1TS6A

Structure of the pb2 intermediate from time-resolved laue crystallography
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photoreceptor
molecule keywords Photoactive yellow protein
publication title Visualizing reaction pathways in photoactive yellow protein from nanoseconds to seconds.
pubmed doi rcsb
source organism Halorhodospira halophila
total genus 37
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2004-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1ts6A00
1S67L 3IS2A 2PR5A 5F5YA 5HD3A 4JGPA 4LRXC 4R38A 5J3WA 1TS8A 5DKKA 2VEAA 5EFWA 1S1YA 2H28A 1TS6A 3H7WB 5G4YA 2D02A 3ZQ5A 5IS1A 4GW9A 2OOLA 2GJ3A 2I9VA 5HWVA 1X0OA 3HJIA 4HP4A 2V0WA 2V9AA 4KQDA 1N9OA 3LI9A 2PYRA 2QWSA 4HI4A 4HOIA 3F1OA 2K7SA 2PD7A 1TS0A 4EESA 3CLOA 4K08A 1LL8A 2QJ5A 3PYPA 2VLGA 3BY8A 5AVFA 4I5SA 3F1PA 5TBMB 2INWA 4BBVA 4HIAA 4I39A 1T19A 3UB7A 3UB8A 4GS9A 2WKRA 1NWZA 1S66L 4L9EA 1GSVA 3LUQA 3KX0X 3G6OA 5KIZA 1T1BA 2Z6DA 1LT0A 4WF0A 2ZOIA 2VV8A 3A0RA 3UMDA 2V0UA 3H82A 1DP8A 2B02A 1S4RA 4EQ1A 4EERA 3ULFA 4NXGA 4DJ3A 5DKLA 3UE6A 1Y28A 4GHIA 4LRYC 4YWZA 2W0NA 4EEUA 5HWWA 2PR6A 2J80A 5HDDA 1WA9A 3CAXA 4NXFA 4HH3A 5AVEA 4DJ2A 1OTBA 3H7WA 3GDIA 2KX6A 1T1CA 4WLAA 1N9LA 1OT9A 3NOTC 5J7EA 2D01A 3ICYA 2V1AA 4EW7A 4L9FA 2CMNA 1UGUA 2M1CA 1LSXA 2WKPA 1BYWA 4HJ4A 4F3LB 4HH2A 2VV7A 1XJ6A 3IBRA 3PHYA 5TBMA 4HNBA 5J4EA 5HDCA 2W27A 2EA9A 3BWLA 3VE4A 1GSXA 2YKHA 3MQOA 2OWJA 3NOUC 2HV1A 3A0SA 4GCZA 4HY8A 1N9NA 4WUJA 2ZBBA 1XFNA 1XFQA 2YKFA 3IS2B 4JGRA 2PHYA 3HJKA 4HP9A 4XT2B 2QHKA 3LICA 4LPZA 2V1BA 1OTEA 1OTDA 5DJTA 4MN5A 3MFXA 2P7JA 4R70A 4R6LA 3EWKA 3K3CA 1DP6A 4R3AA 1D7EA 3MQQA 2PDRA 2JHEA 1S4SA 3LIAA 1G28A 1F98A 3CWFA 3LIFA 1ODVA 4JGOA 5DJUA 2BASA 5F69A 1XJ4A 4PKYA 5F6AA 3F1OB 3FC7A 4RQ9A 1F9IA 1MZUA 5HD5A 1KOUA 3FG8A 4LLOB 3SW1A 2L4RA 1V9YA 1VB6A 2ZOHA 4MN6A 1P0ZA 1OTIA 3BY9A 2L0WA 3F1PB 4HJ3A 1T18A 4GS9B 4KUOA 2PD8A 3MR0A 1D06A 4JGQA 3MJQA 3E4PA 4LRZE 3NJAA 3H82B 4EETB 4NXBA 3MXQA 3B33A 3OLOA 3LIEA 4B9OA 1OTAA 2A24B 1OJGA 2QKPA 5A8BA 4GHIB 3F1NB 5IU1A 3UB9A 4XT2A 4H6JB 3EEHA 2L1MA 3LIDA 3NOPC 3P7NA 4KUKA 1DP9A 3VE3A 1S1ZA 3UB6A 3UMEA 3RTYA 3VOLA 3C8CA 2R78A 1P97A 1OT6A 4HJ6A 1T1AA 2VV6A 3LI8A 3LIBA 3E4OA 1LSWA 3LYXA 3GECA 4BBTA 4WL9A 3T50A 2KDKA 1DRMA 3D72A 4NXEA 5F68A 5G4ZA 1UWNX 4I38A 4HQAA 2OWHA 4I3JA 1XJ2A 2JN7A 1OJ5A 5I5LA 4PKYG 3C2WA 1TS7A 1UWPX 5HDSA 2PYPA 2A24A 5HSQA 3A0VA 4HHDA 1JNUA 4F3LA 2Z6CA 1EW0A 3F1NA 5HWTA 5HZHA 4BBUA 4EEPA 4H6JA 4I3IA 3H9WA 3NHQA 2WKQA 1LSVA 1GSWA 4M4XA 3RH8B 4E04A 3E4QA 1XJ3A 3K3DA 4WN5A 4EXOA 4L9GA 4I3AA 2QJ7A 1V9ZA
chains in the Genus database with same CATH superfamily
1S67L 3OPRA 1MWTA 2O9CA 5FSRA 3AGEA 5F5YA 3DAVA 4JGPA 1S6RA 1G68A 3U4LP 4LRXC 1TS8A 3V67A 5G18A 3WWXA 3T4KA 3C5AA 5EFWA 2JE5A 3H7WB 3OCLA 1Y4OA 3MF0A 2D02A 4OQIA 1EROA 5IS1A 2OOLA 2I9VA 3DW0A 1K38A 1CI9A 3T1XA 4LCLA 4O8GA 1L0EA 1XP4A 4HI4A 1ESIA 3EQVA 2XRNA 3RJUA 3PBTA 3F1OA 2K7SA 4S2NC 3IF5A 4EESA 4K08A 5L2FA 1JWPA 1PW1A 3VOZA 2VKSA 3LEZA 2GNXA 1H8MA 3CITA 4BBVA 1PI5A 4HIAA 4WZ5C 1T19A 3UB7A 3UB8A 4Y5FA 1NLZA 2EX6A 1NWZA 4OLGA 4L9EA 1GSVA 3FWLA 3VP1A 4WF0A 4OOLA 4Q0JA 1S0WA 4PPRA 3ZG8B 4E6WA 4S2NA 1VEUA 1K25A 2JKGA 4BENA 2Z2MB 4X25A 1LHYA 1JVJA 2OLUA 1LI0A 1K54C 3UE6A 1KDSA 1Y28A 2Y2NA 4WZ5A 4LRYC 1IYQA 2VK3A 4JXSA 2Y2QA 2V2FF 5EVIB 1W79A 3IQAA 5EOOA 3IF6B 4E3LA 5KMWA 2ZQ8A 2XEPA 4ZDXA 4S2JA 5HL6A 4RX2A 3H7WA 1XXMA 2XR0A 4FTXA 2EFUA 1E3UA 2WGVA 5CECA 1IKIA 2DMWA 1NRFA 1BZAA 5TJJA 4EW7A 3PR6A 4YFMA 2CMNA 5EM1A 3LGOA 3G2ZA 2A3UA 3GQZA 4QY5A 3M2KA 1MXOA 1LSXA 1CF0A 3IHAA 2VV7A 1XPBA 3BFCA 2Q9MA 5I94A 3QP1A 3IWQA 2XDMA 2ZC5B 1Q2QA 1K4FA 2XFTA 3U2AA 2IWDA 3UPPA 2XROA 5KZHA 4BQMA 2XQZA 1YT4A 5JYOA 2H0TA 3NOUC 2WGWB 2HZ5A 1MY8A 2WAFA 4UQIM 2P08A 2ZQDA 5M1AA 2DRWA 1XFNA 1N4OA 4S2LA 4LV1A 4CPKA 1RGZA 1FR1A 4EU0A 4GDBA 3IS2B 4ZJ2A 3VFFA 1W7FA 1PWGA 2PHYA 4JGRA 5E2FA 1W63Q 1XA1A 4S2PA 2QHKA 1SZVA 4Y15A 1NYMA 3IXHA 2XLNA 4DRTA 4R1GA 4HBUA 1NY0A 1G5UA 2ZM0A 4EBPA 3OZHA 3WS0A 5EE8A 4ETZA 3ZG5A 4PMAA 4R6LA 4PM5A 5AQ9A 5EOEA 3E98A 4R3AA 3TJZC 4FOFA 2Y2HA 2WKIA 1PFLA 1K4EA 3OPHA 3QP5A 3V5MA 3HLDA 1L3LA 3LIAA 3CWFA 4MLLA 3LIFA 1ODVA 4ZTKA 5DJUA 1XJ4A 2H0YA 1MBLA 4Y0OA 3BFEA 2VGKA 1FCNA 3P98A 5CHMA 1MZUA 5HD5A 3MZEA 4KZ9A 1CEGA 4LLOB 4O0PA 5FATA 1V9YA 1M40A 3LEQA 4OOYA 4DE2A 3BFDA 1STZA 4OPZA 3BY9A 2K31A 4S2OA 1KVMA 2L0WA 3F1PB 5A91A 4EBNA 1BLCA 4KUOA 4JXVA 1FCOA 4JGQA 3E4PA 5E2HA 1VETB 3V39A 2Y2IA 4WZ4A 5DF9A 2WGWA 1BUEA 3NJAA 3H82B 4NK3A 3D4FA 4KQRA 4S2MA 2J7VA 3WRZA 5CTMA 1PNEA 5HFOA 2H5SA 5FL3A 4D2OA 4IBRA 4GHIB 5M19A 3CMZA 5IU1A 1L0GA 4H6JB 5FQIA 3NOPC 3P7NA 1IFQA 5F82A 3O86A 1I2SA 1KDWA 3ISGA 4Z9QA 3VE3A 5FEFA 1FIKA 1ZG4A 3LR5A 3N4IA 2EFXA 4OQHA 4UHUA 2ZC3B 3PBSA 3ZVTA 4E3OA 1E25A 4WMCD 3VOLA 1ZTUA 3Q82A 4E3KA 1OT6A 2JBFA 4JXWA 3UDFA 1T1AA 5K5BA 4OPQA 3E4OA 4B88A 3GECA 2OAP1 1NXYA 3S7NA 4WL9A 4BMWA 2HP6A 3FZCA 2KDKA 4MBFA 2XD5A 1DRMA 3D72A 1YSQA 4NXEA 2Y8HA 2OSUA 1IELA 1GA9A 1UWNX 5FDHA 5FI7A 2OV5A 1VETA 4QPRA 2B5RA 4RX3A 5TR7A 5CRFA 4B4ZA 1J9MA 