4HQAA

Crystal structure of pas domain from the human erg (herg) potassium channel
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
110
structure length
110
Chain Sequence
SRKFIIANARVENCAVIYCNDGFCELCGYSRAEVMQRPCTCDFLHGPRTQRRAAAQIAQALLGAEERKVEIAFYRKDGSCFLCLVDVVPVKNEDGAVIMFILNFEVVMEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium voltage-gated channel subfamily H member 2
publication title Structural properties of PAS domains from the KCNH potassium channels
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 31
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2012-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4hqaA00
3F1PA 3NOPC 1T1AA 2KDKA 3MQOA 3MFXA 3VE4A 2V0UA 4E04A 2A24A 2PD8A 3FG8A 4LLOB 5J4EA 4WL9A 4HI4A 2M1CA 3PYPA 2L4RA 4EETB 1T1CA 2OWJA 1P0ZA 5HD5A 4HY8A 1XJ4A 4B9OA 1T18A 4NXBA 5EFWA 3IBRA 1OJ5A 4LPZA 3MQQA 1F9IA 5A8BA 2INWA 4I3AA 4HJ4A 2ZOIA 1TS7A 2PYPA 5HD3A 4DJ2A 4GHIA 3FC7A 4GS9B 4L9EA 4LRZE 3CWFA 3F1OB 3E4OA 1UWPX 2VLGA 5DJTA 2HV1A 3UMDA 2WKPA 3GDIA 1OT9A 4EQ1A 5HDDA 1XJ3A 2QKPA 4KUKA 2V0WA 1T19A 5TBMA 2VV6A 5F5YA 2R78A 4H6JB 3RH8B 1DP9A 5HWWA 4HQAA 1N9OA 1OTAA 3MR0A 4R3AA 3BY9A 3D72A 2Z6DA 3NJAA 2W0NA 2V9AA 1G28A 1S67L 5AVFA 3UE6A 1OTDA 4EERA 4HHDA 3LIEA 4M4XA 4F3LB 3LIFA 5HWVA 4I3JA 3H7WB 4L9FA 3A0SA 5IS1A 2VV8A 1V9YA 1GSWA 3H82B 1T1BA 2PR6A 2PR5A 4RQ9A 1TS6A 1VB6A 2JN7A 2EA9A 4HH3A 2ZBBA 1S4SA 4I5SA 4JGRA 3A0RA 4HP9A 3NHQA 5IU1A 1N9LA 3BWLA 2YKFA 5F68A 3ULFA 2PHYA 3LYXA 3MJQA 4WN5A 1JNUA 5DKKA 2VV7A 3F1PB 4BBUA 4HOIA 4HJ3A 3H9WA 2PD7A 4BBTA 3LIDA 3NOTC 1DRMA 1LSXA 3UB8A 4EESA 2A24B 4R6LA 4BBVA 4EW7A 1WA9A 1S66L 3OLOA 3K3DA 5HSQA 3LIAA 3PHYA 4NXGA 5HWTA 5I5LA 3HJKA 3T50A 4I38A 3IS2B 4YWZA 3B33A 4JGOA 1Y28A 1TS0A 3UB7A 5G4ZA 4PKYA 2D02A 3F1NA 1UWNX 4KQDA 3ICYA 2QJ7A 1OT6A 4GW9A 3UB6A 3C8CA 2W27A 3A0VA 4GHIB 3C2WA 4HP4A 3K3CA 1LSVA 2CMNA 4JGPA 3LICA 5G4YA 3EEHA 4EEPA 4XT2B 1LSWA 2KX6A 3RTYA 3H82A 2JHEA 3E4PA 1LT0A 1ODVA 1GSXA 4HH2A 1XJ2A 5TBMB 1S1ZA 3KX0X 1OJGA 2J80A 3CAXA 3LIBA 5J3WA 1MZUA 5DJUA 3HJIA 4NXFA 3EWKA 5F6AA 1OTBA 2I9VA 3P7NA 4HNBA 2WKRA 3LUQA 2K7SA 3LI9A 3VE3A 2PDRA 1S4RA 4R38A 4KUOA 5F69A 3E4QA 4GS9A 3F1OA 2WKQA 4HJ6A 2H28A 1XJ6A 2D01A 4WUJA 3IS2A 4NXEA 2B02A 1LL8A 1S1YA 1NWZA 1OTEA 2VEAA 4WLAA 4EXOA 3BY8A 2BASA 3G6OA 5HDSA 1TS8A 4I39A 1XFNA 1BYWA 4GCZA 1EW0A 1F98A 1X0OA 1D7EA 1GSVA 4L9GA 4H6JA 4LRYC 3MXQA 5AVEA 5J7EA 1UGUA 2YKHA 1OTIA 2L1MA 2Z6CA 1DP8A 4HIAA 1KOUA 2V1BA 2QJ5A 2OWHA 1D06A 1DP6A 3VOLA 4MN6A 3UB9A 4XT2A 4K08A 5HDCA 4WF0A 1P97A 4DJ3A 2P7JA 4LRXC 3NOUC 2ZOHA 5KIZA 2OOLA 4F3LA 3LI8A 3H7WA 2QWSA 5DKLA 3GECA 1XFQA 2PYRA 3F1NB 1N9NA 5HZHA 4PKYG 3UMEA 4JGQA 2L0WA 2V1AA 2QHKA 3SW1A 4R70A 2GJ3A 3CLOA 1V9ZA 4MN5A 4EEUA 3ZQ5A 4I3IA
chains in the Genus database with same CATH superfamily
3F1PA 4Y2FA 3UO9A 4O01A 2ZMFA 3MQOA 4R23A 4Y15A 3MZDA 2V8CA 5FEGA 1H0MA 4X6TA 4PM7A 2PD8A 1ONHA 4EBNA 2M1CA 2GZAA 2B5RA 3G35A 4EETB 1P0ZA 2OV5A 3BM6A 4B9OA 3HBRA 4LV1A 5EFWA 3DTKA 4ZAMA 1OJ5A 2HGVA 2Y2GA 5A8BA 4II7A 2ZOIA 1ES4A 1PWGA 1VM1A 4GHIA 4OKPA 4GS9B 5DF9A 2P04A 5FSRA 5DF8A 1SDNA 4R4RA 1YQSA 1UWPX 3E98A 1WE4A 5J8XA 4N9LA 3VSLA 3IF6A 2DNSA 2WKPA 3IBJA 1OT9A 3Q1FA 3HLDA 4E3JA 2ZQDA 3V50A 1AXBA 4EUVA 2VV6A 3ZG5A 5FAQA 3B42A 3Q82A 4FCFA 2R78A 5FI6A 4Q0JA 3MXRA 3WS5A 4EBPA 1LL9A 2X71A 3TW8A 4WBGA 4EWFA 3O5YA 4IUKA 4WMCD 1NZOA 1DP9A 1MKIA 2XLNA 1SCWA 1PW1A 2G2WA 3ZFZA 4LENA 1XP4A 3ZNTA 2ZL1B 1NLYA 1OTAA 2G2UA 1IKGA 3JVVA 3SS5A 2Z6DA 3VP4A 4YNRA 2HJEA 2V9AA 2OAQ1 1G28A 1E3UD 3IQAA 3ZG9B 3IF6C 3IH8A 4FH2A 2WZXA 1D1JA 1TF1A 1M40A 3H7WB 1V9YA 4DRTA 1CEGA 3D3OA 3EGDC 3UPOA 4RQ9A 2OLVA 4IBRA 1VB6A 3UY6A 4Q8IA 4PPRA 2Y2KA 1MWUA 3G2ZA 4U0TA 3Q7VA 5F1FA 3T4QA 5K5BA 4G3VA 3K2NA 4BWIA 1AWIA 3NHQA 4S2OA 2WGIA 3D4FA 5EVIC 3MS6A 2UWXA 3T4TA 1E4DA 4EBLA 4MEZA 1FIKA 2XH9A 1ONGA 1JNUA 1I2SA 5F83A 3F1PB 3FPWA 5IHVA 4UA7A 2ZQ8A 4HJ3A 3H9WA 1C3BA 1K56A 5TFQA 4ZJ3A 3BFGA 3UB8A 4OH0A 3NULA 3ZDJA 3WS2A 5DTSA 3M6BA 2HP9A 5GLCA 1YMSA 1WA9A 3CMZA 1BLSA 3IHAA 5U47A 4NXGA 2ZC7A 1BLHA 5I5LA 2JKRM 1BLPA 1YT4A 1GA0A 4YWZA 3B33A 1LLBA 1RGZA 5CX7A 2XR0A 4PKYA 4LV3A 3ITAA 3S7PA 2WYXA 2A3UA 2QJ7A 1MC0A 3ZCZA 1RGYA 3QP2A 3WS4A 4DKIA 4GHIB 3C2WA 4MN7A 2HZ5A 5EM1A 2ZC3B 3HLGA 3V3RA 1VETA 5G4YA 4C75A 5FQKA 1Y4OA 3IF6B 3EEHA 3E2KA 3IXDA 3DWKA 2W1TA 2FH5A 1YLZA 5EVID 1GSXA 3IT9A 3V67A 1SDEA 4B4ZA 3OBFA 4B93A 5MC7A 2J80A 2C6WB 1STZA 5F82A 1YSPA 1MZUA 1FQGA 4X68A 5GLBA 2HDQA 4WEJA 2Y4AA 2E8IA 4XXRA 1RP5A 5C5KA 3OC2A 3HJIA 5EVIB 3PBQA 4K0WA 3EWKA 1MXOA 2JKRI 5E2GA 2ZMVA 3BLSA 3LGOA 5A93A 4HNBA 4RYEA 2Q0OA 1KVLA 5FDSA 1K4FA 2BLSA 4Q0IA 3IXHA 1YMXA 5EOEA 1BSGA 4QB8A 2ZM0A 1S4RA 2W3FA 4DXCA 5AQAA 2IWBA 5F69A 3RXXA 3PBSA 5M1AA 1PW8A 4BD0A 3W4PA 2WKQA 3F1OA 3V3SA 2JKGA 3IWQA 4HJ6A 3TG9A 1PWCA 1XPBA 4N1HA 2VGJA 1XGJA 3L9KA 2D01A 4FSFA 4WUJA 1K56D 1L0EA 3IS2A 4NXEA 2BTFP 1CI8A 2PAVP 4JXGA 3R4KA 2EX9A 2HP6A 2WKHA 4LV2A 5BOHA 1TS8A 3LR0A 1BYWA 4GCZA 1EW0A 1IYPA 4DE0A 3IHBA 3NBLA 1GSVA 4O8GA 4H6JA 3MXQA 5J7EA 1J3WA 2YKHA 2VGLM 4E6XA 4QPRA 5EECA 3OPHA 