1YLJA

Atomic resolution structure of ctx-m-9 beta-lactamase
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
263
structure length
263
Chain Sequence
QTSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTAGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords beta-lactamase CTX-M-9a
publication title Atomic Resolution Structures of CTX-M beta-Lactamases: Extended Spectrum Activities from Increased Mobility and Decreased Stability.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 101
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2005-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1yljA00
1NYMA 1JWZA 3DW0A 4X56A 1JWPA 2H10A 2Y2HA 4KQQA 2UWXA 5JYPA 4LENA 1PYYA 2HDSA 3BFEA 3UPPA 4JBFA 2XH9A 4PPRA 1TDGA 1XA7A 3Q7ZA 2HDUA 4WM9A 1LHYA 4ZAMA 1KGFA 2DCFA 4NK3A 1ES5A 2VGJA 2Z2LB 5AQAA 1LI0A 1NZOA 4R0QA 4R4RA 5GLBA 5HAPA 3DWZA 3DWKA 5KSCA 2Y2LA 3IXDA 4WZ5A 5CHUA 5DTKA 3OPPA 4OPQA 4E3KA 2ZD8A 4EQIA 2ZQ8A 3CG5A 1O7EA 4KZAA 4MNRA 4YFMA 3IHBA 4E3JA 2OSUA 3S22A 4PM8A 4OP5A 2XR0A 1XKZA 3MFDA 4JXSA 5FDHA 1K4EA 2J8YA 3IT9A 4U0XA 2X01A 3CZDA 4IVIA 4OQ0A 4FSFA 4HESA 4RX2A 4LV2A 1I2WA 3FZCA 3WRZA 4PM9A 4QY6A 1FCMA 4R4SA 4ZJ2A 2A3UA 4OONA 4ZDXA 1H8ZA 1JWVA 4UA6A 4CPKA 1SDNA 1CEGA 1AXBA 2P74A 3OPRA 1ES2A 1YMXA 3MXSA 5E2FA 4MBKA 4BLMA 2V1ZA 3OPLA 3S4XA 1K54A 4KZBA 2ZC4B 3TOIA 3UY6A 1HTZA 1MWTA 2WKIA 1MWUA 3IXHA 3VSKA 1KGGA 3GVBA 5TR7A 1TEMA 5A92A 1PZPA 4C75A 3FKVA 1WE4A 4KZ6A 1U60A 1XXMA 1IYPA 4E3IA 3A3DA 3AGEA 5A90A 4GDNA 5CXWA 4JKTA 1N9BA 2OLUA 3W4OA 1BULA 3QNBA 3UE1A 4MBHA 5F82A 1GHPA 1NRFA 5GLDA 5HAQA 4DXCA 1FSWA 1PI5A 3N7WA 4A5RA 1PI4A 4GD8A 2XD1A 5E2GA 2X71A 2G2UA 2Y4AA 2XD5A 2XGNA 3O88A 4NETA 3G4PA 1W8YA 4K0WA 1L2SA 1OMEA 5FQMA 3SH9A 3HVFA 3WS1A 1MXOA 3PBOA 1SCWA 4U0TA 3GRJA 3IXGA 4ZBEA 1EWZA 3HLWA 4KG6A 4BD0A 3OZHA 1GHMA 2EFUA 2HP9A 3BYDA 1NXYA 1XP4A 2XEPA 2Z2MB 3C4PA 1KE3A 2WGWA 4WEJA 3ZNYA 2EXAA 4JXVA 3OCNA 5CHMA 4B4ZA 3B3XA 3G31A 1ERQA 1RP5A 3MZDA 1HZOA 2GDNA 5CECA 2RL3A 4C6YA 3UPNA 3VOYA 1XGIA 2H5SA 4F94A 4OVDA 3MKFA 3VFHA 3A3FA 4GN2A 1IYOA 1K55A 3IF6C 3MZEA 1KE4A 4WEKA 3HBRA 4X55A 2RCXA 3LO7A 4DE0A 1C3BA 3A3JA 1ES3A 3PBSA 3BFFA 1GCEA 1QMFA 5FQIA 3Q7VA 4OH0A 4H8RA 4UAAA 2ZM8A 4ZJ3A 4YINA 3ZDJA 3NI9A 1K57A 2FFFB 3ZGAB 1K56A 2OV5A 5DF9A 1HVBA 3A3IA 4PM5A 1G68A 2ZQCA 1EROA 2IWBA 5GL9A 5FQJA 3FYZA 1ONHA 3G34A 1W79A 3M6BA 5E43A 5HW3A 2PU2A 5EOOA 1BLSA 1PIOA 2CC1A 3HLGA 5DTTA 1FSYA 5FQQA 3PBRA 3VFFA 3VMAA 1DY6A 2V20A 5GLAA 3E2KA 4PM6A 1EI5A 2ZQ7A 4BD1A 4DE2A 5E2EA 1GA9A 2IWCA 1IYQA 4HBTA 2R9XA 1BZAA 2JCHA 3ZG0A 5A91A 1ESIA 2Y2NA 2WUQA 4X53A 3IWIA 3UDIA 5CEBA 3UO9A 4Y7PA 4EBLA 3HLEA 4WBGA 2ZC6B 1N4OA 1O07A 1Y54A 4D2OA 3C4OA 4IEDA 4GOGA 2Y59A 4LV1A 4WMCA 2DRWA 1W7FA 4EBNA 5TGFA 2WGWB 1BLCA 1XA1A 2EX2A 2QPNA 4IBRA 4N9LA 3P09A 4N1XA 1ZC2A 2HDRA 2Y2JA 3N4IA 2HPBA 3EQVA 1H8YA 2WYXA 3G35A 5D3OA 5DF7A 2PBYA 2VGKA 1VM1A 3BRMA 4WYYA 3Q1FA 1YLYA 4DE3A 3G2ZA 5CGXA 1KDSA 1M6KA 2WZZA 3HUOA 4WELA 4GDBA 1LL9A 4OOLA 3IXBA 3N8RA 4EV4A 4OQHA 1SDEA 3MKEA 3GSGA 3Q7VB 4DRTA 1ESUA 4JF6A 1MWSA 4LCMA 4X69A 4XUXA 5FQKA 4JF5A 2G2WA 5EOEA 2Y2GA 3HLDA 3IWOA 4OLDA 3UE3A 2JE5A 3ZG8B 1CI9A 1K56D 4P0MA 1L0EA 2FFYA 4S2IA 3BLSA 1CK3A 1ZG6A 4GZBA 4UA9A 2Y2KA 4MEZA 3IHAA 3RXXA 4KZ4A 4KQRA 1IKGA 4KZ5A 3VP3A 2BG1A 3ISGA 3TSGA 1GA0A 2HP6A 3HLFA 3NCKA 2A49A 3SS3A 1L0DA 5EVIA 1IEMA 1FCNA 2DNSA 2ZLYA 5AQBA 5M19A 4OOMA 3S1YA 2XLNA 3G30A 4N92A 3SS5A 1ZG4A 3BM6A 3UDXA 3SH7A 4RX3A 1L0GA 3BFGA 1PW1A 5EE8A 4E3NA 2WGVA 2QZ6A 4BL2A 4S2LA 4XXRA 1NY0A 3ZG7B 3BLMA 3PBQA 4EUZA 1KVLA 3EQUA 5CTNA 3I7JA 5KZHA 4E3MA 2XK1A 1FR1A 4KZ7A 1BT5A 4WZ5C 5CGWA 5G18A 2ZM0A 3HLBA 1M40A 3E2LA 4OPZA 4ZTKA 4Y0OA 1FQGA 4E3LA 4P87A 4WMCD 3OC2A 1S6RA 4OQGA 4EWFA 1W8QA 1K4FA 5AQ9A 3V3RA 5GLCA 3NDGA 4S2NA 4QB8A 3BFCA 3ZFZA 2XFTA 3BECA 3HL9A 4GKUA 4S2JA 5DF8A 3GV9A 3MXRA 4IBXA 4PM7A 3WWXA 1GHIA 3PAGA 2J7VA 1ERMA 2WK0A 5FAQA 1K38A 1LLBA 1SKFA 2HP5A 4HEFA 5FQ9A 2WADA 1PWDA 2Y2OA 5EVLA 3VP2A 5A93A 4JF4A 1CI8A 4GD6A 1YLTA 1Z6FA 4EBPA 1K54C 3ZVTA 1TDLA 3G32A 2E8IA 2Y2QA 1YLPA 2ZJ9A 4FH2A 4OP8A 2PU4A 2Q9MA 4MBFA 4R23A 4BJPA 3W4PA 1KGEA 1DJBA 4X68A 4JXGA 4DF6A 5CERA 3UNWA 2EX8A 4MLLA 1J9MA 2B5RA 3NDEA 3OPHA 4GB7A 5J8XA 3HUMA 3M2KA 3N8SA 4FCFA 2C5WB 1IYSA 3VP1A 1BLPA 3V5MA 3WRTA 3ZVWA 3UE0A 3BEBA 1DJAA 4OKPA 4KZ9A 4X6TA 5EVID 5F83A 5EVIB 3V50A 2JC7A 3VSLA 3ZG5A 3GR2A 4OPYA 2Y2IA 3PBNA 3VP0A 2ZQ9A 4QD4A 3Q81A 5KSHA 2P9VA 4QJGA 3UDFA 5HL1A 1E4DA 2XDMA 4P6BA 4E6WA 3LEZA 2OLVA 4N1HA 3W8KA 5M18A 1XGJA 3C7VA 5CHJA 5JYOA 2I72A 3NIAA 4O7DA 3PAEA 3IH9A 4N9KA 1YMSA 1ZKJA 2HDQA 1E3UA 4L0LA 4PMAA 1BSGA 4RYEA 3MZFA 4FD8A 1MKIA 4K91A 3BFDA 3HLCA 4WZ4A 1PZOA 3VP4A 3ITAA 4KENB 1WYBA 3ZNTA 4DE1A 2XFSA 3RXWA 1FR6A 1CEFA 1HD8A 5FA7A 5HX9A 3N6IA 4K0XA 1W5DA 3IWQA 3MBZA 1Q2PA 2IWDA 2WAFA 1K55C 1BLHA 1TVFA 4JLFA 3UPOA 2BLSA 1YQSA 3AGDA 3CJMA 2WKEA 3P98A 1K25A 4JPMA 1XX2A 4ID4A 5EUAA 3IF5A 5KMWA 1I2SA 3WS4A 4KZ3A 3M2JA 3GQZA 1K57C 2EFXA 2XQZA 1KE0A 3A3EA 2EXBA 2EX9A 4QY5A 3G2YA 4E3OA 1IELA 2Y2PA 4DXBA 3CMZA 5F1GA 5HFOA 3M6HA 5IHVA 1KVMA 1YT4A 3IQAA 4LCLA 3ZHHA 4Z9QA 3AGFA 2ZM2A 5BOHA 4LV0A 1PWGA 2WZXA 1QMEA 3WS5A 5CGSA 4UA7A 2EX6A 1LL5A 3JYIA 5TFQA 1FCOA 3IF6A 3C5AA 4KQOA 4KZ8A 4OOYA 5HARA 5FASA 2H0TA 3D4FA 5FI2A 3W4QA 4UHUA 4DKIA 4XUZA 1ONGA 4KG2A 4DDYA 2P9VB 2QMIA 3GTCA 1RCJA 3FV7A 5GHYA 1VQQA 4BQMA 1Q2QA 3HUNA 4B88A 4BL3A 1MY8A 1ALQA 3FKWA 3ITBA 5U47A 5EECA 3V39A 3VOZA 4QU3A 1FOFA 5I94A 1E3UD 5DVAA 5FAPA 4DDSA 4S2MA 3ZCZA 3WS2A 3LCEA 5CEDA 5GHXA 3C7UA 4QHCA 1BUEA 1XPBA 4KG5A 3LY4A 2ZQAA 3SH8A 4B4XA 3OCLA 2V2FF 5EPHA 2ZMAA 1PWCA 4RA7A 2ZC7A 2ZC5B 2C6WB 1S0WA 1YLJA 4HBUA 5DTSA 3O3VA 1IKIA 2H0YA 3Q07A 1MBLA 3SOIA 1SHVA 4RVAA 1WYCA 4OQIA 1YLWA 3IH8A 4S2OA 4GNUA 3SS4A 4P85A 3O86A 1BTLA 1JTGA 4R3JA 4LV3A 3QNCA 5CRFA 1JVJA 2J9OA 3LY3A 1ES4A 4S2KA 5FI6A 5M1AA 5L2FA 1NZUA 1RGYA 3DTMA 2JBFA 4E6XA 3GMWA 2WAEA 1MPLA 3TG9A 4OPRA 3HREA 2X02A 3WS0A 5EVIC 4S2PA 3N8LA 1NYYA 5CTMA 2R9WA 3IF6B 4R3BA 1E25A 3NY4A 3O87A 5FSRA 4CJNA 1NJ4A 1K6SA 5FI7A 4Q8IA 2ZQDA 4C3QA 2Q9NA 2Y55A 3ZG9B 4IVKA 3QHYA 1G6AA 1RGZA 1K6RA 4M3KA 4Y0TA 5F1FA 4JXWA 2WKHA 4U3TA 5GHZA 3V3SA 2XF3A 1PW8A 2Y2MA 3NC8A 3Q82A 4OLGA 1LI9A 3PBTA 2ZC3B 4FH4A 4R1GA 5AQ7A 4BENA 5HAIA 5FAOA 1YM1A 1YLZA 2J9PA 1I5QA 2Y91A 2WGIA 3NBLA 1MWRA 1KDWA 4Y0UA 5E2HA 1DJCA 5FATA 3RJUA 1JTDA 4ZJ1A 4S2NC 3PTEA 3UN7A 1H5XA 1L0FA 3FWLA
chains in the Genus database with same CATH superfamily
