4HQAA

Crystal structure of pas domain from the human erg (herg) potassium channel
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
110
structure length
110
Chain Sequence
SRKFIIANARVENCAVIYCNDGFCELCGYSRAEVMQRPCTCDFLHGPRTQRRAAAQIAQALLGAEERKVEIAFYRKDGSCFLCLVDVVPVKNEDGAVIMFILNFEVVMEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Potassium voltage-gated channel subfamily H member 2
publication title Structural properties of PAS domains from the KCNH potassium channels
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2012-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4hqaA00
2WKRA 1XJ4A 4HOIA 1OTBA 4KUOA 3A0SA 1G28A 2VV7A 5HWTA 4GHIA 4R38A 4WL9A 3SW1A 3A0RA 3LIDA 5G4ZA 4WF0A 4MN6A 4PKYG 3H7WA 1DP8A 2A24B 2K7SA 3F1PB 4L9GA 1OTDA 4HIAA 1N9NA 4GCZA 5TBMB 4NXFA 4WUJA 1OT9A 4YWZA 2YKHA 3IBRA 4WN5A 1OT6A 3EEHA 5DKLA 2H28A 3UMEA 2V1AA 4I38A 4NXEA 3LUQA 3ZQ5A 3CLOA 4JGOA 4JGPA 3H82A 2CMNA 2L1MA 5J3WA 3LI9A 2L0WA 1P0ZA 2PYPA 3E4OA 2OWJA 2WKPA 4LRXC 1EW0A 1Y28A 2Z6CA 2R78A 2B02A 5F69A 1LSWA 2YKFA 2QJ7A 3E4PA 5DJTA 3F1PA 3FC7A 3A0VA 2JN7A 1JNUA 4GHIB 5TBMA 1UGUA 4JGQA 4GW9A 1T1CA 3UB8A 3PYPA 4BBTA 1P97A 3T50A 2ZOIA 1X0OA 3CAXA 4I3JA 4EXOA 3LYXA 1T19A 5G4YA 1VB6A 2KDKA 3UB7A 3ICYA 3LICA 3IS2A 5A8BA 1TS6A 1UWNX 4I5SA 2WKQA 1T1AA 3UE6A 3G6OA 1S4RA 1F98A 3C8CA 5DJUA 4HJ4A 4HP4A 3CWFA 2QKPA 3D72A 2OOLA 3OLOA 1GSXA 2VEAA 4DJ2A 1OTIA 1S1YA 1GSWA 1T1BA 1DP6A 2D01A 1D7EA 2D02A 4LPZA 4K08A 5DKKA 5AVFA 2ZOHA 2INWA 2QHKA 4LRYC 2PD8A 1S66L 5F5YA 3ULFA 4L9FA 5IS1A 3C2WA 2GJ3A 4M4XA 3HJKA 3HJIA 4HJ3A 5KIZA 5HD3A 3RTYA 1XJ6A 2QWSA 2M1CA 1WA9A 2HV1A 4HJ6A 4I39A 5EFWA 4LLOB 1LSVA 5J7EA 3RH8B 4HH3A 3BY8A 3IS2B 2QJ5A 3UB9A 2BASA 3FG8A 1N9LA 2PHYA 4E04A 2VLGA 1MZUA 5HWVA 4HI4A 1KOUA 3VE3A 3NHQA 5HZHA 1N9OA 4NXBA 4R6LA 2W0NA 2V0UA 4F3LB 1LT0A 1GSVA 1OJGA 5HDCA 3P7NA 2L4RA 4LRZE 3K3DA 4MN5A 2VV6A 3LI8A 5HD5A 3H9WA 4KUKA 2V9AA 4BBVA 3EWKA 1F9IA 4I3AA 2V1BA 1OJ5A 4PKYA 2Z6DA 4DJ3A 5HSQA 5F6AA 1LSXA 3VOLA 1S1ZA 4B9OA 1OTEA 2KX6A 3KX0X 4H6JB 4F3LA 4EW7A 3MR0A 4HY8A 3K3CA 3F1OB 3E4QA 5HWWA 3VE4A 5I5LA 2PR5A 3UMDA 4L9EA 4NXGA 3GECA 5HDDA 4JGRA 4EERA 4I3IA 5AVEA 4EEUA 4BBUA 2I9VA 5HDSA 1V9YA 1ODVA 1TS7A 2PD7A 2OWHA 4KQDA 2P7JA 1OTAA 4GS9A 3MXQA 3NOPC 3NJAA 2ZBBA 3UB6A 3LIAA 5F68A 1XFNA 3GDIA 4H6JA 4R3AA 1S67L 2W27A 4EESA 3F1OA 3MFXA 5IU1A 3F1NB 1XFQA 3NOTC 3PHYA 1UWPX 2V0WA 2PR6A 1NWZA 2EA9A 1BYWA 4HNBA 4HP9A 3LIEA 4EEPA 4HH2A 1DRMA 4EQ1A 1LL8A 3LIFA 1S4SA 4RQ9A 4XT2B 2A24A 3LIBA 3BWLA 3MQQA 1D06A 2PDRA 2PYRA 1XJ2A 3NOUC 3H7WB 4R70A 4HQAA 3B33A 3F1NA 3BY9A 1TS8A 4GS9B 3MQOA 4HHDA 1DP9A 3MJQA 2J80A 2JHEA 1TS0A 1XJ3A 4EETB 5J4EA 1T18A 1V9ZA 4WLAA 3H82B 2VV8A 4XT2A
chains in the Genus database with same CATH superfamily
3G2YA 4DF6A 2EX6A 1RP5A 1XJ4A 3GV9A 3A0SA 1G28A 2VV7A 5HWTA 2QZ6A 5AJGA 4FD8A 1EI5A 4R38A 4JF4A 4WL9A 1H0MA 3BRMA 2ZM0A 4WF0A 1OPXA 4PKYG 3VV4A 1STZA 4DE0A 1LI9A 2PAVP 1CEGA 2K7SA 3F1PB 1ES5A 1J9MA 5FI7A 2QPNA 4E3MA 1N9NA 2VK3A 4H8RA 2GDNA 3ZDJA 5JYOA 5CHUA 4WUJA 3Q7ZA 5CTNA 3VP0A 3BFDA 3IBRA 4EBLA 4E3LA 1OT6A 3EEHA 2ZC6B 1NRJA 2H28A 4BD1A 1YT4A 2K31A 4NXEA 3ZQ5A 4NK3A 3CLOA 2ZM2A 2C5WB 3HUMA 4FTXA 5AQAA 4E3JA 2Z6CA 4WBGA 2B02A 5F69A 3VP3A 2Y2NA 3R4KA 3MS6A 5LBRA 3T12B 4Y15A 3E4PA 5E2HA 4ESPA 3F1PA 1O07A 4O7DA 1UGUA 2B18A 4JGQA 3S7OA 3WWXA 2VGJA 3BLSA 1PZOA 3QP4A 1T1CA 3OZHA 4ID4A 5HPFA 3CAXA 4GDBA 3T4KA 4I3JA 4B4ZA 3ZNTA 4DE1A 2RCXA 3UB7A 3UDXA 1CEFA 3IS2A 1TS6A 2WAFA 3BQAA 3JYIA 2HP5A 1D1JA 3UE6A 4OOYA 2EX8A 3T4TA 3MZEA 4YFMA 4RVAA 4BWIA 2R9XA 3LCEA 1XP4A 3P98A 1PW1A 3HBRA 4OPYA 2DNSA 1ES3A 3IF6C 1YPRA 4MLLA 1BUEA 4YNRA 3V5MA 3BYDA 4DJ2A 2XK1A 5FEFA 1S1YA 4Y7PA 1KVLA 5M1AA 2GNXA 3MZDA 2D01A 2ZC5B 1D7EA 4EBPA 4LPZA 2VX8A 2INWA 2QHKA 4LRYC 3A3EA 3W4OA 4S2IA 5DF7A 4L9FA 3C2WA 3PBQA 1OMEA 4QU3A 2ZJ9A 3AGEA 3HJIA 2P04A 3G2ZA 1AXBA 1XJ6A 1KGFA 1YSQA 2M1CA 2Q0OA 3CG5A 4XXRA 1WA9A 4R1GA 4Q0HA 3M6BA 4I39A 5HL1A 2QYBA 5EFWA 1IYOA 5J7EA 3MZFA 5L8MA 4ME4A 3UB9A 2IA2A 2XROA 3NDEA 2XDMA 1YM1A 3WRZA 1FCMA 3N8LA 1K6RA 5K5BA 2W3DA 1N9OA 5HZHA 3N7WA 3G30A 4ZJ3A 3IWIA 4PM5A 4E6XA 4R6LA 4OPZA 2V0UA 4OONA 1JWPA 2C6WB 1LT0A 3N6IA 2Y2IA 3CPTA 2IWBA 1IKGA 2EFUA 3FYZA 3OCLA 4WEJA 3V50A 3HLDA 2J3TD 4IEDA 4KQRA 4E3KA 2J7VA 4Y2FA 3BM6A 2WGWB 2V9AA 1MY8A 5HAQA 1F9IA 1PFLA 3MSHA 1DY6A 2Z6DA 2J3TC 4DJ3A 2EWWA 5HSQA 5E2EA 3VOLA 2IWCA 5HAIA 1S1ZA 2BTFP 1G6AA 1VEUB 2H0TA 1L0EA 2KX6A 3ISGA 1E3UA 3EGDC 1YLYA 1VQQA 4EUZA 3T1XA 1H5XA 3E0YA 4KZ9A 4BQMA 2VKSA 3WRTA 2Y2GA 3K3CA 4KENB 4X69A 3IX3A 3F1OB 3OPHA 4R23A 3VE4A 3UO9A 4UQIS 2PR5A 4ETZA 1IFQA 5EUAA 4WMCD 4L9EA 3GECA 4BENA 1G6OA 4IJGA 1BULA 4DE2A 4BBUA 4S2JA 1NJ4A 5CECA 2WGWA 5HDSA 5EM0A 1RCJA 1GA9A 4MBFA 4BL3A 5DTTA 3G34A 5HARA 5GHYA 1FILA 1ONGA 1CJFA 5CXWA 4P87A 3C4PA 3C7UA 1S0WA 1YLZA 2I72A 5KZHA 4DXCA 2ZM8A 3UB6A 4GJ4A 3LGOA 2DCFA 5U47A 4MEZA 3GDIA 3KSGA 2W3EA 4B88A 4QWOA 4ETXA 1S67L 3W8KA 1EWZA 3UNWA 1WE4A 5FQQA 4OVDA 3F1OA 5FATA 4R0QA 5FI6A 1K25A 3PHYA 1SKOB 1NY0A 3B3XA 2XRNA 1BYWA 2WZZA 4HNBA 1SCWA 1NRFA 5DTSA 1ZKJA 