1TS6A

Structure of the pb2 intermediate from time-resolved laue crystallography
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Visualizing reaction pathways in photoactive yellow protein from nanoseconds to seconds.
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Photoreceptor
molecule keywords Photoactive yellow protein
total genus 37
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2004-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1ts6A00
2OWHA 4LPZA 4I3JA 3OLOA 4KUKA 3UB8A 1N9LA 3NHQA 4HI4A 2PR6A 5DKKA 4EERA 4HP4A 4EEUA 3CAXA 2L4RA 1S4SA 2PYRA 4KUOA 3MQOA 3FC7A 2A24A 3F1OA 3LIFA 1G28A 3P7NA 1OTDA 3CWFA 1S1YA 3H9WA 3PYPA 1LSVA 4HY8A 1TS0A 4XT2B 5I5LA 5IS1A 3G6OA 2WKRA 1T19A 3A0RA 2B02A 2VV6A 3C2WA 1V9ZA 2QHKA 3MJQA 4NXBA 2CMNA 2VLGA 3F1NB 4PKYA 4L9FA 1XJ6A 4H6JA 4JGQA 3LUQA 4NXFA 2A24B 2R78A 1OTAA 2PR5A 3C8CA 2INWA 4R3AA 5G4YA 3H82A 4LRZE 1ODVA 2JN7A 4I38A 2WKQA 4BBUA 5DJTA 5F69A 5TBMA 3B33A 1XFNA 5IU1A 3RTYA 3A0VA 3F1NA 3SW1A 3EEHA 2J80A 1XJ4A 5A8BA 5HZHA 4H6JB 1Y28A 3LIAA 4HJ4A 2ZOIA 2PD7A 3UE6A 4HOIA 1LSWA 2KDKA 1OTEA 3E4OA 4EW7A 1LL8A 1T1CA 2V1BA 3E4QA 2P7JA 3K3CA 3LI8A 5F68A 5AVEA 3MXQA 2W27A 5G4ZA 3F1OB 4DJ2A 5HWTA 4L9GA 3IS2B 2L0WA 4RQ9A 4JGRA 4XT2A 1T18A 1D7EA 5DJUA 2V0UA 2VEAA 1XJ2A 4HP9A 3NOPC 1T1BA 2D01A 3ICYA 4LRYC 4BBVA 4DJ3A 4HH2A 2YKHA 1LT0A 4YWZA 2ZBBA 3NOTC 2JHEA 2GJ3A 3GDIA 1VB6A 4GS9B 4F3LA 3IS2A 3MQQA 4MN5A 4EXOA 4MN6A 1S67L 3H82B 1EW0A 3BY8A 2M1CA 1UGUA 4KQDA 4WLAA 5F6AA 4JGOA 5DKLA 1TS6A 1T1AA 1F9IA 2V9AA 2L1MA 5J3WA 5TBMB 3UMDA 4I3IA 2V1AA 5HD5A 5HWVA 1P0ZA 3UB6A 1OT9A 4NXEA 4F3LB 4GS9A 2PD8A 1OJGA 1LSXA 1F98A 1OTIA 2WKPA 3LICA 2PDRA 4HIAA 4R70A 3LI9A 3T50A 5HDCA 5KIZA 4LLOB 3LIBA 2EA9A 2QWSA 3NOUC 2D02A 3KX0X 4HH3A 4R38A 3UMEA 1GSWA 2HV1A 4R6LA 1V9YA 3MFXA 4M4XA 3UB9A 4EQ1A 5J7EA 1KOUA 4K08A 2K7SA 3BWLA 4JGPA 4GW9A 4HNBA 2H28A 2QJ5A 4NXGA 5J4EA 1MZUA 1GSXA 1JNUA 1OT6A 3F1PA 1P97A 1DRMA 4GCZA 4GHIB 4L9EA 5HSQA 1S4RA 3EWKA 3LYXA 3H7WA 3ZQ5A 3VE3A 1X0OA 3VE4A 1TS7A 3ULFA 5HWWA 1OJ5A 2Z6CA 2ZOHA 3PHYA 5AVFA 2KX6A 5EFWA 1OTBA 4I39A 2OWJA 3VOLA 3LIDA 3K3DA 2QJ7A 3F1PB 3RH8B 4GHIA 1D06A 4LRXC 1S66L 4PKYG 3E4PA 3HJKA 1UWPX 5HD3A 1XJ3A 4HJ3A 1BYWA 4HHDA 2OOLA 2Z6DA 3H7WB 4B9OA 3BY9A 3IBRA 2VV8A 4WF0A 4EETB 3LIEA 1UWNX 1DP9A 2I9VA 3D72A 4WL9A 1DP8A 5F5YA 1S1ZA 5HDDA 4BBTA 1N9OA 1WA9A 3CLOA 4HJ6A 4WUJA 5HDSA 2V0WA 3UB7A 2W0NA 4I3AA 3A0SA 2PHYA 4EESA 3NJAA 1DP6A 3MR0A 3HJIA 3GECA 4EEPA 1GSVA 2PYPA 4E04A 4HQAA 1N9NA 2VV7A 3FG8A 1TS8A 4WN5A 4I5SA 2BASA 1NWZA 2YKFA 2QKPA 1XFQA
chains in the Genus database with same CATH superfamily
3HLBA 3LCEA 3BEBA 3T4KA 2WGVA 4E6WA 4DDSA 4ZRRA 3TG9A 1LSVA 5I5LA 2BG1A 5FDSA 4Y17A 1EI5A 3IBJA 4WZ5A 4CLCA 1LI9A 3O88A 3NCKA 3T1RA 4C3QA 2JN7A 4QPRA 5F69A 3OPLA 3PXPA 4R4SA 1JWZA 2GDNA 3M2KA 4C6YA 3Q1FA 4KZAA 1Y28A 3BFCA 2Y2KA 4E3MA 2ZLYA 4EW7A 4L9GA 1ERQA 1JVJA 5FATA 3ICYA 1KDSA 3ZVWA 1AXBA 1IYOA 5GLBA 2ZMVA 3ZNTA 2EWWA 4F3LA 2EXAA 3H82B 2XGNA 1T1AA 1MPLA 4N9LA 3TW8A 4HIAA 4FD8A 4Y0TA 3LI9A 3EQUA 4UA6A 4GOGA 3S7QA 1K6SA 4E6XA 1OPXA 1KOUA 3ZQ5A 2PRFA 1Q2PA 4DN0A 3OZHA 5EOOA 3DWKA 3HJKA 1FCNA 1STZA 3IXGA 4RVAA 2Z6DA 3BY9A 5L07A 1O07A 2PHYA 4HBTA 1DP6A 2UWXA 1NJ4A 2VZWA 5CHMA 1NWZA 1G5UA 2O9AA 1ZKJA 2K31A 2E8JA 2A24A 4XT2B 3A0RA 4X69A 1BLPA 2VLGA 4S2JA 3S7OA 5FAOA 2R78A 4U3TA 3B33A 5F1GA 1SDNA 3BFEA 1YLZA 4P85A 2ZM8A 1NRJA 2PBDP 4OOYA 3G2ZA 5EE8A 3EGDC 1VETB 1DJCA 3EQVA 2L0WA 3N8SA 1D7EA 1ALQA 4WMCA 2V0UA 4UEYA 3WS5A 3ZGAB 4B4XA 4N92A 4JF4A 4LV2A 3NC8A 1UGUA 4MBFA 1K55A 4EU0A 5HW3A 3EGXC 1P0ZA 3NECA 4R23A 3HLCA 1WYBA 5EVEA 1ZHHB 4GD6A 4R6LA 5J7EA 4GW9A 4OP8A 2H28A 4OOLA 2JKTM 1N4OA 3HVFA 3EWKA 3VE3A 4ZDXA 2XQZA 3A3JA 1VM1A 1S66L 4ARZB 1YLWA 2OOLA 4WEKA 1E4DA 3M2JA 2XD5A 3IH8A 4QY6A 3QHYA 4ARZA 1L0GA 5DTTA 3G30A 5F82A 2O99A 1G28A 3CWFA 3H9WA 4HY8A 2HGVA 2ZC7A 3QP2A 5LBRA 3AGDA 4LCMA 4BWIA 2XH9A 4ZJ1A 2INWA 5FDHA 5FQKA 5G4YA 3KYQA 2WKQA 1SHVA 3KSHA 3S4XA 1SCWA 4HBUA 2PD7A 4S2IA 4YFMA 1LSWA 4U0XA 1JTGA 3MXQA 5A90A 2XR0A 1SZVA 2OLVA 3IWQA 4HESA 3VP3A 1JTDA 2VJWA 3I7JA 5FI2A 5M1AA 4ETZA 4GS9A 4JXVA 5KIZA 4LLOB 1FOFA 4OLGA 3UB9A 1BLSA 5J4EA 3MFDA 1DRMA 2P9VB 3ITBA 4DMZA 3PHYA 4Q0IA 2Q9NA 2RL3A 2HJEA 3K3DA 4GHIA 1PWCA 4FOFA 4HHDA 1W79A 5DFYA 3OOVA 4KQRA 5F5YA 5GHXA 5IT5A 1IKIA 3CLOA 2WAEA 5HDSA 3SH9A 1TF1A 5CEDA 4X55A 2XROA 4HQAA 2FFYA 4L0LA 3NHQA 4EEUA 3BLSA 1I2WA 4Y5FA 1K54A 3N4IA 5EECA 4UAAA 3VSKA 1K25A 4DF6A 3ZDJA 1DJBA 2K2NA 2HP6A 1ZG6A 3IHBA 4NXFA 1OTAA 1IOUA 1HVBA 1W7FA 4MNRA 1YMXA 2PBYA 3RXXA 4PM9A 4MBKA 1TDLA 4FH4A 4IHQA 1NZUA 5JYOA 4OKPA 1WYCA 1LHYA 3E0YA 2J3TC 1LT0A 3T1XA 3IS2A 3SH8A 3QP4A 4OOMA 4EBLA 2WADA 3VP1A 3S7PA 4KZ4A 5HDCA 5G18A 3UMEA 5AQAA 3UDFA 3IX8A 1KVMA 3HUMA 4GD8A 5FAPA 3LYXA 4KZ9A 2ZOHA 1RCJA 4MDZA 2W3DA 1C3BA 4UA9A 3OPHA 4IBRA 5CERA 4C75A 1CQAA 4DDYA 4NETA 1L0DA 3IBRA 4BL2A 3UN7A 2XK1A 2DMWA 4KG6A 4EESA 2Y2QA 1W8YA 5EVID 4PM5A 3DW0A 3IWIA 4E04A 1L0FA 1J9MA 4OP5A 4K0XA 2JKTI 2QKPA 2EX6A 1K56D 3PBOA 4Y15A 4ZAMA 1YLPA 3ZG7B 4BL3A 2WGIA 