38A 5HL6A 3A0RA 5CEDA 3N8RA 2J80A 4WBGA 4BWIA 3CAXA 4O7DA 2XROA 4LFUA 4Q8IA 4OP5A 2XFTA 1D06A 3DWKA 3ZVTA 4F3LA 3ZG5A 5FQJA 3ZG0A 3PTEA 1FIKA 4GZBA 3OBFA 4F3LB 2PD8A 1TS6A 2W3EA 1YLPA 2J3WA 4YWZA 1IYSA 4GDNA 3IBRA 1JWZA 3AGEA 1CF0A 2EA9A 1ZHHB 2M7UA 3S7QA 4RYEA 1UGUA 3VP2A 4HH2A 4UQIS 1NYMA 2IWDA 3MFDA 3UDXA 3ULFA 1FOFA 1XJ6A 3B3XA 1GA9A 1VEUA 2V1BA 4AFIA 1N9NA 2M1CA 3LIAA 3KYZA 3UE3A 5MC7A 4CJNA 1K4EA 2VGLM 1FILA 3UB9A 5AJGA 3NC8A 1PWDA 3G30A 4U0TA 4GB7A 4L9FA 1OT6A 3VOLA 2Z2LB 3PYPA 2JC7A 5HFOA 1LL5A 4IVIA 5DKKA 4GS9B 3OPPA 5EOEA 5L10A 1OTDA 2GDNA 4ESPA 1YLWA 4UA9A 5EM0A 3PBQA 4K0WA 4EW7A 4JGPA 2WGVA 4WUJA 1GSVA 3VSLA 1TEMA 4FH4A 2JE5A 3BW6A 1W63M 3S7OA 3P01A 5CHMA 3K3CA 1IFQA 1MPLA 1T1CA 1N9OA 3E98A 3ICYA 5EOOA 4KZ4A 3OPLA 1JWPA 3OOVA 3OZHA 5DTKA 3HJIA 3C5AA 5HW3A 1PFLA 2V9AA 2EFXA 3ZHHA 4S2KA 4EUVA 1ALQA 1DJBA 1TS8A 1ODVA 2V1ZA 3UDFA 2Q9NA 1SZVA 1K55A 3T4TA 5EFWA 2XQZA 4BJPA 4KZAA 1PRQA 2G7UA 1MWTA 3PAEA 3C4PA 1N9BA 4ARZA 2Y2MA 2OOLA 1EROA 2WGWA 1BTLA 2I9VA 4LRYC 5M19A 4KENB 2KX6A 4JF6A 3E4PA 5AQ9A 1GA0A 3QNCA 5TBMB 4I3JA 4LV0A 1V9ZA 4CQHA 1FQGA 4KG6A 1FCNA 4UA6A 4EETB 4P6ZS 1X0OA 3L7HA 3VMAA 1MKMA 2HP5A 4UEYA 2WK0A 1OPXA 4KZ7A 2VA0A 4KQQA 3LR5A 1F9IA 5FAPA 3KX0X 5FAOA 3SOIA 3BLMA 4YINA 3BQAA 3HLFA 5AQ7A 3NJAA 1MWSA 3F1OB 3G35A 3RJUA 4B4ZA 1MBLA 4DE1A 1OMEA 1F5MA 2WYXA 5GHXA 2B02A 1H3QA 2ZOHA 1TVFA 1TDGA 3OLOA 1XA7A 5TBMA 4MDZA 1OTEA 2OLVA 2VK3A 3MKEA 4XUZA 4R23A 3HVFA 3M6BA 1YT4A 2JHEA 1NY0A 1ONHA 1QMEA 3ZNTA 3EQVA 1JVJA 1TS7A 4ETZA 4KZ5A 4UHUA 2OV5A 1MC0A 5J7EA 4G3VA 4KUKA 2QJ7A 4XT2B 3UNWA 3VFHA 1GSXA 1XJ2A 3LIFA 5CECA 4PKYA 4WYYA 3KYEA 2BTFP 5C5KA 3NBLA 2WKRA 1IYPA 1Y54A 4DMZA 4GJ4A 4OKPA 1Z09A 3G6OA 4Y17A 3E2LA 2Y4AA 1YMSA 4HBTA 2BLSA 2ZLYA 3DBAA 2H0YA 1BSGA 1FR6A 2IWCA 4S2LA 5KMWA 1L0GA 1VEUB 1M40A 3UE6A 3GR2A 2HZ5A 4KG5A 4ETXA 3NOTC 3KSGA 4PMAA 3G34A 4FUWA 4JXSA 5FSRA 1S0WA 4DXCA 1W8QA 1EI5A 2L4RA 5HAPA 4X53A 3EEHA 3DW0A 1NRFA 1KVLA 3CHWP 2Y2PA 2ZQ8A 4P87A 4DN0A 3PBRA 3HUMA 5F1FA 5FEFA 1M6KA 5HARA 3C7UA 2OSUA 1IYOA 2W1RA 4BBVA 4DE2A 5HDDA 5M18A 5TJJA 5GLAA 2Z2MB 5EM1A 1ZKJA 5AQAA 3IXBA 1BLPA 2V0WA 3QHYA 3LEQA 4MBFA 1YLTA 3K2NA 2JKTM 5DF7A 5F83A 4DF6A 1LHYA 4D2OA 5CX7A 1VHMA 2X01A 3EEAA 2ZM0A 2ZM2A 2GNXA 2Y55A 3BRMA 4HOIA 5E43A 4X25A 3T1QB 4KUOA 1VETA 4QJGA 1G6OA 5U47A 2W27A 4IVKA 3V39A 4X69A 3NOUC 1K0KA 3LY4A 4N1HA 5L8MA 4JXGA 4O01A 4IBXA 2ZMAA 4HQAA 2XDMA 4JF5A 3SH9A 4KG2A 3MSHA 3FWLA 3SS4A 4N1XA 1GCEA 2CMNA 4C6YA 2ZC6B 2O9CA 4E3JA 3HL9A 2XF3A 3OCNA 4II7A 5AVEA 5EVEA 3ZQ5A 3IS2A 3MJQA 2Y2HA 3HLWA 1L0DA 1NWZA 4ID4A 3UPPA 3C30A 2XEPA 2DNSA 4EBLA 4QHCA 1HVBA 3BM6A 3HLBA 1YSPA 3D9YA 3C4OA 3F1OA 4LV2A 4B4XA 3UB8A 1NXYA 2KLIA 1SKFA 4HESA 4E6XA 2XK1A 4U0XA 4QB8A 1HD8A 4DE3A 1LI0A 1FR1A 3KSFA 5L2FA 3GRJA 4Y15A 3KSHA 3IHAA 2PR5A 5FI7A 4HY8A 5FL3A 1AWIA 1G5UA 5HAIA 3GVBA 4R0QA 4QWOA 3B47A 2HPBA 1PW1A 3FYZA 1LI9A 4JPMA 4E3LA 3Q82A 1RGYA 2W3HA 2H10A 1AXBA 2LB5A 5HD5A 4ZJ1A 4S2IA 3ISGA 4GNUA 3N7WA 2P08A 3LFVA 3UE1A 3V3RA 1ESUA 3HREA 5E2EA 4NXFA 1K38A 3N6IA 4LGWA 4Y2FA 3LICA 2EX8A 3P98A 4HH3A 3TJZC 4R1GA 3VE3A 2A24B 2VEAA 4OLGA 3IBJA 2ZL1A 2FH5A 4NXEA 4LV3A 3OPRA 5DTSA 3RXWA 3A0SA 3CMZA 4JXWA 2WAEA 1A0KA 2RCXA 1KE4A 3SH8A 2OAQ1 2PU4A 2ZQAA 4B9OA 2ZQCA 5J8XA 2JKFA 1GHMA 3QP5A 1TD5A 3JVUA 4X68A 4R70A 2EX2A 3B42A 1J9MA 1T1AA 4OOLA 1XKZA 2R78A 3BEBA 3W4OA 2H0TA 2WKEA 2LB9A 5EVIB 3H7WB 3O5YA 5A92A 3SZTA 2O9AA 2PBDP 5J4EA 4PM8A 5EUAA 5HX9A 4UQIM 3A3JA 1XGJA 3DTKA 2PU2A 3FPVA 3BFCA 3PBSA 4LRXC 4E3IA 3TSGA 3V3SA 4NXBA 3BFFA 4MN7A 3V50A 3JPUA 1DY6A 1IOUA 1DP8A 5G18A 2MJ6A 3TOIA 1S1YA 4OVDA 1K54C 3LO7A 2HP9A 1G28A 1BT5A 1H0MA 1ES2A 4X1MA 1ONGA 2JBFA 4KZ9A 1CQAA 5GLBA 2VGJA 3IF6A 3IX4A 2VGLS 5G4YA 3PAGA 4N9LA 4LRZE 1EW0A 3Q07A 3ZNYA 4JKTA 1S67L 3FKVA 3PBOA 2ZQ7A 1MY8A 3CG5A 4HIAA 3H82B 4O0PA 3MMHA 1FCMA 2L1MA 1ES4A 3V5MA 1NJ4A 1I2SA 3OC2A 1S4SA 1YM1A 4DXBA 3Q1FA 1E3UD 1P97A 1LSWA 5KSCA 2Y2GA 3NOPC 4NETA 2WKQA 2ZJ9A 4NG2A 3VOZA 3CPTA 3TG9A 1FSYA 4Y5FA 2HGVA 4EXOA 5A93A 4N92A 4E3NA 2ZC7A 2HDQA 3IWOA 4MBHA 1H5XA 5GHZA 3BECA 4JBFA 1SKOA 4GW9A 5HAQA 3AGFA 5CGSA 2EFUA 3NY4A 3QNBA 1IYQA 4EEUA 5TFQA 2HDRA 3HUOA 3BFDA 3U4LP 4BQMA 2XA7S 2UWXA 5A90A 4GCZA 4OPYA 3GSGA 3R7WA 2Y2LA 5CEBA 3VP0A 1S6RA 3G2ZA 3MKFA 4R3AA 3PHYA 2ZQDA 3MQOA 4CLCE 2ZM8A 4JF4A 4CLCC 2J7VA 3PBNA 1K54A 3QP2A 2OWHA 1JNUA 3DAVA 4RQ9A 4LV1A 3QP6A 3IWIA 3KSIA 3F1PA 2X02A 2W3FA 3CWFA 1K56D 1PIOA 4N9KA 2H5SA 2W1TA 2XFSA 1IEMA 1TF1A 4R4SA 2O0YA 3ZDJA 4WM9A 1JTDA 2RL3A 5FDHA 3P7NA 3O3VA 3CZDA 4QPRA 4XT2A 1Q2QA 2H28A 4L9GA 1E3UA 3CJMA 4ZBEA 4MNRA 2W0NA 5DKLA 3H82A 5DFYA 5EV0A 1RGZA 2IA2A 4S2PA 4F94A 3LEZA 3UDIA 4WEJA 4PM7A 1J3WA 1NZOA 5GHYA 3R4KA 3RFBA 4Q0IA 4WZ5C 4S2NC 3MZDA 1ERQA 4OPZA 3TW8A 1OTIA 2PR6A 4G3WA 4M4XA 3UY6A 2VLGA 1C3BA 1K6SA 1OJ5A 4EWFA 2VV7A 3IH8A 3FZCA 5L07A 1DRMA 4C75A 3QP8A 4X55A 4KZBA 5F1GA 2QWSA 1SKOB 3LIBA 4Q0HA 4ZJ3A 1LSVA 4B93A 4CLCA 2DCFA 3N8LA 1WE4A 5HZHA 2P04A 4L9EA 3WWXA 4NEED 4FOFA 3L9KA 2OWJA 2VX8A 2ZC4B 4WEKA 1XJ3A 2QYBA 2ZBBA 5TR7A 3T50A 2ZOIA 3N4IA 1BLHA 4EESA 2WUQA 1UWNX 4KQDA 3DWZA 1N9LA 3IXDA 1K4FA 1YLJA 4HNBA 3MS6A 1STZA 5J3WA 4HJ3A 4JGRA 3MFXA 5DJTA 4X1LA 2NUTC 1ZC2A 3T4SA 4BMWA 4FCFA 2PRFA 3T4JA 2L0WA 1ES3A 2Y91A 5EECA 1MZUA 3TE8A 3ZG7B 3ZG8B 1PWCA 3WRZA 4DJ2A 4S2NA 4XUXA 5E2HA 3UMEA 3BFGA 4Z1WA 1Y28A 2UV0E 1YAXA 1NZUA 2JKRM 3WS1A 1U60A 2ACGA 1OJGA 3UN7A 3IF6C 5CGXA 1Q2PA 3VSKA 4O8GA 4FTXA 5F69A 5JYPA 5I5LA 3T4OA 3K3DA 3OCLA