4MMNA 2PBDP 2XD5A 3WS5A 5DVAA 4EEPA 3FPWA 4G3KA 4FH4A 3FKVA 3W4PA 5KSCA 4HBTA 4QJGA 2PT7A 2PDRA 4BLMA 4BL2A 4UA7A 3ZG9B 3T4OA 3PBRA 3LY4A 1XGIA 1MKMA 1PIOA 5A93A 1IEMA 2O9BA 1PI5A 5CEBA 3VP2A 3T4SA 2OSUA 3O87A 3FZCA 4Q0IA 4RA7A 4B93A 1YKDA 3FWLA 3D9YA 2JHEA 1TS0A 4S2NC 1SKOA 4OP8A 1W8QA 1BT5A 2G7UA 4EETB 5J4EA 4X1LA 3KYQA 1L2SA 4ZDXA 4NG2A 4WLAA 3V39A 4Y17A 2VV8A 4K0WA 1L0DA 3CUEC 2CC1A 4A5RA 4HOIA 4KUOA 3K2NA 4GHIA 2JBFA 3SW1A 2RL3A 4PMAA 4UHUA 3LIDA 3MFDA 5CEDA 4MN6A 3DWKA 4ARZB 3WS4A 4OLGA 1MWRA 3PAGA 4CLCD 2A2LA 5F1GA 2IWDA 5E2GA 3OOVA 1OTDA 5EM1A 4WELA 2J9PA 4S2LA 4WM9A 4UA9A 2YKHA 4JLFA 2OLUA 4HESA 2HDQA 4JGOA 2WKIA 5FAQA 1I5QA 2XQZA 1FOFA 2PYPA 2VA0A 4LRXC 4EWFA 1EW0A 1Y28A 1CI9A 2P08A 3QP5A 1A0KA 2OAP1 3M2KA 4ARZA 1LSWA 2QMIA 2PRFA 2YKFA 4M3KA 1CQAA 1FCNA 1SZVA 2W1RA 3CZDA 3G4PA 1ONHA 4NKPA 5DJTA 1H8ZA 2JKTM 1KDSA 2ZC7A 1L3LA 2JN7A 1HD8A 1ZG6A 2OLVA 5EVLA 3ZCZA 2EWVA 4FCFA 4ZTKA 4BBTA 1P97A 1K57C 2Y79A 3LYXA 5G4YA 5HW3A 2E8IA 2FZ0A 3ZG8B 1GHPA 3P09A 3Q82A 2ZD8A 4NETA 3LICA 5A8BA 3BFEA 3IX8A 2WKQA 2WUQA 3G6OA 3IH8A 1S4RA 3O86A 3KSHA 2WKHA 3U4LP 3PBTA 4ZJ2A 3NC8A 4GZBA 1TEMA 2JKRM 2Y2LA 5CHMA 3N8SA 4PHTA 1CF0A 5DJUA 1C3BA 3IHBA 3BJNA 3O5YA 2Y55A 4S2OA 1YLTA 2HJEA 1VM1A 3LEZA 1GSWA 3C4OA 2BLSA 1T1BA 4EBNA 3PBSA 4PAUA 5FSRA 4QY5A 1XX2A 2WGIA 1NXYA 5AVFA 5EVIB 3IF6A 3Q81A 2XA7M 1K6SA 1KVMA 2DRWA 1S66L 1Q2QA 1XXMA 4O8GA 2V20A 1MKIA 3RXWA 1K38A 4LV1A 2VGLS 1LSVA 1PWGA 3RH8B 2ZMFA 1LL9A 4HH3A 4WZ5C 3IS2B 5DTKA 1FR1A 3S22A 1BTLA 1KE3A 1N9LA 5HL6A 3SZTA 3T4QA 1S6RA 3QP8A 4BJPA 3EEAA 3IX4A 3MXRA 1LL5A 5HWVA 1IKIA 2XF3A 3QNCA 4PM8A 2ZQAA 3CHWP 4E3IA 2HPBA 5EVIA 3WS0A 1AWIA 5TFQA 4X53A 2W1TB 1CI8A 1OJGA 2ZL1A 2Q9NA 1CK3A 4S2KA 5GLAA 4LRZE 5FQJA 1YSPA 3IWQA 4N1XA 1LHYA 4F94A 1RGYA 1YLWA 3AGDA 3O88A 3IQAA 4Y3IA 3LI8A 2VGKA 3A3IA 2FH5A 1Q2PA 4KUKA 3TSGA 4BBVA 4I3AA 2EX9A 1YQSA 5FQIA 4D60A 4IVKA 5F6AA 4KQQA 1LSXA 3OBFA 5FAPA 4R4SA 1ZTUA 3EQUA 3BQ8A 1HZOA 2Y2JA 3NECA 2W1TA 2EXAA 3HLGA 5HAPA 3VOZA 4QY6A 4LV3A 4Y0TA 4UA6A 4NXGA 5HDDA 4I3IA 4EEUA 4WEKA 3PBOA 3CPTB 1BZAA 1RGZA 2WYXA 1V9YA 2X01A 4G3WA 4YINA 3UE1A 2PD7A 2ZQ7A 1OTAA 4GS9A 5IT5A 3NJAA 2R9WA 4ZJ1A 2ZBBA 4JXGA 3HLWA 3W4QA 1XFNA 2VGLM 4IUKA 1J3WA 4R3AA 4KG2A 4II7A 2NUTC 1PRQA 2V8FA 2XFSA 1TF1A 4N9LA 3FPVA 4WMCA 3GVBA 3RFBA 3V3SA 3KYEA 3TE8A 5CTMA 4X1MA 2V0WA 1NWZA 4EQIA 4Z9QA 2WADA 5CRFA 1M6KA 3BFCA 3C7VA 4EQ1A 1LL8A 3LIFA 4RQ9A 4XT2B 4E3NA 2A24A 1KGEA 3LIBA 3BWLA 5EPHA 4X25A 2XLNA 1K56A 4DKIA 3MKFA 3A3FA 3LY3A 3H7WB 1SDNA 3OCNA 5HFOA 3BY9A 4UEYA 3MQOA 4HHDA 2HF6A 1LI0A 5EECA 3MJQA 5DFYA 3IBJA 2P9VA 3ZG5A 1XJ3A 2UWXA 3HLBA 1K55C 4S2MA 3HCYA 5FL3A 3UDIA 5DFXA 3MXSA 3H82B 3IH9A 3GRJA 4XT2A 1QMEA 1PW8A 2WKRA 4X68A 3C30A 1OTBA 4C6YA 3KSFA 4KZ6A 4CLCB 1YLJA 3Q07A 2PU4A 3A0RA 4GB7A 3DTIA 5G4ZA 2GZAA 5CERA 5F82A 3M2JA 3GR2A 2ZLYA 1F5MA 3H7WA 4JF5A 1YLPA 4DN0A 4OPRA 1DP8A 3S7NA 4FSFA 4L9GA 5EE8A 5M18A 3SH9A 4HIAA 1TVFA 4HEFA 4GCZA 5TBMB 2G2UA 2Z2LB 5AQBA 2VZWA 2ZQ9A 2ZMAA 4XUXA 3LO7A 4WN5A 3ZFZA 3UMEA 2FFYA 2V1AA 1N4OA 1E4DA 4I38A 3CI6A 3H82A 1IYQA 2CMNA 4GLQA 4B4XA 5A91A 2M7VA 4RX2A 1GCEA 3E4OA 2OWJA 2WKPA 1ES2A 2R78A 4KQOA 2EXBA 4CLCA 1FSYA 3FKWA 3GMWA 3RXXA 4RYEA 3CMZA 1PZPA 2BG1A 2Y2HA 2V1ZA 1W63Q 3Q7VB 2H0YA 3A0VA 1JNUA 4IBXA 3NIAA 4GHIB 5TBMA 1PWDA 2J9OA 4X6TA 2Y2PA 4LENA 4LCMA 2ZC4B 4XUZA 3QHYA 1ACFA 4Y5FA 3TG9A 3PYPA 3UB8A 3JVUA 2EX2A 3T50A 2Y2OA 1X0OA 1ALQA 4GD6A 3TJZC 3T1SA 2WGVA 2KDKA 2JE5A 3ICYA 2PU2A 1UWNX 3V3RA 2OV5A 1T1AA 1GHMA 4FOFA 1EROA 2HJ9C 4O01A 2E8JA 5DF9A 3B42A 4N1HA 1F98A 4OQGA 3UPPA 4L0LA 3N8RA 4D2OA 3LFVA 2XSSA 1FQGA 3Q7VA 5TR7A 1H3QA 2DMWA 2QKPA 2OOLA 4X56A 3LR4A 1OTIA 3HUOA 1DP6A 3UN7A 2XA7S 1E25A 2D02A 5KMWA 3SH7A 2JCHA 1JWZA 3NI9A 4HBUA 1IYSA 4DDYA 5CGXA 3S1YA 4OH0A 1NLZA 5F5YA 3ULFA 4OPQA 2GJ3A 3HJKA 4HJ3A 3HLCA 5HD3A 2JC7A 3DTKA 3T1RA 2HP6A 2QWSA 4OP5A 5TJJA 4Y13A 3ITAA 2HDRA 4HJ6A 1K54C 1F2KA 5HPIA 3SS4A 2QJ5A 2BASA 2A49A 2ZQDA 2PHYA 5J8XA 2VLGA 4DRTA 3R7WB 5EV0A 3IXGA 4HI4A 1KGGA 3NHQA 3CITA 4WZ5A 1XKZA 1H8MA 2O0YA 2XD1A 4IVIA 1GSVA 5L09A 3MF0A 2LB5A 4OLDA 4PM6A 3UE0A 3OPLA 4LGWA 3K3DA 4MN5A 3IF6B 2VV6A 5HD5A 3AGFA 2V1BA 3BECA 1WYBA 3MBZA 3L7HA 1XGJA 3R7WA 1IYPA 1H8YA 5E43A 5FA7A 4K91A 4C75A 3KX0X 2B95A 4P0MA 3MR0A 4PM7A 3SOIA 3RJUA 4CLCE 5I5LA 4ZBEA 5BOHA 3UMDA 4EERA 4R3BA 3SH8A 1IOUA 3HVFA 2ZL1B 4PPRA 1VETB 1K0KA 3W2ZA 3LEQA 2HDUA 2WKEA 1Y4OA 1ODVA 3BLMA 2OWHA 3EQVA 3BW6A 4KQDA 2P7JA 3MQ0A 4Q0JA 5GLCA 1YMSA 1I2WA 3ZG0A 4K0XA 4CPKA 3BEBA 5F68A 2A3UA 1PNEA 1ERMA 1PYYA 4LV0A 3NULA 2ACGA 4KZBA 1BSGA 3MKEA 3IT9A 3NOTC 1UWPX 4DMZA 2H5SA 4GN2A 3ZNYA 4EUVA 1O7EA 2EA9A 3KYZA 1M40A 3KO6A 1ZC2A 3M6HA 3TOIA 3LIEA 4DE3A 1VETA 5EOOA 5TGFA 2MJ6A 1HLUP 5G18A 5FQKA 4OQHA 3HL9A 5L2FA 4QB8A 3UPOA 2PYRA 1FR6A 1XJ2A 5L10A 3FV7A 1K4EA 1MXOA 1K4FA 1W5DA 4R3JA 5FAOA 4P6ZS 5CGWA 4Z1WA 5HX9A 4JXWA 3VOYA 4OQ0A 4R4RA 5F83A 4E6WA 4S2PA 3MMHA 3Q1FA 2G2WA 1IELA 5CX7A 4MBHA 3T4JA 3TW8A 4G3VA 4GS9B 1FCOA 4WYYA 3DWZA 4U0TA 2J80A 4GDNA 2Y2KA 4NEED 1Y54A 4GD8A 1JTDA 3DTMA 3IWOA 1NLYA 1SKFA 