1TS6A

Structure of the pb2 intermediate from time-resolved laue crystallography
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
125
structure length
125
Chain Sequence
b'MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
publication title Visualizing reaction pathways in photoactive yellow protein from nanoseconds to seconds.
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Photoreceptor
total genus 37
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2004-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1ts6A00
3LIAA 3LUQA 2YKHA 4R3AA 3E4QA 2PDRA 5TBMB 3BY9A 5J3WA 2OWJA 4KQDA 5G4ZA 3KX0X 4NXGA 1LSXA 3EWKA 1WA9A 4WL9A 5IU1A 3P7NA 1OTEA 1OTDA 2JN7A 4HI4A 5DJUA 3VE4A 1F98A 1ODVA 2ZBBA 2QHKA 3UE6A 4I3JA 1S4RA 4EETB 3UMEA 4I39A 1P97A 3HJKA 3FC7A 3GECA 2L0WA 5DJTA 5A8BA 3G6OA 1V9YA 5KIZA 1T18A 3OLOA 5TBMA 2ZOHA 2QKPA 4DJ3A 4R6LA 4LLOB 2W0NA 1DP6A 4HJ4A 2HV1A 2D01A 1V9ZA 1D7EA 2VV7A 4HH3A 4DJ2A 3E4PA 2ZOIA 4GCZA 4I3AA 5F68A 3GDIA 1GSXA 4R70A 3A0SA 3IBRA 3F1NA 1JNUA 3MR0A 5HZHA 4F3LB 2B02A 4EW7A 4I5SA 4LRYC 3E4OA 4I38A 1TS7A 1X0OA 4L9FA 3NJAA 3LYXA 3FG8A 2PD7A 5HDDA 3C8CA 3UB6A 3NOTC 4HH2A 4WLAA 2V0WA 2K7SA 3CAXA 3A0RA 2H28A 2PYPA 2KX6A 1DP8A 4GS9A 1XJ3A 3CLOA 4JGRA 4HOIA 1S66L 1GSVA 3LI9A 1OJ5A 4HY8A 2L4RA 2P7JA 2QWSA 2YKFA 4EEPA 4F3LA 3H9WA 4PKYA 1KOUA 3UMDA 5HSQA 1TS6A 4HJ3A 3MQOA 4L9EA 4HP9A 3H82A 1XFQA 1OTIA 4HHDA 4MN6A 1LT0A 1OJGA 4HIAA 4EERA 4LRZE 4WN5A 3F1NB 3UB7A 3RTYA 1DP9A 4L9GA 3LIEA 3CWFA 1LSVA 3F1OA 3MXQA 3UB8A 4MN5A 2Z6CA 1OTAA 5J4EA 1T1AA 1F9IA 5HWVA 5HWWA 3ZQ5A 4PKYG 4KUOA 4WUJA 4EEUA 4GS9B 3LIDA 1T1BA 2L1MA 1XJ2A 1T1CA 3LIBA 4JGOA 4HNBA 1BYWA 5EFWA 5AVFA 3H82B 2PR5A 2R78A 2EA9A 1UGUA 4HQAA 1GSWA 1LSWA 5IS1A 3MQQA 4BBVA 4HJ6A 1XJ4A 3NOPC 2KDKA 3LIFA 2PD8A 4K08A 3F1OB 3K3DA 3PYPA 2J80A 2VV6A 4NXEA 3LI8A 1MZUA 1UWNX 4EXOA 2M1CA 5HDSA 2PYRA 5G4YA 5HDCA 3RH8B 2INWA 1N9NA 2PHYA 2QJ7A 2VLGA 4EESA 3MFXA 3BWLA 1NWZA 4GHIA 1VB6A 3IS2A 2VV8A 4R38A 4M4XA 3D72A 1TS0A 1D06A 3B33A 3T50A 5F69A 1S1ZA 1G28A 4BBUA 1OTBA 3H7WA 3LICA 4NXFA 1Y28A 4RQ9A 2A24B 2WKRA 2PR6A 1OT9A 4H6JA 3ICYA 2OOLA 2V0UA 3MJQA 1OT6A 4KUKA 2GJ3A 3F1PA 4EQ1A 5I5LA 1T19A 2V1AA 3NOUC 4XT2B 4E04A 2W27A 3NHQA 1LL8A 4NXBA 5DKLA 5DKKA 4LRXC 2V9AA 3UB9A 2WKQA 5HWTA 1XJ6A 1DRMA 1EW0A 4I3IA 4WF0A 1S67L 4GW9A 2JHEA 5AVEA 2A24A 3SW1A 2CMNA 4GHIB 3IS2B 5F6AA 4LPZA 3A0VA 3ULFA 5HD3A 2V1BA 4YWZA 4HP4A 4JGQA 2VEAA 1UWPX 2Z6DA 3VOLA 1N9LA 4XT2A 3C2WA 2D02A 2I9VA 3H7WB 1N9OA 2QJ5A 3BY8A 5F5YA 4H6JB 3PHYA 3VE3A 5J7EA 5HD5A 2OWHA 3EEHA 1S4SA 3K3CA 3F1PB 4JGPA 1TS8A 2BASA 2WKPA 4BBTA 1S1YA 1P0ZA 1XFNA 3HJIA 4B9OA
chains in the Genus database with same CATH superfamily
3MMHA 2WKEA 1CQAA 5GLAA 2ZM0A 3ITAA 3KSGA 2YKHA 2XA7S 4IJGA 4X25A 5TBMB 3CPTA 5J3WA 2OWJA 5CHUA 3FKWA 1BLPA 4UA7A 4JKTA 1KGEA 2EXAA 1S6RA 1PWCA 3P7NA 1OTEA 1OTDA 4HI4A 5DJUA 1H8YA 4LGWA 4O7DA 2FZ0A 4GD8A 1CJFA 1PRQA 3UE1A 2WUQA 3UE6A 5HAIA 3FKVA 4YFMA 1MC0A 1SDNA 1FOFA 2J3TD 3W8KA 4N9LA 3FC7A 3GECA 4OP5A 4DE0A 2Z2LB 3FYZA 3VP2A 2OV5A 1V9YA 3LR3A 3OLOA 5TBMA 4KQOA 4E6WA 2QKPA 1Y54A 4WMCA 3HREA 3Q7VB 3L7HA 3R4KA 3G32A 3QP4A 4LLOB 5CEBA 1Z6FA 1MKMA 3WS0A 5K5BA 3PAEA 1IYQA 2VV7A 4I3AA 5F68A 2XA7M 2XROA 4II7A 5EPHA 3F1NA 4UAAA 4QWOA 4YNRA 2XFTA 4MMNA 1FCMA 3NJAA 3LYXA 4Y5FA 1U60A 5GHXA 3K2NA 3OCNA 4O8GA 3C8CA 3HLBA 1K57A 2V0WA 3IX3A 1SKFA 3EGDC 5AJGA 5JYOA 4PM8A 1PIOA 3CAXA 3MXSA 2J7VA 4ETXA 4GS9A 1XJ3A 4JGRA 2JBFA 2XK1A 2HF6A 4JXGA 1GSVA 2L4RA 5DFXA 4MCWA 2NUTC 4S2PA 4ARZA 2G7UA 4N92A 2HP9A 2ZQ7A 5HSQA 4NEED 4WZ4A 5HAQA 1TDGA 1P9WA 3H82A 4ZTKA 1I2SA 4HHDA 1LT0A 2VGKA 5L09A 3IH8A 1OJGA 5KSHA 3U2AA 4HIAA 3SH8A 4ETZA 3UB7A 1YQSA 1OMEA 4MNRA 1CI8A 3GV9A 2Y2QA 2Z2MB 4HESA 1ZTUA 4ZBEA 5GLCA 3ZHHA 3Q7ZA 1PWDA 3UB8A 2A2LA 2ZJ9A 1JTDA 2Z6CA 1T1AA 5DTTA 5A93A 3G4PA 5FATA 2XRNA 1PWGA 4GKUA 2A49A 3FPVA 3OPLA 1W7FA 3T4LA 4DDSA 5CGWA 4WEKA 3VMAA 3L9KA 4IBXA 4UA6A 1FCNA 1NXYA 1MXOA 1K55A 2XDMA 4GJ4A 4XUZA 3C7VA 3QNCA 3VSLA 2EX6A 2O9CA 3KSFA 4KG2A 2H5SA 4YINA 3PBQA 2R78A 4LENA 1FR6A 2M7UA 1GSWA 3QP5A 1K56D 4BBVA 3WS5A 1FSYA 2DNSA 1BULA 1YLYA 1W63Q 3T4JA 1MWSA 3K3DA 4QU3A 2J80A 3IHAA 4KZ3A 2QPNA 5FDHA 5FQQA 1IEMA 2VV6A 4C75A 1PW1A 1RP5A 2VGJA 2Y59A 4PPRA 5HDSA 1K54C 2CC1A 3HUMA 2INWA 2VKSA 3UO9A 1N9NA 2QJ7A 2VLGA 3C5AA 1KVLA 3CMZA 4C6YA 3C38A 1K4EA 3O5YA 2W3EA 4P6BA 5CTNA 2VV8A 2ZD8A 2G2UA 2H0TA 3PAGA 3JVVA 1W5DA 3MKEA 3TE8A 2GNXA 5TR7A 4OPRA 1G28A 3EGXC 1OTBA 3H7WA 4Y0OA 2MJ6A 3HLEA 2PR6A 4H6JA 3ICYA 1CEGA 4DN0A 4NG2A 1OT6A 4ZJ3A 1VHMA 1TDLA 3BFCA 1ERMA 3KSIA 5DVAA 4OQHA 3QNBA 3NI9A 3BRMA 4S2OA 3MZEA 1J3WA 4CLCA 4QJGA 4NXBA 4G3VA 3DTIA 4E3OA 1XA1A 4RVAA 5DKKA 3O86A 4LRXC 5FAPA 1HVBA 3UB9A 3MKFA 4IVKA 2VJWA 4A5RA 5EVLA 3V5MA 2J9OA 3VV4A 5HW3A 5A91A 3M6BA 2HDSA 2ZMFA 4C3QA 2WGWA 4X1LA 2CMNA 3M6HA 4QPRA 4KZ8A 4FH2A 4MBFA 3ULFA 2ZLYA 4Y7PA 1D1JA 1DJCA 5FQMA 5EV0A 3T4QA 2B5RA 4JGQA 3JPUA 3GRJA 1N9LA 2C5WB 3C2WA 2D02A 2EXBA 2I9VA 1YPRA 1YM1A 2B18A 5CGSA 3UN7A 3UE0A 2PRFA 4U0XA 1ES5A 1MPLA 3I7JA 3PHYA 3V50A 4OQGA 5HD5A 