chains in the Genus database with same CATH topology
1PW1A 4GB7A 2A49A 2XH9A 3VOYA 3FYZA 4RVAA 2EX6A 1LI9A 3EQUA 4JPMA 1ZG6A 2Z2LB 4E3LA 3Q82A 2C5WB 1RGYA 1ZG4A 1EWZA 2JC7A 5HFOA 3VFFA 4LENA 1DJCA 2H10A 4OLDA 1LL5A 1PWGA 4Y0OA 1IELA 1BLSA 1AXBA 4IVIA 4B88A 3WS2A 5E2GA 3OPPA 4ZJ1A 3NC8A 5EOEA 4S2IA 3NDGA 3ISGA 2FFYA 1K55C 4GNUA 4XXRA 3N7WA 1G68A 3UE1A 4MEZA 2GDNA 1L0FA 3WS5A 1YLWA 3V3RA 1ESUA 4UA9A 2V20A 3HREA 5GLDA 5GL9A 1XXMA 5E2EA 3PBQA 4K0WA 1K38A 3N6IA 1MXOA 2WAFA 2XGNA 2WGVA 1KE0A 5FQ9A 3VSLA 1TEMA 4FH4A 4E6WA 2ZC5B 1JWVA 4P0MA 2EX8A 2I72A 5CXWA 3P98A 1O7EA 5A91A 4E3MA 4R1GA 5EVIA 2Y59A 2JE5A 2BG1A 2XLNA 4JLFA 3ITBA 4S2JA 5CHMA 4WMCA 4OLGA 1MPLA 3MXRA 4BD0A 5GLCA 4LV3A 5I94A 1I2WA 3OPRA 5EOOA 4FSFA 1H8YA 4KZ4A 2EX9A 5DTSA 4ZJ2A 1YLZA 3RXWA 1IKIA 3OPLA 1JWPA 3CMZA 4R3BA 2P9VA 3OZHA 4JXWA 5DTKA 3C5AA 5HW3A 1HZOA 2P9VB 1GHPA 2WAEA 2ZC3B 2WADA 4QU3A 2RCXA 1KE4A 1Z6FA 3M6HA 4ZDXA 3MXSA 3SH8A 5TGFA 2EFXA 2PU4A 2ZQAA 1YQSA 2ZQCA 5J8XA 3ZHHA 4S2KA 1ALQA 1DJBA 4GN2A 3W4PA 2V1ZA 3UDFA 1GHMA 2ZD8A 5D3OA 3IXHA 4X68A 5FQQA 3A3EA 3ITAA 2Q9NA 1CI8A 2EX2A 3A3IA 4NK3A 5E2FA 5IHVA 1K55A 1G6AA 4HBUA 5FI2A 1J9MA 3M2JA 5JYOA 4OOLA 2QPNA 1MKIA 1XKZA 2XQZA 3BEBA 3HLCA 3W4OA 2H0TA 1W8YA 4BJPA 2WKEA 3IF6B 4KZAA 5EVIB 1MWUA 1PZOA 3UO9A 4BL3A 1MWTA 4GOGA 3PAEA 1XX2A 5A92A 3C4PA 1N9BA 3G32A 3BLSA 5AQBA 2Y2MA 4K0XA 1EROA 2WGWA 4L0LA 1BTLA 1H8ZA 4PM8A 5EUAA 5HX9A 5M19A 3A3JA 1XGJA 2ZQ9A 2PU2A 4KENB 3BFCA 3PBSA 4MBKA 5DF9A 3RXXA 4JF6A 1XGIA 4ZTKA 3WS0A 3WRTA 4E3IA 1JTGA 4Y0TA 5AQ9A 3TSGA 3V3SA 3BFFA 3V50A 1GA0A 3QNCA 4LV0A 3SS5A 1DY6A 3ZCZA 1YMXA 2Y2OA 4QD4A 1FQGA 5FATA 4KG6A 1FCNA 4UA6A 5G18A 3TOIA 4BENA 4OVDA 1K54C 5CERA 2WKIA 3VMAA 4DDYA 5FASA 4OQGA 3LO7A 2A3UA 2HP9A 4WZ4A 1KGFA 1BT5A 2HP5A 1TDLA 3DTMA 1ES2A 2WK0A 4KZ7A 1N4OA 4QY6A 1ONGA 2JBFA 4KZ9A 5GLBA 2VGJA 2JCHA 3Q7VB 2PBYA 3IF6A 3NDEA 4K91A 4EUZA 3FKWA 5HL1A 1K57A 1SCWA 4QY5A 4KQQA 3PAGA 1BZAA 1W7FA 4N9LA 1KGEA 1K25A 5FQIA 3Q07A 3ZNYA 4JKTA 4UAAA 1VQQA 3PBOA 3FKVA 4OQIA 2ZQ7A 1PW8A 1K6RA 5FAPA 1BULA 1IKGA 4OOYA 1MY8A 4EQIA 3CG5A 5FAOA 1L2SA 3SOIA 3BLMA 2Q9MA 3G31A 4YINA 4CPKA 1XPBA 3HLFA 5AQ7A 1XA1A 1FCMA 4HEFA 1MWSA 1ES4A 3V5MA 4PM5A 3G35A 3RJUA 4B4ZA 1MBLA 1NJ4A 1I2SA 3O87A 4OPRA 4OOMA 4DE1A 3OC2A 1OMEA 2WYXA 5GHXA 2EXBA 1YM1A 4DXBA 1KDWA 1PYYA 3Q1FA 4H8RA 4GKUA 4DRTA 1E3UD 5FAQA 3ZG9B 1E25A 5KSCA 2Y2GA 3AGDA 1TVFA 1TDGA 3SS3A 4NETA 1XA7A 2J8YA 4BD1A 1KVMA 4Z9QA 2FFFB 2OLVA 1W79A 1CI9A 2ZJ9A 3VOZA 3MKEA 3TG9A 1FSYA 3GQZA 3UE0A 4XUZA 4R23A 5CTMA 5A93A 4N92A 4E3NA 3HVFA 3IXGA 3OPHA 3M6BA 1YT4A 3MBZA 3A3FA 2HDSA 1NY0A 1ONHA 2ZC7A 3NIAA 2HDQA 3IWOA 5CHJA 4MBHA 1QMEA 4OH0A 3ZNTA 1H5XA 4E3KA 3EQVA 5GHZA 1JVJA 2WZXA 2QZ6A 3BECA 4JBFA 4KZ5A 2J9OA 1NYYA 4OP8A 4PM9A 4UHUA 2OV5A 3O86A 4EV4A 3LCEA 2DRWA 5HAQA 3AGFA 2HDUA 2EFUA 5CGSA 1PZPA 3NY4A 3QNBA 1QMFA 1IYQA 4Y7PA 3UNWA 3VFHA 5CGWA 5TFQA 3ZFZA 2Y2IA 2P74A 3HLEA 2HDRA 5CECA 3HUOA 3BFDA 1MWRA 1BLCA 3Q81A 4WYYA 1KGGA 4BQMA 1KDSA 4A5RA 3NBLA 2UWXA 5A90A 4OPYA 1IYPA 1CK3A 4RA7A 4R3JA 1CEGA 3GSGA 1Y54A 2Y2LA 3A3DA 4OKPA 5CEBA 3VP0A 4P85A 2XD5A 1S6RA 4RX2A 3G2ZA 3O88A 1ESIA 3MKFA 4LCLA 3MZEA 2ZQDA 3E2LA 4KZ8A 2ZM8A 4JF4A 2Y4AA 1YMSA 2J7VA 3G30A 1WYCA 4HBTA 3HBRA 3PBNA 1K54A 3IF5A 4R4RA 2R9WA 2BLSA 4IEDA 1ES5A 2ZLYA 2H0YA 1BSGA 1FR6A 4LV1A 2E8IA 2IWCA 4S2LA 4KZ6A 5KMWA 3VP1A 1L0GA 4KQOA 1M40A 4DKIA 3IWIA 1RP5A 3S4XA 3GR2A 1PI5A 3Q7ZA 5KZHA 3WS4A 2X02A 4KG5A 4OONA 1K56D 1PIOA 4N9KA 2H5SA 4MLLA 5EPHA 1CEFA 2XFSA 1IEMA 5DF8A 4PMAA 4R4SA 5FQKA 4EBPA 4FD8A 3G34A 3ZDJA 4JXSA 4WM9A 4WELA 1JTDA 2RL3A 2VGKA 5FDHA 5FSRA 3O3VA 3CZDA 3I7JA 1S0WA 1E4DA 3P09A 4DXCA 4DE0A 1W8QA 2EXAA 3N8SA 1EI5A 1Q2QA 5HAPA 1E3UA 3CJMA 4ZBEA 4X53A 1GHIA 3VP4A 4MNRA 1K57C 3DW0A 1I5QA 1NRFA 3BYDA 1KVLA 3GV9A 1DJAA 4BLMA 2QMIA 2Y2PA 4OQHA 1LLBA 1RGZA 2ZQ8A 4P87A 4ZAMA 3PBRA 4S2PA 3HUMA 4F94A 4X56A 5F1FA 1K56A 3LEZA 1RCJA 1M6KA 4GDBA 4WEJA 3UDIA 4PM7A 3IWQA 5HARA 1WYBA 1NZOA 3C7UA 2OSUA 5GHYA 1IYOA 2WGWB 4WZ5A 4WZ5C 4U0TA 2OLUA 4P6BA 3S1YA 4DE2A 4Y0UA 4PPRA 4S2NC 3MZDA 5M18A 4FH2A 1ERQA 4OPZA 5GLAA 2CC1A 3GTCA 4EBNA 1LL9A 2Z2MB 2WZZA 1ZKJA 3NCKA 3MZFA 3UY6A 1SHVA 1C3BA 1K6SA 3IQAA 2G2WA 4LCMA 4M3KA 4DDSA 4EWFA 3IH8A 3PBTA 2Y2NA 3FZCA 4PM6A 5AQAA 2J9PA 3IXBA 3SH7A 3W8KA 3ZGAB 1VM1A 4C75A 1O07A 3E2KA 1BLPA 1ERMA 5BOHA 3QHYA 3HLGA 4MBFA 4X55A 4KZBA 1YLTA 5F1GA 2WGIA 4YFMA 4OPQA 5DF7A 5EVLA 5F82A 5F83A 4DF6A 4BL2A 1LHYA 4ZJ3A 2WKHA 1XP4A 5CTNA 1SDNA 4KZ3A 5DTTA 4D2OA 3IHBA 3UPOA 2DCFA 5FA7A 3ZVWA 3N8LA 4KQRA 2X01A 1HTZA 1WE4A 2Y2QA 2ZM0A 2ZM2A 3S22A 4X6TA 2Y2JA 1L0EA 2Y55A 3BRMA 3WWXA 5KSHA 5E43A 1PI4A 2B5RA 5EE8A 1BUEA 3VP3A 2ZC4B 4WEKA 2C6WB 3G2YA 4QJGA 3HLDA 5U47A 5EVIC 3BFEA 5TR7A 4IVKA 2XR0A 4X69A 3V39A 4GD6A 1FSWA 3G4PA 1BLHA 2G2UA 2Y2KA 3GMWA 3IH9A 3LY4A 3N4IA 4N1HA 5EVID 3UPNA 5CEDA 4JXGA 2WUQA 5CHUA 3N8RA 4IBXA 2ZMAA 4WBGA 2XDMA 4JF5A 4O7DA 3DWZA 3SH9A 2R9XA 4KG2A 2IWBA 3M2KA 3IXDA 4Q8IA 3FWLA 3JYIA 1K4FA 1YLJA 2XD1A 3FV7A 4OQ0A 4JXVA 4OP5A 2XFTA 3SS4A 2HP6A 4N1XA 5DVAA 1GCEA 5M1AA 4C6YA 2ZC6B 4UA7A 3DWKA 3ZVTA 3ZG5A 4GD8A 1ZC2A 5FQJA 3ZG0A 3PTEA 3HL9A 2XF3A 3OCNA 4E3JA 4GZBA 2V2FF 4FCFA 2Y2HA 5FQMA 3HLWA 1L0DA 1YLPA 4IBRA 4ID4A 3UPPA 4U3TA 2XEPA 1IYSA 2DNSA 4GDNA 4EBLA 1FCOA 1JWZA 3IT9A 3AGEA 3HUNA 1ES3A 2Y91A 4QHCA 3Q7VA 5EECA 1HVBA 3BM6A 3ZG7B 3ZG8B 1PWCA 3WRZA 4C3QA 3HLBA 3NI9A 4S2NA 2X71A 4XUXA 4RYEA 1SDEA 3C4OA 5E2HA 3VP2A 3BFGA 3LY3A 4LV2A 4B4XA 