3LR0A 1T18A 1GA0A 5GLDA 4Y0UA 3L9KA 5GHZA 1NYMA 3C5AA 3S7QA 4CQHA 2XH9A 4JPMA 3UE3A 2NUPC 4OKPA 3BFFA 4Q8IA 4E3OA 4UAAA 1K55A 4GOGA 2Y8HA 5FDSA 5F1FA 4P6BA 4MNRA 3VMAA 4FUWA 2A24B 4JXSA 2FFFB 1U60A 2O9AA 3NY4A 4NXFA 3EOIA 4KZ5A 1OT9A 2ZC3B 4KG6A 4YWZA 4KZ7A 5DKLA 5EVID 5FASA 1HTZA 4KZ8A 3VFHA 3LUQA 4U3TA 3OPRA 3WS2A 4ZAMA 1LLBA 4JGPA 1NYYA 5EOEA 1W8YA 2L1MA 1I2SA 1JVJA 3LI9A 5J3WA 5EVIC 3E98A 2L0WA 1P0ZA 3UB5P 2P9VB 3LR5A 2KOIA 4LCLA 2B5RA 2X71A 2QJ7A 3DW0A 3VFFA 3A3JA 3OPPA 1BLSA 1Z6FA 1KE0A 3VP1A 3NDGA 3JVVA 5FQ9A 3S7PA 5MC7A 3FC7A 4BD0A 2HP9A 3P01A 4PM9A 1MWSA 3SS3A 4GW9A 3PTEA 2HDSA 4KZ4A 2ZQ8A 2JKGA 1TDGA 1ESIA 3SS5A 3HLEA 2ZOIA 3IXDA 3GSGA 3JPUA 3VSLA 2PBYA 2W3HA 1TD5A 4Y0OA 4X55A 2EFXA 4EXOA 1T19A 1N9BA 4P6ZM 4EU0A 1VB6A 4C3QA 1ZHHB 2Y2QA 3U2AA 4I5SA 3ZG7B 1PWCA 4U0XA 5E2FA 1XPBA 2M7UA 4GKUA 4JKTA 4DDSA 1G5UA 2JKFA 5GLBA 3C8CA 4HJ4A 4HP4A 4N92A 3CWFA 1MC0A 1DJBA 5M19A 1ESUA 1ZG4A 4S2NA 5FI2A 3BFGA 1ES4A 3D72A 5FQMA 3OLOA 1GSXA 3ZVTA 2VEAA 4JF6A 2X02A 5EVEA 5JYPA 1XA7A 5AQ7A 5L07A 3KSIA 4K08A 2ZQCA 5DKKA 3CUEA 2ZOHA 3UY6A 4KZAA 2Y2MA 2PD8A 3IF5A 1G68A 4MCWA 3D3OA 3DBAA 5IS1A 3HLFA 4M4XA 3S4XA 3CJMA 2GX5A 5KIZA 3RTYA 5AQ9A 2HV1A 5A92A 4LLOB 2O9CA 4P85A 3BY8A 4CJNA 2Y59A 3IXHA 1VEUA 3QP1A 2WAEA 1W63M 3FG8A 4IBRA 1NZOA 4EV4A 4E04A 2W3GA 1BLPA 1K56D 1W79A 4KG5A 1MZUA 4IHQA 4QPRA 1BLHA 4YOFA 1MWTA 1JWVA 2HZ5A 2Y91A 4BMWA 2K2NA 1MBLA 1KOUA 3VE3A 2KLIA 3NBLA 3E2KA 1K54A 4NXBA 1SHVA 1XA1A 2W0NA 4F3LB 1Z09A 5HDCA 3P7NA 5FDHA 1E3UD 2L4RA 3WS1A 3QP6A 1FSWA 1L0FA 1YAXA 4JBFA 3UDFA 1W7FA 3VSKA 2VJWA 3HUNA 3PXPA 3H9WA 3EWKA 1P9RA 4PKYA 1OJ5A 2WK0A 3PR6A 4IUHA 4FH2A 4LFUA 1MWUA 1K57A 3B47A 2P74A 3GTCA 4B9OA 2JKTI 1OTEA 2W3FA 3D4FA 2XGNA 4H6JB 4F3LA 4MBKA 4ZRRA 4EW7A 4HY8A 2O99A 3A3DA 4WZ4A 3E4QA 5HWWA 3I7JA 3C38A 3ZYTA 3QNBA 5KSHA 1YMXA 2V2FF 4RX3A 4JGRA 3VP4A 3IHAA 4UQIM 5AVEA 2WZXA 3DTEA 3ZHHA 2I9VA 2XEPA 5GHXA 2XR0A 3LR3A 3OC2A 2UV0E 1NZUA 1TS7A 4MN7A 5CGSA 5DF8A 3O3VA 3MXQA 1WYCA 3NOPC 2JKRI 3LIAA 3DAVA 3UPNA 3QP2A 4CLCC 2Q9MA 3T4LA 4H6JA 2J3WA 3PAEA 5FEGA 4KZ3A 4AFIA 4OQIA 3G31A 3IXBA 3ZVWA 4JXVA 2XFTA 2W27A 4EESA 3MFXA 4QD4A 5C5KA 5IU1A 3F1NB 4N9KA 1XFQA 5I94A 3PBNA 4OOLA 1L0GA 3T1QB 4LV2A 1JTGA 5D3OA 2PR6A 3ZGAB 4OOMA 1FIKA 1KDWA 2Z2MB 1P9WA 4HP9A 4GNUA 4DXBA 2LB9A 2Y4AA 1KE4A 3EGXC 4HH2A 1DRMA 3N4IA 5IHVA 1HVBA 1TDLA 1VHMA 3TRCA 3NCKA 1QMFA 1S4SA 1DJAA 2HGVA 3G32A 3MQQA 2ZMVA 5A90A 1D06A 3E2LA 1SDEA 3NOUC 4O0PA 2H10A 2AVXA 1PI4A 3V67A 4R70A 1MPLA 3G35A 3GQZA 4HQAA 3B33A 4MDZA 3F1NA 2V8CA 1TS8A 1DJCA 1DP9A 1ERQA 5CHJA 3ITBA 2J8YA 1BLCA 1GHIA 1V9ZA 3HREA 2OAQ1 4QHCA 5GL9A
chains in the Genus database with same CATH topology
2WKRA 3S7QA 1XJ4A 4HOIA 3C30A 4CQHA 1OTBA 4KUOA 3A0SA 1G28A 2VV7A 3K2NA 5HWTA 3UE3A 4GHIA 2NUPC 5AJGA 3KSFA 4CLCB 4R38A 4WL9A 3SW1A 3A0RA 3LIDA 5G4ZA 4WF0A 1OPXA 2GZAA 2Y8HA 4MN6A 4ARZB 4PKYG 3VV4A 1F5MA 3H7WA 1STZA 4CLCD 4DN0A 1DP8A 3S7NA 2A2LA 2A24B 2K7SA 3F1PB 4FSFA 4L9GA 3OOVA 1OTDA 4HIAA 1N9NA 4WELA 4GCZA 2O9AA 5TBMB 4NXFA 4WUJA 3EOIA 2VZWA 1OT9A 4YWZA 2YKHA 3IBRA 4WN5A 1OT6A 3EEHA 5DKLA 1NRJA 2H28A 3UMEA 2V1AA 2K31A 4I38A 3CI6A 4NXEA 3LUQA 3ZQ5A 3CLOA 4JGOA 4JGPA 3H82A 2CMNA 4GLQA 2M7VA 2L1MA 5J3WA 3LI9A 3E98A 2VA0A 2L0WA 1P0ZA 3E4OA 2WKPA 2PYPA 2OWJA 4LRXC 1EW0A 1Y28A 2Z6CA 2R78A 3LR5A 4KQOA 2P08A 2B02A 2KOIA 5F69A 2OAP1 4CLCA 3R4KA 5LBRA 4ARZA 1LSWA 2YKFA 2QJ7A 3E4PA 2W1RA 4NKPA 5DJTA 2JKTM 3JVVA 3F1PA 3S7PA 1W63Q 5MC7A 3FC7A 3A0VA 2JN7A 1JNUA 3P01A 4GHIB 5TBMA 1UGUA 2B18A 4JGQA 3S7OA 4GW9A 2EWVA 1T1CA 4Y5FA 3UB8A 3PYPA 3JVUA 1P97A 4BBTA 3T50A 2Y79A 2ZOIA 1X0OA 5HPFA 2W3HA 1TD5A 3CAXA 4I3JA 3T4KA 3TJZC 4EXOA 3LYXA 1T19A 4P6ZM 5G4YA 4EU0A 1VB6A 2FZ0A 2KDKA 3UB7A 3ICYA 3LICA 3IS2A 5A8BA 1TS6A 3BQAA 1UWNX 1ZHHB 3U2AA 4I5SA 2WKQA 1T1AA 3UE6A 4FOFA 3T4TA 3G6OA 2HJ9C 4O01A 4BWIA 1S4RA 5DF9A 2M7UA 3B42A 3KSHA 1F98A 3PBTA 4L0LA 2JKRM 4PHTA 3C8CA 5DJUA 4HJ4A 3LFVA 2XSSA 4HP4A 3BJNA 3CWFA 3O5YA 1MC0A 4YNRA 1H3QA 2DMWA 2QKPA 3D72A 2HJEA 2OOLA 3OLOA 1GSXA 2VEAA 3LR4A 4DJ2A 1OTIA 1S1YA 1GSWA 1T1BA 2GNXA 1DP6A 2D01A 3PBSA 2XA7S 4PAUA 1D7EA 2D02A 3KSIA 4LPZA 2VX8A 4K08A 5DKKA 3CUEA 2ZOHA 5AVFA 2INWA 2QHKA 4LRYC 2PD8A 2XA7M 4MCWA 1S66L 3D3OA 1NLZA 5F5YA 3ULFA 3DBAA 4L9FA 5IS1A 4O8GA 3C2WA 3PBQA 2GJ3A 4M4XA 3HJKA 3HJIA 2GX5A 4HJ3A 2P04A 5KIZA 5HD3A 3RTYA 1XJ6A 1YSQA 2QWSA 2M1CA 5TJJA 1WA9A 2HV1A 4Q0HA 2VGLS 4HJ6A 4I39A 2QYBA 5EFWA 4LLOB 1LSVA 5HPIA 5J7EA 3RH8B 2O9CA 2ZMFA 4HH3A 3IS2B 3BY8A 2QJ5A 5L8MA 4ME4A 1W63M 2BASA 3UB9A 3FG8A 1N9LA 5HL6A 2PHYA 4E04A 2W3GA 2IA2A 3T4QA 2XROA 2VLGA 4BJPA 3R7WB 3EEAA 1MZUA 4IHQA 4QPRA 5HWVA 4YOFA 4HI4A 4BMWA 2K2NA 1KOUA 3VE3A 3NHQA 5K5BA 2W3DA 1N9OA 5HZHA 2KLIA 4NXBA 3CITA 4R6LA 1H8MA 2W0NA 2V0UA 2O0YA 2W1TB 4F3LB 1LT0A 1GSVA 1OJGA 5HDCA 3MF0A 3P7NA 2L4RA 4LRZE 1YSPA 3OCLA 4WEJA 2LB5A 1YAXA 2J3TD 3K3DA 4MN5A 2VV6A 2VJWA 3PXPA 4Y3IA 3LI8A 4Y2FA 5HD5A 3H9WA 2FH5A 4KUKA 2V9AA 4BBVA 3EWKA 1F9IA 4I3AA 2V1BA 1P9RA 1OJ5A 4PKYA 3PR6A 2Z6DA 2J3TC 4IUHA 4DJ3A 3R7WA 2EWWA 3B47A 5HSQA 5F6AA 1LSXA 3OBFA 