3IHAA 4X1LA 3F1NB 2I72A 1SKFA 4E3JA 3IXHA 4X56A 3DTIA 3H82A 5CGWA 5FQJA 1LLBA 3OBFA 3A3EA 3C4OA 1JWVA 4IVIA 3P98A 4QJGA 4GDBA 4IUHA 1YPRA 4DJ3A 3GTCA 3NDEA 1YKDA 2ZQDA 4O01A 3PR6A 1NLYA 4QWOA 1G6AA 3SS4A 5HD5A 3P09A 1H3QA 4O8GA 3A3FA 1SKOA 3C5AA 5DVAA 4NXGA 3F1PA 4WZ5C 2QPNA 4CLCC 5AQBA 3H7WA 3IX3A 1K38A 1OJ5A 5AVFA 3BW6A 1DY6A 1VHMA 3E2LA 2QJ7A 1KE0A 3F1PB 4DRTA 4BQMA 4D60A 3RJUA 1DP9A 3D72A 2G2UA 3CI6A 1S1ZA 1N9BA 1F5MA 1NYYA 1WA9A 4WUJA 2IA2A 3A0SA 3T4LA 4EQIA 2J3TD 2P9VA 3MZDA 3HUNA 5EV0A 4LFUA 4LPZA 4KUKA 2IWDA 3AGFA 2PYRA 3WS1A 2XD1A 3B42A 1T19A 4KQOA 1GA0A 1E25A 1YSPA 3M6BA 4S2MA 5CX7A 1XP4A 1RP5A 4M3KA 2FFFB 1OTEA 3NBLA 3E4QA 1VQQA 1G68A 2ZM0A 2W3FA 5F1FA 4JXGA 5BOHA 1PI4A 3NOTC 2EWVA 1XA1A 2R9WA 3MQQA 1EWZA 4G3KA 5DF7A 3CUEC 4KQDA 1BSGA 2Y2NA 1PZPA 2OLUA 2ZC6B 2LB5A 5GLDA 2Y2MA 3HUOA 1NLZA 3MZFA 4MMNA 2EA9A 4MLLA 1CK3A 2HV1A 1PYYA 2NUTC 4JGPA 2QJ5A 2Y2IA 2J7VA 4WZ4A 5E2FA 1W63M 3VE4A 3VP2A 1K4EA 1MY8A 5FI6A 1TD5A 4KZ6A 1UWPX 5HD3A 1XJ3A 3EEAA 2B18A 5KSHA 1CF0A 2Y4AA 3GECA 2PYPA 4R3BA 2HDSA 5TFQA 2G2WA 3VV4A 3IF6A 4UA7A 3T4QA 3DAVA 4MBHA 2EFXA 3C38A 2A3UA 3FC7A 3MBZA 1MWRA 3GSGA 3O86A 1L0EA 3VOZA 4YNRA 3LO7A 4PKYA 2XF3A 3LFVA 4N1XA 3BFGA 3GR2A 4OPQA 2QMIA 1NXYA 2BLSA 4I38A 4P6ZS 3MXSA 3N8RA 4DE2A 3IX4A 3EEHA 4KENB 5A8BA 1YM1A 2W1RA 2JBFA 4JGRA 3V3RA 2VGKA 1L2SA 2WUQA 4P0MA 4HH2A 4JKTA 4GNUA 1K0KA 3TSGA 3JPUA 4E3LA 5KSCA 4OQHA 2V1AA 1RGZA 3O5YA 2PD8A 4Z1WA 4ZJ3A 3W2ZA 1FILA 3L7HA 1IYQA 3IXBA 4HH3A 3KX0X 4PM6A 4IVKA 2C5WB 2WK0A 3CITA 5JYPA 3GRJA 1S4RA 4BMWA 4OLDA 3Q82A 2LB9A 2DCFA 4PKYG 3WS0A 4Q8IA 4EV4A 1K57A 3G34A 1VEUA 2XSSA 5DTKA 5KZHA 4O0PA 5HDDA 1IYSA 3ZFZA 3HJIA 4RX3A 3D3OA 2FH5A 3ZG8B 1IEMA 2WKEA 4Y13A 5TJJA 2CC1A 4KUOA 2Y91A 3LR0A 1MKIA 4EBPA 3MJQA 3LR3A 4LGWA 4CLCE 4S2NC 1L3LA 3T4OA 2J3WA 3HBRA 5GHZA 5EVIB 4KG2A 1K55C 3JVVA 5EPHA 1K56A 1GHIA 3A0VA 5HL1A 1NRFA 2ZL1A 2Y2JA 3IWOA 5HZHA 5HAPA 2ZOIA 2Z2MB 5E2GA 3TOIA 4P87A 4II7A 2ZQ7A 4QD4A 3F1OB 3VMAA 3RFBA 1CEFA 5HAIA 2HP9A 1HZOA 3Q7ZA 4MN6A 3V3SA 4DE3A 3S1YA 5F6AA 3T1SA 2XFTA 5EUAA 4A5RA 3VFHA 4FSFA 2PT7A 4OQ0A 4HNBA 3KYEA 1CI8A 5HWWA 2PAVP 4I39A 2X71A 2VX8A 3L9KA 3R4KA 4N9KA 1S0WA 4LRXC 1Z6FA 3GMWA 1XX2A 3TRCA 4MN7A 4KG5A 2J8YA 1PIOA 2PU2A 4ESPA 1ESIA 3TE8A 3HLFA 2G7UA 1TS8A 4B4ZA 3E98A 4PM8A 2ZC5B 5GHYA 1ONGA 1YSQA 3G6OA 3NY4A 2VV6A 2ZQ9A 3C2WA 4KZ3A 4X53A 4YOFA 2XDMA 5CRFA 3UDXA 1G6OA 4WELA 5L09A 4QY5A 1VETA 4LRZE 3IF6C 4IBXA 5DF8A 3SW1A 4DE0A 1ZTUA 3HLDA 4H6JB 4HOIA 2KDKA 1LL8A 1SKOB 3ISGA 5HWTA 5GLCA 1IYPA 4RQ9A 4GKUA 3GDIA 3ZHHA 4KZBA 1EW0A 2M1CA 1I2SA 2QZ6A 1ZG4A 2Y8HA 3VP0A 3ZCZA 1OJGA 1LSXA 1A0KA 1H8MA 2PDRA 1MC0A 4WEJA 4ID4A 1V9YA 4JF6A 4KZ8A 1OT6A 3SS3A 4UHUA 2WAFA 1W5DA 2HZ5A 2A49A 4R1GA 5EFWA 2OWJA 3HREA 1SDEA 3C7VA 3A3DA 5FQQA 4O7DA 3MZEA 1GHPA 2GZAA 2I9VA 3DTKA 1Z09A 1YAXA 5DFXA 2HJ9C 3QNCA 1XGJA 2M7VA 3HLWA 3IXDA 5CTNA 2EX2A 5K5BA 1W63Q 2X02A 3MQ0A 3FKWA 2YKFA 3SOIA 2AVXA 1N9LA 1PNEA 1S4SA 2Y2GA 5EM1A 3WWXA 5HAQA 4FCFA 3QNBA 2ZM2A 2XA7S 3LUQA 4R3AA 3NI9A 1ODVA 4K91A 5TBMA 5FQIA 4JXWA 5IU1A 3CZDA 2ZMAA 1XJ4A 4CLCB 3R7WA 2P7JA 5G4ZA 1H0MA 3CPTB 3IS2B 3Q81A 5A92A 5CHJA 2H5SA 4XUXA 3NOPC 1TDGA 3PBTA 1ONHA 4GS9B 3CUEA 4MN5A 1ERMA 2HDQA 2B95A 3G31A 5EM0A 2ZQ8A 2L1MA 3QP8A 4N1HA 5J3WA 4NKPA 4K0WA 3EOIA 3LIBA 4ME4A 2D02A 4K08A 2K7SA 2UV0E 2MJ6A 4GHIB 5HL6A 5F83A 4OH0A 1YLTA 4DE1A 3D9YA 3IF6B 2XLNA 3DTEA 2DNSA 3MF0A 1P9RA 3W8KA 3PAGA 1YLYA 4KZ5A 4S2OA 3WRZA 1XKZA 2RCXA 3QP1A 4Z9QA 3ZYTA 4RX2A 4WM9A 1CJFA 2BTFP 1PRQA 1GSVA 3V50A 3MS6A 4CLCD 1ACFA 3NDGA 4RA7A 1XFQA 3W4OA 2ZC3B 3OLOA 3N8LA 3UB8A 3GVBA 2OV5A 1I5QA 4F94A 2L4RA 2VGLS 3DTMA 3P7NA 1PI5A 5DTSA 3T4SA 2V8FA 4JGQA 1NZOA 2A24B 5CEBA 2PR5A 3C8CA 5HFOA 4Q0HA 3CHWP 3LI8A 2NUPC 3K3CA 4S2LA 5L8MA 2VEAA 4LRYC 5TGFA 3U4LP 1CI9A 3WS4A 3BQAA 3LEZA 2M7UA 5DKLA 1F9IA 3UMDA 4I3IA 3OC2A 4NXEA 3LEQA 4F3LB 4DKIA 2ACGA 4JLFA 3SH7A 1CEGA 1VEUB 4MEZA 2XFSA 5FL3A 4R38A 3Q07A 4M4XA 4GJ4A 3ZG0A 3PTEA 5CECA 2ZC4B 5A93A 2A2LA 4GCZA 5HSQA 3ZVTA 5CHUA 1BLHA 3OCLA 2OAP1 1OTBA 3N6IA 3DWZA 4EUVA 2J9OA 4RYEA 4NG2A 1QMFA 3T4TA 4H8RA 1BULA 3UDIA 1BZAA 1K57C 4GZBA 2VGLM 1DP8A 4OQIA 4BBTA 2V0WA 4X6TA 4Q0JA 4R0QA 4X68A 2VV7A 4I5SA 4FUWA 1FIKA 5FSRA 4DXCA 1BT5A 2OWHA 2H0TA 4HP4A 3NULA 3MQOA 3F1OA 5CGSA 3UE1A 5L10A 5D3OA 1Y4OA 5TR7A 3IH9A 1XJ6A 1PW1A 2O9CA 3VSLA 4WYYA 3ZG9B 5C5KA 2WZZA 5FEFA 4EBNA 2WYXA 4BBUA 2Y2HA 4BJPA 3IT9A 4XXRA 3FV7A 1ES3A 1XJ2A 2D01A 3SZTA 5MC7A 1WE4A 2ZBBA 3UO9A 2Y59A 5TBMB 4Y0OA 2V9AA 2WZXA 3LGOA 5M18A 3N7WA 1XPBA 1EROA 2P08A 3LICA 2ZMFA 4R70A 1FSWA 3P01A 4AFIA 2QWSA 4EQ1A 3MFXA 5FASA 2VK3A 3BWLA 3C4PA 4B93A 5CTMA 4E3OA 1MZUA 3G4PA 3UPOA 2Y2PA 3LY4A 1H8ZA 3VP4A 1TS7A 3V5MA 3QP5A 3LIDA 3FKVA 3RH8B 2WKIA 5CXWA 2Z2LB 3BFDA 1N9OA 3UB7A 2C6WB 2W0NA 2H10A 1GHMA 4EEPA 1U60A 3BECA 4S2NA 5HPIA 2BASA 4PHTA 3AGEA 4I3JA 1AWIA 2EFUA 4EERA 2IWCA 3Q7VB 1FR1A 2O0YA 3LIFA 1OMEA 2E8IA 5IS1A 1KE4A 2WKRA 1FCOA 2QHKA 4MCWA 2CMNA 4KZ7A 3K2NA 3MMHA 3ZG5A 1XXMA 1K6RA 3KSFA 4EWFA 2QYBA 4LV3A 3DBAA 1FCMA 3E4OA 1RGYA 5AVEA 