4GZBA 1D06A 4S2IA 1JWZA 4OVDA 1W63M 1BT5A 2VGLS 1W7FA 5G18A 3P01A 1Y54A 4NETA 3RFBA 5KIZA 1ZG4A 2OOLA 2VK3A 1XX2A 3HVFA 1YKDA 3IWIA 5D3OA 1XFQA 2R9WA 2PYRA 1BTLA 3BYDA 1ESIA 2ZD8A 1RCJA 2UV0E 1XA1A 2W3HA 5CEBA 3EQUA 1N9NA 3A3EA 3ZGAB 2NUPC 1L2SA 4U0XA 1K54A 4DXBA 1WYBA 1NYYA 1W8QA 4Y0OA 2H0TA 5EVEA 3NC8A 4D2OA 3BFDA 3BFEA 1VETB 3SW1A 4DDSA 3BEBA 2QYBA 2J9OA 4ZBEA 2GDNA 3S1YA 3CLOA 1F5MA 2EWVA 1MY8A 1T1AA 1H8MA 1ERQA 4DN0A 1MBLA 2Y2IA 4K91A 2ZQ7A 4R0QA 4X1MA 2E8JA 3C5AA 2A24A 4RVAA 5EOOA 3T4LA 2ZM2A 5FASA 3FG8A 4LLOB 2JBFA 5J4EA 1K54C 5TGFA 3JPUA 2L4RA 2Q9MA 2PBYA 4ZDXA 1YLYA 2OWJA 4HY8A 2WADA 2EXBA 2HP5A 3T1RA 1CQAA 2KOIA 2IWCA 4G3WA 4UAAA 4ETXA 5HARA 3B3XA 4I3AA 4GKUA 3S4XA 2B95A 1PYYA 2V1ZA 3FC7A 3T1QB 2RCXA 3MBZA 3CWFA 3F1OB 3ZHHA 3PBRA 3GSGA 3RXWA 3W8KA 5HX9A 3A3FA 1IFQA 5HPFA 2PU4A 2VLGA 5DJTA 1FSYA 2XD5A 3VMAA 2XRNA 2JE5A 3GDIA 3N8LA 3ZYTA 1HD8A 1XJ3A 3N6IA 2W3DA 4KZ8A 5TR7A 4H6JB 3KSFA 4QD4A 4NKPA 3RH8B 3E0YA 4KQRA 4ME4A 1GHIA 1H3QA 3MR0A 3BY9A 3D72A 2AVXA 2G7UA 3NJAA 5CGXA 2W0NA 3WRZA 2DRWA 3WS0A 5TJJA 4D60A 1S67L 5AVFA 2Y55A 1K25A 1TDLA 4HHDA 5CHJA 3FPVA 5EUAA 3LIFA 3A0SA 2VV8A 3PAGA 1YM1A 5AQBA 2WKIA 3OOVA 1TS6A 5A92A 5FQMA 2EA9A 2Y2JA 2GX5A 4JBFA 5L09A 3OPRA 2EXAA 4HH3A 1S4SA 4I5SA 4BENA 4OQHA 1PI5A 3N8SA 1N9LA 1MPLA 3ULFA 5KSCA 4R1GA 3IX3A 3NDEA 4XUZA 1GCEA 4Z9QA 3OCNA 3NOTC 4WEKA 1DRMA 1TD5A 1SKOA 1G5UA 3ZVWA 4EESA 1NLZA 2A24B 4R6LA 4A5RA 3ITBA 4BBVA 4EW7A 1S66L 3K3DA 1K57A 3DTIA 4OLGA 4QU3A 5HWTA 3HJKA 3SS3A 3M2KA 1BZAA 2HDUA 4JGOA 1NXYA 1FOFA 4BL3A 4R3JA 3VV4A 4BL2A 2WAEA 1UWNX 3QNCA 3ICYA 4P6BA 1OT6A 3C8CA 4WM9A 5GLDA 4HBUA 3VOYA 3K3CA 3VP0A 3GV9A 1LSVA 2P9VA 2CMNA 3LICA 4RX3A 3E2LA 4CPKA 4EEPA 3EOIA 1K57C 4XT2B 1LSWA 3RTYA 3IX4A 3H82A 5FI7A 4Q0HA 1LT0A 5DF7A 1ODVA 1G6AA 4HH2A 4EQIA 3FV7A 5FI2A 5FQJA 1S1ZA 2WUQA 3Q81A 1Q2PA 2ACGA 1NJ4A 1WYCA 2WGWA 4DMZA 1L0FA 3DBAA 3CHWP 3T1SA 1H8ZA 3Q7ZA 2I72A 3C30A 2ZM8A 1MKMA 3P7NA 3CITA 5EPHA 3MKFA 1VEUA 4P6ZS 2K2NA 2WKRA 2QMIA 2W3EA 4DF6A 1GHMA 4EUZA 2B18A 4N9KA 2ZC6B 5AJGA 3GTCA 1GHPA 4R38A 4KUOA 2VJWA 1Z09A 5EV0A 2XROA 2V20A 3S7NA 2ZQAA 4P85A 2EFUA 1YLPA 3HREA 2Y2HA 4RA7A 2O99A 1LL8A 4HEFA 1S1YA 1HLUP 1OTEA 1IEMA 1PZPA 3BY8A 4AFIA 4JXWA 5FL3A 2Y59A 1JWPA 2WKEA 1X0OA 4OP5A 4LRYC 5AVEA 1XXMA 1UGUA 1OTIA 1ERMA 4UEYA 1IYSA 2V1BA 2QJ5A 2OWHA 3QNBA 3NECA 2PT7A 4QJGA 3VFHA 2EX2A 3UB9A 5CTNA 3IF5A 2EX6A 4ID4A 5HDCA 3IXGA 5GHXA 4KZ5A 1YLJA 3I7JA 5HW3A 2P7JA 3NI9A 3NOUC 1FR6A 4ZJ2A 3W4OA 1MWTA 1JTGA 2Y79A 4MLLA 4F3LA 4PM5A 5DKLA 3GECA 3LY4A 3GRJA 1M6KA 3N7WA 2ZMAA 1KE4A 1HVBA 4PKYG 1EI5A 2XSSA 4UQIM 4F94A 2XF3A 4EV4A 1CJFA 1K6RA 2XFTA 2H5SA 2J9PA 2P9VB 3BW6A 4GDBA 3BFFA 1JTDA 3QP1A 4UQIS 1PFLA 1V9ZA 4OPQA 4BJPA 4MN5A 4EEUA 4IUHA 4HI4A 3ZQ5A 3NOPC 4JPMA 2KDKA 3MFXA 3SZTA 3SH9A 3VE4A 3IH9A 1ACFA 2FZ0A 3EQVA 4IVIA 3DTEA 4E04A 4QWOA 4BQMA 4DE2A 4BMWA 2QZ6A 3T1XA 4WL9A 3PYPA 3Q7VB 5FDHA 2Z2MB 2XGNA 1H8YA 1T1CA 1CI9A 1XJ4A 3GMWA 3QP5A 1VEUB 2K31A 3IBRA 4P87A 1ZTUA 1ZG6A 3MQQA 1F9IA 5HL6A 3AGDA 4HJ4A 1TS7A 5E2FA 2A49A 4DJ2A 3QP6A 3ZNYA 4OPRA 4L9EA 3R7WA 2VZWA 1P9RA 3FKWA 2HV1A 3MSHA 4XUXA 4KZ4A 4JF6A 4EQ1A 2HPBA 4QY6A 2Y91A 3GR2A 1ESUA 2RL3A 3UE1A 2O9CA 3MKEA 3VSKA 1DJCA 2QKPA 4ZRRA 4N92A 3A3IA 1K6SA 1ZKJA 4JXVA 4S2MA 2XK1A 5DTTA 3V5MA 5HWWA 3LR5A 4HQAA 1QMFA 4WZ5A 4PM9A 3CUEA 4OLDA 3QP8A 5KMWA 3CJMA 5E43A 4E3LA 1SKFA 3UE6A 1OTDA 1S6RA 3C38A 1K55A 4F3LB 5HWVA 2W1TB 4I3JA 1LI0A 4L9FA 5IS1A 2X02A 3JYIA 1NZUA 1T1BA 5EVLA 5HAPA 2WAFA 2PR6A 4FUWA 3N8RA 2O9BA 2NUTC 1TEMA 2ZC4B 4G3KA 4ARZA 1VQQA 2ZBBA 2VA0A 4ZJ1A 4JGRA 5M19A 3A0RA 4HP9A 4MCWA 4WZ5C 5IU1A 3BWLA 3CUEC 1DJAA 3BLMA 2FFFB 1O07A 3LYXA 4IJGA 1IYOA 2VV7A 1K0KA 4NK3A 4BBTA 1DY6A 3LIDA 1JWVA 3FWLA 4KENB 1LSXA 4X56A 1EWZA 4GN2A 2BG1A 3ZG7B 1LI9A 4FOFA 4KZ6A 4GJ4A 4X53A 3PHYA 1ALQA 3T50A 4I38A 1G68A 3IS2B 3KSGA 5FA7A 2GNXA 1Y28A 3G30A 4OQIA 1Q2QA 4LCMA 2FFYA 3UB7A 5KSHA 2D02A 5JYOA 3F1NA 4KQDA 3T4JA 3CPTA 4JXSA 3HLCA 4GW9A 4LFUA 3UB6A 5KZHA 4ESPA 1ZC2A 1NRFA 2W27A 4Y7PA 2ZL1A 3A0VA 5CGSA 5CRFA 3EEAA 4DE3A 2O9AA 1E25A 4R3BA 4JGPA 3UNWA 3P09A 4E3NA 3KYZA 3MZEA 4QHCA 2J7VA 2KX6A 2Y2PA 3MMHA 3PR6A 2JHEA 3KSIA 3E4PA 1FSWA 2JC7A 3HUNA 3TJZC 1XJ2A 3T4KA 3KX0X 3GVBA 1PI4A 1OJGA 1K4EA 3CAXA 3LIBA 5M18A 2Z2LB 3JVUA 4K0XA 3T4SA 4MBHA 4CJNA 4YINA 3NDGA 1ES3A 4JKTA 2PBDP 5DJUA 5A90A 2JKTM 3PBNA 3M2JA 3TRCA 3QP4A 2I9VA 4FD8A 3AGFA 3Q07A 2Y2QA 4QY5A 3LUQA 2K7SA 3IWOA 2Y2NA 3LR3A 3LR4A 5DFXA 3UN7A 2KLIA 4X55A 2C5WB 4UA9A 4FH4A 3HUMA 3NY4A 1KGFA 4GNUA 2ZQ9A 3B47A 2LB9A 4ARZB 2P74A 2XA7M 3CZDA 3VFFA 4DDYA 1Z6FA 5CERA 4PM8A 5AQ7A 1IKIA 2B02A 4KZBA 1PWDA 2VEAA 5EE8A 4WLAA 3HL9A 1W8YA 5HDSA 2XA7S 4I39A 4HESA 1D7EA 4E3KA 4S2KA 3T12B 3ZG0A 5IT5A 4S2JA 4BD1A 4KZ7A 3A3JA 1FILA 3QHYA 4Y17A 2L1MA 2MJ6A 3G31A 4HIAA 1KOUA 2JKTI 3ZVTA 4MNRA 5L10A 2X01A 1F2KA 4YOFA 3OPLA 3VOLA 2OSUA 4JF5A 5I94A 3UDIA 1PZOA 3UE0A 4WF0A 3ZG8B 3SOIA 1P97A 4Y13A 4DJ3A 5CGWA 3AGEA 2VKSA 2EX8A 3D9YA 4ETZA 5HAQA 2EWWA 3LI8A 4E6WA 1HTZA 4OQGA 1KE3A 1IOUA 1W79A 3F1NB 4Y5FA 5L8MA 3CPTB 2R9XA 1CK3A 1J9MA 