1TS6A

Structure of the pb2 intermediate from time-resolved laue crystallography
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Visualizing reaction pathways in photoactive yellow protein from nanoseconds to seconds.
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Photoreceptor
molecule keywords Photoactive yellow protein
total genus 37
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2004-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1ts6A00
1N9OA 2D02A 5EFWA 1Y28A 2GJ3A 2OWJA 3EEHA 4LRZE 3UB8A 4B9OA 1T1BA 1XFNA 2L4RA 4I3IA 4NXFA 5DJUA 5G4ZA 5DKKA 2VLGA 4I3JA 3SW1A 3E4QA 3LYXA 2M1CA 2V0WA 5AVEA 1F98A 4PKYG 5J7EA 4EERA 1ODVA 1UWPX 1N9LA 3LI9A 2Z6DA 2VV6A 3D72A 1EW0A 1TS6A 1T1CA 1D06A 5F5YA 5HDCA 1DP8A 5HDDA 4EEPA 2JHEA 1WA9A 3IS2B 3H82A 3NOPC 1DP9A 2PR5A 4HJ4A 4EW7A 4F3LA 2YKHA 4HH3A 1S66L 4R6LA 4GCZA 3BY9A 4JGPA 1XFQA 4RQ9A 5IS1A 1T19A 2P7JA 1LSWA 1UWNX 1P0ZA 2A24A 3F1PA 3LIBA 1V9YA 4HQAA 3LUQA 4HIAA 4LRXC 1UGUA 3C2WA 3H7WB 3IBRA 2A24B 3F1PB 1XJ4A 3GECA 1OTEA 5I5LA 2OWHA 1JNUA 3ULFA 2L1MA 5AVFA 3A0SA 5G4YA 1OTBA 2HV1A 3NOTC 3K3DA 4K08A 1S1YA 4L9EA 3LIEA 2D01A 3NJAA 4R3AA 4GS9B 2BASA 2B02A 2V1BA 1OTIA 1GSVA 1V9ZA 2QKPA 4WLAA 4LPZA 1TS0A 2KX6A 3FC7A 5HSQA 3UMDA 2INWA 4KUOA 1S4RA 2W0NA 4GHIA 5DJTA 3A0VA 4KUKA 2PYPA 3EWKA 1T1AA 1MZUA 4NXEA 2PR6A 4WN5A 2PHYA 4HP4A 1OTDA 3MQQA 3HJIA 4JGQA 4BBVA 5A8BA 1F9IA 1LSXA 3KX0X 1DRMA 2K7SA 3LI8A 1XJ6A 2W27A 2H28A 2PD7A 3MQOA 3P7NA 4HI4A 4MN5A 4EESA 4L9FA 5F68A 3PYPA 1KOUA 2EA9A 4GS9A 4DJ3A 1XJ3A 5TBMA 4F3LB 1S1ZA 2V1AA 1TS7A 3F1NB 2KDKA 4HOIA 2J80A 3CLOA 4EETB 4HHDA 1LL8A 3F1NA 4I5SA 1N9NA 1OJ5A 3LIDA 5HWWA 3F1OB 4EQ1A 2JN7A 3F1OA 2QJ7A 3GDIA 4E04A 1VB6A 1BYWA 1G28A 1TS8A 2I9VA 2ZBBA 3VOLA 1DP6A 1OJGA 2OOLA 4WF0A 3MR0A 4GW9A 3BWLA 3VE4A 3VE3A 3CWFA 2PYRA 3B33A 3ZQ5A 2ZOHA 4HJ3A 2Z6CA 3NOUC 4HH2A 4M4XA 2V9AA 3NHQA 4H6JB 4YWZA 1GSXA 3UB7A 1NWZA 4L9GA 1XJ2A 3CAXA 4EEUA 3ICYA 3IS2A 5KIZA 1D7EA 2WKRA 4GHIB 4HNBA 3HJKA 4JGOA 4R38A 3A0RA 3RH8B 3MFXA 3MXQA 3UB9A 3OLOA 4NXGA 1OT6A 4PKYA 2R78A 2V0UA 3E4PA 4WL9A 4HJ6A 5HDSA 2L0WA 1T18A 1GSWA 4I38A 4I3AA 2VV8A 5HWVA 1OTAA 3E4OA 3H7WA 2WKQA 1LT0A 3H82B 2QWSA 3LIFA 3H9WA 3MJQA 5F69A 5HWTA 3PHYA 5J3WA 5HD5A 3LICA 3RTYA 4BBUA 3FG8A 4XT2A 3K3CA 5DKLA 2PD8A 2PDRA 3UB6A 4NXBA 4WUJA 1X0OA 3BY8A 4XT2B 4R70A 2WKPA 4LLOB 2QJ5A 4EXOA 2CMNA 4LRYC 4H6JA 1LSVA 2QHKA 2VV7A 5J4EA 3T50A 1S67L 3G6OA 2YKFA 2VEAA 5HD3A 4HP9A 2ZOIA 3UMEA 5TBMB 4MN6A 3C8CA 4DJ2A 1OT9A 5HZHA 1P97A 3UE6A 4KQDA 5F6AA 5IU1A 4BBTA 4JGRA 4HY8A 1S4SA 3LIAA 4I39A
chains in the Genus database with same CATH superfamily
3IF5A 1N9OA 4GNUA 3CPTB 5FA7A 3ZVWA 5G4ZA 5FEFA 2M1CA 2V0WA 1YLJA 4KZBA 5F5YA 1TF1A 2WUQA 1PI4A 1WA9A 2OV5A 3ZCZA 2HF6A 3T1QB 2HZ5A 4GCZA 4WEKA 3KYZA 1LSWA 3ITBA 5AQ9A 3HUOA 1XJ4A 4EBPA 3N8SA 1JNUA 3N4IA 1ES5A 4KQRA 3WS1A 2O9BA 1GSVA 2KX6A 3UMDA 1K6RA 1S4RA 1IYPA 3C7VA 4C3QA 5KSHA 4LV2A 2QPNA 2CC1A 4DE1A 1KOUA 4GS9A 1W63M 4F3LB 3OBFA 1CI9A 4D2OA 2XR0A 1G28A 2I9VA 4Q0HA 3GVBA 3N8LA 3CWFA 2PBDP 3D4FA 4BL3A 3O86A 3ZFZA 1W63Q 4L9GA 4R3JA 4DKIA 2WAEA 3HJKA 1YSPA 4RA7A 4QHCA 2XD5A 2L0WA 5M1AA 3LICA 4L0LA 4XT2A 2EXAA 4KZ5A 4P6BA 2Y2IA 4R3BA 4EBLA 3G6OA 3E0YA 2P74A 4EUZA 3Q07A 5CERA 1EROA 3UB5P 3ZGAB 3DWZA 3VOYA 2P9VA 4UQIM 2XROA 2Y2KA 2JKRM 2X71A 3IH8A 1CF0A 1D06A 5GL9A 2IA2A 3S4XA 3MFDA 3PBRA 3PBTA 1L0GA 2A24B 4E6WA 3GMWA 1K56A 4EUVA 1BLCA 5GHZA 2HV1A 3NJAA 1DY6A 2BASA 3UDIA 2B02A 2EWVA 1OTIA 3UE0A 2Y79A 3AGDA 1DJAA 1J3WA 1YLPA 3FPVA 5DJTA 5HL1A 4KUKA 4KG5A 3D9YA 5AQ7A 3BLSA 2VZWA 1K57A 1NZOA 4O01A 3EQVA 3BQ8A 1G5UA 3Q82A 5HARA 1H8MA 3MZEA 1A0KA 3F1NA 5HWWA 4EQIA 1MKMA 2W1TA 2Y2JA 3VOZA 3VE4A 1K4EA 4JF4A 2ZOHA 1I2SA 1XGIA 1GSXA 1NLZA 4OPYA 3RXWA 3Q1FA 1JWVA 1DJCA 3LY3A 1L2SA 3IT9A 3TE8A 3K3CA 1ZC2A 3NECA 3UB6A 2RL3A 3HBRA 4Y15A 2Y8HA 2X01A 2H10A 1N9BA 4Z1WA 4GOGA 5HPFA 1H8ZA 5EVID 4B9OA 1T1BA 4I3JA 1YMXA 1CEFA 5KZHA 2XDMA 1MKIA 4EEPA 5EVIC 4EWFA 1KDWA 3IS2B 2A49A 4IBXA 2WGWB 4Q0JA 4ARZB 1Y4OA 3VV4A 2A24A 3LUQA 3C4OA 3H7WB 5M18A 1PNEA 4PAUA 4RVAA 2W3FA 3K3DA 3LIEA 3OPPA 1BUEA 4DE2A 2ZQ7A 2QKPA 4LPZA 3V3SA 4GD8A 5HSQA 4MBHA 1YLWA 4FSFA 1RGYA 2WGIA 4JGQA 1KE4A 5HAPA 2AVXA 3LI8A 1ESIA 4OQIA 4Z9QA 3BFEA 2Z2LB 4GD6A 4WMCA 2ZC4B 3QP6A 3EOIA 5L2FA 1SDNA 2H5SA 2GX5A 5FL3A 1OJ5A 2JN7A 3PBNA 1VB6A 3LEZA 3QP2A 3SH8A 5FEGA 5FI2A 3BWLA 4HJ3A 3NOUC 5I94A 1NJ4A 3A3JA 4Q8IA 4GHIB 4HNBA 4R38A 2Z2MB 4NK3A 5CEBA 3GRJA 3HVFA 1JWPA 3H82B 4S2NC 2QWSA 3MJQA 1VETA 4II7A 1AWIA 3OCLA 2V1ZA 5IHVA 4DRTA 4F94A 2EWWA 4X25A 3V5MA 2Y2HA 5EPHA 1K55A 2HPBA 3MZFA 3T4LA 4ID4A 4NKPA 1H3QA 3RFBA 3ZG7B 4QD4A 1TS6A 4GZBA 5CHUA 4G3VA 3RJUA 