3LY3A 5CGXA 3KSGA 3LR5A 3FZCA 1T18A 1LI0A 1FR6A 1PZOA 1FSYA 2YKHA 4E3IA 4YWZA 2GJ3A 4FH2A 3CMZA 4EXOA 4Y3IA 4WLAA 1YT4A 1TS6A 5HWVA 3G32A 4OPRA 4ETXA 2V20A 4PMAA 3OPPA 1OT9A 1MKMA 3C7UA 4GDNA 3T50A 3UE0A 3ITAA 1F2KA 2GX5A 5FEGA 3UPNA 4JBFA 1NY0A 4E3NA 1KGFA 4LCLA 3E2KA 3MXRA 4CJNA 3TJZC 5GLAA 4Y7PA 1BYWA 4HEFA 3LIEA 1UWNX 4IEDA 1XGIA 4PPRA 3S7NA 2Q0OA 4I3AA 3FYZA 3NJAA 5E2HA 4Y2FA 3BQ8A 1K4FA 4LV1A 2XA7M 5M19A 3FG8A 4WN5A 3T12B 2HF6A 3BLMA 3BRMA 3R7WB 3CPTA 1OTDA 1S1YA 4U0TA 2VKSA 2Y2LA 1V9ZA 4ZTKA 4WBGA 5FA7A 2XRNA 4QU3A 2ZL1B 3O87A 1YLJA 4XUZA 1LL9A 4E3KA 2HP5A 2XEPA 1IELA 1NYMA 5AQ9A 3LR4A 1KDWA 2FZ0A 5AJGA 4HJ4A 3LIAA 3UE6A 1J3WA 4DXBA 1TEMA 1ES2A 4S2KA 1IFQA 5HARA 1MXOA 4Y0UA 2JKRM 4XT2A 4NK3A 2W1TB 1GCEA 1S6RA 2O9BA 2W3EA 5E2EA 1S67L 1E3UD 1KE3A 4B88A 4JGOA 3JVUA 1HD8A 2H0YA 3IF5A 3FPWA 1ES4A 3PBSA 2IWBA 3MKEA 3OPRA 5U47A 3NOUC 2ZQAA 4GLQA 1HLUP 3PAEA 2EXBA 5A91A 3FPVA 2V2FF 4WMCD 1P97A 5HX9A 3VFFA 3HL9A 3OCNA 2JKGA 3ULFA 1KVLA 2R9XA 4CQHA 1FQGA 3MSHA 4GN2A 2P04A 5IHVA 1E3UA 1D06A 3E4PA 3H7WB 4EETB 1YQSA 3QP6A 1O7EA 2JKFA 5HPFA 4BENA 4QHCA 1PFLA 2WKHA 3W4PA 2ZD8A 2P74A 4BBVA 5GL9A 3SS5A 1H5XA 5DKKA 3CAXA 3JYIA 4OVDA 1MWTA 1Q2QA 4S2PA 5EVIA 2B02A 3ZNYA 1W8QA 1ZC2A 5L2FA 4IUKA 4L9FA 3UB5P 1PW8A 4LV0A 2V8CA 4H6JA 4BD1A 1IKGA 3RXWA 5DJTA 3F1NA 2W1TA 1LL5A 2HDRA 2W27A 1D1JA 1KGGA 2Y55A 4QB8A 3UNWA 2Y79A 4HP9A 1T1BA 4BLMA 4NEED 2OAQ1 1BUEA 2OSUA 1P9WA 3PBRA 3BM6A 3U2AA 1HTZA 2HDUA 3T4JA 2JE5A 3KO6A 5FQMA 3V67A 3UY6A 3KSIA 3CJMA 3UB6A 1PWDA 4X1MA 4EUZA 1GSWA 1QMEA 4YINA 3FWLA 1JNUA 5E43A 5I94A 1JWPA 4OPYA 1X0OA 4ZBEA 2JCHA 2KX6A 4OPZA 1GA9A 2DRWA 1ES5A 3VOLA 5FQ9A 2GNXA 4G3VA 1MWSA 3B3XA 4B9OA 2JC7A 3M6HA 4D2OA 2VV8A 5J8XA 2HPBA 3S22A 4WL9A 5EOEA 1Y54A 2V1ZA 4P6BA 4GB7A 1DJAA 2W3HA 4HJ6A 5FI7A 3WRTA 3WS2A 3MKFA 1M6KA 3UPPA 1XA7A 2KOIA 4PM7A 3V39A 4UQIS 2Q9MA 4ZJ2A 1M40A 1YMSA 2PU4A 4HI4A 2PR6A 3PBNA 2ZJ9A 4R4RA 3VOYA 2JKRI 2EX9A 3PYPA 1TS0A 3NIAA 4NXBA 3BJNA 4G3WA 1ESUA 2EX8A 3HCYA 4UQIM 2KLIA 3PBQA 4JXSA 5FAQA 2J9PA 1XFNA 3RTYA 2J80A 2ZQCA 3HLEA 4LENA 4FTXA 1T1CA 2V1BA 2W3GA 5F68A 1BTLA 4DJ2A 3KYZA 5DJUA 5DF9A 3A3IA 1TVFA 4KQQA 2JHEA 1MBLA 4P6ZM 1VB6A 4JPMA 3G2YA 3O3VA 1PWGA 3IQAA 1H8YA 3UE3A 3BY8A 1MWUA 4OONA 2Y2OA 4R3JA 4X25A 4CPKA 1OTIA 1F98A 2WKPA 4IJGA 1K54C 5AQ7A 5EVLA 1BLCA 5EVIC 4JF5A 3G35A 2WGWA 3HLGA 1GSXA 2VA0A 3GQZA 4L9EA 3T1QB 2Z6CA 3W4QA 2VGJA 3B47A 3C30A 2WGWB 1KGEA 5KMWA 3Q7VA 4PAUA 4HJ3A 4WF0A 3CG5A 3GV9A 3BYDA 4OQGA 4BD0A 3MR0A 3BFFA 3D4FA 1N9NA 2X01A 2B5RA
chains in the Genus database with same CATH topology
3PBOA 4I3JA 4EERA 3T4KA 3E98A 2O0YA 3LIFA 4ZRRA 1LSVA 5I5LA 1YSQA 3G6OA 2WKRA 5IS1A 2VV6A 3C2WA 4YOFA 2QHKA 4MCWA 2CMNA 3K2NA 3F1NB 3MMHA 3IBJA 4CLCA 1G6OA 4WELA 3H82A 4LRZE 2JN7A 4QPRA 3KSFA 3PXPA 5F69A 3OBFA 3SW1A 2QYBA 1ZTUA 3DBAA 4H6JB 1Y28A 4HOIA 2KDKA 3E4OA 4EW7A 1LL8A 5AVEA 3KSGA 4L9GA 5HWTA 3LR5A 4RQ9A 4IUHA 1T18A 3ICYA 4DJ3A 2YKHA 2ZMVA 1YKDA 4YWZA 2GJ3A 2EWWA 3GDIA 4F3LA 4EXOA 4Y3IA 3H82B 1EW0A 4O01A 2M1CA 3PR6A 4WLAA 1NLYA 1TS6A 1T1AA 2Y8HA 5HWVA 5HD5A 4ETXA 1OT9A 3TW8A 1H3QA 1MKMA 1OJGA 1LSXA 4O8GA 4HIAA 2PDRA 1H8MA 3T50A 3LI9A 3EQUA 1MC0A 4WEJA 3S7QA 1V9YA 1OPXA 1KOUA 4NXGA 1OT6A 3F1PA 4CLCC 2GX5A 3ZQ5A 3H7WA 1OJ5A 5AVFA 5EFWA 4DN0A 2OWJA 3BW6A 1VHMA 2QJ7A 3F1PB 3HJKA 1STZA 3TJZC 1BYWA 2Z6DA 3BY9A 2GZAA 3LIEA 1UWNX 1DP9A 2I9VA 3D72A 3CI6A 1YAXA 5DFXA 3S7NA 1S1ZA 2HJ9C 1F5MA 1WA9A 2M7VA 4WUJA 2IA2A 4I3AA 3A0SA 2PHYA 3NJAA 1DP6A 3T4LA 4Y2FA 5K5BA 2J3TD 2VZWA 3BQ8A 1W63Q 2XA7M 3FG8A 4WN5A 3MQ0A 1NWZA 2YKFA 2HF6A 4LPZA 2O9AA 4KUKA 1N9LA 3R7WB 2K31A 2PYRA 1S4SA 2A24A 1OTDA 1S1YA 4XT2B 3B42A 1T19A 2VKSA 3A0RA 4KQOA 1V9ZA 2VLGA 2XRNA 2XA7S 3LUQA 3S7OA 2R78A 4R3AA 1YSPA 1ODVA 5CX7A 3LR4A 5TBMA 3B33A 5IU1A 2FZ0A 1XJ4A 4CLCB 5AJGA 4HJ4A 3LIAA 3UE6A 1NRJA 1OTEA 3R7WA 3E4QA 2P7JA 5G4ZA 3EGDC 1IFQA 3EQVA 3IS2B 2L0WA 2JKRM 4XT2A 1D7EA 2V0UA 2W1TB 4UEYA 3NOPC 2W3FA 2O9BA 3PBTA 2W3EA 3NOTC 2EWVA 4GS9B 3CUEA 4G3KA 3MQQA 4MN5A 1S67L 3CUEC 1UGUA 4KQDA 4JGOA 3JVUA 4EU0A 2L1MA 5J3WA 4NKPA 3FPWA 3EGXC 1P0ZA 2LB5A 3EOIA 3PBSA 1NLZA 3LIBA 4MMNA 2EA9A 3NOUC 2D02A 4ME4A 4GLQA 1ZHHB 2HV1A 4R6LA 5J7EA 4K08A 2NUTC 2K7SA 3FPVA 4JGPA 4GW9A 2H28A 2MJ6A 2QJ5A 4OOLA 4GHIB 2JKTM 5HL6A 1P97A 3EWKA 3OCNA 3VE3A 1W63M 3VE4A 3ULFA 4CQHA 3MF0A 1TD5A 1P9RA 2P04A 1D06A 1S66L 3E4PA 4ARZB 1UWPX 5HD3A 1XJ3A 2OOLA 3H7WB 4WEKA 4EETB 3EEAA 2B18A 5KSHA 3ZYTA 5HPFA 4ARZA 3GECA 1GSVA 2PYPA 4CLCD 3VV4A 3T4QA 4BBVA 1XFQA 3OLOA 3C38A 2O99A 3UB8A 5DKKA 3CAXA 2L4RA 3FC7A 2VGLS 1G28A 3P7NA 3CWFA 3H9WA 4HY8A 3T4SA 2HGVA 2B02A 5LBRA 4YNRA 4IUKA 4PKYA 4L9FA 3LFVA 4BWIA 4H6JA 4JGQA 2A24B 2PR5A 3C8CA 2INWA 5G4YA 3KYQA 4I38A 2WKQA 4P6ZS 5DJTA 4Q0HA 3F1NA 2W1TA 3EEHA 5A8BA 3KSHA 2PD7A 1LSWA 2W1RA 3LI8A 2NUPC 3K3CA 3MXQA 2W27A 4JGRA 5L8MA 2VEAA 2Y79A 4HP9A 1T1BA 4LRYC 4NEED 2OAQ1 4HH2A 1P9WA 3PBRA 3U2AA 3T4JA 3BQAA 3KO6A 3V67A 2VJWA 3KSIA 2M7UA 5DKLA 1F9IA 3UMDA 4I3IA 2V1AA 4ETZA 3O5YA 3OC2A 3UB6A 4NXEA 4F3LB 4GS9A 2PD8A 4Z1WA 3W2ZA 5KIZA 4LLOB 