4E3MA 2OWHA 3Q07A 3EEHA 3W2ZA 3F1PB 3Q1FA 3BFFA 2BASA 3G2ZA 1K0KA 1KDSA 5M19A 4HBUA 4DKIA 5TFQA 2EWVA 2O9AA 2Q0OA 2VK3A 4PM5A 4AFIA 3LIAA 3LUQA 5EE8A 1I5QA 1AXBA 3IF6B 5E2GA 4BLMA 4DXCA 3LY4A 2WKIA 1YLPA 5EM1A 4WZ5C 4ZRRA 1WA9A 4WL9A 3MSHA 2E8IA 5FQKA 3B42A 4NKPA 5E43A 3DBAA 3HL9A 4I3JA 4QHCA 4Y17A 1VQQA 5CHJA 1YMXA 3N8LA 4EETB 3HCYA 1JTGA 1K54A 5CGXA 1XXMA 2Q9NA 3GR2A 1MWUA 4LV3A 2IWBA 1KE4A 5DJTA 1TVFA 3OPHA 4U3TA 3EOIA 4R0QA 3TRCA 2ZOHA 3KO6A 2ZC3B 3ZFZA 4R6LA 2P9VA 4FTXA 1SCWA 5CRFA 4R3BA 3DTEA 2W0NA 3DAVA 2H10A 1ES3A 1V9ZA 4R23A 2ZQDA 1D7EA 4HH3A 2VGLS 3E4PA 4EQIA 3GDIA 4PHTA 3BQAA 4R70A 3SS5A 4YOFA 3IBRA 5DF9A 4OOMA 4CLCE 3WS2A 3CPTB 4EW7A 4I5SA 3S7PA 1BSGA 2XEPA 3QP6A 5KZHA 3VP1A 1TS7A 1X0OA 1L3LA 1FILA 3A3DA 4R4SA 4ZAMA 3EQVA 4WMCD 3G34A 3UB6A 3BFEA 3KYEA 2J3TC 5F83A 1DY6A 3BECA 2X71A 2WYXA 2HDQA 3UY6A 4WM9A 4KZBA 4PM9A 3PXPA 2H28A 1L0EA 4Y3IA 4MBHA 3ZG7B 5FQIA 2KX6A 5DTKA 1XX2A 4S2KA 3A3FA 2FFYA 3SZTA 1G6OA 4HOIA 3T1RA 5DF7A 1VETA 3S7OA 3LY3A 1XA7A 4HY8A 2WGIA 2QWSA 2YKFA 4EEPA 4IVIA 4N1HA 2RCXA 1Q2QA 3H9WA 4PKYA 4S2LA 4OQ0A 4JXVA 3IF5A 3IX8A 3GTCA 1FSWA 1IYOA 2BTFP 4HJ3A 2BG1A 4L9EA 2VGLM 4S2JA 1YLTA 5EVIA 5U47A 1IELA 4KG6A 1OTIA 1WYCA 1E3UA 1KE0A 4RYEA 3QHYA 5F1FA 2VA0A 2W3HA 4EERA 3NDEA 3F1NB 3D9YA 1EWZA 4X6TA 4L9GA 3LIEA 4BMWA 3OBFA 4WYYA 3MXQA 4B93A 4Y2FA 3S4XA 4OPZA 4S2NC 3PBOA 4MN5A 4JXWA 3GMWA 1F9IA 1NJ4A 1IYPA 2W3DA 4QB8A 3IXGA 4KUOA 3NBLA 1AWIA 1P9RA 3T4SA 4EEUA 4GS9B 2EX9A 2Y55A 4FOFA 3HLCA 3E0YA 1H8ZA 1T1CA 4EWFA 3IH9A 4ARZB 2PBYA 2WADA 3LIBA 5E2EA 1BT5A 3IXHA 2J9PA 5EFWA 5AVFA 1ES4A 3H82B 3S7NA 5HAPA 1O7EA 3E2KA 1CI9A 3CUEC 1FR1A 1UGUA 3O88A 3O87A 4BL3A 3UDXA 5IS1A 3MQQA 2X01A 4HJ6A 1MBLA 1XJ4A 1NRFA 1ZC2A 4Y15A 3T4OA 4E3KA 2WZZA 1C3BA 3BW6A 5FEGA 2DRWA 2Y79A 3PYPA 5AQBA 1PW8A 3HLGA 4NXEA 1MZUA 4FD8A 1LI0A 3DTMA 1JVJA 2M1CA 2PYRA 4UHUA 4JBFA 3TSGA 5GLBA 3SS3A 4U0TA 2PHYA 3MFXA 1CEFA 3BWLA 3UDFA 3ZCZA 3HLDA 4GHIA 5CX7A 1VB6A 5FQJA 3IS2A 4OONA 4GZBA 1ESIA 4HEFA 3D72A 1D06A 2EFXA 2Q9MA 5E2HA 3R7WA 4G3KA 3NY4A 5F69A 4B4XA 1S1ZA 4H8RA 3LICA 3P01A 4HBTA 4NXFA 3DWKA 4RQ9A 4X68A 1FCOA 1OT9A 4JF6A 3KYQA 4K91A 2V0UA 5CXWA 1RGYA 4KUKA 1TD5A 2GJ3A 5LBRA 3NULA 3A3JA 5CTMA 5I5LA 4OQIA 3TJZC 3VP4A 2HDUA 2V1AA 1BLHA 4XT2B 4WELA 4Y0UA 3NHQA 1LL8A 2ZQCA 3TG9A 2EX2A 3CZDA 2IWCA 4R3JA 2XQZA 2Y8HA 3NECA 5D3OA 5HWTA 1DRMA 3FPWA 1EW0A 2O0YA 1IYSA 4I3IA 5IHVA 1S67L 5GLDA 4OLGA 5AVEA 4CJNA 3OC2A 4GD6A 3BYDA 3SW1A 3LGOA 4GDBA 3A0VA 3QP1A 5HD3A 4CLCD 4K0XA 2W3GA 4KQRA 4XT2A 3UDIA 3H7WB 1H3QA 1LHYA 4ID4A 1N9OA 1BZAA 1KVMA 2JCHA 4IBRA 4FCFA 1Q2PA 5FAQA 4WBGA 4H6JB 3ZVTA 4BWIA 2JKFA 3VE3A 4CPKA 1S4SA 2KOIA 4DE2A 3UE3A 1LLBA 3TW8A 2LB9A 2V2FF 4DMZA 1S1YA 3AGEA 1S0WA 1XFNA 4CLCB 4DRTA 1G5UA 4MDZA 4B9OA 3BFDA 2IWDA 4EUVA 2QMIA 3IBJA 3E4QA 5FI6A 3BY9A 4KQDA 5G4ZA 1W79A 1MWTA 3EWKA 2ZMAA 3Q82A 4UA9A 3FZCA 3P09A 3BJNA 3QP8A 3OPRA 2JN7A 5FAOA 3VE4A 2JKTI 4X69A 4P85A 2WGWB 1F98A 4KZ6A 1ODVA 4E3LA 3DTKA 3ZGAB 2ZBBA 1NZOA 2QHKA 2OAP1 4K0WA 1YKDA 2V8FA 4OH0A 5FDSA 4BL2A 4DXBA 4I39A 1P97A 1W8YA 3BFGA 4DF6A 1ONHA 2HDRA 3RXWA 2KLIA 5E2FA 4BJPA 4ZDXA 1HD8A 3N4IA 2JE5A 2L0WA 3AGDA 1K38A 5A8BA 4GB7A 1GHIA 1T18A 3NCKA 1O07A 3NC8A 4S2MA 4PM6A 4DJ3A 1K56A 1XGJA 3LEZA 3MZFA 2UWXA 2XD5A 3MXRA 3MS6A 2JC7A 1ZHHB 1ZG4A 2G2WA 4KZ5A 2ZL1A 1IKIA 1ACFA 5FASA 1GSXA 2ZM8A 3T1SA 2AVXA 4OVDA 1JNUA 4GN2A 5HZHA 1GCEA 2X02A 3EEAA 2WAEA 1ONGA 1W63M 5AQAA 2WKHA 1JWPA 4QY6A 3E4OA 4L0LA 4L9FA 4GOGA 4D60A 2OSUA 2PD7A 3G30A 1BLCA 4CQHA 3HUNA 3HVFA 3NOTC 4HH2A 2O9BA 1XP4A 3HUOA 3V3SA 3N7WA 5HL1A 1CK3A 3UNWA 3A0RA 4MBKA 3C30A 2PAVP 5DF8A 4EBNA 4KENB 4EV4A 1DP8A 1ZKJA 2OAQ1 3OCLA 3CLOA 1S66L 2JKTM 1L2SA 1NYYA 3LCEA 3W4QA 2V8CA 4KZ9A 2Y2HA 5DTSA 4EU0A 5HARA 1XGIA 5AQ7A 4LV1A 1IKGA 4ZJ1A 3E98A 2P9VB 2ZC7A 1HZOA 5DFYA 1TS6A 3MQOA 1FQGA 4HP9A 1XFQA 4Q0IA 1TF1A 1MKIA 5L07A 1IFQA 1L0FA 1BTLA 2HP5A 3S22A 2JKGA 2PT7A 3RTYA 1DP9A 3N6IA 2E8JA 4XUXA 1LSVA 3F1OA 1E25A 1PFLA 2K2NA 3ZNYA 1H0MA 3W4PA 1DJBA 1F5MA 3D3OA 4Y0TA 5J4EA 5FEFA 5EVID 1SKOA 3S7QA 5HWVA 3ZQ5A 3V67A 2VZWA 1PZPA 4KZAA 4KZ7A 1XPBA 1ESUA 1ALQA 3Q81A 4ESPA 3ISGA 3LIDA 1T1BA 4Q0HA 2W1RA 1K57C 1VETB 2L1MA 2WAFA 1XJ2A 1G68A 5HPFA 3ZG8B 4JGOA 1QMFA 3GSGA 3IHBA 2I72A 4X56A 4RX2A 2PBDP 5EVIB 2OLVA 3SOIA 1LI9A 4X1MA 2PR5A 2JKRI 2EA9A 3IX4A 2HGVA 3LR4A 3IXBA 3M2KA 4HQAA 4B88A 1SHVA 3W4OA 3G35A 3GQZA 3NOPC 4DE1A 2BLSA 5I94A 5BOHA 1M40A 2KDKA 2ACGA 3LIFA 5CHMA 4K08A 5HPIA 2ZM2A 5KMWA 5EUAA 3ZNTA 2Y2NA 3CG5A 2P74A 4IUKA 5IT5A 3LI8A 1G6AA 1UWNX 3MQ0A 4EXOA 3U4LP 4FSFA 4UEYA 5A90A 5G4YA 1VEUA 1VM1A 5HDCA 2DMWA 1K25A 1ES2A 2HP6A 4MLLA 1NWZA 1PI4A 2XLNA 4M4XA 2PU4A 3WS4A 1K6SA 2ZC5B 1TS0A 4RA7A 3ZYTA 3A3IA 2V1ZA 3IWIA 3BEBA 4BQMA 2ZQ8A 4LFUA 3FWLA 4E3JA 1YSPA 2QZ6A 3M2JA 1Y4OA 2R9XA 4QY5A 2Y2KA 3ZG5A 4LCLA 3G2YA 3LR5A 3VOZA 3VFFA 3C4PA 5CEDA 1K55C 3ZG0A 1WE4A 4R1GA 1L0DA 2J3WA 4WZ5A 3NOUC 3CHWP 4GDNA 3IQAA 2ZC6B 3G31A 1NYMA 2WK0A 3RJUA 2JKRM 2RL3A 4B4ZA 5EM0A 3MBZA 3A3EA 1I2WA 3MF0A 1DJAA 2EX8A 1GA9A 2P04A 2JHEA 3P98A 4D2OA 5EOOA 3E2LA 