3VOLA 1S1ZA 4B9OA 1ZTUA 3EQUA 2JKTI 1OTEA 3BQ8A 2KX6A 2W3FA 3EGDC 3KX0X 4H6JB 2W1TA 4F3LA 3E0YA 2VKSA 4ZRRA 4EW7A 3MR0A 4HY8A 3K3CA 2O99A 3F1OB 3E4QA 5HWWA 3C38A 3VE4A 4CLCE 3ZYTA 5I5LA 4UQIS 2PR5A 5KSHA 4ETZA 1IFQA 3UMDA 4L9EA 4NXGA 3GECA 1G6OA 5HDDA 4IJGA 4JGRA 4EERA 4I3IA 1IOUA 4UQIM 5AVEA 4EEUA 4WEKA 4BBUA 2I9VA 3PBOA 5HDSA 3LR3A 3W2ZA 3OC2A 1V9YA 1ODVA 4G3WA 1TS7A 2PD7A 4MN7A 2OWHA 3EQVA 3BW6A 4KQDA 2P7JA 3MQ0A 4Q0JA 1OTAA 4GS9A 3MXQA 5IT5A 3NOPC 3NJAA 2ZBBA 2JKRI 3UB6A 4GJ4A 3LIAA 5F68A 4CLCC 1XFNA 2VGLM 3T4LA 3GDIA 3KSGA 4H6JA 2W3EA 2J3WA 4IUKA 4R3AA 4AFIA 4ETXA 1S67L 4II7A 2NUTC 1TF1A 2W27A 4EESA 3F1OA 3FPVA 3MFXA 5C5KA 5IU1A 3F1NB 3RFBA 1XFQA 3TE8A 3PBNA 4OOLA 3NOTC 3PHYA 1UWPX 2V0WA 4DMZA 2PR6A 1NWZA 4EUVA 2EA9A 3KYZA 4OOMA 2XRNA 1BYWA 1P9WA 3KO6A 4HNBA 4HP9A 4MMNA 3LIEA 2LB9A 2MJ6A 4EEPA 3EGXC 3FPWA 4HH2A 1DRMA 4G3KA 4EQ1A 1LL8A 1VHMA 3TRCA 3LIFA 1S4SA 4RQ9A 4XT2B 2A24A 2HGVA 3LIBA 3BWLA 3MQQA 2ZMVA 1D06A 2PT7A 2PDRA 2PYRA 1XJ2A 3NOUC 3T4OA 4O0PA 3PBRA 4P6ZS 4Z1WA 1MKMA 3H7WB 4R70A 3V67A 4HQAA 3B33A 3OCNA 2O9BA 3MMHA 4MDZA 5CX7A 3F1NA 3T4SA 3BY9A 4UEYA 1TS8A 3T4JA 4G3VA 4GS9B 3TW8A 3MQOA 4HHDA 4Q0IA 2HF6A 4B93A 1YKDA 1DP9A 3MJQA 2J80A 5DFYA 2JHEA 1TS0A 3IBJA 4NEED 1XJ3A 2G7UA 4EETB 3HCYA 1NLYA 5J4EA 5FL3A 3LR0A 3KYQA 1T18A 5DFXA 1V9ZA 2OAQ1 4WLAA 3H82B 2VV8A 4XT2A 3CUEC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WKR A;  1XJ4 A;  4HOI A;  1OTB A;  4KUO A;  3A0S A;  1G28 A;  2VV7 A;  5HWT A;  4GHI A;  4R38 A;  4WL9 A;  3SW1 A;  3A0R A;  3LID A;  5G4Z A;  4WF0 A;  4MN6 A;  4PKY G;  3H7W A;  1DP8 A;  2A24 B;  2K7S A;  3F1P B;  4L9G A;  1OTD A;  4HIA A;  1N9N A;  4GCZ A;  5TBM B;  4NXF A;  4WUJ A;  1OT9 A;  4YWZ A;  2YKH A;  3IBR A;  4WN5 A;  1OT6 A;  3EEH A;  5DKL A;  2H28 A;  3UME A;  2V1A A;  4I38 A;  4NXE A;  3LUQ A;  3ZQ5 A;  3CLO A;  4JGO A;  4JGP A;  3H82 A;  2CMN A;  2L1M A;  5J3W A;  3LI9 A;  2L0W A;  1P0Z A;  2PYP A;  3E4O A;  2OWJ A;  2WKP A;  4LRX C;  1EW0 A;  1Y28 A;  2Z6C A;  2R78 A;  2B02 A;  5F69 A;  1LSW A;  2YKF A;  2QJ7 A;  3E4P A;  5DJT A;  3F1P A;  3FC7 A;  3A0V A;  2JN7 A;  1JNU A;  4GHI B;  5TBM A;  1UGU A;  4JGQ A;  4GW9 A;  1T1C A;  3UB8 A;  3PYP A;  4BBT A;  1P97 A;  3T50 A;  2ZOI A;  1X0O A;  3CAX A;  4I3J A;  4EXO A;  3LYX A;  1T19 A;  5G4Y A;  1VB6 A;  2KDK A;  3UB7 A;  3ICY A;  3LIC A;  3IS2 A;  5A8B A;  1TS6 A;  1UWN X;  4I5S A;  2WKQ A;  1T1A A;  3UE6 A;  3G6O A;  1S4R A;  1F98 A;  3C8C A;  5DJU A;  4HJ4 A;  4HP4 A;  3CWF A;  2QKP A;  3D72 A;  2OOL A;  3OLO A;  1GSX A;  2VEA A;  4DJ2 A;  1OTI A;  1S1Y A;  1GSW A;  1T1B A;  1DP6 A;  2D01 A;  1D7E A;  2D02 A;  4LPZ A;  4K08 A;  5DKK A;  5AVF A;  2ZOH A;  2INW A;  2QHK A;  4LRY C;  2PD8 A;  1S66 L;  5F5Y A;  3ULF A;  4L9F A;  5IS1 A;  3C2W A;  2GJ3 A;  4M4X A;  3HJK A;  3HJI A;  4HJ3 A;  5KIZ A;  5HD3 A;  3RTY A;  1XJ6 A;  2QWS A;  2M1C A;  1WA9 A;  2HV1 A;  4HJ6 A;  4I39 A;  5EFW A;  4LLO B;  1LSV A;  5J7E A;  3RH8 B;  4HH3 A;  3BY8 A;  3IS2 B;  2QJ5 A;  3UB9 A;  2BAS A;  3FG8 A;  1N9L A;  2PHY A;  4E04 A;  2VLG A;  1MZU A;  5HWV A;  4HI4 A;  1KOU A;  3VE3 A;  3NHQ A;  5HZH A;  1N9O A;  4NXB A;  4R6L A;  2W0N A;  2V0U A;  4F3L B;  1LT0 A;  1GSV A;  1OJG A;  5HDC A;  3P7N A;  2L4R A;  4LRZ E;  3K3D A;  4MN5 A;  2VV6 A;  3LI8 A;  5HD5 A;  3H9W A;  4KUK A;  2V9A A;  4BBV A;  3EWK A;  1F9I A;  4I3A A;  2V1B A;  1OJ5 A;  4PKY A;  2Z6D A;  4DJ3 A;  5HSQ A;  5F6A A;  1LSX A;  3VOL A;  1S1Z A;  4B9O A;  1OTE A;  2KX6 A;  3KX0 X;  4H6J B;  4F3L A;  4EW7 A;  3MR0 A;  4HY8 A;  3K3C A;  3F1O B;  3E4Q A;  5HWW A;  3VE4 A;  5I5L A;  2PR5 A;  3UMD A;  4L9E A;  4NXG A;  3GEC A;  5HDD A;  4JGR A;  4EER A;  4I3I A;  5AVE A;  4EEU A;  4BBU A;  2I9V A;  5HDS A;  1V9Y A;  1ODV A;  1TS7 A;  2PD7 A;  2OWH A;  4KQD A;  2P7J A;  1OTA A;  4GS9 A;  3MXQ A;  3NOP C;  3NJA A;  2ZBB A;  3UB6 A;  3LIA A;  5F68 A;  1XFN A;  3GDI A;  4H6J A;  4R3A A;  1S67 L;  2W27 A;  4EES A;  3F1O A;  3MFX A;  5IU1 A;  3F1N B;  1XFQ A;  3NOT C;  3PHY A;  1UWP X;  2V0W A;  2PR6 A;  1NWZ A;  2EA9 A;  1BYW A;  4HNB A;  4HP9 A;  3LIE A;  4EEP A;  4HH2 A;  1DRM A;  4EQ1 A;  1LL8 A;  3LIF A;  1S4S A;  4RQ9 A;  4XT2 B;  2A24 A;  3LIB A;  3BWL A;  3MQQ A;  1D06 A;  2PDR A;  2PYR A;  1XJ2 A;  3NOU C;  3H7W B;  4R70 A;  4HQA A;  3B33 A;  3F1N A;  3BY9 A;  1TS8 A;  4GS9 B;  3MQO A;  4HHD A;  1DP9 A;  3MJQ A;  2J80 A;  2JHE A;  1TS0 A;  1XJ3 A;  4EET B;  5J4E A;  1T18 A;  1V9Z A;  4WLA A;  3H82 B;  2VV8 A;  4XT2 A; 
#chains in the Genus database with same CATH topology