4HH3A 3KX0X 4R38A 5FL3A 1GSWA 3UB9A 4M4XA 4GJ4A 5J4EA 1JNUA 3CITA 1DRMA 2A2LA 4GCZA 5HSQA 1S4RA 4BMWA 1X0OA 4DMZA 3OCLA 3PHYA 2KX6A 2OAP1 1OTBA 4Q0IA 2HJEA 3VOLA 4EUVA 2GNXA 4G3VA 3K3DA 2LB9A 4GHIA 4PKYG 4FOFA 4B9OA 4HHDA 5DFYA 2VV8A 3T4TA 3OOVA 4WL9A 2VGLM 1DP8A 2XSSA 5F5YA 5IT5A 4O0PA 2W3HA 5HDDA 4BBTA 3CLOA 4HJ6A 5HDSA 2V0WA 1TF1A 4Q0JA 2XROA 3HJIA 2KOIA 3D3OA 4UQIS 4HQAA 2FH5A 2VV7A 4I5SA 5TJJA 2OWHA 4L0LA 4HI4A 3NHQA 2PR6A 4EEUA 3PBNA 4HP4A 4Y5FA 4KUOA 3MQOA 2JKRI 3F1OA 3PYPA 1TS0A 3LR0A 3MJQA 4NXBA 3BJNA 4G3WA 3LR3A 2K2NA 4CLCE 1XJ6A 2O9CA 4NXFA 5C5KA 3HCYA 1OTAA 2KLIA 3PBQA 4UQIM 3T4OA 1IOUA 2J3WA 4BBUA 4BJPA 3JVVA 1XFNA 3RTYA 3A0VA 2J80A 5HZHA 2ZOIA 1T1CA 2V1BA 2W3GA 4II7A 5F68A 3F1OB 4IHQA 3KYZA 4DJ2A 5DJUA 3RFBA 5DF9A 1XJ2A 3E0YA 2D01A 2J3TC 1LT0A 5MC7A 2ZBBA 2JHEA 4P6ZM 1VB6A 3IS2A 4OOMA 4MN6A 3UE3A 3BY8A 5F6AA 5TBMB 2V9AA 3S7PA 1OTIA 1F98A 2P08A 2WKPA 2ZMFA 3LICA 4IJGA 4R70A 5HDCA 3P01A 4AFIA 3UMEA 2QWSA 4FSFA 4EQ1A 2PT7A 3MFXA 3BWLA 4B93A 4HNBA 1MZUA 1GSXA 2VA0A 4L9EA 3LYXA 1TS7A 5HWWA 2Z6CA 2ZOHA 4I39A 4MDZA 2W3DA 3B47A 3C30A 3LIDA 2VX8A 3R4KA 3RH8B 4LRXC 4PAUA 4HJ3A 3TRCA 3IBRA 4MN7A 4WF0A 2DMWA 1N9OA 3UB7A 4EESA 2W0NA 3TE8A 3MR0A 4EEPA 2G7UA 4E04A 1N9NA 1TS8A 2JKTI 5HPIA 2BASA 4PHTA 2QKPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OWH A;  4LPZ A;  4I3J A;  3OLO A;  4KUK A;  3UB8 A;  1N9L A;  3NHQ A;  4HI4 A;  2PR6 A;  5DKK A;  4EER A;  4HP4 A;  4EEU A;  3CAX A;  2L4R A;  1S4S A;  2PYR A;  4KUO A;  3MQO A;  3FC7 A;  2A24 A;  3F1O A;  3LIF A;  1G28 A;  3P7N A;  1OTD A;  3CWF A;  1S1Y A;  3H9W A;  3PYP A;  1LSV A;  4HY8 A;  1TS0 A;  4XT2 B;  5I5L A;  5IS1 A;  3G6O A;  2WKR A;  1T19 A;  3A0R A;  2B02 A;  2VV6 A;  3C2W A;  1V9Z A;  2QHK A;  3MJQ A;  4NXB A;  2CMN A;  2VLG A;  3F1N B;  4PKY A;  4L9F A;  1XJ6 A;  4H6J A;  4JGQ A;  3LUQ A;  4NXF A;  2A24 B;  2R78 A;  1OTA A;  2PR5 A;  3C8C A;  2INW A;  4R3A A;  5G4Y A;  3H82 A;  4LRZ E;  1ODV A;  2JN7 A;  4I38 A;  2WKQ A;  4BBU A;  5DJT A;  5F69 A;  5TBM A;  3B33 A;  1XFN A;  5IU1 A;  3RTY A;  3A0V A;  3F1N A;  3SW1 A;  3EEH A;  2J80 A;  1XJ4 A;  5A8B A;  5HZH A;  4H6J B;  1Y28 A;  3LIA A;  4HJ4 A;  2ZOI A;  2PD7 A;  3UE6 A;  4HOI A;  1LSW A;  2KDK A;  1OTE A;  3E4O A;  4EW7 A;  1LL8 A;  1T1C A;  2V1B A;  3E4Q A;  2P7J A;  3K3C A;  3LI8 A;  5F68 A;  5AVE A;  3MXQ A;  2W27 A;  5G4Z A;  3F1O B;  4DJ2 A;  5HWT A;  4L9G A;  3IS2 B;  2L0W A;  4RQ9 A;  4JGR A;  4XT2 A;  1T18 A;  1D7E A;  5DJU A;  2V0U A;  2VEA A;  1XJ2 A;  4HP9 A;  3NOP C;  1T1B A;  2D01 A;  3ICY A;  4LRY C;  4BBV A;  4DJ3 A;  4HH2 A;  2YKH A;  1LT0 A;  4YWZ A;  2ZBB A;  3NOT C;  2JHE A;  2GJ3 A;  3GDI A;  1VB6 A;  4GS9 B;  4F3L A;  3IS2 A;  3MQQ A;  4MN5 A;  4EXO A;  4MN6 A;  1S67 L;  3H82 B;  1EW0 A;  3BY8 A;  2M1C A;  1UGU A;  4KQD A;  4WLA A;  5F6A A;  4JGO A;  5DKL A;  1TS6 A;  1T1A A;  1F9I A;  2V9A A;  2L1M A;  5J3W A;  5TBM B;  3UMD A;  4I3I A;  2V1A A;  5HD5 A;  5HWV A;  1P0Z A;  3UB6 A;  1OT9 A;  4NXE A;  4F3L B;  4GS9 A;  2PD8 A;  1OJG A;  1LSX A;  1F98 A;  1OTI A;  2WKP A;  3LIC A;  2PDR A;  4HIA A;  4R70 A;  3LI9 A;  3T50 A;  5HDC A;  5KIZ A;  4LLO B;  3LIB A;  2EA9 A;  2QWS A;  3NOU C;  2D02 A;  3KX0 X;  4HH3 A;  4R38 A;  3UME A;  1GSW A;  2HV1 A;  4R6L A;  1V9Y A;  3MFX A;  4M4X A;  3UB9 A;  4EQ1 A;  5J7E A;  1KOU A;  4K08 A;  2K7S A;  3BWL A;  4JGP A;  4GW9 A;  4HNB A;  2H28 A;  2QJ5 A;  4NXG A;  5J4E A;  1MZU A;  1GSX A;  1JNU A;  1OT6 A;  3F1P A;  1P97 A;  1DRM A;  4GCZ A;  4GHI B;  4L9E A;  5HSQ A;  1S4R A;  3EWK A;  3LYX A;  3H7W A;  3ZQ5 A;  3VE3 A;  1X0O A;  3VE4 A;  1TS7 A;  3ULF A;  5HWW A;  1OJ5 A;  2Z6C A;  2ZOH A;  3PHY A;  5AVF A;  2KX6 A;  5EFW A;  1OTB A;  4I39 A;  2OWJ A;  3VOL A;  3LID A;  3K3D A;  2QJ7 A;  3F1P B;  3RH8 B;  4GHI A;  1D06 A;  4LRX C;  1S66 L;  4PKY G;  3E4P A;  3HJK A;  1UWP X;  5HD3 A;  1XJ3 A;  4HJ3 A;  1BYW A;  4HHD A;  2OOL A;  2Z6D A;  3H7W B;  4B9O A;  3BY9 A;  3IBR A;  2VV8 A;  4WF0 A;  4EET B;  3LIE A;  1UWN X;  1DP9 A;  2I9V A;  3D72 A;  4WL9 A;  1DP8 A;  5F5Y A;  1S1Z A;  5HDD A;  4BBT A;  1N9O A;  1WA9 A;  3CLO A;  4HJ6 A;  4WUJ A;  5HDS A;  2V0W A;  3UB7 A;  2W0N A;  4I3A A;  3A0S A;  2PHY A;  4EES A;  3NJA A;  1DP6 A;  3MR0 A;  3HJI A;  3GEC A;  4EEP A;  1GSV A;  2PYP A;  4E04 A;  4HQA A;  1N9N A;  2VV7 A;  3FG8 A;  1TS8 A;  4WN5 A;  4I5S A;  2BAS A;  1NWZ A;  2YKF A;  2QKP A;  1XFQ A; 
#chains in the Genus database with same CATH topology