1NYMA 1NXYA 5FI6A 1SKFA 2IWDA 3MFDA 4E3OA 1NZUA 4HESA 3WS1A 1W5DA 3UDXA 3W4QA 4E6XA 1FOFA 2XK1A 3B3XA 4U0XA 3C7VA 3D4FA 4QB8A 1U60A 1HD8A 1YLYA 1GA9A 4DE3A 1LI0A 1FR1A 5L2FA 3GRJA 3UN7A 3IF6C 3IHAA 4S2OA 5CGXA 4WMCD 1Q2PA 5FI7A 3UE3A 3VSKA 5JYPA 4RX3A 4CJNA 1K4EA 5HAIA 3GVBA 4R0QA 3OCLA 5CRFA 4S2MA 1PWDA 1KE3A 2HPBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PW1 A;  4GB7 A;  2A49 A;  2XH9 A;  3VOY A;  3FYZ A;  4RVA A;  2EX6 A;  1LI9 A;  3EQU A;  4JPM A;  1ZG6 A;  2Z2L B;  4E3L A;  3Q82 A;  2C5W B;  1RGY A;  1ZG4 A;  1EWZ A;  2JC7 A;  5HFO A;  3VFF A;  4LEN A;  1DJC A;  2H10 A;  4OLD A;  1LL5 A;  1PWG A;  4Y0O A;  1IEL A;  1BLS A;  1AXB A;  4IVI A;  4B88 A;  3WS2 A;  5E2G A;  3OPP A;  4ZJ1 A;  3NC8 A;  5EOE A;  4S2I A;  3NDG A;  3ISG A;  2FFY A;  1K55 C;  4GNU A;  4XXR A;  3N7W A;  1G68 A;  3UE1 A;  4MEZ A;  2GDN A;  1L0F A;  3WS5 A;  1YLW A;  3V3R A;  1ESU A;  4UA9 A;  2V20 A;  3HRE A;  5GLD A;  5GL9 A;  1XXM A;  5E2E A;  3PBQ A;  4K0W A;  1K38 A;  3N6I A;  1MXO A;  2WAF A;  2XGN A;  2WGV A;  1KE0 A;  5FQ9 A;  3VSL A;  1TEM A;  4FH4 A;  4E6W A;  2ZC5 B;  1JWV A;  4P0M A;  2EX8 A;  2I72 A;  5CXW A;  3P98 A;  1O7E A;  5A91 A;  4E3M A;  4R1G A;  5EVI A;  2Y59 A;  2JE5 A;  2BG1 A;  2XLN A;  4JLF A;  3ITB A;  4S2J A;  5CHM A;  4WMC A;  4OLG A;  1MPL A;  3MXR A;  4BD0 A;  5GLC A;  4LV3 A;  5I94 A;  1I2W A;  3OPR A;  5EOO A;  4FSF A;  1H8Y A;  4KZ4 A;  2EX9 A;  5DTS A;  4ZJ2 A;  1YLZ A;  3RXW A;  1IKI A;  3OPL A;  1JWP A;  3CMZ A;  4R3B A;  2P9V A;  3OZH A;  4JXW A;  5DTK A;  3C5A A;  5HW3 A;  1HZO A;  2P9V B;  1GHP A;  2WAE A;  2ZC3 B;  2WAD A;  4QU3 A;  2RCX A;  1KE4 A;  1Z6F A;  3M6H A;  4ZDX A;  3MXS A;  3SH8 A;  5TGF A;  2EFX A;  2PU4 A;  2ZQA A;  1YQS A;  2ZQC A;  5J8X A;  3ZHH A;  4S2K A;  1ALQ A;  1DJB A;  4GN2 A;  3W4P A;  2V1Z A;  3UDF A;  1GHM A;  2ZD8 A;  5D3O A;  3IXH A;  4X68 A;  5FQQ A;  3A3E A;  3ITA A;  2Q9N A;  1CI8 A;  2EX2 A;  3A3I A;  4NK3 A;  5E2F A;  5IHV A;  1K55 A;  1G6A A;  4HBU A;  5FI2 A;  1J9M A;  3M2J A;  5JYO A;  4OOL A;  2QPN A;  1MKI A;  1XKZ A;  2XQZ A;  3BEB A;  3HLC A;  3W4O A;  2H0T A;  1W8Y A;  4BJP A;  2WKE A;  3IF6 B;  4KZA A;  5EVI B;  1MWU A;  1PZO A;  3UO9 A;  4BL3 A;  1MWT A;  4GOG A;  3PAE A;  1XX2 A;  5A92 A;  3C4P A;  1N9B A;  3G32 A;  3BLS A;  5AQB A;  2Y2M A;  4K0X A;  1ERO A;  2WGW A;  4L0L A;  1BTL A;  1H8Z A;  4PM8 A;  5EUA A;  5HX9 A;  5M19 A;  3A3J A;  1XGJ A;  2ZQ9 A;  2PU2 A;  4KEN B;  3BFC A;  3PBS A;  4MBK A;  5DF9 A;  3RXX A;  4JF6 A;  1XGI A;  4ZTK A;  3WS0 A;  3WRT A;  4E3I A;  1JTG A;  4Y0T A;  5AQ9 A;  3TSG A;  3V3S A;  3BFF A;  3V50 A;  1GA0 A;  3QNC A;  4LV0 A;  3SS5 A;  1DY6 A;  3ZCZ A;  1YMX A;  2Y2O A;  4QD4 A;  1FQG A;  5FAT A;  4KG6 A;  1FCN A;  4UA6 A;  5G18 A;  3TOI A;  4BEN A;  4OVD A;  1K54 C;  5CER A;  2WKI A;  3VMA A;  4DDY A;  5FAS A;  4OQG A;  3LO7 A;  2A3U A;  2HP9 A;  4WZ4 A;  1KGF A;  1BT5 A;  2HP5 A;  1TDL A;  3DTM A;  1ES2 A;  2WK0 A;  4KZ7 A;  1N4O A;  4QY6 A;  1ONG A;  2JBF A;  4KZ9 A;  5GLB A;  2VGJ A;  2JCH A;  3Q7V B;  2PBY A;  3IF6 A;  3NDE A;  4K91 A;  4EUZ A;  3FKW A;  5HL1 A;  1K57 A;  1SCW A;  4QY5 A;  4KQQ A;  3PAG A;  1BZA A;  1W7F A;  4N9L A;  1KGE A;  1K25 A;  5FQI A;  3Q07 A;  3ZNY A;  4JKT A;  4UAA A;  1VQQ A;  3PBO A;  3FKV A;  4OQI A;  2ZQ7 A;  1PW8 A;  1K6R A;  5FAP A;  1BUL A;  1IKG A;  4OOY A;  1MY8 A;  4EQI A;  3CG5 A;  5FAO A;  1L2S A;  3SOI A;  3BLM A;  2Q9M A;  3G31 A;  4YIN A;  4CPK A;  1XPB A;  3HLF A;  5AQ7 A;  1XA1 A;  1FCM A;  4HEF A;  1MWS A;  1ES4 A;  3V5M A;  4PM5 A;  3G35 A;  3RJU A;  4B4Z A;  1MBL A;  1NJ4 A;  1I2S A;  3O87 A;  4OPR A;  4OOM A;  4DE1 A;  3OC2 A;  1OME A;  2WYX A;  5GHX A;  2EXB A;  1YM1 A;  4DXB A;  1KDW A;  1PYY A;  3Q1F A;  4H8R A;  4GKU A;  4DRT A;  1E3U D;  5FAQ A;  3ZG9 B;  1E25 A;  5KSC A;  2Y2G A;  3AGD A;  1TVF A;  1TDG A;  3SS3 A;  4NET A;  1XA7 A;  2J8Y A;  4BD1 A;  1KVM A;  4Z9Q A;  2FFF B;  2OLV A;  1W79 A;  1CI9 A;  2ZJ9 A;  3VOZ A;  3MKE A;  3TG9 A;  1FSY A;  3GQZ A;  3UE0 A;  4XUZ A;  4R23 A;  5CTM A;  5A93 A;  4N92 A;  4E3N A;  3HVF A;  3IXG A;  3OPH A;  3M6B A;  1YT4 A;  3MBZ A;  3A3F A;  2HDS A;  1NY0 A;  1ONH A;  2ZC7 A;  3NIA A;  2HDQ A;  3IWO A;  5CHJ A;  4MBH A;  1QME A;  4OH0 A;  3ZNT A;  1H5X A;  4E3K A;  3EQV A;  5GHZ A;  1JVJ A;  2WZX A;  2QZ6 A;  3BEC A;  4JBF A;  4KZ5 A;  2J9O A;  1NYY A;  4OP8 A;  4PM9 A;  4UHU A;  2OV5 A;  3O86 A;  4EV4 A;  3LCE A;  2DRW A;  5HAQ A;  3AGF A;  2HDU A;  2EFU A;  5CGS A;  1PZP A;  3NY4 A;  3QNB A;  1QMF A;  1IYQ A;  4Y7P A;  3UNW A;  3VFH A;  5CGW A;  5TFQ A;  3ZFZ A;  2Y2I A;  2P74 A;  3HLE A;  2HDR A;  5CEC A;  3HUO A;  3BFD A;  1MWR A;  1BLC A;  3Q81 A;  4WYY A;  1KGG A;  4BQM A;  1KDS A;  4A5R A;  3NBL A;  2UWX A;  5A90 A;  4OPY A;  1IYP A;  1CK3 A;  4RA7 A;  4R3J A;  1CEG A;  3GSG A;  1Y54 A;  2Y2L A;  3A3D A;  4OKP A;  5CEB A;  3VP0 A;  4P85 A;  2XD5 A;  1S6R A;  4RX2 A;  3G2Z A;  3O88 A;  1ESI A;  3MKF A;  4LCL A;  3MZE A;  2ZQD A;  3E2L A;  4KZ8 A;  2ZM8 A;  4JF4 A;  2Y4A A;  1YMS A;  2J7V A;  3G30 A;  1WYC A;  4HBT A;  3HBR A;  3PBN A;  1K54 A;  3IF5 A;  4R4R A;  2R9W A;  2BLS A;  4IED A;  1ES5 A;  2ZLY A;  2H0Y A;  1BSG A;  1FR6 A;  4LV1 A;  2E8I A;  2IWC A;  4S2L A;  4KZ6 A;  5KMW A;  3VP1 A;  1L0G A;  4KQO A;  1M40 A;  4DKI A;  3IWI A;  1RP5 A;  3S4X A;  3GR2 A;  1PI5 A;  3Q7Z A;  5KZH A;  