1QMEA 4FD8A 4HEFA 1K56A 5J8XA 2PYPA 1PWCA 4IUHA 3A0VA 4F3LA 4UQIS 2Z6CA 1VHMA 2W3FA 5HZHA 4H6JA 3H9WA 4DKIA 4K0WA 3UNWA 3PAEA 3B47A 4WN5A 4KZAA 4IJGA 4KZ3A 4OLDA 4ID4A 2HDRA 3I7JA 4DXBA 3BQ8A 4ME4A 1IOUA 1H8ZA 2C5WB 1M6KA 2PR5A 2EWWA 5HD3A 1Y54A 4R38A 3C7UA 5DKKA 2B18A 4CLCA 2VEAA 3A3FA 1S1YA 1F5MA 1KVLA 1FSYA 4WYYA 2B95A 4GW9A 2GJ3A 5HWVA 4HP4A 2V0WA 2V9AA 3HLCA 3LR3A 1PWDA 1GHMA 2PYRA 2RCXA 3S22A 1ES3A 5EUAA 1PZOA 2XGNA 4ZRRA 3VMAA 2PRFA 1YQSA 3BQAA 1LL8A 2QJ5A 3PYPA 2ZMAA 4NETA 3E2LA 3NDEA 1IEMA 3KYQA 4HBTA 3PAGA 5FQMA 3LO7A 5TBMB 2XK1A 4C6YA 4G3KA 4AFIA 1ES5A 4I39A 5FEGA 4CLCE 2WKRA 1ES4A 1S66L 3LUQA 5KIZA 5FAOA 2Z6DA 3GV9A 5AQ7A 2ZC7A 2O0YA 1H5XA 2ZOIA 1NRJA 2V20A 2EX9A 2V0UA 3G31A 2Q0OA 3QP4A 4BWIA 1DP8A 3VP4A 3UDIA 3C38A 4EERA 3ULFA 3C4OA 4NXGA 4HESA 4WBGA 5FAQA 2ZLYA 5EV0A 4QWOA 4GN2A 1NZOA 1K6RA 2ZL1B 3IXDA 1MKMA 3CAXA 4NXFA 5FI6A 3TSGA 4LV2A 3ZG0A 4WM9A 5CHJA 4FCFA 2G2WA 1T1CA 4JKTA 5DTTA 4WLAA 1OT9A 1ZHHB 3R4KA 4JLFA 1FOFA 5J7EA 4KENB 5L09A 2K2NA 3PBNA 2OLVA 4X1LA 5GLAA 4GJ4A 1KE3A 4Y7PA 1BYWA 2X02A 3L9KA 5FAPA 2WKEA 1U60A 5E2EA 5CGSA 3EGXC 1XJ6A 3GRJA 4Q0IA 3PHYA 5TBMA 4HNBA 1JWZA 5J4EA 4DF6A 3VE4A 3ZG9B 3JVUA 3MQOA 2IA2A 4X55A 4MBHA 3HLGA 3OC2A 4WUJA 3HBRA 1YKDA 3IH8A 4JF6A 1EWZA 3MBZA 3GMWA 3GVBA 4OP5A 1O7EA 3HJKA 4XT2B 4LPZA 3LICA 1OTDA 3BLMA 3MSHA 5DJTA 2O9BA 3MKEA 3MFXA 3FPWA 3G32A 4LCMA 2ZL1A 4XUZA 2KLIA 3FKWA 3K3CA 4P0MA 3MQQA 1W8QA 4WELA 2JHEA 4KZ8A 3BM6A 1S4SA 3DWZA 1F98A 4KQOA 1NJ4A 2X01A 4X6TA 1HVBA 4PKYA 1FR6A 3ZNYA 4RQ9A 1K0KA 1F9IA 3UO9A 1LL9A 1WYCA 3DWKA 2QPNA 3FG8A 5KSCA 3SW1A 5D3OA 3B42A 3HVFA 3RXXA 3BECA 4NKPA 1TF1A 4MN6A 5EPHA 4GS9B 2NUTC 3FYZA 2PD8A 3MR0A 1YAXA 3S7QA 1K54A 5F1FA 1E3UD 3D9YA 1YLYA 4LRZE 1NLYA 1N9BA 3Q7ZA 2JC7A 3SS3A 3NC8A 3MXQA 3NCKA 1L2SA 5IT5A 3T4SA 4E3JA 3T4LA 2QKPA 5A8BA 3BLSA 1HZOA 3CHWP 1VQQA 4XT2A 5HPIA 2J9PA 4KUKA 1YLWA 4R23A 4D60A 5EVIC 2HGVA 3SS5A 3IF6C 3UN7A 4K0XA 1S1ZA 2LB9A 2Y2MA 3V3RA 4BL3A 3IH9A 4E3MA 4X53A 4P85A 5FI2A 1YMSA 2J8YA 4E3IA 2R78A 1P97A 5LBRA 2JKRI 2XF3A 1MWUA 4HJ6A 3SH8A 3C4PA 5EVIA 4DE3A 1LSWA 4BBTA 3IF6A 4R3JA 5DF7A 3VFHA 3KYEA 4UA9A 4O01A 5FQ9A 3JVVA 5GL9A 3W4OA 2ZQCA 2Y4AA 3VV4A 5TFQA 2Y2JA 2J3TD 4KZ6A 4PM6A 5G4ZA 2ZMFA 1KGGA 1FILA 4I38A 3SZTA 4GLQA 5HAPA 1CJFA 5GHXA 4I3JA 4X69A 5FDSA 1NYYA 3HUNA 4PKYG 5CEDA 3C2WA 2WKHA 4QHCA 4N9LA 3T1SA 3KSIA 3NI9A 2JKRM 1K57C 5EECA 4BD0A 4KZ4A 2Y2PA 2MJ6A 2GZAA 2M7UA 4OPRA 4MNRA 3TG9A 3NHQA 2WKQA 1LSVA 4LENA 1GSWA 2E8JA 3T4TA 2V8FA 4A5RA 3ZVWA 4DMZA 4P6ZM 3N6IA 1PIOA 2JKFA 4EXOA 4B4XA 2V1ZA 2P9VB 5EM0A 5U47A 3ITAA 1V9ZA 3O3VA 4XXRA 1KGFA 2FFYA 3IS2A 5AJGA 2P74A 1NZUA 3FPVA 1PI4A 4Y0TA 4KZBA 4DDSA 1BLSA 4P87A 5J3WA 4S2IA 3Q1FA 2VGJA 4M3KA 1TS6A 2GX5A 5HPFA 5G4YA 3BJNA 3FKVA 5DTSA 1X0OA 3WS1A 3IX4A 4X1MA 1YPRA 5GLBA 3OPPA 3NDGA 4KQQA 1BTLA 3LI9A 4JXGA 4MDZA 2QWSA 1ERQA 2CC1A 2IWCA 2EXAA 4Q0HA 3O88A 4OKPA 3UPOA 4QU3A 5GLCA 3QP2A 2JKTM 1ESUA 3M6BA 3N8SA 1I2WA 2VLGA 3LY3A 1SKOB 4O7DA 3BY8A 5AVFA 5F1GA 3WS5A 3F1PA 4KZ7A 3VP2A 4ETXA 2FFFB 3CPTB 4GNUA 1XGIA 1OMEA 3ZYTA 3G6OA 4E3NA 1T1BA 4IVIA 1LT0A 1Z09A 1YM1A 1MPLA 1YLTA 5HX9A 1IYSA 3H82A 2WYXA 1XGJA 2P9VA 2G7UA 1MC0A 2HJEA 4DJ3A 1K56D 1MKIA 2Y79A 5DKLA 5CGWA 3T1QB 4PAUA 4GHIA 4YWZA 5L10A 1TDLA 2W0NA 4EEUA 5HWWA 2PR6A 1OPXA 3NECA 4Y0UA 5AQBA 4HH3A 4S2KA 3N8RA 5AVEA 1Q2PA 4DJ2A 3GDIA 2KX6A 3MFDA 1LLBA 2VZWA 1BLPA 1GHIA 5MC7A 1N9LA 5DFYA 2RL3A 4FH2A 2D01A 3QNCA 2V1AA 1SHVA 5F83A 1FSWA 1IYPA 4ARZB 2HPBA 4NG2A 1UGUA 3SOIA 1ONGA 1HD8A 4CLCD 4MCWA 2VGLM 2WKPA 2Y2LA 1CQAA 2W3HA 3TOIA 4HH2A 1ERMA 2WK0A 2EWVA 3VP0A 2ZD8A 4UAAA 2YKHA 2OWJA 1YSPA 2HV1A 3A0SA 2WADA 3S7PA 1JTDA 4HY8A 4BD1A 4P6BA 1N9NA 2ZBBA 2BTFP 4GKUA 1XFQA 2BLSA 2Y91A 3HLEA 4P6ZS 2YKFA 2X71A 3NBLA 3M6HA 3EOIA 2WUQA 2Y2OA 4MN5A 2P04A 4XUXA 1RGYA 3VOYA 2I72A 3HUMA 3G4PA 3V50A 2W3DA 3EWKA 4RA7A 1D7EA 2DNSA 3NIAA 2Q9NA 3PBOA 3NULA 2BG1A 2EX8A 4JGOA 2XFSA 3PBQA 1SDEA 5CGXA 4EBLA 3F1OB 3FC7A 4Q8IA 1DY6A 4ARZA 3UE1A 1ALQA 1KOUA 3VSKA 2PBDP 3W4QA 2L4RA 3A3DA 3FV7A 2V8CA 1P0ZA 4HJ3A 3BYDA 5A92A 1A0KA 4LV0A 3LR4A 2LB5A 1ZC2A 1ZKJA 2UV0E 1D06A 3G30A 3WS2A 3MJQA 1K6SA 2Y2KA 4F94A 5FQKA 2PU2A 1VEUB 2WAEA 3KSGA 2PBYA 3KSHA 3W4PA 1BULA 5EVLA 3HREA 3B33A 1Z6FA 3OLOA 2QZ6A 4U3TA 3MQ0A 4JF4A 4B9OA 1OTAA 3IHBA 1KGEA 3MMHA 3F1NB 2Z2LB 3EEHA 2L1MA 3LIDA 4PM8A 3TE8A 5TGFA 5E43A 3MZDA 4DE0A 1ZG6A 2QMIA 4UEYA 3UB6A 3LY4A 3UMEA 5C5KA 4OH0A 5E2GA 1SDNA 2HJ9C 1ES2A 2G2UA 3C8CA 4WEJA 3WRTA 3IX3A 5DTKA 2ZQ9A 3BFGA 3MXSA 4EUVA 5FQJA 2HDSA 3HLWA 2VX8A 3L7HA 2ZJ9A 1ONHA 2KOIA 4DN0A 3T50A 1BSGA 2QYBA 2Y55A 4Y13A 1CI8A 2ZC6B 5FA7A 1GA0A 1HTZA 4IUKA 3UY6A 4Z1WA 1FQGA 2PAVP 3ZDJA 2VGLS 2FZ0A 1TD5A 4HQAA 1HLUP 2XSSA 2Y59A 4R3BA 3BEBA 3MZFA 3CG5A 2JN7A 3SS4A 1YLJA 1OJ5A 5I5LA 4RVAA 3Q07A 1TS7A 1UWPX 2GDNA 5HDSA 4JBFA 2ZQ7A 3T4QA 1MWSA 5DF8A 3PBRA 2FH5A 5HSQA 3CUEC 4HHDA 3UE3A 1JNUA 3HLBA 3ZNTA 1TVFA 3IWIA 3F1NA 1AXBA 2XA7M 5HWTA 4BBUA 4EEPA 4UA7A 4I3IA 3KYZA 3ZHHA 4M4XA 3RH8B 4QY6A 4E04A 3HCYA 3LFVA 1TDGA 1RCJA 3W2ZA 1XJ3A 2WGIA 3TRCA 5CEBA 