 3HLB A;  3LCE A;  3BEB A;  3T4K A;  2WGV A;  4E6W A;  4DDS A;  4ZRR A;  3TG9 A;  1LSV A;  5I5L A;  2BG1 A;  5FDS A;  4Y17 A;  1EI5 A;  3IBJ A;  4WZ5 A;  4CLC A;  1LI9 A;  3O88 A;  3NCK A;  3T1R A;  4C3Q A;  2JN7 A;  4QPR A;  5F69 A;  3OPL A;  3PXP A;  4R4S A;  1JWZ A;  2GDN A;  3M2K A;  4C6Y A;  3Q1F A;  4KZA A;  1Y28 A;  3BFC A;  2Y2K A;  4E3M A;  2ZLY A;  4EW7 A;  4L9G A;  1ERQ A;  1JVJ A;  5FAT A;  3ICY A;  1KDS A;  3ZVW A;  1AXB A;  1IYO A;  5GLB A;  2ZMV A;  3ZNT A;  2EWW A;  4F3L A;  2EXA A;  3H82 B;  2XGN A;  1T1A A;  1MPL A;  4N9L A;  3TW8 A;  4HIA A;  4FD8 A;  4Y0T A;  3LI9 A;  3EQU A;  4UA6 A;  4GOG A;  3S7Q A;  1K6S A;  4E6X A;  1OPX A;  1KOU A;  3ZQ5 A;  2PRF A;  1Q2P A;  4DN0 A;  3OZH A;  5EOO A;  3DWK A;  3HJK A;  1FCN A;  1STZ A;  3IXG A;  4RVA A;  2Z6D A;  3BY9 A;  5L07 A;  1O07 A;  2PHY A;  4HBT A;  1DP6 A;  2UWX A;  1NJ4 A;  2VZW A;  5CHM A;  1NWZ A;  1G5U A;  2O9A A;  1ZKJ A;  2K31 A;  2E8J A;  2A24 A;  4XT2 B;  3A0R A;  4X69 A;  1BLP A;  2VLG A;  4S2J A;  3S7O A;  5FAO A;  2R78 A;  4U3T A;  3B33 A;  5F1G A;  1SDN A;  3BFE A;  1YLZ A;  4P85 A;  2ZM8 A;  1NRJ A;  2PBD P;  4OOY A;  3G2Z A;  5EE8 A;  3EGD C;  1VET B;  1DJC A;  3EQV A;  2L0W A;  3N8S A;  1D7E A;  1ALQ A;  4WMC A;  2V0U A;  4UEY A;  3WS5 A;  3ZGA B;  4B4X A;  4N92 A;  4JF4 A;  4LV2 A;  3NC8 A;  1UGU A;  4MBF A;  1K55 A;  4EU0 A;  5HW3 A;  3EGX C;  1P0Z A;  3NEC A;  4R23 A;  3HLC A;  1WYB A;  5EVE A;  1ZHH B;  4GD6 A;  4R6L A;  5J7E A;  4GW9 A;  4OP8 A;  2H28 A;  4OOL A;  2JKT M;  1N4O A;  3HVF A;  3EWK A;  3VE3 A;  4ZDX A;  2XQZ A;  3A3J A;  1VM1 A;  1S66 L;  4ARZ B;  1YLW A;  2OOL A;  4WEK A;  1E4D A;  3M2J A;  2XD5 A;  3IH8 A;  4QY6 A;  3QHY A;  4ARZ A;  1L0G A;  5DTT A;  3G30 A;  5F82 A;  2O99 A;  1G28 A;  3CWF A;  3H9W A;  4HY8 A;  2HGV A;  2ZC7 A;  3QP2 A;  5LBR A;  3AGD A;  4LCM A;  4BWI A;  2XH9 A;  4ZJ1 A;  2INW A;  5FDH A;  5FQK A;  5G4Y A;  3KYQ A;  2WKQ A;  1SHV A;  3KSH A;  3S4X A;  1SCW A;  4HBU A;  2PD7 A;  4S2I A;  4YFM A;  1LSW A;  4U0X A;  1JTG A;  3MXQ A;  5A90 A;  2XR0 A;  1SZV A;  2OLV A;  3IWQ A;  4HES A;  3VP3 A;  1JTD A;  2VJW A;  3I7J A;  5FI2 A;  5M1A A;  4ETZ A;  4GS9 A;  4JXV A;  5KIZ A;  4LLO B;  1FOF A;  4OLG A;  3UB9 A;  1BLS A;  5J4E A;  3MFD A;  1DRM A;  2P9V B;  3ITB A;  4DMZ A;  3PHY A;  4Q0I A;  2Q9N A;  2RL3 A;  2HJE A;  3K3D A;  4GHI A;  1PWC A;  4FOF A;  4HHD A;  1W79 A;  5DFY A;  3OOV A;  4KQR A;  5F5Y A;  5GHX A;  5IT5 A;  1IKI A;  3CLO A;  2WAE A;  5HDS A;  3SH9 A;  1TF1 A;  5CED A;  4X55 A;  2XRO A;  4HQA A;  2FFY A;  4L0L A;  3NHQ A;  4EEU A;  3BLS A;  1I2W A;  4Y5F A;  1K54 A;  3N4I A;  5EEC A;  4UAA A;  3VSK A;  1K25 A;  4DF6 A;  3ZDJ A;  1DJB A;  2K2N A;  2HP6 A;  1ZG6 A;  3IHB A;  4NXF A;  1OTA A;  1IOU A;  1HVB A;  1W7F A;  4MNR A;  1YMX A;  2PBY A;  3RXX A;  4PM9 A;  4MBK A;  1TDL A;  4FH4 A;  4IHQ A;  1NZU A;  5JYO A;  4OKP A;  1WYC A;  1LHY A;  3E0Y A;  2J3T C;  1LT0 A;  3T1X A;  3IS2 A;  3SH8 A;  3QP4 A;  4OOM A;  4EBL A;  2WAD A;  3VP1 A;  3S7P A;  4KZ4 A;  5HDC A;  5G18 A;  3UME A;  5AQA A;  3UDF A;  3IX8 A;  1KVM A;  3HUM A;  4GD8 A;  5FAP A;  3LYX A;  4KZ9 A;  2ZOH A;  1RCJ A;  4MDZ A;  2W3D A;  1C3B A;  4UA9 A;  3OPH A;  4IBR A;  5CER A;  4C75 A;  1CQA A;  4DDY A;  4NET A;  1L0D A;  3IBR A;  4BL2 A;  3UN7 A;  2XK1 A;  2DMW A;  4KG6 A;  4EES A;  2Y2Q A;  1W8Y A;  5EVI D;  4PM5 A;  3DW0 A;  3IWI A;  4E04 A;  1L0F A;  1J9M A;  4OP5 A;  4K0X A;  2JKT I;  2QKP A;  2EX6 A;  1K56 D;  3PBO A;  4Y15 A;  4ZAM A;  1YLP A;  3ZG7 B;  4BL3 A;  2WGI A;  3IHA A;  4X1L A;  3F1N B;  2I72 A;  1SKF A;  4E3J A;  3IXH A;  4X56 A;  3DTI A;  3H82 A;  5CGW A;  5FQJ A;  1LLB A;  3OBF A;  3A3E A;  3C4O A;  1JWV A;  4IVI A;  3P98 A;  4QJG A;  4GDB A;  4IUH A;  1YPR A;  4DJ3 A;  3GTC A;  3NDE A;  1YKD A;  2ZQD A;  4O01 A;  3PR6 A;  1NLY A;  4QWO A;  1G6A A;  3SS4 A;  5HD5 A;  3P09 A;  1H3Q A;  4O8G A;  3A3F A;  1SKO A;  3C5A A;  5DVA A;  4NXG A;  3F1P A;  4WZ5 C;  2QPN A;  4CLC C;  5AQB A;  3H7W A;  3IX3 A;  1K38 A;  1OJ5 A;  5AVF A;  3BW6 A;  1DY6 A;  1VHM A;  3E2L A;  2QJ7 A;  1KE0 A;  3F1P B;  4DRT A;  4BQM A;  4D60 A;  3RJU A;  1DP9 A;  3D72 A;  2G2U A;  3CI6 A;  1S1Z A;  1N9B A;  1F5M A;  1NYY A;  1WA9 A;  4WUJ A;  2IA2 A;  3A0S A;  3T4L A;  4EQI A;  2J3T D;  2P9V A;  3MZD A;  3HUN A;  5EV0 A;  4LFU A;  4LPZ A;  4KUK A;  2IWD A;  3AGF A;  2PYR A;  3WS1 A;  2XD1 A;  3B42 A;  1T19 A;  4KQO A;  1GA0 A;  1E25 A;  1YSP A;  3M6B A;  4S2M A;  5CX7 A;  1XP4 A;  1RP5 A;  4M3K A;  2FFF B;  1OTE A;  3NBL A;  3E4Q A;  1VQQ A;  1G68 A;  2ZM0 A;  2W3F A;  5F1F A;  4JXG A;  5BOH A;  1PI4 A;  3NOT C;  2EWV A;  1XA1 A;  2R9W A;  3MQQ A;  1EWZ A;  4G3K A;  5DF7 A;  3CUE C;  4KQD A;  1BSG A;  2Y2N A;  1PZP A;  2OLU A;  2ZC6 B;  2LB5 A;  5GLD A;  2Y2M A;  3HUO A;  1NLZ A;  3MZF A;  4MMN A;  2EA9 A;  4MLL A;  1CK3 A;  2HV1 A;  1PYY A;  2NUT C;  4JGP A;  2QJ5 A;  2Y2I A;  2J7V A;  4WZ4 A;  5E2F A;  1W63 M;  3VE4 A;  3VP2 A;  1K4E A;  1MY8 A;  5FI6 A;  1TD5 A;  4KZ6 A;  1UWP X;  5HD3 A;  1XJ3 A;  3EEA A;  2B18 A;  5KSH A;  1CF0 A;  2Y4A A;  3GEC A;  2PYP A;  4R3B A;  2HDS A;  5TFQ A;  2G2W A;  3VV4 A;  3IF6 A;  4UA7 A;  3T4Q A;  3DAV A;  4MBH A;  2EFX A;  3C38 A;  2A3U A;  3FC7 A;  3MBZ A;  1MWR A;  3GSG A;  3O86 A;  1L0E A;  3VOZ A;  4YNR A;  3LO7 A;  4PKY A;  2XF3 A;  3LFV A;  4N1X A;  3BFG A;  3GR2 A;  4OPQ A;  2QMI A;  1NXY A;  2BLS A;  4I38 A;  4P6Z S;  3MXS A;  3N8R A;  4DE2 A;  3IX4 A;  3EEH A;  4KEN