3WS4 A;  2X02 A;  4KG5 A;  4OON A;  1K56 D;  1PIO A;  4N9K A;  2H5S A;  4MLL A;  5EPH A;  1CEF A;  2XFS A;  1IEM A;  5DF8 A;  4PMA A;  4R4S A;  5FQK A;  4EBP A;  4FD8 A;  3G34 A;  3ZDJ A;  4JXS A;  4WM9 A;  4WEL A;  1JTD A;  2RL3 A;  2VGK A;  5FDH A;  5FSR A;  3O3V A;  3CZD A;  3I7J A;  1S0W A;  1E4D A;  3P09 A;  4DXC A;  4DE0 A;  1W8Q A;  2EXA A;  3N8S A;  1EI5 A;  1Q2Q A;  5HAP A;  1E3U A;  3CJM A;  4ZBE A;  4X53 A;  1GHI A;  3VP4 A;  4MNR A;  1K57 C;  3DW0 A;  1I5Q A;  1NRF A;  3BYD A;  1KVL A;  3GV9 A;  1DJA A;  4BLM A;  2QMI A;  2Y2P A;  4OQH A;  1LLB A;  1RGZ A;  2ZQ8 A;  4P87 A;  4ZAM A;  3PBR A;  4S2P A;  3HUM A;  4F94 A;  4X56 A;  5F1F A;  1K56 A;  3LEZ A;  1RCJ A;  1M6K A;  4GDB A;  4WEJ A;  3UDI A;  4PM7 A;  3IWQ A;  5HAR A;  1WYB A;  1NZO A;  3C7U A;  2OSU A;  5GHY A;  1IYO A;  2WGW B;  4WZ5 A;  4WZ5 C;  4U0T A;  2OLU A;  4P6B A;  3S1Y A;  4DE2 A;  4Y0U A;  4PPR A;  4S2N C;  3MZD A;  5M18 A;  4FH2 A;  1ERQ A;  4OPZ A;  5GLA A;  2CC1 A;  3GTC A;  4EBN A;  1LL9 A;  2Z2M B;  2WZZ A;  1ZKJ A;  3NCK A;  3MZF A;  3UY6 A;  1SHV A;  1C3B A;  1K6S A;  3IQA A;  2G2W A;  4LCM A;  4M3K A;  4DDS A;  4EWF A;  3IH8 A;  3PBT A;  2Y2N A;  3FZC A;  4PM6 A;  5AQA A;  2J9P A;  3IXB A;  3SH7 A;  3W8K A;  3ZGA B;  1VM1 A;  4C75 A;  1O07 A;  3E2K A;  1BLP A;  1ERM A;  5BOH A;  3QHY A;  3HLG A;  4MBF A;  4X55 A;  4KZB A;  1YLT A;  5F1G A;  2WGI A;  4YFM A;  4OPQ A;  5DF7 A;  5EVL A;  5F82 A;  5F83 A;  4DF6 A;  4BL2 A;  1LHY A;  4ZJ3 A;  2WKH A;  1XP4 A;  5CTN A;  1SDN A;  4KZ3 A;  5DTT A;  4D2O A;  3IHB A;  3UPO A;  2DCF A;  5FA7 A;  3ZVW A;  3N8L A;  4KQR A;  2X01 A;  1HTZ A;  1WE4 A;  2Y2Q A;  2ZM0 A;  2ZM2 A;  3S22 A;  4X6T A;  2Y2J A;  1L0E A;  2Y55 A;  3BRM A;  3WWX A;  5KSH A;  5E43 A;  1PI4 A;  2B5R A;  5EE8 A;  1BUE A;  3VP3 A;  2ZC4 B;  4WEK A;  2C6W B;  3G2Y A;  4QJG A;  3HLD A;  5U47 A;  5EVI C;  3BFE A;  5TR7 A;  4IVK A;  2XR0 A;  4X69 A;  3V39 A;  4GD6 A;  1FSW A;  3G4P A;  1BLH A;  2G2U A;  2Y2K A;  3GMW A;  3IH9 A;  3LY4 A;  3N4I A;  4N1H A;  5EVI D;  3UPN A;  5CED A;  4JXG A;  2WUQ A;  5CHU A;  3N8R A;  4IBX A;  2ZMA A;  4WBG A;  2XDM A;  4JF5 A;  4O7D A;  3DWZ A;  3SH9 A;  2R9X A;  4KG2 A;  2IWB A;  3M2K A;  3IXD A;  4Q8I A;  3FWL A;  3JYI A;  1K4F A;  1YLJ A;  2XD1 A;  3FV7 A;  4OQ0 A;  4JXV A;  4OP5 A;  2XFT A;  3SS4 A;  2HP6 A;  4N1X A;  5DVA A;  1GCE A;  5M1A A;  4C6Y A;  2ZC6 B;  4UA7 A;  3DWK A;  3ZVT A;  3ZG5 A;  4GD8 A;  1ZC2 A;  5FQJ A;  3ZG0 A;  3PTE A;  3HL9 A;  2XF3 A;  3OCN A;  4E3J A;  4GZB A;  2V2F F;  4FCF A;  2Y2H A;  5FQM A;  3HLW A;  1L0D A;  1YLP A;  4IBR A;  4ID4 A;  3UPP A;  4U3T A;  2XEP A;  1IYS A;  2DNS A;  4GDN A;  4EBL A;  1FCO A;  1JWZ A;  3IT9 A;  3AGE A;  3HUN A;  1ES3 A;  2Y91 A;  4QHC A;  3Q7V A;  5EEC A;  1HVB A;  3BM6 A;  3ZG7 B;  3ZG8 B;  1PWC A;  3WRZ A;  4C3Q A;  3HLB A;  3NI9 A;  4S2N A;  2X71 A;  4XUX A;  4RYE A;  1SDE A;  3C4O A;  5E2H A;  3VP2 A;  3BFG A;  3LY3 A;  4LV2 A;  4B4X A;  1NYM A;  1NXY A;  5FI6 A;  1SKF A;  2IWD A;  3MFD A;  4E3O A;  1NZU A;  4HES A;  3WS1 A;  1W5D A;  3UDX A;  3W4Q A;  4E6X A;  1FOF A;  2XK1 A;  3B3X A;  4U0X A;  3C7V A;  3D4F A;  4QB8 A;  1U60 A;  1HD8 A;  1YLY A;  1GA9 A;  4DE3 A;  1LI0 A;  1FR1 A;  5L2F A;  3GRJ A;  3UN7 A;  3IF6 C;  3IHA A;  4S2O A;  5CGX A;  4WMC D;  1Q2P A;  5FI7 A;  3UE3 A;  3VSK A;  5JYP A;  4RX3 A;  4CJN A;  1K4E A;  5HAI A;  3GVB A;  4R0Q A;  3OCL A;  5CRF A;  4S2M A;  1PWD A;  1KE3 A;  2HPB A; 
#chains in the Genus database with same CATH topology
 2A49 A;  3LR3 A;  3EQU A;  5HPI A;  1OTA A;  3NUL A;  2C5W B;  1ZG4 A;  4IUK A;  4CLC B;  1DJC A;  1PWG A;  3BY8 A;  1IEL A;  2QJ5 A;  4YNR A;  3WS2 A;  1P9W A;  3NDG A;  2FFY A;  1K55 C;  4XXR A;  4MEZ A;  1L0F A;  3HCY A;  3MF0 A;  1MXO A;  2WAF A;  2XGN A;  3R7W B;  1T1B A;  3UMD A;  5DJU A;  2B95 A;  4E6W A;  2ZC5 B;  1JWV A;  1ZTU A;  4P0M A;  2I72 A;  3LGO A;  5A91 A;  1L3L A;  2Y59 A;  2XLN A;  2BG1 A;  5HDS A;  3D3O A;  4S2J A;  3E4Q A;  4WMC A;  5IS1 A;  4BD0 A;  5GLC A;  2XSS A;  1I2W A;  2HV1 A;  4FSF A;  1H8Y A;  2PHY A;  2EX9 A;  4ZJ2 A;  4BBT A;  1YLZ A;  1IKI A;  4ARZ B;  2Q0O A;  4PAU A;  1KOU A;  2ZC3 B;  4ZDX A;  2WAD A;  2W3G A;  3BJN A;  4GN2 A;  3W4P A;  2ZD8 A;  3A3E A;  5E2F A;  2HJE A;  3A3I A;  3CUE A;  3UB7 A;  4I5S A;  1G6A A;  4HBU A;  2ZL1 B;  3M2J A;  5JYO A;  2QPN A;  3D72 A;  1W8Y A;  3IF6 B;  3IX3 A;  2K7S A;  1UWP X;  1MWU A;  3UO9 A;  4BL3 A;  1XX2 A;  3S7P A;  3BLS A;  5AQB A;  2HJ9 C;  4HP9 A;  3C2W A;  4K0X A;  1H8Z A;  1OTB A;  3WRT A;  3SW1 A;  1JTG A;  3ZCZ A;  4IUH A;  2Z6C A;  4H6J B;  4G3K A;  5CER A;  4DDY A;  4OQG A;  4HJ4 A;  4WZ4 A;  2D01 A;  2AVX A;  3PXP A;  4P6Z M;  4QY6 A;  1XFQ A;  2JCH A;  3Q7V B;  3B33 A;  2GJ3 A;  4EUZ A;  3FKW A;  1SCW A;  4QY5 A;  3FC7 A;  3GDI A;  1D1J A;  1K25 A;  5FQI A;  1GSW A;  1V9Y A;  4UAA A;  4OQI A;  4WL9 A;  1PW8 A;  1K6R A;  2V1A A;  1BUL A;  3DTE A;  3H9W A;  4OOY A;  4CPK A;  4HEF A;  4MN6 A;  4PKY G;  1F98 A;  3O87 A;  4OOM A;  2EXB A;  1PYY A;  2JN7 A;  2BAS A;  2J8Y A;  4NXG A;  4BD1 A;  1KVM A;  4MN5 A;  1YPR A;  4Z9Q A;  5FDS A;  3GQZ A;  3UE0 A;  2K31 A;  3CUE C;  5HSQ A;  3OPH A;  3MBZ A;  4MMN A;  3A3F A;  3NIA A;  3EGX C;  3LUQ A;  1NRJ A;  4CLC D;  2J9O A;  4OP8 A;  4YOF A;  4PM9 A;  4EQ1 A;  3LCE A;  4HP4 A;  5FEG A;  2DRW A;  2HDU A;  2YKH A;  1QMF