3K3DA 4GDNA 2DCFA 4L9GA 3BRMA 3GSGA 2QJ7A 1SCWA 5AQAA 2HDUA 4LFUA 2WZXA 3CUEA 4N92A 1O07A 3ZGAB 4YNRA 1L0FA 1C3BA 4EV4A 3S7OA 2W3GA 4JPMA 1F2KA 4N1HA 4Y17A 1P9WA 2H28A 5CX7A 3ZCZA 4IEDA 3ZQ5A 3G34A 3K2NA 1CK3A 3A3IA 4DDYA 4YINA 3T12B 1BT5A 3HJIA 3WS4A 4KQDA 1N9OA 3IBJA 5GHZA 5CHUA 3N7WA 3E2KA 3S1YA 3EGDC 3OCNA 4HOIA 4YOFA 2PD7A 1TS0A 5FQQA 3CLOA 3Q7VB 3G2YA 1KE0A 4GD8A 5EVID 2J3TC 3JPUA 2Y2GA 4I5SA 5A93A 2INWA 3Q81A 4GS9A 3PXPA 5GHYA 2PT7A 3MS6A 2AVXA 3KX0X 1AWIA 5L8MA 4IBXA 3S4XA 2UWXA 3R7WB 2ZC4B 2VV8A 3A0RA 1PRQA 3UMDA 1LL5A 4FUWA 2E8IA 2B02A 1S4RA 4EQ1A 3CI6A 3G35A 3HUOA 4RYEA 2ZM8A 3N8LA 5M18A 2O9AA 3IT9A 2JCHA 3D3OA 1RP5A 1XA7A 4ZBEA 4NEED 3QP6A 3P01A 3ZG7B 3RFBA 4OQGA 2J80A 1GHPA 5HDDA 2A49A 1WA9A 4JF5A 4R4RA 2J3WA 1OTBA 4KG5A 4MMNA 3OOVA 1QMFA 5CTNA 2EX2A 1K57A 2JKTI 4U0TA 3O87A 3M2JA 4OONA 4EWFA 1J3WA 3C7VA 3NOTC 4N9KA 1GCEA 3BFFA 3QNBA 3ICYA 4L9FA 3EEAA 1SKFA 3BW6A 4ZJ1A 1XKZA 3Q7VA 3AGFA 2M1CA 3T4OA 3C30A 5BOHA 1JWVA 2J9OA 4E6XA 4HJ4A 4CJNA 3LCEA 4F3LB 1P9RA 5EVEA 1G6OA 4PM9A 3JYIA 4EUZA 4WEKA 3IBRA 5KSHA 3IXGA 2HP9A 5HDCA 2W27A 2O99A 3HLFA 3T4JA 1YLPA 2R9XA 2EA9A 3BWLA 1GSXA 1LI9A 4X56A 3R7WA 4GCZA 4QB8A 3SH9A 1IKGA 2XA7S 4GOGA 4EQIA 1G6AA 2ZMVA 4G3WA 2WZZA 4WMCA 1VM1A 1L0DA 2HP5A 1PW8A 4CQHA 2W3EA 4ZAMA 3DTMA 4HP9A 4OPYA 3O5YA 2V1BA 1OTEA 3DTIA 1W63M 4CLCB 2P7JA 4R70A 4ESPA 4PM7A 4K91A 1DP6A 2PDRA 4KG2A 4QD4A 5HAQA 2NUPC 1CEFA 2H10A 2C6WB 1G28A 1JTGA 1DJBA 4DE1A 3KSFA 3QHYA 2BASA 4H8RA 5F69A 3VSLA 5F6AA 4MN7A 4OOMA 5DVAA 5L07A 3EQUA 4GD6A 1BLHA 1VB6A 3OPLA 3SH7A 1I5QA 2ZOHA 3IXBA 4BJPA 2ZQAA 1OTIA 3QP8A 2A2LA 3PTEA 5HAIA 3OBFA 1T18A 4C3QA 2W1TB 4B93A 4MBKA 3DTEA 1W8YA 2R9WA 4OQ0A 3MXRA 4LGWA 4CLCC 3CZDA 3MKFA 4G3VA 4UA6A 1TEMA 3AGDA 1PZPA 1DJCA 4EETB 3HL9A 4NXBA 3UDXA 1DJAA 3ZFZA 3LIEA 2A24B 1OJGA 1MWRA 1SKOA 4IHQA 4OP8A 4R0QA 1H0MA 3UB9A 3A3JA 4QJGA 3CPTA 5CXWA 3T1RA 1KE4A 1DP9A 4GB7A 3VP3A 3GR2A 3A3EA 1H8YA 4C75A 5GLDA 4KG6A 1YMXA 4N1XA 3ITBA 5CERA 1IYOA 2VA0A 4PHTA 3RTYA 3IX8A 2HDQA 1D1JA 5FASA 3UB5P 3CJMA 2VJWA 4BLMA 4Y3IA 2ACGA 2VV6A 5HARA 3GTCA 3LI8A 3LIBA 2W1RA 2EXBA 3LYXA 5IHVA 3W8KA 4II7A 2PU4A 5HW3A 1PYYA 4FSFA 3E0YA 3RXWA 5JYPA 3NY4A 2XD1A 3DTKA 5F68A 2W1TA 4BL2A 3KO6A 2OAQ1 2XH9A 2IWBA 4KZ5A 4DXCA 1XX2A 1FCMA 2OWHA 3TW8A 1XJ2A 1K55C 5A90A 2HF6A 4ZJ3A 4MEZA 4LV3A 1EI5A 1WE4A 5HL1A 1E4DA 2A24A 3UE0A 3B3XA 4FH4A 1H3QA 1W5DA 2ZM2A 1EW0A 3V3SA 4R4SA 3IWOA 4OVDA 4GZBA 4X68A 3P09A 3UPNA 3DBAA 2M7VA 4U0XA 3E4QA 1WYBA 1K55A 1YLZA 4IVKA 4I3AA 1ACFA 5DFXA 4L0LA 4Y2FA 3LR0A
chains in the Genus database with same CATH topology
1S67L 3CUEA 3BQ8A 3IS2A 4ME4A 5AJGA 2O9CA 1IOUA 4YNRA 3FPVA 2PR5A 2EWWA 5F5YA 5HD3A 4JGPA 3S7OA 4LRXC 4R38A 5J3WA 1TS8A 2W3GA 3V67A 5DKKA 3T4KA 2B18A 4CLCA 2VEAA 5EFWA 1S1YA 1F5MA 1P9WA 2H28A 1TS6A 5CX7A 2GX5A 3H7WB 3OCLA 5HPFA 5G4YA 3BJNA 2D02A 3MF0A 3ZQ5A 3K2NA 5IS1A 4GW9A 2OOLA 2GJ3A 2I9VA 5HWVA 1X0OA 3HJIA 4HP4A 2V0WA 2V9AA 4KQDA 3LR3A 1N9OA 3IBJA 3LI9A 4MDZA 2PYRA 4O8GA 2QWSA 4HI4A 3EGDC 3EQVA 4Q0HA 3OCNA 4HOIA 4ZRRA 2XRNA 3PBTA 3F1OA 2K7SA 4YOFA 2PD7A 1TS0A 4EESA 2JKTM 3CLOA 4K08A 3BQAA 1LL8A 2QJ5A 2J3TC 3PYPA 2VKSA 2VLGA 3KYQA 2GNXA 1H8MA 3BY8A 5AVFA 4I5SA 3CITA 3F1PA 5TBMB 2INWA 4BBVA 4G3KA 4AFIA 4HIAA 4I39A 4ETXA 1T19A 3UB7A 3UB8A 4GS9A 4CLCE 2WKRA 3PXPA 1NLZA 2PT7A 4Y5FA 1NWZA 1S66L 4L9EA 1GSVA 3LUQA 3KX0X 3G6OA 3ZYTA 5L8MA 5KIZA 1T1BA 2Z6DA 1LT0A 4WF0A 4OOLA 2O0YA 4Q0JA 3R7WB 2ZOIA 1NRJA 2VV8A 3A0RA 3UMDA 2V0UA 3H82A 4BWIA 1DP8A 2B02A 1S4RA 4EQ1A 2G7UA 3C38A 3CI6A 1MC0A 2HJEA 4EERA 3ULFA 4NXGA 4DJ3A 2Y79A 5DKLA 3UE6A 1Y28A 4PAUA 2O9AA 4GHIA 4LRYC 4YWZA 3D3OA 2W0NA 4EEUA 4NEED 3P01A 5HWWA 2PR6A 3RFBA 2J80A 5HDDA 1OPXA 1WA9A 1MKMA 3CAXA 4HH3A 4NXFA 5HL6A 5AVEA 4DJ2A 2J3WA 1OTBA 3H7WA 3GDIA 2KX6A 4MMNA 2VZWA 3OOVA 1T1CA 5MC7A 2JKTI 4WLAA 1N9LA 5DFYA 1OT9A 1ZHHB 2DMWA 3R4KA 3NOTC 5J7EA 2D01A 3ICYA 5TJJA 2V1AA 4EW7A 4L9FA 3PR6A 2K2NA 3PBNA 4ARZB 2CMNA 3EEAA 1UGUA 3BW6A 2M1CA 3T4OA 3C30A 4GJ4A 4CLCD 4MCWA 1LSXA 2VGLM 1BYWA 2WKPA 4HJ4A 2W3HA 4F3LB 1P9RA 4HH2A 3EGXC 1G6OA 2VV7A 4WEKA 1XJ6A 3IBRA 4Q0IA 5KSHA 3PHYA 5TBMA 4HNBA 5J4EA 2EWVA 5HDCA 2W27A 2O99A 3U2AA 3T4JA 2XROA 2EA9A 3BWLA 3VE4A 1GSXA 2YKHA 3JVUA 3MQOA 2IA2A 2OWJA 3R7WA 3NOUC 1YSPA 2HV1A 3A0SA 4UQIM 4GCZA 3S7PA 2P08A 4HY8A 2XA7S 1N9NA 3OC2A 4WUJA 2ZBBA 1XFNA 1YKDA 2ZMVA 4G3WA 1XFQA 4EU0A 4P6ZS 2YKFA 3IS2B 4CQHA 2W3EA 4JGRA 2PHYA 3HJKA 1W63Q 4HP9A 4XT2B 3EOIA 2QHKA 3LICA 3O5YA 2V1BA 4LPZA 1OTEA 1OTDA 5DJTA 2O9BA 4MN5A 2P04A 1W63M 3MFXA 3FPWA 4CLCB 2P7JA 4R70A 4ETZA 4R6LA 2KLIA 2W3DA 3EWKA 3K3CA 1DP6A 3E98A 1D7EA 4R3AA 3MQQA 2PDRA 4WELA 2JHEA 3TJZC 4FOFA 2NUPC 1S4SA 3PBOA 3LIAA 1G28A 1F98A 4KQOA 3CWFA 3KSFA 3LIFA 1ODVA 4JGOA 3PBQA 5DJUA 2BASA 5F69A 1XJ4A 4PKYA 5F6AA 3F1OB 3FC7A 4RQ9A 1F9IA 1MZUA 4MN7A 4ARZA 4OOMA 5HD5A 1KOUA 3FG8A 4LLOB 4O0PA 3SW1A 3EQUA 2L4RA 1V9YA 1VB6A 3B42A 2ZOHA 4BJPA 1STZA 1TF1A 1P0ZA 4MN6A 1OTIA 3BY9A 2K31A 4NKPA 2L0WA 2A2LA 3F1PB 3OBFA 4HJ3A 1T18A 4GS9B 2NUTC 4KUOA 3LR4A 2W1TB 4B93A 2LB5A 2PD8A 