4KQQA 3T4OA 1NWZA 4PPRA 1TDGA 2HDUA 1KGFA 2J3TD 1VHMA 4I38A 4R4RA 4HHDA 4E3KA 3OPPA 2XA7M 2ZQ8A 4P6ZS 3IHBA 2ZMVA 2PAVP 4EEUA 5L09A 3IT9A 4OQ0A 5AJGA 4HESA 4LV2A 4QY6A 4R4SA 2VV7A 4OONA 4ZDXA 1AXBA 1YMXA 4BLMA 3OPLA 3S4XA 1K54A 3UMDA 1OTAA 1MWTA 3UY6A 1MWUA 3VSKA 1TEMA 3E0YA 5CX7A 3FKVA 1WE4A 3DTKA 4NXBA 1XXMA 3AGEA 1D7EA 5CXWA 3VOLA 1F9IA 1H3QA 3UE1A 5LBRA 5G4ZA 1PI4A 1TS0A 2XD5A 1XJ4A 3G4PA 3E4PA 4K0WA 2WKRA 1SCWA 3QP2A 4WL9A 3KSFA 2Z2MB 2W3HA 3C4PA 1KE3A 2W0NA 4ARZB 4B4ZA 1LSVA 4LGWA 2VA0A 2GDNA 4HOIA 4KUKA 2RL3A 3VOYA 1XGIA 3MKFA 3A3FA 3HBRA 5HD3A 3LO7A 3A3JA 3PXPA 2L4RA 4OH0A 4G3KA 2VK3A 4PM5A 1OTEA 3FYZA 5E43A 5HW3A 1BLSA 5HDSA 3T1QB 1FSYA 4GS9A 4EETB 2ZQ7A 3F1NB 1IYQA 2O9BA 1XJ2A 1BZAA 2JCHA 3CAXA 5A91A 2JKTM 3LFVA 3QP8A 2Y2NA 3UDIA 4ESPA 3ZQ5A 2W3DA 4WBGA 2ZC6B 1N4OA 3GDIA 5EFWA 4D2OA 2VGLM 4GOGA 1TS8A 5F6AA 2DRWA 4EBNA 5TGFA 3KSHA 1XA1A 4IBRA 3N4IA 4G3WA 4PKYA 3EQVA 3G35A 4ME4A 3BQ8A 3HUOA 1LL9A 4OQHA 1SDEA 3T50A 3Q7VB 2G7UA 4LCMA 4X69A 4I39A 3IWOA 2JE5A 4Y5FA 3BLSA 1CK3A 4HJ3A 1OTIA 4UA9A 2Y2KA 4KZ4A 5DKKA 5L10A 2PR6A 2BG1A 2D02A 2A49A 5EVIA 1IEMA 1FCNA 5HZHA 5M19A 3SS5A 3SH7A 5J7EA 4MMNA 3UE6A 1L0GA 3IS2B 3BFGA 3KSIA 2WKPA 5EE8A 2WGVA 2QZ6A 4XXRA 3HJKA 3QP6A 3EQUA 5KZHA 2H28A 5CGWA 1BT5A 2P08A 2ZM0A 1SKOA 1OJ5A 4E3LA 1UWNX 1S6RA 2HGVA 5AVEA 1W8QA 2J80A 5AQ9A 1CJFA 3V3RA 5GLCA 3NDGA 4S2NA 3ZFZA 2FH5A 3GV9A 3WWXA 1S67L 1SKFA 2HP5A 4L9GA 4BMWA 1Z6FA 3BWLA 4X1MA 1K54C 3D9YA 3ZVTA 2E8IA 4FH2A 1YLPA 2ZJ9A 4OP8A 2PU4A 4R23A 3UB9A 4BJPA 1KGEA 3UNWA 1J9MA 2B5RA 2MJ6A 2C5WB 1BLPA 3ZVWA 1G5UA 3MMHA 4PHTA 4KZ9A 4X6TA 5EVID 5F83A 2Y2IA 3S7PA 3VP0A 4QD4A 2P9VA 5HL1A 2XDMA 3LEZA 3KO6A 4YOFA 3NIAA 2JKRM 1ZKJA 4PMAA 2YKFA 4K91A 4WZ4A 4NEED 4LRXC 4K0XA 3SW1A 3CPTA 1H8MA 2HJEA 3NOPC 1TVFA 4UEYA 2J3WA 2BLSA 4R70A 3P98A 1BYWA 2VJWA 2Y8HA 3UB8A 2XQZA 4HY8A 3A3EA 3S7OA 4E3OA 3MF0A 3RTYA 4DXBA 4EW7A 1DP8A 3CMZA 4R38A 4Z9QA 3AGFA 3JVUA 4JGRA 5CGSA 3LI8A 1OT6A 2EX6A 3JYIA 3C2WA 2PYRA 2XSSA 4KQOA 4KZ8A 5HARA 5FASA 3D4FA 5FI2A 1ONGA 3SZTA 4HIAA 4MCWA 4BQMA 1Q2QA 3HUNA 4B88A 5DJTA 3ITBA 3VOZA 3WS2A 2R78A 3D72A 5GHXA 1XPBA 2W1TB 4KG5A 2ZMAA 1PWCA 1IOUA 1S0WA 1G28A 2HV1A 4Y13A 5HPIA 3A0RA 2K7SA 2O99A 4BBVA 2Q0OA 3SOIA 1SHVA 4S2OA 3SS4A 3LEQA 4LV3A 3QNCA 5CRFA 5DFXA 4B9OA 4E6XA 4RQ9A 3R4KA 5EV0A 5EVIC 4EERA 3N8LA 5FSRA 1E25A 3NY4A 5FI7A 4F3LA 2ZQDA 2Y55A 4LPZA 3LIEA 3A0SA 3E98A 2BASA 3LR3A 4Y0TA 2WKHA 3LR4A 3V3SA 2XF3A 2Y2MA 2B18A 3NC8A 1LI9A 2GX5A 4FH4A 2M7VA 5FAOA 1YM1A 2J9PA 2Y91A 3NBLA 4DN0A 1JTDA 4ZJ1A 4S2NC 4I3JA 4R6LA 2H10A 1Y4OA 2XH9A 1XA7A 3Q7ZA 1LHYA 4ZAMA 2DCFA 2XRNA 4NK3A 3LIBA 5GLBA 1NZOA 4R0QA 5KSCA 2Y2LA 5DTKA 4Y17A 2ZD8A 4EQIA 1O7EA 4YFMA 3CI6A 2WKQA 4PM8A 5K5BA 5FDHA 4U0XA 3L9KA 1I2WA 3WRZA 4CPKA 4CLCB 3OBFA 2P74A 1ES2A 3T4TA 3QP4A 3NOTC 3PHYA 2A24B 3F1OB 3GVBA 3T4QA 1L3LA 4KZ6A 1IYPA 3A3DA 5MC7A 5A90A 1BULA 3QNBA 4MBHA 5F82A 5GLDA 5HAQA 4DXCA 1FSWA 3N7WA 5TBMB 2G2UA 2GZAA 3HVFA 3PBOA 4U0TA 4KG6A 1W63Q 2EFUA 2HP9A 5HPFA 1XP4A 2WGWA 4JXVA 3OCNA 5CHMA 1NRJA 5CECA 3A0VA 4F94A 3MS6A 4GN2A 1KE4A 2ZL1A 4DE0A 1ES3A 1N9NA 5L07A 3BFFA 1QMFA 2QYBA 2O9CA 4HQAA 4UAAA 2ZM8A 4ZJ3A 4YINA 3ZDJA 1MKMA 1K57A 2FFFB 4NG2A 3JVVA 2OWJA 2ZQCA 1EROA 1ONHA 3CLOA 3M6BA 2PU2A 3HLGA 1PIOA 3QP1A 3PBRA 1DY6A 4PM6A 1EI5A 3ICYA 4BD1A 5E2EA 3T4KA 4HBTA 2R9XA 3ZG0A 1G6OA 4EQ1A 5FEGA 2PHYA 4K08A 5CEBA 4EBLA 5DKLA 1YKDA 2Y59A 3HJIA 1W7FA 1MZUA 4N9LA 3P09A 4N1XA 2Y2JA 2HPBA 3VE4A 1H8YA 4Y3IA 5DF7A 2PBYA 1SZVA 3BRMA 3Q1FA 5CGXA 1KDSA 1M6KA 4WELA 4GDBA 2OOLA 4OOLA 3DAVA 3GSGA 4JF5A 2G2WA 4NKPA 5FDSA 3HLDA 4OLDA 3ZG8B 1S4SA 3UE3A 1CI9A 1Y28A 2VX8A 3H82A 3LR5A 4MEZA 3IHAA 3T1XA 2M7UA 3ULFA 3TSGA 2HP6A 3NCKA 1L0DA 4OOMA 3G30A 4N92A 2QJ5A 3T1RA 1S1YA 1VEUA 5IS1A 4E3NA 1NY0A 1DRMA 1KVLA 4NXGA 1H0MA 4E3MA 1FR1A 3RH8B 5G18A 1M40A 4OPZA 1DP9A 1FQGA 3OC2A 3CWFA 4OQGA 4EWFA 1K4FA 4DMZA 3CITA 4O0PA 5I5LA 3HL9A 4S2JA 3MXRA 5FAQA 2J7VA 1ERMA 2WK0A 3KYQA 3DTIA 5A93A 4JF4A 3MR0A 3G32A 4XT2B 4MBFA 3B42A 2HZ5A 4DF6A 2JN7A 3M2KA 1IYSA 1OJGA 3WRTA 3ZG5A 4MDZA 3GR2A 4OPYA 1FILA 3PYPA 3P01A 3Q81A 4GW9A 1XGJA 3C7VA 5JYOA 2VV8A 2J3TC 3PAEA 1YMSA 4L0LA 2FZ0A 1BSGA 2KLIA 3BFDA 3HLCA 3KYEA 1PZOA 4II7A 3ITAA 1WYBA 2XFSA 1N9OA 3N6IA 1W5DA 1WA9A 3MBZA 2WAFA 3H7WB 4JLFA 3UPOA 4LLOB 3ZYTA 4JPMA 3WS4A 3GQZA 3H9WA 1K57C 4UQIS 1S1ZA 4O8GA 4QY5A 5IHVA 5HFOA 2ZOIA 3IQAA 4LCLA 4L9FA 4LV0A 2WZXA 1QMEA 3R7WB 1FCOA 3IF6A 3C5AA 4BWIA 4DKIA 4DDYA 2QMIA 5GHYA 4GJ4A 4BL3A 4IUKA 1ALQA 3FKWA 5U47A 3V39A 1FOFA 1T1BA 5DVAA 4DDSA 2K31A 2VKSA 3C7UA 1BUEA 4NXEA 2NUPC 2ZQAA 4B4XA 5EM0A 2OAQ1 3O3VA 2PD8A 2H0YA 1WYCA 1YLWA 3MSHA 1F98A 1OPXA 1JTGA 3FG8A 3O5YA 1JVJA 3FC7A 2OAP1 1PFLA 5L2FA 1CQAA 2WAEA 3TG9A 4OPRA 3WS0A 3O87A 1VETB 4C3QA 3W2ZA 1G6AA 1EW0A 4M3KA 1T1CA 4JXWA 2KOIA 5GHZA 5KIZA 4OLGA 5TJJA 1F5MA 2ZC3B 4BENA 4DJ2A 3EOIA 1YLZA 2WGIA 1DJCA 4ETZA 3UN7A 4X1LA 1L0FA 1NYMA 3UB5P 1JWZA 3DW0A 4X56A 2Y2HA 2UWXA 3BJNA 5J3WA 2JKGA 2D01A 2VV6A 3NECA 1ES5A 2Z2LB 5AQAA 4H6JB 2KDKA 3DWZA 3DWKA 4GHIB 4OPQA 3CG5A 4D60A 3F1PB 4ARZA 2OSUA 1XKZA 3LIAA 2PD7A 4JXSA 4RX2A 3FZCA 4ZJ2A 4UA6A 3IBRA 3OPRA 5E2FA 3MXSA 2V1ZA 2ZC4B 2WKIA 3IXHA 1KGGA 5TR7A 1PZPA 4C75A 4HH2A 4PKYG 1U60A 1P0ZA 4E3IA 3E4OA 4CLCE 5IU1A 1DP6A 3W4OA 3F1NA 2W3EA 1GHPA 1NRFA 4A5RA 4GD8A 3KYZA 2XD1A 5E2GA 2Y4AA 2XGNA 1W8YA 3FPWA 3C8CA 3UMEA 4HNBA 1OMEA 5FQMA 3SH9A 3WS1A 4IUHA 3IXGA 1EWZA 3HLWA 4BD0A 3EGDC 1V9YA 3OZHA 3BYDA 1V9ZA 2XEPA 2JKFA 3ZNYA 3B33A 1T19A 3B47A 3B3XA 3G31A 1JNUA 4FOFA 5HL6A 4B93A 1IYOA 1K55A 3IF6C 4X55A 4WEKA 1C3BA 3K2NA 5FQIA 3Q7VA 4WF0A 3ZGAB 1K56A 2OV5A 2V1AA 5DF9A 3TRCA 2IWBA 2P04A 3LUQA 3L7HA 5EOOA 3LIDA 3VFFA 1GSWA 5GLAA 3E2KA 3OLOA 5F5YA 4DE2A 4WUJA 1GA9A 2IWCA 3IS2A 2QHKA 3LYXA 3EEAA 3EGXC 3VV4A 2BTFP 4X53A 4M4XA 3HLEA 3IX3A 1O07A 1UGUA 1Y54A 4WMCA 1BLCA 2VEAA 1ZC2A 2HDRA 5EM1A 2WYXA 1VM1A 4LRZE 1YLYA 4DE3A 4QWOA 3NJAA 3U2AA 3D3OA 1LL8A 4DRTA 1ESUA 2LB5A 4JF6A 5FQKA 1GSXA 2Y2GA 1KOUA 1K56D 1S4RA 2FFYA 4S2IA 1ZG6A 4GZBA 3RXXA 1TS7A 4KQRA 1IKGA 4KZ5A 3VP3A 3ISGA 1GA0A 5HSQA 2ZLYA 2DNSA 3S1YA 2XLNA 1ZG4A 3UDXA 1AWIA 4BL2A 4S2LA 1LT0A 3BLMA 2V9AA 5CTNA 3I7JA 2XK1A 3E2LA 4ZTKA 4Y0OA 4P87A 4WMCD 1YSQA 4GLQA 3BFCA 3BECA 1OT9A 4Q0IA 1TS6A 1GHIA 3PAGA 4UQIM 1K38A 3VP2A 4KUOA 4GD6A 4EBPA 4IHQA 2Y2QA 1D06A 3F1PA 1ODVA 2YKHA 3W4PA 4X68A 4JXGA 1A0KA 2EX8A 4MLLA 4GB7A 3HUMA 3VP1A 3V5MA 4HI4A 1F2KA 1UWPX 3UE0A 3BEBA 4OKPA 3UB6A 5EVIB 3V50A 3PBNA 2ZQ9A 3HCYA 3DTEA 5KSHA 4QJGA 3UDFA 1E4DA 5DJUA 4E6WA 3W8KA 4N1HA 2B02A 2I72A 2Z6DA 4O7DA 3JPUA 1E3UA 3BW6A 3MZFA 2PR5A 5DFYA 1MKIA 1SKOB 3E4QA 3VP4A 2IA2A 2ZOHA 2W1TA 3ZNTA 4DE1A 4ZRRA 1CEFA 2L1MA 3IWQA 2HF6A 1Q2PA 2IWDA 4HJ6A 1K55C 1GSVA 4I5SA 1P97A 3AGDA 2WKEA 5HWVA 4NXFA 1XX2A 1N9LA 4ID4A 5KMWA 1I2SA 4KZ3A 2V1BA 2EFXA 3U4LP 5C5KA 2EX9A 3G2YA 2O9AA 1IELA 4HP9A 5F1GA 3M6HA 3BQAA 3ZHHA 1D1JA 4YWZA 2ZM2A 1PWGA 3WS5A 4UA7A 1LL5A 5TFQA 2B95A 5F69A 4XUZA 4KG2A 4DJ3A 2P9VB 3EEHA 3GTCA 3FV7A 1VQQA 4I3AA 5EECA 5I94A 1E3UD 4S2MA 3TW8A 3ZCZA 5CEDA 4QHCA 3SH8A 3NOUC 5EPHA 2INWA 1PRQA 4RA7A 3CPTB 2ZC7A 2ZC5B 4HBUA 5DTSA 3MFXA 1IKIA 5HD5A 3Q07A 5IT5A 3DBAA 1HLUP 3IH8A 4GNUA 2A2LA 3O86A 3T4LA 4WN5A 4MN7A 3C38A 2J9OA 3NHQA 4S2KA 5FI6A 