4HQAA

Crystal structure of pas domain from the human erg (herg) potassium channel
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
110
structure length
110
Chain Sequence
b'SRKFIIANARVENCAVIYCNDGFCELCGYSRAEVMQRPCTCDFLHGPRTQRRAAAQIAQALLGAEERKVEIAFYRKDGSCFLCLVDVVPVKNEDGAVIMFILNFEVVMEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium voltage-gated channel subfamily H member 2
publication title Structural properties of PAS domains from the KCNH potassium channels
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 31
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2012-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4hqaA00
1D06A 3P7NA 2V0UA 1T1CA 2YKHA 5DKLA 4NXFA 4I38A 3NOPC 3NOTC 5J7EA 3A0VA 2VLGA 3GECA 1TS8A 2VV7A 3BWLA 2Z6DA 4I3AA 3IBRA 1G28A 3RTYA 1OJ5A 4KUKA 5DJUA 3LIAA 4XT2A 1MZUA 4YWZA 3LIBA 4HY8A 4HQAA 1GSXA 2A24A 3IS2A 2PD8A 3RH8B 1S4RA 3G6OA 1XFNA 4PKYA 1F9IA 3NOUC 4HH3A 1P0ZA 1OTBA 2EA9A 3B33A 4M4XA 4WLAA 1UWPX 3MR0A 4MN6A 4R38A 1T1AA 4JGQA 3ZQ5A 4BBTA 2QWSA 3E4PA 3H9WA 1BYWA 2QKPA 5I5LA 2PDRA 2JHEA 3PYPA 3ICYA 4GS9B 1DP9A 4GHIB 3H7WB 4H6JB 5J3WA 2VV8A 4DJ3A 3F1NB 1DRMA 1T1BA 2VV6A 3UMEA 2L4RA 5AVEA 3HJKA 1N9NA 2OOLA 2R78A 2V1AA 1S1YA 2V9AA 5F68A 5HWWA 5TBMA 2OWJA 2V0WA 4HH2A 3ULFA 1UWNX 4HI4A 2W0NA 3LIDA 3PHYA 1KOUA 3LYXA 2YKFA 2P7JA 3F1PB 1T18A 2B02A 4HHDA 2HV1A 5IU1A 1X0OA 5F5YA 3MQOA 4HP4A 4EESA 5DKKA 3F1OA 4F3LA 3OLOA 2H28A 3K3CA 5AVFA 1D7EA 2M1CA 2JN7A 4I39A 3H7WA 2QJ7A 4KUOA 4EETB 4KQDA 1XJ2A 4H6JA 1VB6A 1GSWA 1TS7A 1OT9A 3D72A 4R6LA 4WUJA 1N9OA 4NXGA 1S4SA 3F1NA 4BBVA 3LIEA 1DP8A 2QHKA 1UGUA 5F6AA 3H82B 1LSVA 3T50A 2OWHA 4HJ4A 3K3DA 1NWZA 1XJ4A 2PR5A 4BBUA 4DJ2A 1ODVA 2J80A 2GJ3A 1LL8A 2K7SA 4XT2B 4WF0A 3GDIA 1TS0A 3A0RA 2QJ5A 4GW9A 1OTDA 4WN5A 3IS2B 4L9GA 4MN5A 4WL9A 3KX0X 1T19A 4HJ3A 3LI9A 2ZBBA 4E04A 3UE6A 3HJIA 4EERA 4EW7A 3C2WA 5J4EA 1EW0A 5IS1A 4I5SA 1V9YA 1TS6A 3NJAA 5HWTA 1DP6A 2V1BA 2PD7A 2PYRA 3LIFA 3VOLA 3EEHA 1WA9A 4LRYC 4EEUA 5HWVA 3H82A 3UB9A 4EQ1A 1OT6A 5HD3A 3A0SA 2BASA 4L9EA 5G4ZA 1N9LA 4HP9A 5HD5A 3UMDA 4I3IA 5HDSA 2CMNA 2W27A 1LSWA 2WKPA 3VE3A 4EXOA 1OTIA 1OJGA 4HOIA 3FC7A 4GS9A 4GHIA 3VE4A 1S66L 2KX6A 2VEAA 3CLOA 1Y28A 4LRXC 4HNBA 3NHQA 5A8BA 1LSXA 2L1MA 4LRZE 1OTAA 4PKYG 2D01A 1F98A 5DJTA 5KIZA 5EFWA 2D02A 2KDKA 4HIAA 5TBMB 1GSVA 1S67L 3FG8A 1LT0A 5G4YA 1XJ6A 2WKQA 4LPZA 4B9OA 3UB8A 5HDDA 2PHYA 2ZOHA 4NXBA 4EEPA 2A24B 3F1PA 2ZOIA 3MXQA 3LI8A 5F69A 1XFQA 2PYPA 4HJ6A 1XJ3A 2INWA 3F1OB 3C8CA 3LUQA 1V9ZA 4I3JA 4F3LB 5HDCA 2WKRA 4JGRA 2I9VA 4R70A 3CAXA 3CWFA 3BY9A 4K08A 2Z6CA 2L0WA 1OTEA 3BY8A 3SW1A 3MJQA 4R3AA 1S1ZA 3MFXA 3MQQA 3E4OA 3E4QA 4L9FA 3UB7A 4LLOB 1P97A 5HSQA 4RQ9A 1JNUA 4JGOA 5HZHA 3EWKA 4JGPA 4GCZA 4NXEA 3UB6A 2PR6A 3LICA
chains in the Genus database with same CATH superfamily
1JWPA 4BJPA 2Y4AA 5DKLA 4N92A 3QP5A 3C30A 1ACFA 2EXAA 5FASA 2VV7A 3O5YA 2WAFA 3MQ0A 3C7VA 1OJ5A 4KUKA 4MNRA 5DJUA 4K91A 3IWIA 2O0YA 4MMNA 1MZUA 3T12B 4IVKA 4CLCC 4E6WA 2P9VA 3LIBA 4UQIS 4HY8A 2HDUA 3DTEA 5FQIA 2A24A 2Y2OA 3WS0A 2Y8HA 2X02A 3IWQA 3IS2A 4LCLA 2JE5A 4MBHA 3UDXA 4X55A 4S2IA 3G6OA 4GJ4A 5FQ9A 4BD1A 3G30A 4Y13A 2P74A 2EA9A 3DWKA 3B33A 2VK3A 3B42A 4WLAA 1CI8A 1ERQA 4N9LA 1DJAA 2Y2NA 3HBRA 4QY5A 1YMXA 2WZXA 3QNCA 4OQIA 4JF6A 5BOHA 4JGQA 1L0FA 1BYWA 5E2GA 1K55A 4GZBA 5AQ9A 2A49A 3A3IA 4KQQA 5HPFA 1YM1A 3GMWA 5CGWA 2Q9MA 2VZWA 5EVID 4DJ3A 1T1BA 3M6BA 5GLAA 3SOIA 2L4RA 4PAUA 3HUOA 1GHIA 1N9NA 1SKOB 1GA0A 3JVUA 1ZC2A 3KYZA 3AGFA 1QMEA 3VOYA 2V9AA 4KZ9A 4Q0IA 4CLCB 2PT7A 3V3SA 5HL6A 3C38A 4UA6A 3G32A 2ZLYA 4OP8A 3LGOA 5EVIC 3LEZA 2ZQCA 5E2EA 3ULFA 1UWNX 4KZAA 5AQ7A 3M2KA 3LYXA 2Y91A 4GDNA 2P7JA 2Y79A 3QHYA 4LCMA 1IFQA 2ZC5B 5FSRA 2B02A 5E2FA 1IELA 3NDEA 4OLDA 2EX9A 3IX3A 1IEMA 5GLBA 3GTCA 5DKKA 3VV4A 4EQIA 3VP4A 1D7EA 2M1CA 2H5SA 1K6SA 2QJ7A 3LEQA 2HP5A 2WZZA 4KQDA 1TS7A 1OT9A 3D72A 4WUJA 1LLBA 4RA7A 4NXGA 4E3KA 2JKRM 2XR0A 4BBVA 3B3XA 5GHYA 3S22A 5CGXA 3HLBA 3QP2A 3T4QA 4N1HA 2QHKA 3HVFA 3H82B 1LSVA 2ZMAA 1PZOA 5FI2A 4B4ZA 4Q8IA 4WBGA 5CRFA 5A91A 4UHUA 1NWZA 2WGIA 3VP1A 2X71A 2Y2JA 4PM6A 5EOOA 4ME4A 5EM1A 3KSHA 1NZOA 3NBLA 4Z9QA 4NG2A 4MEZA 3O3VA 3U2AA 4IVIA 1WYCA 2E8JA 1XX2A 3ZHHA 3A0RA 4HESA 3UB5P 1OTDA 2RL3A 4WN5A 1C3BA 1KGGA 3HLCA 3SH8A 4MN5A 3UE6A 3HJIA 3C2WA 1PRQA 5J4EA 3ISGA 2EWWA 4JLFA 4OQGA 4OOLA 4Z1WA 5FEGA 3VP0A 4PPRA 4KZBA 4MBKA 3BFDA 3LIFA 5EE8A 4BL2A 2XROA 3EQVA 2CC1A 3LO7A 3PAEA 5HPIA 4DXBA 4OOMA 5HWVA 1I5QA 1RGYA 4S2LA 3VFHA 4L9EA 1SCWA 5CERA 4BENA 3W4QA 2P08A 3UMDA 3CUEC 4FCFA 4I3IA 2PRFA 2WGWB 4S2OA 5CX7A 2Y2LA 2WKPA 3OBFA 1Q2PA 1OTIA 2ZC6B 5HX9A 4N1XA 4FTXA 3BW6A 2Y2QA 4GS9A 4GHIA 4Y5FA 2KX6A 3UE0A 1Y28A 3GVBA 1XPBA 4U0XA 2J3TD 4LV3A 1YLZA 2D01A 4II7A 5DJTA 3GSGA 4R3BA 5EFWA 3T1SA 2D02A 2KDKA 2G7UA 1XXMA 3BYDA 4X1MA 5KSCA 4M3KA 2VGLM 4R4SA 5FDSA 2G2UA 3IXDA 2J9OA 1L0EA 1S0WA 1P9WA 3N7WA 3AGDA 1EROA 2PHYA 1XGJA 1IYSA 2J3TC 3D4FA 4S2NC 5FAQA 2WUQA 5CGSA 5HAIA 4NXBA 4WYYA 1YMSA 5DF9A 3K2NA 4EEPA 3LI8A 2PYPA 1ES4A 3VOZA 5D3OA 5GHZA 4KG2A 2O9CA 3BY8A 3GQZA 5CTMA 1QMFA 1YKDA 