B;  5A8B A;  1YM1 A;  2W1R A;  2JBF A;  4JGR A;  3V3R A;  2VGK A;  1L2S A;  2WUQ A;  4P0M A;  4HH2 A;  4JKT A;  4GNU A;  1K0K A;  3TSG A;  3JPU A;  4E3L A;  5KSC A;  4OQH A;  2V1A A;  1RGZ A;  3O5Y A;  2PD8 A;  4Z1W A;  4ZJ3 A;  3W2Z A;  1FIL A;  3L7H A;  1IYQ A;  3IXB A;  4HH3 A;  3KX0 X;  4PM6 A;  4IVK A;  2C5W B;  2WK0 A;  3CIT A;  5JYP A;  3GRJ A;  1S4R A;  4BMW A;  4OLD A;  3Q82 A;  2LB9 A;  2DCF A;  4PKY G;  3WS0 A;  4Q8I A;  4EV4 A;  1K57 A;  3G34 A;  1VEU A;  2XSS A;  5DTK A;  5KZH A;  4O0P A;  5HDD A;  1IYS A;  3ZFZ A;  3HJI A;  4RX3 A;  3D3O A;  2FH5 A;  3ZG8 B;  1IEM A;  2WKE A;  4Y13 A;  5TJJ A;  2CC1 A;  4KUO A;  2Y91 A;  3LR0 A;  1MKI A;  4EBP A;  3MJQ A;  3LR3 A;  4LGW A;  4CLC E;  4S2N C;  1L3L A;  3T4O A;  2J3W A;  3HBR A;  5GHZ A;  5EVI B;  4KG2 A;  1K55 C;  3JVV A;  5EPH A;  1K56 A;  1GHI A;  3A0V A;  5HL1 A;  1NRF A;  2ZL1 A;  2Y2J A;  3IWO A;  5HZH A;  5HAP A;  2ZOI A;  2Z2M B;  5E2G A;  3TOI A;  4P87 A;  4II7 A;  2ZQ7 A;  4QD4 A;  3F1O B;  3VMA A;  3RFB A;  1CEF A;  5HAI A;  2HP9 A;  1HZO A;  3Q7Z A;  4MN6 A;  3V3S A;  4DE3 A;  3S1Y A;  5F6A A;  3T1S A;  2XFT A;  5EUA A;  4A5R A;  3VFH A;  4FSF A;  2PT7 A;  4OQ0 A;  4HNB A;  3KYE A;  1CI8 A;  5HWW A;  2PAV P;  4I39 A;  2X71 A;  2VX8 A;  3L9K A;  3R4K A;  4N9K A;  1S0W A;  4LRX C;  1Z6F A;  3GMW A;  1XX2 A;  3TRC A;  4MN7 A;  4KG5 A;  2J8Y A;  1PIO A;  2PU2 A;  4ESP A;  1ESI A;  3TE8 A;  3HLF A;  2G7U A;  1TS8 A;  4B4Z A;  3E98 A;  4PM8 A;  2ZC5 B;  5GHY A;  1ONG A;  1YSQ A;  3G6O A;  3NY4 A;  2VV6 A;  2ZQ9 A;  3C2W A;  4KZ3 A;  4X53 A;  4YOF A;  2XDM A;  5CRF A;  3UDX A;  1G6O A;  4WEL A;  5L09 A;  4QY5 A;  1VET A;  4LRZ E;  3IF6 C;  4IBX A;  5DF8 A;  3SW1 A;  4DE0 A;  1ZTU A;  3HLD A;  4H6J B;  4HOI A;  2KDK A;  1LL8 A;  1SKO B;  3ISG A;  5HWT A;  5GLC A;  1IYP A;  4RQ9 A;  4GKU A;  3GDI A;  3ZHH A;  4KZB A;  1EW0 A;  2M1C A;  1I2S A;  2QZ6 A;  1ZG4 A;  2Y8H A;  3VP0 A;  3ZCZ A;  1OJG A;  1LSX A;  1A0K A;  1H8M A;  2PDR A;  1MC0 A;  4WEJ A;  4ID4 A;  1V9Y A;  4JF6 A;  4KZ8 A;  1OT6 A;  3SS3 A;  4UHU A;  2WAF A;  1W5D A;  2HZ5 A;  2A49 A;  4R1G A;  5EFW A;  2OWJ A;  3HRE A;  1SDE A;  3C7V A;  3A3D A;  5FQQ A;  4O7D A;  3MZE A;  1GHP A;  2GZA A;  2I9V A;  3DTK A;  1Z09 A;  1YAX A;  5DFX A;  2HJ9 C;  3QNC A;  1XGJ A;  2M7V A;  3HLW A;  3IXD A;  5CTN A;  2EX2 A;  5K5B A;  1W63 Q;  2X02 A;  3MQ0 A;  3FKW A;  2YKF A;  3SOI A;  2AVX A;  1N9L A;  1PNE A;  1S4S A;  2Y2G A;  5EM1 A;  3WWX A;  5HAQ A;  4FCF A;  3QNB A;  2ZM2 A;  2XA7 S;  3LUQ A;  4R3A A;  3NI9 A;  1ODV A;  4K91 A;  5TBM A;  5FQI A;  4JXW A;  5IU1 A;  3CZD A;  2ZMA A;  1XJ4 A;  4CLC B;  3R7W A;  2P7J A;  5G4Z A;  1H0M A;  3CPT B;  3IS2 B;  3Q81 A;  5A92 A;  5CHJ A;  2H5S A;  4XUX A;  3NOP C;  1TDG A;  3PBT A;  1ONH A;  4GS9 B;  3CUE A;  4MN5 A;  1ERM A;  2HDQ A;  2B95 A;  3G31 A;  5EM0 A;  2ZQ8 A;  2L1M A;  3QP8 A;  4N1H A;  5J3W A;  4NKP A;  4K0W A;  3EOI A;  3LIB A;  4ME4 A;  2D02 A;  4K08 A;  2K7S A;  2UV0 E;  2MJ6 A;  4GHI B;  5HL6 A;  5F83 A;  4OH0 A;  1YLT A;  4DE1 A;  3D9Y A;  3IF6 B;  2XLN A;  3DTE A;  2DNS A;  3MF0 A;  1P9R A;  3W8K A;  3PAG A;  1YLY A;  4KZ5 A;  4S2O A;  3WRZ A;  1XKZ A;  2RCX A;  3QP1 A;  4Z9Q A;  3ZYT A;  4RX2 A;  4WM9 A;  1CJF A;  2BTF P;  1PRQ A;  1GSV A;  3V50 A;  3MS6 A;  4CLC D;  1ACF A;  3NDG A;  4RA7 A;  1XFQ A;  3W4O A;  2ZC3 B;  3OLO A;  3N8L A;  3UB8 A;  3GVB A;  2OV5 A;  1I5Q A;  4F94 A;  2L4R A;  2VGL S;  3DTM A;  3P7N A;  1PI5 A;  5DTS A;  3T4S A;  2V8F A;  4JGQ A;  1NZO A;  2A24 B;  5CEB A;  2PR5 A;  3C8C A;  5HFO A;  4Q0H A;  3CHW P;  3LI8 A;  2NUP C;  3K3C A;  4S2L A;  5L8M A;  2VEA A;  4LRY C;  5TGF A;  3U4L P;  1CI9 A;  3WS4 A;  3BQA A;  3LEZ A;  2M7U A;  5DKL A;  1F9I A;  3UMD A;  4I3I A;  3OC2 A;  4NXE A;  3LEQ A;  4F3L B;  4DKI A;  2ACG A;  4JLF A;  3SH7 A;  1CEG A;  1VEU B;  4MEZ A;  2XFS A;  5FL3 A;  4R38 A;  3Q07 A;  4M4X A;  4GJ4 A;  3ZG0 A;  3PTE A;  5CEC A;  2ZC4 B;  5A93 A;  2A2L A;  4GCZ A;  5HSQ A;  3ZVT A;  5CHU A;  1BLH A;  3OCL A;  2OAP 1;  1OTB A;  3N6I A;  3DWZ A;  4EUV A;  2J9O A;  4RYE A;  4NG2 A;  1QMF A;  3T4T A;  4H8R A;  1BUL A;  3UDI A;  1BZA A;  1K57 C;  4GZB A;  2VGL M;  1DP8 A;  4OQI A;  4BBT A;  2V0W A;  4X6T A;  4Q0J A;  4R0Q A;  4X68 A;  2VV7 A;  4I5S A;  4FUW A;  1FIK A;  5FSR A;  4DXC A;  1BT5 A;  2OWH A;  2H0T A;  4HP4 A;  3NUL A;  3MQO A;  3F1O A;  5CGS A;  3UE1 A;  5L10 A;  5D3O A;  1Y4O A;  5TR7 A;  3IH9 A;  1XJ6 A;  1PW1 A;  2O9C A;  3VSL A;  4WYY A;  3ZG9 B;  5C5K A;  2WZZ A;  5FEF A;  4EBN A;  2WYX A;  4BBU A;  2Y2H A;  4BJP A;  3IT9 A;  4XXR A;  3FV7 A;  1ES3 A;  1XJ2 A;  2D01 A;  3SZT A;  5MC7 A;  1WE4 A;  2ZBB A;  3UO9 A;  2Y59 A;  5TBM B;  4Y0O A;  2V9A A;  2WZX A;  3LGO A;  5M18 A;  3N7W A;  1XPB A;  1ERO A;  2P08 A;  3LIC A;  2ZMF A;  4R70 A;  1FSW A;  3P01 A;  4AFI A;  2QWS A;  4EQ1 A;  3MFX A;  5FAS A;  2VK3 A;  3BWL A;  3C4P A;  4B93 A;  5CTM A;  4E3O A;  1MZU A;  3G4P A;  3UPO A;  2Y2P A;  3LY4 