1NZUA 1RGYA 3GMWA 1MPLA 3HREA 1NYYA 1STZA 2R9WA 4Q8IA 2Y79A 1NJ4A 1K6SA 4CLCA 4WLAA 3ZG9B 5FEFA 1K6RA 5F1FA 2A24A 3F1OA 4U3TA 4BBUA 4PAUA 1PW8A 1K0KA 1YAXA 2QKPA 2M1CA 5HAIA 1I5QA 4MN5A 3PTEA 5TBMA 4KQDA 3FWLA 2L0WA 2V0UA 1JWPA 5JYPA 4LENA 1PYYA 2HDSA 3BFEA 3UPPA 4JBFA 4WM9A 3LGOA 3S7NA 2VGJA 1LI0A 4IJGA 2DMWA 5HAPA 3IXDA 4WZ5A 5CHUA 4KZAA 4MNRA 3CHWP 4E3JA 3S22A 4OP5A 2XR0A 3MFDA 1K4EA 2J8YA 2X01A 3CZDA 4IVIA 3CUEA 2EWWA 4FSFA 4PM9A 1FCMA 5A8BA 2A3UA 4CQHA 1H8ZA 1JWVA 4CLCD 4F3LB 1SDNA 1CEGA 1MC0A 4MBKA 4O01A 4KZBA 1NLYA 3TOIA 1HTZA 3LR0A 5A92A 4FUWA 2JKTI 4FTXA 4GDNA 4EXOA 2ZBBA 4JKTA 1N9BA 4JGPA 2OLUA 2I9VA 5G4YA 5F68A 1PI5A 2W3GA 2X71A 3K3DA 2P7JA 3TJZC 3O88A 4NETA 1L2SA 1OTBA 1MXOA 1LSWA 3GRJA 4ZBEA 1NLZA 1CF0A 1GHMA 1NXYA 2GNXA 2NUTC 4WEJA 2EXAA 1FIKA 2QWSA 1ERQA 1RP5A 3MZDA 1HZOA 2XA7S 4C6YA 3UPNA 2H5SA 2EWVA 4OVDA 3LICA 3VFHA 3UB7A 3KX0X 3MZEA 2KX6A 1XJ6A 1ZHHB 2RCXA 3PBSA 4LRYC 1GCEA 1TF1A 4H8RA 3NI9A 1HVBA 3A3IA 1G68A 2CMNA 5AVFA 5GL9A 5FQJA 3G34A 1LSXA 1W79A 4EEPA 5DTTA 2CC1A 3VMAA 1ZTUA 5FQQA 2W27A 2V20A 2PBDP 1X0OA 3K3CA 1ESIA 2WUQA 3IWIA 3UO9A 4L9EA 4Y7PA 4Q0HA 5HWTA 3TE8A 4AFIA 3G6OA 4MN6A 3C4OA 4IEDA 2VLGA 5HDDA 5HWWA 4LV1A 1W63M 3OOVA 2LB9A 2WGWB 2EX2A 2QPNA 3T4SA 1XJ3A 2ZMFA 3LIFA 3LI9A 5D3OA 2VGKA 4WYYA 3C30A 3G2ZA 2WZZA 2ZL1B 4CLCC 3IXBA 3N8RA 4EV4A 3MQOA 1PNEA 3MKEA 4XUXA 1MWSA 4GCZA 4XT2A 5EOEA 4P0MA 1L0EA 3PR6A 3T12B 1T1AA 3VE3A 4R3AA 3GECA 3HLFA 3SS3A 2JKRI 4HP4A 5AQBA 1J3WA 3MJQA 4Z1WA 3BM6A 4RX3A 2VZWA 4EU0A 1PW1A 3RFBA 3ZG7B 1Z09A 3PBQA 4EUZA 4ETXA 4KZ7A 4WZ5C 2W1RA 3HLBA 3BY9A 2HJ9C 3P7NA 2PT7A 3BY8A 3KSGA 4QB8A 2VGLS 2XFTA 3CUEC 3H7WA 4GKUA 5DF8A 3IBJA 4X25A 4IBXA 4PM7A 2V0WA 2Z6CA 1LLBA 4HEFA 5FQ9A 4P6ZM 2WADA 1PWDA 2Y2OA 5EVLA 1CI8A 1YLTA 3MQ0A 1TDLA 2K2NA 2Q9MA 2PDRA 1DJBA 2QJ7A 5L8MA 1YPRA 5CERA 3OPHA 3NDEA 3H82B 5J8XA 3N8SA 4FCFA 3V67A 4Y2FA 3R7WA 1DJAA 1TD5A 3VSLA 2JC7A 4EESA 1OTDA 3S7QA 2OWHA 5EVEA 4P6BA 1VEUB 2OLVA 3T1SA 5M18A 1YSPA 5CHJA 3IH9A 4N9KA 1P9RA 2HDQA 4QPRA 2EA9A 4RYEA 4FD8A 1S66L 4KENB 3RXWA 2O0YA 1FR6A 4JGOA 1HD8A 5FA7A 5HX9A 3FPVA 5J4EA 4I3IA 4YNRA 4HJ4A 1BLHA 1YQSA 2E8JA 3CJMA 1K25A 5EUAA 3IF5A 3M2JA 3IX8A 2XROA 1KE0A 4LFUA 5FL3A 2EXBA 5HDCA 2Y2PA 1KVMA 1YT4A 3EWKA 4JGQA 2V8CA 5BOHA 1IFQA 2GJ3A 4GS9B 4OOYA 1VETA 3MXQA 4Q0JA 2H0TA 3W4QA 4UHUA 1RCJA 2PYPA 3MQQA 1MY8A 4E04A 4QU3A 3QP5A 5FAPA 2UV0E 4HH3A 1T18A 3LCEA 1P9WA 4G3VA 3LY4A 4Y15A 2W3FA 3OCLA 2V2FF 2C6WB 1YLJA 2AVXA 1MBLA 4H6JA 4RVAA 4OQIA 4GHIA 4P85A 1BTLA 4R3JA 4BBTA 3LY3A 1ES4A 4EUVA 1ACFA 5M1AA 3DTMA 2JBFA 2X02A 2PRFA 4S2PA 5CTMA 3IF6B 4CJNA 4R3BA 2Q9NA 4IVKA 2JHEA 3QHYA 1XFNA 1RGZA 1XFQA 3Q82A 3T4JA 2ACGA 3NULA 3PBTA 4R1GA 5AQ7A 4Y0UA 2V8FA 1MWRA 1KDWA 5E2HA 5FATA 1VB6A 3RJUA 3IX4A 1H5XA
chains in the Genus database with same CATH topology
1NYMA 1JWZA 3DW0A 4X56A 1JWPA 2H10A 2Y2HA 4KQQA 2UWXA 5JYPA 4LENA 1PYYA 2HDSA 3BFEA 3UPPA 4JBFA 2XH9A 4PPRA 1TDGA 1XA7A 3Q7ZA 2HDUA 4WM9A 1LHYA 4ZAMA 1KGFA 2DCFA 4NK3A 1ES5A 2VGJA 2Z2LB 5AQAA 1LI0A 1NZOA 4R0QA 4R4RA 5GLBA 5HAPA 3DWZA 3DWKA 5KSCA 2Y2LA 3IXDA 4WZ5A 5CHUA 5DTKA 3OPPA 4OPQA 4E3KA 2ZD8A 4EQIA 2ZQ8A 3CG5A 1O7EA 4KZAA 4MNRA 4YFMA 3IHBA 4E3JA 2OSUA 3S22A 4PM8A 4OP5A 2XR0A 1XKZA 3MFDA 4JXSA 5FDHA 1K4EA 2J8YA 3IT9A 4U0XA 2X01A 3CZDA 4IVIA 4OQ0A 4FSFA 4HESA 4RX2A 4LV2A 1I2WA 3FZCA 3WRZA 4PM9A 4QY6A 1FCMA 4R4SA 4ZJ2A 2A3UA 4OONA 4ZDXA 1H8ZA 1JWVA 4UA6A 4CPKA 1SDNA 1CEGA 1AXBA 2P74A 3OPRA 1ES2A 1YMXA 3MXSA 5E2FA 4MBKA 4BLMA 2V1ZA 3OPLA 3S4XA 1K54A 4KZBA 2ZC4B 3TOIA 3UY6A 1HTZA 1MWTA 2WKIA 1MWUA 3IXHA 3VSKA 1KGGA 3GVBA 5TR7A 1TEMA 5A92A 1PZPA 4C75A 3FKVA 1WE4A 4KZ6A 1U60A 1XXMA 1IYPA 4E3IA 3A3DA 3AGEA 5A90A 4GDNA 5CXWA 4JKTA 1N9BA 2OLUA 3W4OA 1BULA 3QNBA 3UE1A 4MBHA 5F82A 1GHPA 1NRFA 5GLDA 5HAQA 4DXCA 1FSWA 1PI5A 3N7WA 4A5RA 1PI4A 4GD8A 2XD1A 5E2GA 2X71A 2G2UA 2Y4AA 2XD5A 2XGNA 3O88A 4NETA 3G4PA 1W8YA 4K0WA 1L2SA 1OMEA 5FQMA 3SH9A 3HVFA 3WS1A 1MXOA 3PBOA 1SCWA 4U0TA 3GRJA 3IXGA 4ZBEA 1EWZA 3HLWA 4KG6A 4BD0A 3OZHA 1GHMA 2EFUA 2HP9A 3BYDA 1NXYA 1XP4A 2XEPA 2Z2MB 3C4PA 1KE3A 2WGWA 4WEJA 3ZNYA 2EXAA 4JXVA 3OCNA 5CHMA 4B4ZA 3B3XA 3G31A 1ERQA 1RP5A 3MZDA 1HZOA 2GDNA 5CECA 2RL3A 4C6YA 3UPNA 3VOYA 1XGIA 2H5SA 4F94A 4OVDA 3MKFA 3VFHA 3A3FA 4GN2A 1IYOA 1K55A 3IF6C 3MZEA 1KE4A 4WEKA 3HBRA 4X55A 2RCXA 3LO7A 4DE0A 1C3BA 3A3JA 1ES3A 3PBSA 3BFFA 1GCEA 1QMFA 5FQIA 3Q7VA 4OH0A 4H8RA 4UAAA 2ZM8A 4ZJ3A 4YINA 3ZDJA 3NI9A 1K57A 2FFFB 3ZGAB 1K56A 2OV5A 5DF9A 1HVBA 3A3IA 4PM5A 1G68A 2ZQCA 1EROA 2IWBA 5GL9A 5FQJA 3FYZA 1ONHA 3G34A 1W79A 3M6BA 5E43A 5HW3A 2PU2A 5EOOA 1BLSA 1PIOA 2CC1A 3HLGA 5DTTA 1FSYA 5FQQA 3PBRA 3VFFA 3VMAA 1DY6A 2V20A 5GLAA 3E2KA 4PM6A 1EI5A 2ZQ7A 4BD1A 4DE2A 5E2EA 1GA9A 2IWCA 1IYQA 4HBTA 2R9XA 1BZAA 2JCHA 3ZG0A 5A91A 1ESIA 2Y2NA 2WUQA 4X53A 3IWIA 3UDIA 5CEBA 3UO9A 4Y7PA 4EBLA 3HLEA 4WBGA 2ZC6B 1N4OA 1O07A 1Y54A 4D2OA 3C4OA 4IEDA 4GOGA 2Y59A 4LV1A 4WMCA 2DRWA 1W7FA 4EBNA 5TGFA 2WGWB 1BLCA 1XA1A 2EX2A 2QPNA 4IBRA 4N9LA 3P09A 4N1XA 1ZC2A 2HDRA 2Y2JA 3N4IA 2HPBA 3EQVA 1H8YA 2WYXA 3G35A 5D3OA 5DF7A 2PBYA 2VGKA 1VM1A 3BRMA 4WYYA 3Q1FA 1YLYA 4DE3A 3G2ZA 5CGXA 1KDSA 1M6KA 2WZZA 3HUOA 4WELA 4GDBA 1LL9A 4OOLA 3IXBA 3N8RA 4EV4A 4OQHA 1SDEA 3MKEA 3GSGA 3Q7VB 4DRTA 1ESUA 4JF6A 1MWSA 4LCMA 4X69A 4XUXA 5FQKA 4JF5A 2G2WA 5EOEA 2Y2GA 3HLDA 3IWOA 4OLDA 3UE3A 2JE5A 3ZG8B 1CI9A 1K56D 4P0MA 1L0EA 2FFYA 4S2IA 3BLSA 1CK3A 1ZG6A 4GZBA 4UA9A 2Y2KA 4MEZA 3IHAA 3RXXA 4KZ4A 4KQRA 1IKGA 4KZ5A 3VP3A 2BG1A 3ISGA 3TSGA 1GA0A 2HP6A 3HLFA 3NCKA 2A49A 3SS3A 1L0DA 5EVIA 1IEMA 1FCNA 2DNSA 2ZLYA 5AQBA 5M19A 4OOMA 3S1YA 2XLNA 3G30A 4N92A 3SS5A 1ZG4A 3BM6A 3UDXA 3SH7A 4RX3A 1L0GA 3BFGA 1PW1A 5EE8A 4E3NA 2WGVA 2QZ6A 4BL2A 4S2LA 4XXRA 1NY0A 3ZG7B 3BLMA 3PBQA 4EUZA 1KVLA 3EQUA 5CTNA 3I7JA 5KZHA 4E3MA 2XK1A 1FR1A 4KZ7A 1BT5A 4WZ5C 5CGWA 5G18A 2ZM0A 3HLBA 1M40A 3E2LA 4OPZA 4ZTKA 4Y0OA 1FQGA 4E3LA 4P87A 4WMCD 3OC2A 1S6RA 4OQGA 4EWFA 1W8QA 1K4FA 5AQ9A 3V3RA 5GLCA 3NDGA 4S2NA 4QB8A 3BFCA 3ZFZA 2XFTA 3BECA 3HL9A 4GKUA 4S2JA 5DF8A 3GV9A 3MXRA 4IBXA 4PM7A 3WWXA 1GHIA 3PAGA 2J7VA 1ERMA 2WK0A 5FAQA 1K38A 1LLBA 1SKFA 2HP5A 4HEFA 5FQ9A 2WADA 1PWDA 2Y2OA 5EVLA 3VP2A 5A93A 4JF4A 1CI8A 4GD6A 1YLTA 1Z6FA 4EBPA 1K54C 3ZVTA 1TDLA 3G32A 2E8IA 2Y2QA 1YLPA 2ZJ9A 4FH2A 4OP8A 2PU4A 2Q9MA 4MBFA 4R23A 4BJPA 3W4PA 1KGEA 1DJBA 4X68A 4JXGA 4DF6A 5CERA 3UNWA 2EX8A 4MLLA 1J9MA 2B5RA 3NDEA 3OPHA 4GB7A 5J8XA 3HUMA 3M2KA 3N8SA 4FCFA 2C5WB 1IYSA 3VP1A 1BLPA 3V5MA 3WRTA 3ZVWA 3UE0A 3BEBA 1DJAA 4OKPA 4KZ9A 4X6TA 5EVID 5F83A 5EVIB 3V50A 2JC7A 3VSLA 3ZG5A 3GR2A 4OPYA 2Y2IA 3PBNA 3VP0A 2ZQ9A 4QD4A 3Q81A 5KSHA 2P9VA 4QJGA 3UDFA 5HL1A 1E4DA 2XDMA 4P6BA 4E6WA 3LEZA 2OLVA 4N1HA 3W8KA 5M18A 1XGJA 3C7VA 5CHJA 5JYOA 2I72A 3NIAA 4O7DA 3PAEA 3IH9A 4N9KA 1YMSA 1ZKJA 2HDQA 1E3UA 4L0LA 4PMAA 1BSGA 4RYEA 3MZFA 4FD8A 1MKIA 