3ISGA 2J3WA 5EVIA 1FCMA 4H8RA 3G2YA 5FQQA 4KQQA 3OPPA 5CTMA 3G4PA 2J8YA 4P6ZM 4R70A 2PU2A 1KGEA 1KVMA 3PTEA 3L7HA 3FZCA 2HJ9C 5CXWA 4I3IA 3LCEA 3W4QA 1ZHHB 5DVAA 3KO6A 3DTMA 2XEPA 2V0UA 1NYMA 3G34A 3UDXA 1XGIA 1TDGA 4CLCA 4Y0TA 3SH7A 1N4OA 4WZ4A 4Y3IA 1G6OA 5GLAA 2Y8HA 5HD5A 4DE1A 3CG5A 2M7UA 1T18A 3UDFA 4NXBA 2W3GA 4UA6A 2Y2OA 4LPZA 5FAOA 1YAXA 4B4XA 1IELA 1FR1A 2INWA 4PM6A 3BFCA 1IYQA 2PYPA 4E3OA 2M7VA 2XD1A 5HD3A 4IVKA 4O0PA 4R4SA 2VX8A 4LRZE 1SKOB 4B88A 3E4OA 4CLCC 4OOYA 3MF0A 3O86A 1QMEA 5CECA 3UMDA 4KG5A 4PAUA 3HUOA 4OONA 4KG2A 1BLCA 5HDDA 3HLEA 3LFVA 3MXSA 3O88A 4KUKA 2JCHA 2V0WA 1T19A 5TBMA 2WK0A 3HCYA 4KQOA 1KE0A 5F5YA 3RJUA 5F1GA 4NG2A 3GQZA 3UE3A 3IX8A 5L07A 1LHYA 4YFMA 4E3IA 2O0YA 3S7QA 2HDSA 2IA2A 1YLTA 1FCNA 1N9OA 4R3AA 5GHZA 3U4LP 4E3MA 4MBKA 5FATA 5JYPA 4LCLA 4LV0A 3KYQA 4EERA 3CI6A 1KDSA 3LIEA 4M4XA 4BLMA 1VHMA 4FTXA 5HFOA 5L2FA 1GSWA 3H82B 4L0LA 3BQ8A 4PHTA 2PR5A 2ZC5B 4GDNA 2JN7A 4WYYA 1NY0A 1PRQA 1U60A 2WGWB 3OCLA 2V2FF 2YKFA 2Y2LA 5F68A 2HF6A 1BUEA 2PHYA 2Y2MA 4CQHA 3HLFA 3FKVA 3T4OA 3MQ0A 3WRTA 4CLCD 4M3KA 1ES2A 3MJQA 4WN5A 1YSQA 5AQ9A 3TE8A 5DKKA 3VOZA 4U3TA 4BBUA 4HOIA 3KSHA 4C6YA 4PMAA 2PD7A 5CHUA 4ZTKA 3P98A 1DJBA 3PBOA 1L3LA 3UB5P 1OPXA 4CLCB 3BJNA 2A2LA 3OLOA 3UPPA 4Y0UA 5HAIA 5HSQA 3LIAA 4MBFA 1SZVA 3O3VA 3WS1A 3LY3A 2H10A 1CF0A 5LBRA 4MDZA 2JKFA 3U2AA 1NRJA 1TS0A 4KZAA 5G4ZA 1HZOA 4Z1WA 4UHUA 1OMEA 3KYEA 1MWSA 5DFYA 4GLQA 2ZLYA 1KDWA 1K38A 4HP4A 3VP1A 4GD8A 3FYZA 1PNEA 3S22A 4NEED 5FQ9A 4KG6A 2HDRA 3C4OA 2VGKA 3BRMA 1I2WA 5DTKA 2CC1A 4LGWA 1L0DA 2P08A 5E2HA 3SS4A 3DW0A 3SH8A 5TBMB 2QPNA 5FEFA 4O7DA 3EGXC 4S2NA 5FQIA 5HL1A 3N4IA 5J3WA 1MWRA 4HBTA 1ES5A 5HPIA 2J3TC 4IBXA 3BQAA 2V8FA 3A3DA 2WZZA 3VP2A 4NXFA 3LO7A 5A91A 5F6AA 4OQ0A 1OTBA 3TOIA 2OLUA 2LB5A 3C4PA 3LI9A 1W63Q 3VE3A 2PDRA 2Q9NA 3PAEA 2XFSA 5GL9A 4GD6A 1XKZA 4IHQA 1K55C 1PIOA 3E4QA 4MMNA 2XDMA 2ZQCA 4GS9A 1LL5A 1YLWA 1S0WA 4S2NC 2H28A 1KGGA 1A0KA 3MFDA 2DCFA 1XJ6A 3NCKA 3DAVA 1O7EA 3OZHA 3LEQA 4RX2A 3M6HA 1NWZA 3S7OA 4EXOA 5E2EA 3IXBA 1FCOA 4CLCE 2BASA 4OPYA 3G6OA 3C7UA 5GHYA 1XFNA 4C3QA 3W2ZA 4S2PA 1I5QA 4IEDA 1F98A 2W1RA 4N1XA 4L9GA 4X25A 4EU0A 1EROA 3PXPA 4JLFA 4KZ3A 4WELA 3VP3A 4P0MA 3MZFA 5FAPA 1H5XA 4X1LA 4GB7A 2WGVA 2Z6CA 1DP8A 3TSGA 1DP6A 3HLBA 4MN6A 5CEDA 2OAP1 3WWXA 4XT2A 4K08A 4OOLA 3R7WB 2J3TD 3BECA 2IWDA 1TVFA 2EFXA 4LRXC 4WMCA 2ZOHA 3DWZA 4KZ9A 3H7WA 2QWSA 4OP8A 1GA9A 1W5DA 1L0GA 2ZJ9A 2XQZA 5HZHA 4OPZA 3HLWA 1E3UA 1P9WA 2DMWA 5CHMA 3G32A 3UMEA 4X69A 4JGQA 2L0WA 2V1AA 2QHKA 3NIAA 1SHVA 3C7VA 1N9BA 3PBTA 1CEFA 1BULA 3V39A 1XA7A 4JF4A 2GJ3A 2PRFA 5EM0A 3LEZA 1YPRA 2H0YA 4GOGA 3O87A 4OOMA 4S2LA 1JVJA 3UPNA
chains in the Genus database with same CATH topology
3F1PA 3NOPC 4Y2FA 1T1AA 1H8MA 4O01A 4DN0A 1ZHHB 2KDKA 2ZMFA 3MQOA 3KO6A 3MFXA 3VE4A 2V0UA 2FZ0A 3EQVA 4E04A 2A24A 4CLCA 3T4LA 2PD8A 4BMWA 3FG8A 4LLOB 5J4EA 4Y3IA 4WL9A 2M1CA 1G6OA 2GZAA 3PYPA 2L4RA 2Y8HA 4EETB 1T1CA 2OWJA 1P0ZA 5HD5A 4HY8A 2M7UA 1XJ4A 4B9OA 1T18A 4NXBA 2W3GA 5EFWA 2K31A 3IBRA 1ZTUA 2KOIA 4G3WA 1OJ5A 4LPZA 1YAXA 2HGVA 3MQQA 4ETXA 1F9IA 5HL6A 2INWA 5A8BA 4II7A 4I3AA 4HJ4A 2ZOIA 1TS7A 2PYPA 2M7VA 5HD3A 4DJ2A 4O0PA 4GHIA 3FC7A 2VX8A 4GS9B 4L9EA 5DF9A 2P04A 4LRZE 3CWFA 3R7WA 3F1OB 2VZWA 3PBRA 1P9RA 3E4OA 4CLCC 1UWPX 3E98A 3MF0A 1IFQA 5HPFA 2VLGA 5DJTA 2HV1A 3UMDA 2XRNA 2WKPA 3GDIA 4PAUA 3IBJA 1OT9A 4EQ1A 5HDDA 3ZYTA 3LFVA 2O9CA 1XJ3A 2QKPA 4KUKA 4ZRRA 2V0WA 1T19A 5TBMA 3HCYA 4KQOA 2W3DA 4EUVA 2VV6A 5F5YA 3B42A 2R78A 4H6JB 3KSFA 4Q0JA 4NKPA 3TW8A 3RH8B 3E0YA 3UE3A 3O5YA 4IUKA 1DP9A 4ME4A 2O0YA 5HWWA 3S7QA 2IA2A 3LR5A 4HQAA 1N9OA 1H3QA 1NLYA 1OTAA 3MR0A 3BY9A 4R3AA 3CUEA 3D72A 3JVVA 2G7UA 2Z6DA 4YNRA 3NJAA 2HJEA 2W0NA 5TJJA 2V9AA 2OAQ1 1G28A 1S67L 5AVFA 3KYQA 3UE6A 1OTDA 4EERA 3C38A 3CI6A 4HHDA 3FPVA 3LIEA 4M4XA 1TF1A 1VHMA 3LIFA 4F3LB 5HWVA 2W1TB 4I3JA 3H7WB 4L9FA 3A0SA 5IS1A 2VV8A 1V9YA 1GSWA 3H82B 1T1BA 4L0LA 3D3OA 3BQ8A 4PHTA 3EGDC 2PR6A 2PR5A 4RQ9A 3OOVA 1TS6A 1VB6A 2JN7A 2O9BA 2EA9A 2GX5A 2NUTC 4G3KA 3T4QA 4HH3A 2ZBBA 4ARZA 2VA0A 1S4SA 4I5SA 5K5BA 4G3VA 4JGRA 3K2NA 4BWIA 3A0RA 4HP9A 4MCWA 3NHQA 3OCLA 5IU1A 1N9LA 3BWLA 2YKFA 5F68A 2HF6A 3ULFA 2PHYA 4CQHA 3T4TA 3CUEC 3T4OA 3MQ0A 4CLCD 3LYXA 3MJQA 4WN5A 1YSQA 1JNUA 4IJGA 3TE8A 5DKKA 2VV7A 3F1PB 3FPWA 4BBUA 4HOIA 3KSHA 4HJ3A 3H9WA 2PD7A 4BBTA 3LIDA 3NOTC 3OCNA 4WEKA 1DRMA 1TD5A 3PBOA 1LSXA 3UB8A 4EESA 1NLZA 1OPXA 2A24B 4CLCB 3BJNA 4R6LA 4FOFA 4BBVA 4EW7A 2A2LA 1WA9A 1S66L 3OLOA 3K3DA 4GJ4A 5HSQA 3LIAA 3PHYA 4NXGA 5HWTA 2JKRM 5I5LA 3HJKA 3T50A 4I38A 3IS2B 4YWZA 3B33A 3KSGA 4JGOA 5LBRA 2GNXA 1Y28A 4MDZA 5CX7A 3U2AA 1NRJA 1TS0A 3UB7A 5G4ZA 4PKYA 5KSHA 3VV4A 3S7PA 2D02A 4Z1WA 3F1NA 1UWNX 4KQDA 3T4JA 3ICYA 2QJ7A 1MC0A 1OT6A 4GW9A 3UB6A 3C8CA 5DFYA 2W27A 4GLQA 3A0VA 4GHIB 3C2WA 4MN7A 3EEAA 4HP4A 3K3CA 2O9AA 1LSVA 2CMNA 4JGPA 3LICA 4NEED 5G4YA 3EEHA 4EEPA 3EOIA 4XT2B 3KYZA 1LSWA 2W1TA 2KX6A 2FH5A 3RTYA 3MMHA 3PR6A 3H82A 2JHEA 4Q0HA 3KSIA 2P08A 3E4PA 1LT0A 1ODVA 1GSXA 4HH2A 3TJZC 1XJ2A 5TBMB 1S1ZA 3V67A 3T4KA 3KX0X 3OBFA 4B93A 