A;  1H8Z A;  3VP4 A;  1TS7 A;  3V5M A;  3QP5 A;  3LID A;  3FKV A;  3RH8 B;  2WKI A;  5CXW A;  2Z2L B;  3BFD A;  1N9O A;  3UB7 A;  2C6W B;  2W0N A;  2H10 A;  1GHM A;  4EEP A;  1U60 A;  3BEC A;  4S2N A;  5HPI A;  2BAS A;  4PHT A;  3AGE A;  4I3J A;  1AWI A;  2EFU A;  4EER A;  2IWC A;  3Q7V B;  1FR1 A;  2O0Y A;  3LIF A;  1OME A;  2E8I A;  5IS1 A;  1KE4 A;  2WKR A;  1FCO A;  2QHK A;  4MCW A;  2CMN A;  4KZ7 A;  3K2N A;  3MMH A;  3ZG5 A;  1XXM A;  1K6R A;  3KSF A;  4EWF A;  2QYB A;  4LV3 A;  3DBA A;  1FCM A;  3E4O A;  1RGY A;  5AVE A;  3LY3 A;  5CGX A;  3KSG A;  3LR5 A;  3FZC A;  1T18 A;  1LI0 A;  1FR6 A;  1PZO A;  1FSY A;  2YKH A;  4E3I A;  4YWZ A;  2GJ3 A;  4FH2 A;  3CMZ A;  4EXO A;  4Y3I A;  4WLA A;  1YT4 A;  1TS6 A;  5HWV A;  3G32 A;  4OPR A;  4ETX A;  2V20 A;  4PMA A;  3OPP A;  1OT9 A;  1MKM A;  3C7U A;  4GDN A;  3T50 A;  3UE0 A;  3ITA A;  1F2K A;  2GX5 A;  5FEG A;  3UPN A;  4JBF A;  1NY0 A;  4E3N A;  1KGF A;  4LCL A;  3E2K A;  3MXR A;  4CJN A;  3TJZ C;  5GLA A;  4Y7P A;  1BYW A;  4HEF A;  3LIE A;  1UWN X;  4IED A;  1XGI A;  4PPR A;  3S7N A;  2Q0O A;  4I3A A;  3FYZ A;  3NJA A;  5E2H A;  4Y2F A;  3BQ8 A;  1K4F A;  4LV1 A;  2XA7 M;  5M19 A;  3FG8 A;  4WN5 A;  3T12 B;  2HF6 A;  3BLM A;  3BRM A;  3R7W B;  3CPT A;  1OTD A;  1S1Y A;  4U0T A;  2VKS A;  2Y2L A;  1V9Z A;  4ZTK A;  4WBG A;  5FA7 A;  2XRN A;  4QU3 A;  2ZL1 B;  3O87 A;  1YLJ A;  4XUZ A;  1LL9 A;  4E3K A;  2HP5 A;  2XEP A;  1IEL A;  1NYM A;  5AQ9 A;  3LR4 A;  1KDW A;  2FZ0 A;  5AJG A;  4HJ4 A;  3LIA A;  3UE6 A;  1J3W A;  4DXB A;  1TEM A;  1ES2 A;  4S2K A;  1IFQ A;  5HAR A;  1MXO A;  4Y0U A;  2JKR M;  4XT2 A;  4NK3 A;  2W1T B;  1GCE A;  1S6R A;  2O9B A;  2W3E A;  5E2E A;  1S67 L;  1E3U D;  1KE3 A;  4B88 A;  4JGO A;  3JVU A;  1HD8 A;  2H0Y A;  3IF5 A;  3FPW A;  1ES4 A;  3PBS A;  2IWB A;  3MKE A;  3OPR A;  5U47 A;  3NOU C;  2ZQA A;  4GLQ A;  1HLU P;  3PAE A;  2EXB A;  5A91 A;  3FPV A;  2V2F F;  4WMC D;  1P97 A;  5HX9 A;  3VFF A;  3HL9 A;  3OCN A;  2JKG A;  3ULF A;  1KVL A;  2R9X A;  4CQH A;  1FQG A;  3MSH A;  4GN2 A;  2P04 A;  5IHV A;  1E3U A;  1D06 A;  3E4P A;  3H7W B;  4EET B;  1YQS A;  3QP6 A;  1O7E A;  2JKF A;  5HPF A;  4BEN A;  4QHC A;  1PFL A;  2WKH A;  3W4P A;  2ZD8 A;  2P74 A;  4BBV A;  5GL9 A;  3SS5 A;  1H5X A;  5DKK A;  3CAX A;  3JYI A;  4OVD A;  1MWT A;  1Q2Q A;  4S2P A;  5EVI A;  2B02 A;  3ZNY A;  1W8Q A;  1ZC2 A;  5L2F A;  4IUK A;  4L9F A;  3UB5 P;  1PW8 A;  4LV0 A;  2V8C A;  4H6J A;  4BD1 A;  1IKG A;  3RXW A;  5DJT A;  3F1N A;  2W1T A;  1LL5 A;  2HDR A;  2W27 A;  1D1J A;  1KGG A;  2Y55 A;  4QB8 A;  3UNW A;  2Y79 A;  4HP9 A;  1T1B A;  4BLM A;  4NEE D;  2OAQ 1;  1BUE A;  2OSU A;  1P9W A;  3PBR A;  3BM6 A;  3U2A A;  1HTZ A;  2HDU A;  3T4J A;  2JE5 A;  3KO6 A;  5FQM A;  3V67 A;  3UY6 A;  3KSI A;  3CJM A;  3UB6 A;  1PWD A;  4X1M A;  4EUZ A;  1GSW A;  1QME A;  4YIN A;  3FWL A;  1JNU A;  5E43 A;  5I94 A;  1JWP A;  4OPY A;  1X0O A;  4ZBE A;  2JCH A;  2KX6 A;  4OPZ A;  1GA9 A;  2DRW A;  1ES5 A;  3VOL A;  5FQ9 A;  2GNX A;  4G3V A;  1MWS A;  3B3X A;  4B9O A;  2JC7 A;  3M6H A;  4D2O A;  2VV8 A;  5J8X A;  2HPB A;  3S22 A;  4WL9 A;  5EOE A;  1Y54 A;  2V1Z A;  4P6B A;  4GB7 A;  1DJA A;  2W3H A;  4HJ6 A;  5FI7 A;  3WRT A;  3WS2 A;  3MKF A;  1M6K A;  3UPP A;  1XA7 A;  2KOI A;  4PM7 A;  3V39 A;  4UQI S;  2Q9M A;  4ZJ2 A;  1M40 A;  1YMS A;  2PU4 A;  4HI4 A;  2PR6 A;  3PBN A;  2ZJ9 A;  4R4R A;  3VOY A;  2JKR I;  2EX9 A;  3PYP A;  1TS0 A;  3NIA A;  4NXB A;  3BJN A;  4G3W A;  1ESU A;  2EX8 A;  3HCY A;  4UQI M;  2KLI A;  3PBQ A;  4JXS A;  5FAQ A;  2J9P A;  1XFN A;  3RTY A;  2J80 A;  2ZQC A;  3HLE A;  4LEN A;  4FTX A;  1T1C A;  2V1B A;  2W3G A;  5F68 A;  1BTL A;  4DJ2 A;  3KYZ A;  5DJU A;  5DF9 A;  3A3I A;  1TVF A;  4KQQ A;  2JHE A;  1MBL A;  4P6Z M;  1VB6 A;  4JPM A;  3G2Y A;  3O3V A;  1PWG A;  3IQA A;  1H8Y A;  3UE3 A;  3BY8 A;  1MWU A;  4OON A;  2Y2O A;  4R3J A;  4X25 A;  4CPK A;  1OTI A;  1F98 A;  2WKP A;  4IJG A;  1K54 C;  5AQ7 A;  5EVL A;  1BLC A;  5EVI C;  4JF5 A;  3G35 A;  2WGW A;  3HLG A;  1GSX A;  2VA0 A;  3GQZ A;  4L9E A;  3T1Q B;  2Z6C A;  3W4Q A;  2VGJ A;  3B47 A;  3C30 A;  2WGW B;  1KGE A;  5KMW A;  3Q7V A;  4PAU A;  4HJ3 A;  4WF0 A;  3CG5 A;  3GV9 A;  3BYD A;  4OQG A;  4BD0 A;  3MR0 A;  3BFF A;  3D4F A;  1N9N A;  2X01 A;  2B5R A; 
#chains in the Genus database with same CATH homology