4K91A 3BFDA 3HLCA 4WZ4A 1PZOA 3VP4A 3ITAA 4KENB 1WYBA 3ZNTA 4DE1A 2XFSA 3RXWA 1FR6A 1CEFA 1HD8A 5FA7A 5HX9A 3N6IA 4K0XA 1W5DA 3IWQA 3MBZA 1Q2PA 2IWDA 2WAFA 1K55C 1BLHA 1TVFA 4JLFA 3UPOA 2BLSA 1YQSA 3AGDA 3CJMA 2WKEA 3P98A 1K25A 4JPMA 1XX2A 4ID4A 5EUAA 3IF5A 5KMWA 1I2SA 3WS4A 4KZ3A 3M2JA 3GQZA 1K57C 2EFXA 2XQZA 1KE0A 3A3EA 2EXBA 2EX9A 4QY5A 3G2YA 4E3OA 1IELA 2Y2PA 4DXBA 3CMZA 5F1GA 5HFOA 3M6HA 5IHVA 1KVMA 1YT4A 3IQAA 4LCLA 3ZHHA 4Z9QA 3AGFA 2ZM2A 5BOHA 4LV0A 1PWGA 2WZXA 1QMEA 3WS5A 5CGSA 4UA7A 2EX6A 1LL5A 3JYIA 5TFQA 1FCOA 3IF6A 3C5AA 4KQOA 4KZ8A 4OOYA 5HARA 5FASA 2H0TA 3D4FA 5FI2A 3W4QA 4UHUA 4DKIA 4XUZA 1ONGA 4KG2A 4DDYA 2P9VB 2QMIA 3GTCA 1RCJA 3FV7A 5GHYA 1VQQA 4BQMA 1Q2QA 3HUNA 4B88A 4BL3A 1MY8A 1ALQA 3FKWA 3ITBA 5U47A 5EECA 3V39A 3VOZA 4QU3A 1FOFA 5I94A 1E3UD 5DVAA 5FAPA 4DDSA 4S2MA 3ZCZA 3WS2A 3LCEA 5CEDA 5GHXA 3C7UA 4QHCA 1BUEA 1XPBA 4KG5A 3LY4A 2ZQAA 3SH8A 4B4XA 3OCLA 2V2FF 5EPHA 2ZMAA 1PWCA 4RA7A 2ZC7A 2ZC5B 2C6WB 1S0WA 1YLJA 4HBUA 5DTSA 3O3VA 1IKIA 2H0YA 3Q07A 1MBLA 3SOIA 1SHVA 4RVAA 1WYCA 4OQIA 1YLWA 3IH8A 4S2OA 4GNUA 3SS4A 4P85A 3O86A 1BTLA 1JTGA 4R3JA 4LV3A 3QNCA 5CRFA 1JVJA 2J9OA 3LY3A 1ES4A 4S2KA 5FI6A 5M1AA 5L2FA 1NZUA 1RGYA 3DTMA 2JBFA 4E6XA 3GMWA 2WAEA 1MPLA 3TG9A 4OPRA 3HREA 2X02A 3WS0A 5EVIC 4S2PA 3N8LA 1NYYA 5CTMA 2R9WA 3IF6B 4R3BA 1E25A 3NY4A 3O87A 5FSRA 4CJNA 1NJ4A 1K6SA 5FI7A 4Q8IA 2ZQDA 4C3QA 2Q9NA 2Y55A 3ZG9B 4IVKA 3QHYA 1G6AA 1RGZA 1K6RA 4M3KA 4Y0TA 5F1FA 4JXWA 2WKHA 4U3TA 5GHZA 3V3SA 2XF3A 1PW8A 2Y2MA 3NC8A 3Q82A 4OLGA 1LI9A 3PBTA 2ZC3B 4FH4A 4R1GA 5AQ7A 4BENA 5HAIA 5FAOA 1YM1A 1YLZA 2J9PA 1I5QA 2Y91A 2WGIA 3NBLA 1MWRA 1KDWA 4Y0UA 5E2HA 1DJCA 5FATA 3RJUA 1JTDA 4ZJ1A 4S2NC 3PTEA 3UN7A 1H5XA 1L0FA 3FWLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NYM A;  1JWZ A;  3DW0 A;  4X56 A;  1JWP A;  2H10 A;  2Y2H A;  4KQQ A;  2UWX A;  5JYP A;  4LEN A;  1PYY A;  2HDS A;  3BFE A;  3UPP A;  4JBF A;  2XH9 A;  4PPR A;  1TDG A;  1XA7 A;  3Q7Z A;  2HDU A;  4WM9 A;  1LHY A;  4ZAM A;  1KGF A;  2DCF A;  4NK3 A;  1ES5 A;  2VGJ A;  2Z2L B;  5AQA A;  1LI0 A;  1NZO A;  4R0Q A;  4R4R A;  5GLB A;  5HAP A;  3DWZ A;  3DWK A;  5KSC A;  2Y2L A;  3IXD A;  4WZ5 A;  5CHU A;  5DTK A;  3OPP A;  4OPQ A;  4E3K A;  2ZD8 A;  4EQI A;  2ZQ8 A;  3CG5 A;  1O7E A;  4KZA A;  4MNR A;  4YFM A;  3IHB A;  4E3J A;  2OSU A;  3S22 A;  4PM8 A;  4OP5 A;  2XR0 A;  1XKZ A;  3MFD A;  4JXS A;  5FDH A;  1K4E A;  2J8Y A;  3IT9 A;  4U0X A;  2X01 A;  3CZD A;  4IVI A;  4OQ0 A;  4FSF A;  4HES A;  4RX2 A;  4LV2 A;  1I2W A;  3FZC A;  3WRZ A;  4PM9 A;  4QY6 A;  1FCM A;  4R4S A;  4ZJ2 A;  2A3U A;  4OON A;  4ZDX A;  1H8Z A;  1JWV A;  4UA6 A;  4CPK A;  1SDN A;  1CEG A;  1AXB A;  2P74 A;  3OPR A;  1ES2 A;  1YMX A;  3MXS A;  5E2F A;  4MBK A;  4BLM A;  2V1Z A;  3OPL A;  3S4X A;  1K54 A;  4KZB A;  2ZC4 B;  3TOI A;  3UY6 A;  1HTZ A;  1MWT A;  2WKI A;  1MWU A;  3IXH A;  3VSK A;  1KGG A;  3GVB A;  5TR7 A;  1TEM A;  5A92 A;  1PZP A;  4C75 A;  3FKV A;  1WE4 A;  4KZ6 A;  1U60 A;  1XXM A;  1IYP A;  4E3I A;  3A3D A;  3AGE A;  5A90 A;  4GDN A;  5CXW A;  4JKT A;  1N9B A;  2OLU A;  3W4O A;  1BUL A;  3QNB A;  3UE1 A;  4MBH A;  5F82 A;  1GHP A;  1NRF A;  5GLD A;  5HAQ A;  4DXC A;  1FSW A;  1PI5 A;  3N7W A;  4A5R A;  1PI4 A;  4GD8 A;  2XD1 A;  5E2G A;  2X71 A;  2G2U A;  2Y4A A;  2XD5 A;  2XGN A;  3O88 A;  4NET A;  3G4P A;  1W8Y A;  4K0W A;  1L2S A;  1OME A;  5FQM A;  3SH9 A;  3HVF A;  3WS1 A;  1MXO A;  3PBO A;  1SCW A;  4U0T A;  3GRJ A;  3IXG A;  4ZBE A;  1EWZ A;  3HLW A;  4KG6 A;  4BD0 A;  3OZH A;  1GHM A;  2EFU A;  2HP9 A;  3BYD A;  1NXY A;  1XP4 A;  2XEP A;  2Z2M B;  3C4P A;  1KE3 A;  2WGW A;  4WEJ A;  3ZNY A;  2EXA A;  4JXV A;  3OCN A;  5CHM A;  4B4Z A;  3B3X A;  3G31 A;  1ERQ A;  1RP5 A;  3MZD A;  1HZO A;  2GDN A;  5CEC A;  2RL3 A;  4C6Y A;  3UPN A;  3VOY A;  1XGI A;  2H5S A;  4F94 A;  4OVD A;  3MKF A;  3VFH A;  3A3F A;  4GN2 A;  1IYO A;  1K55 A;  3IF6 C;  3MZE A;  1KE4 A;  4WEK A;  3HBR A;  4X55 A;  2RCX A;  3LO7 A;  4DE0 A;  1C3B A;  3A3J A;  1ES3 A;  3PBS A;  3BFF A;  1GCE A;  1QMF A;  5FQI A;  3Q7V A;  4OH0 A;  4H8R A;  4UAA A;  2ZM8 A;  4ZJ3 A;  4YIN A;  3ZDJ A;  3NI9 A;  1K57 A;  2FFF B;  3ZGA B;  1K56 A;  2OV5 A;  5DF9 A;  1HVB A;  3A3I A;  4PM5 A;  1G68 A;  2ZQC A;  1ERO A;  2IWB A;  5GL9 A;  5FQJ A;  3FYZ A;  1ONH A;  3G34 A;  1W79 A;  3M6B A;  5E43 A;  5HW3 A;  2PU2 A;  5EOO A;  1BLS A;  1PIO A;  2CC1 A;  3HLG A;  5DTT A;  1FSY A;  5FQQ A;  3PBR A;  3VFF A;  3VMA A;  1DY6 A;  2V20 A;  5GLA A;  3E2K A;  4PM6 A;  1EI5 A;  2ZQ7 A;  4BD1 A;  4DE2 A;  5E2E A;  1GA9 A;  2IWC A;  1IYQ A;  4HBT A;  2R9X A;  1BZA A;  2JCH A;  3ZG0 A;  5A91 A;  1ESI A;  2Y2N A;  2WUQ A;  4X53 A;  3IWI A;  3UDI A;  5CEB A;  3UO9 A;  4Y7P A;  4EBL A;  3HLE A;  4WBG A;  2ZC6 B;  1N4O A;  1O07 A;  1Y54 A;  4D2O A;  3C4O A;  4IED A;  4GOG A;  2Y59 A;  4LV1 A;  4WMC A;  2DRW A;  1W7F A;  4EBN A;  5TGF A;  2WGW B;  1BLC A;  1XA1 A;  2EX2 A;  2QPN A;  4IBR A;  4N9L A;  3P09 A;  4N1X A;  1ZC2 A;  2HDR A;  2Y2J A;  3N4I A;  2HPB A;  3EQV A;  1H8Y A;  2WYX A;  3G35 A;  5D3O A;  5DF7 A;  2PBY A;  2VGK A;  1VM1 A;  3BRM A;  4WYY A;  3Q1F A;  1YLY A;  4DE3 A;  3G2Z A;  5CGX A;  1KDS A;  1M6K A;  2WZZ A;  3HUO A;  4WEL A;  4GDB A;  1LL9 A;  4OOL A;  3IXB A;  3N8R A;  4EV4 A;  4OQH A;  1SDE A;  3MKE A;  3GSG A;  3Q7V B;  4DRT A;  1ESU A;  4JF6 A;  1MWS A;  4LCM A;  4X69 A;  4XUX A;  5FQK A;  4JF5 A;  2G2W A;  5EOE A;  2Y2G A;  3HLD A;  3IWO A;  4OLD A;  3UE3 A;  2JE5 A;  3ZG8 B;  1CI9 A;  1K56 D;  4P0M A;  1L0E A;  2FFY A;  4S2I A;  3BLS A;  1CK3 A;  1ZG6 A;  4GZB A;  4UA9 A;  2Y2K A;  4MEZ A;  3IHA A;  3RXX A;  4KZ4 A;  4KQR A;  1IKG A;  4KZ5 A;  3VP3 A;  2BG1 A;  3ISG A;  3TSG A;  1GA0 A;  2HP6 A;  3HLF A;  3NCK A;  2A49 A;  3SS3 A;  1L0D A;  5EVI A;  1IEM A;  1FCN A;  2DNS A;  2ZLY A;  5AQB A;  5M19 A;  4OOM A;  3S1Y A;  2XLN A;  3G30 A;  4N92 A;  3SS5 A;  1ZG4 A;  3BM6 A;  3UDX A;  3SH7 A;  4RX3 A;  1L0G A;  3BFG A;  1PW1 A;  5EE8 A;  4E3N A;  2WGV A;  2QZ6 A;  4BL2 A;  4S2L A;  4XXR A;  1NY0 A;  3ZG7 B;  3BLM A;  3PBQ A;  4EUZ A;  1KVL A;  3EQU A;  5CTN A;  3I7J A;  5KZH A;  4E3M A;  2XK1 A;  1FR1 A;  4KZ7 A;  1BT5 A;  4WZ5 C;  5CGW A;  5G18 A;  2ZM0 A;  3HLB A;  1M40 A;  3E2L A;  4OPZ A;  4ZTK A;  4Y0O A;  1FQG A;  4E3L A;  4P87 A;  4WMC D;  3OC2 A;  1S6R A;  4OQG A;  4EWF A;  1W8Q A;  1K4F A;  5AQ9 A;  3V3R A;  5GLC A;  3NDG A;  4S2N A;  4QB8 A;  3BFC A;  3ZFZ A;  2XFT A;  3BEC A;  3HL9 A;  4GKU A;  4S2J A;  5DF8 A;  3GV9 A;  3MXR A;  4IBX A;  4PM7 A;  3WWX A;  1GHI A;  3PAG A;  2J7V A;  1ERM A;  2WK0 A;  5FAQ A;  1K38 A;  1LLB A;  1SKF A;  2HP5 A;  4HEF A;  5FQ9 A;  2WAD A;  1PWD A;  2Y2O A;  5EVL A;  3VP2 A;  5A93 A;  4JF4 A;  1CI8 A;  4GD6 A;  1YLT