3MR0A 1D06A 1YAXA 3S7QA 4JGQA 3MJQA 3E4PA 4CLCC 4LRZE 4G3VA 1NLYA 5DF9A 3KSGA 3NJAA 3H82B 4EETB 4NXBA 3KSHA 3MXQA 5IT5A 3B33A 3OLOA 3LIEA 3MQ0A 3T4SA 4B9OA 1OTAA 2A24B 1OJGA 5FL3A 3T4LA 2QKPA 4IHQA 5A8BA 4GHIB 3MMHA 3F1NB 5IU1A 3UB9A 4XT2A 4H6JB 5HPIA 3EEHA 2L1MA 3LIDA 3NOPC 1IFQA 3P7NA 4KUKA 3TE8A 1DP9A 2HGVA 3VE3A 1S1ZA 2LB9A 4UEYA 3UB6A 3UMEA 3LR5A 5C5KA 2VA0A 4PHTA 3RTYA 3PBSA 2HJ9C 3VOLA 3C8CA 4WEJA 1ZTUA 2R78A 1P97A 5LBRA 2JKRI 2VJWA 1OT6A 4HJ6A 1T1AA 2VV6A 4Y3IA 4EUVA 5K5BA 3LI8A 3LIBA 3E4OA 2W1RA 1LSWA 3LYXA 3GECA 4BBTA 2OAP1 2VX8A 3S7NA 4II7A 4WL9A 2KOIA 4BMWA 4O01A 3T50A 4DN0A 2QYBA 3JVVA 2KDKA 4FSFA 3E0YA 1DRMA 4IUKA 3VV4A 3D72A 1YSQA 4NXEA 4Z1WA 2J3TD 2Y8HA 5F68A 2W1TA 5G4ZA 3KO6A 2ZMFA 2OAQ1 1UWNX 4I38A 2VGLS 2FZ0A 4GLQA 1TD5A 4HQAA 4QPRA 2OWHA 4I3JA 3TW8A 1XJ2A 2XSSA 2JN7A 2HF6A 1OJ5A 5I5LA 4PKYG 3C2WA 1TS7A 1UWPX 5HDSA 3T4QA 3KSIA 2JKRM 2PYPA 3PBRA 2FH5A 2A24A 4IUHA 5HSQA 3A0VA 3CUEC 2MJ6A 4HHDA 3UE3A 2GZAA 1JNUA 4UQIS 1H3QA 4F3LA 2Z6CA 2M7UA 1VHMA 1EW0A 3F1NA 2W3FA 2XA7M 5HWTA 5HZHA 4BBUA 4EEPA 4H6JA 4I3IA 3KYZA 3H9WA 3NHQA 2WKQA 1LSVA 1GSWA 4M4XA 3RH8B 3DBAA 4E04A 2M7VA 3T4TA 3E4QA 3HCYA 4DMZA 4P6ZM 3LFVA 3W2ZA 1XJ3A 3TRCA 3B47A 3K3DA 4WN5A 4EXOA 4L9GA 4I3AA 4IJGA 5DFXA 2QJ7A 4L0LA 4Y2FA 3LR0A 1V9ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S67 L;  3IS2 A;  2PR5 A;  5F5Y A;  5HD3 A;  4JGP A;  4LRX C;  4R38 A;  5J3W A;  1TS8 A;  5DKK A;  2VEA A;  5EFW A;  1S1Y A;  2H28 A;  1TS6 A;  3H7W B;  5G4Y A;  2D02 A;  3ZQ5 A;  5IS1 A;  4GW9 A;  2OOL A;  2GJ3 A;  2I9V A;  5HWV A;  1X0O A;  3HJI A;  4HP4 A;  2V0W A;  2V9A A;  4KQD A;  1N9O A;  3LI9 A;  2PYR A;  2QWS A;  4HI4 A;  4HOI A;  3F1O A;  2K7S A;  2PD7 A;  1TS0 A;  4EES A;  3CLO A;  4K08 A;  1LL8 A;  2QJ5 A;  3PYP A;  2VLG A;  3BY8 A;  5AVF A;  4I5S A;  3F1P A;  5TBM B;  2INW A;  4BBV A;  4HIA A;  4I39 A;  1T19 A;  3UB7 A;  3UB8 A;  4GS9 A;  2WKR A;  1NWZ A;  1S66 L;  4L9E A;  1GSV A;  3LUQ A;  3KX0 X;  3G6O A;  5KIZ A;  1T1B A;  2Z6D A;  1LT0 A;  4WF0 A;  2ZOI A;  2VV8 A;  3A0R A;  3UMD A;  2V0U A;  3H82 A;  1DP8 A;  2B02 A;  1S4R A;  4EQ1 A;  4EER A;  3ULF A;  4NXG A;  4DJ3 A;  5DKL A;  3UE6 A;  1Y28 A;  4GHI A;  4LRY C;  4YWZ A;  2W0N A;  4EEU A;  5HWW A;  2PR6 A;  2J80 A;  5HDD A;  1WA9 A;  3CAX A;  4NXF A;  4HH3 A;  5AVE A;  4DJ2 A;  1OTB A;  3H7W A;  3GDI A;  2KX6 A;  1T1C A;  4WLA A;  1N9L A;  1OT9 A;  3NOT C;  5J7E A;  2D01 A;  3ICY A;  2V1A A;  4EW7 A;  4L9F A;  2CMN A;  1UGU A;  2M1C A;  1LSX A;  2WKP A;  1BYW A;  4HJ4 A;  4F3L B;  4HH2 A;  2VV7 A;  1XJ6 A;  3IBR A;  3PHY A;  5TBM A;  4HNB A;  5J4E A;  5HDC A;  2W27 A;  2EA9 A;  3BWL A;  3VE4 A;  1GSX A;  2YKH A;  3MQO A;  2OWJ A;  3NOU C;  2HV1 A;  3A0S A;  4GCZ A;  4HY8 A;  1N9N A;  4WUJ A;  2ZBB A;  1XFN A;  1XFQ A;  2YKF A;  3IS2 B;  4JGR A;  2PHY A;  3HJK A;  4HP9 A;  4XT2 B;  2QHK A;  3LIC A;  4LPZ A;  2V1B A;  1OTE A;  1OTD A;  5DJT A;  4MN5 A;  3MFX A;  2P7J A;  4R70 A;  4R6L A;  3EWK A;  3K3C A;  1DP6 A;  4R3A A;  1D7E A;  3MQQ A;  2PDR A;  2JHE A;  1S4S A;  3LIA A;  1G28 A;  1F98 A;  3CWF A;  3LIF A;  1ODV A;  4JGO A;  5DJU A;  2BAS A;  5F69 A;  1XJ4 A;  4PKY A;  5F6A A;  3F1O B;  3FC7 A;  4RQ9 A;  1F9I A;  1MZU A;  5HD5 A;  1KOU A;  3FG8 A;  4LLO B;  3SW1 A;  2L4R A;  1V9Y A;  1VB6 A;  2ZOH A;  4MN6 A;  1P0Z A;  1OTI A;  3BY9 A;  2L0W A;  3F1P B;  4HJ3 A;  1T18 A;  4GS9 B;  4KUO A;  2PD8 A;  3MR0 A;  1D06 A;  4JGQ A;  3MJQ A;  3E4P A;  4LRZ E;  3NJA A;  3H82 B;  4EET B;  4NXB A;  3MXQ A;  3B33 A;  3OLO A;  3LIE A;  4B9O A;  1OTA A;  2A24 B;  1OJG A;  2QKP A;  5A8B A;  4GHI B;  3F1N B;  5IU1 A;  3UB9 A;  4XT2 A;  4H6J B;  3EEH A;  2L1M A;  3LID A;  3NOP C;  3P7N A;  4KUK A;  1DP9 A;  3VE3 A;  1S1Z A;  3UB6 A;  3UME A;  3RTY A;  3VOL A;  3C8C A;  2R78 A;  1P97 A;  1OT6 A;  4HJ6 A;  1T1A A;  2VV6 A;  3LI8 A;  3LIB A;  3E4O A;  1LSW A;  3LYX A;  3GEC A;  4BBT A;  4WL9 A;  3T50 A;  2KDK A;  1DRM A;  3D72 A;  4NXE A;  5F68 A;  5G4Z A;  1UWN X;  4I38 A;  4HQA A;  2OWH A;  4I3J A;  1XJ2 A;  2JN7 A;  1OJ5 A;  5I5L A;  4PKY G;  3C2W A;  1TS7 A;  1UWP X;  5HDS A;  2PYP A;  2A24 A;  5HSQ A;  3A0V A;  4HHD A;  1JNU A;  4F3L A;  2Z6C A;  1EW0 A;  3F1N A;  5HWT A;  5HZH A;  4BBU A;  4EEP A;  4H6J A;  4I3I A;  3H9W A;  3NHQ A;  2WKQ A;  1LSV A;  1GSW A;  4M4X A;  3RH8 B;  4E04 A;  3E4Q A;  1XJ3 A;  3K3D A;  4WN5 A;  4EXO A;  4L9G A;  4I3A A;  2QJ7 A;  1V9Z A; 
#chains in the Genus database with same CATH topology