 3G2Y A;  4DF6 A;  2EX6 A;  1RP5 A;  1XJ4 A;  3GV9 A;  3A0S A;  1G28 A;  2VV7 A;  5HWT A;  2QZ6 A;  5AJG A;  4FD8 A;  1EI5 A;  4R38 A;  4JF4 A;  4WL9 A;  1H0M A;  3BRM A;  2ZM0 A;  4WF0 A;  1OPX A;  4PKY G;  3VV4 A;  1STZ A;  4DE0 A;  1LI9 A;  2PAV P;  1CEG A;  2K7S A;  3F1P B;  1ES5 A;  1J9M A;  5FI7 A;  2QPN A;  4E3M A;  1N9N A;  2VK3 A;  4H8R A;  2GDN A;  3ZDJ A;  5JYO A;  5CHU A;  4WUJ A;  3Q7Z A;  5CTN A;  3VP0 A;  3BFD A;  3IBR A;  4EBL A;  4E3L A;  1OT6 A;  3EEH A;  2ZC6 B;  1NRJ A;  2H28 A;  4BD1 A;  1YT4 A;  2K31 A;  4NXE A;  3ZQ5 A;  4NK3 A;  3CLO A;  2ZM2 A;  2C5W B;  3HUM A;  4FTX A;  5AQA A;  4E3J A;  2Z6C A;  4WBG A;  2B02 A;  5F69 A;  3VP3 A;  2Y2N A;  3R4K A;  3MS6 A;  5LBR A;  3T12 B;  4Y15 A;  3E4P A;  5E2H A;  4ESP A;  3F1P A;  1O07 A;  4O7D A;  1UGU A;  2B18 A;  4JGQ A;  3S7O A;  3WWX A;  2VGJ A;  3BLS A;  1PZO A;  3QP4 A;  1T1C A;  3OZH A;  4ID4 A;  5HPF A;  3CAX A;  4GDB A;  3T4K A;  4I3J A;  4B4Z A;  3ZNT A;  4DE1 A;  2RCX A;  3UB7 A;  3UDX A;  1CEF A;  3IS2 A;  1TS6 A;  2WAF A;  3BQA A;  3JYI A;  2HP5 A;  1D1J A;  3UE6 A;  4OOY A;  2EX8 A;  3T4T A;  3MZE A;  4YFM A;  4RVA A;  4BWI A;  2R9X A;  3LCE A;  1XP4 A;  3P98 A;  1PW1 A;  3HBR A;  4OPY A;  2DNS A;  1ES3 A;  3IF6 C;  1YPR A;  4MLL A;  1BUE A;  4YNR A;  3V5M A;  3BYD A;  4DJ2 A;  2XK1 A;  5FEF A;  1S1Y A;  4Y7P A;  1KVL A;  5M1A A;  2GNX A;  3MZD A;  2D01 A;  2ZC5 B;  1D7E A;  4EBP A;  4LPZ A;  2VX8 A;  2INW A;  2QHK A;  4LRY C;  3A3E A;  3W4O A;  4S2I A;  5DF7 A;  4L9F A;  3C2W A;  3PBQ A;  1OME A;  4QU3 A;  2ZJ9 A;  3AGE A;  3HJI A;  2P04 A;  3G2Z A;  1AXB A;  1XJ6 A;  1KGF A;  1YSQ A;  2M1C A;  2Q0O A;  3CG5 A;  4XXR A;  1WA9 A;  4R1G A;  4Q0H A;  3M6B A;  4I39 A;  5HL1 A;  2QYB A;  5EFW A;  1IYO A;  5J7E A;  3MZF A;  5L8M A;  4ME4 A;  3UB9 A;  2IA2 A;  2XRO A;  3NDE A;  2XDM A;  1YM1 A;  3WRZ A;  1FCM A;  3N8L A;  1K6R A;  5K5B A;  2W3D A;  1N9O A;  5HZH A;  3N7W A;  3G30 A;  4ZJ3 A;  3IWI A;  4PM5 A;  4E6X A;  4R6L A;  4OPZ A;  2V0U A;  4OON A;  1JWP A;  2C6W B;  1LT0 A;  3N6I A;  2Y2I A;  3CPT A;  2IWB A;  1IKG A;  2EFU A;  3FYZ A;  3OCL A;  4WEJ A;  3V50 A;  3HLD A;  2J3T D;  4IED A;  4KQR A;  4E3K A;  2J7V A;  4Y2F A;  3BM6 A;  2WGW B;  2V9A A;  1MY8 A;  5HAQ A;  1F9I A;  1PFL A;  3MSH A;  1DY6 A;  2Z6D A;  2J3T C;  4DJ3 A;  2EWW A;  5HSQ A;  5E2E A;  3VOL A;  2IWC A;  5HAI A;  1S1Z A;  2BTF P;  1G6A A;  1VEU B;  2H0T A;  1L0E A;  2KX6 A;  3ISG A;  1E3U A;  3EGD C;  1YLY A;  1VQQ A;  4EUZ A;  3T1X A;  1H5X A;  3E0Y A;  4KZ9 A;  4BQM A;  2VKS A;  3WRT A;  2Y2G A;  3K3C A;  4KEN B;  4X69 A;  3IX3 A;  3F1O B;  3OPH A;  4R23 A;  3VE4 A;  3UO9 A;  4UQI S;  2PR5 A;  4ETZ A;  1IFQ A;  5EUA A;  4WMC D;  4L9E A;  3GEC A;  4BEN A;  1G6O A;  4IJG A;  1BUL A;  4DE2 A;  4BBU A;  4S2J A;  1NJ4 A;  5CEC A;  2WGW A;  5HDS A;  5EM0 A;  1RCJ A;  1GA9 A;  4MBF A;  4BL3 A;  5DTT A;  3G34 A;  5HAR A;  5GHY A;  1FIL A;  1ONG A;  1CJF A;  5CXW A;  4P87 A;  3C4P A;  3C7U A;  1S0W A;  1YLZ A;  2I72 A;  5KZH A;  4DXC A;  2ZM8 A;  3UB6 A;  4GJ4 A;  3LGO A;  2DCF A;  5U47 A;  4MEZ A;  3GDI A;  3KSG A;  2W3E A;  4B88 A;  4QWO A;  4ETX A;  1S67 L;  3W8K A;  1EWZ A;  3UNW A;  1WE4 A;  5FQQ A;  4OVD A;  3F1O A;  5FAT A;  4R0Q A;  5FI6 A;  1K25 A;  3PHY A;  1SKO B;  1NY0 A;  3B3X A;  2XRN A;  1BYW A;  2WZZ A;  4HNB A;  1SCW A;  1NRF A;  5DTS A;  1ZKJ A;  4MMN A;  2PBD P;  2XD5 A;  3WS5 A;  5DVA A;  4EEP A;  3FPW A;  4G3K A;  4FH4 A;  3FKV A;  3W4P A;  5KSC A;  4HBT A;  4QJG A;  2PT7 A;  2PDR A;  4BLM A;  4BL2 A;  4UA7 A;  3ZG9 B;  3T4O A;  3PBR A;  3LY4 A;  1XGI A;  1MKM A;  1PIO A;  5A93 A;  1IEM A;  2O9B A;  1PI5 A;  5CEB A;  3VP2 A;  3T4S A;  2OSU A;  3O87 A;  3FZC A;  4Q0I A;  4RA7 A;  4B93 A;  1YKD A;  3FWL A;  3D9Y A;  2JHE A;  1TS0 A;  4S2N C;  1SKO A;  4OP8 A;  1W8Q A;  1BT5 A;  2G7U A;  4EET B;  5J4E A;  4X1L A;  3KYQ A;  1L2S A;  4ZDX A;  4NG2 A;  4WLA A;  3V39 A;  4Y17 A;  2VV8 A;  4K0W A;  1L0D A;  3CUE C;  2CC1 A;  4A5R A;  4HOI A;  4KUO A;  3K2N A;  4GHI A;  2JBF A;  3SW1 A;  2RL3 A;  4PMA A;  4UHU A;  3LID A;  3MFD A;  5CED A;  4MN6 A;  3DWK A;  4ARZ B;  3WS4 A;  4OLG A;  1MWR A;  3PAG A;  4CLC D;  2A2L A;  5F1G A;  2IWD A;  5E2G A;  3OOV A;  1OTD A;  5EM1 A;  4WEL A;  2J9P A;  4S2L A;  4WM9 A;  4UA9 A;  2YKH A;  4JLF A;  2OLU A;  4HES A;  2HDQ A;  4JGO A;  2WKI A;  5FAQ A;  1I5Q A;  2XQZ A;  1FOF A;  2PYP A;  2VA0 A;  4LRX C;  4EWF A;  1EW0 A;  1Y28 A;  1CI9 A;  2P08 A;  3QP5 A;  1A0K A;  2OAP 1;  3M2K A;  4ARZ A;  1LSW A;  2QMI A;  2PRF A;  2YKF A;  4M3K A;  1CQA A;  1FCN A;  1SZV A;  2W1R A;  3CZD A;  3G4P A;  1ONH A;  4NKP A;  5DJT A;  1H8Z A;  2JKT M;  1KDS A;  2ZC7 A;  1L3L A;  2JN7 A;  1HD8 A;  1ZG6 A;  2OLV A;  5EVL A;  3ZCZ A;  2EWV A;  4FCF A;  4ZTK A;  4BBT A;  1P97 A;  1K57 C;  2Y79 A;  3LYX A;  5G4Y A;  5HW3 A;  2E8I A;  2FZ0 A;  3ZG8 B;  1GHP A;  3P09 A;  3Q82 A;  2ZD8 A;  4NET A;  3LIC A;  5A8B A;  3BFE A;  3IX8 A;  2WKQ A;  2WUQ A;  3G6O A;  3IH8 A;  1S4R A;  3O86 A;  3KSH A;  2WKH A;  3U4L P;  3PBT A;  4ZJ2 A;  3NC8 A;  4GZB A;  1TEM A;  2JKR M;  2Y2L A;  5CHM A;  3N8S A;  4PHT A;  1CF0 A;  5DJU A;  1C3B A;  3IHB A;  3BJN A;  3O5Y A;  2Y55 A;  4S2O A;  1YLT A;  2HJE A;  1VM1 A;  3LEZ A;  1GSW A;  3C4O A;  2BLS A;  1T1B A;  4EBN A;  3PBS A;  4PAU A;  5FSR A;  4QY5 A;  1XX2 A;  2WGI A;  1NXY A;  5AVF A;  5EVI B;  3IF6 A;  3Q81 A;  2XA7 M;  1K6S A;  1KVM A;  2DRW A;  1S66 