4DE3A 4GHIB 3KYZA 3IS2B 2IA2A 1QMEA 1HTZA 3DWZA 3R7WB 1NLYA 1UWPX 2Z6DA 3HLFA 4IUHA 3VOLA 4DDYA 5HFOA 3IT9A 3WRZA 3V3RA 1PNEA 3ZDJA 4UQIS 3CJMA 1BLSA 3BY8A 4X53A 4KZ4A 5AQ9A 2OLUA 3ZVWA 3K3CA 1LL5A 1TS8A 3Q7VA 4JF5A 4E3NA 1WYBA 5GL9A 1YLZA 3C4OA 5KSCA 3HJIA 3MZDA 2XR0A 1YAXA 4R4RA 3PBSA 4OKPA 1J9MA 5FL3A 4R3AA 2ZQ9A 1PI5A 2PDRA 1LL9A 4JLFA 2Y2GA 4IHQA 1YSQA 3OOVA 1W8QA 3KX0X 4NXGA 1LSXA 2C6WB 2Y2IA 4CLCC 3B47A 4OLDA 1H5XA 5IU1A 2J8YA 4IEDA 2VX8A 3CI6A 3NDGA 3FV7A 4GNUA 1S4RA 1FIKA 1SDEA 1NY0A 1M6KA 4P0MA 4UQIM 2GX5A 3UMEA 4NK3A 4G3WA 2LB5A 3HJKA 2P08A 1F2KA 1EROA 4N9KA 1GHPA 2FH5A 3G6OA 1K4FA 1RCJA 5KIZA 5G18A 2XD1A 3O3VA 2A3UA 1DP6A 2XH9A 4HJ4A 2HV1A 2GDNA 3IWQA 2D01A 1YT4A 3SH7A 4DJ2A 3ITBA 2ZOIA 4GCZA 2ZC4B 4JPMA 2O99A 5EVEA 3B3XA 1NRJA 3A0SA 4S2NA 3LR0A 1HLUP 3MR0A 3OPPA 4MEZA 4F3LB 2B02A 3N8SA 1KE3A 1YMSA 4EBPA 4LRYC 3BQ8A 2Y91A 3DW0A 4I38A 3RFBA 5J8XA 1STZA 3T1XA 3FG8A 1SZVA 1TEMA 2UV0E 3LEQA 5HDDA 2W1TB 1GHMA 4LV0A 4WLAA 2K7SA 4BENA 2PYPA 4GLQA 1YLWA 1E4DA 1Z09A 3PBNA 4P87A 3WS1A 1CF0A 2ZQAA 5GHYA 3CUEA 5FQ9A 3LI9A 1OJ5A 3T4TA 1N9BA 5M18A 3SH9A 2P7JA 4FUWA 1JWZA 4F3LA 4E3IA 1KOUA 3BLSA 3UMDA 1NLZA 2XGNA 4Q8IA 3N8RA 2QYBA 4MN7A 4M3KA 2K31A 3QP2A 1JWVA 2W1TA 4MN6A 2XSSA 2ZL1B 3IF6C 5M1AA 3VFHA 4XXRA 5L10A 4LRZE 4WN5A 1K6RA 1OPXA 2Y4AA 1MWRA 3CWFA 1YLJA 5GHZA 1MY8A 2HJ9C 1H8MA 2EFUA 1KGGA 1OTAA 1GA0A 2DCFA 4ZJ2A 5HWWA 2HZ5A 4WEJA 4PKYG 2Y2MA 4WUJA 2WGVA 4JF4A 4OP8A 4EBLA 3PBTA 2ZMVA 1A0KA 2R9WA 4PM7A 2EWWA 5EECA 4HNBA 1BYWA 1L0GA 2PU2A 3AGFA 2M7VA 3UPNA 3WRTA 4S2IA 2WZXA 4KG5A 1LSWA 3IXDA 5L2FA 2Y2OA 5HX9A 2FFFB 3VP0A 3IWOA 4EUZA 3SS4A 3RXXA 2Y2PA 3JVUA 2PD8A 2W3FA 5EVIC 3F1OB 4PMAA 5FA7A 1ERQA 3BLMA 3MFDA 3UPOA 2Y2JA 3KSHA 1ZG6A 4BD0A 4JXSA 4KQQA 1NZUA 2B95A 1SKOB 3V39A 5F1GA 3RH8B 4LCMA 5MC7A 4EESA 3D4FA 5HL6A 3JYIA 4R38A 2XF3A 4ME4A 4Q0JA 2Y2LA 3B33A 5TJJA 3VOYA 3T50A 5L8MA 4X55A 5TGFA 5A92A 3LO7A 4BBUA 3PTEA 4OPYA 3OZHA 5C5KA 1Y28A 4OPQA 2A24B 4NETA 3TOIA 3C7UA 2WKRA 2OOLA 3T12B 3MJQA 2HPBA 4F94A 3F1PA 3WWXA 4EQ1A 3S1YA 4OOYA 5FSRA 3NIAA 1T19A 4E04A 4BD1A 3PR6A 5CERA 5F82A 2W27A 1PYYA 1E3UD 4PAUA 3GVBA 4P6ZS 5DKLA 1KGFA 4Y13A 2V9AA 2WKQA 3IF6A 1XJ6A 4RX3A 1VEUB 4WF0A 2XFSA 4GW9A 1XKZA 5FI7A 1IOUA 1N4OA 2A24A 3T4KA 5FI2A 3HBRA 2NUPC 4O01A 3CITA 3VSKA 2HJEA 3LFVA 4QD4A 5F6AA 4LPZA 4N1XA 5JYPA 3ZG9B 1PZOA 2V1BA 4OOLA 4YWZA 3EQUA 4Z1WA 4HP4A 2VEAA 3UB5P 3T1QB 4O0PA 2V20A 1KDWA 3PBRA 3UPPA 1BUEA 3VP3A 2QJ5A 5EOEA 5F5YA 2H0YA 3BM6A 5J7EA 4E6XA 1RGZA 4JGPA 1EI5A 2WKPA 2GZAA 4LV2A 4Z9QA 4BBTA 4FH4A 1P0ZA 4P6ZM 5CECA 3HLWA
chains in the Genus database with same CATH topology
3LIAA 3MMHA 3LUQA 3PBSA 3KSGA 2YKHA 5FL3A 4R3AA 4EUVA 2XA7S 3IBJA 4IJGA 3E4QA 2PDRA 5TBMB 3BY9A 5J3WA 2OWJA 4IHQA 4ZRRA 1YSQA 4KQDA 3OOVA 5G4ZA 3KX0X 4NXGA 1LSXA 4CLCC 3EWKA 1WA9A 4WL9A 3B47A 5IU1A 3P7NA 2VX8A 3BJNA 1OTEA 1OTDA 2JN7A 3B42A 4HI4A 4NKPA 5DJUA 3VE4A 2JKTI 1F98A 2FZ0A 1ODVA 3DBAA 3CI6A 2ZBBA 2QHKA 3UE6A 2OAP1 4I3JA 1S4RA 1YKDA 4EETB 3HCYA 4UQIM 2GX5A 1MC0A 3UMEA 4I39A 1P97A 4G3WA 2LB5A 3HJKA 2J3TD 2P08A 3FC7A 2KLIA 3GECA 4BJPA 2L0WA 5DJTA 2FH5A 3G6OA 5A8BA 3EOIA 1V9YA 5KIZA 3LR3A 1T18A 3OLOA 5TBMA 2ZOHA 4KQOA 3KO6A 3TRCA 2QKPA 4DJ3A 4R6LA 3R4KA 4LLOB 2W0NA 1DP6A 1MKMA 4HJ4A 1ZHHB 2HV1A 2D01A 1V9ZA 5K5BA 1D7EA 2VV7A 4HH3A 2VGLS 4DJ2A 3E4PA 2ZOIA 4GCZA 4I3AA 5F68A 3GDIA 1GSXA 2O99A 2XA7M 4PHTA 2XROA 3BQAA 4II7A 1NRJA 3A0SA 4R70A 4YOFA 3IBRA 3LR0A 3F1NA 1JNUA 3MR0A 5DF9A 4OOMA 4CLCE 5HZHA 4F3LB 3EEAA 2B02A 1W63M 4EW7A 4YNRA 4I5SA 3S7PA 4MMNA 4LRYC 3BQ8A 3E4OA 4I38A 4L0LA 3RFBA 1TS7A 1X0OA 1STZA 4L9FA 3NJAA 3LYXA 4Y5FA 3EQVA 3FG8A 2PD7A 5HDDA 3K2NA 3OCNA 2W1TB 4CQHA 4O8GA 3C8CA 3UB6A 2J3TC 3NOTC 4HH2A 4WLAA 2V0WA 2O9BA 3EGDC 5AJGA 2K7SA 3CAXA 3A0RA 3C30A 2H28A 3PXPA 4Y3IA 2PYPA 4GLQA 2KX6A 3PBNA 1DP8A 4ETXA 4GS9A 1G6OA 2OAQ1 3OCLA 1XJ3A 3CLOA 4JGRA 4HOIA 1S66L 2JKTM 3CUEA 2HF6A 1GSVA 3LI9A 1OJ5A 4HY8A 2L4RA 3S7OA 3T4TA 4EU0A 2P7JA 2QWSA 2YKFA 5DFXA 4MCWA 4EEPA 2NUTC 4F3LA 4ARZA 3H9WA 2G7UA 4PKYA 1KOUA 3UMDA 3E98A 5HSQA 4NEED 1NLZA 5DFYA 1TS6A 4HJ3A 3MQOA 4L9EA 1P9WA 2QYBA 1XFQA 3H82A 4HP9A 2VGLM 4MN7A 2K31A 4Q0IA 1TF1A 1IFQA 1OTIA 2W1TA 4HHDA 4MN6A 1LT0A 2XSSA 1OJGA 5KSHA 3U2AA 4HIAA 2VA0A 2W3HA 4ETZA 4EERA 4LRZE 4WN5A 3F1NB 3UB7A 1OPXA 2PT7A 3RTYA 1DP9A 4L9GA 3LIEA 3CWFA 1LSVA 4BMWA 3F1OA 3OBFA 3MXQA 2K2NA 4B93A 4Y2FA 1ZTUA 2HJ9C 1H8MA 1F5MA 3UB8A 2A2LA 3D3OA 3PBOA 4MN5A 2Z6CA 1OTAA 5J4EA 1T1AA 1F9IA 2W3DA 3S7QA 5HWVA 5HWWA 3ZQ5A 3V67A 4WEJA 2VZWA 4PKYG 4KUOA 4WUJA 2XRNA 1P9RA 3T4SA 4EEUA 3FPVA 4GS9B 3LIDA 3PBTA 1T1BA 2ZMVA 4Q0HA 3T4LA 2W1RA 4WEKA 4FOFA 2L1MA 1XJ2A 3E0YA 1T1CA 5HPFA 4GJ4A 4ARZB 2EWWA 3LIBA 4JGOA 4HNBA 1BYWA 5EFWA 5AVFA 2O9CA 3H82B 3KSFA 3S7NA 3PBQA 2M7VA 2PR5A 2JKRI 2R78A 2EA9A 3CUEC 3LR4A 1UGUA 2HGVA 2M7UA 4HQAA 1GSWA 1LSWA 5IS1A 3MQQA 4BBVA 4HJ6A 1XJ4A 3NOPC 2KDKA 3T4OA 3JVUA 1W63Q 3LIFA 3BW6A 2PD8A 2W3FA 3T4JA 4K08A 3F1OB 5HPIA 3K3DA 2Y79A 3PYPA 2J80A 4AFIA 2VV6A 4IUKA 4NXEA 5IT5A 3LI8A 1MZUA 1UWNX 3KSHA 3MQ0A 4EXOA 4FSFA 