 1S67 L;  3OPR A;  1MWT A;  2O9C A;  5FSR A;  3AGE A;  5F5Y A;  3DAV A;  4JGP A;  1S6R A;  1G68 A;  3U4L P;  4LRX C;  1TS8 A;  3V67 A;  5G18 A;  3WWX A;  3T4K A;  3C5A A;  5EFW A;  2JE5 A;  3H7W B;  3OCL A;  1Y4O A;  3MF0 A;  2D02 A;  4OQI A;  1ERO A;  5IS1 A;  2OOL A;  2I9V A;  3DW0 A;  1K38 A;  1CI9 A;  3T1X A;  4LCL A;  4O8G A;  1L0E A;  1XP4 A;  4HI4 A;  1ESI A;  3EQV A;  2XRN A;  3RJU A;  3PBT A;  3F1O A;  2K7S A;  4S2N C;  3IF5 A;  4EES A;  4K08 A;  5L2F A;  1JWP A;  1PW1 A;  3VOZ A;  2VKS A;  3LEZ A;  2GNX A;  1H8M A;  3CIT A;  4BBV A;  1PI5 A;  4HIA A;  4WZ5 C;  1T19 A;  3UB7 A;  3UB8 A;  4Y5F A;  1NLZ A;  2EX6 A;  1NWZ A;  4OLG A;  4L9E A;  1GSV A;  3FWL A;  3VP1 A;  4WF0 A;  4OOL A;  4Q0J A;  1S0W A;  4PPR A;  3ZG8 B;  4E6W A;  4S2N A;  1VEU A;  1K25 A;  2JKG A;  4BEN A;  2Z2M B;  4X25 A;  1LHY A;  1JVJ A;  2OLU A;  1LI0 A;  1K54 C;  3UE6 A;  1KDS A;  1Y28 A;  2Y2N A;  4WZ5 A;  4LRY C;  1IYQ A;  2VK3 A;  4JXS A;  2Y2Q A;  2V2F F;  5EVI B;  1W79 A;  3IQA A;  5EOO A;  3IF6 B;  4E3L A;  5KMW A;  2ZQ8 A;  2XEP A;  4ZDX A;  4S2J A;  5HL6 A;  4RX2 A;  3H7W A;  1XXM A;  2XR0 A;  4FTX A;  2EFU A;  1E3U A;  2WGV A;  5CEC A;  1IKI A;  2DMW A;  1NRF A;  1BZA A;  5TJJ A;  4EW7 A;  3PR6 A;  4YFM A;  2CMN A;  5EM1 A;  3LGO A;  3G2Z A;  2A3U A;  3GQZ A;  4QY5 A;  3M2K A;  1MXO A;  1LSX A;  1CF0 A;  3IHA A;  2VV7 A;  1XPB A;  3BFC A;  2Q9M A;  5I94 A;  3QP1 A;  3IWQ A;  2XDM A;  2ZC5 B;  1Q2Q A;  1K4F A;  2XFT A;  3U2A A;  2IWD A;  3UPP A;  2XRO A;  5KZH A;  4BQM A;  2XQZ A;  1YT4 A;  5JYO A;  2H0T A;  3NOU C;  2WGW B;  2HZ5 A;  1MY8 A;  2WAF A;  4UQI M;  2P08 A;  2ZQD A;  5M1A A;  2DRW A;  1XFN A;  1N4O A;  4S2L A;  4LV1 A;  4CPK A;  1RGZ A;  1FR1 A;  4EU0 A;  4GDB A;  3IS2 B;  4ZJ2 A;  3VFF A;  1W7F A;  1PWG A;  2PHY A;  4JGR A;  5E2F A;  1W63 Q;  1XA1 A;  4S2P A;  2QHK A;  1SZV A;  4Y15 A;  1NYM A;  3IXH A;  2XLN A;  4DRT A;  4R1G A;  4HBU A;  1NY0 A;  1G5U A;  2ZM0 A;  4EBP A;  3OZH A;  3WS0 A;  5EE8 A;  4ETZ A;  3ZG5 A;  4PMA A;  4R6L A;  4PM5 A;  5AQ9 A;  5EOE A;  3E98 A;  4R3A A;  3TJZ C;  4FOF A;  2Y2H A;  2WKI A;  1PFL A;  1K4E A;  3OPH A;  3QP5 A;  3V5M A;  3HLD A;  1L3L A;  3LIA A;  3CWF A;  4MLL A;  3LIF A;  1ODV A;  4ZTK A;  5DJU A;  1XJ4 A;  2H0Y A;  1MBL A;  4Y0O A;  3BFE A;  2VGK A;  1FCN A;  3P98 A;  5CHM A;  1MZU A;  5HD5 A;  3MZE A;  4KZ9 A;  1CEG A;  4LLO B;  4O0P A;  5FAT A;  1V9Y A;  1M40 A;  3LEQ A;  4OOY A;  4DE2 A;  3BFD A;  1STZ A;  4OPZ A;  3BY9 A;  2K31 A;  4S2O A;  1KVM A;  2L0W A;  3F1P B;  5A91 A;  4EBN A;  1BLC A;  4KUO A;  4JXV A;  1FCO A;  4JGQ A;  3E4P A;  5E2H A;  1VET B;  3V39 A;  2Y2I A;  4WZ4 A;  5DF9 A;  2WGW A;  1BUE A;  3NJA A;  3H82 B;  4NK3 A;  3D4F A;  4KQR A;  4S2M A;  2J7V A;  3WRZ A;  5CTM A;  1PNE A;  5HFO A;  2H5S A;  5FL3 A;  4D2O A;  4IBR A;  4GHI B;  5M19 A;  3CMZ A;  5IU1 A;  1L0G A;  4H6J B;  5FQI A;  3NOP C;  3P7N A;  1IFQ A;  5F82 A;  3O86 A;  1I2S A;  1KDW A;  3ISG A;  4Z9Q A;  3VE3 A;  5FEF A;  1FIK A;  1ZG4 A;  3LR5 A;  3N4I A;  2EFX A;  4OQH A;  4UHU A;  2ZC3 B;  3PBS A;  3ZVT A;  4E3O A;  1E25 A;  4WMC D;  3VOL A;  1ZTU A;  3Q82 A;  4E3K A;  1OT6 A;  2JBF A;  4JXW A;  3UDF A;  1T1A A;  5K5B A;  4OPQ A;  3E4O A;  4B88 A;  3GEC A;  2OAP 1;  1NXY A;  3S7N A;  4WL9 A;  4BMW A;  2HP6 A;  3FZC A;  2KDK A;  4MBF A;  2XD5 A;  1DRM A;  3D72 A;  1YSQ A;  4NXE A;  2Y8H A;  2OSU A;  1IEL A;  1GA9 A;  1UWN X;  5FDH A;  5FI7 A;  2OV5 A;  1VET A;  4QPR A;  2B5R A;  4RX3 A;  5TR7 A;  5CRF A;  4B4Z A;  1J9M A;  1QME A;  4FD8 A;  4HEF A;  1K56 A;  5J8X A;  2PYP A;  1PWC A;  4IUH A;  3A0V A;  4F3L A;  4UQI S;  2Z6C A;  1VHM A;  2W3F A;  5HZH A;  4H6J A;  3H9W A;  4DKI A;  4K0W A;  3UNW A;  3PAE A;  3B47 A;  4WN5 A;  4KZA A;  4IJG A;  4KZ3 A;  4OLD A;  4ID4 A;  2HDR A;  3I7J A;  4DXB A;  3BQ8 A;  4ME4 A;  1IOU A;  1H8Z A;  2C5W B;  1M6K A;  2PR5 A;  2EWW A;  5HD3 A;  1Y54 A;  4R38 A;  3C7U A;  5DKK A;  2B18 A;  4CLC A;  2VEA A;  3A3F A;  1S1Y A;  1F5M A;  1KVL A;  1FSY A;  4WYY A;  2B95 A;  4GW9 A;  2GJ3 A;  5HWV A;  4HP4 A;  2V0W A;  2V9A A;  3HLC A;  3LR3 A;  1PWD A;  1GHM A;  2PYR A;  2RCX A;  3S22 A;  1ES3 A;  5EUA A;  1PZO A;  2XGN A;  4ZRR A;  3VMA A;  2PRF A;  1YQS A;  3BQA A;  1LL8 A;  2QJ5 A;  3PYP A;  2ZMA A;  4NET A;  3E2L A;  3NDE A;  1IEM A;  3KYQ A;  4HBT A;  3PAG A;  5FQM A;  3LO7 A;  5TBM B;  2XK1 A;  4C6Y A;  4G3K A;  4AFI A;  1ES5 A;  4I39 A;  5FEG A;  4CLC E;  2WKR A;  1ES4 A;  1S66 L;  3LUQ A;  5KIZ A;  5FAO A;  2Z6D A;  3GV9 A;  5AQ7 A;  2ZC7 A;  2O0Y A;  1H5X A;  2ZOI A;  1NRJ A;  2V20 A;  2EX9 A;  2V0U A;  3G31 A;  2Q0O A;  3QP4 A;  4BWI A;  1DP8 A;  3VP4 A;  3UDI A;  3C38 A;  4EER A;  3ULF A;  3C4O A;  4NXG A;  4HES A;  4WBG A;  5FAQ A;  2ZLY A;  5EV0 A;  4QWO A;  4GN2 A;  1NZO A;  1K6R A;  2ZL1 B;  3IXD A;  1MKM A;  3CAX A;  4NXF A;  5FI6 A;  3TSG A;  4LV2 A;  3ZG0 A;  4WM9 A;  5CHJ A;  4FCF A;  2G2W A;  1T1C A;  4JKT A;  5DTT A;  4WLA A;  1OT9 A;  1ZHH B;  3R4K A;  4JLF A;  1FOF A;  5J7E A;  4KEN B;  5L09 A;  2K2N A;  3PBN A;  2OLV A;  4X1L A;  5GLA A;  4GJ4 A;  1KE3 A;  4Y7P A;  1BYW A;  2X02 A;  3L9K A;  5FAP A;  2WKE A;  1U60 A;  5E2E A;  5CGS A;  3EGX C;  1XJ6 A;  3GRJ A;  4Q0I A;  3PHY A;  5TBM A;  4HNB A;  1JWZ A;  5J4E A;  4DF6 A;  3VE4 A;  3ZG9 B;  3JVU A;  3MQO A;  2IA2 A;  4X55 A;  4MBH A;  3HLG A;  3OC2 A;  4WUJ A;  3HBR A;  1YKD A;  3IH8 A;  4JF6 A;  1EWZ A;  3MBZ A;  3GMW A;  3GVB A;  4OP5 A;  1O7E A;  3HJK A;  4XT2 B;  