L;  1Q2Q A;  1XXM A;  4O8G A;  2V20 A;  1MKI A;  3RXW A;  1K38 A;  4LV1 A;  2VGL S;  1LSV A;  1PWG A;  3RH8 B;  2ZMF A;  1LL9 A;  4HH3 A;  4WZ5 C;  3IS2 B;  5DTK A;  1FR1 A;  3S22 A;  1BTL A;  1KE3 A;  1N9L A;  5HL6 A;  3SZT A;  3T4Q A;  1S6R A;  3QP8 A;  4BJP A;  3EEA A;  3IX4 A;  3MXR A;  1LL5 A;  5HWV A;  1IKI A;  2XF3 A;  3QNC A;  4PM8 A;  2ZQA A;  3CHW P;  4E3I A;  2HPB A;  5EVI A;  3WS0 A;  1AWI A;  5TFQ A;  4X53 A;  2W1T B;  1CI8 A;  1OJG A;  2ZL1 A;  2Q9N A;  1CK3 A;  4S2K A;  5GLA A;  4LRZ E;  5FQJ A;  1YSP A;  3IWQ A;  4N1X A;  1LHY A;  4F94 A;  1RGY A;  1YLW A;  3AGD A;  3O88 A;  3IQA A;  4Y3I A;  3LI8 A;  2VGK A;  3A3I A;  2FH5 A;  1Q2P A;  4KUK A;  3TSG A;  4BBV A;  4I3A A;  2EX9 A;  1YQS A;  5FQI A;  4D60 A;  4IVK A;  5F6A A;  4KQQ A;  1LSX A;  3OBF A;  5FAP A;  4R4S A;  1ZTU A;  3EQU A;  3BQ8 A;  1HZO A;  2Y2J A;  3NEC A;  2W1T A;  2EXA A;  3HLG A;  5HAP A;  3VOZ A;  4QY6 A;  4LV3 A;  4Y0T A;  4UA6 A;  4NXG A;  5HDD A;  4I3I A;  4EEU A;  4WEK A;  3PBO A;  3CPT B;  1BZA A;  1RGZ A;  2WYX A;  1V9Y A;  2X01 A;  4G3W A;  4YIN A;  3UE1 A;  2PD7 A;  2ZQ7 A;  1OTA A;  4GS9 A;  5IT5 A;  3NJA A;  2R9W A;  4ZJ1 A;  2ZBB A;  4JXG A;  3HLW A;  3W4Q A;  1XFN A;  2VGL M;  4IUK A;  1J3W A;  4R3A A;  4KG2 A;  4II7 A;  2NUT C;  1PRQ A;  2V8F A;  2XFS A;  1TF1 A;  4N9L A;  3FPV A;  4WMC A;  3GVB A;  3RFB A;  3V3S A;  3KYE A;  3TE8 A;  5CTM A;  4X1M A;  2V0W A;  1NWZ A;  4EQI A;  4Z9Q A;  2WAD A;  5CRF A;  1M6K A;  3BFC A;  3C7V A;  4EQ1 A;  1LL8 A;  3LIF A;  4RQ9 A;  4XT2 B;  4E3N A;  2A24 A;  1KGE A;  3LIB A;  3BWL A;  5EPH A;  4X25 A;  2XLN A;  1K56 A;  4DKI A;  3MKF A;  3A3F A;  3LY3 A;  3H7W B;  1SDN A;  3OCN A;  5HFO A;  3BY9 A;  4UEY A;  3MQO A;  4HHD A;  2HF6 A;  1LI0 A;  5EEC A;  3MJQ A;  5DFY A;  3IBJ A;  2P9V A;  3ZG5 A;  1XJ3 A;  2UWX A;  3HLB A;  1K55 C;  4S2M A;  3HCY A;  5FL3 A;  3UDI A;  5DFX A;  3MXS A;  3H82 B;  3IH9 A;  3GRJ A;  4XT2 A;  1QME A;  1PW8 A;  2WKR A;  4X68 A;  3C30 A;  1OTB A;  4C6Y A;  3KSF A;  4KZ6 A;  4CLC B;  1YLJ A;  3Q07 A;  2PU4 A;  3A0R A;  4GB7 A;  3DTI A;  5G4Z A;  2GZA A;  5CER A;  5F82 A;  3M2J A;  3GR2 A;  2ZLY A;  1F5M A;  3H7W A;  4JF5 A;  1YLP A;  4DN0 A;  4OPR A;  1DP8 A;  3S7N A;  4FSF A;  4L9G A;  5EE8 A;  5M18 A;  3SH9 A;  4HIA A;  1TVF A;  4HEF A;  4GCZ A;  5TBM B;  2G2U A;  2Z2L B;  5AQB A;  2VZW A;  2ZQ9 A;  2ZMA A;  4XUX A;  3LO7 A;  4WN5 A;  3ZFZ A;  3UME A;  2FFY A;  2V1A A;  1N4O A;  1E4D A;  4I38 A;  3CI6 A;  3H82 A;  1IYQ A;  2CMN A;  4GLQ A;  4B4X A;  5A91 A;  2M7V A;  4RX2 A;  1GCE A;  3E4O A;  2OWJ A;  2WKP A;  1ES2 A;  2R78 A;  4KQO A;  2EXB A;  4CLC A;  1FSY A;  3FKW A;  3GMW A;  3RXX A;  4RYE A;  3CMZ A;  1PZP A;  2BG1 A;  2Y2H A;  2V1Z A;  1W63 Q;  3Q7V B;  2H0Y A;  3A0V A;  1JNU A;  4IBX A;  3NIA A;  4GHI B;  5TBM A;  1PWD A;  2J9O A;  4X6T A;  2Y2P A;  4LEN A;  4LCM A;  2ZC4 B;  4XUZ A;  3QHY A;  1ACF A;  4Y5F A;  3TG9 A;  3PYP A;  3UB8 A;  3JVU A;  2EX2 A;  3T50 A;  2Y2O A;  1X0O A;  1ALQ A;  4GD6 A;  3TJZ C;  3T1S A;  2WGV A;  2KDK A;  2JE5 A;  3ICY A;  2PU2 A;  1UWN X;  3V3R A;  2OV5 A;  1T1A A;  1GHM A;  4FOF A;  1ERO A;  2HJ9 C;  4O01 A;  2E8J A;  5DF9 A;  3B42 A;  4N1H A;  1F98 A;  4OQG A;  3UPP A;  4L0L A;  3N8R A;  4D2O A;  3LFV A;  2XSS A;  1FQG A;  3Q7V A;  5TR7 A;  1H3Q A;  2DMW A;  2QKP A;  2OOL A;  4X56 A;  3LR4 A;  1OTI A;  3HUO A;  1DP6 A;  3UN7 A;  2XA7 S;  1E25 A;  2D02 A;  5KMW A;  3SH7 A;  2JCH A;  1JWZ A;  3NI9 A;  4HBU A;  1IYS A;  4DDY A;  5CGX A;  3S1Y A;  4OH0 A;  1NLZ A;  5F5Y A;  3ULF A;  4OPQ A;  2GJ3 A;  3HJK A;  4HJ3 A;  3HLC A;  5HD3 A;  2JC7 A;  3DTK A;  3T1R A;  2HP6 A;  2QWS A;  4OP5 A;  5TJJ A;  4Y13 A;  3ITA A;  2HDR A;  4HJ6 A;  1K54 C;  1F2K A;  5HPI A;  3SS4 A;  2QJ5 A;  2BAS A;  2A49 A;  2ZQD A;  2PHY A;  5J8X A;  2VLG A;  4DRT A;  3R7W B;  5EV0 A;  3IXG A;  4HI4 A;  1KGG A;  3NHQ A;  3CIT A;  4WZ5 A;  1XKZ A;  1H8M A;  2O0Y A;  2XD1 A;  4IVI A;  1GSV A;  5L09 A;  3MF0 A;  2LB5 A;  4OLD A;  4PM6 A;  3UE0 A;  3OPL A;  4LGW A;  3K3D A;  4MN5 A;  3IF6 B;  2VV6 A;  5HD5 A;  3AGF A;  2V1B A;  3BEC A;  1WYB A;  3MBZ A;  3L7H A;  1XGJ A;  3R7W A;  1IYP A;  1H8Y A;  5E43 A;  5FA7 A;  4K91 A;  4C75 A;  3KX0 X;  2B95 A;  4P0M A;  3MR0 A;  4PM7 A;  3SOI A;  3RJU A;  4CLC E;  5I5L A;  4ZBE A;  5BOH A;  3UMD A;  4EER A;  4R3B A;  3SH8 A;  1IOU A;  3HVF A;  2ZL1 B;  4PPR A;  1VET B;  1K0K A;  3W2Z A;  3LEQ A;  2HDU A;  2WKE A;  1Y4O A;  1ODV A;  3BLM A;  2OWH A;  3EQV A;  3BW6 A;  4KQD A;  2P7J A;  3MQ0 A;  4Q0J A;  5GLC A;  1YMS A;  1I2W A;  3ZG0 A;  4K0X A;  4CPK A;  3BEB A;  5F68 A;  2A3U A;  1PNE A;  1ERM A;  1PYY A;  4LV0 A;  3NUL A;  2ACG A;  4KZB A;  1BSG A;  3MKE A;  3IT9 A;  3NOT C;  1UWP X;  4DMZ A;  2H5S A;  4GN2 A;  3ZNY A;  4EUV A;  1O7E A;  2EA9 A;  3KYZ A;  1M40 A;  3KO6 A;  1ZC2 A;  3M6H A;  3TOI A;  3LIE A;  4DE3 A;  1VET A;  5EOO A;  5TGF A;  2MJ6 A;  1HLU P;  5G18 A;  5FQK A;  4OQH A;  3HL9 A;  5L2F A;  4QB8 A;  3UPO A;  