4UEYA 2M1CA 5HDSA 2PYRA 5G4YA 5HDCA 3RH8B 2DMWA 2INWA 5MC7A 2VKSA 1N9NA 2PHYA 2QJ7A 2VLGA 4EESA 3MFXA 3BWLA 3C38A 1NWZA 3O5YA 5HL6A 4GHIA 5CX7A 2W3EA 1VB6A 3IS2A 2VV8A 4R38A 4M4XA 3D72A 4ME4A 4Q0JA 1TS0A 1D06A 3B33A 3JVVA 4G3KA 5TJJA 3R7WA 3TE8A 3ZYTA 3T50A 2GNXA 5L8MA 5F69A 1S1ZA 1G28A 3EGXC 4BBUA 1OTBA 3H7WA 3LICA 3P01A 1Y28A 4NXFA 5C5KA 4RQ9A 2A24B 2MJ6A 1YSPA 2WKRA 2PR6A 1OT9A 4H6JA 3ICYA 3KYQA 2OOLA 2V0UA 4DN0A 3MJQA 1OT6A 1TD5A 4KUKA 1VHMA 2GJ3A 5LBRA 3F1PA 3KSIA 3LR5A 4EQ1A 5I5LA 3TJZC 1T19A 2J3WA 2V1AA 3NOUC 4XT2B 4B9OA 4E04A 3PR6A 4WELA 2W27A 4CLCA 3NHQA 4PAUA 1LL8A 4P6ZS 4NXBA 4G3VA 5DKLA 5DKKA 2JKRM 4LRXC 2V9AA 2Y8HA 3UB9A 2WKQA 5HWTA 1XJ6A 1DRMA 3FPWA 2VJWA 1EW0A 2O0YA 3MF0A 4I3IA 4WF0A 1S67L 2P04A 3VV4A 4GW9A 1IOUA 2JHEA 5AVEA 2A24A 3T4KA 3OC2A 2ZMFA 2NUPC 4O01A 3CITA 3SW1A 2HJEA 2CMNA 4GHIB 3KYZA 3LFVA 4QPRA 3IS2B 5F6AA 4LPZA 2IA2A 3A0VA 3ULFA 5HD3A 2V1BA 4OOLA 4YWZA 4CLCD 3EQUA 2W3GA 4Z1WA 3T4QA 4HP4A 4JGQA 2VEAA 3R7WB 1NLYA 1UWPX 2Z6DA 4IUHA 3VOLA 1N9LA 4XT2A 4O0PA 3C2WA 2D02A 2I9VA 3H7WB 1H3QA 3PBRA 4UQIS 2B18A 1N9OA 2QJ5A 3BY8A 5F5YA 4H6JB 4BWIA 3PHYA 3VE3A 5J7EA 5HD5A 2OWHA 3K3CA 1S4SA 2KOIA 3EEHA 3F1PB 4JGPA 3W2ZA 3UE3A 1TS8A 2BASA 2WKPA 2GZAA 3TW8A 2LB9A 4BBTA 4DMZA 1S1YA 1P0ZA 4P6ZM 1XFNA 3HJIA 2EWVA 2O9AA 4CLCB 4MDZA 1YAXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LIA A;  3LUQ A;  2YKH A;  4R3A A;  3E4Q A;  2PDR A;  5TBM B;  3BY9 A;  5J3W A;  2OWJ A;  4KQD A;  5G4Z A;  3KX0 X;  4NXG A;  1LSX A;  3EWK A;  1WA9 A;  4WL9 A;  5IU1 A;  3P7N A;  1OTE A;  1OTD A;  2JN7 A;  4HI4 A;  5DJU A;  3VE4 A;  1F98 A;  1ODV A;  2ZBB A;  2QHK A;  3UE6 A;  4I3J A;  1S4R A;  4EET B;  3UME A;  4I39 A;  1P97 A;  3HJK A;  3FC7 A;  3GEC A;  2L0W A;  5DJT A;  5A8B A;  3G6O A;  1V9Y A;  5KIZ A;  1T18 A;  3OLO A;  5TBM A;  2ZOH A;  2QKP A;  4DJ3 A;  4R6L A;  4LLO B;  2W0N A;  1DP6 A;  4HJ4 A;  2HV1 A;  2D01 A;  1V9Z A;  1D7E A;  2VV7 A;  4HH3 A;  4DJ2 A;  3E4P A;  2ZOI A;  4GCZ A;  4I3A A;  5F68 A;  3GDI A;  1GSX A;  4R70 A;  3A0S A;  3IBR A;  3F1N A;  1JNU A;  3MR0 A;  5HZH A;  4F3L B;  2B02 A;  4EW7 A;  4I5S A;  4LRY C;  3E4O A;  4I38 A;  1TS7 A;  1X0O A;  4L9F A;  3NJA A;  3LYX A;  3FG8 A;  2PD7 A;  5HDD A;  3C8C A;  3UB6 A;  3NOT C;  4HH2 A;  4WLA A;  2V0W A;  2K7S A;  3CAX A;  3A0R A;  2H28 A;  2PYP A;  2KX6 A;  1DP8 A;  4GS9 A;  1XJ3 A;  3CLO A;  4JGR A;  4HOI A;  1S66 L;  1GSV A;  3LI9 A;  1OJ5 A;  4HY8 A;  2L4R A;  2P7J A;  2QWS A;  2YKF A;  4EEP A;  4F3L A;  3H9W A;  4PKY A;  1KOU A;  3UMD A;  5HSQ A;  1TS6 A;  4HJ3 A;  3MQO A;  4L9E A;  4HP9 A;  3H82 A;  1XFQ A;  1OTI A;  4HHD A;  4MN6 A;  1LT0 A;  1OJG A;  4HIA A;  4EER A;  4LRZ E;  4WN5 A;  3F1N B;  3UB7 A;  3RTY A;  1DP9 A;  4L9G A;  3LIE A;  3CWF A;  1LSV A;  3F1O A;  3MXQ A;  3UB8 A;  4MN5 A;  2Z6C A;  1OTA A;  5J4E A;  1T1A A;  1F9I A;  5HWV A;  5HWW A;  3ZQ5 A;  4PKY G;  4KUO A;  4WUJ A;  4EEU A;  4GS9 B;  3LID A;  1T1B A;  2L1M A;  1XJ2 A;  1T1C A;  3LIB A;  4JGO A;  4HNB A;  1BYW A;  5EFW A;  5AVF A;  3H82 B;  2PR5 A;  2R78 A;  2EA9 A;  1UGU A;  4HQA A;  1GSW A;  1LSW A;  5IS1 A;  3MQQ A;  4BBV A;  4HJ6 A;  1XJ4 A;  3NOP C;  2KDK A;  3LIF A;  2PD8 A;  4K08 A;  3F1O B;  3K3D A;  3PYP A;  2J80 A;  2VV6 A;  4NXE A;  3LI8 A;  1MZU A;  1UWN X;  4EXO A;  2M1C A;  5HDS A;  2PYR A;  5G4Y A;  5HDC A;  3RH8 B;  2INW A;  1N9N A;  2PHY A;  2QJ7 A;  2VLG A;  4EES A;  3MFX A;  3BWL A;  1NWZ A;  4GHI A;  1VB6 A;  3IS2 A;  2VV8 A;  4R38 A;  4M4X A;  3D72 A;  1TS0 A;  1D06 A;  3B33 A;  3T50 A;  5F69 A;  1S1Z A;  1G28 A;  4BBU A;  1OTB A;  3H7W A;  3LIC A;  4NXF A;  1Y28 A;  4RQ9 A;  2A24 B;  2WKR A;  2PR6 A;  1OT9 A;  4H6J A;  3ICY A;  2OOL A;  2V0U A;  3MJQ A;  1OT6 A;  4KUK A;  2GJ3 A;  3F1P A;  4EQ1 A;  5I5L A;  1T19 A;  2V1A A;  3NOU C;  4XT2 B;  4E04 A;  2W27 A;  3NHQ A;  1LL8 A;  4NXB A;  5DKL A;  5DKK A;  4LRX C;  2V9A A;  3UB9 A;  2WKQ A;  5HWT A;  1XJ6 A;  1DRM A;  1EW0 A;  4I3I A;  4WF0 A;  1S67 L;  4GW9 A;  2JHE A;  5AVE A;  2A24 A;  3SW1 A;  2CMN A;  4GHI B;  3IS2 B;  5F6A A;  4LPZ A;  3A0V A;  3ULF A;  5HD3 A;  2V1B A;  4YWZ A;  4HP4 A;  4JGQ A;  2VEA A;  1UWP X;  2Z6D A;  3VOL A;  1N9L A;  4XT2 A;  3C2W A;  2D02 A;  2I9V A;  3H7W B;  1N9O A;  2QJ5 A;  3BY8 A;  5F5Y A;  4H6J B;  3PHY A;  3VE3 A;  5J7E A;  5HD5 A;  2OWH A;  3EEH A;  1S4S A;  3K3C A;  3F1P B;  4JGP A;  1TS8 A;  2BAS A;  2WKP A;  4BBT A;  1S1Y A;  1P0Z A;  1XFN A;  3HJI A;  4B9O A; 
#chains in the Genus database with same CATH topology