2JKRI 3IH9A 4Y2FA 3M6HA 4X25A 4KZ3A 1VHMA 3N8LA 2V1ZA 5CEBA 5GL9A 4OQ0A 3S7OA 4DE0A 5HL1A 3QP8A 4G3KA 1SHVA 5HSQA 5HZHA 1O07A 1GCEA 5HAPA 2A3UA 4BWIA 1MWTA 1CEGA 3P7NA 4KG5A 3UDFA 4JPMA 4PM5A 3DW0A 2JKTI 5F1GA 3NOTC 5CTNA 3DTIA 3PBSA 2LB5A 1MKIA 3HUNA 1PWDA 3QNBA 1G28A 4WEKA 1K54C 1MC0A 4DXCA 2WGVA 4FH4A 4IUHA 4XXRA 4DDSA 2XA7M 4GNUA 4HQAA 1GHMA 4EUVA 1VEUB 1BTLA 3A3DA 5DF8A 5EM0A 2UV0E 3NC8A 1ZTUA 4JKTA 3BRMA 1J9MA 2HF6A 3IT9A 3CHWP 1P0ZA 4B88A 4Y0UA 1U60A 3OPPA 4M4XA 4LENA 1H5XA 3RJUA 5DF7A 1UWPX 4YOFA 2PU2A 2XRNA 1BUEA 3MR0A 1KGEA 5GLCA 4ZJ2A 5HAQA 2Y2GA 4X6TA 4UA9A 1T1AA 3ZQ5A 4BBTA 1KDSA 1ERMA 3SS3A 2QKPA 4GOGA 5GLDA 4JXWA 2EX8A 3RFBA 4ZBEA 3PYPA 3ICYA 1ZHHB 5EOEA 4YFMA 2W3GA 4H6JB 1NJ4A 1NLZA 3DAVA 1N9BA 3V5MA 1FQGA 2GDNA 4K0WA 3F1NB 2BG1A 1WE4A 3ZCZA 3EOIA 3PBTA 4CLCE 3N8SA 2Y2IA 4QJGA 1O7EA 1CF0A 2OOLA 2K2NA 2V1AA 1L3LA 5F68A 3CPTB 4JXVA 4E3LA 2PAVP 2VA0A 3PBQA 4KZ6A 3P09A 1JWVA 1Z09A 1G5UA 3ZNTA 1W63M 4HH2A 4QU3A 3RXWA 2JKGA 3T4SA 2ZM0A 4WZ5A 3BFEA 1KGFA 3MXSA 5M18A 3N4IA 5IU1A 5FQKA 2NUTC 4HP4A 1E4DA 1HTZA 3IH8A 2ZL1A 4EESA 3IHAA 3RXXA 3F1OA 1KDWA 3OLOA 5DTTA 1JWZA 4P6ZS 5DFYA 1LI9A 4UEYA 3T1RA 3LFVA 3T4OA 5FDHA 1ES2A 1VB6A 1GSWA 5L09A 2R9XA 2BTFP 3TW8A 1K55C 5M1AA 1S4SA 3L7HA 4FSFA 1XP4A 1SKOA 5CHJA 1BULA 5FQMA 1VM1A 5EECA 5G18A 3T50A 2XQZA 2ZMFA 3IF6B 2OWHA 1DY6A 4G3VA 2W3DA 2ACGA 2HZ5A 1W5DA 3DTMA 3ZYTA 4DE3A 3NY4A 1W7FA 4S2MA 4DJ2A 1MY8A 2J80A 2JKFA 2OLVA 4JF5A 4ARZA 2V20A 2P9VB 2HJ9C 1ONGA 4KZ5A 2J9PA 1FCNA 3ZDJA 1PW8A 3IS2B 1KE3A 2OAP1 4PHTA 1CJFA 4C6YA 2ZBBA 2IWBA 1MWRA 4EERA 4EW7A 2XLNA 2OAQ1 2XF3A 5FI7A 4I5SA 1AXBA 1TS6A 3HCYA 3NJAA 1J3WA 1MWSA 4Y3IA 4HEFA 3VFFA 4P85A 2QZ6A 1EWZA 1BLCA 2XD1A 3L9KA 1GA9A 2ZQ9A 1HVBA 5FA7A 3MFDA 2ZQAA 3VOLA 3TOIA 1SDEA 4ZDXA 3DBAA 3EEHA 2VGLS 3BFGA 3PBOA 4LRYC 1EI5A 4H8RA 3H82A 3HLGA 3KO6A 4EQ1A 5HD3A 1YPRA 2ZC3B 3UE3A 4HP9A 1IYQA 2Y59A 3CI6A 1M40A 3EEAA 4OPRA 1E3UA 3SS5A 2A2LA 3FV7A 3T4TA 4HOIA 3I7JA 1YLYA 3CLOA 3O86A 4LRXC 3KYQA 2W3HA 5A8BA 4BLMA 4LRZE 2IA2A 1H0MA 3HLEA 4PKYG 1F98A 5FL3A 3MZDA 5C5KA 5JYPA 5FAPA 3V39A 4HIAA 4B4XA 2M7VA 2Y2KA 4MDZA 1FIKA 3S4XA 3EQUA 3FG8A 4GLQA 4S2KA 3HL9A 1ONHA 3BM6A 1XJ6A 2WKQA 3FKWA 4LPZA 5HDDA 3KSFA 3FPVA 2EX2A 4HBTA 4IJGA 1STZA 3IXBA 5F1FA 4GN2A 4NEED 4N9KA 3PXPA 3P98A 4PM9A 2JKTM 3MZFA 1N4OA 2G2WA 4CQHA 4EWFA 4OPQA 3O87A 2VGKA 3Q7VB 4MN7A 4PMAA 3ZVTA 4D2OA 2C5WB 3MKFA 2X01A 3C4PA 1FOFA 2B18A 4DMZA 3F1PA 3UN7A 4HJ6A 4LV1A 1K6RA 3LUQA 4UQIM 4I3JA 4LV0A 2ZD8A 3U4LP 2W1TA 4JGRA 5EVIB 3CWFA 4K08A 5HFOA 4JXGA 1PW1A 2Z6CA 3GV9A 1K0KA 3G2YA 1LL5A 4MLLA 3MJQA 4FUWA 2DCFA 3NIAA 3MFXA 4C75A 3T1QB 2V8CA 2KOIA 3UB7A 2I72A 5CECA 5J8XA 4LLOB 1CK3A 1D1JA 3BFCA 4P0MA 4IUKA 4F94A 3EWKA 3MZEA 3JPUA 3S7QA 1L2SA 1ESIA 1I2SA 2YKHA 1K4FA 2PU4A 1L0DA 3MF0A 4NXFA 4R0QA 3NOPC 3OPRA 4IBXA 3A0VA 2WKHA 4QB8A 3S1YA 1TS8A 1ZKJA 2KLIA 3BWLA 5CHMA 3NCKA 2HPBA 4I3AA 4YNRA 4KG6A 1BT5A 4O7DA 4BL3A 3DTKA 2FH5A 3W4OA 3Q81A 4XT2A 1TEMA 4KQRA 5EVEA 4YWZA 3FYZA 2XFTA 3HLDA 3T4LA 3QP1A 1GSXA 4XUXA 3HUMA 1HZOA 1BLPA 4PKYA 3BEBA 1W8YA 4HH3A 3NI9A 1YLJA 4ETZA 1F2KA 3N8RA 3WS4A 4P6BA 2AVXA 2HGVA 5K5BA 1MKMA 2ZC4B 3A3FA 4LV2A 2JBFA 2WKIA 4ESPA 4MN6A 1PWCA 4GD8A 4R38A 3R7WA 4DDYA 4ZRRA 1XA1A 2K31A 3S7PA 2QWSA 3E4PA 3H9WA 1PNEA 3LCEA 4E6XA 2OV5A 3LR5A 3W8KA 2Y2PA 3E0YA 1NXYA 1JTDA 4GS9B 1DP9A 4GHIB 1YLWA 3H7WB 5A92A 2VV8A 1VETA 1NRFA 2VV6A 3UMEA 1FCOA 2XEPA 3W4PA 3HJKA 1PZPA 1YSQA 3E2KA 2R78A 2J8YA 1S1YA 2HJEA 2VX8A 1YSPA 4GKUA 1S6RA 5TBMA 5KMWA 2XDMA 5AQBA 2OWJA 1SDNA 3UY6A 3MS6A 2V0WA 4HI4A 4B93A 1TVFA 2W0NA 3LIDA 3IHBA 2Y55A 4IHQA 5DVAA 3PHYA 4KZ4A 2YKFA 4G3WA 5FAOA 1MBLA 2V2FF 1PI5A 4HHDA 2HV1A 2H10A 3P01A 4ID4A 1X0OA 2Q0OA 3IX4A 4EBPA 1G6OA 3MQOA 5CXWA 2EWVA 4A5RA 4Y0TA 4F3LA 3BFFA 3KYEA 1Y54A 2ZMVA 3ZG9B 3K3CA 5AVFA 2PBDP 3G2ZA 4WEJA 3MBZA 4KUOA 4EETB 1XJ2A 4H6JA 4KQOA 4C3QA 1FR6A 3M2JA 1PI4A 4RX3A 3F1NA 3LIEA 5I94A 1GHPA 4OLGA 3CMZA 4S2PA 1BLSA 2XSSA 4Q0HA 5CHUA 4QY6A 3MXRA 3PAGA 2IWDA 4BD0A 2J3WA 1BZAA 1RP5A 3NDGA 2EX6A 3FPWA 3CPTA 3K3DA 4WZ4A 1F5MA 4BBUA 3IBJA 1HLUP 4U3TA 1MPLA 1PYYA 2K7SA 3ZVWA 1JTGA 2Y2HA 3LY4A 3GDIA 3OPHA 4AFIA 2P04A 2QJ5A 4GW9A 5F83A 1FCMA 4L9GA 4QPRA 4JF4A 3ZNYA 4WZ5C 3LR4A 3NULA 3A3EA 4HJ3A 1WYBA 1L0GA 4JBFA 1K57C 2B5RA 1EW0A 5IS1A 1W79A 5HWTA 4YINA 1DP6A 2V1BA 4KZ8A 2OSUA 4R23A 1K56D 5F82A 1P9RA 5KZHA 2PD7A 4IBRA 2PYRA 3MMHA 4CLCD 4UA7A 2FFYA 1FILA 3GR2A 1G6AA 3D3OA 1DJCA 3CJMA 4EEUA 3UB9A 1K57A 1OT6A 2QMIA 3A0SA 2BASA 5G4ZA 3IF6A 5HDSA 5M19A 1KVLA 2W27A 1IYPA 2XH9A 1LSWA 4X53A 3VE3A 5L8MA 2O9BA 4X69A 3UE1A 4O8GA 1FSYA 4OPYA 3FC7A 1KVMA 4ZAMA 3UPOA 2EFUA 4WMCA 1YAXA 4ZJ3A 3BECA 1OPXA 1LSXA 2L1MA 4DRTA 2GZAA 4IEDA 2PBYA 4P87A 5GHXA 2ZQ8A 3BQAA 3SH9A 1K56A 1GSVA 2IWCA 3ZG0A 4OKPA 5FQJA 3TG9A 1S67L 4X56A 4R4RA 1LI0A 4CLCA 5L10A 4B9OA 3OOVA 3UB8A 4O0PA 3V67A 1ALQA 3OC2A 2ZOHA 1IOUA 4NK3A 1H8YA 4MCWA 2XFSA 3FWLA 2FFFB 5FQQA 4EU0A 2A24B 2ZL1B 2Q9NA 3MXQA 5F69A 1E3UD 1XFQA 3UPPA 2V8FA 3TE8A 1XJ3A 1H3QA 3F1OB 3C8CA 1MWUA 5HDCA 3Q82A 2I9VA 3EGDC 4R70A 2BLSA 5AQAA 4EBLA 2HDQA 