A;  1Z6F A;  4EBP A;  1K54 C;  3ZVT A;  1TDL A;  3G32 A;  2E8I A;  2Y2Q A;  1YLP A;  2ZJ9 A;  4FH2 A;  4OP8 A;  2PU4 A;  2Q9M A;  4MBF A;  4R23 A;  4BJP A;  3W4P A;  1KGE A;  1DJB A;  4X68 A;  4JXG A;  4DF6 A;  5CER A;  3UNW A;  2EX8 A;  4MLL A;  1J9M A;  2B5R A;  3NDE A;  3OPH A;  4GB7 A;  5J8X A;  3HUM A;  3M2K A;  3N8S A;  4FCF A;  2C5W B;  1IYS A;  3VP1 A;  1BLP A;  3V5M A;  3WRT A;  3ZVW A;  3UE0 A;  3BEB A;  1DJA A;  4OKP A;  4KZ9 A;  4X6T A;  5EVI D;  5F83 A;  5EVI B;  3V50 A;  2JC7 A;  3VSL A;  3ZG5 A;  3GR2 A;  4OPY A;  2Y2I A;  3PBN A;  3VP0 A;  2ZQ9 A;  4QD4 A;  3Q81 A;  5KSH A;  2P9V A;  4QJG A;  3UDF A;  5HL1 A;  1E4D A;  2XDM A;  4P6B A;  4E6W A;  3LEZ A;  2OLV A;  4N1H A;  3W8K A;  5M18 A;  1XGJ A;  3C7V A;  5CHJ A;  5JYO A;  2I72 A;  3NIA A;  4O7D A;  3PAE A;  3IH9 A;  4N9K A;  1YMS A;  1ZKJ A;  2HDQ A;  1E3U A;  4L0L A;  4PMA A;  1BSG A;  4RYE A;  3MZF A;  4FD8 A;  1MKI A;  4K91 A;  3BFD A;  3HLC A;  4WZ4 A;  1PZO A;  3VP4 A;  3ITA A;  4KEN B;  1WYB A;  3ZNT A;  4DE1 A;  2XFS A;  3RXW A;  1FR6 A;  1CEF A;  1HD8 A;  5FA7 A;  5HX9 A;  3N6I A;  4K0X A;  1W5D A;  3IWQ A;  3MBZ A;  1Q2P A;  2IWD A;  2WAF A;  1K55 C;  1BLH A;  1TVF A;  4JLF A;  3UPO A;  2BLS A;  1YQS A;  3AGD A;  3CJM A;  2WKE A;  3P98 A;  1K25 A;  4JPM A;  1XX2 A;  4ID4 A;  5EUA A;  3IF5 A;  5KMW A;  1I2S A;  3WS4 A;  4KZ3 A;  3M2J A;  3GQZ A;  1K57 C;  2EFX A;  2XQZ A;  1KE0 A;  3A3E A;  2EXB A;  2EX9 A;  4QY5 A;  3G2Y A;  4E3O A;  1IEL A;  2Y2P A;  4DXB A;  3CMZ A;  5F1G A;  5HFO A;  3M6H A;  5IHV A;  1KVM A;  1YT4 A;  3IQA A;  4LCL A;  3ZHH A;  4Z9Q A;  3AGF A;  2ZM2 A;  5BOH A;  4LV0 A;  1PWG A;  2WZX A;  1QME A;  3WS5 A;  5CGS A;  4UA7 A;  2EX6 A;  1LL5 A;  3JYI A;  5TFQ A;  1FCO A;  3IF6 A;  3C5A A;  4KQO A;  4KZ8 A;  4OOY A;  5HAR A;  5FAS A;  2H0T A;  3D4F A;  5FI2 A;  3W4Q A;  4UHU A;  4DKI A;  4XUZ A;  1ONG A;  4KG2 A;  4DDY A;  2P9V B;  2QMI A;  3GTC A;  1RCJ A;  3FV7 A;  5GHY A;  1VQQ A;  4BQM A;  1Q2Q A;  3HUN A;  4B88 A;  4BL3 A;  1MY8 A;  1ALQ A;  3FKW A;  3ITB A;  5U47 A;  5EEC A;  3V39 A;  3VOZ A;  4QU3 A;  1FOF A;  5I94 A;  1E3U D;  5DVA A;  5FAP A;  4DDS A;  4S2M A;  3ZCZ A;  3WS2 A;  3LCE A;  5CED A;  5GHX A;  3C7U A;  4QHC A;  1BUE A;  1XPB A;  4KG5 A;  3LY4 A;  2ZQA A;  3SH8 A;  4B4X A;  3OCL A;  2V2F F;  5EPH A;  2ZMA A;  1PWC A;  4RA7 A;  2ZC7 A;  2ZC5 B;  2C6W B;  1S0W A;  1YLJ A;  4HBU A;  5DTS A;  3O3V A;  1IKI A;  2H0Y A;  3Q07 A;  1MBL A;  3SOI A;  1SHV A;  4RVA A;  1WYC A;  4OQI A;  1YLW A;  3IH8 A;  4S2O A;  4GNU A;  3SS4 A;  4P85 A;  3O86 A;  1BTL A;  1JTG A;  4R3J A;  4LV3 A;  3QNC A;  5CRF A;  1JVJ A;  2J9O A;  3LY3 A;  1ES4 A;  4S2K A;  5FI6 A;  5M1A A;  5L2F A;  1NZU A;  1RGY A;  3DTM A;  2JBF A;  4E6X A;  3GMW A;  2WAE A;  1MPL A;  3TG9 A;  4OPR A;  3HRE A;  2X02 A;  3WS0 A;  5EVI C;  4S2P A;  3N8L A;  1NYY A;  5CTM A;  2R9W A;  3IF6 B;  4R3B A;  1E25 A;  3NY4 A;  3O87 A;  5FSR A;  4CJN A;  1NJ4 A;  1K6S A;  5FI7 A;  4Q8I A;  2ZQD A;  4C3Q A;  2Q9N A;  2Y55 A;  3ZG9 B;  4IVK A;  3QHY A;  1G6A A;  1RGZ A;  1K6R A;  4M3K A;  4Y0T A;  5F1F A;  4JXW A;  2WKH A;  4U3T A;  5GHZ A;  3V3S A;  2XF3 A;  1PW8 A;  2Y2M A;  3NC8 A;  3Q82 A;  4OLG A;  1LI9 A;  3PBT A;  2ZC3 B;  4FH4 A;  4R1G A;  5AQ7 A;  4BEN A;  5HAI A;  5FAO A;  1YM1 A;  1YLZ A;  2J9P A;  1I5Q A;  2Y91 A;  2WGI A;  3NBL A;  1MWR A;  1KDW A;  4Y0U A;  5E2H A;  1DJC A;  5FAT A;  3RJU A;  1JTD A;  4ZJ1 A;  4S2N C;  3PTE A;  3UN7 A;  1H5X A;  1L0F A;  3FWL A; 
#chains in the Genus database with same CATH topology
 4KQQ A;  3T4O A;  1NWZ A;  4PPR A;  1TDG A;  2HDU A;  1KGF A;  2J3T D;  1VHM A;  4I38 A;  4R4R A;  4HHD A;  4E3K A;  3OPP A;  2XA7 M;  2ZQ8 A;  4P6Z S;  3IHB A;  2ZMV A;  2PAV P;  4EEU A;  5L09 A;  3IT9 A;  4OQ0 A;  5AJG A;  4HES A;  4LV2 A;  4QY6 A;  4R4S A;  2VV7 A;  4OON A;  4ZDX A;  1AXB A;  1YMX A;  4BLM A;  3OPL A;  3S4X A;  1K54 A;  3UMD A;  1OTA A;  1MWT A;  3UY6 A;  1MWU A;  3VSK A;  1TEM A;  3E0Y A;  5CX7 A;  3FKV A;  1WE4 A;  3DTK A;  4NXB A;  1XXM A;  3AGE A;  1D7E A;  5CXW A;  3VOL A;  1F9I A;  1H3Q A;  3UE1 A;  5LBR A;  5G4Z A;  1PI4 A;  1TS0 A;  2XD5 A;  1XJ4 A;  3G4P A;  3E4P A;  4K0W A;  2WKR A;  1SCW A;  3QP2 A;  4WL9 A;  3KSF A;  2Z2M B;  2W3H A;  3C4P A;  1KE3 A;  2W0N A;  4ARZ B;  4B4Z A;  1LSV A;  4LGW A;  2VA0 A;  2GDN A;  4HOI A;  4KUK A;  2RL3 A;  3VOY A;  1XGI A;  3MKF A;  3A3F A;  3HBR A;  5HD3 A;  3LO7 A;  3A3J A;  3PXP A;  2L4R A;  4OH0 A;  4G3K A;  2VK3 A;  4PM5 A;  1OTE A;  3FYZ A;  5E43 A;  5HW3 A;  1BLS A;  5HDS A;  3T1Q B;  1FSY A;  4GS9 A;  4EET B;  2ZQ7 A;  3F1N B;  1IYQ A;  2O9B A;  1XJ2 A;  1BZA A;  2JCH A;  3CAX A;  5A91 A;  2JKT M;  3LFV A;  3QP8 A;  2Y2N A;  3UDI A;  4ESP A;  3ZQ5 A;  2W3D A;  4WBG A;  2ZC6 B;  1N4O A;  3GDI A;  5EFW A;  4D2O A;  2VGL M;  4GOG A;  1TS8 A;  5F6A A;  2DRW A;  4EBN A;  5TGF A;  3KSH A;  1XA1 A;  4IBR A;  3N4I A;  4G3W A;  4PKY A;  3EQV A;  3G35 A;  4ME4 A;  3BQ8 A;  3HUO A;  1LL9 A;  4OQH A;  1SDE A;  3T50 A;  3Q7V B;  2G7U A;  4LCM A;  4X69 A;  4I39 A;  3IWO A;  2JE5 A;  4Y5F A;  3BLS A;  1CK3 A;  4HJ3 A;  1OTI A;  4UA9 A;  2Y2K A;  4KZ4 A;  5DKK A;  5L10 A;  2PR6 A;  2BG1 A;  2D02 A;  2A49 A;  5EVI A;  1IEM A;  1FCN A;  5HZH A;  5M19 A;  3SS5 A;  3SH7 A;  5J7E A;  4MMN A;  3UE6 A;  1L0G A;  3IS2 B;  3BFG A;  3KSI A;  2WKP A;  5EE8 A;  2WGV A;  2QZ6 A;  4XXR A;  3HJK A;  3QP6 A;  3EQU A;  5KZH A;  2H28 A;  5CGW A;  1BT5 A;  2P08 A;  2ZM0 A;  1SKO A;  1OJ5 A;  4E3L A;  1UWN X;  1S6R A;  2HGV A;  5AVE A;  1W8Q A;  2J80 A;  5AQ9 A;  1CJF A;  3V3R A;  5GLC A;  3NDG A;  4S2N A;  3ZFZ A;  2FH5 A;  3GV9 A;  3WWX A;  1S67 L;  1SKF A;  2HP5 A;  4L9G A;  4BMW A;  1Z6F A;  3BWL A;  4X1M A;  1K54 C;  3D9Y A;  3ZVT A;  2E8I A;  4FH2 A;  1YLP A;  2ZJ9 A;  4OP8 A;  2PU4 A;  4R23 A;  3UB9 A;  4BJP A;  1KGE A;  3UNW A;  1J9M A;  2B5R A;  2MJ6 A;  2C5W B;  1BLP A;  3ZVW A;  1G5U A;  3MMH A;  4PHT A;  4KZ9 A;  4X6T A;  5EVI D;  5F83 A;  2Y2I A;  3S7P A;  3VP0 A;  4QD4 A;  2P9V A;  5HL1 A;  2XDM A;  3LEZ A;  3KO6 A;  4YOF A;  3NIA A;  2JKR M;  1ZKJ A;  4PMA A;  2YKF A;  4K91 A;  4WZ4 A;  4NEE D;  4LRX C;  4K0X A;  3SW1 A;  3CPT A;  1H8M A;  2HJE A;  3NOP C;  1TVF A;  4UEY A;  2J3W A;  2BLS A;  4R70 A;  3P98 A;  1BYW A;  2VJW A;  2Y8H A;  3UB8 A;  2XQZ A;  4HY8 A;  3A3E A;  3S7O A;  4E3O A;  3MF0 A;  3RTY A;  4DXB A;  4EW7 A;  1DP8 A;  3CMZ A;  4R38 A;  4Z9Q A;  3AGF A;  3JVU A;  4JGR A;  5CGS A;  3LI8 A;  1OT6 A;  2EX6 A;  3JYI A;  3C2W A;  2PYR A;  2XSS A;  4KQO A;  4KZ8 A;  5HAR A;  5FAS A;  3D4F A;  5FI2 A;  1ONG A;  3SZT A;  4HIA A;  4MCW A;  4BQM A;  1Q2Q A;  3HUN A;  4B88 A;  5DJT A;  3ITB A;  3VOZ A;  3WS2 A;  2R78 A;  3D72 A;  5GHX A;  1XPB