4LPZ A;  3LIC A;  1OTD A;  3BLM A;  3MSH A;  5DJT A;  2O9B A;  3MKE A;  3MFX A;  3FPW A;  3G32 A;  4LCM A;  2ZL1 A;  4XUZ A;  2KLI A;  3FKW A;  3K3C A;  4P0M A;  3MQQ A;  1W8Q A;  4WEL A;  2JHE A;  4KZ8 A;  3BM6 A;  1S4S A;  3DWZ A;  1F98 A;  4KQO A;  1NJ4 A;  2X01 A;  4X6T A;  1HVB A;  4PKY A;  1FR6 A;  3ZNY A;  4RQ9 A;  1K0K A;  1F9I A;  3UO9 A;  1LL9 A;  1WYC A;  3DWK A;  2QPN A;  3FG8 A;  5KSC A;  3SW1 A;  5D3O A;  3B42 A;  3HVF A;  3RXX A;  3BEC A;  4NKP A;  1TF1 A;  4MN6 A;  5EPH A;  4GS9 B;  2NUT C;  3FYZ A;  2PD8 A;  3MR0 A;  1YAX A;  3S7Q A;  1K54 A;  5F1F A;  1E3U D;  3D9Y A;  1YLY A;  4LRZ E;  1NLY A;  1N9B A;  3Q7Z A;  2JC7 A;  3SS3 A;  3NC8 A;  3MXQ A;  3NCK A;  1L2S A;  5IT5 A;  3T4S A;  4E3J A;  3T4L A;  2QKP A;  5A8B A;  3BLS A;  1HZO A;  3CHW P;  1VQQ A;  4XT2 A;  5HPI A;  2J9P A;  4KUK A;  1YLW A;  4R23 A;  4D60 A;  5EVI C;  2HGV A;  3SS5 A;  3IF6 C;  3UN7 A;  4K0X A;  1S1Z A;  2LB9 A;  2Y2M A;  3V3R A;  4BL3 A;  3IH9 A;  4E3M A;  4X53 A;  4P85 A;  5FI2 A;  1YMS A;  2J8Y A;  4E3I A;  2R78 A;  1P97 A;  5LBR A;  2JKR I;  2XF3 A;  1MWU A;  4HJ6 A;  3SH8 A;  3C4P A;  5EVI A;  4DE3 A;  1LSW A;  4BBT A;  3IF6 A;  4R3J A;  5DF7 A;  3VFH A;  3KYE A;  4UA9 A;  4O01 A;  5FQ9 A;  3JVV A;  5GL9 A;  3W4O A;  2ZQC A;  2Y4A A;  3VV4 A;  5TFQ A;  2Y2J A;  2J3T D;  4KZ6 A;  4PM6 A;  5G4Z A;  2ZMF A;  1KGG A;  1FIL A;  4I38 A;  3SZT A;  4GLQ A;  5HAP A;  1CJF A;  5GHX A;  4I3J A;  4X69 A;  5FDS A;  1NYY A;  3HUN A;  4PKY G;  5CED A;  3C2W A;  2WKH A;  4QHC A;  4N9L A;  3T1S A;  3KSI A;  3NI9 A;  2JKR M;  1K57 C;  5EEC A;  4BD0 A;  4KZ4 A;  2Y2P A;  2MJ6 A;  2GZA A;  2M7U A;  4OPR A;  4MNR A;  3TG9 A;  3NHQ A;  2WKQ A;  1LSV A;  4LEN A;  1GSW A;  2E8J A;  3T4T A;  2V8F A;  4A5R A;  3ZVW A;  4DMZ A;  4P6Z M;  3N6I A;  1PIO A;  2JKF A;  4EXO A;  4B4X A;  2V1Z A;  2P9V B;  5EM0 A;  5U47 A;  3ITA A;  1V9Z A;  3O3V A;  4XXR A;  1KGF A;  2FFY A;  3IS2 A;  5AJG A;  2P74 A;  1NZU A;  3FPV A;  1PI4 A;  4Y0T A;  4KZB A;  4DDS A;  1BLS A;  4P87 A;  5J3W A;  4S2I A;  3Q1F A;  2VGJ A;  4M3K A;  1TS6 A;  2GX5 A;  5HPF A;  5G4Y A;  3BJN A;  3FKV A;  5DTS A;  1X0O A;  3WS1 A;  3IX4 A;  4X1M A;  1YPR A;  5GLB A;  3OPP A;  3NDG A;  4KQQ A;  1BTL A;  3LI9 A;  4JXG A;  4MDZ A;  2QWS A;  1ERQ A;  2CC1 A;  2IWC A;  2EXA A;  4Q0H A;  3O88 A;  4OKP A;  3UPO A;  4QU3 A;  5GLC A;  3QP2 A;  2JKT M;  1ESU A;  3M6B A;  3N8S A;  1I2W A;  2VLG A;  3LY3 A;  1SKO B;  4O7D A;  3BY8 A;  5AVF A;  5F1G A;  3WS5 A;  3F1P A;  4KZ7 A;  3VP2 A;  4ETX A;  2FFF B;  3CPT B;  4GNU A;  1XGI A;  1OME A;  3ZYT A;  3G6O A;  4E3N A;  1T1B A;  4IVI A;  1LT0 A;  1Z09 A;  1YM1 A;  1MPL A;  1YLT A;  5HX9 A;  1IYS A;  3H82 A;  2WYX A;  1XGJ A;  2P9V A;  2G7U A;  1MC0 A;  2HJE A;  4DJ3 A;  1K56 D;  1MKI A;  2Y79 A;  5DKL A;  5CGW A;  3T1Q B;  4PAU A;  4GHI A;  4YWZ A;  5L10 A;  1TDL A;  2W0N A;  4EEU A;  5HWW A;  2PR6 A;  1OPX A;  3NEC A;  4Y0U A;  5AQB A;  4HH3 A;  4S2K A;  3N8R A;  5AVE A;  1Q2P A;  4DJ2 A;  3GDI A;  2KX6 A;  3MFD A;  1LLB A;  2VZW A;  1BLP A;  1GHI A;  5MC7 A;  1N9L A;  5DFY A;  2RL3 A;  4FH2 A;  2D01 A;  3QNC A;  2V1A A;  1SHV A;  5F83 A;  1FSW A;  1IYP A;  4ARZ B;  2HPB A;  4NG2 A;  1UGU A;  3SOI A;  1ONG A;  1HD8 A;  4CLC D;  4MCW A;  2VGL M;  2WKP A;  2Y2L A;  1CQA A;  2W3H A;  3TOI A;  4HH2 A;  1ERM A;  2WK0 A;  2EWV A;  3VP0 A;  2ZD8 A;  4UAA A;  2YKH A;  2OWJ A;  1YSP A;  2HV1 A;  3A0S A;  2WAD A;  3S7P A;  1JTD A;  4HY8 A;  4BD1 A;  4P6B A;  1N9N A;  2ZBB A;  2BTF P;  4GKU A;  1XFQ A;  2BLS A;  2Y91 A;  3HLE A;  4P6Z S;  2YKF A;  2X71 A;  3NBL A;  3M6H A;  3EOI A;  2WUQ A;  2Y2O A;  4MN5 A;  2P04 A;  4XUX A;  1RGY A;  3VOY A;  2I72 A;  3HUM A;  3G4P A;  3V50 A;  2W3D A;  3EWK A;  4RA7 A;  1D7E A;  2DNS A;  3NIA A;  2Q9N A;  3PBO A;  3NUL A;  2BG1 A;  2EX8 A;  4JGO A;  2XFS A;  3PBQ A;  1SDE A;  5CGX A;  4EBL A;  3F1O B;  3FC7 A;  4Q8I A;  1DY6 A;  4ARZ A;  3UE1 A;  1ALQ A;  1KOU A;  3VSK A;  2PBD P;  3W4Q A;  2L4R A;  3A3D A;  3FV7 A;  2V8C A;  1P0Z A;  4HJ3 A;  3BYD A;  5A92 A;  1A0K A;  4LV0 A;  3LR4 A;  2LB5 A;  1ZC2 A;  1ZKJ A;  2UV0 E;  1D06 A;  3G30 A;  3WS2 A;  3MJQ A;  1K6S A;  2Y2K A;  4F94 A;  5FQK A;  2PU2 A;  1VEU B;  2WAE A;  3KSG A;  2PBY A;  3KSH A;  3W4P A;  1BUL A;  5EVL A;  3HRE A;  3B33 A;  1Z6F A;  3OLO A;  2QZ6 A;  4U3T A;  3MQ0 A;  4JF4 A;  4B9O A;  1OTA A;  3IHB A;  1KGE A;  3MMH A;  3F1N B;  2Z2L B;  3EEH A;  2L1M A;  3LID A;  4PM8 A;  3TE8 A;  5TGF A;  5E43 A;  3MZD A;  4DE0 A;  1ZG6 A;  2QMI A;  4UEY A;  3UB6 A;  3LY4 A;  3UME A;  5C5K A;  4OH0 A;  5E2G A;  1SDN A;  2HJ9 C;  1ES2 A;  2G2U A;  3C8C A;  4WEJ A;  3WRT A;  3IX3 A;  5DTK A;  2ZQ9 A;  3BFG A;  3MXS A;  4EUV A;  5FQJ A;  2HDS A;  3HLW A;  2VX8 A;  3L7H A;  2ZJ9 A;  1ONH A;  2KOI A;  4DN0 A;  3T50 A;  1BSG A;  2QYB A;  2Y55 A;  4Y13 A;  1CI8 A;  2ZC6 B;  5FA7 A;  1GA0 A;  1HTZ A;  4IUK A;  3UY6 A;  4Z1W A;  1FQG A;  2PAV P;  3ZDJ A;  2VGL S;  2FZ0 A;  1TD5 