1OJGA 5MC7A 2J80A 3CAXA 3LIBA 3EGXC 1STZA 3JVUA 3T4SA 4DMZA 1YSPA 5J3WA 1MZUA 3DBAA 5HPIA 2J3TC 4WEJA 3BQAA 5DJUA 5C5KA 3OC2A 3HJIA 4NXFA 2JKTM 3PBQA 3PBNA 3EWKA 2JKRI 3C30A 2ZMVA 5F6AA 1OTBA 3TRCA 1MKMA 2I9VA 3P7NA 3CITA 4HNBA 3ZQ5A 2LB5A 4P6ZS 2K2NA 2WKRA 3LUQA 2K7SA 2W3EA 3LI9A 3LR3A 4Q0IA 1W63Q 3LR4A 3VE3A 2B18A 5DFXA 2PDRA 2KLIA 5AJGA 1S4RA 2W3FA 4R38A 4KUOA 2VJWA 4IHQA 2XROA 5F69A 3E4QA 4MMNA 3PBSA 4GS9A 3S7NA 3B47A 3F1OA 2WKQA 4HJ6A 2LB9A 2H28A 4ARZB 2XA7M 1XJ6A 2D01A 4FSFA 4WUJA 3IS2A 4NXEA 2O99A 2B02A 1LL8A 1S1YA 1NWZA 1OTEA 2VEAA 4WLAA 3S7OA 3R4KA 4EXOA 3BY8A 4AFIA 4CLCE 2BASA 3G6OA 5HDSA 2XA7S 1TS8A 4I39A 1XFNA 3LR0A 1BYWA 4GCZA 5FL3A 1EW0A 3W2ZA 1F98A 1X0OA 2W1RA 1D7EA 1GSVA 4L9GA 4O8GA 4H6JA 4EU0A 4LRYC 3MXQA 5AVEA 3PXPA 4WELA 1UGUA 5IT5A 5J7EA 2YKHA 2VGLM 1OTIA 4QPRA 4UEYA 2L1MA 2MJ6A 1DP8A 2Z6CA 1KOUA 2JKTI 2QJ5A 2V1BA 4HIAA 2OWHA 4YOFA 1D06A 1DP6A 3VOLA 4MN6A 2PT7A 2OAP1 3UB9A 4XT2A 1W63M 4K08A 4OOLA 3R7WB 2VGLS 5HDCA 4WF0A 3P01A 2J3TD 1P97A 4DJ3A 3RFBA 2P7JA 4LRXC 2VKSA 3NOUC 2ZOHA 5KIZA 2OOLA 2Y79A 4F3LA 4ETZA 2EWWA 3LI8A 1YKDA 3H7WA 2QWSA 5DKLA 3GECA 1XFQA 2PYRA 1IOUA 3F1NB 4Y5FA 2W3HA 5L8MA 3EQUA 1N9NA 2NUPC 2J3WA 5HZHA 1P9WA 2DMWA 4PKYG 2XSSA 4UQIM 3UMEA 4JGQA 2L0WA 2V1AA 2QHKA 3PBTA 4P6ZM 3BW6A 3SW1A 4R70A 2QYBA 2GJ3A 3CLOA 4UQIS 4OOMA 1V9ZA 4BJPA 1F5MA 2EWVA 2HJ9C 4MN5A 4EEUA 4IUHA 4HI4A 4I3IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F1P A;  3NOP C;  1T1A A;  2KDK A;  3MQO A;  3MFX A;  3VE4 A;  2V0U A;  4E04 A;  2A24 A;  2PD8 A;  3FG8 A;  4LLO B;  5J4E A;  4WL9 A;  4HI4 A;  2M1C A;  3PYP A;  2L4R A;  4EET B;  1T1C A;  2OWJ A;  1P0Z A;  5HD5 A;  4HY8 A;  1XJ4 A;  4B9O A;  1T18 A;  4NXB A;  5EFW A;  3IBR A;  1OJ5 A;  4LPZ A;  3MQQ A;  1F9I A;  5A8B A;  2INW A;  4I3A A;  4HJ4 A;  2ZOI A;  1TS7 A;  2PYP A;  5HD3 A;  4DJ2 A;  4GHI A;  3FC7 A;  4GS9 B;  4L9E A;  4LRZ E;  3CWF A;  3F1O B;  3E4O A;  1UWP X;  2VLG A;  5DJT A;  2HV1 A;  3UMD A;  2WKP A;  3GDI A;  1OT9 A;  4EQ1 A;  5HDD A;  1XJ3 A;  2QKP A;  4KUK A;  2V0W A;  1T19 A;  5TBM A;  2VV6 A;  5F5Y A;  2R78 A;  4H6J B;  3RH8 B;  1DP9 A;  5HWW A;  4HQA A;  1N9O A;  1OTA A;  3MR0 A;  4R3A A;  3BY9 A;  3D72 A;  2Z6D A;  3NJA A;  2W0N A;  2V9A A;  1G28 A;  1S67 L;  5AVF A;  3UE6 A;  1OTD A;  4EER A;  4HHD A;  3LIE A;  4M4X A;  4F3L B;  3LIF A;  5HWV A;  4I3J A;  3H7W B;  4L9F A;  3A0S A;  5IS1 A;  2VV8 A;  1V9Y A;  1GSW A;  3H82 B;  1T1B A;  2PR6 A;  2PR5 A;  4RQ9 A;  1TS6 A;  1VB6 A;  2JN7 A;  2EA9 A;  4HH3 A;  2ZBB A;  1S4S A;  4I5S A;  4JGR A;  3A0R A;  4HP9 A;  3NHQ A;  5IU1 A;  1N9L A;  3BWL A;  2YKF A;  5F68 A;  3ULF A;  2PHY A;  3LYX A;  3MJQ A;  4WN5 A;  1JNU A;  5DKK A;  2VV7 A;  3F1P B;  4BBU A;  4HOI A;  4HJ3 A;  3H9W A;  2PD7 A;  4BBT A;  3LID A;  3NOT C;  1DRM A;  1LSX A;  3UB8 A;  4EES A;  2A24 B;  4R6L A;  4BBV A;  4EW7 A;  1WA9 A;  1S66 L;  3OLO A;  3K3D A;  5HSQ A;  3LIA A;  3PHY A;  4NXG A;  5HWT A;  5I5L A;  3HJK A;  3T50 A;  4I38 A;  3IS2 B;  4YWZ A;  3B33 A;  4JGO A;  1Y28 A;  1TS0 A;  3UB7 A;  5G4Z A;  4PKY A;  2D02 A;  3F1N A;  1UWN X;  4KQD A;  3ICY A;  2QJ7 A;  1OT6 A;  4GW9 A;  3UB6 A;  3C8C A;  2W27 A;  3A0V A;  4GHI B;  3C2W A;  4HP4 A;  3K3C A;  1LSV A;  2CMN A;  4JGP A;  3LIC A;  5G4Y A;  3EEH A;  4EEP A;  4XT2 B;  1LSW A;  2KX6 A;  3RTY A;  3H82 A;  2JHE A;  3E4P A;  1LT0 A;  1ODV A;  1GSX A;  4HH2 A;  1XJ2 A;  5TBM B;  1S1Z A;  3KX0 X;  1OJG A;  2J80 A;  3CAX A;  3LIB A;  5J3W A;  1MZU A;  5DJU A;  3HJI A;  4NXF A;  3EWK A;  5F6A A;  1OTB A;  2I9V A;  3P7N A;  4HNB A;  2WKR A;  3LUQ A;  2K7S A;  3LI9 A;  3VE3 A;  2PDR A;  1S4R A;  4R38 A;  4KUO A;  5F69 A;  3E4Q A;  4GS9 A;  3F1O A;  2WKQ A;  4HJ6 A;  2H28 A;  1XJ6 A;  2D01 A;  4WUJ A;  3IS2 A;  4NXE A;  2B02 A;  1LL8 A;  1S1Y A;  1NWZ A;  1OTE A;  2VEA A;  4WLA A;  4EXO A;  3BY8 A;  2BAS A;  3G6O A;  5HDS A;  1TS8 A;  4I39 A;  1XFN A;  1BYW A;  4GCZ A;  1EW0 A;  1F98 A;  1X0O A;  1D7E A;  1GSV A;  4L9G A;  4H6J A;  4LRY C;  3MXQ A;  5AVE A;  5J7E A;  1UGU A;  2YKH A;  1OTI A;  2L1M A;  2Z6C A;  1DP8 A;  4HIA A;  1KOU A;  2V1B A;  2QJ5 A;  2OWH A;  1D06 A;  1DP6 A;  3VOL A;  4MN6 A;  3UB9 A;  4XT2 A;  4K08 A;  5HDC A;  4WF0 A;  1P97 A;  4DJ3 A;  2P7J A;  4LRX C;  3NOU C;  2ZOH A;  5KIZ A;  2OOL A;  4F3L A;  3LI8 A;  3H7W A;  2QWS A;  5DKL A;  3GEC A;  1XFQ A;  2PYR A;  3F1N B;  1N9N A;  5HZH A;  4PKY G;  3UME A;  4JGQ A;  2L0W A;  2V1A A;  2QHK A;  3SW1 A;  4R70 A;  2GJ3 A;  3CLO A;  1V9Z A;  4MN5 A;  4EEU A;  3ZQ5 A;  4I3I A; 
#chains in the Genus database with same CATH topology