A;  2W1T B;  4KG5 A;  2ZMA A;  1PWC A;  1IOU A;  1S0W A;  1G28 A;  2HV1 A;  4Y13 A;  5HPI A;  3A0R A;  2K7S A;  2O99 A;  4BBV A;  2Q0O A;  3SOI A;  1SHV A;  4S2O A;  3SS4 A;  3LEQ A;  4LV3 A;  3QNC A;  5CRF A;  5DFX A;  4B9O A;  4E6X A;  4RQ9 A;  3R4K A;  5EV0 A;  5EVI C;  4EER A;  3N8L A;  5FSR A;  1E25 A;  3NY4 A;  5FI7 A;  4F3L A;  2ZQD A;  2Y55 A;  4LPZ A;  3LIE A;  3A0S A;  3E98 A;  2BAS A;  3LR3 A;  4Y0T A;  2WKH A;  3LR4 A;  3V3S A;  2XF3 A;  2Y2M A;  2B18 A;  3NC8 A;  1LI9 A;  2GX5 A;  4FH4 A;  2M7V A;  5FAO A;  1YM1 A;  2J9P A;  2Y91 A;  3NBL A;  4DN0 A;  1JTD A;  4ZJ1 A;  4S2N C;  4I3J A;  4R6L A;  2H10 A;  1Y4O A;  2XH9 A;  1XA7 A;  3Q7Z A;  1LHY A;  4ZAM A;  2DCF A;  2XRN A;  4NK3 A;  3LIB A;  5GLB A;  1NZO A;  4R0Q A;  5KSC A;  2Y2L A;  5DTK A;  4Y17 A;  2ZD8 A;  4EQI A;  1O7E A;  4YFM A;  3CI6 A;  2WKQ A;  4PM8 A;  5K5B A;  5FDH A;  4U0X A;  3L9K A;  1I2W A;  3WRZ A;  4CPK A;  4CLC B;  3OBF A;  2P74 A;  1ES2 A;  3T4T A;  3QP4 A;  3NOT C;  3PHY A;  2A24 B;  3F1O B;  3GVB A;  3T4Q A;  1L3L A;  4KZ6 A;  1IYP A;  3A3D A;  5MC7 A;  5A90 A;  1BUL A;  3QNB A;  4MBH A;  5F82 A;  5GLD A;  5HAQ A;  4DXC A;  1FSW A;  3N7W A;  5TBM B;  2G2U A;  2GZA A;  3HVF A;  3PBO A;  4U0T A;  4KG6 A;  1W63 Q;  2EFU A;  2HP9 A;  5HPF A;  1XP4 A;  2WGW A;  4JXV A;  3OCN A;  5CHM A;  1NRJ A;  5CEC A;  3A0V A;  4F94 A;  3MS6 A;  4GN2 A;  1KE4 A;  2ZL1 A;  4DE0 A;  1ES3 A;  1N9N A;  5L07 A;  3BFF A;  1QMF A;  2QYB A;  2O9C A;  4HQA A;  4UAA A;  2ZM8 A;  4ZJ3 A;  4YIN A;  3ZDJ A;  1MKM A;  1K57 A;  2FFF B;  4NG2 A;  3JVV A;  2OWJ A;  2ZQC A;  1ERO A;  1ONH A;  3CLO A;  3M6B A;  2PU2 A;  3HLG A;  1PIO A;  3QP1 A;  3PBR A;  1DY6 A;  4PM6 A;  1EI5 A;  3ICY A;  4BD1 A;  5E2E A;  3T4K A;  4HBT A;  2R9X A;  3ZG0 A;  1G6O A;  4EQ1 A;  5FEG A;  2PHY A;  4K08 A;  5CEB A;  4EBL A;  5DKL A;  1YKD A;  2Y59 A;  3HJI A;  1W7F A;  1MZU A;  4N9L A;  3P09 A;  4N1X A;  2Y2J A;  2HPB A;  3VE4 A;  1H8Y A;  4Y3I A;  5DF7 A;  2PBY A;  1SZV A;  3BRM A;  3Q1F A;  5CGX A;  1KDS A;  1M6K A;  4WEL A;  4GDB A;  2OOL A;  4OOL A;  3DAV A;  3GSG A;  4JF5 A;  2G2W A;  4NKP A;  5FDS A;  3HLD A;  4OLD A;  3ZG8 B;  1S4S A;  3UE3 A;  1CI9 A;  1Y28 A;  2VX8 A;  3H82 A;  3LR5 A;  4MEZ A;  3IHA A;  3T1X A;  2M7U A;  3ULF A;  3TSG A;  2HP6 A;  3NCK A;  1L0D A;  4OOM A;  3G30 A;  4N92 A;  2QJ5 A;  3T1R A;  1S1Y A;  1VEU A;  5IS1 A;  4E3N A;  1NY0 A;  1DRM A;  1KVL A;  4NXG A;  1H0M A;  4E3M A;  1FR1 A;  3RH8 B;  5G18 A;  1M40 A;  4OPZ A;  1DP9 A;  1FQG A;  3OC2 A;  3CWF A;  4OQG A;  4EWF A;  1K4F A;  4DMZ A;  3CIT A;  4O0P A;  5I5L A;  3HL9 A;  4S2J A;  3MXR A;  5FAQ A;  2J7V A;  1ERM A;  2WK0 A;  3KYQ A;  3DTI A;  5A93 A;  4JF4 A;  3MR0 A;  3G32 A;  4XT2 B;  4MBF A;  3B42 A;  2HZ5 A;  4DF6 A;  2JN7 A;  3M2K A;  1IYS A;  1OJG A;  3WRT A;  3ZG5 A;  4MDZ A;  3GR2 A;  4OPY A;  1FIL A;  3PYP A;  3P01 A;  3Q81 A;  4GW9 A;  1XGJ A;  3C7V A;  5JYO A;  2VV8 A;  2J3T C;  3PAE A;  1YMS A;  4L0L A;  2FZ0 A;  1BSG A;  2KLI A;  3BFD A;  3HLC A;  3KYE A;  1PZO A;  4II7 A;  3ITA A;  1WYB A;  2XFS A;  1N9O A;  3N6I A;  1W5D A;  1WA9 A;  3MBZ A;  2WAF A;  3H7W B;  4JLF A;  3UPO A;  4LLO B;  3ZYT A;  4JPM A;  3WS4 A;  3GQZ A;  3H9W A;  1K57 C;  4UQI S;  1S1Z A;  4O8G A;  4QY5 A;  5IHV A;  5HFO A;  2ZOI A;  3IQA A;  4LCL A;  4L9F A;  4LV0 A;  2WZX A;  1QME A;  3R7W B;  1FCO A;  3IF6 A;  3C5A A;  4BWI A;  4DKI A;  4DDY A;  2QMI A;  5GHY A;  4GJ4 A;  4BL3 A;  4IUK A;  1ALQ A;  3FKW A;  5U47 A;  3V39 A;  1FOF A;  1T1B A;  5DVA A;  4DDS A;  2K31 A;  2VKS A;  3C7U A;  1BUE A;  4NXE A;  2NUP C;  2ZQA A;  4B4X A;  5EM0 A;  2OAQ 1;  3O3V A;  2PD8 A;  2H0Y A;  1WYC A;  1YLW A;  3MSH A;  1F98 A;  1OPX A;  1JTG A;  3FG8 A;  3O5Y A;  1JVJ A;  3FC7 A;  2OAP 1;  1PFL A;  5L2F A;  1CQA A;  2WAE A;  3TG9 A;  4OPR A;  3WS0 A;  3O87 A;  1VET B;  4C3Q A;  3W2Z A;  1G6A A;  1EW0 A;  4M3K A;  1T1C A;  4JXW A;  2KOI A;  5GHZ A;  5KIZ A;  4OLG A;  5TJJ A;  1F5M A;  2ZC3 B;  4BEN A;  4DJ2 A;  3EOI A;  1YLZ A;  2WGI A;  1DJC A;  4ETZ A;  3UN7 A;  4X1L A;  1L0F A;  1NYM A;  3UB5 P;  1JWZ A;  3DW0 A;  4X56 A;  2Y2H A;  2UWX A;  3BJN A;  5J3W A;  2JKG A;  2D01 A;  2VV6 A;  3NEC A;  1ES5 A;  2Z2L B;  5AQA A;  4H6J B;  2KDK A;  3DWZ A;  3DWK A;  4GHI B;  4OPQ A;  3CG5 A;  4D60 A;  3F1P B;  4ARZ A;  2OSU A;  1XKZ A;  3LIA A;  2PD7 A;  4JXS A;  4RX2 A;  3FZC A;  4ZJ2 A;  4UA6 A;  3IBR A;  3OPR A;  5E2F A;  3MXS A;  2V1Z A;  2ZC4 B;  2WKI A;  3IXH A;  1KGG A;  5TR7 A;  1PZP A;  4C75 A;  4HH2 A;  4PKY G;  1U60 A;  1P0Z A;  4E3I A;  3E4O A;  4CLC E;  5IU1 A;  1DP6 A;  3W4O A;  3F1N A;  2W3E A;  1GHP A;  1NRF A;  4A5R A;  4GD8 A;  3KYZ A;  2XD1 A;  5E2G A;  2Y4A A;  2XGN A;  1W8Y A;  3FPW A;  3C8C A;  3UME A;  4HNB A;  1OME A;  5FQM A;  3SH9 A;  3WS1 A;  4IUH A;  3IXG A;  1EWZ A;  3HLW A;  4BD0 A;  3EGD C;  1V9Y A;  3OZH A;  3BYD A;  1V9Z A;  2XEP A;  2JKF A;  3ZNY A;  3B33 A;  1T19 A;  3B47 A;  3B3X A;  3G31 A;  1JNU A;  4FOF A;  5HL6 A;  4B93 A;  1IYO A;  1K55 A;  3IF6 C;  4X55 A;  4WEK A;  1C3B A;  3K2N A;  5FQI A;  3Q7V A;  4WF0 A;  3ZGA B;  1K56 A;  2OV5 A;  2V1A A;  5DF9 A;  3TRC A;  2IWB A;  2P04 A;  3LUQ A;  3L7H A;  5EOO A;  3LID A;  3VFF A;  1GSW A;  5GLA A;  3E2K A;  3OLO A;  5F5Y A;  4DE2 A;  4WUJ A;  1GA9 A;  2IWC A;  3IS2 A;  2QHK A;  3LYX A;  3EEA A;  3EGX C;  3VV4 A;  2BTF P;  4X53 A;  4M4X A;  3HLE A;  3IX3 A;  1O07 A;  1UGU A;  1Y54 A;  4WMC A;  1BLC A;  2VEA A;  1ZC2 A;  2HDR A;  5EM1 A;  2WYX A;  1VM1 A;  4LRZ E;  1YLY A;  4DE3 A;  4QWO A;  3NJA A;  3U2A A;  3D3O A;  1LL8 A;  4DRT A;  1ESU A;  2LB5 A;  4JF6 A;  5FQK A;  1GSX A;  2Y2G A;  1KOU A;  1K56 D;  1S4R A;  2FFY A;  4S2I A;  1ZG6 A;  4GZB A;  3RXX A;  1TS7 A;  4KQR A;  1IKG A;  4KZ5 A;  3VP3 A;  3ISG A;  1GA0 A;  5HSQ A;  2ZLY A;  2DNS A;  3S1Y A;  2XLN A;  1ZG4 A;  3UDX A;  1AWI A;  4BL2 A;  4S2L A;  1LT0 A;  3BLM A;  2V9A A;  5CTN A;  3I7J A;  2XK1 A;  3E2L A;  4ZTK A;  4Y0O A;  4P87 A;  4WMC D;  1YSQ A;  4GLQ A;  3BFC A;  3BEC A;  1OT9 A;  4Q0I A;  1TS6 A;  1GHI A;  3PAG A;  4UQI M;  1K38 A;  3VP2 A;  4KUO A;  4GD6 A;  4EBP A;  4IHQ A;  2Y2Q A;  1D06 A;  3F1P A;  1ODV A;  2YKH A;  3W4P A;  4X68 A;  4JXG A;  1A0K A;  2EX8 A;  4MLL A;  4GB7 A;  3HUM A;  3VP1 A;  3V5M A;  4HI4 A;  1F2K A;  1UWP X;  3UE0 A;  3BEB A;  4OKP A;  3UB6 A;  5EVI B;  3V50 A;  3PBN A;  2ZQ9 A;  3HCY A;  3DTE A;  5KSH A;  4QJG A;  3UDF A;  1E4D A;  5DJU A;  4E6W A;  3W8K A;  4N1H A;  2B02 A;  2I72 A;  2Z6D A;  4O7D A;  3JPU A;  1E3U A;  3BW6 A;  3MZF A;  2PR5 A;  5DFY A;  1MKI A;  1SKO B;  3E4Q A;  3VP4 A;  2IA2 A;  2ZOH A;  2W1T A;  3ZNT A;  4DE1 A;  4ZRR A;  1CEF A;  2L1M A;  3IWQ A;  2HF6 A;  1Q2P A;  2IWD A;  4HJ6 A;  1K55 C;  1GSV