A;  1P9R A;  4Y7P A;  3ZFZ A;  2J3T D;  3HLE A;  1MWR A;  3FG8 A;  1KGG A;  1KDS A;  4A5R A;  5L09 A;  4R3J A;  2JKR I;  2XD5 A;  3MQQ A;  2PYR A;  3O88 A;  4HJ6 A;  3IS2 B;  4R4R A;  3IF5 A;  2R9W A;  2VKS A;  5K5B A;  4KZ6 A;  2QHK A;  5DFX A;  3S4X A;  3LYX A;  5KZH A;  4GHI B;  4OON A;  3MXQ A;  3PR6 A;  5EPH A;  1CEF A;  4GHI A;  4Y3I A;  3UB6 A;  5FQK A;  4FD8 A;  2FZ0 A;  2K2N A;  4WEL A;  2VGK A;  1CJF A;  1VET B;  3I7J A;  3P09 A;  2EXA A;  3LIE A;  2EWW A;  1GHI A;  1K57 C;  3BYD A;  4GLQ A;  4OQH A;  4WN5 A;  4ZAM A;  4X56 A;  1RCJ A;  1HLU P;  4GDB A;  3IWQ A;  1WYB A;  1XFN A;  3T4Q A;  1XJ4 A;  2WGW B;  4WZ5 A;  3ZYT A;  4LPZ A;  4P6B A;  3S1Y A;  3E4O A;  4Y0U A;  4FH2 A;  3GTC A;  4EBN A;  2WZZ A;  2PT7 A;  3NCK A;  2WKP A;  3CPT B;  2G2W A;  4LCM A;  4M3K A;  4DDS A;  4Q0J A;  4E04 A;  3VV4 A;  1S4R A;  2Y2N A;  4PM6 A;  2J9P A;  3ZGA B;  1VM1 A;  3RH8 B;  1LSX A;  1ERM A;  3HLG A;  2Y79 A;  4I38 A;  1LL8 A;  4YFM A;  4OPQ A;  5EVL A;  5F82 A;  4BL2 A;  2WKH A;  1XP4 A;  5CTN A;  1SDN A;  5DTT A;  3IHB A;  3UPO A;  4KQR A;  1HTZ A;  2Y2Q A;  2O9B A;  4X6T A;  2Y2J A;  1L0E A;  3C8C A;  1PI4 A;  1YSQ A;  3T12 B;  5EE8 A;  3VP3 A;  4K08 A;  2C6W B;  3CI6 A;  3IX8 A;  1S1Z A;  2XR0 A;  5FAS A;  3G4P A;  2G2U A;  3IH9 A;  3UPN A;  2XA7 M;  2D02 A;  4IHQ A;  5CHU A;  2VV6 A;  2XRN A;  2R9X A;  2IWB A;  3M2K A;  3JYI A;  2XD1 A;  3FV7 A;  4OQ0 A;  2V8C A;  4JXV A;  2HP6 A;  5DVA A;  5M1A A;  2E8J A;  4UA7 A;  5KIZ A;  4GD8 A;  3QP4 A;  3LR0 A;  2V2F F;  5FQM A;  4IBR A;  4U3T A;  1OT9 A;  1FCO A;  3IT9 A;  2GX5 A;  3HUN A;  2ZMV A;  3A0V A;  3Q7V A;  1S66 L;  4R38 A;  4C3Q A;  3EWK A;  3NI9 A;  2PDR A;  2X71 A;  1SDE A;  3LY3 A;  5FI6 A;  1PNE A;  4EER A;  4E3O A;  1W5D A;  5F68 A;  3GEC A;  3W4Q A;  3C7V A;  3D4F A;  1YLY A;  5A8B A;  4I39 A;  5HD3 A;  4S2O A;  4WMC D;  3F1N A;  3W2Z A;  4RX3 A;  3LR4 A;  1YKD A;  5CRF A;  4JGO A;  4EU0 A;  4S2M A;  1KE3 A;  2XH9 A;  4RVA A;  2EX6 A;  1ZG6 A;  1VB6 A;  1EWZ A;  3VFF A;  4LEN A;  5HWT A;  4OLD A;  4Y0O A;  1BLS A;  4B88 A;  2A24 A;  5E2G A;  3MR0 A;  3F1N B;  1DP9 A;  1G68 A;  5AVF A;  3WS5 A;  3T4K A;  2V20 A;  5GLD A;  5GL9 A;  1XXM A;  1KE0 A;  2W3D A;  5FQ9 A;  1NLY A;  5CXW A;  1O7E A;  4E3M A;  5EVI A;  4JLF A;  3ITB A;  2J3T C;  3MXR A;  3RTY A;  5F6A A;  4D60 A;  5I94 A;  3CIT A;  4R3B A;  2P9V A;  4Y13 A;  2PAV P;  1HZO A;  3TRC A;  2P9V B;  1GHP A;  4QU3 A;  1Z6F A;  3M6H A;  3MXS A;  5TGF A;  3KO6 A;  1YQS A;  4I3A A;  3BWL A;  4WLA A;  3NEC A;  3IXH A;  5D3O A;  3VE4 A;  5FQQ A;  3ITA A;  3VOY A;  1CI8 A;  5IHV A;  4NK3 A;  2KOI A;  5HDC A;  5FI2 A;  5HPF A;  4PHT A;  1MKI A;  3HLC A;  2PD7 A;  2VJW A;  1PZO A;  2A2L A;  4GOG A;  3G32 A;  2ZMF A;  3NHQ A;  4L0L A;  4IJG A;  1H8M A;  1Y4O A;  4ZRR A;  1LT0 A;  2ZQ9 A;  4MBK A;  5DF9 A;  3RXX A;  3WS0 A;  1XGI A;  4ZTK A;  2QKP A;  4Y0T A;  2PYP A;  3JVV A;  3SS5 A;  1YMX A;  2NUP C;  2Y2O A;  4QD4 A;  2B18 A;  5FAT A;  3LID A;  2Y8H A;  5HWW A;  3H7W A;  3BQ8 A;  3T1R A;  4BEN A;  2P7J A;  3QP1 A;  2WKI A;  2A3U A;  1KGF A;  1TDL A;  2W1T B;  3DTM A;  1N4O A;  2GZA A;  2PBY A;  3NDE A;  4K91 A;  5HL1 A;  3HJK A;  1K57 A;  3KYQ A;  1BZA A;  1NLZ A;  1W7F A;  1KGE A;  4JGQ A;  4I3I A;  1VQQ A;  2V8F A;  4WF0 A;  4LLO B;  1IKG A;  4EQI A;  1L2S A;  2Q9M A;  3G31 A;  1XPB A;  4HI4 A;  1XA1 A;  1T19 A;  4PM5 A;  4OPR A;  2EWV A;  1T18 A;  3CLO A;  1KDW A;  4H8R A;  4GKU A;  4DRT A;  5FAQ A;  3ZG9 B;  1E25 A;  3AGD A;  3SS3 A;  2FFF B;  2VV8 A;  1W79 A;  1CI9 A;  2HF6 A;  5CTM A;  1D7E A;  3IXG A;  2HDS A;  5CHJ A;  4OH0 A;  1DP6 A;  4E3K A;  2WZX A;  2QZ6 A;  3FPW A;  1NYY A;  3O86 A;  4EV4 A;  5LBR A;  1PZP A;  5F5Y A;  2JKG A;  4R6L A;  5CGW A;  2VZW A;  2Y2I A;  1WA9 A;  2P74 A;  4EEP A;  3Q81 A;  1BLC A;  4HHD A;  4NKP A;  2OAP 1;  1CK3 A;  4RA7 A;  1CEG A;  3U2A A;  3BY9 A;  3A3D A;  4P85 A;  4RX2 A;  4MCW A;  1ESI A;  4LCL A;  3MZE A;  4KZ8 A;  1F2K A;  2V0U A;  1WYC A;  3E0Y A;  3HBR A;  3MQ0 A;  4IED A;  1ES5 A;  5HWV A;  1ACF A;  2E8I A;  3VP1 A;  4KQO A;  4DKI A;  1RP5 A;  1PI5 A;  4DJ3 A;  3Q7Z A;  3WS4 A;  2DMW A;  4MLL A;  5DF8 A;  4EBP A;  4H6J A;  1E4D A;  4DE0 A;  3N8S A;  3VP4 A;  1I5Q A;  3T1X A;  1TS0 A;  3GV9 A;  1DJA A;  4BLM A;  2QMI A;  1LLB A;  3F1P B;  1K56 A;  3EGD C;  2INW A;  3T4L A;  2OLU A;  4PPR A;  2M7V A;  3V67 A;  2CC1 A;  1LL9 A;  3MZF A;  2JKT I;  3UB5 P;  1SHV A;  4ME4 A;  3IQA A;  3PBT A;  5IU1 A;  2KDK A;  3SH7 A;  3W8K A;  1O07 A;  4BBU A;  3E2K A;  5IT5 A;  5BOH A;  1W63 Q;  5G4Z A;  1P0Z A;  2O99 A;  3S7N A;  3T1S A;  2WGI A;  2YKF A;  4GS9 A;  4KZ3 A;  3LI9 A;  5FA7 A;  3ZVW A;  3EOI A;  1BYW A;  3S22 A;  3LI8 A;  5KSH A;  2B5R A;  3DTI A;  1BUE A;  2Z6D A;  3G2Y A;  3HLD A;  5EVI C;  3BFE A;  4GD6 A;  1FSW A;  2Y2K A;  3GMW A;  5EVI D;  3C38 A;  5HL6 A;  3A0R A;  5CED A;  3N8R A;  2J80 A;  4WBG A;  4BWI A;  3CAX A;  4O7D A;  2XRO A;  4LFU A;  4Q8I A;  4OP5 A;  2XFT A;  1D06 A;  3DWK A;  3ZVT A;  4F3L A;  3ZG5 A;  5FQJ A;  3ZG0 A;  3PTE A;  1FIK A;  4GZB A;  3OBF A;  4F3L B;  2PD8 A;  1TS6 A;  2W3E A;  1YLP A;  2J3W A;  4YWZ A;  1IYS A;  4GDN A;  3IBR A;  1JWZ A;  3AGE A;  1CF0 A;  2EA9 A;  1ZHH B;  2M7U A;  3S7Q A;  4RYE A;  1UGU A;  3VP2 A;  4HH2 A;  4UQI S;  1NYM A;  2IWD A;  3MFD A;  3UDX A;  3ULF A;  1FOF A;  1XJ6 A;  3B3X A;  1GA9 