5L10A 2ZQ8A 1D1JA 3CZDA 5HX9A 4XXRA 4F3LA 2K2NA 1XX2A 4DDSA 2P7JA 2PAVP 1UWNX 1YPRA 4OH0A 4HIAA 3IBRA 3F1PB 1NYYA 3IF6A 4WZ5A 5TGFA 3BW6A 2BG1A 4ZDXA 4Y0OA 3HCYA 1PWGA 1NXYA 1VQQA 4E3JA 3V39A 2PYPA 5EOOA 3GTCA 4NXEA 4HP4A 3MQQA 5FQJA 2H28A 3ZDJA 1XXMA 2Y59A 4EV4A 3RXXA 3ZNYA 2KDKA 5F82A 3G32A 1GA0A 3FYZA 4GB7A 1YKDA 3PR6A 3DBAA 3A3FA 3VOLA 1XJ2A 4HESA 1PW8A 3MXQA 2R78A 4KQOA 4GKUA 4Y3IA 4I38A 1H5XA 3E4OA 3RTYA 4IUHA 5DTTA 3E98A 5G18A 3VP2A 4XUXA 4WMCD 4XUZA 2W3GA 1ES4A 5HZHA 4DJ2A 4PM7A 4KQDA 4HY8A 3IXDA 3MF0A 3SH7A 3UB8A 1ZHHB 3C38A 4S2IA 5FQIA 2XH9A 5EVIB 3D72A 1TDGA 1ZKJA 1MXOA 1LLBA 2J3TC 2IWBA 3BY9A 1Q2QA 1U60A 3F1PA 2KLIA 4LRXC 3G2ZA 2W1RA 1YSQA 2Y55A 3KSFA 2L1MA 4S2JA 5FAQA 3NOTC 3JPUA 1ES2A 5FDHA 1NZUA 3CI6A 4B4XA 4KUOA 2C6WB 5CEDA 3KSHA 2PHYA 2ZL1A 4BBVA 4S2PA 5F68A 1GHIA 3C4PA 2XGNA 2C5WB 1TDLA 2VGKA 3GDIA 2G2WA 4QU3A 4RX3A 3ZNTA 1BLPA 3R7WA 3UB7A 4EEUA 1D7EA 4FD8A 4WL9A 2QYBA 3OCNA 5FDSA 1FCNA 5J3WA 2WZXA 4PHTA 2QJ5A 3VFHA 3NDGA 3T50A 4U0XA 1YLYA 1P97A 3PBOA 1ZG4A 3NY4A 2OAQ1 4Y5FA 4PKYG 3G34A 4PM6A 4BD0A 2JHEA 2XLNA 5HPIA 3OPRA 5CTNA 1KVLA 4DE3A 4RQ9A 3NCKA 3MZDA 1I2WA 3HLFA 3T4QA 3VSKA 1KVMA 3IH9A 4YNRA 3JVUA 1XP4A 1MY8A 5A93A 1VHMA 2INWA 3IWIA 1HZOA 2MJ6A 4GHIA 3UPPA 1RGZA 3V67A 1WYBA 4Y17A 1OTDA 2P04A 1LSXA 2JE5A 3NI9A 5F1GA 5A91A 1VETB 1W7FA 3PXPA 1CEGA 5CGWA 4UA7A 5HAIA 4PM9A 2ZQ9A 3MXSA 4EQ1A 2ZM2A 4ZTKA 4MBFA 2JKFA 3NBLA 5DTSA 4CLCD 1DP6A 4Y2FA 1K55C 2EX8A 1PFLA 3VE3A 3LR0A 1F5MA 3SOIA 1GHMA 4JGOA 5D3OA 2W3EA 2Q9MA 2JKGA 1M40A 3TG9A 2VV8A 5HWVA 2Y2NA 2G2UA 2WGVA 4Y7PA 3S7PA 4FH2A 4WUJA 4N1HA 3QP1A 2E8IA 5EM1A 2DNSA 3DTEA 3CHWP 2ZOIA 2Y2MA 3Q7VA 4Y13A 3PAEA 2WK0A 2XFTA 3GR2A 1XFNA 4BENA 3E4QA 4K0XA 3QP4A 4S2KA 3EEAA 5FQQA 3MXRA 4E3OA 2E8JA 2ACGA 3H82A 4CLCA 2HDSA 2PR5A 4HQAA 1W8QA 1C3BA 3JYIA 3GECA 2O9CA 4GS9B 5JYPA 4JBFA 1PIOA 2ZLYA 4KZ8A 1RCJA 3B3XA 4WN5A 4IVKA 1YLTA 1IYOA 3UN7A 2VA0A 2K7SA 3KSGA 3QP8A 1GHPA 2W27A 5FI6A 4HI4A 1F2KA 3OZHA 4JXWA 3VMAA 3VP3A 2BTFP 1KDSA 4P0MA 1Z09A 4K91A 3F1OB 5E43A 3AGFA 3CPTA 1IFQA 4E04A 1ESUA 4GDNA 2HJEA 1STZA 3ZQ5A 3AGEA 3DTKA 1XGJA 1Z6FA 3G35A 2B18A 5HFOA 4KZ9A 4PKYA 4LCLA 1SHVA 2ZC5B 3E4PA 4KZ7A 1T18A 3S1YA 1K25A 2EFUA 3OOVA 3PHYA 4BBUA 3SS3A 2PD8A 4S2OA 1EI5A 3SZTA 2WKPA 3T4JA 5IT5A 3R4KA 4H6JA 4ZAMA 5DF8A 1NRFA 3T1XA 2H0YA 1L0DA 2LB9A 1HVBA 5FQKA 4YFMA 5DF7A 1Y28A 1PZPA 2J7VA 1AXBA 4LCMA 1W8YA 4N92A 3GV9A 2Z6DA 1YLZA 1YMSA 4RYEA 1EW0A 3KSIA 4CLCB 3HLCA 5FI7A 5CTMA 5LBRA 1P0ZA 3UDFA 1NY0A 3LO7A 4QY5A 3S22A 1IKGA 3ZG5A 3JVVA 3BLMA 3BEBA 1IELA 4PMAA 4HBTA 2J8YA 3R7WB 2FZ0A 5CRFA 3BQAA 1N4OA 1LI0A 2ZC7A 5GLDA 1XJ6A 4PM5A 4M3KA 3PYPA 4WYYA 2B5RA 4KENB 4OPRA 2V8FA 4DXCA 2EXBA 4WEJA 5FQMA 3BFDA 4KZAA 2P9VB 4YINA 3B42A 3UE3A 4Q0IA 4LV1A 2PYRA 3B33A 3VP4A 3MKFA 4HH2A 2V9AA 3I7JA 1NWZA 1HTZA 3A0RA 2ZC6B 1ALQA 2WKQA 5MC7A 2W3HA 3FG8A 5DKLA 1MWTA 1X0OA 2ZL1B 3MSHA 4HBUA 3WRTA 4BD1A 1IKIA 1P9RA 3UMEA 4UA6A 3W2ZA 4JF5A 1H0MA 3FKVA 1MWSA 4OVDA 4B4ZA 4I39A 3BECA 4BL2A 2L4RA 4P87A 4DE0A 4NXFA 1E4DA 4N9LA 4OPQA 5GLAA 3T4TA 4KG2A 1E3UD 2EX2A 2ZMAA 4EERA 5BOHA 2GZAA 3CJMA 2O99A 5HDCA 1KGEA 1DP8A 3GQZA 3NULA 4IBRA 4WZ4A 2HJ9C 3BM6A 2WYXA 3QP5A 3W4PA 3S7NA 4E3LA 5AJGA 3HLGA 3P01A 4DF6A 1JVJA 5DFYA 5E2GA 3CG5A 1W79A 2FFFB 3FC7A 3ZYTA 1GCEA 4ESPA 3N6IA 3BYDA 3C5AA 2XA7S 2HP5A 1SDEA 4OP5A 2Y4AA 4IJGA 3TOIA 4X53A 3F1NB 3S7QA 5CHJA 3D3OA 1K0KA 2OLUA 4OPZA 4I5SA 3LIDA 2W1TB 3UPOA 4NG2A 4JKTA 1BYWA 3ZVTA 1LL5A 4GW9A 2WZZA 4U0TA 4K0WA 2Z6CA 2H0TA 3B47A 4DMZA 4FUWA 1P9WA 3IF6C 3IX8A 3MS6A 2J3WA 1MBLA 2QMIA 2Y2LA 4NXBA 3TJZC 5EOEA 2WAFA 4JXGA 2VJWA 1BTLA 2RCXA 3IXBA 5TBMB 3OC2A 3UE6A 5EUAA 1QMEA 1CI8A 3MKEA 5FAPA 2OWJA 2PU4A 2ZMFA 1PZOA 4GJ4A 5DKKA 4YOFA 2OSUA 5J7EA 2HDUA 1ODVA 2HDRA 1XPBA 5HDDA 2R9XA 3NOPC 1DP9A 5U47A 4MN7A 2WKHA 4E3NA 4JXSA 3L7HA 1ZTUA 5L07A 4K08A 4FH4A 4ZJ2A 3K2NA 2VK3A 3L9KA 5GHXA 2XSSA 3FWLA 2HP9A 2ZM8A 2ZC3B 1RP5A 4CQHA 3M2KA 3SS5A 2WKIA 4MLLA 4X68A 1MPLA 3EQUA 3P7NA 1TEMA 4JF6A 3TW8A 1IYQA 2EA9A 1PWCA 4ETXA 2J80A 2R9WA 3GSGA 5J8XA 2V8CA 5F83A 1KGGA 4R4RA 5FAOA 3IQAA 3BFCA 2JKTI 1TS8A 3BFFA 4WF0A 4WBGA 3IX3A 3T4OA 5A90A 3QHYA 1YAXA 4OQGA 3UDXA 3WS2A 3VFFA 4Y0TA 4HJ6A 5L8MA 1LT0A 3LIFA 4LGWA 3WS4A 4CJNA 2PDRA 4XT2B 4R70A 3W4OA 4EXOA 1Q2PA 2Y2GA 3LR3A 2ZD8A 2UWXA 2M7VA 4JGRA 3IWQA 3EEHA 2J9OA 1SKOA 3UPNA 4UHUA 5DJUA 2VLGA 3ITAA 2JC7A 3LY4A 4HJ4A 2YKHA 3C30A 3P09A 4HH3A 4LRYC 1V9YA 5A92A 4MBKA 4X56A 2OWHA 3A0SA 1FSWA 1KE3A 3T12B 4R1GA 3QNBA 2EX9A 1TS0A 1BLSA 2W0NA 3TRCA 5CGXA 1L3LA 3EWKA 1T1AA 4E3MA 3E2KA 2NUPC 3KX0X 2XD1A 4ETZA 4EESA 2VGJA 4OP8A 3IBJA 4DJ3A 4LFUA 3HLBA 1OPXA 2V1AA 1XA1A 1N9NA 3W8KA 2X02A 1OMEA 