A;  4I5S A;  1P97 A;  3AGD A;  2WKE A;  5HWV A;  4NXF A;  1XX2 A;  1N9L A;  4ID4 A;  5KMW A;  1I2S A;  4KZ3 A;  2V1B A;  2EFX A;  3U4L P;  5C5K A;  2EX9 A;  3G2Y A;  2O9A A;  1IEL A;  4HP9 A;  5F1G A;  3M6H A;  3BQA A;  3ZHH A;  1D1J A;  4YWZ A;  2ZM2 A;  1PWG A;  3WS5 A;  4UA7 A;  1LL5 A;  5TFQ A;  2B95 A;  5F69 A;  4XUZ A;  4KG2 A;  4DJ3 A;  2P9V B;  3EEH A;  3GTC A;  3FV7 A;  1VQQ A;  4I3A A;  5EEC A;  5I94 A;  1E3U D;  4S2M A;  3TW8 A;  3ZCZ A;  5CED A;  4QHC A;  3SH8 A;  3NOU C;  5EPH A;  2INW A;  1PRQ A;  4RA7 A;  3CPT B;  2ZC7 A;  2ZC5 B;  4HBU A;  5DTS A;  3MFX A;  1IKI A;  5HD5 A;  3Q07 A;  5IT5 A;  3DBA A;  1HLU P;  3IH8 A;  4GNU A;  2A2L A;  3O86 A;  3T4L A;  4WN5 A;  4MN7 A;  3C38 A;  2J9O A;  3NHQ A;  4S2K A;  5FI6 A;  1NZU A;  1RGY A;  3GMW A;  1MPL A;  3HRE A;  1NYY A;  1STZ A;  2R9W A;  4Q8I A;  2Y79 A;  1NJ4 A;  1K6S A;  4CLC A;  4WLA A;  3ZG9 B;  5FEF A;  1K6R A;  5F1F A;  2A24 A;  3F1O A;  4U3T A;  4BBU A;  4PAU A;  1PW8 A;  1K0K A;  1YAX A;  2QKP A;  2M1C A;  5HAI A;  1I5Q A;  4MN5 A;  3PTE A;  5TBM A;  4KQD A;  3FWL A;  2L0W A;  2V0U A;  1JWP A;  5JYP A;  4LEN A;  1PYY A;  2HDS A;  3BFE A;  3UPP A;  4JBF A;  4WM9 A;  3LGO A;  3S7N A;  2VGJ A;  1LI0 A;  4IJG A;  2DMW A;  5HAP A;  3IXD A;  4WZ5 A;  5CHU A;  4KZA A;  4MNR A;  3CHW P;  4E3J A;  3S22 A;  4OP5 A;  2XR0 A;  3MFD A;  1K4E A;  2J8Y A;  2X01 A;  3CZD A;  4IVI A;  3CUE A;  2EWW A;  4FSF A;  4PM9 A;  1FCM A;  5A8B A;  2A3U A;  4CQH A;  1H8Z A;  1JWV A;  4CLC D;  4F3L B;  1SDN A;  1CEG A;  1MC0 A;  4MBK A;  4O01 A;  4KZB A;  1NLY A;  3TOI A;  1HTZ A;  3LR0 A;  5A92 A;  4FUW A;  2JKT I;  4FTX A;  4GDN A;  4EXO A;  2ZBB A;  4JKT A;  1N9B A;  4JGP A;  2OLU A;  2I9V A;  5G4Y A;  5F68 A;  1PI5 A;  2W3G A;  2X71 A;  3K3D A;  2P7J A;  3TJZ C;  3O88 A;  4NET A;  1L2S A;  1OTB A;  1MXO A;  1LSW A;  3GRJ A;  4ZBE A;  1NLZ A;  1CF0 A;  1GHM A;  1NXY A;  2GNX A;  2NUT C;  4WEJ A;  2EXA A;  1FIK A;  2QWS A;  1ERQ A;  1RP5 A;  3MZD A;  1HZO A;  2XA7 S;  4C6Y A;  3UPN A;  2H5S A;  2EWV A;  4OVD A;  3LIC A;  3VFH A;  3UB7 A;  3KX0 X;  3MZE A;  2KX6 A;  1XJ6 A;  1ZHH B;  2RCX A;  3PBS A;  4LRY C;  1GCE A;  1TF1 A;  4H8R A;  3NI9 A;  1HVB A;  3A3I A;  1G68 A;  2CMN A;  5AVF A;  5GL9 A;  5FQJ A;  3G34 A;  1LSX A;  1W79 A;  4EEP A;  5DTT A;  2CC1 A;  3VMA A;  1ZTU A;  5FQQ A;  2W27 A;  2V20 A;  2PBD P;  1X0O A;  3K3C A;  1ESI A;  2WUQ A;  3IWI A;  3UO9 A;  4L9E A;  4Y7P A;  4Q0H A;  5HWT A;  3TE8 A;  4AFI A;  3G6O A;  4MN6 A;  3C4O A;  4IED A;  2VLG A;  5HDD A;  5HWW A;  4LV1 A;  1W63 M;  3OOV A;  2LB9 A;  2WGW B;  2EX2 A;  2QPN A;  3T4S A;  1XJ3 A;  2ZMF A;  3LIF A;  3LI9 A;  5D3O A;  2VGK A;  4WYY A;  3C30 A;  3G2Z A;  2WZZ A;  2ZL1 B;  4CLC C;  3IXB A;  3N8R A;  4EV4 A;  3MQO A;  1PNE A;  3MKE A;  4XUX A;  1MWS A;  4GCZ A;  4XT2 A;  5EOE A;  4P0M A;  1L0E A;  3PR6 A;  3T12 B;  1T1A A;  3VE3 A;  4R3A A;  3GEC A;  3HLF A;  3SS3 A;  2JKR I;  4HP4 A;  5AQB A;  1J3W A;  3MJQ A;  4Z1W A;  3BM6 A;  4RX3 A;  2VZW A;  4EU0 A;  1PW1 A;  3RFB A;  3ZG7 B;  1Z09 A;  3PBQ A;  4EUZ A;  4ETX A;  4KZ7 A;  4WZ5 C;  2W1R A;  3HLB A;  3BY9 A;  2HJ9 C;  3P7N A;  2PT7 A;  3BY8 A;  3KSG A;  4QB8 A;  2VGL S;  2XFT A;  3CUE C;  3H7W A;  4GKU A;  5DF8 A;  3IBJ A;  4X25 A;  4IBX A;  4PM7 A;  2V0W A;  2Z6C A;  1LLB A;  4HEF A;  5FQ9 A;  4P6Z M;  2WAD A;  1PWD A;  2Y2O A;  5EVL A;  1CI8 A;  1YLT A;  3MQ0 A;  1TDL A;  2K2N A;  2Q9M A;  2PDR A;  1DJB A;  2QJ7 A;  5L8M A;  1YPR A;  5CER A;  3OPH A;  3NDE A;  3H82 B;  5J8X A;  3N8S A;  4FCF A;  3V67 A;  4Y2F A;  3R7W A;  1DJA A;  1TD5 A;  3VSL A;  2JC7 A;  4EES A;  1OTD A;  3S7Q A;  2OWH A;  5EVE A;  4P6B A;  1VEU B;  2OLV A;  3T1S A;  5M18 A;  1YSP A;  5CHJ A;  3IH9 A;  4N9K A;  1P9R A;  2HDQ A;  4QPR A;  2EA9 A;  4RYE A;  4FD8 A;  1S66 L;  4KEN B;  3RXW A;  2O0Y A;  1FR6 A;  4JGO A;  1HD8 A;  5FA7 A;  5HX9 A;  3FPV A;  5J4E A;  4I3I A;  4YNR A;  4HJ4 A;  1BLH A;  1YQS A;  2E8J A;  3CJM A;  1K25 A;  5EUA A;  3IF5 A;  3M2J A;  3IX8 A;  2XRO A;  1KE0 A;  4LFU A;  5FL3 A;  2EXB A;  5HDC A;  2Y2P A;  1KVM A;  1YT4 A;  3EWK A;  4JGQ A;  2V8C A;  5BOH A;  1IFQ A;  2GJ3 A;  4GS9 B;  4OOY A;  1VET A;  3MXQ A;  4Q0J A;  2H0T A;  3W4Q A;  4UHU A;  1RCJ A;  2PYP A;  3MQQ A;  1MY8 A;  4E04 A;  4QU3 A;  3QP5 A;  5FAP A;  2UV0 E;  4HH3 A;  1T18 A;  3LCE A;  1P9W A;  4G3V A;  3LY4 A;  4Y15 A;  2W3F A;  3OCL A;  2V2F F;  2C6W B;  1YLJ A;  2AVX A;  1MBL A;  4H6J A;  4RVA A;  4OQI A;  4GHI A;  4P85 A;  1BTL A;  4R3J A;  4BBT A;  3LY3 A;  1ES4 A;  4EUV A;  1ACF A;  5M1A A;  3DTM A;  2JBF A;  2X02 A;  2PRF A;  4S2P A;  5CTM A;  3IF6 B;  4CJN A;  4R3B A;  2Q9N A;  4IVK A;  2JHE A;  3QHY A;  1XFN A;  1RGZ A;  1XFQ A;  3Q82 A;  3T4J A;  2ACG A;  3NUL A;  3PBT A;  4R1G A;  5AQ7 A;  4Y0U A;  2V8F A;  1MWR A;  1KDW A;  5E2H A;  5FAT A;  1VB6 A;  3RJU A;  3IX4 A;  1H5X A; 
#chains in the Genus database with same CATH homology
 1NYM A;  1JWZ A;  3DW0 A;  4X56 A;  1JWP A;  2H10 A;  2Y2H A;  4KQQ A;  2UWX A;  5JYP A;  4LEN A;  1PYY A;  2HDS A;  3BFE A;  3UPP A;  4JBF A;  2XH9 A;  4PPR A;  1TDG A;  1XA7 A;  3Q7Z A;  2HDU A;  4WM9 A;  1LHY A;  4ZAM A;  1KGF A;  2DCF A;  4NK3 A;  1ES5 A;  2VGJ A;  2Z2L B;  5AQA A;  1LI0 A;  1NZO A;  4R0Q A;  4R4R A;  5GLB A;  5HAP A;  3DWZ A;  3DWK A;  5KSC A;  2Y2L A;  3IXD A;  4WZ5 A;  5CHU A;  5DTK A;  3OPP A;  4OPQ A;  4E3K A;  2ZD8 A;  4EQI A;  2ZQ8 A;  3CG5 A;  1O7E A;  4KZA A;  4MNR A;  4YFM A;  3IHB A;  4E3J A;  2OSU A;  3S22 A;  4PM8 A;  4OP5 A;  2XR0 A;  1XKZ A;  3MFD A;  4JXS A;  5FDH A;  1K4E A;  2J8Y A;  3IT9 A;  4U0X A;  2X01 A;  3CZD A;  4IVI A;  4OQ0 A;  4FSF A;  4HES A;  4RX2 A;  4LV2 A;  1I2W A;  3FZC A;  3WRZ A;  4PM9 A;  4QY6 A;  1FCM A;  4R4S A;  4ZJ2 A;  2A3U A;  4OON A;  4ZDX A;  1H8Z A;  1JWV A;  4UA6 A;  4CPK A;  1SDN A;  1CEG A;  1AXB A;  2P74 A;  3OPR A;  1ES2 A;  1YMX A;  3MXS A;  5E2F A;  4MBK A;  4BLM A;  2V1Z A;  3OPL A;  3S4X A;  1K54 A;  4KZB A;  2ZC4 B;  3TOI A;  3UY6 A;  1HTZ A;  1MWT A;  2WKI A;  1MWU A;  3IXH A;  3VSK A;  1KGG A;  3GVB A;  5TR7 A;  1TEM A;  5A92 A;  1PZP A;  4C75 A;  3FKV A;  1WE4 A;  4KZ6 A;  1U60 A;  1XXM A;  1IYP A;  4E3I A;  3A3D A;  3AGE A;  5A90 A;  4GDN A;  5CXW A;  4JKT A;  1N9B A;  2OLU A;  3W4O A;  1BUL A;  3QNB A;  3UE1 A;  4MBH A;  5F82 A;  1GHP A;  1NRF A;  5GLD A;  5HAQ A;  4DXC A;  1FSW A;  1PI5 A;  3N7W A;  4A5R A;  1PI4 A;  4GD8 A;  2XD1 A;  5E2G A;  2X71 A;  2G2U A;  2Y4A A;  2XD5 A;  2XGN A;  3O88 A;  4NET A;  3G4P A;  1W8Y A;  4K0W A;  1L2S A;  1OME A;  5FQM A;  3SH9 A;  3HVF A;  3WS1 A;  1MXO A;  3PBO A;  1SCW A;  4U0T A;  3GRJ A;  3IXG A;  4ZBE A;  1EWZ A;  3HLW A;  4KG6 A;  4BD0 A;  3OZH A;  1GHM A;  2EFU A;  2HP9 A;  3BYD