 3F1P A;  4Y2F A;  3UO9 A;  4O01 A;  2ZMF A;  3MQO A;  4R23 A;  4Y15 A;  3MZD A;  2V8C A;  5FEG A;  1H0M A;  4X6T A;  4PM7 A;  2PD8 A;  1ONH A;  4EBN A;  2M1C A;  2GZA A;  2B5R A;  3G35 A;  4EET B;  1P0Z A;  2OV5 A;  3BM6 A;  4B9O A;  3HBR A;  4LV1 A;  5EFW A;  3DTK A;  4ZAM A;  1OJ5 A;  2HGV A;  2Y2G A;  5A8B A;  4II7 A;  2ZOI A;  1ES4 A;  1PWG A;  1VM1 A;  4GHI A;  4OKP A;  4GS9 B;  5DF9 A;  2P04 A;  5FSR A;  5DF8 A;  1SDN A;  4R4R A;  1YQS A;  1UWP X;  3E98 A;  1WE4 A;  5J8X A;  4N9L A;  3VSL A;  3IF6 A;  2DNS A;  2WKP A;  3IBJ A;  1OT9 A;  3Q1F A;  3HLD A;  4E3J A;  2ZQD A;  3V50 A;  1AXB A;  4EUV A;  2VV6 A;  3ZG5 A;  5FAQ A;  3B42 A;  3Q82 A;  4FCF A;  2R78 A;  5FI6 A;  4Q0J A;  3MXR A;  3WS5 A;  4EBP A;  1LL9 A;  2X71 A;  3TW8 A;  4WBG A;  4EWF A;  3O5Y A;  4IUK A;  4WMC D;  1NZO A;  1DP9 A;  1MKI A;  2XLN A;  1SCW A;  1PW1 A;  2G2W A;  3ZFZ A;  4LEN A;  1XP4 A;  3ZNT A;  2ZL1 B;  1NLY A;  1OTA A;  2G2U A;  1IKG A;  3JVV A;  3SS5 A;  2Z6D A;  3VP4 A;  4YNR A;  2HJE A;  2V9A A;  2OAQ 1;  1G28 A;  1E3U D;  3IQA A;  3ZG9 B;  3IF6 C;  3IH8 A;  4FH2 A;  2WZX A;  1D1J A;  1TF1 A;  1M40 A;  3H7W B;  1V9Y A;  4DRT A;  1CEG A;  3D3O A;  3EGD C;  3UPO A;  4RQ9 A;  2OLV A;  4IBR A;  1VB6 A;  3UY6 A;  4Q8I A;  4PPR A;  2Y2K A;  1MWU A;  3G2Z A;  4U0T A;  3Q7V A;  5F1F A;  3T4Q A;  5K5B A;  4G3V A;  3K2N A;  4BWI A;  1AWI A;  3NHQ A;  4S2O A;  2WGI A;  3D4F A;  5EVI C;  3MS6 A;  2UWX A;  3T4T A;  1E4D A;  4EBL A;  4MEZ A;  1FIK A;  2XH9 A;  1ONG A;  1JNU A;  1I2S A;  5F83 A;  3F1P B;  3FPW A;  5IHV A;  4UA7 A;  2ZQ8 A;  4HJ3 A;  3H9W A;  1C3B A;  1K56 A;  5TFQ A;  4ZJ3 A;  3BFG A;  3UB8 A;  4OH0 A;  3NUL A;  3ZDJ A;  3WS2 A;  5DTS A;  3M6B A;  2HP9 A;  5GLC A;  1YMS A;  1WA9 A;  3CMZ A;  1BLS A;  3IHA A;  5U47 A;  4NXG A;  2ZC7 A;  1BLH A;  5I5L A;  2JKR M;  1BLP A;  1YT4 A;  1GA0 A;  4YWZ A;  3B33 A;  1LLB A;  1RGZ A;  5CX7 A;  2XR0 A;  4PKY A;  4LV3 A;  3ITA A;  3S7P A;  2WYX A;  2A3U A;  2QJ7 A;  1MC0 A;  3ZCZ A;  1RGY A;  3QP2 A;  3WS4 A;  4DKI A;  4GHI B;  3C2W A;  4MN7 A;  2HZ5 A;  5EM1 A;  2ZC3 B;  3HLG A;  3V3R A;  1VET A;  5G4Y A;  4C75 A;  5FQK A;  1Y4O A;  3IF6 B;  3EEH A;  3E2K A;  3IXD A;  3DWK A;  2W1T A;  2FH5 A;  1YLZ A;  5EVI D;  1GSX A;  3IT9 A;  3V67 A;  1SDE A;  4B4Z A;  3OBF A;  4B93 A;  5MC7 A;  2J80 A;  2C6W B;  1STZ A;  5F82 A;  1YSP A;  1MZU A;  1FQG A;  4X68 A;  5GLB A;  2HDQ A;  4WEJ A;  2Y4A A;  2E8I A;  4XXR A;  1RP5 A;  5C5K A;  3OC2 A;  3HJI A;  5EVI B;  3PBQ A;  4K0W A;  3EWK A;  1MXO A;  2JKR I;  5E2G A;  2ZMV A;  3BLS A;  3LGO A;  5A93 A;  4HNB A;  4RYE A;  2Q0O A;  1KVL A;  5FDS A;  1K4F A;  2BLS A;  4Q0I A;  3IXH A;  1YMX A;  5EOE A;  1BSG A;  4QB8 A;  2ZM0 A;  1S4R A;  2W3F A;  4DXC A;  5AQA A;  2IWB A;  5F69 A;  3RXX A;  3PBS A;  5M1A A;  1PW8 A;  4BD0 A;  3W4P A;  2WKQ A;  3F1O A;  3V3S A;  2JKG A;  3IWQ A;  4HJ6 A;  3TG9 A;  1PWC A;  1XPB A;  4N1H A;  2VGJ A;  1XGJ A;  3L9K A;  2D01 A;  4FSF A;  4WUJ A;  1K56 D;  1L0E A;  3IS2 A;  4NXE A;  2BTF P;  1CI8 A;  2PAV P;  4JXG A;  3R4K A;  2EX9 A;  2HP6 A;  2WKH A;  4LV2 A;  5BOH A;  1TS8 A;  3LR0 A;  1BYW A;  4GCZ A;  1EW0 A;  1IYP A;  4DE0 A;  3IHB A;  3NBL A;  1GSV A;  4O8G A;  4H6J A;  3MXQ A;  5J7E A;  1J3W A;  2YKH A;  2VGL M;  4E6X A;  4QPR A;  5EEC A;  3OPH A;  4GZB A;  1D06 A;  4S2I A;  1JWZ A;  4OVD A;  1W63 M;  1BT5 A;  2VGL S;  1W7F A;  5G18 A;  3P01 A;  1Y54 A;  4NET A;  3RFB A;  5KIZ A;  1ZG4 A;  2OOL A;  2VK3 A;  1XX2 A;  3HVF A;  1YKD A;  3IWI A;  5D3O A;  1XFQ A;  2R9W A;  2PYR A;  1BTL A;  3BYD A;  1ESI A;  2ZD8 A;  1RCJ A;  2UV0 E;  1XA1 A;  2W3H A;  5CEB A;  3EQU A;  1N9N A;  3A3E A;  3ZGA B;  2NUP C;  1L2S A;  4U0X A;  1K54 A;  4DXB A;  1WYB A;  1NYY A;  1W8Q A;  4Y0O A;  2H0T A;  5EVE A;  3NC8 A;  4D2O A;  3BFD A;  3BFE A;  1VET B;  3SW1 A;  4DDS A;  3BEB A;  2QYB A;  2J9O A;  4ZBE A;  2GDN A;  3S1Y A;  3CLO A;  1F5M A;  2EWV A;  1MY8 A;  1T1A A;  1H8M A;  1ERQ A;  4DN0 A;  1MBL A;  2Y2I A;  4K91 A;  2ZQ7 A;  4R0Q A;  4X1M A;  2E8J A;  3C5A A;  2A24 A;  4RVA A;  5EOO A;  3T4L A;  2ZM2 A;  5FAS A;  3FG8 A;  4LLO B;  2JBF A;  5J4E A;  1K54 C;  5TGF A;  3JPU A;  2L4R A;  2Q9M A;  2PBY A;  4ZDX A;  1YLY A;  2OWJ A;  4HY8 A;  2WAD A;  2EXB A;  2HP5 A;  3T1R A;  1CQA A;  2KOI A;  2IWC A;  4G3W A;  4UAA A;  4ETX A;  5HAR A;  3B3X A;  4I3A A;  4GKU A;  3S4X A;  2B95 A;  1PYY A;  2V1Z A;  3FC7 A;  3T1Q B;  2RCX A;  3MBZ A;  3CWF A;  3F1O B;  3ZHH A;  3PBR A;  3GSG A;  3RXW A;  3W8K A;  5HX9 A;  3A3F A;  1IFQ A;  5HPF A;  2PU4 A;  2VLG A;  5DJT A;  1FSY A;  2XD5 A;  3VMA A;  2XRN A;  2JE5 A;  3GDI A;  3N8L A;  3ZYT A;  1HD8 A;  1XJ3 A;  3N6I A;  2W3D A;  4KZ8 A;  5TR7 A;  4H6J B;  3KSF A;  4QD4 A;  4NKP A;  3RH8 B;  3E0Y A;  4KQR A;  4ME4 A;  1GHI A;  1H3Q A;  3MR0 A;  3BY9 A;  3D72 A;  2AVX A;  2G7U A;  3NJA A;  5CGX A;  2W0N A;  3WRZ A;  2DRW A;  3WS0 A;  5TJJ A;  4D60 A;  1S67 L;  5AVF A;  2Y55 A;  1K25 A;  1TDL A;  4HHD A;  5CHJ A;  3FPV A;  5EUA A;  3LIF A;  3A0S A;  2VV8 A;  3PAG A;  1YM1 A;  5AQB A;  2WKI A;  3OOV A;  1TS6 A;  5A92 A;  5FQM A;  2EA9 A;  2Y2J A;  2GX5 A;  4JBF A;  5L09 A;  3OPR A;  2EXA A;  4HH3 A;  1S4S A;  4I5S A;  4BEN A;  4OQH A;  1PI5 A;  3N8S A;  1N9L A;  1MPL A;  3ULF A;  5KSC A;  4R1G A;  3IX3 A;  3NDE A;  4XUZ A;  1GCE A;  4Z9Q A;  3OCN A;  3NOT C;  4WEK A;  1DRM A;  1TD5 A;  1SKO A;  1G5U A;  3ZVW A;  4EES A;  