4IVIA 3Q7ZA 3NC8A 4WELA 3SH9A 4R0QA 3U4LP 3QNCA 5F1FA 3OPLA 3PTEA 4R23A 4KZ3A 3RH8B 3UB9A 2V0UA 3O3VA 3FV7A 4CPKA 2XA7M 3IWOA 3KYQA 4G3WA 4E6XA 5E2HA 4JPMA 5DF9A 3KYEA 2JCHA 1TVFA 1K38A 1SKOB 4N9KA 4S2LA 2GJ3A 3LR4A 4LRZE 1GA9A 4C75A 2J3TD 3LYXA 1F98A 1N9LA 1FQGA 1JTDA 2GDNA 2Y2PA 3HL9A 3FKWA 4BWIA 1LL9A 3IHBA 2PRFA 3ZG8B 2OLVA 4R6LA 5CHMA 3M6BA 3ISGA 2P08A 3ULFA 3CITA 3HLEA 3NDEA 5G4YA 4NXGA 2WKEA 1K56D 4R3AA 2FFYA 4EU0A 4OLDA 4X1MA 1BULA 2Y2OA 1S0WA 1K6SA 5DFXA 5C5KA 3UO9A 4ME4A 4CLCE 4R4SA 4O8GA 3HREA 4JLFA 3T1RA 3LFVA 5FATA 3M2JA 1FR1A 1VEUB 1IOUA 1M6KA 2DRWA 4KG6A 3O5YA 1PWDA 2BLSA 3LR5A 4KZ4A 3T4KA 3CAXA 4P85A 4BMWA 2PU2A 3A3EA 5HWTA 2HP6A 4B93A 2EFXA 4OOYA 5HAQA 1CJFA 2OAP1 2QHKA 3G30A 3OPHA 1SKFA 3UY6A 5HL6A 3U2AA 3IHAA 5EFWA 2D02A 2Y91A 4GDBA 3G2YA 5AVEA 2ZQCA 2A2LA 2V20A 4ZJ3A 5CGSA 2IWDA 1ZG6A 3CMZA 2NUTC 3HUMA 4JGPA 4MN6A 4ZJ1A 2XRNA 5I5LA 1ERQA 4QPRA 2XK1A 5K5BA 4HEFA 4ZRRA 2V1BA 1J9MA 5EM0A 5L09A 1YT4A 3KO6A 4ARZA 1XA7A 4A5RA 3A0VA 3E2LA 5FASA 5A8BA 2PT7A 1E3UA 2VGLM 2PD7A 3WWXA 4L9FA 3BRMA 1E25A 3HUNA 4HOIA 5TFQA 3Q7VB 2ZBBA 2LB5A 2OOLA 4OONA 3MR0A 2A3UA 1O07A 4U3TA 4H6JB 4ZBEA 3BJNA 1ONGA 1BZAA 3MFXA 3OLOA 4MMNA 4WZ5C 1GSWA 3Q81A 2XFSA 4IHQA 1ONHA 1IYSA 1G6OA 2V2FF 4X55A 1FCMA 1BT5A 2O9AA 4QWOA 2G7UA 1L0FA 2CMNA 4S2MA 1LSVA 2I72A 5J4EA 5EVLA 1S67L 3O87A 5IU1A 4QB8A 3VP0A 1LHYA 3A3DA 4I3IA 4IUKA 5FQ9A 4X69A 1UWPX 3TSGA 3IXHA 3A3IA 1FR6A 1NLYA 4C6YA 3MBZA 3T4SA 3EGDC 3W4QA 4KQQA 1MC0A 2VKSA 1T19A 1K54C 3N7WA 4EBNA 1CQAA 1KGFA 3S7OA 3WS5A 1OTEA 3FPWA 3UE1A 4DXBA 1CK3A 1V9ZA 4WLAA 4BJPA 3DTMA 3EGXC 1KE0A 3M6HA 4MNRA 2Y2QA 4OLGA 2PR6A 5EECA 1JTGA 1F9IA 2ZJ9A 3IF6B 3LCEA 5DTKA 1YQSA 3VSLA 2PBYA 1MWRA 1TS7A 4OKPA 5EVIA 1BLHA 3MMHA 3CLOA 1LL8A 3SS4A 4BLMA 2VX8A 4OQHA 4IEDA 3ZHHA 3T1SA 1BSGA 4KZ6A 2QZ6A 1OJGA 4UA9A 4X1LA 2Q0OA 1SZVA 4M4XA 3P98A 5KIZA 2WKRA 4N1XA 4PPRA 2J9PA 3CUEC 4FCFA 5GLBA 1K54A 4G3KA 3BY8A 4O7DA 4X6TA 1VM1A 4E3KA 1PRQA 4UAAA 5E2EA 1IEMA 3LIAA 5FSRA 1S6RA 3SW1A 3UNWA 4OOMA 1LI9A 3LI9A 4S2NA 5CXWA 2VV6A 5CX7A 1HLUP 1T1CA 4GLQA 3DW0A 4DDYA 5EV0A 4LENA 2UV0E 4EW7A 2XEPA 5IS1A 1XFQA 1PYYA 2DCFA 2GNXA 3LIBA 4BBTA 3LGOA 1MWUA 3FZCA 1UGUA 3C2WA 3BFGA 4WM9A 2XQZA 3LEQA 1VEUA 5AVFA 4B88A 1S1YA 1NYMA 4MEZA 5KMWA 4FOFA 1HD8A 3PBQA 5CECA 4OOLA 1PI5A 5KSCA 1TD5A 5AQAA 5EVEA 1FCOA 1XJ3A 1FILA 1S1ZA 1K4FA 3NIAA 4AFIA 4JXVA 4PM8A 2VGLS 3DAVA 2QJ7A 3CUEA 1JWZA 4UQIS 3MQ0A 1NRJA 4O0PA 5DVAA 4BQMA 3NHQA 1FOFA 2ZMVA 3IS2A 4QY6A 4MDZA 4DN0A 2Q9NA 2JBFA 2XF3A 3N8RA 3H7WA 2HGVA 5F69A 2WGWA 4FTXA 5HD5A 3DTIA 2K31A 3WRZA 4LLOB 1DJBA 3DWKA 1QMFA 2YKFA 2VEAA 3G31A 2B95A 5E2FA 5TR7A 1S4SA 3WS0A 1O7EA 4P6ZS 1Y54A 1ES3A 4LV3A 3HLWA 1PW1A 3V50A 2EX6A 4D60A 4NETA 4UEYA 1ACFA 1S66L 4E3IA 1L0EA 1ERMA 2HDQA 1G68A 4OQ0A 2KOIA 3VP1A 5HW3A 3O88A 1OTBA 4L9EA 3IX4A 2D01A 3ZG9B 5GHYA 1W5DA 5EE8A 2JKTM 1I5QA 5TJJA 2FH5A 4MCWA 5JYOA 1MZUA 4H8RA 3HJIA 1EWZA 4GN2A 1DRMA 4MN5A 3PAGA 3MQOA 1YM1A 4Y0UA 4CLCC 5TBMA 1WYCA 4EETB 4HHDA 1FIKA 1K57C 5M19A 3F1OA 4QJGA 1SCWA 4P6ZM 2M7UA 4LV0A 1WE4A 2DMWA 4YWZA 4RX2A 1XKZA 3ICYA 2ZM0A 2W3DA 3V3RA 1OT6A 3IXGA 2O0YA 1FSYA 5GLCA 5HDSA 4I3AA 1OTAA 3PBSA 3H9WA 3C7UA 2WADA 3HLDA 1H8YA 5AQBA 2ZQDA 3G4PA 2IWCA 2VV7A 3ZG0A 4NEED 5HD3A 1G6AA 2JKRI 4HP9A 3C8CA 1OT9A 5F6AA 2ZQAA
chains in the Genus database with same CATH topology
1N9OA 2D02A 3MF0A 5EFWA 3UB8A 2L4RA 4NXFA 5G4ZA 2M1CA 1ZHHB 2V0WA 5AVEA 3T4TA 3C38A 4EERA 2GZAA 2A2LA 3D72A 2O99A 5F5YA 1TF1A 5HDCA 1DP8A 1WA9A 2HF6A 2J3TC 2NUTC 3BY9A 4GCZA 4JGPA 4WEKA 3KYZA 2HJ9C 1LSWA 3F1PA 4MN6A 2KLIA 4LRXC 2W1RA 1YSQA 3S7NA 1XJ4A 3KSFA 2XRNA 5I5LA 5AJGA 1JNUA 3P01A 2L1MA 4QPRA 3NOTC 5K5BA 4ZRRA 2V1BA 3CI6A 2O9BA 5DFYA 1GSVA 3FC7A 2KX6A 3ZYTA 3KO6A 3UMDA 4ARZA 4KUOA 1S4RA 3A0VA 5KSHA 3KSHA 2PHYA 4BBVA 5A8BA 2PT7A 2XA7S 2VGLM 2PD7A 4L9FA 5F68A 4IJGA 1KOUA 4GS9A 1W63M 4F3LB 3F1NB 3S7QA 4HOIA 3D3OA 4I5SA 3OBFA 3LIDA 2W1TB 3GDIA 2ZBBA 1BYWA 1G28A 2I9VA 4Q0HA 2LB5A 2OOLA 3MR0A 4GW9A 3CWFA 2Z6CA 4H6JB 3R7WA 3UB7A 1W63Q 4L9GA 3B47A 4EEUA 1D7EA 3BJNA 3HJKA 1YSPA 4DMZA 3MFXA 3OLOA 4MMNA 4WL9A 1P9WA 2QYBA 3OCNA 2J3WA 2L0WA 1GSWA 5J3WA 4IHQA 3LICA 4L0LA 4XT2A 1G6OA 4NXBA 4PHTA 3TJZC 2O9AA 2G7UA 2QJ5A 2VJWA 2CMNA 1LSVA 5J4EA 3T50A 1S67L 3G6OA 3E0YA 5TBMB 3OC2A 1P97A 3UE6A 3PBOA 5IU1A 2OAQ1 2OWJA 2ZMFA 4I3IA 4UQIM 2XROA 4GJ4A 4IUKA 5DKKA 4Y5FA 4YOFA 5J7EA 4PKYG 1ODVA 2JKRM 1UWPX 1NLYA 1D06A 5HDDA 2JHEA 3NOPC 2IA2A 1DP9A 3EGDC 3T4SA 5HPIA 4MN7A 3PBRA 4RQ9A 1MC0A 2VKSA 1T19A 3PBTA 3S7OA 3T4QA 2A24B 1ZTUA 1OTEA 3FPWA 4EUVA 2HV1A 4K08A 3NJAA 2BASA 2B02A 2EWVA 3K2NA 4YNRA 1OTIA 1V9ZA 4WLAA 4BJPA 3JVUA 2Y79A 2XSSA 1VHMA 2INWA 