2PYR A;  1FR6 A;  1XJ2 A;  5L10 A;  3FV7 A;  1K4E A;  1MXO A;  1K4F A;  1W5D A;  4R3J A;  5FAO A;  4P6Z S;  5CGW A;  4Z1W A;  5HX9 A;  4JXW A;  3VOY A;  4OQ0 A;  4R4R A;  5F83 A;  4E6W A;  4S2P A;  3MMH A;  3Q1F A;  2G2W A;  1IEL A;  5CX7 A;  4MBH A;  3T4J A;  3TW8 A;  4G3V A;  4GS9 B;  1FCO A;  4WYY A;  3DWZ A;  4U0T A;  2J80 A;  4GDN A;  2Y2K A;  4NEE D;  1Y54 A;  4GD8 A;  1JTD A;  3DTM A;  3IWO A;  1NLY A;  1SKF A;  3LR0 A;  1T18 A;  1GA0 A;  5GLD A;  4Y0U A;  3L9K A;  5GHZ A;  1NYM A;  3C5A A;  3S7Q A;  4CQH A;  2XH9 A;  4JPM A;  3UE3 A;  2NUP C;  4OKP A;  3BFF A;  4Q8I A;  4E3O A;  4UAA A;  1K55 A;  4GOG A;  2Y8H A;  5FDS A;  5F1F A;  4P6B A;  4MNR A;  3VMA A;  4FUW A;  2A24 B;  4JXS A;  2FFF B;  1U60 A;  2O9A A;  3NY4 A;  4NXF A;  3EOI A;  4KZ5 A;  1OT9 A;  2ZC3 B;  4KG6 A;  4YWZ A;  4KZ7 A;  5DKL A;  5EVI D;  5FAS A;  1HTZ A;  4KZ8 A;  3VFH A;  3LUQ A;  4U3T A;  3OPR A;  3WS2 A;  4ZAM A;  1LLB A;  4JGP A;  1NYY A;  5EOE A;  1W8Y A;  2L1M A;  1I2S A;  1JVJ A;  3LI9 A;  5J3W A;  5EVI C;  3E98 A;  2L0W A;  1P0Z A;  3UB5 P;  2P9V B;  3LR5 A;  2KOI A;  4LCL A;  2B5R A;  2X71 A;  2QJ7 A;  3DW0 A;  3VFF A;  3A3J A;  3OPP A;  1BLS A;  1Z6F A;  1KE0 A;  3VP1 A;  3NDG A;  3JVV A;  5FQ9 A;  3S7P A;  5MC7 A;  3FC7 A;  4BD0 A;  2HP9 A;  3P01 A;  4PM9 A;  1MWS A;  3SS3 A;  4GW9 A;  3PTE A;  2HDS A;  4KZ4 A;  2ZQ8 A;  2JKG A;  1TDG A;  1ESI A;  3SS5 A;  3HLE A;  2ZOI A;  3IXD A;  3GSG A;  3JPU A;  3VSL A;  2PBY A;  2W3H A;  1TD5 A;  4Y0O A;  4X55 A;  2EFX A;  4EXO A;  1T19 A;  1N9B A;  4P6Z M;  4EU0 A;  1VB6 A;  4C3Q A;  1ZHH B;  2Y2Q A;  3U2A A;  4I5S A;  3ZG7 B;  1PWC A;  4U0X A;  5E2F A;  1XPB A;  2M7U A;  4GKU A;  4JKT A;  4DDS A;  1G5U A;  2JKF A;  5GLB A;  3C8C A;  4HJ4 A;  4HP4 A;  4N92 A;  3CWF A;  1MC0 A;  1DJB A;  5M19 A;  1ESU A;  1ZG4 A;  4S2N A;  5FI2 A;  3BFG A;  1ES4 A;  3D72 A;  5FQM A;  3OLO A;  1GSX A;  3ZVT A;  2VEA A;  4JF6 A;  2X02 A;  5EVE A;  5JYP A;  1XA7 A;  5AQ7 A;  5L07 A;  3KSI A;  4K08 A;  2ZQC A;  5DKK A;  3CUE A;  2ZOH A;  3UY6 A;  4KZA A;  2Y2M A;  2PD8 A;  3IF5 A;  1G68 A;  4MCW A;  3D3O A;  3DBA A;  5IS1 A;  3HLF A;  4M4X A;  3S4X A;  3CJM A;  2GX5 A;  5KIZ A;  3RTY A;  5AQ9 A;  2HV1 A;  5A92 A;  4LLO B;  2O9C A;  4P85 A;  3BY8 A;  4CJN A;  2Y59 A;  3IXH A;  1VEU A;  3QP1 A;  2WAE A;  1W63 M;  3FG8 A;  4IBR A;  1NZO A;  4EV4 A;  4E04 A;  2W3G A;  1BLP A;  1K56 D;  1W79 A;  4KG5 A;  1MZU A;  4IHQ A;  4QPR A;  1BLH A;  4YOF A;  1MWT A;  1JWV A;  2HZ5 A;  2Y91 A;  4BMW A;  2K2N A;  1MBL A;  1KOU A;  3VE3 A;  2KLI A;  3NBL A;  3E2K A;  1K54 A;  4NXB A;  1SHV A;  1XA1 A;  2W0N A;  4F3L B;  1Z09 A;  5HDC A;  3P7N A;  5FDH A;  1E3U D;  2L4R A;  3WS1 A;  3QP6 A;  1FSW A;  1L0F A;  1YAX A;  4JBF A;  3UDF A;  1W7F A;  3VSK A;  2VJW A;  3HUN A;  3PXP A;  3H9W A;  3EWK A;  1P9R A;  4PKY A;  1OJ5 A;  2WK0 A;  3PR6 A;  4IUH A;  4FH2 A;  4LFU A;  1MWU A;  1K57 A;  3B47 A;  2P74 A;  3GTC A;  4B9O A;  2JKT I;  1OTE A;  2W3F A;  3D4F A;  2XGN A;  4H6J B;  4F3L A;  4MBK A;  4ZRR A;  4EW7 A;  4HY8 A;  2O99 A;  3A3D A;  4WZ4 A;  3E4Q A;  5HWW A;  3I7J A;  3C38 A;  3ZYT A;  3QNB A;  5KSH A;  1YMX A;  2V2F F;  4RX3 A;  4JGR A;  3VP4 A;  3IHA A;  4UQI M;  5AVE A;  2WZX A;  3DTE A;  3ZHH A;  2I9V A;  2XEP A;  5GHX A;  2XR0 A;  3LR3 A;  3OC2 A;  2UV0 E;  1NZU A;  1TS7 A;  4MN7 A;  5CGS A;  5DF8 A;  3O3V A;  3MXQ A;  1WYC A;  3NOP C;  2JKR I;  3LIA A;  3DAV A;  3UPN A;  3QP2 A;  4CLC C;  2Q9M A;  3T4L A;  4H6J A;  2J3W A;  3PAE A;  5FEG A;  4KZ3 A;  4AFI A;  4OQI A;  3G31 A;  3IXB A;  3ZVW A;  4JXV A;  2XFT A;  2W27 A;  4EES A;  3MFX A;  4QD4 A;  5C5K A;  5IU1 A;  3F1N B;  4N9K A;  1XFQ A;  5I94 A;  3PBN A;  4OOL A;  1L0G A;  3T1Q B;  4LV2 A;  1JTG A;  5D3O A;  2PR6 A;  3ZGA B;  4OOM A;  1FIK A;  1KDW A;  2Z2M B;  1P9W A;  4HP9 A;  4GNU A;  4DXB A;  2LB9 A;  2Y4A A;  1KE4 A;  3EGX C;  4HH2 A;  1DRM A;  3N4I A;  5IHV A;  1HVB A;  1TDL A;  1VHM A;  3TRC A;  3NCK A;  1QMF A;  1S4S A;  1DJA A;  2HGV A;  3G32 A;  3MQQ A;  2ZMV A;  5A90 A;  1D06 A;  3E2L A;  1SDE A;  3NOU C;  4O0P A;  2H10 A;  2AVX A;  1PI4 A;  3V67 A;  4R70 A;  1MPL A;  3G35 A;  3GQZ A;  4HQA A;  3B33 A;  4MDZ A;  3F1N A;  2V8C A;  1TS8 A;  1DJC A;  1DP9 A;  1ERQ A;  5CHJ A;  3ITB A;  2J8Y A;  1BLC A;  1GHI A;  1V9Z A;  3HRE A;  2OAQ 1;  4QHC A;  5GL9 A; 
#chains in the Genus database with same CATH homology