1NLZ A;  2A24 B;  4R6L A;  4A5R A;  3ITB A;  4BBV A;  4EW7 A;  1S66 L;  3K3D A;  1K57 A;  3DTI A;  4OLG A;  4QU3 A;  5HWT A;  3HJK A;  3SS3 A;  3M2K A;  1BZA A;  2HDU A;  4JGO A;  1NXY A;  1FOF A;  4BL3 A;  4R3J A;  3VV4 A;  4BL2 A;  2WAE A;  1UWN X;  3QNC A;  3ICY A;  4P6B A;  1OT6 A;  3C8C A;  4WM9 A;  5GLD A;  4HBU A;  3VOY A;  3K3C A;  3VP0 A;  3GV9 A;  1LSV A;  2P9V A;  2CMN A;  3LIC A;  4RX3 A;  3E2L A;  4CPK A;  4EEP A;  3EOI A;  1K57 C;  4XT2 B;  1LSW A;  3RTY A;  3IX4 A;  3H82 A;  5FI7 A;  4Q0H A;  1LT0 A;  5DF7 A;  1ODV A;  1G6A A;  4HH2 A;  4EQI A;  3FV7 A;  5FI2 A;  5FQJ A;  1S1Z A;  2WUQ A;  3Q81 A;  1Q2P A;  2ACG A;  1NJ4 A;  1WYC A;  2WGW A;  4DMZ A;  1L0F A;  3DBA A;  3CHW P;  3T1S A;  1H8Z A;  3Q7Z A;  2I72 A;  3C30 A;  2ZM8 A;  1MKM A;  3P7N A;  3CIT A;  5EPH A;  3MKF A;  1VEU A;  4P6Z S;  2K2N A;  2WKR A;  2QMI A;  2W3E A;  4DF6 A;  1GHM A;  4EUZ A;  2B18 A;  4N9K A;  2ZC6 B;  5AJG A;  3GTC A;  1GHP A;  4R38 A;  4KUO A;  2VJW A;  1Z09 A;  5EV0 A;  2XRO A;  2V20 A;  3S7N A;  2ZQA A;  4P85 A;  2EFU A;  1YLP A;  3HRE A;  2Y2H A;  4RA7 A;  2O99 A;  1LL8 A;  4HEF A;  1S1Y A;  1HLU P;  1OTE A;  1IEM A;  1PZP A;  3BY8 A;  4AFI A;  4JXW A;  5FL3 A;  2Y59 A;  1JWP A;  2WKE A;  1X0O A;  4OP5 A;  4LRY C;  5AVE A;  1XXM A;  1UGU A;  1OTI A;  1ERM A;  4UEY A;  1IYS A;  2V1B A;  2QJ5 A;  2OWH A;  3QNB A;  3NEC A;  2PT7 A;  4QJG A;  3VFH A;  2EX2 A;  3UB9 A;  5CTN A;  3IF5 A;  2EX6 A;  4ID4 A;  5HDC A;  3IXG A;  5GHX A;  4KZ5 A;  1YLJ A;  3I7J A;  5HW3 A;  2P7J A;  3NI9 A;  3NOU C;  1FR6 A;  4ZJ2 A;  3W4O A;  1MWT A;  1JTG A;  2Y79 A;  4MLL A;  4F3L A;  4PM5 A;  5DKL A;  3GEC A;  3LY4 A;  3GRJ A;  1M6K A;  3N7W A;  2ZMA A;  1KE4 A;  1HVB A;  4PKY G;  1EI5 A;  2XSS A;  4UQI M;  4F94 A;  2XF3 A;  4EV4 A;  1CJF A;  1K6R A;  2XFT A;  2H5S A;  2J9P A;  2P9V B;  3BW6 A;  4GDB A;  3BFF A;  1JTD A;  3QP1 A;  4UQI S;  1PFL A;  1V9Z A;  4OPQ A;  4BJP A;  4MN5 A;  4EEU A;  4IUH A;  4HI4 A;  3ZQ5 A;  3NOP C;  4JPM A;  2KDK A;  3MFX A;  3SZT A;  3SH9 A;  3VE4 A;  3IH9 A;  1ACF A;  2FZ0 A;  3EQV A;  4IVI A;  3DTE A;  4E04 A;  4QWO A;  4BQM A;  4DE2 A;  4BMW A;  2QZ6 A;  3T1X A;  4WL9 A;  3PYP A;  3Q7V B;  5FDH A;  2Z2M B;  2XGN A;  1H8Y A;  1T1C A;  1CI9 A;  1XJ4 A;  3GMW A;  3QP5 A;  1VEU B;  2K31 A;  3IBR A;  4P87 A;  1ZTU A;  1ZG6 A;  3MQQ A;  1F9I A;  5HL6 A;  3AGD A;  4HJ4 A;  1TS7 A;  5E2F A;  2A49 A;  4DJ2 A;  3QP6 A;  3ZNY A;  4OPR A;  4L9E A;  3R7W A;  2VZW A;  1P9R A;  3FKW A;  2HV1 A;  3MSH A;  4XUX A;  4KZ4 A;  4JF6 A;  4EQ1 A;  2HPB A;  4QY6 A;  2Y91 A;  3GR2 A;  1ESU A;  2RL3 A;  3UE1 A;  2O9C A;  3MKE A;  3VSK A;  1DJC A;  2QKP A;  4ZRR A;  4N92 A;  3A3I A;  1K6S A;  1ZKJ A;  4JXV A;  4S2M A;  2XK1 A;  5DTT A;  3V5M A;  5HWW A;  3LR5 A;  4HQA A;  1QMF A;  4WZ5 A;  4PM9 A;  3CUE A;  4OLD A;  3QP8 A;  5KMW A;  3CJM A;  5E43 A;  4E3L A;  1SKF A;  3UE6 A;  1OTD A;  1S6R A;  3C38 A;  1K55 A;  4F3L B;  5HWV A;  2W1T B;  4I3J A;  1LI0 A;  4L9F A;  5IS1 A;  2X02 A;  3JYI A;  1NZU A;  1T1B A;  5EVL A;  5HAP A;  2WAF A;  2PR6 A;  4FUW A;  3N8R A;  2O9B A;  2NUT C;  1TEM A;  2ZC4 B;  4G3K A;  4ARZ A;  1VQQ A;  2ZBB A;  2VA0 A;  4ZJ1 A;  4JGR A;  5M19 A;  3A0R A;  4HP9 A;  4MCW A;  4WZ5 C;  5IU1 A;  3BWL A;  3CUE C;  1DJA A;  3BLM A;  2FFF B;  1O07 A;  3LYX A;  4IJG A;  1IYO A;  2VV7 A;  1K0K A;  4NK3 A;  4BBT A;  1DY6 A;  3LID A;  1JWV A;  3FWL A;  4KEN B;  1LSX A;  4X56 A;  1EWZ A;  4GN2 A;  2BG1 A;  3ZG7 B;  1LI9 A;  4FOF A;  4KZ6 A;  4GJ4 A;  4X53 A;  3PHY A;  1ALQ A;  3T50 A;  4I38 A;  1G68 A;  3IS2 B;  3KSG A;  5FA7 A;  2GNX A;  1Y28 A;  3G30 A;  4OQI A;  1Q2Q A;  4LCM A;  2FFY A;  3UB7 A;  5KSH A;  2D02 A;  5JYO A;  3F1N A;  4KQD A;  3T4J A;  3CPT A;  4JXS A;  3HLC A;  4GW9 A;  4LFU A;  3UB6 A;  5KZH A;  4ESP A;  1ZC2 A;  1NRF A;  2W27 A;  4Y7P A;  2ZL1 A;  3A0V A;  5CGS A;  5CRF A;  3EEA A;  4DE3 A;  2O9A A;  1E25 A;  4R3B A;  4JGP A;  3UNW A;  3P09 A;  4E3N A;  3KYZ A;  3MZE A;  4QHC A;  2J7V A;  2KX6 A;  2Y2P A;  3MMH A;  3PR6 A;  2JHE A;  3KSI A;  3E4P A;  1FSW A;  2JC7 A;  3HUN A;  3TJZ C;  1XJ2 A;  3T4K A;  3KX0 X;  3GVB A;  1PI4 A;  1OJG A;  1K4E A;  3CAX A;  3LIB A;  5M18 A;  2Z2L B;  3JVU A;  4K0X A;  3T4S A;  4MBH A;  4CJN A;  4YIN A;  3NDG A;  1ES3 A;  4JKT A;  2PBD P;  5DJU A;  5A90 A;  2JKT M;  3PBN A;  3M2J A;  3TRC A;  3QP4 A;  2I9V A;  4FD8 A;  3AGF A;  3Q07 A;  2Y2Q A;  4QY5 A;  3LUQ A;  2K7S A;  3IWO A;  2Y2N A;  3LR3 A;  3LR4 A;  5DFX A;  3UN7 A;  2KLI A;  4X55 A;  2C5W B;  4UA9 A;  4FH4 A;  3HUM A;  3NY4 A;  1KGF A;  4GNU A;  2ZQ9 A;  3B47 A;  2LB9 A;  4ARZ B;  2P74 A;  2XA7 M;  3CZD A;  3VFF A;  4DDY A;  1Z6F A;  5CER A;  4PM8 A;  5AQ7 A;  1IKI A;  2B02 A;  4KZB A;  1PWD A;  2VEA A;  5EE8 A;  4WLA A;  3HL9 A;  1W8Y A;  5HDS A;  2XA7 S;  4I39 A;  4HES A;  1D7E A;  4E3K A;  4S2K A;  3T12 B;  3ZG0 A;  5IT5 A;  4S2J A;  4BD1 A;  4KZ7 A;  3A3J A;  1FIL A;  3QHY A;  4Y17 A;  2L1M A;  2MJ6 A;  3G31 A;  4HIA A;  1KOU A;  2JKT