3FPVA 3EGXC 2MJ6A 4GHIA 5DJTA 4KUKA 3V67A 4CQHA 2PR6A 1OTDA 2P04A 1F9IA 1LSXA 2VZWA 4O01A 3EQUA 3P7NA 3EQVA 3BQ8A 3PXPA 3TW8A 1H8MA 2EA9A 1TS7A 4ETXA 2J80A 3MMHA 3CLOA 1LL8A 3F1NA 5HWWA 2VX8A 4EQ1A 2JKTI 1MKMA 2W1TA 1TS8A 4CLCD 1DP6A 1OJGA 4WF0A 4Y2FA 3VE4A 3VE3A 2ZOHA 3LR0A 4M4XA 3T4OA 1GSXA 1F5MA 1YAXA 5KIZA 1NLZA 2WKRA 4JGOA 2W3EA 4HJ6A 5L8MA 2VV8A 5HWVA 1LT0A 3LIFA 3CUEC 3TE8A 3S7PA 3K3CA 3UB6A 2PDRA 4G3KA 4WUJA 3BY8A 4XT2B 4R70A 4EXOA 2ZOIA 2Y8HA 3LR3A 2M7VA 4JGRA 4Z1WA 3LIAA 5HPFA 3EEHA 4B9OA 1T1BA 1XFNA 5DJUA 2VLGA 4I3JA 3SW1A 3E4QA 4OOMA 3EEAA 3LI9A 2VV6A 5CX7A 1T1CA 4GLQA 4EEPA 3IS2B 3H82A 4CLCA 2PR5A 4HJ4A 4EW7A 2YKHA 3C30A 4Q0JA 4HH3A 4ARZB 5IS1A 1XFQA 2GNXA 3LIBA 3VV4A 2A24A 4BBTA 4HQAA 4LRYC 1V9YA 3LUQA 1UGUA 3C2WA 3H7WB 3GECA 4PAUA 2OWHA 2W3FA 5AVFA 3A0SA 3K3DA 1S1YA 3LIEA 2O9CA 4GS9B 2QKPA 4FOFA 4LPZA 1TS0A 5HSQA 3PBQA 2W0NA 3TRCA 4FSFA 4OOLA 3EWKA 1T1AA 4WN5A 4JGQA 2NUPC 3KX0X 2VA0A 3LI8A 2K7SA 3KSGA 4ETZA 2W27A 1TD5A 4HI4A 4EESA 3IBJA 4DJ3A 1XJ3A 1OPXA 1S1ZA 2V1AA 3EOIA 4AFIA 2GX5A 5FL3A 1N9NA 1OJ5A 3F1OB 2VGLS 2JN7A 1IFQA 2QJ7A 3CUEA 4E04A 3PBNA 1VB6A 4UQIS 3MQ0A 1NRJA 2HJEA 3BWLA 4O0PA 1STZA 4WELA 3ZQ5A 4HJ3A 3NOUC 3NHQA 2ZMVA 3IS2A 2B18A 4GHIB 4HNBA 4R38A 3RH8B 3UB9A 4MDZA 4PKYA 4DN0A 2V0UA 3E4PA 1T18A 3H7WA 3H82B 2HGVA 2QWSA 5F69A 3MJQA 3OOVA 3PHYA 5HD5A 4BBUA 2XA7M 4II7A 2PD8A 3KYQA 4G3WA 3OCLA 2K31A 2WKPA 3T4JA 4LLOB 5IT5A 3R4KA 4H6JA 2YKFA 2VEAA 5DF9A 2LB9A 2EWWA 1S4SA 1Y28A 2GJ3A 3LR4A 4LRZE 3T4LA 4P6ZS 2J3TD 3LYXA 1F98A 4NKPA 1H3QA 3RFBA 1N9LA 2Z6DA 1EW0A 1TS6A 3KSIA 4CLCB 4G3VA 4UEYA 4BWIA 4F3LA 2K2NA 1S66L 4R6LA 2P7JA 1UWNX 1P0ZA 5LBRA 4HIAA 3IBRA 3F1PB 2P08A 2KOIA 3ULFA 3CITA 3JVVA 5G4YA 1OTBA 4L9EA 3BW6A 4NXGA 2D01A 4R3AA 3HCYA 4EU0A 3R7WB 2FZ0A 2JKTM 5TJJA 3BQAA 2PYPA 2FH5A 4MCWA 1MZUA 4NXEA 5DFXA 5C5KA 4HP4A 3MQQA 3HJIA 4ME4A 1DRMA 4CLCE 1XJ6A 4MN5A 2H28A 3MQOA 4O8GA 3PYPA 4CLCC 5TBMA 3LFVA 2KDKA 4EETB 4HHDA 4WEJA 1YKDA 3PR6A 3DBAA 3F1OA 3B42A 3UE3A 4Q0IA 1IOUA 3VOLA 4P6ZM 2M7UA 3O5YA 2DMWA 2PYRA 3B33A 3LR5A 4HH2A 2V9AA 4YWZA 1NWZA 3T4KA 1XJ2A 3CAXA 3ICYA 2W3DA 4BMWA 3A0RA 3MXQA 1OT6A 2R78A 4KQOA 2O0YA 4Y3IA 4I38A 5HDSA 4I3AA 1OTAA 3E4OA 2WKQA 3PBSA 3H9WA 3RTYA 5HWTA 4B93A 2W3HA 5MC7A 3FG8A 4IUHA 5DKLA 1X0OA 3E98A 2OAP1 2QHKA 2W3GA 2VV7A 1P9RA 4NEED 5HD3A 2JKRI 4HP9A 5HZHA 3UMEA 4DJ2A 3C8CA 1OT9A 3W2ZA 4KQDA 5F6AA 5HL6A 4HY8A 3U2AA 4I39A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N9O A;  2D02 A;  5EFW A;  1Y28 A;  2GJ3 A;  2OWJ A;  3EEH A;  4LRZ E;  3UB8 A;  4B9O A;  1T1B A;  1XFN A;  2L4R A;  4I3I A;  4NXF A;  5DJU A;  5G4Z A;  5DKK A;  2VLG A;  4I3J A;  3SW1 A;  3E4Q A;  3LYX A;  2M1C A;  2V0W A;  5AVE A;  1F98 A;  4PKY G;  5J7E A;  4EER A;  1ODV A;  1UWP X;  1N9L A;  3LI9 A;  2Z6D A;  2VV6 A;  3D72 A;  1EW0 A;  1TS6 A;  1T1C A;  1D06 A;  5F5Y A;  5HDC A;  1DP8 A;  5HDD A;  4EEP A;  2JHE A;  1WA9 A;  3IS2 B;  3H82 A;  3NOP C;  1DP9 A;  2PR5 A;  4HJ4 A;  4EW7 A;  4F3L A;  2YKH A;  4HH3 A;  1S66 L;  4R6L A;  4GCZ A;  3BY9 A;  4JGP A;  1XFQ A;  4RQ9 A;  5IS1 A;  1T19 A;  2P7J A;  1LSW A;  1UWN X;  1P0Z A;  2A24 A;  3F1P A;  3LIB A;  1V9Y A;  4HQA A;  3LUQ A;  4HIA A;  4LRX C;  1UGU A;  3C2W A;  3H7W B;  3IBR A;  2A24 B;  3F1P B;  1XJ4 A;  3GEC A;  1OTE A;  5I5L A;  2OWH A;  1JNU A;  3ULF A;  2L1M A;  5AVF A;  3A0S A;  5G4Y A;  1OTB A;  2HV1 A;  3NOT C;  3K3D A;  4K08 A;  1S1Y A;  4L9E A;  3LIE A;  2D01 A;  3NJA A;  4R3A A;  4GS9 B;  2BAS A;  2B02 A;  2V1B A;  1OTI A;  1GSV A;  1V9Z A;  2QKP A;  4WLA A;  4LPZ A;  1TS0 A;  2KX6 A;  3FC7 A;  5HSQ A;  3UMD A;  2INW A;  4KUO A;  1S4R A;  2W0N A;  4GHI A;  5DJT A;  3A0V A;  4KUK A;  2PYP A;  3EWK A;  1T1A A;  1MZU A;  4NXE A;  2PR6 A;  4WN5 A;  2PHY A;  4HP4 A;  1OTD A;  3MQQ A;  3HJI A;  4JGQ A;  4BBV A;  5A8B A;  1F9I A;  1LSX A;  3KX0 X;  1DRM A;  2K7S A;  3LI8 A;  1XJ6 A;  2W27 A;  2H28 A;  2PD7 A;  3MQO A;  3P7N A;  4HI4 A;  4MN5 A;  4EES A;  4L9F A;  5F68 A;  3PYP A;  1KOU A;  2EA9 A;  4GS9 A;  4DJ3 A;  1XJ3 A;  5TBM A;  4F3L B;  1S1Z A;  2V1A A;  1TS7 A;  3F1N B;  2KDK A;  4HOI A;  2J80 A;  3CLO A;  4EET B;  4HHD A;  1LL8 A;  3F1N A;  4I5S A;  1N9N A;  1OJ5 A;  3LID A;  5HWW A;  3F1O B;  4EQ1 A;  2JN7 A;  3F1O A;  2QJ7 A;  3GDI A;  4E04 A;  1VB6 A;  1BYW A;  1G28 A;  1TS8 A;  2I9V A;  2ZBB A;  3VOL A;  1DP6 A;  1OJG A;  2OOL A;  4WF0 A;  3MR0 A;  4GW9 A;  3BWL A;  3VE4 A;  3VE3 A;  3CWF A;  2PYR A;  3B33 A;  3ZQ5 A;  2ZOH A;  4HJ3 A;  2Z6C A;  3NOU C;  4HH2 A;  4M4X A;  2V9A A;  3NHQ A;  4H6J B;  4YWZ A;  1GSX A;  3UB7 A;  1NWZ A;  4L9G A;  1XJ2 A;  3CAX A;  4EEU