 2WKR A;  3S7Q A;  1XJ4 A;  4HOI A;  3C30 A;  4CQH A;  1OTB A;  4KUO A;  3A0S A;  1G28 A;  2VV7 A;  3K2N A;  5HWT A;  3UE3 A;  4GHI A;  2NUP C;  5AJG A;  3KSF A;  4CLC B;  4R38 A;  4WL9 A;  3SW1 A;  3A0R A;  3LID A;  5G4Z A;  4WF0 A;  1OPX A;  2GZA A;  2Y8H A;  4MN6 A;  4ARZ B;  4PKY G;  3VV4 A;  1F5M A;  3H7W A;  1STZ A;  4CLC D;  4DN0 A;  1DP8 A;  3S7N A;  2A2L A;  2A24 B;  2K7S A;  3F1P B;  4FSF A;  4L9G A;  3OOV A;  1OTD A;  4HIA A;  1N9N A;  4WEL A;  4GCZ A;  2O9A A;  5TBM B;  4NXF A;  4WUJ A;  3EOI A;  2VZW A;  1OT9 A;  4YWZ A;  2YKH A;  3IBR A;  4WN5 A;  1OT6 A;  3EEH A;  5DKL A;  1NRJ A;  2H28 A;  3UME A;  2V1A A;  2K31 A;  4I38 A;  3CI6 A;  4NXE A;  3LUQ A;  3ZQ5 A;  3CLO A;  4JGO A;  4JGP A;  3H82 A;  2CMN A;  4GLQ A;  2M7V A;  2L1M A;  5J3W A;  3LI9 A;  3E98 A;  2VA0 A;  2L0W A;  1P0Z A;  3E4O A;  2WKP A;  2PYP A;  2OWJ A;  4LRX C;  1EW0 A;  1Y28 A;  2Z6C A;  2R78 A;  3LR5 A;  4KQO A;  2P08 A;  2B02 A;  2KOI A;  5F69 A;  2OAP 1;  4CLC A;  3R4K A;  5LBR A;  4ARZ A;  1LSW A;  2YKF A;  2QJ7 A;  3E4P A;  2W1R A;  4NKP A;  5DJT A;  2JKT M;  3JVV A;  3F1P A;  3S7P A;  1W63 Q;  5MC7 A;  3FC7 A;  3A0V A;  2JN7 A;  1JNU A;  3P01 A;  4GHI B;  5TBM A;  1UGU A;  2B18 A;  4JGQ A;  3S7O A;  4GW9 A;  2EWV A;  1T1C A;  4Y5F A;  3UB8 A;  3PYP A;  3JVU A;  1P97 A;  4BBT A;  3T50 A;  2Y79 A;  2ZOI A;  1X0O A;  5HPF A;  2W3H A;  1TD5 A;  3CAX A;  4I3J A;  3T4K A;  3TJZ C;  4EXO A;  3LYX A;  1T19 A;  4P6Z M;  5G4Y A;  4EU0 A;  1VB6 A;  2FZ0 A;  2KDK A;  3UB7 A;  3ICY A;  3LIC A;  3IS2 A;  5A8B A;  1TS6 A;  3BQA A;  1UWN X;  1ZHH B;  3U2A A;  4I5S A;  2WKQ A;  1T1A A;  3UE6 A;  4FOF A;  3T4T A;  3G6O A;  2HJ9 C;  4O01 A;  4BWI A;  1S4R A;  5DF9 A;  2M7U A;  3B42 A;  3KSH A;  1F98 A;  3PBT A;  4L0L A;  2JKR M;  4PHT A;  3C8C A;  5DJU A;  4HJ4 A;  3LFV A;  2XSS A;  4HP4 A;  3BJN A;  3CWF A;  3O5Y A;  1MC0 A;  4YNR A;  1H3Q A;  2DMW A;  2QKP A;  3D72 A;  2HJE A;  2OOL A;  3OLO A;  1GSX A;  2VEA A;  3LR4 A;  4DJ2 A;  1OTI A;  1S1Y A;  1GSW A;  1T1B A;  2GNX A;  1DP6 A;  2D01 A;  3PBS A;  2XA7 S;  4PAU A;  1D7E A;  2D02 A;  3KSI A;  4LPZ A;  2VX8 A;  4K08 A;  5DKK A;  3CUE A;  2ZOH A;  5AVF A;  2INW A;  2QHK A;  4LRY C;  2PD8 A;  2XA7 M;  4MCW A;  1S66 L;  3D3O A;  1NLZ A;  5F5Y A;  3ULF A;  3DBA A;  4L9F A;  5IS1 A;  4O8G A;  3C2W A;  3PBQ A;  2GJ3 A;  4M4X A;  3HJK A;  3HJI A;  2GX5 A;  4HJ3 A;  2P04 A;  5KIZ A;  5HD3 A;  3RTY A;  1XJ6 A;  1YSQ A;  2QWS A;  2M1C A;  5TJJ A;  1WA9 A;  2HV1 A;  4Q0H A;  2VGL S;  4HJ6 A;  4I39 A;  2QYB A;  5EFW A;  4LLO B;  1LSV A;  5HPI A;  5J7E A;  3RH8 B;  2O9C A;  2ZMF A;  4HH3 A;  3IS2 B;  3BY8 A;  2QJ5 A;  5L8M A;  4ME4 A;  1W63 M;  2BAS A;  3UB9 A;  3FG8 A;  1N9L A;  5HL6 A;  2PHY A;  4E04 A;  2W3G A;  2IA2 A;  3T4Q A;  2XRO A;  2VLG A;  4BJP A;  3R7W B;  3EEA A;  1MZU A;  4IHQ A;  4QPR A;  5HWV A;  4YOF A;  4HI4 A;  4BMW A;  2K2N A;  1KOU A;  3VE3 A;  3NHQ A;  5K5B A;  2W3D A;  1N9O A;  5HZH A;  2KLI A;  4NXB A;  3CIT A;  4R6L A;  1H8M A;  2W0N A;  2V0U A;  2O0Y A;  2W1T B;  4F3L B;  1LT0 A;  1GSV A;  1OJG A;  5HDC A;  3MF0 A;  3P7N A;  2L4R A;  4LRZ E;  1YSP A;  3OCL A;  4WEJ A;  2LB5 A;  1YAX A;  2J3T D;  3K3D A;  4MN5 A;  2VV6 A;  2VJW A;  3PXP A;  4Y3I A;  3LI8 A;  4Y2F A;  5HD5 A;  3H9W A;  2FH5 A;  4KUK A;  2V9A A;  4BBV A;  3EWK A;  1F9I A;  4I3A A;  2V1B A;  1P9R A;  1OJ5 A;  4PKY A;  3PR6 A;  2Z6D A;  2J3T C;  4IUH A;  4DJ3 A;  3R7W A;  2EWW A;  3B47 A;  5HSQ A;  5F6A A;  1LSX A;  3OBF A;  3VOL A;  1S1Z A;  4B9O A;  1ZTU A;  3EQU A;  2JKT I;  1OTE A;  3BQ8 A;  2KX6 A;  2W3F A;  3EGD C;  3KX0 X;  4H6J B;  2W1T A;  4F3L A;  3E0Y A;  2VKS A;  4ZRR A;  4EW7 A;  3MR0 A;  4HY8 A;  3K3C A;  2O99 A;  3F1O B;  3E4Q A;  5HWW A;  3C38 A;  3VE4 A;  4CLC E;  3ZYT A;  5I5L A;  4UQI S;  2PR5 A;  5KSH A;  4ETZ A;  1IFQ A;  3UMD A;  4L9E A;  4NXG A;  3GEC A;  1G6O A;  5HDD A;  4IJG A;  4JGR A;  4EER A;  4I3I A;  1IOU A;  4UQI M;  5AVE A;  4EEU A;  4WEK A;  4BBU A;  2I9V A;  3PBO A;  5HDS A;  3LR3 A;  3W2Z A;  3OC2 A;  1V9Y A;  1ODV A;  4G3W A;  1TS7 A;  2PD7 A;  4MN7 A;  2OWH A;  3EQV A;  3BW6 A;  4KQD A;  2P7J A;  3MQ0 A;  4Q0J A;  1OTA A;  4GS9 A;  3MXQ A;  5IT5 A;  3NOP C;  3NJA A;  2ZBB A;  2JKR I;  3UB6 A;  4GJ4 A;  3LIA A;  5F68 A;  4CLC C;  1XFN A;  2VGL M;  3T4L A;  3GDI A;  3KSG A;  4H6J A;  2W3E A;  2J3W A;  4IUK A;  4R3A A;  4AFI A;  4ETX A;  1S67 L;  4II7 A;  2NUT C;  1TF1 A;  2W27 A;  4EES A;  3F1O A;  3FPV A;  3MFX A;  5C5K A;  5IU1 A;  3F1N B;  3RFB A;  1XFQ A;  3TE8 A;  3PBN A;  4OOL A;  3NOT C;  3PHY A;  1UWP X;  2V0W A;  4DMZ A;  2PR6 A;  1NWZ A;  4EUV A;  2EA9 A;  3KYZ A;  4OOM A;  2XRN A;  1BYW A;  1P9W A;  3KO6 A;  4HNB A;  4HP9 A;  4MMN A;  3LIE A;  2LB9 A;  2MJ6 A;  4EEP A;  3EGX C;  3FPW A;  4HH2 A;  1DRM A;  4G3K A;  4EQ1 A;  1LL8 A;  1VHM A;  3TRC A;  3LIF A;  1S4S A;  4RQ9 A;  4XT2 B;  2A24 A;  2HGV A;  3LIB A;  3BWL A;  3MQQ A;  2ZMV A;  1D06 A;  2PT7 A;  2PDR A;  2PYR A;  1XJ2 A;  3NOU C;  3T4O A;  4O0P A;  3PBR A;  4P6Z S;  4Z1W A;  1MKM A;  3H7W B;  4R70 A;  3V67 A;  4HQA A;  3B33 A;  3OCN A;  2O9B A;  3MMH A;  4MDZ A;  5CX7 A;  3F1N A;  3T4S A;  3BY9 A;  4UEY A;  1TS8 A;  3T4J A;  4G3V A;  4GS9 B;  3TW8 A;  3MQO A;  4HHD A;  4Q0I A;  2HF6 A;  4B93 A;  1YKD A;  1DP9 A;  3MJQ A;  2J80 A;  5DFY A;  2JHE A;  1TS0 A;  3IBJ A;  4NEE D;  1XJ3 A;  2G7U A;  4EET B;  3HCY A;  1NLY A;  5J4E A;  5FL3 A;  3LR0 A;  3KYQ A;  1T18 A;  5DFX A;  1V9Z A;  2OAQ 1;  4WLA A;  3H82 B;  2VV8 A;  4XT2 A;  3CUE C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...