A;  1VEU A;  2V1B A;  4AFI A;  1N9N A;  2M1C A;  3LIA A;  3KYZ A;  3UE3 A;  5MC7 A;  4CJN A;  1K4E A;  2VGL M;  1FIL A;  3UB9 A;  5AJG A;  3NC8 A;  1PWD A;  3G30 A;  4U0T A;  4GB7 A;  4L9F A;  1OT6 A;  3VOL A;  2Z2L B;  3PYP A;  2JC7 A;  5HFO A;  1LL5 A;  4IVI A;  5DKK A;  4GS9 B;  3OPP A;  5EOE A;  5L10 A;  1OTD A;  2GDN A;  4ESP A;  1YLW A;  4UA9 A;  5EM0 A;  3PBQ A;  4K0W A;  4EW7 A;  4JGP A;  2WGV A;  4WUJ A;  1GSV A;  3VSL A;  1TEM A;  4FH4 A;  2JE5 A;  3BW6 A;  1W63 M;  3S7O A;  3P01 A;  5CHM A;  3K3C A;  1IFQ A;  1MPL A;  1T1C A;  1N9O A;  3E98 A;  3ICY A;  5EOO A;  4KZ4 A;  3OPL A;  1JWP A;  3OOV A;  3OZH A;  5DTK A;  3HJI A;  3C5A A;  5HW3 A;  1PFL A;  2V9A A;  2EFX A;  3ZHH A;  4S2K A;  4EUV A;  1ALQ A;  1DJB A;  1TS8 A;  1ODV A;  2V1Z A;  3UDF A;  2Q9N A;  1SZV A;  1K55 A;  3T4T A;  5EFW A;  2XQZ A;  4BJP A;  4KZA A;  1PRQ A;  2G7U A;  1MWT A;  3PAE A;  3C4P A;  1N9B A;  4ARZ A;  2Y2M A;  2OOL A;  1ERO A;  2WGW A;  1BTL A;  2I9V A;  4LRY C;  5M19 A;  4KEN B;  2KX6 A;  4JF6 A;  3E4P A;  5AQ9 A;  1GA0 A;  3QNC A;  5TBM B;  4I3J A;  4LV0 A;  1V9Z A;  4CQH A;  1FQG A;  4KG6 A;  1FCN A;  4UA6 A;  4EET B;  4P6Z S;  1X0O A;  3L7H A;  3VMA A;  1MKM A;  2HP5 A;  4UEY A;  2WK0 A;  1OPX A;  4KZ7 A;  2VA0 A;  4KQQ A;  3LR5 A;  1F9I A;  5FAP A;  3KX0 X;  5FAO A;  3SOI A;  3BLM A;  4YIN A;  3BQA A;  3HLF A;  5AQ7 A;  3NJA A;  1MWS A;  3F1O B;  3G35 A;  3RJU A;  4B4Z A;  1MBL A;  4DE1 A;  1OME A;  1F5M A;  2WYX A;  5GHX A;  2B02 A;  1H3Q A;  2ZOH A;  1TVF A;  1TDG A;  3OLO A;  1XA7 A;  5TBM A;  4MDZ A;  1OTE A;  2OLV A;  2VK3 A;  3MKE A;  4XUZ A;  4R23 A;  3HVF A;  3M6B A;  1YT4 A;  2JHE A;  1NY0 A;  1ONH A;  1QME A;  3ZNT A;  3EQV A;  1JVJ A;  1TS7 A;  4ETZ A;  4KZ5 A;  4UHU A;  2OV5 A;  1MC0 A;  5J7E A;  4G3V A;  4KUK A;  2QJ7 A;  4XT2 B;  3UNW A;  3VFH A;  1GSX A;  1XJ2 A;  3LIF A;  5CEC A;  4PKY A;  4WYY A;  3KYE A;  2BTF P;  5C5K A;  3NBL A;  2WKR A;  1IYP A;  1Y54 A;  4DMZ A;  4GJ4 A;  4OKP A;  1Z09 A;  3G6O A;  4Y17 A;  3E2L A;  2Y4A A;  1YMS A;  4HBT A;  2BLS A;  2ZLY A;  3DBA A;  2H0Y A;  1BSG A;  1FR6 A;  2IWC A;  4S2L A;  5KMW A;  1L0G A;  1VEU B;  1M40 A;  3UE6 A;  3GR2 A;  2HZ5 A;  4KG5 A;  4ETX A;  3NOT C;  3KSG A;  4PMA A;  3G34 A;  4FUW A;  4JXS A;  5FSR A;  1S0W A;  4DXC A;  1W8Q A;  1EI5 A;  2L4R A;  5HAP A;  4X53 A;  3EEH A;  3DW0 A;  1NRF A;  1KVL A;  3CHW P;  2Y2P A;  2ZQ8 A;  4P87 A;  4DN0 A;  3PBR A;  3HUM A;  5F1F A;  5FEF A;  1M6K A;  5HAR A;  3C7U A;  2OSU A;  1IYO A;  2W1R A;  4BBV A;  4DE2 A;  5HDD A;  5M18 A;  5TJJ A;  5GLA A;  2Z2M B;  5EM1 A;  1ZKJ A;  5AQA A;  3IXB A;  1BLP A;  2V0W A;  3QHY A;  3LEQ A;  4MBF A;  1YLT A;  3K2N A;  2JKT M;  5DF7 A;  5F83 A;  4DF6 A;  1LHY A;  4D2O A;  5CX7 A;  1VHM A;  2X01 A;  3EEA A;  2ZM0 A;  2ZM2 A;  2GNX A;  2Y55 A;  3BRM A;  4HOI A;  5E43 A;  4X25 A;  3T1Q B;  4KUO A;  1VET A;  4QJG A;  1G6O A;  5U47 A;  2W27 A;  4IVK A;  3V39 A;  4X69 A;  3NOU C;  1K0K A;  3LY4 A;  4N1H A;  5L8M A;  4JXG A;  4O01 A;  4IBX A;  2ZMA A;  4HQA A;  2XDM A;  4JF5 A;  3SH9 A;  4KG2 A;  3MSH A;  3FWL A;  3SS4 A;  4N1X A;  1GCE A;  2CMN A;  4C6Y A;  2ZC6 B;  2O9C A;  4E3J A;  3HL9 A;  2XF3 A;  3OCN A;  4II7 A;  5AVE A;  5EVE A;  3ZQ5 A;  3IS2 A;  3MJQ A;  2Y2H A;  3HLW A;  1L0D A;  1NWZ A;  4ID4 A;  3UPP A;  3C30 A;  2XEP A;  2DNS A;  4EBL A;  4QHC A;  1HVB A;  3BM6 A;  3HLB A;  1YSP A;  3D9Y A;  3C4O A;  3F1O A;  4LV2 A;  4B4X A;  3UB8 A;  1NXY A;  2KLI A;  1SKF A;  4HES A;  4E6X A;  2XK1 A;  4U0X A;  4QB8 A;  1HD8 A;  4DE3 A;  1LI0 A;  1FR1 A;  3KSF A;  5L2F A;  3GRJ A;  4Y15 A;  3KSH A;  3IHA A;  2PR5 A;  5FI7 A;  4HY8 A;  5FL3 A;  1AWI A;  1G5U A;  5HAI A;  3GVB A;  4R0Q A;  4QWO A;  3B47 A;  2HPB A;  1PW1 A;  3FYZ A;  1LI9 A;  4JPM A;  4E3L A;  3Q82 A;  1RGY A;  2W3H A;  2H10 A;  1AXB A;  2LB5 A;  5HD5 A;  4ZJ1 A;  4S2I A;  3ISG A;  4GNU A;  3N7W A;  2P08 A;  3LFV A;  3UE1 A;  3V3R A;  1ESU A;  3HRE A;  5E2E A;  4NXF A;  1K38 A;  3N6I A;  4LGW A;  4Y2F A;  3LIC A;  2EX8 A;  3P98 A;  4HH3 A;  3TJZ C;  4R1G A;  3VE3 A;  2A24 B;  2VEA A;  4OLG A;  3IBJ A;  2ZL1 A;  2FH5 A;  4NXE A;  4LV3 A;  3OPR A;  5DTS A;  3RXW A;  3A0S A;  3CMZ A;  4JXW A;  2WAE A;  1A0K A;  2RCX A;  1KE4 A;  3SH8 A;  2OAQ 1;  2PU4 A;  2ZQA A;  4B9O A;  2ZQC A;  5J8X A;  2JKF A;  1GHM A;  3QP5 A;  1TD5 A;  3JVU A;  4X68 A;  4R70 A;  2EX2 A;  3B42 A;  1J9M A;  1T1A A;  4OOL A;  1XKZ A;  2R78 A;  3BEB A;  3W4O A;  2H0T A;  2WKE A;  2LB9 A;  5EVI B;  3H7W B;  3O5Y A;  5A92 A;  3SZT A;  2O9A A;  2PBD P;  5J4E A;  4PM8 A;  5EUA A;  5HX9 A;  4UQI M;  3A3J A;  1XGJ A;  3DTK A;  2PU2 A;  3FPV A;  3BFC A;  3PBS A;  4LRX C;  4E3I A;  3TSG A;  3V3S A;  4NXB A;  3BFF A;  4MN7 A;  3V50 A;  3JPU A;  1DY6 A;  1IOU A;  1DP8 A;  5G18 A;  2MJ6 A;  3TOI A;  1S1Y A;  4OVD A;  1K54 C;  3LO7 A;  2HP9 A;  1G28 A;  1BT5 A;  1H0M A;  1ES2 A;  4X1M A;  1ONG A;  2JBF A;  4KZ9 A;  1CQA A;  5GLB A;  2VGJ A;  3IF6 A;  3IX4 A;  2VGL S;  5G4Y A;  3PAG A;  4N9L A;  4LRZ E;  1EW0 A;  3Q07 A;  3ZNY A;  4JKT A;  1S67 L;  3FKV A;  3PBO A;  2ZQ7 A;  1MY8 A;  3CG5 A;  4HIA A;  3H82 B;  4O0P A;  3MMH A;  1FCM A;  2L1M A;  1ES4 A;  3V5M A;  1NJ4 A;  1I2S A;  3OC2 A;  1S4S A;  1YM1 A;  4DXB A;  3Q1F A;  1E3U D;  1P97 A;  1LSW A;  5KSC A;  2Y2G A;  3NOP C;  4NET A;  2WKQ A;  2ZJ9 A;  4NG2 A;  3VOZ A;  3CPT A;  3TG9 A;  1FSY