3ITAA 4KZ7A 1BSGA 4GDBA 2ZQDA 4RYEA 4MBFA 2O99A 2B95A 3PTEA 5DFXA 3E2LA 5KSHA 4ZJ1A 1P97A 3T4KA 4RQ9A 4JGOA 4RX2A 3UB6A 2PR6A 3ZG7B 1D06A 1K38A 2XK1A 3G31A 1NZUA 3IF5A 2V0UA 1BLHA 1T1CA 5CEDA 3HREA 4OQHA 3WRTA 5DTSA 2FZ0A 4I38A 4OVDA 5J7EA 2VLGA 3GECA 3VP2A 2Z6DA 4ARZB 2JCHA 3IBRA 2WADA 3RTYA 5EV0A 4JXSA 2RCXA 3EGXC 4E3IA 2H0TA 3LIAA 3D9YA 2R9WA 1ES3A 2NUPC 5HW3A 3G35A 2WAEA 3Q7VA 5E2HA 1YLPA 3MSHA 3LR0A 5L2FA 4RVAA 2PD8A 1ES5A 5EVIA 3RH8B 1S4RA 4PM8A 1XFNA 2O9AA 1F9IA 1IKGA 2W1RA 3NOUC 4S2JA 4DN0A 1NRJA 1NY0A 1OTBA 4Y7PA 1KE4A 3SH7A 4OP5A 4GD6A 4NETA 1XKZA 1FR1A 4E3MA 1G68A 3UO9A 4CPKA 4U0TA 3BLSA 4QD4A 3BQ8A 3ZG5A 3IX8A 1YQSA 3WS1A 3Q1FA 2Z2MB 1ESUA 3QP6A 5I5LA 2PDRA 4E3JA 2HP6A 5FI6A 2WYXA 2Y2MA 3Q07A 3ZGAB 4EBNA 2H0YA 2JHEA 3BJNA 2WGWA 4R1GA 2EFXA 2ZM8A 2XA7S 1E25A 4P6ZM 3V3RA 1PIOA 5J3WA 5DTKA 3VSKA 1KE0A 1RGZA 5LBRA 1TDGA 5FEFA 1DRMA 5EPHA 5AVEA 4Q0JA 2DRWA 1LL9A 3SS4A 1AWIA 1JVJA 4WELA 3WRZA 2WKEA 5EUAA 4KENB 2C6WB 4OPZA 4CJNA 5HWWA 3TRCA 1W8QA 3OCLA 3OPLA 1CQAA 1A0KA 2EXBA 3KSIA 5EVLA 2W3FA 5L07A 1H8ZA 2XGNA 1KOUA 3F1PB 2VJWA 1T18A 2UWXA 1XGIA 4EUZA 2W1TB 5F5YA 4FH2A 5JYOA 1LHYA 3SZTA 2J7VA 1YLTA 2H28A 4OOYA 3PR6A 5HARA 4LFUA 3N6IA 2JN7A 4DKIA 4I39A 3H7WA 4E3OA 5IHVA 3PBNA 4R6LA 1N9OA 1IYOA 3NECA 2OLUA 4LGWA 3CUEA 4NKPA 3GRJA 1DP8A 1XA7A 1UGUA 5F6AA 3A3JA 1RCJA 3CG5A 3LR3A 2HDSA 4HJ4A 2JC7A 2QYBA 1K4EA 3VMAA 3UDIA 5U47A 4L0LA 1TF1A 5MC7A 3CZDA 1XJ4A 3OCNA 2PR5A 4WM9A 3BLMA 5TJJA 3S7NA 3FZCA 4X1LA 1ODVA 2GJ3A 1LL8A 5A90A 4XT2B 1M6KA 1NYMA 4WF0A 3G4PA 3ZFZA 2QPNA 1SZVA 1TS0A 5TFQA 4OONA 3IXGA 4QHCA 4WL9A 3KX0X 1T19A 4UAAA 1PWGA 3UNWA 3LI9A 1VEUA 4E04A 5A93A 3ZG8B 3T1XA 3G34A 4S2NA 3C5AA 1V9YA 1MXOA 3KSGA 4XUZA 2VGJA 3WWXA 4BMWA 2ZJ9A 2ZM2A 1ZG6A 3IXHA 3R7WB 3QP4A 3VSLA 1I2WA 1WA9A 4DE1A 3JYIA 3AGEA 2HDRA 2Z2LB 1VQQA 5TR7A 4GB7A 4ETXA 5E43A 2XD5A 3HLWA 1N9LA 1Q2QA 1K25A 5HD5A 2CMNA 4ZTKA 4PM7A 2GX5A 1H8MA 2WK0A 4EXOA 2LB9A 1DJBA 4E3NA 1OJGA 1NYYA 3HLFA 4OH0A 3JVVA 1VETB 3VE4A 1NLYA 1CI9A 1S66L 1ZG4A 2VEAA 4FD8A 4D60A 1CEFA 3ITBA 2E8IA 3NHQA 3R4KA 4HNBA 1Y4OA 2DNSA 1OTAA 4K0XA 5KIZA 2MJ6A 2M7UA 3PBRA 5AJGA 3DWZA 4DE2A 3B47A 4QWOA 4Y17A 5TBMB 4FOFA 1YT4A 2W3EA 1K54A 1Z6FA 3UPNA 3TSGA 2DMWA 3C4OA 4O01A 1LT0A 5G4YA 1HD8A 4Y15A 2ZC7A 4Y0OA 2ZQ7A 2GNXA 3Q7ZA 1TDLA 3OZHA 1SKFA 3CITA 4X68A 3FKVA 4BQMA 3TJZC 2ZOIA 3C7UA 5IT5A 2INWA 1V9ZA 4F3LB 1FSWA 2WKRA 4EV4A 3CAXA 3BY9A 3O88A 1OMEA 1IKIA 1TD5A 4WMCD 3V50A 2L0WA 1OTEA 2VKSA 5TGFA 4HBUA 3SW1A 4DF6A 3IF6C 4R3AA 3T4JA 1S1ZA 1W63Q 2HP9A 3VP3A 5FATA 3MQQA 4R3JA 3WS2A 3E4OA 3E4QA 4L9FA 3IQAA 3MKEA 3E98A 1JNUA 1PFLA 4JGPA 3WS5A 3IWOA 4GCZA 3W2ZA 4NXEA 3LICA 3LY3A
chains in the Genus database with same CATH topology
1D06A 3P7NA 2V0UA 4BJPA 1T1CA 2YKHA 5DKLA 2FZ0A 3MF0A 4NXFA 4I38A 2JKTI 3NOPC 3NOTC 3C30A 5J7EA 3A0VA 2VLGA 3GECA 1TS8A 2KLIA 2VV7A 3BWLA 2Z6DA 3O5YA 3MQ0A 2LB5A 3PBSA 4I3AA 4YNRA 4ARZB 3IBRA 1G28A 4WEKA 1MC0A 3RTYA 1OJ5A 4KUKA 5DJUA 2FH5A 3EGXC 3LIAA 4MMNA 2O0YA 4XT2A 1MZUA 2NUPC 4IUHA 4CLCC 4YWZA 2XA7M 3LIBA 4UQIS 4HY8A 3T4LA 4HQAA 1GSXA 4EUVA 2A24A 3LR0A 2Y8HA 3IS2A 2PD8A 1ZTUA 1S4RA 3RH8B 3G6OA 1XFNA 2HF6A 4GJ4A 2O9AA 4PKYA 1F9IA 2W1RA 3NOUC 4DN0A 1NRJA 4HH3A 1P0ZA 1OTBA 2EA9A 3B33A 4ETZA 3B42A 2HGVA 5K5BA 4M4XA 1MKMA 4WLAA 1UWPX 4YOFA 2XRNA 3MR0A 4MN6A 4R38A 3BQ8A 3R7WA 4ZRRA 1T1AA 4JGQA 2K31A 3ZQ5A 3S7PA 4BBTA 2QWSA 3E4PA 3H9WA 1BYWA 2QKPA 5I5LA 2PDRA 3LR5A 3E0YA 3RFBA 2JHEA 3PYPA 3BJNA 1ZHHB 3ICYA 4GS9B 1DP9A 4GHIB 2W3GA 5HPFA 3H7WB 2XA7S 4P6ZM 4H6JB 5J3WA 1NLZA 2VV8A 2VZWA 5LBRA 4DJ3A 3F1NB 1DRMA 1T1BA 2VV6A 3UMEA 2L4RA 5AVEA 3EOIA 3HJKA 4PAUA 3PBTA 4CLCE 1N9NA 1YSQA 3JVUA 4Q0JA 4WELA 2OOLA 2K2NA 3KYZA 2R78A 2V1AA 1S1YA 2V9AA 5F68A 2HJEA 2VX8A 1YSPA 4Q0IA 4CLCB 2PT7A 5HWWA 2VA0A 3PBQA 3TRCA 5TBMA 5HL6A 2OWJA 3C38A 3OCLA 2V0WA 1W63M 4HH2A 3ULFA 1UWNX 4HI4A 3T4SA 4B93A 2W0NA 3KSIA 3LIDA 2W3FA 4IHQA 3PHYA 1KOUA 3LYXA 2YKFA 2P7JA 2Y79A 3F1PB 4G3WA 2VJWA 1IFQA 1T18A 2B02A 4HHDA 2HV1A 5IU1A 2W1TB 3P01A 1X0OA 5F5YA 1G6OA 3MQOA 2NUTC 4HP4A 2EWVA 4EESA 5DKKA 3VV4A 3F1OA 4F3LA 3OLOA 2ZMVA 2H28A 3PR6A 4P6ZS 3K3CA 5AVFA 1D7EA 5DFYA 2M1CA 4UEYA 2JN7A 4WEJA 3LFVA 4I39A 3H7WA 3T4OA 2QJ7A 4KUOA 4EETB 4KQDA 1XJ2A 4H6JA 1VB6A 1GSWA 4KQOA 3D72A 1TS7A 1OT9A 3PBNA 4R6LA 4WUJA 1N9OA 4NXGA 3TW8A 2JKRM 1S4SA 3F1NA 4BBVA 3LIEA 3CUEA 4NKPA 3T4QA 4FSFA 1DP8A 2XSSA 4Q0HA 2QHKA 1UGUA 5F6AA 3H82B 1LSVA 3T50A 2J3WA 3LR3A 2ZMFA 2OWHA 4HJ4A 4G3VA 2W3DA 2QYBA 3FPWA 4L0LA 1TF1A 3K3DA 5MC7A 1NWZA 3ZYTA 1F5MA 1XJ4A 2PR5A 3OCNA 4BBUA 4ME4A 5TJJA 3S7NA 3IBJA 3KSHA 4DJ2A 1ODVA 2J80A 2GJ3A 1LL8A 2K7SA 4XT2B 4WF0A 4ARZA 3GDIA 3U2AA 2HJ9C 4AFIA 2P04A 1TS0A 3A0RA 2QJ5A 4GW9A 1OTDA 4WN5A 3IS2B 4L9GA 4QPRA 2OAP1 4MN5A 4WL9A 3KX0X 4PHTA 1T19A 3LR4A 4HJ3A 3LI9A 2ZBBA 4E04A 3UE6A 3HJIA 4EERA 4EW7A 3C2WA 5J4EA 1EW0A 5IS1A 2OAQ1 2EWWA 4I5SA 1V9YA 4OOLA 1TS6A 3HCYA 3NJAA 5HWTA 3KSGA 4Z1WA 1DP6A 2V1BA 4Y3IA 4BMWA 1P9RA 2PD7A 2PYRA 3LIFA 3VOLA 3R7WB 3DBAA 3MMHA 3EEHA 2XROA 1WA9A 3EQVA 4CLCD 2VGLS 4LRYC 3PBOA 5HPIA 4OOMA 3D3OA 