A;  3ICY A;  3IS2 A;  5KIZ A;  1D7E A;  2WKR A;  4GHI B;  4HNB A;  3HJK A;  4JGO A;  4R38 A;  3A0R A;  3RH8 B;  3MFX A;  3MXQ A;  3UB9 A;  3OLO A;  4NXG A;  1OT6 A;  4PKY A;  2R78 A;  2V0U A;  3E4P A;  4WL9 A;  4HJ6 A;  5HDS A;  2L0W A;  1T18 A;  1GSW A;  4I38 A;  4I3A A;  2VV8 A;  5HWV A;  1OTA A;  3E4O A;  3H7W A;  2WKQ A;  1LT0 A;  3H82 B;  2QWS A;  3LIF A;  3H9W A;  3MJQ A;  5F69 A;  5HWT A;  3PHY A;  5J3W A;  5HD5 A;  3LIC A;  3RTY A;  4BBU A;  3FG8 A;  4XT2 A;  3K3C A;  5DKL A;  2PD8 A;  2PDR A;  3UB6 A;  4NXB A;  4WUJ A;  1X0O A;  3BY8 A;  4XT2 B;  4R70 A;  2WKP A;  4LLO B;  2QJ5 A;  4EXO A;  2CMN A;  4LRY C;  4H6J A;  1LSV A;  2QHK A;  2VV7 A;  5J4E A;  3T50 A;  1S67 L;  3G6O A;  2YKF A;  2VEA A;  5HD3 A;  4HP9 A;  2ZOI A;  3UME A;  5TBM B;  4MN6 A;  3C8C A;  4DJ2 A;  1OT9 A;  5HZH A;  1P97 A;  3UE6 A;  4KQD A;  5F6A A;  5IU1 A;  4BBT A;  4JGR A;  4HY8 A;  1S4S A;  3LIA A;  4I39 A; 
#chains in the Genus database with same CATH topology
 3IF5 A;  1N9O A;  4GNU A;  3CPT B;  5FA7 A;  3ZVW A;  5G4Z A;  5FEF A;  2M1C A;  2V0W A;  1YLJ A;  4KZB A;  5F5Y A;  1TF1 A;  2WUQ A;  1PI4 A;  1WA9 A;  2OV5 A;  3ZCZ A;  2HF6 A;  3T1Q B;  2HZ5 A;  4GCZ A;  4WEK A;  3KYZ A;  1LSW A;  3ITB A;  5AQ9 A;  3HUO A;  1XJ4 A;  4EBP A;  3N8S A;  1JNU A;  3N4I A;  1ES5 A;  4KQR A;  3WS1 A;  2O9B A;  1GSV A;  2KX6 A;  3UMD A;  1K6R A;  1S4R A;  1IYP A;  3C7V A;  4C3Q A;  5KSH A;  4LV2 A;  2QPN A;  2CC1 A;  4DE1 A;  1KOU A;  4GS9 A;  1W63 M;  4F3L B;  3OBF A;  1CI9 A;  4D2O A;  2XR0 A;  1G28 A;  2I9V A;  4Q0H A;  3GVB A;  3N8L A;  3CWF A;  2PBD P;  3D4F A;  4BL3 A;  3O86 A;  3ZFZ A;  1W63 Q;  4L9G A;  4R3J A;  4DKI A;  2WAE A;  3HJK A;  1YSP A;  4RA7 A;  4QHC A;  2XD5 A;  2L0W A;  5M1A A;  3LIC A;  4L0L A;  4XT2 A;  2EXA A;  4KZ5 A;  4P6B A;  2Y2I A;  4R3B A;  4EBL A;  3G6O A;  3E0Y A;  2P74 A;  4EUZ A;  3Q07 A;  5CER A;  1ERO A;  3UB5 P;  3ZGA B;  3DWZ A;  3VOY A;  2P9V A;  4UQI M;  2XRO A;  2Y2K A;  2JKR M;  2X71 A;  3IH8 A;  1CF0 A;  1D06 A;  5GL9 A;  2IA2 A;  3S4X A;  3MFD A;  3PBR A;  3PBT A;  1L0G A;  2A24 B;  4E6W A;  3GMW A;  1K56 A;  4EUV A;  1BLC A;  5GHZ A;  2HV1 A;  3NJA A;  1DY6 A;  2BAS A;  3UDI A;  2B02 A;  2EWV A;  1OTI A;  3UE0 A;  2Y79 A;  3AGD A;  1DJA A;  1J3W A;  1YLP A;  3FPV A;  5DJT A;  5HL1 A;  4KUK A;  4KG5 A;  3D9Y A;  5AQ7 A;  3BLS A;  2VZW A;  1K57 A;  1NZO A;  4O01 A;  3EQV A;  3BQ8 A;  1G5U A;  3Q82 A;  5HAR A;  1H8M A;  3MZE A;  1A0K A;  3F1N A;  5HWW A;  4EQI A;  1MKM A;  2W1T A;  2Y2J A;  3VOZ A;  3VE4 A;  1K4E A;  4JF4 A;  2ZOH A;  1I2S A;  1XGI A;  1GSX A;  1NLZ A;  4OPY A;  3RXW A;  3Q1F A;  1JWV A;  1DJC A;  3LY3 A;  1L2S A;  3IT9 A;  3TE8 A;  3K3C A;  1ZC2 A;  3NEC A;  3UB6 A;  2RL3 A;  3HBR A;  4Y15 A;  2Y8H A;  2X01 A;  2H10 A;  1N9B A;  4Z1W A;  4GOG A;  5HPF A;  1H8Z A;  5EVI D;  4B9O A;  1T1B A;  4I3J A;  1YMX A;  1CEF A;  5KZH A;  2XDM A;  1MKI A;  4EEP A;  5EVI C;  4EWF A;  1KDW A;  3IS2 B;  2A49 A;  4IBX A;  2WGW B;  4Q0J A;  4ARZ B;  1Y4O A;  3VV4 A;  2A24 A;  3LUQ A;  3C4O A;  3H7W B;  5M18 A;  1PNE A;  4PAU A;  4RVA A;  2W3F A;  3K3D A;  3LIE A;  3OPP A;  1BUE A;  4DE2 A;  2ZQ7 A;  2QKP A;  4LPZ A;  3V3S A;  4GD8 A;  5HSQ A;  4MBH A;  1YLW A;  4FSF A;  1RGY A;  2WGI A;  4JGQ A;  1KE4 A;  5HAP A;  2AVX A;  3LI8 A;  1ESI A;  4OQI A;  4Z9Q A;  3BFE A;  2Z2L B;  4GD6 A;  4WMC A;  2ZC4 B;  3QP6 A;  3EOI A;  5L2F A;  1SDN A;  2H5S A;  2GX5 A;  5FL3 A;  1OJ5 A;  2JN7 A;  3PBN A;  1VB6 A;  3LEZ A;  3QP2 A;  3SH8 A;  5FEG A;  5FI2 A;  3BWL A;  4HJ3 A;  3NOU C;  5I94 A;  1NJ4 A;  3A3J A;  4Q8I A;  4GHI B;  4HNB A;  4R38 A;  2Z2M B;  4NK3 A;  5CEB A;  3GRJ A;  3HVF A;  1JWP A;  3H82 B;  4S2N C;  2QWS A;  3MJQ A;  1VET A;  4II7 A;  1AWI A;  3OCL A;  2V1Z A;  5IHV A;  4DRT A;  4F94 A;  2EWW A;  4X25 A;  3V5M A;  2Y2H A;  5EPH A;  1K55 A;  2HPB A;  3MZF A;  3T4L A;  4ID4 A;  4NKP A;  1H3Q A;  3RFB A;  3ZG7 B;  4QD4 A;  1TS6 A;  4GZB A;  5CHU A;  4G3V A;  3RJU A;  5L10 A;  2ZQ8 A;  1D1J A;  3CZD A;  5HX9 A;  4XXR A;  4F3L A;  2K2N A;  1XX2 A;  4DDS A;  2P7J A;  2PAV P;  1UWN X;  1YPR A;  4OH0 A;  4HIA A;  3IBR A;  3F1P B;  1NYY A;  3IF6 A;  4WZ5 A;  5TGF A;  3BW6 A;  2BG1 A;  4ZDX A;  4Y0O A;  3HCY A;  1PWG A;  1NXY A;  1VQQ A;  4E3J A;  3V39 A;  2PYP A;  5EOO A;  3GTC A;  4NXE A;  4HP4 A;  3MQQ A;  5FQJ A;  2H28 A;  3ZDJ A;  1XXM A;  2Y59 A;  4EV4 A;  3RXX A;  3ZNY A;  2KDK A;  5F82 A;  3G32 A;  1GA0 A;  3FYZ A;  4GB7 A;  1YKD A;  3PR6 A;  3DBA A;  3A3F A;  3VOL A;  1XJ2 A;  4HES A;  1PW8 A;  3MXQ A;  2R78 A;  4KQO A;  4GKU A;  4Y3I A;  4I38 A;  