 3MMH A;  2WKE A;  1CQA A;  5GLA A;  2ZM0 A;  3ITA A;  3KSG A;  2YKH A;  2XA7 S;  4IJG A;  4X25 A;  5TBM B;  3CPT A;  5J3W A;  2OWJ A;  5CHU A;  3FKW A;  1BLP A;  4UA7 A;  4JKT A;  1KGE A;  2EXA A;  1S6R A;  1PWC A;  3P7N A;  1OTE A;  1OTD A;  4HI4 A;  5DJU A;  1H8Y A;  4LGW A;  4O7D A;  2FZ0 A;  4GD8 A;  1CJF A;  1PRQ A;  3UE1 A;  2WUQ A;  3UE6 A;  5HAI A;  3FKV A;  4YFM A;  1MC0 A;  1SDN A;  1FOF A;  2J3T D;  3W8K A;  4N9L A;  3FC7 A;  3GEC A;  4OP5 A;  4DE0 A;  2Z2L B;  3FYZ A;  3VP2 A;  2OV5 A;  1V9Y A;  3LR3 A;  3OLO A;  5TBM A;  4KQO A;  4E6W A;  2QKP A;  1Y54 A;  4WMC A;  3HRE A;  3Q7V B;  3L7H A;  3R4K A;  3G32 A;  3QP4 A;  4LLO B;  5CEB A;  1Z6F A;  1MKM A;  3WS0 A;  5K5B A;  3PAE A;  1IYQ A;  2VV7 A;  4I3A A;  5F68 A;  2XA7 M;  2XRO A;  4II7 A;  5EPH A;  3F1N A;  4UAA A;  4QWO A;  4YNR A;  2XFT A;  4MMN A;  1FCM A;  3NJA A;  3LYX A;  4Y5F A;  1U60 A;  5GHX A;  3K2N A;  3OCN A;  4O8G A;  3C8C A;  3HLB A;  1K57 A;  2V0W A;  3IX3 A;  1SKF A;  3EGD C;  5AJG A;  5JYO A;  4PM8 A;  1PIO A;  3CAX A;  3MXS A;  2J7V A;  4ETX A;  4GS9 A;  1XJ3 A;  4JGR A;  2JBF A;  2XK1 A;  2HF6 A;  4JXG A;  1GSV A;  2L4R A;  5DFX A;  4MCW A;  2NUT C;  4S2P A;  4ARZ A;  2G7U A;  4N92 A;  2HP9 A;  2ZQ7 A;  5HSQ A;  4NEE D;  4WZ4 A;  5HAQ A;  1TDG A;  1P9W A;  3H82 A;  4ZTK A;  1I2S A;  4HHD A;  1LT0 A;  2VGK A;  5L09 A;  3IH8 A;  1OJG A;  5KSH A;  3U2A A;  4HIA A;  3SH8 A;  4ETZ A;  3UB7 A;  1YQS A;  1OME A;  4MNR A;  1CI8 A;  3GV9 A;  2Y2Q A;  2Z2M B;  4HES A;  1ZTU A;  4ZBE A;  5GLC A;  3ZHH A;  3Q7Z A;  1PWD A;  3UB8 A;  2A2L A;  2ZJ9 A;  1JTD A;  2Z6C A;  1T1A A;  5DTT A;  5A93 A;  3G4P A;  5FAT A;  2XRN A;  1PWG A;  4GKU A;  2A49 A;  3FPV A;  3OPL A;  1W7F A;  3T4L A;  4DDS A;  5CGW A;  4WEK A;  3VMA A;  3L9K A;  4IBX A;  4UA6 A;  1FCN A;  1NXY A;  1MXO A;  1K55 A;  2XDM A;  4GJ4 A;  4XUZ A;  3C7V A;  3QNC A;  3VSL A;  2EX6 A;  2O9C A;  3KSF A;  4KG2 A;  2H5S A;  4YIN A;  3PBQ A;  2R78 A;  4LEN A;  1FR6 A;  2M7U A;  1GSW A;  3QP5 A;  1K56 D;  4BBV A;  3WS5 A;  1FSY A;  2DNS A;  1BUL A;  1YLY A;  1W63 Q;  3T4J A;  1MWS A;  3K3D A;  4QU3 A;  2J80 A;  3IHA A;  4KZ3 A;  2QPN A;  5FDH A;  5FQQ A;  1IEM A;  2VV6 A;  4C75 A;  1PW1 A;  1RP5 A;  2VGJ A;  2Y59 A;  4PPR A;  5HDS A;  1K54 C;  2CC1 A;  3HUM A;  2INW A;  2VKS A;  3UO9 A;  1N9N A;  2QJ7 A;  2VLG A;  3C5A A;  1KVL A;  3CMZ A;  4C6Y A;  3C38 A;  1K4E A;  3O5Y A;  2W3E A;  4P6B A;  5CTN A;  2VV8 A;  2ZD8 A;  2G2U A;  2H0T A;  3PAG A;  3JVV A;  1W5D A;  3MKE A;  3TE8 A;  2GNX A;  5TR7 A;  4OPR A;  1G28 A;  3EGX C;  1OTB A;  3H7W A;  4Y0O A;  2MJ6 A;  3HLE A;  2PR6 A;  4H6J A;  3ICY A;  1CEG A;  4DN0 A;  4NG2 A;  1OT6 A;  4ZJ3 A;  1VHM A;  1TDL A;  3BFC A;  1ERM A;  3KSI A;  5DVA A;  4OQH A;  3QNB A;  3NI9 A;  3BRM A;  4S2O A;  3MZE A;  1J3W A;  4CLC A;  4QJG A;  4NXB A;  4G3V A;  3DTI A;  4E3O A;  1XA1 A;  4RVA A;  5DKK A;  3O86 A;  4LRX C;  5FAP A;  1HVB A;  3UB9 A;  3MKF A;  4IVK A;  2VJW A;  4A5R A;  5EVL A;  3V5M A;  2J9O A;  3VV4 A;  5HW3 A;  5A91 A;  3M6B A;  2HDS A;  2ZMF A;  4C3Q A;  2WGW A;  4X1L A;  2CMN A;  3M6H A;  4QPR A;  4KZ8 A;  4FH2 A;  4MBF A;  3ULF A;  2ZLY A;  4Y7P A;  1D1J A;  1DJC A;  5FQM A;  5EV0 A;  3T4Q A;  2B5R A;  4JGQ A;  3JPU A;  3GRJ A;  1N9L A;  2C5W B;  3C2W A;  2D02 A;  2EXB A;  2I9V A;  1YPR A;  1YM1 A;  2B18 A;  5CGS A;  3UN7 A;  3UE0 A;  2PRF A;  4U0X A;  1ES5 A;  1MPL A;  3I7J A;  3PHY A;  3V50 A;  4OQG A;  5HD5 A;  4E3M A;  2OWH A;  3Q07 A;  3EEH A;  3W2Z A;  3F1P B;  3Q1F A;  3BFF A;  2BAS A;  3G2Z A;  1K0K A;  1KDS A;  5M19 A;  4HBU A;  4DKI A;  5TFQ A;  2EWV A;  2O9A A;  2Q0O A;  2VK3 A;  4PM5 A;  4AFI A;  3LIA A;  3LUQ A;  5EE8 A;  1I5Q A;  1AXB A;  3IF6 B;  5E2G A;  4BLM A;  4DXC A;  3LY4 A;  2WKI A;  1YLP A;  5EM1 A;  4WZ5 C;  4ZRR A;  1WA9 A;  4WL9 A;  3MSH A;  2E8I A;  5FQK A;  3B42 A;  4NKP A;  5E43 A;  3DBA A;  3HL9 A;  4I3J A;  4QHC A;  4Y17 A;  1VQQ A;  5CHJ A;  1YMX A;  3N8L A;  4EET B;  3HCY A;  1JTG A;  1K54 A;  5CGX A;  1XXM A;  2Q9N A;  3GR2 A;  1MWU A;  4LV3 A;  2IWB A;  1KE4 A;  5DJT A;  1TVF A;  3OPH A;  4U3T A;  3EOI A;  4R0Q A;  3TRC A;  2ZOH A;  3KO6 A;  2ZC3 B;  3ZFZ A;  4R6L A;  2P9V A;  4FTX A;  1SCW A;  5CRF A;  4R3B A;  3DTE A;  2W0N A;  3DAV A;  2H10 A;  1ES3 A;  1V9Z A;  4R23 A;  2ZQD A;  1D7E A;  4HH3 A;  2VGL S;  3E4P A;  4EQI A;  3GDI A;  4PHT A;  3BQA A;  4R70 A;  3SS5 A;  4YOF A;  3IBR A;  5DF9 A;  4OOM A;  4CLC E;  3WS2 A;  3CPT B;  4EW7 A;  4I5S A;  3S7P A;  1BSG A;  2XEP A;  3QP6 A;  5KZH A;  3VP1 A;  1TS7 A;  1X0O A;  1L3L A;  1FIL A;  3A3D A;  4R4S A;  4ZAM A;  3EQV A;  4WMC D;  3G34 A;  3UB6 A;  3BFE A;  3KYE A;  2J3T C;  5F83 A;  1DY6 A;  3BEC A;  2X71 A;  2WYX A;  2HDQ A;  3UY6 A;  4WM9 A;  4KZB A;  4PM9 A;  3PXP A;  2H28 A;  1L0E A;  4Y3I A;  4MBH A;  3ZG7 B;  5FQI A;  2KX6 A;  5DTK A;  1XX2 A;  4S2K A;  3A3F A;  2FFY A;  3SZT A;  1G6O A;  4HOI A;  3T1R A;  5DF7 A;  1VET A;  3S7O A;  3LY3 A;  1XA7 A;  4HY8 A;  2WGI A;  2QWS A;  2YKF A;  4EEP A;  4IVI A;  4N1H A;  2RCX A;  1Q2Q A;  3H9W A;  4PKY A;  4S2L A;  4OQ0 A;  4JXV A;  3IF5 A;  3IX8 A;  3GTC A;  1FSW A;  1IYO A;  2BTF P;  4HJ3 A;  2BG1 A;  4L9E A;  2VGL M;  4S2J A;  1YLT A;  5EVI A;  5U47 A;  1IEL A;  4KG6 A;  1OTI A;  1WYC A;  1E3U A;  1KE0 A;  4RYE A;  3QHY A;  5F1F A;  2VA0 A;  2W3H A;  4EER A;  3NDE A;  3F1N B;  3D9Y A;  1EWZ A;  4X6T A;  4L9G A;  3LIE A;  4BMW A;  3OBF A;  4WYY A;  3MXQ A;  4B93 A;  