A;  4Y5F A;  2HGV A;  4EXO A;  5A93 A;  4N92 A;  4E3N A;  2ZC7 A;  2HDQ A;  3IWO A;  4MBH A;  1H5X A;  5GHZ A;  3BEC A;  4JBF A;  1SKO A;  4GW9 A;  5HAQ A;  3AGF A;  5CGS A;  2EFU A;  3NY4 A;  3QNB A;  1IYQ A;  4EEU A;  5TFQ A;  2HDR A;  3HUO A;  3BFD A;  3U4L P;  4BQM A;  2XA7 S;  2UWX A;  5A90 A;  4GCZ A;  4OPY A;  3GSG A;  3R7W A;  2Y2L A;  5CEB A;  3VP0 A;  1S6R A;  3G2Z A;  3MKF A;  4R3A A;  3PHY A;  2ZQD A;  3MQO A;  4CLC E;  2ZM8 A;  4JF4 A;  4CLC C;  2J7V A;  3PBN A;  1K54 A;  3QP2 A;  2OWH A;  1JNU A;  3DAV A;  4RQ9 A;  4LV1 A;  3QP6 A;  3IWI A;  3KSI A;  3F1P A;  2X02 A;  2W3F A;  3CWF A;  1K56 D;  1PIO A;  4N9K A;  2H5S A;  2W1T A;  2XFS A;  1IEM A;  1TF1 A;  4R4S A;  2O0Y A;  3ZDJ A;  4WM9 A;  1JTD A;  2RL3 A;  5FDH A;  3P7N A;  3O3V A;  3CZD A;  4QPR A;  4XT2 A;  1Q2Q A;  2H28 A;  4L9G A;  1E3U A;  3CJM A;  4ZBE A;  4MNR A;  2W0N A;  5DKL A;  3H82 A;  5DFY A;  5EV0 A;  1RGZ A;  2IA2 A;  4S2P A;  4F94 A;  3LEZ A;  3UDI A;  4WEJ A;  4PM7 A;  1J3W A;  1NZO A;  5GHY A;  3R4K A;  3RFB A;  4Q0I A;  4WZ5 C;  4S2N C;  3MZD A;  1ERQ A;  4OPZ A;  3TW8 A;  1OTI A;  2PR6 A;  4G3W A;  4M4X A;  3UY6 A;  2VLG A;  1C3B A;  1K6S A;  1OJ5 A;  4EWF A;  2VV7 A;  3IH8 A;  3FZC A;  5L07 A;  1DRM A;  4C75 A;  3QP8 A;  4X55 A;  4KZB A;  5F1G A;  2QWS A;  1SKO B;  3LIB A;  4Q0H A;  4ZJ3 A;  1LSV A;  4B93 A;  4CLC A;  2DCF A;  3N8L A;  1WE4 A;  5HZH A;  2P04 A;  4L9E A;  3WWX A;  4NEE D;  4FOF A;  3L9K A;  2OWJ A;  2VX8 A;  2ZC4 B;  4WEK A;  1XJ3 A;  2QYB A;  2ZBB A;  5TR7 A;  3T50 A;  2ZOI A;  3N4I A;  1BLH A;  4EES A;  2WUQ A;  1UWN X;  4KQD A;  3DWZ A;  1N9L A;  3IXD A;  1K4F A;  1YLJ A;  4HNB A;  3MS6 A;  1STZ A;  5J3W A;  4HJ3 A;  4JGR A;  3MFX A;  5DJT A;  4X1L A;  2NUT C;  1ZC2 A;  3T4S A;  4BMW A;  4FCF A;  2PRF A;  3T4J A;  2L0W A;  1ES3 A;  2Y91 A;  5EEC A;  1MZU A;  3TE8 A;  3ZG7 B;  3ZG8 B;  1PWC A;  3WRZ A;  4DJ2 A;  4S2N A;  4XUX A;  5E2H A;  3UME A;  3BFG A;  4Z1W A;  1Y28 A;  2UV0 E;  1YAX A;  1NZU A;  2JKR M;  3WS1 A;  1U60 A;  2ACG A;  1OJG A;  3UN7 A;  3IF6 C;  5CGX A;  1Q2P A;  3VSK A;  4O8G A;  4FTX A;  5F69 A;  5JYP A;  5I5L A;  3T4O A;  3K3D A;  3OCL A; 
#chains in the Genus database with same CATH homology
 1PW1 A;  4GB7 A;  2A49 A;  2XH9 A;  3VOY A;  3FYZ A;  4RVA A;  2EX6 A;  1LI9 A;  3EQU A;  4JPM A;  1ZG6 A;  2Z2L B;  4E3L A;  3Q82 A;  2C5W B;  1RGY A;  1ZG4 A;  1EWZ A;  2JC7 A;  5HFO A;  3VFF A;  4LEN A;  1DJC A;  2H10 A;  4OLD A;  1LL5 A;  1PWG A;  4Y0O A;  1IEL A;  1BLS A;  1AXB A;  4IVI A;  4B88 A;  3WS2 A;  5E2G A;  3OPP A;  4ZJ1 A;  3NC8 A;  5EOE A;  4S2I A;  3NDG A;  3ISG A;  2FFY A;  1K55 C;  4GNU A;  4XXR A;  3N7W A;  1G68 A;  3UE1 A;  4MEZ A;  2GDN A;  1L0F A;  3WS5 A;  1YLW A;  3V3R A;  1ESU A;  4UA9 A;  2V20 A;  3HRE A;  5GLD A;  5GL9 A;  1XXM A;  5E2E A;  3PBQ A;  4K0W A;  1K38 A;  3N6I A;  1MXO A;  2WAF A;  2XGN A;  2WGV A;  1KE0 A;  5FQ9 A;  3VSL A;  1TEM A;  4FH4 A;  4E6W A;  2ZC5 B;  1JWV A;  4P0M A;  2EX8 A;  2I72 A;  5CXW A;  3P98 A;  1O7E A;  5A91 A;  4E3M A;  4R1G A;  5EVI A;  2Y59 A;  2JE5 A;  2BG1 A;  2XLN A;  4JLF A;  3ITB A;  4S2J A;  5CHM A;  4WMC A;  4OLG A;  1MPL A;  3MXR A;  4BD0 A;  5GLC A;  4LV3 A;  5I94 A;  1I2W A;  3OPR A;  5EOO A;  4FSF A;  1H8Y A;  4KZ4 A;  2EX9 A;  5DTS A;  4ZJ2 A;  1YLZ A;  3RXW A;  1IKI A;  3OPL A;  1JWP A;  3CMZ A;  4R3B A;  2P9V A;  3OZH A;  4JXW A;  5DTK A;  3C5A A;  5HW3 A;  1HZO A;  2P9V B;  1GHP A;  2WAE A;  2ZC3 B;  2WAD A;  4QU3 A;  2RCX A;  1KE4 A;  1Z6F A;  3M6H A;  4ZDX A;  3MXS A;  3SH8 A;  5TGF A;  2EFX A;  2PU4 A;  2ZQA A;  1YQS A;  2ZQC A;  5J8X A;  3ZHH A;  4S2K A;  1ALQ A;  1DJB A;  4GN2 A;  3W4P A;  2V1Z A;  3UDF A;  1GHM A;  2ZD8 A;  5D3O A;  3IXH A;  4X68 A;  5FQQ A;  3A3E A;  3ITA A;  2Q9N A;  1CI8 A;  2EX2 A;  3A3I A;  4NK3 A;  5E2F A;  5IHV A;  1K55 A;  1G6A A;  4HBU A;  5FI2 A;  1J9M A;  3M2J A;  5JYO A;  4OOL A;  2QPN A;  1MKI A;  1XKZ A;  2XQZ A;  3BEB A;  3HLC A;  3W4O A;  2H0T A;  1W8Y A;  4BJP A;  2WKE A;  3IF6 B;  4KZA A;  5EVI B;  1MWU A;  1PZO A;  3UO9 A;  4BL3 A;  1MWT A;  4GOG A;  3PAE A;  1XX2 A;  5A92 A;  3C4P A;  1N9B A;  3G32 A;  3BLS A;  5AQB A;  2Y2M A;  4K0X A;  1ERO A;  2WGW A;  4L0L A;  1BTL A;  1H8Z A;  4PM8 A;  5EUA A;  5HX9 A;  5M19 A;  3A3J A;  1XGJ A;  2ZQ9 A;  2PU2 A;  4KEN B;  3BFC A;  3PBS A;  4MBK A;  5DF9 A;  3RXX A;  4JF6 A;  1XGI A;  4ZTK A;  3WS0 A;  3WRT A;  4E3I A;  1JTG A;  4Y0T A;  5AQ9 A;  3TSG A;  3V3S A;  3BFF A;  3V50 A;  1GA0 A;  3QNC A;  4LV0 A;  3SS5 A;  1DY6 A;  3ZCZ A;  1YMX A;  2Y2O A;  4QD4 A;  1FQG A;  5FAT A;  4KG6 A;  1FCN A;  4UA6 A;  5G18 A;  3TOI A;  4BEN A;  4OVD A;  1K54 C;  5CER A;  2WKI A;  3VMA A;  4DDY A;  5FAS A;  4OQG A;  3LO7 A;  2A3U A;  2HP9 A;  4WZ4 A;  1KGF A;  1BT5 A;  2HP5 A;  1TDL A;  3DTM A;  1ES2 A;  2WK0 A;  4KZ7 A;  1N4O A;  4QY6 A;  1ONG A;  2JBF A;  4KZ9 A;  5GLB A;  2VGJ A;  2JCH A;  3Q7V B;  2PBY A;  3IF6 A;  3NDE A;  4K91 A;  4EUZ A;  3FKW A;  5HL1 A;  1K57 A;  1SCW A;  4QY5 A;  4KQQ A;  3PAG A;  1BZA A;  1W7F A;  4N9L A;  1KGE A;  1K25 A;  5FQI A;  3Q07 A;  3ZNY A;  4JKT A;  4UAA A;  1VQQ A;  3PBO A;  3FKV A;  4OQI A;  2ZQ7 A;  1PW8 A;  1K6R A;  5FAP A;  1BUL A;  1IKG A;  4OOY A;  1MY8 A;  4EQI A;  3CG5 A;  5FAO A;  1L2S A;  3SOI A;  3BLM A;  2Q9M A;  3G31 A;  4YIN A;  4CPK A;  1XPB A;  3HLF A;  5AQ7 A;  1XA1 A;  1FCM A;  4HEF