4EEUA 5HWVA 3H82A 3KO6A 3UB9A 4EQ1A 4ETXA 1OT6A 5HD3A 3A0SA 2BASA 4L9EA 1N9LA 5G4ZA 3UE3A 4HP9A 2P08A 3CI6A 5HD5A 3CUEC 3UMDA 3EEAA 4I3IA 5HDSA 2CMNA 2GX5A 2W27A 5CX7A 1LSWA 2WKPA 3OBFA 1H8MA 3VE3A 5L8MA 4EXOA 2O9BA 1OTIA 2LB9A 1OJGA 2A2LA 3BW6A 3T4TA 3JVVA 4O8GA 4HOIA 3FC7A 4GS9A 4GHIA 1NLYA 3VE4A 4Y5FA 1S66L 2KX6A 2VEAA 3CLOA 1Y28A 1YAXA 4LRXC 3KYQA 2W3HA 3NHQA 3R4KA 1OPXA 4HNBA 5A8BA 2J3TD 1LSXA 2L1MA 4LRZE 1OTAA 2GZAA 2IA2A 4PKYG 2D01A 4II7A 1F98A 5DJTA 5KIZA 2MJ6A 2M7UA 3PBRA 5AJGA 5FL3A 5EFWA 3B47A 2D02A 5C5KA 2KDKA 3BQAA 2G7UA 4HIAA 2M7VA 5TBMB 4FOFA 1GSVA 4MDZA 2W3EA 1S67L 3EQUA 3FG8A 4GLQA 2DMWA 2VGLM 4O01A 1LT0A 5G4YA 1XJ6A 4CLCA 2WKQA 4LPZA 4B9OA 3OOVA 3UB8A 5HDDA 3FPVA 3KSFA 1P9WA 4IJGA 1STZA 2PHYA 4NEED 4O0PA 3V67A 2J3TC 2GNXA 3PXPA 3OC2A 2ZOHA 1IOUA 2JKTM 4NXBA 4CQHA 4MCWA 4MN7A 5DF9A 3CITA 3K2NA 4EU0A 4EEPA 2A24B 2B18A 3TJZC 3F1PA 4DMZA 2ZOIA 3MXQA 3LI8A 5F69A 5IT5A 1XFQA 2PYPA 4HJ6A 3TE8A 1XJ3A 1H3QA 2INWA 3C8CA 3F1OB 1V9ZA 3LUQA 4I3JA 4UQIM 4F3LB 5HDCA 2WKRA 2W1TA 4JGRA 2I9VA 3EGDC 4R70A 3CAXA 3CWFA 3BY9A 4K08A 2O9CA 1TD5A 2Z6CA 2L0WA 1OTEA 2VKSA 3BY8A 3SW1A 1YKDA 2JKRI 3MJQA 4Y2FA 4R3AA 3T4JA 1S1ZA 1W63Q 3MFXA 3MQQA 1VHMA 2O99A 3E4OA 3E4QA 2KOIA 4L9FA 3UB7A 5DFXA 3S7OA 5KSHA 4LLOB 1P97A 4G3KA 3E98A 3T4KA 5HSQA 4RQ9A 1JNUA 4IUKA 4JGOA 5HZHA 3EWKA 4JGPA 4GCZA 3W2ZA 3S7QA 4BWIA 4NXEA 3UB6A 2PR6A 3LICA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D06 A;  3P7N A;  2V0U A;  1T1C A;  2YKH A;  5DKL A;  4NXF A;  4I38 A;  3NOP C;  3NOT C;  5J7E A;  3A0V A;  2VLG A;  3GEC A;  1TS8 A;  2VV7 A;  3BWL A;  2Z6D A;  4I3A A;  3IBR A;  1G28 A;  3RTY A;  1OJ5 A;  4KUK A;  5DJU A;  3LIA A;  4XT2 A;  1MZU A;  4YWZ A;  3LIB A;  4HY8 A;  4HQA A;  1GSX A;  2A24 A;  3IS2 A;  2PD8 A;  3RH8 B;  1S4R A;  3G6O A;  1XFN A;  4PKY A;  1F9I A;  3NOU C;  4HH3 A;  1P0Z A;  1OTB A;  2EA9 A;  3B33 A;  4M4X A;  4WLA A;  1UWP X;  3MR0 A;  4MN6 A;  4R38 A;  1T1A A;  4JGQ A;  3ZQ5 A;  4BBT A;  2QWS A;  3E4P A;  3H9W A;  1BYW A;  2QKP A;  5I5L A;  2PDR A;  2JHE A;  3PYP A;  3ICY A;  4GS9 B;  1DP9 A;  4GHI B;  3H7W B;  4H6J B;  5J3W A;  2VV8 A;  4DJ3 A;  3F1N B;  1DRM A;  1T1B A;  2VV6 A;  3UME A;  2L4R A;  5AVE A;  3HJK A;  1N9N A;  2OOL A;  2R78 A;  2V1A A;  1S1Y A;  2V9A A;  5F68 A;  5HWW A;  5TBM A;  2OWJ A;  2V0W A;  4HH2 A;  3ULF A;  1UWN X;  4HI4 A;  2W0N A;  3LID A;  3PHY A;  1KOU A;  3LYX A;  2YKF A;  2P7J A;  3F1P B;  1T18 A;  2B02 A;  4HHD A;  2HV1 A;  5IU1 A;  1X0O A;  5F5Y A;  3MQO A;  4HP4 A;  4EES A;  5DKK A;  3F1O A;  4F3L A;  3OLO A;  2H28 A;  3K3C A;  5AVF A;  1D7E A;  2M1C A;  2JN7 A;  4I39 A;  3H7W A;  2QJ7 A;  4KUO A;  4EET B;  4KQD A;  1XJ2 A;  4H6J A;  1VB6 A;  1GSW A;  1TS7 A;  1OT9 A;  3D72 A;  4R6L A;  4WUJ A;  1N9O A;  4NXG A;  1S4S A;  3F1N A;  4BBV A;  3LIE A;  1DP8 A;  2QHK A;  1UGU A;  5F6A A;  3H82 B;  1LSV A;  3T50 A;  2OWH A;  4HJ4 A;  3K3D A;  1NWZ A;  1XJ4 A;  2PR5 A;  4BBU A;  4DJ2 A;  1ODV A;  2J80 A;  2GJ3 A;  1LL8 A;  2K7S A;  4XT2 B;  4WF0 A;  3GDI A;  1TS0 A;  3A0R A;  2QJ5 A;  4GW9 A;  1OTD A;  4WN5 A;  3IS2 B;  4L9G A;  4MN5 A;  4WL9 A;  3KX0 X;  1T19 A;  4HJ3 A;  3LI9 A;  2ZBB A;  4E04 A;  3UE6 A;  3HJI A;  4EER A;  4EW7 A;  3C2W A;  5J4E A;  1EW0 A;  5IS1 A;  4I5S A;  1V9Y A;  1TS6 A;  3NJA A;  5HWT A;  1DP6 A;  2V1B A;  2PD7 A;  2PYR A;  3LIF A;  3VOL A;  3EEH A;  1WA9 A;  4LRY C;  4EEU A;  5HWV A;  3H82 A;  3UB9 A;  4EQ1 A;  1OT6 A;  5HD3 A;  3A0S A;  2BAS A;  4L9E A;  5G4Z A;  1N9L A;  4HP9 A;  5HD5 A;  3UMD A;  4I3I A;  5HDS A;  2CMN A;  2W27 A;  1LSW A;  2WKP A;  3VE3 A;  4EXO A;  1OTI A;  1OJG A;  4HOI A;  3FC7 A;  4GS9 A;  4GHI A;  3VE4 A;  1S66 L;  2KX6 A;  2VEA A;  3CLO A;  1Y28 A;  4LRX C;  4HNB A;  3NHQ A;  5A8B A;  1LSX A;  2L1M A;  4LRZ E;  1OTA A;  4PKY G;  2D01 A;  1F98 A;  5DJT A;  5KIZ A;  5EFW A;  2D02 A;  2KDK A;  4HIA A;  5TBM B;  1GSV A;  1S67 L;  3FG8 A;  1LT0 A;  5G4Y A;  1XJ6 A;  2WKQ A;  4LPZ A;  4B9O A;  3UB8 A;  5HDD A;  2PHY A;  2ZOH A;  4NXB A;  4EEP A;  2A24 B;  3F1P A;  2ZOI A;  3MXQ A;  3LI8 A;  5F69 A;  1XFQ A;  2PYP A;  4HJ6 A;  1XJ3 A;  2INW A;  3F1O B;  3C8C A;  3LUQ A;  1V9Z A;  4I3J A;  4F3L B;  5HDC A;  2WKR A;  4JGR A;  2I9V A;  4R70 A;  3CAX A;  3CWF A;  3BY9 A;  4K08 A;  2Z6C A;  2L0W A;  1OTE A;  3BY8 A;  3SW1 A;  3MJQ A;  4R3A A;  1S1Z A;  3MFX A;  3MQQ A;  3E4O A;  3E4Q A;  4L9F A;  3UB7 A;  4LLO B;  1P97 A;  5HSQ A;  4RQ9 A;  1JNU A;  4JGO A;  5HZH A;  3EWK A;  4JGP A;  4GCZ A;  4NXE A;  3UB6 A;  2PR6 A;  3LIC A; 
#chains in the Genus database with same CATH topology