4Y2F A;  3S4X A;  4OPZ A;  4S2N C;  3PBO A;  4MN5 A;  4JXW A;  3GMW A;  1F9I A;  1NJ4 A;  1IYP A;  2W3D A;  4QB8 A;  3IXG A;  4KUO A;  3NBL A;  1AWI A;  1P9R A;  3T4S A;  4EEU A;  4GS9 B;  2EX9 A;  2Y55 A;  4FOF A;  3HLC A;  3E0Y A;  1H8Z A;  1T1C A;  4EWF A;  3IH9 A;  4ARZ B;  2PBY A;  2WAD A;  3LIB A;  5E2E A;  1BT5 A;  3IXH A;  2J9P A;  5EFW A;  5AVF A;  1ES4 A;  3H82 B;  3S7N A;  5HAP A;  1O7E A;  3E2K A;  1CI9 A;  3CUE C;  1FR1 A;  1UGU A;  3O88 A;  3O87 A;  4BL3 A;  3UDX A;  5IS1 A;  3MQQ A;  2X01 A;  4HJ6 A;  1MBL A;  1XJ4 A;  1NRF A;  1ZC2 A;  4Y15 A;  3T4O A;  4E3K A;  2WZZ A;  1C3B A;  3BW6 A;  5FEG A;  2DRW A;  2Y79 A;  3PYP A;  5AQB A;  1PW8 A;  3HLG A;  4NXE A;  1MZU A;  4FD8 A;  1LI0 A;  3DTM A;  1JVJ A;  2M1C A;  2PYR A;  4UHU A;  4JBF A;  3TSG A;  5GLB A;  3SS3 A;  4U0T A;  2PHY A;  3MFX A;  1CEF A;  3BWL A;  3UDF A;  3ZCZ A;  3HLD A;  4GHI A;  5CX7 A;  1VB6 A;  5FQJ A;  3IS2 A;  4OON A;  4GZB A;  1ESI A;  4HEF A;  3D72 A;  1D06 A;  2EFX A;  2Q9M A;  5E2H A;  3R7W A;  4G3K A;  3NY4 A;  5F69 A;  4B4X A;  1S1Z A;  4H8R A;  3LIC A;  3P01 A;  4HBT A;  4NXF A;  3DWK A;  4RQ9 A;  4X68 A;  1FCO A;  1OT9 A;  4JF6 A;  3KYQ A;  4K91 A;  2V0U A;  5CXW A;  1RGY A;  4KUK A;  1TD5 A;  2GJ3 A;  5LBR A;  3NUL A;  3A3J A;  5CTM A;  5I5L A;  4OQI A;  3TJZ C;  3VP4 A;  2HDU A;  2V1A A;  1BLH A;  4XT2 B;  4WEL A;  4Y0U A;  3NHQ A;  1LL8 A;  2ZQC A;  3TG9 A;  2EX2 A;  3CZD A;  2IWC A;  4R3J A;  2XQZ A;  2Y8H A;  3NEC A;  5D3O A;  5HWT A;  1DRM A;  3FPW A;  1EW0 A;  2O0Y A;  1IYS A;  4I3I A;  5IHV A;  1S67 L;  5GLD A;  4OLG A;  5AVE A;  4CJN A;  3OC2 A;  4GD6 A;  3BYD A;  3SW1 A;  3LGO A;  4GDB A;  3A0V A;  3QP1 A;  5HD3 A;  4CLC D;  4K0X A;  2W3G A;  4KQR A;  4XT2 A;  3UDI A;  3H7W B;  1H3Q A;  1LHY A;  4ID4 A;  1N9O A;  1BZA A;  1KVM A;  2JCH A;  4IBR A;  4FCF A;  1Q2P A;  5FAQ A;  4WBG A;  4H6J B;  3ZVT A;  4BWI A;  2JKF A;  3VE3 A;  4CPK A;  1S4S A;  2KOI A;  4DE2 A;  3UE3 A;  1LLB A;  3TW8 A;  2LB9 A;  2V2F F;  4DMZ A;  1S1Y A;  3AGE A;  1S0W A;  1XFN A;  4CLC B;  4DRT A;  1G5U A;  4MDZ A;  4B9O A;  3BFD A;  2IWD A;  4EUV A;  2QMI A;  3IBJ A;  3E4Q A;  5FI6 A;  3BY9 A;  4KQD A;  5G4Z A;  1W79 A;  1MWT A;  3EWK A;  2ZMA A;  3Q82 A;  4UA9 A;  3FZC A;  3P09 A;  3BJN A;  3QP8 A;  3OPR A;  2JN7 A;  5FAO A;  3VE4 A;  2JKT I;  4X69 A;  4P85 A;  2WGW B;  1F98 A;  4KZ6 A;  1ODV A;  4E3L A;  3DTK A;  3ZGA B;  2ZBB A;  1NZO A;  2QHK A;  2OAP 1;  4K0W A;  1YKD A;  2V8F A;  4OH0 A;  5FDS A;  4BL2 A;  4DXB A;  4I39 A;  1P97 A;  1W8Y A;  3BFG A;  4DF6 A;  1ONH A;  2HDR A;  3RXW A;  2KLI A;  5E2F A;  4BJP A;  4ZDX A;  1HD8 A;  3N4I A;  2JE5 A;  2L0W A;  3AGD A;  1K38 A;  5A8B A;  4GB7 A;  1GHI A;  1T18 A;  3NCK A;  1O07 A;  3NC8 A;  4S2M A;  4PM6 A;  4DJ3 A;  1K56 A;  1XGJ A;  3LEZ A;  3MZF A;  2UWX A;  2XD5 A;  3MXR A;  3MS6 A;  2JC7 A;  1ZHH B;  1ZG4 A;  2G2W A;  4KZ5 A;  2ZL1 A;  1IKI A;  1ACF A;  5FAS A;  1GSX A;  2ZM8 A;  3T1S A;  2AVX A;  4OVD A;  1JNU A;  4GN2 A;  5HZH A;  1GCE A;  2X02 A;  3EEA A;  2WAE A;  1ONG A;  1W63 M;  5AQA A;  2WKH A;  1JWP A;  4QY6 A;  3E4O A;  4L0L A;  4L9F A;  4GOG A;  4D60 A;  2OSU A;  2PD7 A;  3G30 A;  1BLC A;  4CQH A;  3HUN A;  3HVF A;  3NOT C;  4HH2 A;  2O9B A;  1XP4 A;  3HUO A;  3V3S A;  3N7W A;  5HL1 A;  1CK3 A;  3UNW A;  3A0R A;  4MBK A;  3C30 A;  2PAV P;  5DF8 A;  4EBN A;  4KEN B;  4EV4 A;  1DP8 A;  1ZKJ A;  2OAQ 1;  3OCL A;  3CLO A;  1S66 L;  2JKT M;  1L2S A;  1NYY A;  3LCE A;  3W4Q A;  2V8C A;  4KZ9 A;  2Y2H A;  5DTS A;  4EU0 A;  5HAR A;  1XGI A;  5AQ7 A;  4LV1 A;  1IKG A;  4ZJ1 A;  3E98 A;  2P9V B;  2ZC7 A;  1HZO A;  5DFY A;  1TS6 A;  3MQO A;  1FQG A;  4HP9 A;  1XFQ A;  4Q0I A;  1TF1 A;  1MKI A;  5L07 A;  1IFQ A;  1L0F A;  1BTL A;  2HP5 A;  3S22 A;  2JKG A;  2PT7 A;  3RTY A;  1DP9 A;  3N6I A;  2E8J A;  4XUX A;  1LSV A;  3F1O A;  1E25 A;  1PFL A;  2K2N A;  3ZNY A;  1H0M A;  3W4P A;  1DJB A;  1F5M A;  3D3O A;  4Y0T A;  5J4E A;  5FEF A;  5EVI D;  1SKO A;  3S7Q A;  5HWV A;  3ZQ5 A;  3V67 A;  2VZW A;  1PZP A;  4KZA A;  4KZ7 A;  1XPB A;  1ESU A;  1ALQ A;  3Q81 A;  4ESP A;  3ISG A;  3LID A;  1T1B A;  4Q0H A;  2W1R A;  1K57 C;  1VET B;  2L1M A;  2WAF A;  1XJ2 A;  1G68 A;  5HPF A;  3ZG8 B;  4JGO A;  1QMF A;  3GSG A;  3IHB A;  2I72 A;  4X56 A;  4RX2 A;  2PBD P;  5EVI B;  2OLV A;  3SOI A;  1LI9 A;  4X1M A;  2PR5 A;  2JKR I;  2EA9 A;  3IX4 A;  2HGV A;  3LR4 A;  3IXB A;  3M2K A;  4HQA A;  4B88 A;  1SHV A;  3W4O A;  3G35 A;  3GQZ A;  3NOP C;  4DE1 A;  2BLS A;  5I94 A;  5BOH A;  1M40 A;  2KDK A;  2ACG A;  3LIF A;  5CHM A;  4K08 A;  5HPI A;  2ZM2 A;  5KMW A;  5EUA A;  3ZNT A;  2Y2N A;  3CG5 A;  2P74 A;  4IUK A;  5IT5 A;  3LI8 A;  1G6A A;  1UWN X;  3MQ0 A;  4EXO A;  3U4L P;  4FSF A;  4UEY A;  5A90 A;  5G4Y A;  1VEU A;  1VM1 A;  5HDC A;  2DMW A;  1K25 A;  1ES2 A;  2HP6 A;  4MLL A;  1NWZ A;  1PI4 A;  2XLN A;  4M4X A;  2PU4 A;  3WS4 A;  1K6S A;  2ZC5 B;  1TS0 A;  4RA7 A;  3ZYT A;  3A3I A;  2V1Z A;  3IWI A;  3BEB