 3PBO A;  4I3J A;  4EER A;  3T4K A;  3E98 A;  2O0Y A;  3LIF A;  4ZRR A;  1LSV A;  5I5L A;  1YSQ A;  3G6O A;  2WKR A;  5IS1 A;  2VV6 A;  3C2W A;  4YOF A;  2QHK A;  4MCW A;  2CMN A;  3K2N A;  3F1N B;  3MMH A;  3IBJ A;  4CLC A;  1G6O A;  4WEL A;  3H82 A;  4LRZ E;  2JN7 A;  4QPR A;  3KSF A;  3PXP A;  5F69 A;  3OBF A;  3SW1 A;  2QYB A;  1ZTU A;  3DBA A;  4H6J B;  1Y28 A;  4HOI A;  2KDK A;  3E4O A;  4EW7 A;  1LL8 A;  5AVE A;  3KSG A;  4L9G A;  5HWT A;  3LR5 A;  4RQ9 A;  4IUH A;  1T18 A;  3ICY A;  4DJ3 A;  2YKH A;  2ZMV A;  1YKD A;  4YWZ A;  2GJ3 A;  2EWW A;  3GDI A;  4F3L A;  4EXO A;  4Y3I A;  3H82 B;  1EW0 A;  4O01 A;  2M1C A;  3PR6 A;  4WLA A;  1NLY A;  1TS6 A;  1T1A A;  2Y8H A;  5HWV A;  5HD5 A;  4ETX A;  1OT9 A;  3TW8 A;  1H3Q A;  1MKM A;  1OJG A;  1LSX A;  4O8G A;  4HIA A;  2PDR A;  1H8M A;  3T50 A;  3LI9 A;  3EQU A;  1MC0 A;  4WEJ A;  3S7Q A;  1V9Y A;  1OPX A;  1KOU A;  4NXG A;  1OT6 A;  3F1P A;  4CLC C;  2GX5 A;  3ZQ5 A;  3H7W A;  1OJ5 A;  5AVF A;  5EFW A;  4DN0 A;  2OWJ A;  3BW6 A;  1VHM A;  2QJ7 A;  3F1P B;  3HJK A;  1STZ A;  3TJZ C;  1BYW A;  2Z6D A;  3BY9 A;  2GZA A;  3LIE A;  1UWN X;  1DP9 A;  2I9V A;  3D72 A;  3CI6 A;  1YAX A;  5DFX A;  3S7N A;  1S1Z A;  2HJ9 C;  1F5M A;  1WA9 A;  2M7V A;  4WUJ A;  2IA2 A;  4I3A A;  3A0S A;  2PHY A;  3NJA A;  1DP6 A;  3T4L A;  4Y2F A;  5K5B A;  2J3T D;  2VZW A;  3BQ8 A;  1W63 Q;  2XA7 M;  3FG8 A;  4WN5 A;  3MQ0 A;  1NWZ A;  2YKF A;  2HF6 A;  4LPZ A;  2O9A A;  4KUK A;  1N9L A;  3R7W B;  2K31 A;  2PYR A;  1S4S A;  2A24 A;  1OTD A;  1S1Y A;  4XT2 B;  3B42 A;  1T19 A;  2VKS A;  3A0R A;  4KQO A;  1V9Z A;  2VLG A;  2XRN A;  2XA7 S;  3LUQ A;  3S7O A;  2R78 A;  4R3A A;  1YSP A;  1ODV A;  5CX7 A;  3LR4 A;  5TBM A;  3B33 A;  5IU1 A;  2FZ0 A;  1XJ4 A;  4CLC B;  5AJG A;  4HJ4 A;  3LIA A;  3UE6 A;  1NRJ A;  1OTE A;  3R7W A;  3E4Q A;  2P7J A;  5G4Z A;  3EGD C;  1IFQ A;  3EQV A;  3IS2 B;  2L0W A;  2JKR M;  4XT2 A;  1D7E A;  2V0U A;  2W1T B;  4UEY A;  3NOP C;  2W3F A;  2O9B A;  3PBT A;  2W3E A;  3NOT C;  2EWV A;  4GS9 B;  3CUE A;  4G3K A;  3MQQ A;  4MN5 A;  1S67 L;  3CUE C;  1UGU A;  4KQD A;  4JGO A;  3JVU A;  4EU0 A;  2L1M A;  5J3W A;  4NKP A;  3FPW A;  3EGX C;  1P0Z A;  2LB5 A;  3EOI A;  3PBS A;  1NLZ A;  3LIB A;  4MMN A;  2EA9 A;  3NOU C;  2D02 A;  4ME4 A;  4GLQ A;  1ZHH B;  2HV1 A;  4R6L A;  5J7E A;  4K08 A;  2NUT C;  2K7S A;  3FPV A;  4JGP A;  4GW9 A;  2H28 A;  2MJ6 A;  2QJ5 A;  4OOL A;  4GHI B;  2JKT M;  5HL6 A;  1P97 A;  3EWK A;  3OCN A;  3VE3 A;  1W63 M;  3VE4 A;  3ULF A;  4CQH A;  3MF0 A;  1TD5 A;  1P9R A;  2P04 A;  1D06 A;  1S66 L;  3E4P A;  4ARZ B;  1UWP X;  5HD3 A;  1XJ3 A;  2OOL A;  3H7W B;  4WEK A;  4EET B;  3EEA A;  2B18 A;  5KSH A;  3ZYT A;  5HPF A;  4ARZ A;  3GEC A;  1GSV A;  2PYP A;  4CLC D;  3VV4 A;  3T4Q A;  4BBV A;  1XFQ A;  3OLO A;  3C38 A;  2O99 A;  3UB8 A;  5DKK A;  3CAX A;  2L4R A;  3FC7 A;  2VGL S;  1G28 A;  3P7N A;  3CWF A;  3H9W A;  4HY8 A;  3T4S A;  2HGV A;  2B02 A;  5LBR A;  4YNR A;  4IUK A;  4PKY A;  4L9F A;  3LFV A;  4BWI A;  4H6J A;  4JGQ A;  2A24 B;  2PR5 A;  3C8C A;  2INW A;  5G4Y A;  3KYQ A;  4I38 A;  2WKQ A;  4P6Z S;  5DJT A;  4Q0H A;  3F1N A;  2W1T A;  3EEH A;  5A8B A;  3KSH A;  2PD7 A;  1LSW A;  2W1R A;  3LI8 A;  2NUP C;  3K3C A;  3MXQ A;  2W27 A;  4JGR A;  5L8M A;  2VEA A;  2Y79 A;  4HP9 A;  1T1B A;  4LRY C;  4NEE D;  2OAQ 1;  4HH2 A;  1P9W A;  3PBR A;  3U2A A;  3T4J A;  3BQA A;  3KO6 A;  3V67 A;  2VJW A;  3KSI A;  2M7U A;  5DKL A;  1F9I A;  3UMD A;  4I3I A;  2V1A A;  4ETZ A;  3O5Y A;  3OC2 A;  3UB6 A;  4NXE A;  4F3L B;  4GS9 A;  2PD8 A;  4Z1W A;  3W2Z A;  5KIZ A;  4LLO B;  4HH3 A;  3KX0 X;  4R38 A;  5FL3 A;  1GSW A;  3UB9 A;  4M4X A;  4GJ4 A;  5J4E A;  1JNU A;  3CIT A;  1DRM A;  2A2L A;  4GCZ A;  5HSQ A;  1S4R A;  4BMW A;  1X0O A;  4DMZ A;  3OCL A;  3PHY A;  2KX6 A;  2OAP 1;  1OTB A;  4Q0I A;  2HJE A;  3VOL A;  4EUV A;  2GNX A;  4G3V A;  3K3D A;  2LB9 A;  4GHI A;  4PKY G;  4FOF A;  4B9O A;  4HHD A;  5DFY A;  2VV8 A;  3T4T A;  3OOV A;  4WL9 A;  2VGL M;  1DP8 A;  2XSS A;  5F5Y A;  5IT5 A;  4O0P A;  2W3H A;  5HDD A;  4BBT A;  3CLO A;  4HJ6 A;  5HDS A;  2V0W A;  1TF1 A;  4Q0J A;  2XRO A;  3HJI A;  2KOI A;  3D3O A;  4UQI S;  4HQA A;  2FH5 A;  2VV7 A;  4I5S A;  5TJJ A;  2OWH A;  4L0L A;  4HI4 A;  3NHQ A;  2PR6 A;  4EEU A;  3PBN A;  4HP4 A;  4Y5F A;  4KUO A;  3MQO A;  2JKR I;  3F1O A;  3PYP A;  1TS0 A;  3LR0 A;  3MJQ A;  4NXB A;  3BJN A;  4G3W A;  3LR3 A;  2K2N A;  4CLC E;  1XJ6 A;  2O9C A;  4NXF A;  5C5K A;  3HCY A;  1OTA A;  2KLI A;  3PBQ A;  4UQI M;  3T4O A;  1IOU A;  2J3W A;  4BBU A;  4BJP A;  3JVV A;  1XFN A;  3RTY A;  3A0V A;  2J80 A;  5HZH A;  2ZOI A;  1T1C A;  2V1B A;  2W3G A;  4II7 A;  5F68 A;  3F1O B;  4IHQ A;  3KYZ A;  4DJ2 A;  5DJU A;  3RFB A;  5DF9 A;  1XJ2 A;  3E0Y A;  2D01 A;  2J3T C;  1LT0 A;  5MC7 A;  2ZBB A;  2JHE A;  4P6Z M;  1VB6 A;  3IS2 A;  4OOM A;  4MN6 A;  3UE3 A;  3BY8 A;  5F6A A;  5TBM B;  2V9A A;  3S7P A;  1OTI A;  1F98 A;  2P08 A;  2WKP A;  2ZMF A;  3LIC A;  4IJG A;  4R70 A;  5HDC A;  3P01 A;  4AFI A;  3UME A;  2QWS A;  4FSF A;  4EQ1 A;  2PT7 A;  3MFX A;  3BWL A;  4B93 A;  4HNB A;  1MZU A;  1GSX A;  2VA0 A;  4L9E A;  3LYX A;  1TS7 A;  5HWW A;  2Z6C A;  2ZOH A;  4I39 A;  4MDZ A;  2W3D A;  3B47 A;  3C30 A;  3LID A;  2VX8 A;  3R4K A;  3RH8 B;  4LRX C;  4PAU A;  4HJ3 A;  3TRC A;  3IBR A;  4MN7 A;  4WF0 A;  2DMW A;  1N9O A;  3UB7 A;  4EES A;  2W0N A;  3TE8 A;  3MR0 A;  4EEP A;  2G7U A;  4E04 A;  1N9N A;  1TS8 A;  2JKT I;  5HPI A;  2BAS A;  4PHT A;  2QKP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...