 1JWP A;  4BJP A;  2Y4A A;  5DKL A;  4N92 A;  3QP5 A;  3C30 A;  1ACF A;  2EXA A;  5FAS A;  2VV7 A;  3O5Y A;  2WAF A;  3MQ0 A;  3C7V A;  1OJ5 A;  4KUK A;  4MNR A;  5DJU A;  4K91 A;  3IWI A;  2O0Y A;  4MMN A;  1MZU A;  3T12 B;  4IVK A;  4CLC C;  4E6W A;  2P9V A;  3LIB A;  4UQI S;  4HY8 A;  2HDU A;  3DTE A;  5FQI A;  2A24 A;  2Y2O A;  3WS0 A;  2Y8H A;  2X02 A;  3IWQ A;  3IS2 A;  4LCL A;  2JE5 A;  4MBH A;  3UDX A;  4X55 A;  4S2I A;  3G6O A;  4GJ4 A;  5FQ9 A;  4BD1 A;  3G30 A;  4Y13 A;  2P74 A;  2EA9 A;  3DWK A;  3B33 A;  2VK3 A;  3B42 A;  4WLA A;  1CI8 A;  1ERQ A;  4N9L A;  1DJA A;  2Y2N A;  3HBR A;  4QY5 A;  1YMX A;  2WZX A;  3QNC A;  4OQI A;  4JF6 A;  5BOH A;  4JGQ A;  1L0F A;  1BYW A;  5E2G A;  1K55 A;  4GZB A;  5AQ9 A;  2A49 A;  3A3I A;  4KQQ A;  5HPF A;  1YM1 A;  3GMW A;  5CGW A;  2Q9M A;  2VZW A;  5EVI D;  4DJ3 A;  1T1B A;  3M6B A;  5GLA A;  3SOI A;  2L4R A;  4PAU A;  3HUO A;  1GHI A;  1N9N A;  1SKO B;  1GA0 A;  3JVU A;  1ZC2 A;  3KYZ A;  3AGF A;  1QME A;  3VOY A;  2V9A A;  4KZ9 A;  4Q0I A;  4CLC B;  2PT7 A;  3V3S A;  5HL6 A;  3C38 A;  4UA6 A;  3G32 A;  2ZLY A;  4OP8 A;  3LGO A;  5EVI C;  3LEZ A;  2ZQC A;  5E2E A;  3ULF A;  1UWN X;  4KZA A;  5AQ7 A;  3M2K A;  3LYX A;  2Y91 A;  4GDN A;  2P7J A;  2Y79 A;  3QHY A;  4LCM A;  1IFQ A;  2ZC5 B;  5FSR A;  2B02 A;  5E2F A;  1IEL A;  3NDE A;  4OLD A;  2EX9 A;  3IX3 A;  1IEM A;  5GLB A;  3GTC A;  5DKK A;  3VV4 A;  4EQI A;  3VP4 A;  1D7E A;  2M1C A;  2H5S A;  1K6S A;  2QJ7 A;  3LEQ A;  2HP5 A;  2WZZ A;  4KQD A;  1TS7 A;  1OT9 A;  3D72 A;  4WUJ A;  1LLB A;  4RA7 A;  4NXG A;  4E3K A;  2JKR M;  2XR0 A;  4BBV A;  3B3X A;  5GHY A;  3S22 A;  5CGX A;  3HLB A;  3QP2 A;  3T4Q A;  4N1H A;  2QHK A;  3HVF A;  3H82 B;  1LSV A;  2ZMA A;  1PZO A;  5FI2 A;  4B4Z A;  4Q8I A;  4WBG A;  5CRF A;  5A91 A;  4UHU A;  1NWZ A;  2WGI A;  3VP1 A;  2X71 A;  2Y2J A;  4PM6 A;  5EOO A;  4ME4 A;  5EM1 A;  3KSH A;  1NZO A;  3NBL A;  4Z9Q A;  4NG2 A;  4MEZ A;  3O3V A;  3U2A A;  4IVI A;  1WYC A;  2E8J A;  1XX2 A;  3ZHH A;  3A0R A;  4HES A;  3UB5 P;  1OTD A;  2RL3 A;  4WN5 A;  1C3B A;  1KGG A;  3HLC A;  3SH8 A;  4MN5 A;  3UE6 A;  3HJI A;  3C2W A;  1PRQ A;  5J4E A;  3ISG A;  2EWW A;  4JLF A;  4OQG A;  4OOL A;  4Z1W A;  5FEG A;  3VP0 A;  4PPR A;  4KZB A;  4MBK A;  3BFD A;  3LIF A;  5EE8 A;  4BL2 A;  2XRO A;  3EQV A;  2CC1 A;  3LO7 A;  3PAE A;  5HPI A;  4DXB A;  4OOM A;  5HWV A;  1I5Q A;  1RGY A;  4S2L A;  3VFH A;  4L9E A;  1SCW A;  5CER A;  4BEN A;  3W4Q A;  2P08 A;  3UMD A;  3CUE C;  4FCF A;  4I3I A;  2PRF A;  2WGW B;  4S2O A;  5CX7 A;  2Y2L A;  2WKP A;  3OBF A;  1Q2P A;  1OTI A;  2ZC6 B;  5HX9 A;  4N1X A;  4FTX A;  3BW6 A;  2Y2Q A;  4GS9 A;  4GHI A;  4Y5F A;  2KX6 A;  3UE0 A;  1Y28 A;  3GVB A;  1XPB A;  4U0X A;  2J3T D;  4LV3 A;  1YLZ A;  2D01 A;  4II7 A;  5DJT A;  3GSG A;  4R3B A;  5EFW A;  3T1S A;  2D02 A;  2KDK A;  2G7U A;  1XXM A;  3BYD A;  4X1M A;  5KSC A;  4M3K A;  2VGL M;  4R4S A;  5FDS A;  2G2U A;  3IXD A;  2J9O A;  1L0E A;  1S0W A;  1P9W A;  3N7W A;  3AGD A;  1ERO A;  2PHY A;  1XGJ A;  1IYS A;  2J3T C;  3D4F A;  4S2N C;  5FAQ A;  2WUQ A;  5CGS A;  5HAI A;  4NXB A;  4WYY A;  1YMS A;  5DF9 A;  3K2N A;  4EEP A;  3LI8 A;  2PYP A;  1ES4 A;  3VOZ A;  5D3O A;  5GHZ A;  4KG2 A;  2O9C A;  3BY8 A;  3GQZ A;  5CTM A;  1QMF A;  1YKD A;  2JKR I;  3IH9 A;  4Y2F A;  3M6H A;  4X25 A;  4KZ3 A;  1VHM A;  3N8L A;  2V1Z A;  5CEB A;  5GL9 A;  4OQ0 A;  3S7O A;  4DE0 A;  5HL1 A;  3QP8 A;  4G3K A;  1SHV A;  5HSQ A;  5HZH A;  1O07 A;  1GCE A;  5HAP A;  2A3U A;  4BWI A;  1MWT A;  1CEG A;  3P7N A;  4KG5 A;  3UDF A;  4JPM A;  4PM5 A;  3DW0 A;  2JKT I;  5F1G A;  3NOT C;  5CTN A;  3DTI A;  3PBS A;  2LB5 A;  1MKI A;  3HUN A;  1PWD A;  3QNB A;  1G28 A;  4WEK A;  1K54 C;  1MC0 A;  4DXC A;  2WGV A;  4FH4 A;  4IUH A;  4XXR A;  4DDS A;  2XA7 M;  4GNU A;  4HQA A;  1GHM A;  4EUV A;  1VEU B;  1BTL A;  3A3D A;  5DF8 A;  5EM0 A;  2UV0 E;  3NC8 A;  1ZTU A;  4JKT A;  3BRM A;  1J9M A;  2HF6 A;  3IT9 A;  3CHW P;  1P0Z A;  4B88 A;  4Y0U A;  1U60 A;  3OPP A;  4M4X A;  4LEN A;  1H5X A;  3RJU A;  5DF7 A;  1UWP X;  4YOF A;  2PU2 A;  2XRN A;  1BUE A;  3MR0 A;  1KGE A;  5GLC A;  4ZJ2 A;  5HAQ A;  2Y2G A;  4X6T A;  4UA9 A;  1T1A A;  3ZQ5 A;  4BBT A;  1KDS A;  1ERM A;  3SS3 A;  2QKP A;  4GOG A;  5GLD A;  4JXW A;  2EX8 A;  3RFB A;  4ZBE A;  3PYP A;  3ICY A;  1ZHH B;  5EOE A;  4YFM A;  2W3G A;  4H6J B;  1NJ4 A;  1NLZ A;  3DAV A;  1N9B A;  3V5M A;  1FQG A;  2GDN A;  4K0W A;  3F1N B;  2BG1 A;  1WE4 A;  3ZCZ A;  3EOI A;  3PBT A;  4CLC E;  3N8S A;  2Y2I A;  4QJG A;  1O7E A;  1CF0 A;  2OOL A;  2K2N A;  2V1A A;  1L3L A;  5F68 A;  3CPT B;  4JXV A;  4E3L A;  2PAV P;  2VA0 A;  3PBQ A;  4KZ6 A;  3P09 A;  1JWV A;  1Z09 A;  1G5U A;  3ZNT A;  1W63 M;  4HH2 A;  4QU3 A;  3RXW A;  2JKG A;  3T4S A;  2ZM0 A;  4WZ5 A;  3BFE A;  1KGF A;  3MXS A;  5M18 A;  3N4I A;  5IU1 A;  5FQK A;  2NUT C;  4HP4 A;  1E4D A;  1HTZ A;  3IH8 A;  2ZL1 A;  4EES A;  3IHA A;  3RXX A;  3F1O A;  1KDW A;  3OLO A;  5DTT A;  1JWZ A;  4P6Z S;  5DFY A;  1LI9 A;  4UEY A;  3T1R A;  3LFV A;  3T4O A;  5FDH A;  1ES2 A;  1VB6 A;  1GSW A;  5L09 A;  2R9X A;  2BTF P;  3TW8 A;  1K55 C;  5M1A A;  1S4S A;  3L7H A;  4FSF A;  1XP4 A;  1SKO A;  5CHJ A;  1BUL A;  5FQM A;  1VM1 A;  5EEC A;  5G18 A;  3T50 A;  2XQZ A;  2ZMF A;  3IF6 B;  2OWH A;  1DY6 A;  4G3V A;  2W3D A;  2ACG A;  2HZ5 A;  1W5D A;  3DTM A;  3ZYT A;  4DE3 A;  3NY4 A;  1W7F A;  4S2M A;  4DJ2 A;  1MY8 A;  2J80 A;  2JKF A;  2OLV A;  4JF5 A;  4ARZ A;  2V20 A;  2P9V B;  2HJ9 C;  1ONG A;  4KZ5 A;  2J9P A;  1FCN A;  3ZDJ A;  1PW8 A;  3IS2 B;  1KE3 A;  2OAP 1;  4PHT A;  1CJF A;  4C6Y A;  2ZBB A;  2IWB A;  1MWR A;  4EER A;  4EW7 A;  2XLN A;  2OAQ 1;  2XF3 A;  5FI7 A;  4I5S A;  1AXB A;  1TS6 A;  3HCY A;  3NJA A;  1J3W A;  1MWS A;  4Y3I A;  4HEF A;  3VFF A;  4P85 A;  2QZ6 A;  1EWZ A;  1BLC A;  2XD1 A;  3L9K A;  1GA9 A;  2ZQ9 A;  1HVB A;  5FA7 A;  3MFD A;  2ZQA A;  3VOL A;  3TOI A;  1SDE A;  4ZDX A;  3DBA A;  3EEH A;  2VGL S;  3BFG A;  3PBO A;  4LRY C;  1EI5 A;  4H8R A;  3H82 A;  3HLG A;  3KO6 A;  4EQ1 A;  5HD3 A;  1YPR A;  2ZC3 B;  3UE3 A;  4HP9 A;  1IYQ A;  2Y59 A;  3CI6 A;  1M40 A;  3EEA A;  4OPR A;  1E3U A;  3SS5 A;  2A2L A;  3FV7 A;  3T4T A;  4HOI A;  3I7J A;  1YLY A;  3CLO A;  3O86 A;  4LRX C;  3KYQ A;  2W3H A;  5A8B A;  4BLM A;  4LRZ E;  2IA2 A;  1H0M A;  3HLE A;  4PKY G;  1F98 A;  5FL3 A;  3MZD A;  5C5K A;  5JYP A;  5FAP A;  3V39 A;  4HIA A;  4B4X A;  2M7V A;  2Y2K A;  4MDZ A;  1FIK A;  3S4X A;  3EQU A;  3FG8 A;  4GLQ A;  4S2K A;  3HL9 A;  1ONH A;  3BM6 A;  1XJ6 A;  2WKQ A;  3FKW A;  4LPZ A;  5HDD A;  3KSF A;  3FPV A;  2EX2 A;  4HBT A;  4IJG A;  1STZ A;  3IXB A;  5F1F A;  4GN2 A;  4NEE D;  4N9K A;  3PXP A;  3P98 A;  4PM9 A;  2JKT M;  3MZF A;  1N4O A;  2G2W A;  4CQH A;  4EWF A;  4OPQ A;  3O87 A;  2VGK A;  3Q7V B;  4MN7 A;  4PMA A;  3ZVT A;  4D2O A;  2C5W B;  3MKF A;  2X01 A;  3C4P A;  1FOF A;  2B18 A;  4DMZ A;  3F1P A;  3UN7 A;  4HJ6 A;  4LV1 A;  1K6R A;  3LUQ A;  4UQI M;  4I3J A;  4LV0 A;  2ZD8 A;  3U4L P;  2W1T A;  4JGR A;  5EVI B;  3CWF A;  4K08 A;  5HFO A;  4JXG A;  1PW1 A;  2Z6C A;  3GV9 A;  1K0K A;  3G2Y A;  1LL5 A;  4MLL A;  3MJQ A;  4FUW A;  2DCF A;  3NIA A;  3MFX A;  4C75 A;  3T1Q B;  2V8C A;  2KOI A;  3UB7 A;  2I72 A;  5CEC A;  5J8X A;  4LLO B;  1CK3 A;  1D1J A;  3BFC A;  4P0M A;  4IUK A;  4F94 A;  3EWK A;  3MZE A;  3JPU A;  3S7Q A;  1L2S A;  1ESI A;  1I2S A;  2YKH A;  1K4F A;  2PU4 A;  1L0D A;  3MF0 A;  4NXF A;  4R0Q A;  3NOP C;  3OPR A;  4IBX A;  3A0V A;  2WKH A;  4QB8 A;  3S1Y A;  1TS8 A;  1ZKJ A;  2KLI A;  3BWL A;  5CHM A;  3NCK A;  2HPB A;  4I3A A;  4YNR A;  4KG6 A;  1BT5 A;  4O7D A;  4BL3 A;  3DTK A;  2FH5 A;  3W4O A;  3Q81 A;  4XT2 A;  1TEM A;  4KQR A;  5EVE A;  4YWZ A;  3FYZ A;  2XFT A;  3HLD A;  3T4L A;  3QP1 A;  1GSX A;  4XUX A;  3HUM A;  1HZO A;  1BLP A;  4PKY A;  3BEB A;  1W8Y A;  4HH3 A;  3NI9 A;  1YLJ A;  4ETZ A;  1F2K A;  3N8R A;  3WS4 A;  4P6B A;  2AVX A;  2HGV A;  5K5B A;  1MKM A;  2ZC4 B;  3A3F A;  4LV2 A;  2JBF A;  2WKI A;  4ESP A;  4MN6 A;  1PWC A;  4GD8 A;  4R38 A;  3R7W A;  4DDY A;  4ZRR A;  1XA1 A;  2K31 A;  3S7P A;  2QWS A;  3E4P A;  3H9W A;  1PNE A;  3LCE A;  4E6X A;  2OV5 A;  3LR5 A;  3W8K A;  2Y2P A;  3E0Y A;  1NXY A;  1JTD A;  4GS9 B;  1DP9 A;  4GHI B;  1YLW A;  3H7W B;  5A92 A;  2VV8 A;  1VET A;  1NRF A;  2VV6 A;  3UME A;  1FCO A;  2XEP A;  3W4P A;  3HJK A;  1PZP A;  1YSQ A;  3E2K A;  2R78 A;  2J8Y A;  1S1Y A;  2HJE A;  2VX8 A;  1YSP A;  4GKU A;  1S6R A;  5TBM A;  5KMW A;  2XDM A;  5AQB A;  2OWJ A;  1SDN A;  3UY6 A;  3MS6 A;  2V0W A;  4HI4 A;  4B93 A;  1TVF A;  2W0N A;  3LID A;  3IHB A;  2Y55 A;  4IHQ A;  5DVA A;  3PHY A;  4KZ4 A;  2YKF A;  4G3W A;  5FAO A;  1MBL A;  2V2F F;  1PI5 A;  4HHD A;  2HV1 A;  2H10 A;  3P01 A;  4ID4 A;  1X0O A;  2Q0O A;  3IX4 A;  4EBP A;  1G6O A;  3MQO A;  5CXW A;  2EWV A;  4A5R A;  4Y0T A;  4F3L A;  3BFF A;  3KYE A;  1Y54 A;  2ZMV A;  3ZG9 B;  3K3C A;  5AVF A;  2PBD P;  3G2Z A;  4WEJ A;  3MBZ A;  4KUO A;  4EET B;  1XJ2 A;  4H6J A;  4KQO A;  4C3Q A;  1FR6 A;  3M2J A;  1PI4 A;  4RX3 A;  3F1N A;  3LIE A;  5I94 A;  1GHP A;  4OLG A;  3CMZ A;  4S2P A;  1BLS A;  2XSS A;  4Q0H A;  5CHU A;  4QY6 A;  3MXR A;  3PAG A;  2IWD A;  4BD0 A;  2J3W A;  1BZA A;  1RP5 A;  3NDG A;  2EX6 A;  3FPW A;  3CPT A;  3K3D A;  4WZ4 A;  1F5M A;  4BBU A;  3IBJ A;  1HLU P;  4U3T A;  1MPL A;  1PYY A;  2K7S A;  3ZVW A;  1JTG A;  2Y2H A;  3LY4 A;  3GDI A;  3OPH A;  4AFI A;  2P04 A;  2QJ5 A;  4GW9 A;  5F83 A;  1FCM A;  4L9G A;  4QPR A;  4JF4 A;  3ZNY A;  4WZ5 C;  3LR4 A;  3NUL A;  3A3E A;  4HJ3 A;  1WYB A;  1L0G A;  4JBF A;  1K57 C;  2B5R A;  1EW0 A;  5IS1 A;  1W79 A;  5HWT A;  4YIN A;  1DP6 A;  2V1B A;  4KZ8 A;  2OSU A;  4R23 A;  1K56 D;  5F82 A;  1P9R A;  5KZH A;  2PD7 A;  4IBR A;  2PYR A;  3MMH A;  4CLC D;  4UA7 A;  2FFY A;  1FIL A;  3GR2 A;  1G6A A;  3D3O A;  1DJC A;  3CJM A;  4EEU A;  3UB9 A;  1K57 A;  1OT6 A;  2QMI A;  3A0S A;  2BAS A;  5G4Z A;  3IF6 A;  5HDS A;  5M19 A;  1KVL A;  2W27 A;  1IYP A;  2XH9 A;  1LSW A;  4X53 A;  3VE3 A;  5L8M A;  2O9B A;  4X69 A;  3UE1 A;  4O8G A;  1FSY A;  4OPY A;  3FC7 A;  1KVM A;  4ZAM A;  3UPO A;  2EFU A;  4WMC A;  1YAX A;  4ZJ3 A;  3BEC A;  1OPX A;  1LSX A;  2L1M A;  4DRT A;  2GZA A;  4IED A;  2PBY A;  4P87 A;  5GHX A;  2ZQ8 A;  3BQA A;  3SH9 A;  1K56 A;  1GSV A;  2IWC A;  3ZG0 A;  4OKP A;  5FQJ A;  3TG9 A;  1S67 L;  4X56 A;  4R4R A;  1LI0 A;  4CLC