I;  3ZVT A;  4MNR A;  5L10 A;  2X01 A;  1F2K A;  4YOF A;  3OPL A;  3VOL A;  2OSU A;  4JF5 A;  5I94 A;  3UDI A;  1PZO A;  3UE0 A;  4WF0 A;  3ZG8 B;  3SOI A;  1P97 A;  4Y13 A;  4DJ3 A;  5CGW A;  3AGE A;  2VKS A;  2EX8 A;  3D9Y A;  4ETZ A;  5HAQ A;  2EWW A;  3LI8 A;  4E6W A;  1HTZ A;  4OQG A;  1KE3 A;  1IOU A;  1W79 A;  3F1N B;  4Y5F A;  5L8M A;  3CPT B;  2R9X A;  1CK3 A;  1J9M A;  3ISG A;  2J3W A;  5EVI A;  1FCM A;  4H8R A;  3G2Y A;  5FQQ A;  4KQQ A;  3OPP A;  5CTM A;  3G4P A;  2J8Y A;  4P6Z M;  4R70 A;  2PU2 A;  1KGE A;  1KVM A;  3PTE A;  3L7H A;  3FZC A;  2HJ9 C;  5CXW A;  4I3I A;  3LCE A;  3W4Q A;  1ZHH B;  5DVA A;  3KO6 A;  3DTM A;  2XEP A;  2V0U A;  1NYM A;  3G34 A;  3UDX A;  1XGI A;  1TDG A;  4CLC A;  4Y0T A;  3SH7 A;  1N4O A;  4WZ4 A;  4Y3I A;  1G6O A;  5GLA A;  2Y8H A;  5HD5 A;  4DE1 A;  3CG5 A;  2M7U A;  1T18 A;  3UDF A;  4NXB A;  2W3G A;  4UA6 A;  2Y2O A;  4LPZ A;  5FAO A;  1YAX A;  4B4X A;  1IEL A;  1FR1 A;  2INW A;  4PM6 A;  3BFC A;  1IYQ A;  2PYP A;  4E3O A;  2M7V A;  2XD1 A;  5HD3 A;  4IVK A;  4O0P A;  4R4S A;  2VX8 A;  4LRZ E;  1SKO B;  4B88 A;  3E4O A;  4CLC C;  4OOY A;  3MF0 A;  3O86 A;  1QME A;  5CEC A;  3UMD A;  4KG5 A;  4PAU A;  3HUO A;  4OON A;  4KG2 A;  1BLC A;  5HDD A;  3HLE A;  3LFV A;  3MXS A;  3O88 A;  4KUK A;  2JCH A;  2V0W A;  1T19 A;  5TBM A;  2WK0 A;  3HCY A;  4KQO A;  1KE0 A;  5F5Y A;  3RJU A;  5F1G A;  4NG2 A;  3GQZ A;  3UE3 A;  3IX8 A;  5L07 A;  1LHY A;  4YFM A;  4E3I A;  2O0Y A;  3S7Q A;  2HDS A;  2IA2 A;  1YLT A;  1FCN A;  1N9O A;  4R3A A;  5GHZ A;  3U4L P;  4E3M A;  4MBK A;  5FAT A;  5JYP A;  4LCL A;  4LV0 A;  3KYQ A;  4EER A;  3CI6 A;  1KDS A;  3LIE A;  4M4X A;  4BLM A;  1VHM A;  4FTX A;  5HFO A;  5L2F A;  1GSW A;  3H82 B;  4L0L A;  3BQ8 A;  4PHT A;  2PR5 A;  2ZC5 B;  4GDN A;  2JN7 A;  4WYY A;  1NY0 A;  1PRQ A;  1U60 A;  2WGW B;  3OCL A;  2V2F F;  2YKF A;  2Y2L A;  5F68 A;  2HF6 A;  1BUE A;  2PHY A;  2Y2M A;  4CQH A;  3HLF A;  3FKV A;  3T4O A;  3MQ0 A;  3WRT A;  4CLC D;  4M3K A;  1ES2 A;  3MJQ A;  4WN5 A;  1YSQ A;  5AQ9 A;  3TE8 A;  5DKK A;  3VOZ A;  4U3T A;  4BBU A;  4HOI A;  3KSH A;  4C6Y A;  4PMA A;  2PD7 A;  5CHU A;  4ZTK A;  3P98 A;  1DJB A;  3PBO A;  1L3L A;  3UB5 P;  1OPX A;  4CLC B;  3BJN A;  2A2L A;  3OLO A;  3UPP A;  4Y0U A;  5HAI A;  5HSQ A;  3LIA A;  4MBF A;  1SZV A;  3O3V A;  3WS1 A;  3LY3 A;  2H10 A;  1CF0 A;  5LBR A;  4MDZ A;  2JKF A;  3U2A A;  1NRJ A;  1TS0 A;  4KZA A;  5G4Z A;  1HZO A;  4Z1W A;  4UHU A;  1OME A;  3KYE A;  1MWS A;  5DFY A;  4GLQ A;  2ZLY A;  1KDW A;  1K38 A;  4HP4 A;  3VP1 A;  4GD8 A;  3FYZ A;  1PNE A;  3S22 A;  4NEE D;  5FQ9 A;  4KG6 A;  2HDR A;  3C4O A;  2VGK A;  3BRM A;  1I2W A;  5DTK A;  2CC1 A;  4LGW A;  1L0D A;  2P08 A;  5E2H A;  3SS4 A;  3DW0 A;  3SH8 A;  5TBM B;  2QPN A;  5FEF A;  4O7D A;  3EGX C;  4S2N A;  5FQI A;  5HL1 A;  3N4I A;  5J3W A;  1MWR A;  4HBT A;  1ES5 A;  5HPI A;  2J3T C;  4IBX A;  3BQA A;  2V8F A;  3A3D A;  2WZZ A;  3VP2 A;  4NXF A;  3LO7 A;  5A91 A;  5F6A A;  4OQ0 A;  1OTB A;  3TOI A;  2OLU A;  2LB5 A;  3C4P A;  3LI9 A;  1W63 Q;  3VE3 A;  2PDR A;  2Q9N A;  3PAE A;  2XFS A;  5GL9 A;  4GD6 A;  1XKZ A;  4IHQ A;  1K55 C;  1PIO A;  3E4Q A;  4MMN A;  2XDM A;  2ZQC A;  4GS9 A;  1LL5 A;  1YLW A;  1S0W A;  4S2N C;  2H28 A;  1KGG A;  1A0K A;  3MFD A;  2DCF A;  1XJ6 A;  3NCK A;  3DAV A;  1O7E A;  3OZH A;  3LEQ A;  4RX2 A;  3M6H A;  1NWZ A;  3S7O A;  4EXO A;  5E2E A;  3IXB A;  1FCO A;  4CLC E;  2BAS A;  4OPY A;  3G6O A;  3C7U A;  5GHY A;  1XFN A;  4C3Q A;  3W2Z A;  4S2P A;  1I5Q A;  4IED A;  1F98 A;  2W1R A;  4N1X A;  4L9G A;  4X25 A;  4EU0 A;  1ERO A;  3PXP A;  4JLF A;  4KZ3 A;  4WEL A;  3VP3 A;  4P0M A;  3MZF A;  5FAP A;  1H5X A;  4X1L A;  4GB7 A;  2WGV A;  2Z6C A;  1DP8 A;  3TSG A;  1DP6 A;  3HLB A;  4MN6 A;  5CED A;  2OAP 1;  3WWX A;  4XT2 A;  4K08 A;  4OOL A;  3R7W B;  2J3T D;  3BEC A;  2IWD A;  1TVF A;  2EFX A;  4LRX C;  4WMC A;  2ZOH A;  3DWZ A;  4KZ9 A;  3H7W A;  2QWS A;  4OP8 A;  1GA9 A;  1W5D A;  1L0G A;  2ZJ9 A;  2XQZ A;  5HZH A;  4OPZ A;  3HLW A;  1E3U A;  1P9W A;  2DMW A;  5CHM A;  3G32 A;  3UME A;  4X69 A;  4JGQ A;  2L0W A;  2V1A A;  2QHK A;  3NIA A;  1SHV A;  3C7V A;  1N9B A;  3PBT A;  1CEF A;  1BUL A;  3V39 A;  1XA7 A;  4JF4 A;  2GJ3 A;  2PRF A;  5EM0 A;  3LEZ A;  1YPR A;  2H0Y A;  4GOG A;  3O87 A;  4OOM A;  4S2L A;  1JVJ A;  3UPN A; 
#chains in the Genus database with same CATH homology