1H5X A;  3E4O A;  3RTY A;  4IUH A;  5DTT A;  3E98 A;  5G18 A;  3VP2 A;  4XUX A;  4WMC D;  4XUZ A;  2W3G A;  1ES4 A;  5HZH A;  4DJ2 A;  4PM7 A;  4KQD A;  4HY8 A;  3IXD A;  3MF0 A;  3SH7 A;  3UB8 A;  1ZHH B;  3C38 A;  4S2I A;  5FQI A;  2XH9 A;  5EVI B;  3D72 A;  1TDG A;  1ZKJ A;  1MXO A;  1LLB A;  2J3T C;  2IWB A;  3BY9 A;  1Q2Q A;  1U60 A;  3F1P A;  2KLI A;  4LRX C;  3G2Z A;  2W1R A;  1YSQ A;  2Y55 A;  3KSF A;  2L1M A;  4S2J A;  5FAQ A;  3NOT C;  3JPU A;  1ES2 A;  5FDH A;  1NZU A;  3CI6 A;  4B4X A;  4KUO A;  2C6W B;  5CED A;  3KSH A;  2PHY A;  2ZL1 A;  4BBV A;  4S2P A;  5F68 A;  1GHI A;  3C4P A;  2XGN A;  2C5W B;  1TDL A;  2VGK A;  3GDI A;  2G2W A;  4QU3 A;  4RX3 A;  3ZNT A;  1BLP A;  3R7W A;  3UB7 A;  4EEU A;  1D7E A;  4FD8 A;  4WL9 A;  2QYB A;  3OCN A;  5FDS A;  1FCN A;  5J3W A;  2WZX A;  4PHT A;  2QJ5 A;  3VFH A;  3NDG A;  3T50 A;  4U0X A;  1YLY A;  1P97 A;  3PBO A;  1ZG4 A;  3NY4 A;  2OAQ 1;  4Y5F A;  4PKY G;  3G34 A;  4PM6 A;  4BD0 A;  2JHE A;  2XLN A;  5HPI A;  3OPR A;  5CTN A;  1KVL A;  4DE3 A;  4RQ9 A;  3NCK A;  3MZD A;  1I2W A;  3HLF A;  3T4Q A;  3VSK A;  1KVM A;  3IH9 A;  4YNR A;  3JVU A;  1XP4 A;  1MY8 A;  5A93 A;  1VHM A;  2INW A;  3IWI A;  1HZO A;  2MJ6 A;  4GHI A;  3UPP A;  1RGZ A;  3V67 A;  1WYB A;  4Y17 A;  1OTD A;  2P04 A;  1LSX A;  2JE5 A;  3NI9 A;  5F1G A;  5A91 A;  1VET B;  1W7F A;  3PXP A;  1CEG A;  5CGW A;  4UA7 A;  5HAI A;  4PM9 A;  2ZQ9 A;  3MXS A;  4EQ1 A;  2ZM2 A;  4ZTK A;  4MBF A;  2JKF A;  3NBL A;  5DTS A;  4CLC D;  1DP6 A;  4Y2F A;  1K55 C;  2EX8 A;  1PFL A;  3VE3 A;  3LR0 A;  1F5M A;  3SOI A;  1GHM A;  4JGO A;  5D3O A;  2W3E A;  2Q9M A;  2JKG A;  1M40 A;  3TG9 A;  2VV8 A;  5HWV A;  2Y2N A;  2G2U A;  2WGV A;  4Y7P A;  3S7P A;  4FH2 A;  4WUJ A;  4N1H A;  3QP1 A;  2E8I A;  5EM1 A;  2DNS A;  3DTE A;  3CHW P;  2ZOI A;  2Y2M A;  3Q7V A;  4Y13 A;  3PAE A;  2WK0 A;  2XFT A;  3GR2 A;  1XFN A;  4BEN A;  3E4Q A;  4K0X A;  3QP4 A;  4S2K A;  3EEA A;  5FQQ A;  3MXR A;  4E3O A;  2E8J A;  2ACG A;  3H82 A;  4CLC A;  2HDS A;  2PR5 A;  4HQA A;  1W8Q A;  1C3B A;  3JYI A;  3GEC A;  2O9C A;  4GS9 B;  5JYP A;  4JBF A;  1PIO A;  2ZLY A;  4KZ8 A;  1RCJ A;  3B3X A;  4WN5 A;  4IVK A;  1YLT A;  1IYO A;  3UN7 A;  2VA0 A;  2K7S A;  3KSG A;  3QP8 A;  1GHP A;  2W27 A;  5FI6 A;  4HI4 A;  1F2K A;  3OZH A;  4JXW A;  3VMA A;  3VP3 A;  2BTF P;  1KDS A;  4P0M A;  1Z09 A;  4K91 A;  3F1O B;  5E43 A;  3AGF A;  3CPT A;  1IFQ A;  4E04 A;  1ESU A;  4GDN A;  2HJE A;  1STZ A;  3ZQ5 A;  3AGE A;  3DTK A;  1XGJ A;  1Z6F A;  3G35 A;  2B18 A;  5HFO A;  4KZ9 A;  4PKY A;  4LCL A;  1SHV A;  2ZC5 B;  3E4P A;  4KZ7 A;  1T18 A;  3S1Y A;  1K25 A;  2EFU A;  3OOV A;  3PHY A;  4BBU A;  3SS3 A;  2PD8 A;  4S2O A;  1EI5 A;  3SZT A;  2WKP A;  3T4J A;  5IT5 A;  3R4K A;  4H6J A;  4ZAM A;  5DF8 A;  1NRF A;  3T1X A;  2H0Y A;  1L0D A;  2LB9 A;  1HVB A;  5FQK A;  4YFM A;  5DF7 A;  1Y28 A;  1PZP A;  2J7V A;  1AXB A;  4LCM A;  1W8Y A;  4N92 A;  3GV9 A;  2Z6D A;  1YLZ A;  1YMS A;  4RYE A;  1EW0 A;  3KSI A;  4CLC B;  3HLC A;  5FI7 A;  5CTM A;  5LBR A;  1P0Z A;  3UDF A;  1NY0 A;  3LO7 A;  4QY5 A;  3S22 A;  1IKG A;  3ZG5 A;  3JVV A;  3BLM A;  3BEB A;  1IEL A;  4PMA A;  4HBT A;  2J8Y A;  3R7W B;  2FZ0 A;  5CRF A;  3BQA A;  1N4O A;  1LI0 A;  2ZC7 A;  5GLD A;  1XJ6 A;  4PM5 A;  4M3K A;  3PYP A;  4WYY A;  2B5R A;  4KEN B;  4OPR A;  2V8F A;  4DXC A;  2EXB A;  4WEJ A;  5FQM A;  3BFD A;  4KZA A;  2P9V B;  4YIN A;  3B42 A;  3UE3 A;  4Q0I A;  4LV1 A;  2PYR A;  3B33 A;  3VP4 A;  3MKF A;  4HH2 A;  2V9A A;  3I7J A;  1NWZ A;  1HTZ A;  3A0R A;  2ZC6 B;  1ALQ A;  2WKQ A;  5MC7 A;  2W3H A;  3FG8 A;  5DKL A;  1MWT A;  1X0O A;  2ZL1 B;  3MSH A;  4HBU A;  3WRT A;  4BD1 A;  1IKI A;  1P9R A;  3UME A;  4UA6 A;  3W2Z A;  4JF5 A;  1H0M A;  3FKV A;  1MWS A;  4OVD A;  4B4Z A;  4I39 A;  3BEC A;  4BL2 A;  2L4R A;  4P87 A;  4DE0 A;  4NXF A;  1E4D A;  4N9L A;  4OPQ A;  5GLA A;  3T4T A;  4KG2 A;  1E3U D;  2EX2 A;  2ZMA A;  4EER A;  5BOH A;  2GZA A;  3CJM A;  2O99 A;  5HDC A;  1KGE A;  1DP8 A;  3GQZ A;  3NUL A;  4IBR A;  4WZ4 A;  2HJ9 C;  3BM6 A;  2WYX A;  3QP5 A;  3W4P A;  3S7N A;  4E3L A;  5AJG A;  3HLG A;  3P01 A;  4DF6 A;  1JVJ A;  5DFY A;  5E2G A;  3CG5 A;  1W79 A;  2FFF B;  3FC7 A;  3ZYT A;  1GCE A;  4ESP A;  3N6I A;  3BYD A;  3C5A A;  2XA7 S;  2HP5 A;  1SDE A;  4OP5 A;  2Y4A A;  4IJG A;  3TOI A;  4X53 A;  3F1N B;  3S7Q A;  5CHJ A;  3D3O A;  1K0K A;  2OLU A;  4OPZ A;  4I5S A;  3LID A;  2W1T B;  3UPO A;  4NG2 A;  4JKT A;  1BYW A;  3ZVT A;  1LL5 A;  4GW9 A;  2WZZ A;  4U0T A;  4K0W A;  2Z6C A;  2H0T A;  3B47 A;  4DMZ A;  4FUW A;  