A;  5L10 A;  4B9O A;  3OOV A;  3UB8 A;  4O0P A;  3V67 A;  1ALQ A;  3OC2 A;  2ZOH A;  1IOU A;  4NK3 A;  1H8Y A;  4MCW A;  2XFS A;  3FWL A;  2FFF B;  5FQQ A;  4EU0 A;  2A24 B;  2ZL1 B;  2Q9N A;  3MXQ A;  5F69 A;  1E3U D;  1XFQ A;  3UPP A;  2V8F A;  3TE8 A;  1XJ3 A;  1H3Q A;  3F1O B;  3C8C A;  1MWU A;  5HDC A;  3Q82 A;  2I9V A;  3EGD C;  4R70 A;  2BLS A;  5AQA A;  4EBL A;  2HDQ A;  3ITA A;  4KZ7 A;  1BSG A;  4GDB A;  2ZQD A;  4RYE A;  4MBF A;  2O99 A;  2B95 A;  3PTE A;  5DFX A;  3E2L A;  5KSH A;  4ZJ1 A;  1P97 A;  3T4K A;  4RQ9 A;  4JGO A;  4RX2 A;  3UB6 A;  2PR6 A;  3ZG7 B;  1D06 A;  1K38 A;  2XK1 A;  3G31 A;  1NZU A;  3IF5 A;  2V0U A;  1BLH A;  1T1C A;  5CED A;  3HRE A;  4OQH A;  3WRT A;  5DTS A;  2FZ0 A;  4I38 A;  4OVD A;  5J7E A;  2VLG A;  3GEC A;  3VP2 A;  2Z6D A;  4ARZ B;  2JCH A;  3IBR A;  2WAD A;  3RTY A;  5EV0 A;  4JXS A;  2RCX A;  3EGX C;  4E3I A;  2H0T A;  3LIA A;  3D9Y A;  2R9W A;  1ES3 A;  2NUP C;  5HW3 A;  3G35 A;  2WAE A;  3Q7V A;  5E2H A;  1YLP A;  3MSH A;  3LR0 A;  5L2F A;  4RVA A;  2PD8 A;  1ES5 A;  5EVI A;  3RH8 B;  1S4R A;  4PM8 A;  1XFN A;  2O9A A;  1F9I A;  1IKG A;  2W1R A;  3NOU C;  4S2J A;  4DN0 A;  1NRJ A;  1NY0 A;  1OTB A;  4Y7P A;  1KE4 A;  3SH7 A;  4OP5 A;  4GD6 A;  4NET A;  1XKZ A;  1FR1 A;  4E3M A;  1G68 A;  3UO9 A;  4CPK A;  4U0T A;  3BLS A;  4QD4 A;  3BQ8 A;  3ZG5 A;  3IX8 A;  1YQS A;  3WS1 A;  3Q1F A;  2Z2M B;  1ESU A;  3QP6 A;  5I5L A;  2PDR A;  4E3J A;  2HP6 A;  5FI6 A;  2WYX A;  2Y2M A;  3Q07 A;  3ZGA B;  4EBN A;  2H0Y A;  2JHE A;  3BJN A;  2WGW A;  4R1G A;  2EFX A;  2ZM8 A;  2XA7 S;  1E25 A;  4P6Z M;  3V3R A;  1PIO A;  5J3W A;  5DTK A;  3VSK A;  1KE0 A;  1RGZ A;  5LBR A;  1TDG A;  5FEF A;  1DRM A;  5EPH A;  5AVE A;  4Q0J A;  2DRW A;  1LL9 A;  3SS4 A;  1AWI A;  1JVJ A;  4WEL A;  3WRZ A;  2WKE A;  5EUA A;  4KEN B;  2C6W B;  4OPZ A;  4CJN A;  5HWW A;  3TRC A;  1W8Q A;  3OCL A;  3OPL A;  1CQA A;  1A0K A;  2EXB A;  3KSI A;  5EVL A;  2W3F A;  5L07 A;  1H8Z A;  2XGN A;  1KOU A;  3F1P B;  2VJW A;  1T18 A;  2UWX A;  1XGI A;  4EUZ A;  2W1T B;  5F5Y A;  4FH2 A;  5JYO A;  1LHY A;  3SZT A;  2J7V A;  1YLT A;  2H28 A;  4OOY A;  3PR6 A;  5HAR A;  4LFU A;  3N6I A;  2JN7 A;  4DKI A;  4I39 A;  3H7W A;  4E3O A;  5IHV A;  3PBN A;  4R6L A;  1N9O A;  1IYO A;  3NEC A;  2OLU A;  4LGW A;  3CUE A;  4NKP A;  3GRJ A;  1DP8 A;  1XA7 A;  1UGU A;  5F6A A;  3A3J A;  1RCJ A;  3CG5 A;  3LR3 A;  2HDS A;  4HJ4 A;  2JC7 A;  2QYB A;  1K4E A;  3VMA A;  3UDI A;  5U47 A;  4L0L A;  1TF1 A;  5MC7 A;  3CZD A;  1XJ4 A;  3OCN A;  2PR5 A;  4WM9 A;  3BLM A;  5TJJ A;  3S7N A;  3FZC A;  4X1L A;  1ODV A;  2GJ3 A;  1LL8 A;  5A90 A;  4XT2 B;  1M6K A;  1NYM A;  4WF0 A;  3G4P A;  3ZFZ A;  2QPN A;  1SZV A;  1TS0 A;  5TFQ A;  4OON A;  3IXG A;  4QHC A;  4WL9 A;  3KX0 X;  1T19 A;  4UAA A;  1PWG A;  3UNW A;  3LI9 A;  1VEU A;  4E04 A;  5A93 A;  3ZG8 B;  3T1X A;  3G34 A;  4S2N A;  3C5A A;  1V9Y A;  1MXO A;  3KSG A;  4XUZ A;  2VGJ A;  3WWX A;  4BMW A;  2ZJ9 A;  2ZM2 A;  1ZG6 A;  3IXH A;  3R7W B;  3QP4 A;  3VSL A;  1I2W A;  1WA9 A;  4DE1 A;  3JYI A;  3AGE A;  2HDR A;  2Z2L B;  1VQQ A;  5TR7 A;  4GB7 A;  4ETX A;  5E43 A;  2XD5 A;  3HLW A;  1N9L A;  1Q2Q A;  1K25 A;  5HD5 A;  2CMN A;  4ZTK A;  4PM7 A;  2GX5 A;  1H8M A;  2WK0 A;  4EXO A;  2LB9 A;  1DJB A;  4E3N A;  1OJG A;  1NYY A;  3HLF A;  4OH0 A;  3JVV A;  1VET B;  3VE4 A;  1NLY A;  1CI9 A;  1S66 L;  1ZG4 A;  2VEA A;  4FD8 A;  4D60 A;  1CEF A;  3ITB A;  2E8I A;  3NHQ A;  3R4K A;  4HNB A;  1Y4O A;  2DNS A;  1OTA A;  4K0X A;  5KIZ A;  2MJ6 A;  2M7U A;  3PBR A;  5AJG A;  3DWZ A;  4DE2 A;  3B47 A;  4QWO A;  4Y17 A;  5TBM B;  4FOF A;  1YT4 A;  2W3E A;  1K54 A;  1Z6F A;  3UPN A;  3TSG A;  2DMW A;  3C4O A;  4O01 A;  1LT0 A;  5G4Y A;  1HD8 A;  4Y15 A;  2ZC7 A;  4Y0O A;  2ZQ7 A;  2GNX A;  3Q7Z A;  1TDL A;  3OZH A;  1SKF A;  3CIT A;  4X68 A;  3FKV A;  4BQM A;  3TJZ C;  2ZOI A;  3C7U A;  5IT5 A;  2INW A;  1V9Z A;  4F3L B;  1FSW A;  2WKR A;  4EV4 A;  3CAX A;  3BY9 A;  3O88 A;  1OME A;  1IKI A;  1TD5 A;  4WMC D;  3V50 A;  2L0W A;  1OTE A;  2VKS A;  5TGF A;  4HBU A;  3SW1 A;  4DF6 A;  3IF6 C;  4R3A A;  3T4J A;  1S1Z A;  1W63 Q;  2HP9 A;  3VP3 A;  5FAT A;  3MQQ A;  4R3J A;  3WS2 A;  3E4O A;  3E4Q A;  4L9F A;  3IQA A;  3MKE A;  3E98 A;  1JNU A;  1PFL A;  4JGP A;  3WS5 A;  3IWO A;  4GCZ A;  3W2Z A;  4NXE A;  3LIC A;  3LY3 A; 
#chains in the Genus database with same CATH homology