A;  1MWS A;  1ES4 A;  3V5M A;  4PM5 A;  3G35 A;  3RJU A;  4B4Z A;  1MBL A;  1NJ4 A;  1I2S A;  3O87 A;  4OPR A;  4OOM A;  4DE1 A;  3OC2 A;  1OME A;  2WYX A;  5GHX A;  2EXB A;  1YM1 A;  4DXB A;  1KDW A;  1PYY A;  3Q1F A;  4H8R A;  4GKU A;  4DRT A;  1E3U D;  5FAQ A;  3ZG9 B;  1E25 A;  5KSC A;  2Y2G A;  3AGD A;  1TVF A;  1TDG A;  3SS3 A;  4NET A;  1XA7 A;  2J8Y A;  4BD1 A;  1KVM A;  4Z9Q A;  2FFF B;  2OLV A;  1W79 A;  1CI9 A;  2ZJ9 A;  3VOZ A;  3MKE A;  3TG9 A;  1FSY A;  3GQZ A;  3UE0 A;  4XUZ A;  4R23 A;  5CTM A;  5A93 A;  4N92 A;  4E3N A;  3HVF A;  3IXG A;  3OPH A;  3M6B A;  1YT4 A;  3MBZ A;  3A3F A;  2HDS A;  1NY0 A;  1ONH A;  2ZC7 A;  3NIA A;  2HDQ A;  3IWO A;  5CHJ A;  4MBH A;  1QME A;  4OH0 A;  3ZNT A;  1H5X A;  4E3K A;  3EQV A;  5GHZ A;  1JVJ A;  2WZX A;  2QZ6 A;  3BEC A;  4JBF A;  4KZ5 A;  2J9O A;  1NYY A;  4OP8 A;  4PM9 A;  4UHU A;  2OV5 A;  3O86 A;  4EV4 A;  3LCE A;  2DRW A;  5HAQ A;  3AGF A;  2HDU A;  2EFU A;  5CGS A;  1PZP A;  3NY4 A;  3QNB A;  1QMF A;  1IYQ A;  4Y7P A;  3UNW A;  3VFH A;  5CGW A;  5TFQ A;  3ZFZ A;  2Y2I A;  2P74 A;  3HLE A;  2HDR A;  5CEC A;  3HUO A;  3BFD A;  1MWR A;  1BLC A;  3Q81 A;  4WYY A;  1KGG A;  4BQM A;  1KDS A;  4A5R A;  3NBL A;  2UWX A;  5A90 A;  4OPY A;  1IYP A;  1CK3 A;  4RA7 A;  4R3J A;  1CEG A;  3GSG A;  1Y54 A;  2Y2L A;  3A3D A;  4OKP A;  5CEB A;  3VP0 A;  4P85 A;  2XD5 A;  1S6R A;  4RX2 A;  3G2Z A;  3O88 A;  1ESI A;  3MKF A;  4LCL A;  3MZE A;  2ZQD A;  3E2L A;  4KZ8 A;  2ZM8 A;  4JF4 A;  2Y4A A;  1YMS A;  2J7V A;  3G30 A;  1WYC A;  4HBT A;  3HBR A;  3PBN A;  1K54 A;  3IF5 A;  4R4R A;  2R9W A;  2BLS A;  4IED A;  1ES5 A;  2ZLY A;  2H0Y A;  1BSG A;  1FR6 A;  4LV1 A;  2E8I A;  2IWC A;  4S2L A;  4KZ6 A;  5KMW A;  3VP1 A;  1L0G A;  4KQO A;  1M40 A;  4DKI A;  3IWI A;  1RP5 A;  3S4X A;  3GR2 A;  1PI5 A;  3Q7Z A;  5KZH A;  3WS4 A;  2X02 A;  4KG5 A;  4OON A;  1K56 D;  1PIO A;  4N9K A;  2H5S A;  4MLL A;  5EPH A;  1CEF A;  2XFS A;  1IEM A;  5DF8 A;  4PMA A;  4R4S A;  5FQK A;  4EBP A;  4FD8 A;  3G34 A;  3ZDJ A;  4JXS A;  4WM9 A;  4WEL A;  1JTD A;  2RL3 A;  2VGK A;  5FDH A;  5FSR A;  3O3V A;  3CZD A;  3I7J A;  1S0W A;  1E4D A;  3P09 A;  4DXC A;  4DE0 A;  1W8Q A;  2EXA A;  3N8S A;  1EI5 A;  1Q2Q A;  5HAP A;  1E3U A;  3CJM A;  4ZBE A;  4X53 A;  1GHI A;  3VP4 A;  4MNR A;  1K57 C;  3DW0 A;  1I5Q A;  1NRF A;  3BYD A;  1KVL A;  3GV9 A;  1DJA A;  4BLM A;  2QMI A;  2Y2P A;  4OQH A;  1LLB A;  1RGZ A;  2ZQ8 A;  4P87 A;  4ZAM A;  3PBR A;  4S2P A;  3HUM A;  4F94 A;  4X56 A;  5F1F A;  1K56 A;  3LEZ A;  1RCJ A;  1M6K A;  4GDB A;  4WEJ A;  3UDI A;  4PM7 A;  3IWQ A;  5HAR A;  1WYB A;  1NZO A;  3C7U A;  2OSU A;  5GHY A;  1IYO A;  2WGW B;  4WZ5 A;  4WZ5 C;  4U0T A;  2OLU A;  4P6B A;  3S1Y A;  4DE2 A;  4Y0U A;  4PPR A;  4S2N C;  3MZD A;  5M18 A;  4FH2 A;  1ERQ A;  4OPZ A;  5GLA A;  2CC1 A;  3GTC A;  4EBN A;  1LL9 A;  2Z2M B;  2WZZ A;  1ZKJ A;  3NCK A;  3MZF A;  3UY6 A;  1SHV A;  1C3B A;  1K6S A;  3IQA A;  2G2W A;  4LCM A;  4M3K A;  4DDS A;  4EWF A;  3IH8 A;  3PBT A;  2Y2N A;  3FZC A;  4PM6 A;  5AQA A;  2J9P A;  3IXB A;  3SH7 A;  3W8K A;  3ZGA B;  1VM1 A;  4C75 A;  1O07 A;  3E2K A;  1BLP A;  1ERM A;  5BOH A;  3QHY A;  3HLG A;  4MBF A;  4X55 A;  4KZB A;  1YLT A;  5F1G A;  2WGI A;  4YFM A;  4OPQ A;  5DF7 A;  5EVL A;  5F82 A;  5F83 A;  4DF6 A;  4BL2 A;  1LHY A;  4ZJ3 A;  2WKH A;  1XP4 A;  5CTN A;  1SDN A;  4KZ3 A;  5DTT A;  4D2O A;  3IHB A;  3UPO A;  2DCF A;  5FA7 A;  3ZVW A;  3N8L A;  4KQR A;  2X01 A;  1HTZ A;  1WE4 A;  2Y2Q A;  2ZM0 A;  2ZM2 A;  3S22 A;  4X6T A;  2Y2J A;  1L0E A;  2Y55 A;  3BRM A;  3WWX A;  5KSH A;  5E43 A;  1PI4 A;  2B5R A;  5EE8 A;  1BUE A;  3VP3 A;  2ZC4 B;  4WEK A;  2C6W B;  3G2Y A;  4QJG A;  3HLD A;  5U47 A;  5EVI C;  3BFE A;  5TR7 A;  4IVK A;  2XR0 A;  4X69 A;  3V39 A;  4GD6 A;  1FSW A;  3G4P A;  1BLH A;  2G2U A;  2Y2K A;  3GMW A;  3IH9 A;  3LY4 A;  3N4I A;  4N1H A;  5EVI D;  3UPN A;  5CED A;  4JXG A;  2WUQ A;  5CHU A;  3N8R A;  4IBX A;  2ZMA A;  4WBG A;  2XDM A;  4JF5 A;  4O7D A;  3DWZ A;  3SH9 A;  2R9X A;  4KG2 A;  2IWB A;  3M2K A;  3IXD A;  4Q8I A;  3FWL A;  3JYI A;  1K4F A;  1YLJ A;  2XD1 A;  3FV7 A;  4OQ0 A;  4JXV A;  4OP5 A;  2XFT A;  3SS4 A;  2HP6 A;  4N1X A;  5DVA A;  1GCE A;  5M1A A;  4C6Y A;  2ZC6 B;  4UA7 A;  3DWK A;  3ZVT A;  3ZG5 A;  4GD8 A;  1ZC2 A;  5FQJ A;  3ZG0 A;  3PTE A;  3HL9 A;  2XF3 A;  3OCN A;  4E3J A;  4GZB A;  2V2F F;  4FCF A;  2Y2H A;  5FQM A;  3HLW A;  1L0D A;  1YLP A;  4IBR A;  4ID4 A;  3UPP A;  4U3T A;  2XEP A;  1IYS A;  2DNS A;  4GDN A;  4EBL A;  1FCO A;  1JWZ A;  3IT9 A;  3AGE A;  3HUN A;  1ES3 A;  2Y91 A;  4QHC A;  3Q7V A;  5EEC A;  1HVB A;  3BM6 A;  3ZG7 B;  3ZG8 B;  1PWC A;  3WRZ A;  4C3Q A;  3HLB A;  3NI9 A;  4S2N A;  2X71 A;  4XUX A;  4RYE A;  1SDE A;  3C4O A;  5E2H A;  3VP2 A;  3BFG A;  3LY3 A;  4LV2 A;  4B4X A;  1NYM A;  1NXY A;  5FI6 A;  1SKF A;  2IWD A;  3MFD A;  4E3O A;  1NZU A;  4HES A;  3WS1 A;  1W5D A;  3UDX A;  3W4Q A;  4E6X A;  1FOF A;  2XK1 A;  3B3X A;  4U0X A;  3C7V A;  3D4F A;  4QB8 A;  1U60 A;  1HD8 A;  1YLY A;  1GA9 A;  4DE3 A;  1LI0 A;  1FR1 A;  5L2F A;  3GRJ A;  3UN7 A;  3IF6 C;  3IHA A;  4S2O A;  5CGX A;  4WMC D;  1Q2P A;  5FI7 A;  3UE3 A;  3VSK A;  5JYP A;  4RX3 A;  4CJN A;  1K4E A;  5HAI A;  3GVB A;  4R0Q A;  3OCL A;  5CRF A;  4S2M A;  1PWD A;  1KE3 A;  2HPB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...