A;  4HQA A;  1HLU P;  2XSS A;  2Y59 A;  4R3B A;  3BEB A;  3MZF A;  3CG5 A;  2JN7 A;  3SS4 A;  1YLJ A;  1OJ5 A;  5I5L A;  4RVA A;  3Q07 A;  1TS7 A;  1UWP X;  2GDN A;  5HDS A;  4JBF A;  2ZQ7 A;  3T4Q A;  1MWS A;  5DF8 A;  3PBR A;  2FH5 A;  5HSQ A;  3CUE C;  4HHD A;  3UE3 A;  1JNU A;  3HLB A;  3ZNT A;  1TVF A;  3IWI A;  3F1N A;  1AXB A;  2XA7 M;  5HWT A;  4BBU A;  4EEP A;  4UA7 A;  4I3I A;  3KYZ A;  3ZHH A;  4M4X A;  3RH8 B;  4QY6 A;  4E04 A;  3HCY A;  3LFV A;  1TDG A;  1RCJ A;  3W2Z A;  1XJ3 A;  2WGI A;  3TRC A;  5CEB A;  3K3D A;  4GDN A;  2DCF A;  4L9G A;  3BRM A;  3GSG A;  2QJ7 A;  1SCW A;  5AQA A;  2HDU A;  4LFU A;  2WZX A;  3CUE A;  4N92 A;  1O07 A;  3ZGA B;  4YNR A;  1L0F A;  1C3B A;  4EV4 A;  3S7O A;  2W3G A;  4JPM A;  1F2K A;  4N1H A;  4Y17 A;  1P9W A;  2H28 A;  5CX7 A;  3ZCZ A;  4IED A;  3ZQ5 A;  3G34 A;  3K2N A;  1CK3 A;  3A3I A;  4DDY A;  4YIN A;  3T12 B;  1BT5 A;  3HJI A;  3WS4 A;  4KQD A;  1N9O A;  3IBJ A;  5GHZ A;  5CHU A;  3N7W A;  3E2K A;  3S1Y A;  3EGD C;  3OCN A;  4HOI A;  4YOF A;  2PD7 A;  1TS0 A;  5FQQ A;  3CLO A;  3Q7V B;  3G2Y A;  1KE0 A;  4GD8 A;  5EVI D;  2J3T C;  3JPU A;  2Y2G A;  4I5S A;  5A93 A;  2INW A;  3Q81 A;  4GS9 A;  3PXP A;  5GHY A;  2PT7 A;  3MS6 A;  2AVX A;  3KX0 X;  1AWI A;  5L8M A;  4IBX A;  3S4X A;  2UWX A;  3R7W B;  2ZC4 B;  2VV8 A;  3A0R A;  1PRQ A;  3UMD A;  1LL5 A;  4FUW A;  2E8I A;  2B02 A;  1S4R A;  4EQ1 A;  3CI6 A;  3G35 A;  3HUO A;  4RYE A;  2ZM8 A;  3N8L A;  5M18 A;  2O9A A;  3IT9 A;  2JCH A;  3D3O A;  1RP5 A;  1XA7 A;  4ZBE A;  4NEE D;  3QP6 A;  3P01 A;  3ZG7 B;  3RFB A;  4OQG A;  2J80 A;  1GHP A;  5HDD A;  2A49 A;  1WA9 A;  4JF5 A;  4R4R A;  2J3W A;  1OTB A;  4KG5 A;  4MMN A;  3OOV A;  1QMF A;  5CTN A;  2EX2 A;  1K57 A;  2JKT I;  4U0T A;  3O87 A;  3M2J A;  4OON A;  4EWF A;  1J3W A;  3C7V A;  3NOT C;  4N9K A;  1GCE A;  3BFF A;  3QNB A;  3ICY A;  4L9F A;  3EEA A;  1SKF A;  3BW6 A;  4ZJ1 A;  1XKZ A;  3Q7V A;  3AGF A;  2M1C A;  3T4O A;  3C30 A;  5BOH A;  1JWV A;  2J9O A;  4E6X A;  4HJ4 A;  4CJN A;  3LCE A;  4F3L B;  1P9R A;  5EVE A;  1G6O A;  4PM9 A;  3JYI A;  4EUZ A;  4WEK A;  3IBR A;  5KSH A;  3IXG A;  2HP9 A;  5HDC A;  2W27 A;  2O99 A;  3HLF A;  3T4J A;  1YLP A;  2R9X A;  2EA9 A;  3BWL A;  1GSX A;  1LI9 A;  4X56 A;  3R7W A;  4GCZ A;  4QB8 A;  3SH9 A;  1IKG A;  2XA7 S;  4GOG A;  4EQI A;  1G6A A;  2ZMV A;  4G3W A;  2WZZ A;  4WMC A;  1VM1 A;  1L0D A;  2HP5 A;  1PW8 A;  4CQH A;  2W3E A;  4ZAM A;  3DTM A;  4HP9 A;  4OPY A;  3O5Y A;  2V1B A;  1OTE A;  3DTI A;  1W63 M;  4CLC B;  2P7J A;  4R70 A;  4ESP A;  4PM7 A;  4K91 A;  1DP6 A;  2PDR A;  4KG2 A;  4QD4 A;  5HAQ A;  2NUP C;  1CEF A;  2H10 A;  2C6W B;  1G28 A;  1JTG A;  1DJB A;  4DE1 A;  3KSF A;  3QHY A;  2BAS A;  4H8R A;  5F69 A;  3VSL A;  5F6A A;  4MN7 A;  4OOM A;  5DVA A;  5L07 A;  3EQU A;  4GD6 A;  1BLH A;  1VB6 A;  3OPL A;  3SH7 A;  1I5Q A;  2ZOH A;  3IXB A;  4BJP A;  2ZQA A;  1OTI A;  3QP8 A;  2A2L A;  3PTE A;  5HAI A;  3OBF A;  1T18 A;  4C3Q A;  2W1T B;  4B93 A;  4MBK A;  3DTE A;  1W8Y A;  2R9W A;  4OQ0 A;  3MXR A;  4LGW A;  4CLC C;  3CZD A;  3MKF A;  4G3V A;  4UA6 A;  1TEM A;  3AGD A;  1PZP A;  1DJC A;  4EET B;  3HL9 A;  4NXB A;  3UDX A;  1DJA A;  3ZFZ A;  3LIE A;  2A24 B;  1OJG A;  1MWR A;  1SKO A;  4IHQ A;  4OP8 A;  4R0Q A;  1H0M A;  3UB9 A;  3A3J A;  4QJG A;  3CPT A;  5CXW A;  3T1R A;  1KE4 A;  1DP9 A;  4GB7 A;  3VP3 A;  3GR2 A;  3A3E A;  1H8Y A;  4C75 A;  5GLD A;  4KG6 A;  1YMX A;  4N1X A;  3ITB A;  5CER A;  1IYO A;  2VA0 A;  4PHT A;  3RTY A;  3IX8 A;  2HDQ A;  1D1J A;  5FAS A;  3UB5 P;  3CJM A;  2VJW A;  4BLM A;  4Y3I A;  2ACG A;  2VV6 A;  5HAR A;  3GTC A;  3LI8 A;  3LIB A;  2W1R A;  2EXB A;  3LYX A;  5IHV A;  3W8K A;  4II7 A;  2PU4 A;  5HW3 A;  1PYY A;  4FSF A;  3E0Y A;  3RXW A;  5JYP A;  3NY4 A;  2XD1 A;  3DTK A;  5F68 A;  2W1T A;  4BL2 A;  3KO6 A;  2OAQ 1;  2XH9 A;  2IWB A;  4KZ5 A;  4DXC A;  1XX2 A;  1FCM A;  2OWH A;  3TW8 A;  1XJ2 A;  1K55 C;  5A90 A;  2HF6 A;  4ZJ3 A;  4MEZ A;  4LV3 A;  1EI5 A;  1WE4 A;  5HL1 A;  1E4D A;  2A24 A;  3UE0 A;  3B3X A;  4FH4 A;  1H3Q A;  1W5D A;  2ZM2 A;  1EW0 A;  3V3S A;  4R4S A;  3IWO A;  4OVD A;  4GZB A;  4X68 A;  3P09 A;  3UPN A;  3DBA A;  2M7V A;  4U0X A;  3E4Q A;  1WYB A;  1K55 A;  1YLZ A;  4IVK A;  4I3A A;  1ACF A;  5DFX A;  4L0L A;  4Y2F A;  3LR0 A; 
#chains in the Genus database with same CATH homology