 1D06 A;  3P7N A;  2V0U A;  4BJP A;  1T1C A;  2YKH A;  5DKL A;  2FZ0 A;  3MF0 A;  4NXF A;  4I38 A;  2JKT I;  3NOP C;  3NOT C;  3C30 A;  5J7E A;  3A0V A;  2VLG A;  3GEC A;  1TS8 A;  2KLI A;  2VV7 A;  3BWL A;  2Z6D A;  3O5Y A;  3MQ0 A;  2LB5 A;  3PBS A;  4I3A A;  4YNR A;  4ARZ B;  3IBR A;  1G28 A;  4WEK A;  1MC0 A;  3RTY A;  1OJ5 A;  4KUK A;  5DJU A;  2FH5 A;  3EGX C;  3LIA A;  4MMN A;  2O0Y A;  4XT2 A;  1MZU A;  2NUP C;  4IUH A;  4CLC C;  4YWZ A;  2XA7 M;  3LIB A;  4UQI S;  4HY8 A;  3T4L A;  4HQA A;  1GSX A;  4EUV A;  2A24 A;  3LR0 A;  2Y8H A;  3IS2 A;  2PD8 A;  1ZTU A;  1S4R A;  3RH8 B;  3G6O A;  1XFN A;  2HF6 A;  4GJ4 A;  2O9A A;  4PKY A;  1F9I A;  2W1R A;  3NOU C;  4DN0 A;  1NRJ A;  4HH3 A;  1P0Z A;  1OTB A;  2EA9 A;  3B33 A;  4ETZ A;  3B42 A;  2HGV A;  5K5B A;  4M4X A;  1MKM A;  4WLA A;  1UWP X;  4YOF A;  2XRN A;  3MR0 A;  4MN6 A;  4R38 A;  3BQ8 A;  3R7W A;  4ZRR A;  1T1A A;  4JGQ A;  2K31 A;  3ZQ5 A;  3S7P A;  4BBT A;  2QWS A;  3E4P A;  3H9W A;  1BYW A;  2QKP A;  5I5L A;  2PDR A;  3LR5 A;  3E0Y A;  3RFB A;  2JHE A;  3PYP A;  3BJN A;  1ZHH B;  3ICY A;  4GS9 B;  1DP9 A;  4GHI B;  2W3G A;  5HPF A;  3H7W B;  2XA7 S;  4P6Z M;  4H6J B;  5J3W A;  1NLZ A;  2VV8 A;  2VZW A;  5LBR A;  4DJ3 A;  3F1N B;  1DRM A;  1T1B A;  2VV6 A;  3UME A;  2L4R A;  5AVE A;  3EOI A;  3HJK A;  4PAU A;  3PBT A;  4CLC E;  1N9N A;  1YSQ A;  3JVU A;  4Q0J A;  4WEL A;  2OOL A;  2K2N A;  3KYZ A;  2R78 A;  2V1A A;  1S1Y A;  2V9A A;  5F68 A;  2HJE A;  2VX8 A;  1YSP A;  4Q0I A;  4CLC B;  2PT7 A;  5HWW A;  2VA0 A;  3PBQ A;  3TRC A;  5TBM A;  5HL6 A;  2OWJ A;  3C38 A;  3OCL A;  2V0W A;  1W63 M;  4HH2 A;  3ULF A;  1UWN X;  4HI4 A;  3T4S A;  4B93 A;  2W0N A;  3KSI A;  3LID A;  2W3F A;  4IHQ A;  3PHY A;  1KOU A;  3LYX A;  2YKF A;  2P7J A;  2Y79 A;  3F1P B;  4G3W A;  2VJW A;  1IFQ A;  1T18 A;  2B02 A;  4HHD A;  2HV1 A;  5IU1 A;  2W1T B;  3P01 A;  1X0O A;  5F5Y A;  1G6O A;  3MQO A;  2NUT C;  4HP4 A;  2EWV A;  4EES A;  5DKK A;  3VV4 A;  3F1O A;  4F3L A;  3OLO A;  2ZMV A;  2H28 A;  3PR6 A;  4P6Z S;  3K3C A;  5AVF A;  1D7E A;  5DFY A;  2M1C A;  4UEY A;  2JN7 A;  4WEJ A;  3LFV A;  4I39 A;  3H7W A;  3T4O A;  2QJ7 A;  4KUO A;  4EET B;  4KQD A;  1XJ2 A;  4H6J A;  1VB6 A;  1GSW A;  4KQO A;  3D72 A;  1TS7 A;  1OT9 A;  3PBN A;  4R6L A;  4WUJ A;  1N9O A;  4NXG A;  3TW8 A;  2JKR M;  1S4S A;  3F1N A;  4BBV A;  3LIE A;  3CUE A;  4NKP A;  3T4Q A;  4FSF A;  1DP8 A;  2XSS A;  4Q0H A;  2QHK A;  1UGU A;  5F6A A;  3H82 B;  1LSV A;  3T50 A;  2J3W A;  3LR3 A;  2ZMF A;  2OWH A;  4HJ4 A;  4G3V A;  2W3D A;  2QYB A;  3FPW A;  4L0L A;  1TF1 A;  3K3D A;  5MC7 A;  1NWZ A;  3ZYT A;  1F5M A;  1XJ4 A;  2PR5 A;  3OCN A;  4BBU A;  4ME4 A;  5TJJ A;  3S7N A;  3IBJ A;  3KSH A;  4DJ2 A;  1ODV A;  2J80 A;  2GJ3 A;  1LL8 A;  2K7S A;  4XT2 B;  4WF0 A;  4ARZ A;  3GDI A;  3U2A A;  2HJ9 C;  4AFI A;  2P04 A;  1TS0 A;  3A0R A;  2QJ5 A;  4GW9 A;  1OTD A;  4WN5 A;  3IS2 B;  4L9G A;  4QPR A;  2OAP 1;  4MN5 A;  4WL9 A;  3KX0 X;  4PHT A;  1T19 A;  3LR4 A;  4HJ3 A;  3LI9 A;  2ZBB A;  4E04 A;  3UE6 A;  3HJI A;  4EER A;  4EW7 A;  3C2W A;  5J4E A;  1EW0 A;  5IS1 A;  2OAQ 1;  2EWW A;  4I5S A;  1V9Y A;  4OOL A;  1TS6 A;  3HCY A;  3NJA A;  5HWT A;  3KSG A;  4Z1W A;  1DP6 A;  2V1B A;  4Y3I A;  4BMW A;  1P9R A;  2PD7 A;  2PYR A;  3LIF A;  3VOL A;  3R7W B;  3DBA A;  3MMH A;  3EEH A;  2XRO A;  1WA9 A;  3EQV A;  4CLC D;  2VGL S;  4LRY C;  3PBO A;  5HPI A;  4OOM A;  3D3O A;  4EEU A;  5HWV A;  3H82 A;  3KO6 A;  3UB9 A;  4EQ1 A;  4ETX A;  1OT6 A;  5HD3 A;  3A0S A;  2BAS A;  4L9E A;  1N9L A;  5G4Z A;  3UE3 A;  4HP9 A;  2P08 A;  3CI6 A;  5HD5 A;  3CUE C;  3UMD A;  3EEA A;  4I3I A;  5HDS A;  2CMN A;  2GX5 A;  2W27 A;  5CX7 A;  1LSW A;  2WKP A;  3OBF A;  1H8M A;  3VE3 A;  5L8M A;  4EXO A;  2O9B A;  1OTI A;  2LB9 A;  1OJG A;  2A2L A;  3BW6 A;  3T4T A;  3JVV A;  4O8G A;  4HOI A;  3FC7 A;  4GS9 A;  4GHI A;  1NLY A;  3VE4 A;  4Y5F A;  1S66 L;  2KX6 A;  2VEA A;  3CLO A;  1Y28 A;  1YAX A;  4LRX C;  3KYQ A;  2W3H A;  3NHQ A;  3R4K A;  1OPX A;  4HNB A;  5A8B A;  2J3T D;  1LSX A;  2L1M A;  4LRZ E;  1OTA A;  2GZA A;  2IA2 A;  4PKY G;  2D01 A;  4II7 A;  1F98 A;  5DJT A;  5KIZ A;  2MJ6 A;  2M7U A;  3PBR A;  5AJG A;  5FL3 A;  5EFW A;  3B47 A;  2D02 A;  5C5K A;  2KDK A;  3BQA A;  2G7U A;  4HIA A;  2M7V A;  5TBM B;  4FOF A;  1GSV A;  4MDZ A;  2W3E A;  1S67 L;  3EQU A;  3FG8 A;  4GLQ A;  2DMW A;  2VGL M;  4O01 A;  1LT0 A;  5G4Y A;  1XJ6 A;  4CLC A;  2WKQ A;  4LPZ A;  4B9O A;  3OOV A;  3UB8 A;  5HDD A;  3FPV A;  3KSF A;  1P9W A;  4IJG A;  1STZ A;  2PHY A;  4NEE D;  4O0P A;  3V67 A;  2J3T C;  2GNX A;  3PXP A;  3OC2 A;  2ZOH A;  1IOU A;  2JKT M;  4NXB A;  4CQH A;  4MCW A;  4MN7 A;  5DF9 A;  3CIT A;  3K2N A;  4EU0 A;  4EEP A;  2A24 B;  2B18 A;  3TJZ C;  3F1P A;  4DMZ A;  2ZOI A;  3MXQ A;  3LI8 A;  5F69 A;  5IT5 A;  1XFQ A;  2PYP A;  4HJ6 A;  3TE8 A;  1XJ3 A;  1H3Q A;  2INW A;  3C8C A;  3F1O B;  1V9Z A;  3LUQ A;  4I3J A;  4UQI M;  4F3L B;  5HDC A;  2WKR A;  2W1T A;  4JGR A;  2I9V A;  3EGD C;  4R70 A;  3CAX A;  3CWF A;  3BY9 A;  4K08 A;  2O9C A;  1TD5 A;  2Z6C A;  2L0W A;  1OTE A;  2VKS A;  3BY8 A;  3SW1 A;  1YKD A;  2JKR I;  3MJQ A;  4Y2F A;  4R3A A;  3T4J A;  1S1Z A;  1W63 Q;  3MFX A;  3MQQ A;  1VHM A;  2O99 A;  3E4O A;  3E4Q A;  2KOI A;  4L9F A;  3UB7 A;  5DFX A;  3S7O A;  5KSH A;  4LLO B;  1P97 A;  4G3K A;  3E98 A;  3T4K A;  5HSQ A;  4RQ9 A;  1JNU A;  4IUK A;  4JGO A;  5HZH A;  3EWK A;  4JGP A;  4GCZ A;  3W2Z A;  3S7Q A;  4BWI A;  4NXE A;  3UB6 A;  2PR6 A;  3LIC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...