 3F1P A;  3NOP C;  4Y2F A;  1T1A A;  1H8M A;  4O01 A;  4DN0 A;  1ZHH B;  2KDK A;  2ZMF A;  3MQO A;  3KO6 A;  3MFX A;  3VE4 A;  2V0U A;  2FZ0 A;  3EQV A;  4E04 A;  2A24 A;  4CLC A;  3T4L A;  2PD8 A;  4BMW A;  3FG8 A;  4LLO B;  5J4E A;  4Y3I A;  4WL9 A;  2M1C A;  1G6O A;  2GZA A;  3PYP A;  2L4R A;  2Y8H A;  4EET B;  1T1C A;  2OWJ A;  1P0Z A;  5HD5 A;  4HY8 A;  2M7U A;  1XJ4 A;  4B9O A;  1T18 A;  4NXB A;  2W3G A;  5EFW A;  2K31 A;  3IBR A;  1ZTU A;  2KOI A;  4G3W A;  1OJ5 A;  4LPZ A;  1YAX A;  2HGV A;  3MQQ A;  4ETX A;  1F9I A;  5HL6 A;  2INW A;  5A8B A;  4II7 A;  4I3A A;  4HJ4 A;  2ZOI A;  1TS7 A;  2PYP A;  2M7V A;  5HD3 A;  4DJ2 A;  4O0P A;  4GHI A;  3FC7 A;  2VX8 A;  4GS9 B;  4L9E A;  5DF9 A;  2P04 A;  4LRZ E;  3CWF A;  3R7W A;  3F1O B;  2VZW A;  3PBR A;  1P9R A;  3E4O A;  4CLC C;  1UWP X;  3E98 A;  3MF0 A;  1IFQ A;  5HPF A;  2VLG A;  5DJT A;  2HV1 A;  3UMD A;  2XRN A;  2WKP A;  3GDI A;  4PAU A;  3IBJ A;  1OT9 A;  4EQ1 A;  5HDD A;  3ZYT A;  3LFV A;  2O9C A;  1XJ3 A;  2QKP A;  4KUK A;  4ZRR A;  2V0W A;  1T19 A;  5TBM A;  3HCY A;  4KQO A;  2W3D A;  4EUV A;  2VV6 A;  5F5Y A;  3B42 A;  2R78 A;  4H6J B;  3KSF A;  4Q0J A;  4NKP A;  3TW8 A;  3RH8 B;  3E0Y A;  3UE3 A;  3O5Y A;  4IUK A;  1DP9 A;  4ME4 A;  2O0Y A;  5HWW A;  3S7Q A;  2IA2 A;  3LR5 A;  4HQA A;  1N9O A;  1H3Q A;  1NLY A;  1OTA A;  3MR0 A;  3BY9 A;  4R3A A;  3CUE A;  3D72 A;  3JVV A;  2G7U A;  2Z6D A;  4YNR A;  3NJA A;  2HJE A;  2W0N A;  5TJJ A;  2V9A A;  2OAQ 1;  1G28 A;  1S67 L;  5AVF A;  3KYQ A;  3UE6 A;  1OTD A;  4EER A;  3C38 A;  3CI6 A;  4HHD A;  3FPV A;  3LIE A;  4M4X A;  1TF1 A;  1VHM A;  3LIF A;  4F3L B;  5HWV A;  2W1T B;  4I3J A;  3H7W B;  4L9F A;  3A0S A;  5IS1 A;  2VV8 A;  1V9Y A;  1GSW A;  3H82 B;  1T1B A;  4L0L A;  3D3O A;  3BQ8 A;  4PHT A;  3EGD C;  2PR6 A;  2PR5 A;  4RQ9 A;  3OOV A;  1TS6 A;  1VB6 A;  2JN7 A;  2O9B A;  2EA9 A;  2GX5 A;  2NUT C;  4G3K A;  3T4Q A;  4HH3 A;  2ZBB A;  4ARZ A;  2VA0 A;  1S4S A;  4I5S A;  5K5B A;  4G3V A;  4JGR A;  3K2N A;  4BWI A;  3A0R A;  4HP9 A;  4MCW A;  3NHQ A;  3OCL A;  5IU1 A;  1N9L A;  3BWL A;  2YKF A;  5F68 A;  2HF6 A;  3ULF A;  2PHY A;  4CQH A;  3T4T A;  3CUE C;  3T4O A;  3MQ0 A;  4CLC D;  3LYX A;  3MJQ A;  4WN5 A;  1YSQ A;  1JNU A;  4IJG A;  3TE8 A;  5DKK A;  2VV7 A;  3F1P B;  3FPW A;  4BBU A;  4HOI A;  3KSH A;  4HJ3 A;  3H9W A;  2PD7 A;  4BBT A;  3LID A;  3NOT C;  3OCN A;  4WEK A;  1DRM A;  1TD5 A;  3PBO A;  1LSX A;  3UB8 A;  4EES A;  1NLZ A;  1OPX A;  2A24 B;  4CLC B;  3BJN A;  4R6L A;  4FOF A;  4BBV A;  4EW7 A;  2A2L A;  1WA9 A;  1S66 L;  3OLO A;  3K3D A;  4GJ4 A;  5HSQ A;  3LIA A;  3PHY A;  4NXG A;  5HWT A;  2JKR M;  5I5L A;  3HJK A;  3T50 A;  4I38 A;  3IS2 B;  4YWZ A;  3B33 A;  3KSG A;  4JGO A;  5LBR A;  2GNX A;  1Y28 A;  4MDZ A;  5CX7 A;  3U2A A;  1NRJ A;  1TS0 A;  3UB7 A;  5G4Z A;  4PKY A;  5KSH A;  3VV4 A;  3S7P A;  2D02 A;  4Z1W A;  3F1N A;  1UWN X;  4KQD A;  3T4J A;  3ICY A;  2QJ7 A;  1MC0 A;  1OT6 A;  4GW9 A;  3UB6 A;  3C8C A;  5DFY A;  2W27 A;  4GLQ A;  3A0V A;  4GHI B;  3C2W A;  4MN7 A;  3EEA A;  4HP4 A;  3K3C A;  2O9A A;  1LSV A;  2CMN A;  4JGP A;  3LIC A;  4NEE D;  5G4Y A;  3EEH A;  4EEP A;  3EOI A;  4XT2 B;  3KYZ A;  1LSW A;  2W1T A;  2KX6 A;  2FH5 A;  3RTY A;  3MMH A;  3PR6 A;  3H82 A;  2JHE A;  4Q0H A;  3KSI A;  2P08 A;  3E4P A;  1LT0 A;  1ODV A;  1GSX A;  4HH2 A;  3TJZ C;  1XJ2 A;  5TBM B;  1S1Z A;  3V67 A;  3T4K A;  3KX0 X;  3OBF A;  4B93 A;  1OJG A;  5MC7 A;  2J80 A;  3CAX A;  3LIB A;  3EGX C;  1STZ A;  3JVU A;  3T4S A;  4DMZ A;  1YSP A;  5J3W A;  1MZU A;  3DBA A;  5HPI A;  2J3T C;  4WEJ A;  3BQA A;  5DJU A;  5C5K A;  3OC2 A;  3HJI A;  4NXF A;  2JKT M;  3PBQ A;  3PBN A;  3EWK A;  2JKR I;  3C30 A;  2ZMV A;  5F6A A;  1OTB A;  3TRC A;  1MKM A;  2I9V A;  3P7N A;  3CIT A;  4HNB A;  3ZQ5 A;  2LB5 A;  4P6Z S;  2K2N A;  2WKR A;  3LUQ A;  2K7S A;  2W3E A;  3LI9 A;  3LR3 A;  4Q0I A;  1W63 Q;  3LR4 A;  3VE3 A;  2B18 A;  5DFX A;  2PDR A;  2KLI A;  5AJG A;  1S4R A;  2W3F A;  4R38 A;  4KUO A;  2VJW A;  4IHQ A;  2XRO A;  5F69 A;  3E4Q A;  4MMN A;  3PBS A;  4GS9 A;  3S7N A;  3B47 A;  3F1O A;  2WKQ A;  4HJ6 A;  2LB9 A;  2H28 A;  4ARZ B;  2XA7 M;  1XJ6 A;  2D01 A;  4FSF A;  4WUJ A;  3IS2 A;  4NXE A;  2O99 A;  2B02 A;  1LL8 A;  1S1Y A;  1NWZ A;  1OTE A;  2VEA A;  4WLA A;  3S7O A;  3R4K A;  4EXO A;  3BY8 A;  4AFI A;  4CLC E;  2BAS A;  3G6O A;  5HDS A;  2XA7 S;  1TS8 A;  4I39 A;  1XFN A;  3LR0 A;  1BYW A;  4GCZ A;  5FL3 A;  1EW0 A;  3W2Z A;  1F98 A;  1X0O A;  2W1R A;  1D7E A;  1GSV A;  4L9G A;  4O8G A;  4H6J A;  4EU0 A;  4LRY C;  3MXQ A;  5AVE A;  3PXP A;  4WEL A;  1UGU A;  5IT5 A;  5J7E A;  2YKH A;  2VGL M;  1OTI A;  4QPR A;  4UEY A;  2L1M A;  2MJ6 A;  1DP8 A;  2Z6C A;  1KOU A;  2JKT I;  2QJ5 A;  2V1B A;  4HIA A;  2OWH A;  4YOF A;  1D06 A;  1DP6 A;  3VOL A;  4MN6 A;  2PT7 A;  2OAP 1;  3UB9 A;  4XT2 A;  1W63 M;  4K08 A;  4OOL A;  3R7W B;  2VGL S;  5HDC A;  4WF0 A;  3P01 A;  2J3T D;  1P97 A;  4DJ3 A;  3RFB A;  2P7J A;  4LRX C;  2VKS A;  3NOU C;  2ZOH A;  5KIZ A;  2OOL A;  2Y79 A;  4F3L A;  4ETZ A;  2EWW A;  3LI8 A;  1YKD A;  3H7W A;  2QWS A;  5DKL A;  3GEC A;  1XFQ A;  2PYR A;  1IOU A;  3F1N B;  4Y5F A;  2W3H A;  5L8M A;  3EQU A;  1N9N A;  2NUP C;  2J3W A;  5HZH A;  1P9W A;  2DMW A;  4PKY G;  2XSS A;  4UQI M;  3UME A;  4JGQ A;  2L0W A;  2V1A A;  2QHK A;  3PBT A;  4P6Z M;  3BW6 A;  3SW1 A;  4R70 A;  2QYB A;  2GJ3 A;  3CLO A;  4UQI S;  4OOM A;  1V9Z A;  4BJP A;  1F5M A;  2EWV A;  2HJ9 C;  4MN5 A;  4EEU A;  4IUH A;  4HI4 A;  4I3I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...