A;  4BQM A;  2ZQ8 A;  4LFU A;  3FWL A;  4E3J A;  1YSP A;  2QZ6 A;  3M2J A;  1Y4O A;  2R9X A;  4QY5 A;  2Y2K A;  3ZG5 A;  4LCL A;  3G2Y A;  3LR5 A;  3VOZ A;  3VFF A;  3C4P A;  5CED A;  1K55 C;  3ZG0 A;  1WE4 A;  4R1G A;  1L0D A;  2J3W A;  4WZ5 A;  3NOU C;  3CHW P;  4GDN A;  3IQA A;  2ZC6 B;  3G31 A;  1NYM A;  2WK0 A;  3RJU A;  2JKR M;  2RL3 A;  4B4Z A;  5EM0 A;  3MBZ A;  3A3E A;  1I2W A;  3MF0 A;  1DJA A;  2EX8 A;  1GA9 A;  2P04 A;  2JHE A;  3P98 A;  4D2O A;  5EOO A;  3E2L A;  4DE3 A;  4GHI B;  3KYZ A;  3IS2 B;  2IA2 A;  1QME A;  1HTZ A;  3DWZ A;  3R7W B;  1NLY A;  1UWP X;  2Z6D A;  3HLF A;  4IUH A;  3VOL A;  4DDY A;  5HFO A;  3IT9 A;  3WRZ A;  3V3R A;  1PNE A;  3ZDJ A;  4UQI S;  3CJM A;  1BLS A;  3BY8 A;  4X53 A;  4KZ4 A;  5AQ9 A;  2OLU A;  3ZVW A;  3K3C A;  1LL5 A;  1TS8 A;  3Q7V A;  4JF5 A;  4E3N A;  1WYB A;  5GL9 A;  1YLZ A;  3C4O A;  5KSC A;  3HJI A;  3MZD A;  2XR0 A;  1YAX A;  4R4R A;  3PBS A;  4OKP A;  1J9M A;  5FL3 A;  4R3A A;  2ZQ9 A;  1PI5 A;  2PDR A;  1LL9 A;  4JLF A;  2Y2G A;  4IHQ A;  1YSQ A;  3OOV A;  1W8Q A;  3KX0 X;  4NXG A;  1LSX A;  2C6W B;  2Y2I A;  4CLC C;  3B47 A;  4OLD A;  1H5X A;  5IU1 A;  2J8Y A;  4IED A;  2VX8 A;  3CI6 A;  3NDG A;  3FV7 A;  4GNU A;  1S4R A;  1FIK A;  1SDE A;  1NY0 A;  1M6K A;  4P0M A;  4UQI M;  2GX5 A;  3UME A;  4NK3 A;  4G3W A;  2LB5 A;  3HJK A;  2P08 A;  1F2K A;  1ERO A;  4N9K A;  1GHP A;  2FH5 A;  3G6O A;  1K4F A;  1RCJ A;  5KIZ A;  5G18 A;  2XD1 A;  3O3V A;  2A3U A;  1DP6 A;  2XH9 A;  4HJ4 A;  2HV1 A;  2GDN A;  3IWQ A;  2D01 A;  1YT4 A;  3SH7 A;  4DJ2 A;  3ITB A;  2ZOI A;  4GCZ A;  2ZC4 B;  4JPM A;  2O99 A;  5EVE A;  3B3X A;  1NRJ A;  3A0S A;  4S2N A;  3LR0 A;  1HLU P;  3MR0 A;  3OPP A;  4MEZ A;  4F3L B;  2B02 A;  3N8S A;  1KE3 A;  1YMS A;  4EBP A;  4LRY C;  3BQ8 A;  2Y91 A;  3DW0 A;  4I38 A;  3RFB A;  5J8X A;  1STZ A;  3T1X A;  3FG8 A;  1SZV A;  1TEM A;  2UV0 E;  3LEQ A;  5HDD A;  2W1T B;  1GHM A;  4LV0 A;  4WLA A;  2K7S A;  4BEN A;  2PYP A;  4GLQ A;  1YLW A;  1E4D A;  1Z09 A;  3PBN A;  4P87 A;  3WS1 A;  1CF0 A;  2ZQA A;  5GHY A;  3CUE A;  5FQ9 A;  3LI9 A;  1OJ5 A;  3T4T A;  1N9B A;  5M18 A;  3SH9 A;  2P7J A;  4FUW A;  1JWZ A;  4F3L A;  4E3I A;  1KOU A;  3BLS A;  3UMD A;  1NLZ A;  2XGN A;  4Q8I A;  3N8R A;  2QYB A;  4MN7 A;  4M3K A;  2K31 A;  3QP2 A;  1JWV A;  2W1T A;  4MN6 A;  2XSS A;  2ZL1 B;  3IF6 C;  5M1A A;  3VFH A;  4XXR A;  5L10 A;  4LRZ E;  4WN5 A;  1K6R A;  1OPX A;  2Y4A A;  1MWR A;  3CWF A;  1YLJ A;  5GHZ A;  1MY8 A;  2HJ9 C;  1H8M A;  2EFU A;  1KGG A;  1OTA A;  1GA0 A;  2DCF A;  4ZJ2 A;  5HWW A;  2HZ5 A;  4WEJ A;  4PKY G;  2Y2M A;  4WUJ A;  2WGV A;  4JF4 A;  4OP8 A;  4EBL A;  3PBT A;  2ZMV A;  1A0K A;  2R9W A;  4PM7 A;  2EWW A;  5EEC A;  4HNB A;  1BYW A;  1L0G A;  2PU2 A;  3AGF A;  2M7V A;  3UPN A;  3WRT A;  4S2I A;  2WZX A;  4KG5 A;  1LSW A;  3IXD A;  5L2F A;  2Y2O A;  5HX9 A;  2FFF B;  3VP0 A;  3IWO A;  4EUZ A;  3SS4 A;  3RXX A;  2Y2P A;  3JVU A;  2PD8 A;  2W3F A;  5EVI C;  3F1O B;  4PMA A;  5FA7 A;  1ERQ A;  3BLM A;  3MFD A;  3UPO A;  2Y2J A;  3KSH A;  1ZG6 A;  4BD0 A;  4JXS A;  4KQQ A;  1NZU A;  2B95 A;  1SKO B;  3V39 A;  5F1G A;  3RH8 B;  4LCM A;  5MC7 A;  4EES A;  3D4F A;  5HL6 A;  3JYI A;  4R38 A;  2XF3 A;  4ME4 A;  4Q0J A;  2Y2L A;  3B33 A;  5TJJ A;  3VOY A;  3T50 A;  5L8M A;  4X55 A;  5TGF A;  5A92 A;  3LO7 A;  4BBU A;  3PTE A;  4OPY A;  3OZH A;  5C5K A;  1Y28 A;  4OPQ A;  2A24 B;  4NET A;  3TOI A;  3C7U A;  2WKR A;  2OOL A;  3T12 B;  3MJQ A;  2HPB A;  4F94 A;  3F1P A;  3WWX A;  4EQ1 A;  3S1Y A;  4OOY A;  5FSR A;  3NIA A;  1T19 A;  4E04 A;  4BD1 A;  3PR6 A;  5CER A;  5F82 A;  2W27 A;  1PYY A;  1E3U D;  4PAU A;  3GVB A;  4P6Z S;  5DKL A;  1KGF A;  4Y13 A;  2V9A A;  2WKQ A;  3IF6 A;  1XJ6 A;  4RX3 A;  1VEU B;  4WF0 A;  2XFS A;  4GW9 A;  1XKZ A;  5FI7 A;  1IOU A;  1N4O A;  2A24 A;  3T4K A;  5FI2 A;  3HBR A;  2NUP C;  4O01 A;  3CIT A;  3VSK A;  2HJE A;  3LFV A;  4QD4 A;  5F6A A;  4LPZ A;  4N1X A;  5JYP A;  3ZG9 B;  1PZO A;  2V1B A;  4OOL A;  4YWZ A;  3EQU A;  4Z1W A;  4HP4 A;  2VEA A;  3UB5 P;  3T1Q B;  4O0P A;  2V20 A;  1KDW A;  3PBR A;  3UPP A;  1BUE A;  3VP3 A;  2QJ5 A;  5EOE A;  5F5Y A;  2H0Y A;  3BM6 A;  5J7E A;  4E6X A;  1RGZ A;  4JGP A;  1EI5 A;  2WKP A;  2GZA A;  4LV2 A;  4Z9Q A;  4BBT A;  4FH4 A;  1P0Z A;  4P6Z M;  5CEC A;  3HLW A; 
#chains in the Genus database with same CATH homology