 1S67 L;  3CUE A;  3BQ8 A;  3IS2 A;  4ME4 A;  5AJG A;  2O9C A;  1IOU A;  4YNR A;  3FPV A;  2PR5 A;  2EWW A;  5F5Y A;  5HD3 A;  4JGP A;  3S7O A;  4LRX C;  4R38 A;  5J3W A;  1TS8 A;  2W3G A;  3V67 A;  5DKK A;  3T4K A;  2B18 A;  4CLC A;  2VEA A;  5EFW A;  1S1Y A;  1F5M A;  1P9W A;  2H28 A;  1TS6 A;  5CX7 A;  2GX5 A;  3H7W B;  3OCL A;  5HPF A;  5G4Y A;  3BJN A;  2D02 A;  3MF0 A;  3ZQ5 A;  3K2N A;  5IS1 A;  4GW9 A;  2OOL A;  2GJ3 A;  2I9V A;  5HWV A;  1X0O A;  3HJI A;  4HP4 A;  2V0W A;  2V9A A;  4KQD A;  3LR3 A;  1N9O A;  3IBJ A;  3LI9 A;  4MDZ A;  2PYR A;  4O8G A;  2QWS A;  4HI4 A;  3EGD C;  3EQV A;  4Q0H A;  3OCN A;  4HOI A;  4ZRR A;  2XRN A;  3PBT A;  3F1O A;  2K7S A;  4YOF A;  2PD7 A;  1TS0 A;  4EES A;  2JKT M;  3CLO A;  4K08 A;  3BQA A;  1LL8 A;  2QJ5 A;  2J3T C;  3PYP A;  2VKS A;  2VLG A;  3KYQ A;  2GNX A;  1H8M A;  3BY8 A;  5AVF A;  4I5S A;  3CIT A;  3F1P A;  5TBM B;  2INW A;  4BBV A;  4G3K A;  4AFI A;  4HIA A;  4I39 A;  4ETX A;  1T19 A;  3UB7 A;  3UB8 A;  4GS9 A;  4CLC E;  2WKR A;  3PXP A;  1NLZ A;  2PT7 A;  4Y5F A;  1NWZ A;  1S66 L;  4L9E A;  1GSV A;  3LUQ A;  3KX0 X;  3G6O A;  3ZYT A;  5L8M A;  5KIZ A;  1T1B A;  2Z6D A;  1LT0 A;  4WF0 A;  4OOL A;  2O0Y A;  4Q0J A;  3R7W B;  2ZOI A;  1NRJ A;  2VV8 A;  3A0R A;  3UMD A;  2V0U A;  3H82 A;  4BWI A;  1DP8 A;  2B02 A;  1S4R A;  4EQ1 A;  2G7U A;  3C38 A;  3CI6 A;  1MC0 A;  2HJE A;  4EER A;  3ULF A;  4NXG A;  4DJ3 A;  2Y79 A;  5DKL A;  3UE6 A;  1Y28 A;  4PAU A;  2O9A A;  4GHI A;  4LRY C;  4YWZ A;  3D3O A;  2W0N A;  4EEU A;  4NEE D;  3P01 A;  5HWW A;  2PR6 A;  3RFB A;  2J80 A;  5HDD A;  1OPX A;  1WA9 A;  1MKM A;  3CAX A;  4HH3 A;  4NXF A;  5HL6 A;  5AVE A;  4DJ2 A;  2J3W A;  1OTB A;  3H7W A;  3GDI A;  2KX6 A;  4MMN A;  2VZW A;  3OOV A;  1T1C A;  5MC7 A;  2JKT I;  4WLA A;  1N9L A;  5DFY A;  1OT9 A;  1ZHH B;  2DMW A;  3R4K A;  3NOT C;  5J7E A;  2D01 A;  3ICY A;  5TJJ A;  2V1A A;  4EW7 A;  4L9F A;  3PR6 A;  2K2N A;  3PBN A;  4ARZ B;  2CMN A;  3EEA A;  1UGU A;  3BW6 A;  2M1C A;  3T4O A;  3C30 A;  4GJ4 A;  4CLC D;  4MCW A;  1LSX A;  2VGL M;  1BYW A;  2WKP A;  4HJ4 A;  2W3H A;  4F3L B;  1P9R A;  4HH2 A;  3EGX C;  1G6O A;  2VV7 A;  4WEK A;  1XJ6 A;  3IBR A;  4Q0I A;  5KSH A;  3PHY A;  5TBM A;  4HNB A;  5J4E A;  2EWV A;  5HDC A;  2W27 A;  2O99 A;  3U2A A;  3T4J A;  2XRO A;  2EA9 A;  3BWL A;  3VE4 A;  1GSX A;  2YKH A;  3JVU A;  3MQO A;  2IA2 A;  2OWJ A;  3R7W A;  3NOU C;  1YSP A;  2HV1 A;  3A0S A;  4UQI M;  4GCZ A;  3S7P A;  2P08 A;  4HY8 A;  2XA7 S;  1N9N A;  3OC2 A;  4WUJ A;  2ZBB A;  1XFN A;  1YKD A;  2ZMV A;  4G3W A;  1XFQ A;  4EU0 A;  4P6Z S;  2YKF A;  3IS2 B;  4CQH A;  2W3E A;  4JGR A;  2PHY A;  3HJK A;  1W63 Q;  4HP9 A;  4XT2 B;  3EOI A;  2QHK A;  3LIC A;  3O5Y A;  2V1B A;  4LPZ A;  1OTE A;  1OTD A;  5DJT A;  2O9B A;  4MN5 A;  2P04 A;  1W63 M;  3MFX A;  3FPW A;  4CLC B;  2P7J A;  4R70 A;  4ETZ A;  4R6L A;  2KLI A;  2W3D A;  3EWK A;  3K3C A;  1DP6 A;  3E98 A;  1D7E A;  4R3A A;  3MQQ A;  2PDR A;  4WEL A;  2JHE A;  3TJZ C;  4FOF A;  2NUP C;  1S4S A;  3PBO A;  3LIA A;  1G28 A;  1F98 A;  4KQO A;  3CWF A;  3KSF A;  3LIF A;  1ODV A;  4JGO A;  3PBQ A;  5DJU A;  2BAS A;  5F69 A;  1XJ4 A;  4PKY A;  5F6A A;  3F1O B;  3FC7 A;  4RQ9 A;  1F9I A;  1MZU A;  4MN7 A;  4ARZ A;  4OOM A;  5HD5 A;  1KOU A;  3FG8 A;  4LLO B;  4O0P A;  3SW1 A;  3EQU A;  2L4R A;  1V9Y A;  1VB6 A;  3B42 A;  2ZOH A;  4BJP A;  1STZ A;  1TF1 A;  1P0Z A;  4MN6 A;  1OTI A;  3BY9 A;  2K31 A;  4NKP A;  2L0W A;  2A2L A;  3F1P B;  3OBF A;  4HJ3 A;  1T18 A;  4GS9 B;  2NUT C;  4KUO A;  3LR4 A;  2W1T B;  4B93 A;  2LB5 A;  2PD8 A;  3MR0 A;  1D06 A;  1YAX A;  3S7Q A;  4JGQ A;  3MJQ A;  3E4P A;  4CLC C;  4LRZ E;  4G3V A;  1NLY A;  5DF9 A;  3KSG A;  3NJA A;  3H82 B;  4EET B;  4NXB A;  3KSH A;  3MXQ A;  5IT5 A;  3B33 A;  3OLO A;  3LIE A;  3MQ0 A;  3T4S A;  4B9O A;  1OTA A;  2A24 B;  1OJG A;  5FL3 A;  3T4L A;  2QKP A;  4IHQ A;  5A8B A;  4GHI B;  3MMH A;  3F1N B;  5IU1 A;  3UB9 A;  4XT2 A;  4H6J B;  5HPI A;  3EEH A;  2L1M A;  3LID A;  3NOP C;  1IFQ A;  3P7N A;  4KUK A;  3TE8 A;  1DP9 A;  2HGV A;  3VE3 A;  1S1Z A;  2LB9 A;  4UEY A;  3UB6 A;  3UME A;  3LR5 A;  5C5K A;  2VA0 A;  4PHT A;  3RTY A;  3PBS A;  2HJ9 C;  3VOL A;  3C8C A;  4WEJ A;  1ZTU A;  2R78 A;  1P97 A;  5LBR A;  2JKR I;  2VJW A;  1OT6 A;  4HJ6 A;  1T1A A;  2VV6 A;  4Y3I A;  4EUV A;  5K5B A;  3LI8 A;  3LIB A;  3E4O A;  2W1R A;  1LSW A;  3LYX A;  3GEC A;  4BBT A;  2OAP 1;  2VX8 A;  3S7N A;  4II7 A;  4WL9 A;  2KOI A;  4BMW A;  4O01 A;  3T50 A;  4DN0 A;  2QYB A;  3JVV A;  2KDK A;  4FSF A;  3E0Y A;  1DRM A;  4IUK A;  3VV4 A;  3D72 A;  1YSQ A;  4NXE A;  4Z1W A;  2J3T D;  2Y8H A;  5F68 A;  2W1T A;  5G4Z A;  3KO6 A;  2ZMF A;  2OAQ 1;  1UWN X;  4I38 A;  2VGL S;  2FZ0 A;  4GLQ A;  1TD5 A;  4HQA A;  4QPR A;  2OWH A;  4I3J A;  3TW8 A;  1XJ2 A;  2XSS A;  2JN7 A;  2HF6 A;  1OJ5 A;  5I5L A;  4PKY G;  3C2W A;  1TS7 A;  1UWP X;  5HDS A;  3T4Q A;  3KSI A;  2JKR M;  2PYP A;  3PBR A;  2FH5 A;  2A24 A;  4IUH A;  5HSQ A;  3A0V A;  3CUE C;  2MJ6 A;  4HHD A;  3UE3 A;  2GZA A;  1JNU A;  4UQI S;  1H3Q A;  4F3L A;  2Z6C A;  2M7U A;  1VHM A;  1EW0 A;  3F1N A;  2W3F A;  2XA7 M;  5HWT A;  5HZH A;  4BBU A;  4EEP A;  4H6J A;  4I3I A;  3KYZ A;  3H9W A;  3NHQ A;  2WKQ A;  1LSV A;  1GSW A;  4M4X A;  3RH8 B;  3DBA A;  4E04 A;  2M7V A;  3T4T A;  3E4Q A;  3HCY A;  4DMZ A;  4P6Z M;  3LFV A;  3W2Z A;  1XJ3 A;  3TRC A;  3B47 A;  3K3D A;  4WN5 A;  4EXO A;  4L9G A;  4I3A A;  4IJG A;  5DFX A;  2QJ7 A;  4L0L A;  4Y2F A;  3LR0 A;  1V9Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...