A;  1NXY A;  1XP4 A;  2XEP A;  2Z2M B;  3C4P A;  1KE3 A;  2WGW A;  4WEJ A;  3ZNY A;  2EXA A;  4JXV A;  3OCN A;  5CHM A;  4B4Z A;  3B3X A;  3G31 A;  1ERQ A;  1RP5 A;  3MZD A;  1HZO A;  2GDN A;  5CEC A;  2RL3 A;  4C6Y A;  3UPN A;  3VOY A;  1XGI A;  2H5S A;  4F94 A;  4OVD A;  3MKF A;  3VFH A;  3A3F A;  4GN2 A;  1IYO A;  1K55 A;  3IF6 C;  3MZE A;  1KE4 A;  4WEK A;  3HBR A;  4X55 A;  2RCX A;  3LO7 A;  4DE0 A;  1C3B A;  3A3J A;  1ES3 A;  3PBS A;  3BFF A;  1GCE A;  1QMF A;  5FQI A;  3Q7V A;  4OH0 A;  4H8R A;  4UAA A;  2ZM8 A;  4ZJ3 A;  4YIN A;  3ZDJ A;  3NI9 A;  1K57 A;  2FFF B;  3ZGA B;  1K56 A;  2OV5 A;  5DF9 A;  1HVB A;  3A3I A;  4PM5 A;  1G68 A;  2ZQC A;  1ERO A;  2IWB A;  5GL9 A;  5FQJ A;  3FYZ A;  1ONH A;  3G34 A;  1W79 A;  3M6B A;  5E43 A;  5HW3 A;  2PU2 A;  5EOO A;  1BLS A;  1PIO A;  2CC1 A;  3HLG A;  5DTT A;  1FSY A;  5FQQ A;  3PBR A;  3VFF A;  3VMA A;  1DY6 A;  2V20 A;  5GLA A;  3E2K A;  4PM6 A;  1EI5 A;  2ZQ7 A;  4BD1 A;  4DE2 A;  5E2E A;  1GA9 A;  2IWC A;  1IYQ A;  4HBT A;  2R9X A;  1BZA A;  2JCH A;  3ZG0 A;  5A91 A;  1ESI A;  2Y2N A;  2WUQ A;  4X53 A;  3IWI A;  3UDI A;  5CEB A;  3UO9 A;  4Y7P A;  4EBL A;  3HLE A;  4WBG A;  2ZC6 B;  1N4O A;  1O07 A;  1Y54 A;  4D2O A;  3C4O A;  4IED A;  4GOG A;  2Y59 A;  4LV1 A;  4WMC A;  2DRW A;  1W7F A;  4EBN A;  5TGF A;  2WGW B;  1BLC A;  1XA1 A;  2EX2 A;  2QPN A;  4IBR A;  4N9L A;  3P09 A;  4N1X A;  1ZC2 A;  2HDR A;  2Y2J A;  3N4I A;  2HPB A;  3EQV A;  1H8Y A;  2WYX A;  3G35 A;  5D3O A;  5DF7 A;  2PBY A;  2VGK A;  1VM1 A;  3BRM A;  4WYY A;  3Q1F A;  1YLY A;  4DE3 A;  3G2Z A;  5CGX A;  1KDS A;  1M6K A;  2WZZ A;  3HUO A;  4WEL A;  4GDB A;  1LL9 A;  4OOL A;  3IXB A;  3N8R A;  4EV4 A;  4OQH A;  1SDE A;  3MKE A;  3GSG A;  3Q7V B;  4DRT A;  1ESU A;  4JF6 A;  1MWS A;  4LCM A;  4X69 A;  4XUX A;  5FQK A;  4JF5 A;  2G2W A;  5EOE A;  2Y2G A;  3HLD A;  3IWO A;  4OLD A;  3UE3 A;  2JE5 A;  3ZG8 B;  1CI9 A;  1K56 D;  4P0M A;  1L0E A;  2FFY A;  4S2I A;  3BLS A;  1CK3 A;  1ZG6 A;  4GZB A;  4UA9 A;  2Y2K A;  4MEZ A;  3IHA A;  3RXX A;  4KZ4 A;  4KQR A;  1IKG A;  4KZ5 A;  3VP3 A;  2BG1 A;  3ISG A;  3TSG A;  1GA0 A;  2HP6 A;  3HLF A;  3NCK A;  2A49 A;  3SS3 A;  1L0D A;  5EVI A;  1IEM A;  1FCN A;  2DNS A;  2ZLY A;  5AQB A;  5M19 A;  4OOM A;  3S1Y A;  2XLN A;  3G30 A;  4N92 A;  3SS5 A;  1ZG4 A;  3BM6 A;  3UDX A;  3SH7 A;  4RX3 A;  1L0G A;  3BFG A;  1PW1 A;  5EE8 A;  4E3N A;  2WGV A;  2QZ6 A;  4BL2 A;  4S2L A;  4XXR A;  1NY0 A;  3ZG7 B;  3BLM A;  3PBQ A;  4EUZ A;  1KVL A;  3EQU A;  5CTN A;  3I7J A;  5KZH A;  4E3M A;  2XK1 A;  1FR1 A;  4KZ7 A;  1BT5 A;  4WZ5 C;  5CGW A;  5G18 A;  2ZM0 A;  3HLB A;  1M40 A;  3E2L A;  4OPZ A;  4ZTK A;  4Y0O A;  1FQG A;  4E3L A;  4P87 A;  4WMC D;  3OC2 A;  1S6R A;  4OQG A;  4EWF A;  1W8Q A;  1K4F A;  5AQ9 A;  3V3R A;  5GLC A;  3NDG A;  4S2N A;  4QB8 A;  3BFC A;  3ZFZ A;  2XFT A;  3BEC A;  3HL9 A;  4GKU A;  4S2J A;  5DF8 A;  3GV9 A;  3MXR A;  4IBX A;  4PM7 A;  3WWX A;  1GHI A;  3PAG A;  2J7V A;  1ERM A;  2WK0 A;  5FAQ A;  1K38 A;  1LLB A;  1SKF A;  2HP5 A;  4HEF A;  5FQ9 A;  2WAD A;  1PWD A;  2Y2O A;  5EVL A;  3VP2 A;  5A93 A;  4JF4 A;  1CI8 A;  4GD6 A;  1YLT A;  1Z6F A;  4EBP A;  1K54 C;  3ZVT A;  1TDL A;  3G32 A;  2E8I A;  2Y2Q A;  1YLP A;  2ZJ9 A;  4FH2 A;  4OP8 A;  2PU4 A;  2Q9M A;  4MBF A;  4R23 A;  4BJP A;  3W4P A;  1KGE A;  1DJB A;  4X68 A;  4JXG A;  4DF6 A;  5CER A;  3UNW A;  2EX8 A;  4MLL A;  1J9M A;  2B5R A;  3NDE A;  3OPH A;  4GB7 A;  5J8X A;  3HUM A;  3M2K A;  3N8S A;  4FCF A;  2C5W B;  1IYS A;  3VP1 A;  1BLP A;  3V5M A;  3WRT A;  3ZVW A;  3UE0 A;  3BEB A;  1DJA A;  4OKP A;  4KZ9 A;  4X6T A;  5EVI D;  5F83 A;  5EVI B;  3V50 A;  2JC7 A;  3VSL A;  3ZG5 A;  3GR2 A;  4OPY A;  2Y2I A;  3PBN A;  3VP0 A;  2ZQ9 A;  4QD4 A;  3Q81 A;  5KSH A;  2P9V A;  4QJG A;  3UDF A;  5HL1 A;  1E4D A;  2XDM A;  4P6B A;  4E6W A;  3LEZ A;  2OLV A;  4N1H A;  3W8K A;  5M18 A;  1XGJ A;  3C7V A;  5CHJ A;  5JYO A;  2I72 A;  3NIA A;  4O7D A;  3PAE A;  3IH9 A;  4N9K A;  1YMS A;  1ZKJ A;  2HDQ A;  1E3U A;  4L0L A;  4PMA A;  1BSG A;  4RYE A;  3MZF A;  4FD8 A;  1MKI A;  4K91 A;  3BFD A;  3HLC A;  4WZ4 A;  1PZO A;  3VP4 A;  3ITA A;  4KEN B;  1WYB A;  3ZNT A;  4DE1 A;  2XFS A;  3RXW A;  1FR6 A;  1CEF A;  1HD8 A;  5FA7 A;  5HX9 A;  3N6I A;  4K0X A;  1W5D A;  3IWQ A;  3MBZ A;  1Q2P A;  2IWD A;  2WAF A;  1K55 C;  1BLH A;  1TVF A;  4JLF A;  3UPO A;  2BLS A;  1YQS A;  3AGD A;  3CJM A;  2WKE A;  3P98 A;  1K25 A;  4JPM A;  1XX2 A;  4ID4 A;  5EUA A;  3IF5 A;  5KMW A;  1I2S A;  3WS4 A;  4KZ3 A;  3M2J A;  3GQZ A;  1K57 C;  2EFX A;  2XQZ A;  1KE0 A;  3A3E A;  2EXB A;  2EX9 A;  4QY5 A;  3G2Y A;  4E3O A;  1IEL A;  2Y2P A;  4DXB A;  3CMZ A;  5F1G A;  5HFO A;  3M6H A;  5IHV A;  1KVM A;  1YT4 A;  3IQA A;  4LCL A;  3ZHH A;  4Z9Q A;  3AGF A;  2ZM2 A;  5BOH A;  4LV0 A;  1PWG A;  2WZX A;  1QME A;  3WS5 A;  5CGS A;  4UA7 A;  2EX6 A;  1LL5 A;  3JYI A;  5TFQ A;  1FCO A;  3IF6 A;  3C5A A;  4KQO A;  4KZ8 A;  4OOY A;  5HAR A;  5FAS A;  2H0T A;  3D4F A;  5FI2 A;  3W4Q A;  4UHU A;  4DKI A;  4XUZ A;  1ONG A;  4KG2 A;  4DDY A;  2P9V B;  2QMI A;  3GTC A;  1RCJ A;  3FV7 A;  5GHY A;  1VQQ A;  4BQM A;  1Q2Q A;  3HUN A;  4B88 A;  4BL3 A;  1MY8 A;  1ALQ A;  3FKW A;  3ITB A;  5U47 A;  5EEC A;  3V39 A;  3VOZ A;  4QU3 A;  1FOF A;  5I94 A;  1E3U D;  5DVA A;  5FAP A;  4DDS A;  4S2M A;  3ZCZ A;  3WS2 A;  3LCE A;  5CED A;  5GHX A;  3C7U A;  4QHC A;  1BUE A;  1XPB A;  4KG5 A;  3LY4 A;  2ZQA A;  3SH8 A;  4B4X A;  3OCL A;  2V2F F;  5EPH A;  2ZMA A;  1PWC A;  4RA7 A;  2ZC7 A;  2ZC5 B;  2C6W B;  1S0W A;  1YLJ A;  4HBU A;  5DTS A;  3O3V A;  1IKI A;  2H0Y A;  3Q07 A;  1MBL A;  3SOI A;  1SHV A;  4RVA A;  1WYC A;  4OQI A;  1YLW A;  3IH8 A;  4S2O A;  4GNU A;  3SS4 A;  4P85 A;  3O86 A;  1BTL A;  1JTG A;  4R3J A;  4LV3 A;  3QNC A;  5CRF A;  1JVJ A;  2J9O A;  3LY3 A;  1ES4 A;  4S2K A;  5FI6 A;  5M1A A;  5L2F A;  1NZU A;  1RGY A;  3DTM A;  2JBF A;  4E6X A;  3GMW A;  2WAE A;  1MPL A;  3TG9 A;  4OPR A;  3HRE A;  2X02 A;  3WS0 A;  5EVI C;  4S2P A;  3N8L A;  1NYY A;  5CTM A;  2R9W A;  3IF6 B;  4R3B A;  1E25 A;  3NY4 A;  3O87 A;  5FSR A;  4CJN A;  1NJ4 A;  1K6S A;  5FI7 A;  4Q8I A;  2ZQD A;  4C3Q A;  2Q9N A;  2Y55 A;  3ZG9 B;  4IVK A;  3QHY A;  1G6A A;  1RGZ A;  1K6R A;  4M3K A;  4Y0T A;  5F1F A;  4JXW A;  2WKH A;  4U3T A;  5GHZ A;  3V3S A;  2XF3 A;  1PW8 A;  2Y2M A;  3NC8 A;  3Q82 A;  4OLG A;  1LI9 A;  3PBT A;  2ZC3 B;  4FH4 A;  4R1G A;  5AQ7 A;  4BEN A;  5HAI A;  5FAO A;  1YM1 A;  1YLZ A;  2J9P A;  1I5Q A;  2Y91 A;  2WGI A;  3NBL A;  1MWR A;  1KDW A;  4Y0U A;  5E2H A;  1DJC A;  5FAT A;  3RJU A;  1JTD A;  4ZJ1 A;  4S2N C;  3PTE A;  3UN7 A;  1H5X A;  1L0F A;  3FWL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...