 3LIA A;  3MMH A;  3LUQ A;  3PBS A;  3KSG A;  2YKH A;  5FL3 A;  4R3A A;  4EUV A;  2XA7 S;  3IBJ A;  4IJG A;  3E4Q A;  2PDR A;  5TBM B;  3BY9 A;  5J3W A;  2OWJ A;  4IHQ A;  4ZRR A;  1YSQ A;  4KQD A;  3OOV A;  5G4Z A;  3KX0 X;  4NXG A;  1LSX A;  4CLC C;  3EWK A;  1WA9 A;  4WL9 A;  3B47 A;  5IU1 A;  3P7N A;  2VX8 A;  3BJN A;  1OTE A;  1OTD A;  2JN7 A;  3B42 A;  4HI4 A;  4NKP A;  5DJU A;  3VE4 A;  2JKT I;  1F98 A;  2FZ0 A;  1ODV A;  3DBA A;  3CI6 A;  2ZBB A;  2QHK A;  3UE6 A;  2OAP 1;  4I3J A;  1S4R A;  1YKD A;  4EET B;  3HCY A;  4UQI M;  2GX5 A;  1MC0 A;  3UME A;  4I39 A;  1P97 A;  4G3W A;  2LB5 A;  3HJK A;  2J3T D;  2P08 A;  3FC7 A;  2KLI A;  3GEC A;  4BJP A;  2L0W A;  5DJT A;  2FH5 A;  3G6O A;  5A8B A;  3EOI A;  1V9Y A;  5KIZ A;  3LR3 A;  1T18 A;  3OLO A;  5TBM A;  2ZOH A;  4KQO A;  3KO6 A;  3TRC A;  2QKP A;  4DJ3 A;  4R6L A;  3R4K A;  4LLO B;  2W0N A;  1DP6 A;  1MKM A;  4HJ4 A;  1ZHH B;  2HV1 A;  2D01 A;  1V9Z A;  5K5B A;  1D7E A;  2VV7 A;  4HH3 A;  2VGL S;  4DJ2 A;  3E4P A;  2ZOI A;  4GCZ A;  4I3A A;  5F68 A;  3GDI A;  1GSX A;  2O99 A;  2XA7 M;  4PHT A;  2XRO A;  3BQA A;  4II7 A;  1NRJ A;  3A0S A;  4R70 A;  4YOF A;  3IBR A;  3LR0 A;  3F1N A;  1JNU A;  3MR0 A;  5DF9 A;  4OOM A;  4CLC E;  5HZH A;  4F3L B;  3EEA A;  2B02 A;  1W63 M;  4EW7 A;  4YNR A;  4I5S A;  3S7P A;  4MMN A;  4LRY C;  3BQ8 A;  3E4O A;  4I38 A;  4L0L A;  3RFB A;  1TS7 A;  1X0O A;  1STZ A;  4L9F A;  3NJA A;  3LYX A;  4Y5F A;  3EQV A;  3FG8 A;  2PD7 A;  5HDD A;  3K2N A;  3OCN A;  2W1T B;  4CQH A;  4O8G A;  3C8C A;  3UB6 A;  2J3T C;  3NOT C;  4HH2 A;  4WLA A;  2V0W A;  2O9B A;  3EGD C;  5AJG A;  2K7S A;  3CAX A;  3A0R A;  3C30 A;  2H28 A;  3PXP A;  4Y3I A;  2PYP A;  4GLQ A;  2KX6 A;  3PBN A;  1DP8 A;  4ETX A;  4GS9 A;  1G6O A;  2OAQ 1;  3OCL A;  1XJ3 A;  3CLO A;  4JGR A;  4HOI A;  1S66 L;  2JKT M;  3CUE A;  2HF6 A;  1GSV A;  3LI9 A;  1OJ5 A;  4HY8 A;  2L4R A;  3S7O A;  3T4T A;  4EU0 A;  2P7J A;  2QWS A;  2YKF A;  5DFX A;  4MCW A;  4EEP A;  2NUT C;  4F3L A;  4ARZ A;  3H9W A;  2G7U A;  4PKY A;  1KOU A;  3UMD A;  3E98 A;  5HSQ A;  4NEE D;  1NLZ A;  5DFY A;  1TS6 A;  4HJ3 A;  3MQO A;  4L9E A;  1P9W A;  2QYB A;  1XFQ A;  3H82 A;  4HP9 A;  2VGL M;  4MN7 A;  2K31 A;  4Q0I A;  1TF1 A;  1IFQ A;  1OTI A;  2W1T A;  4HHD A;  4MN6 A;  1LT0 A;  2XSS A;  1OJG A;  5KSH A;  3U2A A;  4HIA A;  2VA0 A;  2W3H A;  4ETZ A;  4EER A;  4LRZ E;  4WN5 A;  3F1N B;  3UB7 A;  1OPX A;  2PT7 A;  3RTY A;  1DP9 A;  4L9G A;  3LIE A;  3CWF A;  1LSV A;  4BMW A;  3F1O A;  3OBF A;  3MXQ A;  2K2N A;  4B93 A;  4Y2F A;  1ZTU A;  2HJ9 C;  1H8M A;  1F5M A;  3UB8 A;  2A2L A;  3D3O A;  3PBO A;  4MN5 A;  2Z6C A;  1OTA A;  5J4E A;  1T1A A;  1F9I A;  2W3D A;  3S7Q A;  5HWV A;  5HWW A;  3ZQ5 A;  3V67 A;  4WEJ A;  2VZW A;  4PKY G;  4KUO A;  4WUJ A;  2XRN A;  1P9R A;  3T4S A;  4EEU A;  3FPV A;  4GS9 B;  3LID A;  3PBT A;  1T1B A;  2ZMV A;  4Q0H A;  3T4L A;  2W1R A;  4WEK A;  4FOF A;  2L1M A;  1XJ2 A;  3E0Y A;  1T1C A;  5HPF A;  4GJ4 A;  4ARZ B;  2EWW A;  3LIB A;  4JGO A;  4HNB A;  1BYW A;  5EFW A;  5AVF A;  2O9C A;  3H82 B;  3KSF A;  3S7N A;  3PBQ A;  2M7V A;  2PR5 A;  2JKR I;  2R78 A;  2EA9 A;  3CUE C;  3LR4 A;  1UGU A;  2HGV A;  2M7U A;  4HQA A;  1GSW A;  1LSW A;  5IS1 A;  3MQQ A;  4BBV A;  4HJ6 A;  1XJ4 A;  3NOP C;  2KDK A;  3T4O A;  3JVU A;  1W63 Q;  3LIF A;  3BW6 A;  2PD8 A;  2W3F A;  3T4J A;  4K08 A;  3F1O B;  5HPI A;  3K3D A;  2Y79 A;  3PYP A;  2J80 A;  4AFI A;  2VV6 A;  4IUK A;  4NXE A;  5IT5 A;  3LI8 A;  1MZU A;  1UWN X;  3KSH A;  3MQ0 A;  4EXO A;  4FSF A;  4UEY A;  2M1C A;  5HDS A;  2PYR A;  5G4Y A;  5HDC A;  3RH8 B;  2DMW A;  2INW A;  5MC7 A;  2VKS A;  1N9N A;  2PHY A;  2QJ7 A;  2VLG A;  4EES A;  3MFX A;  3BWL A;  3C38 A;  1NWZ A;  3O5Y A;  5HL6 A;  4GHI A;  5CX7 A;  2W3E A;  1VB6 A;  3IS2 A;  2VV8 A;  4R38 A;  4M4X A;  3D72 A;  4ME4 A;  4Q0J A;  1TS0 A;  1D06 A;  3B33 A;  3JVV A;  4G3K A;  5TJJ A;  3R7W A;  3TE8 A;  3ZYT A;  3T50 A;  2GNX A;  5L8M A;  5F69 A;  1S1Z A;  1G28 A;  3EGX C;  4BBU A;  1OTB A;  3H7W A;  3LIC A;  3P01 A;  1Y28 A;  4NXF A;  5C5K A;  4RQ9 A;  2A24 B;  2MJ6 A;  1YSP A;  2WKR A;  2PR6 A;  1OT9 A;  4H6J A;  3ICY A;  3KYQ A;  2OOL A;  2V0U A;  4DN0 A;  3MJQ A;  1OT6 A;  1TD5 A;  4KUK A;  1VHM A;  2GJ3 A;  5LBR A;  3F1P A;  3KSI A;  3LR5 A;  4EQ1 A;  5I5L A;  3TJZ C;  1T19 A;  2J3W A;  2V1A A;  3NOU C;  4XT2 B;  4B9O A;  4E04 A;  3PR6 A;  4WEL A;  2W27 A;  4CLC A;  3NHQ A;  4PAU A;  1LL8 A;  4P6Z S;  4NXB A;  4G3V A;  5DKL A;  5DKK A;  2JKR M;  4LRX C;  2V9A A;  2Y8H A;  3UB9 A;  2WKQ A;  5HWT A;  1XJ6 A;  1DRM A;  3FPW A;  2VJW A;  1EW0 A;  2O0Y A;  3MF0 A;  4I3I A;  4WF0 A;  1S67 L;  2P04 A;  3VV4 A;  4GW9 A;  1IOU A;  2JHE A;  5AVE A;  2A24 A;  3T4K A;  3OC2 A;  2ZMF A;  2NUP C;  4O01 A;  3CIT A;  3SW1 A;  2HJE A;  2CMN A;  4GHI B;  3KYZ A;  3LFV A;  4QPR A;  3IS2 B;  5F6A A;  4LPZ A;  2IA2 A;  3A0V A;  3ULF A;  5HD3 A;  2V1B A;  4OOL A;  4YWZ A;  4CLC D;  3EQU A;  2W3G A;  4Z1W A;  3T4Q A;  4HP4 A;  4JGQ A;  2VEA A;  3R7W B;  1NLY A;  1UWP X;  2Z6D A;  4IUH A;  3VOL A;  1N9L A;  4XT2 A;  4O0P A;  3C2W A;  2D02 A;  2I9V A;  3H7W B;  1H3Q A;  3PBR A;  4UQI S;  2B18 A;  1N9O A;  2QJ5 A;  3BY8 A;  5F5Y A;  4H6J B;  4BWI A;  3PHY A;  3VE3 A;  5J7E A;  5HD5 A;  2OWH A;  3K3C A;  1S4S A;  2KOI A;  3EEH A;  3F1P B;  4JGP A;  3W2Z A;  3UE3 A;  1TS8 A;  2BAS A;  2WKP A;  2GZA A;  3TW8 A;  2LB9 A;  4BBT A;  4DMZ A;  1S1Y A;  1P0Z A;  4P6Z M;  1XFN A;  3HJI A;  2EWV A;  2O9A A;  4CLC B;  4MDZ A;  1YAX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...