1P9W A;  3IF6 C;  3IX8 A;  3MS6 A;  2J3W A;  1MBL A;  2QMI A;  2Y2L A;  4NXB A;  3TJZ C;  5EOE A;  2WAF A;  4JXG A;  2VJW A;  1BTL A;  2RCX A;  3IXB A;  5TBM B;  3OC2 A;  3UE6 A;  5EUA A;  1QME A;  1CI8 A;  3MKE A;  5FAP A;  2OWJ A;  2PU4 A;  2ZMF A;  1PZO A;  4GJ4 A;  5DKK A;  4YOF A;  2OSU A;  5J7E A;  2HDU A;  1ODV A;  2HDR A;  1XPB A;  5HDD A;  2R9X A;  3NOP C;  1DP9 A;  5U47 A;  4MN7 A;  2WKH A;  4E3N A;  4JXS A;  3L7H A;  1ZTU A;  5L07 A;  4K08 A;  4FH4 A;  4ZJ2 A;  3K2N A;  2VK3 A;  3L9K A;  5GHX A;  2XSS A;  3FWL A;  2HP9 A;  2ZM8 A;  2ZC3 B;  1RP5 A;  4CQH A;  3M2K A;  3SS5 A;  2WKI A;  4MLL A;  4X68 A;  1MPL A;  3EQU A;  3P7N A;  1TEM A;  4JF6 A;  3TW8 A;  1IYQ A;  2EA9 A;  1PWC A;  4ETX A;  2J80 A;  2R9W A;  3GSG A;  5J8X A;  2V8C A;  5F83 A;  1KGG A;  4R4R A;  5FAO A;  3IQA A;  3BFC A;  2JKT I;  1TS8 A;  3BFF A;  4WF0 A;  4WBG A;  3IX3 A;  3T4O A;  5A90 A;  3QHY A;  1YAX A;  4OQG A;  3UDX A;  3WS2 A;  3VFF A;  4Y0T A;  4HJ6 A;  5L8M A;  1LT0 A;  3LIF A;  4LGW A;  3WS4 A;  4CJN A;  2PDR A;  4XT2 B;  4R70 A;  3W4O A;  4EXO A;  1Q2P A;  2Y2G A;  3LR3 A;  2ZD8 A;  2UWX A;  2M7V A;  4JGR A;  3IWQ A;  3EEH A;  2J9O A;  1SKO A;  3UPN A;  4UHU A;  5DJU A;  2VLG A;  3ITA A;  2JC7 A;  3LY4 A;  4HJ4 A;  2YKH A;  3C30 A;  3P09 A;  4HH3 A;  4LRY C;  1V9Y A;  5A92 A;  4MBK A;  4X56 A;  2OWH A;  3A0S A;  1FSW A;  1KE3 A;  3T12 B;  4R1G A;  3QNB A;  2EX9 A;  1TS0 A;  1BLS A;  2W0N A;  3TRC A;  5CGX A;  1L3L A;  3EWK A;  1T1A A;  4E3M A;  3E2K A;  2NUP C;  3KX0 X;  2XD1 A;  4ETZ A;  4EES A;  2VGJ A;  4OP8 A;  3IBJ A;  4DJ3 A;  4LFU A;  3HLB A;  1OPX A;  2V1A A;  1XA1 A;  1N9N A;  3W8K A;  2X02 A;  1OME A;  4IVI A;  3Q7Z A;  3NC8 A;  4WEL A;  3SH9 A;  4R0Q A;  3U4L P;  3QNC A;  5F1F A;  3OPL A;  3PTE A;  4R23 A;  4KZ3 A;  3RH8 B;  3UB9 A;  2V0U A;  3O3V A;  3FV7 A;  4CPK A;  2XA7 M;  3IWO A;  3KYQ A;  4G3W A;  4E6X A;  5E2H A;  4JPM A;  5DF9 A;  3KYE A;  2JCH A;  1TVF A;  1K38 A;  1SKO B;  4N9K A;  4S2L A;  2GJ3 A;  3LR4 A;  4LRZ E;  1GA9 A;  4C75 A;  2J3T D;  3LYX A;  1F98 A;  1N9L A;  1FQG A;  1JTD A;  2GDN A;  2Y2P A;  3HL9 A;  3FKW A;  4BWI A;  1LL9 A;  3IHB A;  2PRF A;  3ZG8 B;  2OLV A;  4R6L A;  5CHM A;  3M6B A;  3ISG A;  2P08 A;  3ULF A;  3CIT A;  3HLE A;  3NDE A;  5G4Y A;  4NXG A;  2WKE A;  1K56 D;  4R3A A;  2FFY A;  4EU0 A;  4OLD A;  4X1M A;  1BUL A;  2Y2O A;  1S0W A;  1K6S A;  5DFX A;  5C5K A;  3UO9 A;  4ME4 A;  4CLC E;  4R4S A;  4O8G A;  3HRE A;  4JLF A;  3T1R A;  3LFV A;  5FAT A;  3M2J A;  1FR1 A;  1VEU B;  1IOU A;  1M6K A;  2DRW A;  4KG6 A;  3O5Y A;  1PWD A;  2BLS A;  3LR5 A;  4KZ4 A;  3T4K A;  3CAX A;  4P85 A;  4BMW A;  2PU2 A;  3A3E A;  5HWT A;  2HP6 A;  4B93 A;  2EFX A;  4OOY A;  5HAQ A;  1CJF A;  2OAP 1;  2QHK A;  3G30 A;  3OPH A;  1SKF A;  3UY6 A;  5HL6 A;  3U2A A;  3IHA A;  5EFW A;  2D02 A;  2Y91 A;  4GDB A;  3G2Y A;  5AVE A;  2ZQC A;  2A2L A;  2V20 A;  4ZJ3 A;  5CGS A;  2IWD A;  1ZG6 A;  3CMZ A;  2NUT C;  3HUM A;  4JGP A;  4MN6 A;  4ZJ1 A;  2XRN A;  5I5L A;  1ERQ A;  4QPR A;  2XK1 A;  5K5B A;  4HEF A;  4ZRR A;  2V1B A;  1J9M A;  5EM0 A;  5L09 A;  1YT4 A;  3KO6 A;  4ARZ A;  1XA7 A;  4A5R A;  3A0V A;  3E2L A;  5FAS A;  5A8B A;  2PT7 A;  1E3U A;  2VGL M;  2PD7 A;  3WWX A;  4L9F A;  3BRM A;  1E25 A;  3HUN A;  4HOI A;  5TFQ A;  3Q7V B;  2ZBB A;  2LB5 A;  2OOL A;  4OON A;  3MR0 A;  2A3U A;  1O07 A;  4U3T A;  4H6J B;  4ZBE A;  3BJN A;  1ONG A;  1BZA A;  3MFX A;  3OLO A;  4MMN A;  4WZ5 C;  1GSW A;  3Q81 A;  2XFS A;  4IHQ A;  1ONH A;  1IYS A;  1G6O A;  2V2F F;  4X55 A;  1FCM A;  1BT5 A;  2O9A A;  4QWO A;  2G7U A;  1L0F A;  2CMN A;  4S2M A;  1LSV A;  2I72 A;  5J4E A;  5EVL A;  1S67 L;  3O87 A;  5IU1 A;  4QB8 A;  3VP0 A;  1LHY A;  3A3D A;  4I3I A;  4IUK A;  5FQ9 A;  4X69 A;  1UWP X;  3TSG A;  3IXH A;  3A3I A;  1FR6 A;  1NLY A;  4C6Y A;  3MBZ A;  3T4S A;  3EGD C;  3W4Q A;  4KQQ A;  1MC0 A;  2VKS A;  1T19 A;  1K54 C;  3N7W A;  4EBN A;  1CQA A;  1KGF A;  3S7O A;  3WS5 A;  1OTE A;  3FPW A;  3UE1 A;  4DXB A;  1CK3 A;  1V9Z A;  4WLA A;  4BJP A;  3DTM A;  3EGX C;  1KE0 A;  3M6H A;  4MNR A;  2Y2Q A;  4OLG A;  2PR6 A;  5EEC A;  1JTG A;  1F9I A;  2ZJ9 A;  3IF6 B;  3LCE A;  5DTK A;  1YQS A;  3VSL A;  2PBY A;  1MWR A;  1TS7 A;  4OKP A;  5EVI A;  1BLH A;  3MMH A;  3CLO A;  1LL8 A;  3SS4 A;  4BLM A;  2VX8 A;  4OQH A;  4IED A;  3ZHH A;  3T1S A;  1BSG A;  4KZ6 A;  2QZ6 A;  1OJG A;  4UA9 A;  4X1L A;  2Q0O A;  1SZV A;  4M4X A;  3P98 A;  5KIZ A;  2WKR A;  4N1X A;  4PPR A;  2J9P A;  3CUE C;  4FCF A;  5GLB A;  1K54 A;  4G3K A;  3BY8 A;  4O7D A;  4X6T A;  1VM1 A;  4E3K A;  1PRQ A;  4UAA A;  5E2E A;  1IEM A;  3LIA A;  5FSR A;  1S6R A;  3SW1 A;  3UNW A;  4OOM A;  1LI9 A;  3LI9 A;  4S2N A;  5CXW A;  2VV6 A;  5CX7 A;  1HLU P;  1T1C A;  4GLQ A;  3DW0 A;  4DDY A;  5EV0 A;  4LEN A;  2UV0 E;  4EW7 A;  2XEP A;  5IS1 A;  1XFQ A;  1PYY A;  2DCF A;  2GNX A;  3LIB A;  4BBT A;  3LGO A;  1MWU A;  3FZC A;  1UGU A;  3C2W A;  3BFG A;  4WM9 A;  2XQZ A;  3LEQ A;  1VEU A;  5AVF A;  4B88 A;  1S1Y A;  1NYM A;  4MEZ A;  5KMW A;  4FOF A;  1HD8 A;  3PBQ A;  5CEC A;  4OOL A;  1PI5 A;  5KSC A;  1TD5 A;  5AQA A;  5EVE A;  1FCO A;  1XJ3 A;  1FIL A;  1S1Z A;  1K4F A;  3NIA A;  4AFI A;  4JXV A;  4PM8 A;  2VGL S;  3DAV A;  2QJ7 A;  3CUE A;  1JWZ A;  4UQI S;  3MQ0 A;  1NRJ A;  4O0P A;  5DVA A;  4BQM A;  3NHQ A;  1FOF A;  2ZMV A;  3IS2 A;  4QY6 A;  4MDZ A;  4DN0 A;  2Q9N A;  2JBF A;  2XF3 A;  3N8R A;  3H7W A;  2HGV A;  5F69 A;  2WGW A;  4FTX A;  5HD5 A;  3DTI A;  2K31 A;  3WRZ A;  4LLO B;  1DJB A;  3DWK A;  1QMF A;  2YKF A;  2VEA A;  3G31 A;  2B95 A;  5E2F A;  5TR7 A;  1S4S A;  3WS0 A;  1O7E A;  4P6Z S;  1Y54 A;  1ES3 A;  4LV3 A;  3HLW A;  1PW1 A;  3V50 A;  2EX6 A;  4D60 A;  4NET A;  4UEY A;  1ACF A;  1S66 L;  4E3I A;  1L0E A;  1ERM A;  2HDQ A;  1G68 A;  4OQ0 A;  2KOI A;  3VP1 A;  5HW3 A;  3O88 A;  1OTB A;  4L9E A;  3IX4 A;  2D01 A;  3ZG9 B;  5GHY A;  1W5D A;  5EE8 A;  2JKT M;  1I5Q A;  5TJJ A;  2FH5 A;  4MCW A;  5JYO A;  1MZU A;  4H8R A;  3HJI A;  1EWZ A;  4GN2 A;  1DRM A;  4MN5 A;  3PAG A;  3MQO A;  1YM1 A;  4Y0U A;  4CLC C;  5TBM A;  1WYC A;  4EET B;  4HHD A;  1FIK A;  1K57 C;  5M19 A;  3F1O A;  4QJG A;  1SCW A;  4P6Z M;  2M7U A;  4LV0 A;  1WE4 A;  2DMW A;  4YWZ A;  4RX2 A;  1XKZ A;  3ICY A;  2ZM0 A;  2W3D A;  3V3R A;  1OT6 A;  3IXG A;  2O0Y A;  1FSY A;  5GLC A;  5HDS A;  4I3A A;  1OTA A;  3PBS A;  3H9W A;  3C7U A;  2WAD A;  3HLD A;  1H8Y A;  5AQB A;  2ZQD A;  3G4P A;  2IWC A;  2VV7 A;  3ZG0 A;  4NEE D;  5HD3 A;  1G6A A;  2JKR I;  4HP9 A;  3C8C A;  1OT9 A;  5F6A A;  2ZQA A; 
#chains in the Genus database with same CATH homology
 1N9O A;  2D02 A;  3MF0 A;  5EFW A;  3UB8 A;  2L4R A;  4NXF A;  5G4Z A;  2M1C A;  1ZHH B;  2V0W A;  5AVE A;  3T4T A;  3C38 A;  4EER A;  2GZA A;  2A2L A;  3D72 A;  2O99 A;  5F5Y A;  1TF1 A;  5HDC A;  1DP8 A;  1WA9 A;  2HF6 A;  2J3T C;  2NUT C;  3BY9 A;  4GCZ A;  4JGP A;  4WEK A;  3KYZ A;  2HJ9 C;  1LSW A;  3F1P A;  4MN6 A;  2KLI A;  4LRX C;  2W1R A;  1YSQ A;  3S7N A;  1XJ4 A;  3KSF A;  2XRN A;  5I5L A;  5AJG A;  1JNU A;  3P01 A;  2L1M A;  4QPR A;  3NOT C;  5K5B A;  4ZRR A;  2V1B A;  3CI6 A;  2O9B A;  5DFY A;  1GSV A;  3FC7 A;  2KX6 A;  3ZYT A;  3KO6 A;  3UMD A;  4ARZ A;  4KUO A;  1S4R A;  3A0V A;  5KSH A;  3KSH A;  2PHY A;  4BBV A;  5A8B A;  2PT7 A;  2XA7 S;  2VGL M;  2PD7 A;  4L9F A;  5F68 A;  4IJG A;  1KOU A;  4GS9 A;  1W63 M;  4F3L B;  3F1N B;  3S7Q A;  4HOI A;  3D3O A;  4I5S A;  3OBF A;  3LID A;  2W1T B;  3GDI A;  2ZBB A;  1BYW A;  1G28 A;  2I9V A;  4Q0H A;  2LB5 A;  2OOL A;  3MR0 A;  4GW9 A;  3CWF A;  2Z6C A;  4H6J B;  3R7W A;  3UB7 A;  1W63 Q;  4L9G A;  3B47 A;  4EEU A;  1D7E A;  3BJN A;  3HJK A;  1YSP A;  4DMZ A;  3MFX A;  3OLO A;  4MMN A;  4WL9 A;  1P9W A;  2QYB A;  3OCN A;  2J3W A;  2L0W A;  1GSW A;  5J3W A;  4IHQ A;  3LIC A;  4L0L A;  4XT2 A;  1G6O A;  4NXB A;  4PHT A;  3TJZ C;  2O9A A;  2G7U A;  2QJ5 A;  2VJW A;  2CMN A;  1LSV A;  5J4E A;  3T50 A;  1S67 L;  3G6O A;  3E0Y A;  5TBM B;  3OC2 A;  1P97 A;  3UE6 A;  3PBO A;  5IU1 A;  2OAQ 1;  2OWJ A;  2ZMF A;  4I3I A;  4UQI M;  2XRO A;  4GJ4 A;  4IUK A;  5DKK A;  4Y5F A;  4YOF A;  5J7E A;  4PKY G;  1ODV A;  2JKR M;  1UWP X;  1NLY A;  1D06 A;  5HDD A;  2JHE A;  3NOP C;  2IA2 A;  1DP9 A;  3EGD C;  3T4S A;  5HPI A;  4MN7 A;  3PBR A;  4RQ9 A;  1MC0 A;  2VKS A;  1T19 A;  3PBT A;  3S7O A;  3T4Q A;  2A24 B;  1ZTU A;  1OTE A;  3FPW A;  4EUV A;  2HV1 A;  4K08 A;  3NJA A;  2BAS A;  2B02 A;  2EWV A;  3K2N A;  4YNR A;  1OTI A;  1V9Z A;  4WLA A;  4BJP A;  3JVU A;  2Y79 A;  2XSS A;  1VHM A;  2INW A;  3FPV A;  3EGX C;  2MJ6 A;  4GHI A;  5DJT A;  4KUK A;  3V67 A;  4CQH A;  2PR6 A;  1OTD A;  2P04 A;  1F9I A;  1LSX A;  2VZW A;  4O01 A;  3EQU A;  3P7N A;  3EQV A;  3BQ8 A;  3PXP A;  3TW8 A;  1H8M A;  2EA9 A;  1TS7 A;  4ETX A;  2J80 A;  3MMH A;  3CLO A;  1LL8 A;  3F1N A;  5HWW A;  2VX8 A;  4EQ1 A;  2JKT I;  1MKM A;  2W1T A;  1TS8 A;  4CLC D;  1DP6 A;  1OJG A;  4WF0 A;  4Y2F A;  3VE4 A;  3VE3 A;  2ZOH A;  3LR0 A;  4M4X A;  3T4O A;  1GSX A;  1F5M A;  1YAX A;  5KIZ A;  1NLZ A;  2WKR A;  4JGO A;  2W3E A;  4HJ6 A;  5L8M A;  2VV8 A;  5HWV A;  1LT0 A;  3LIF A;  3CUE C;  3TE8 A;  3S7P A;  3K3C A;  3UB6 A;  2PDR A;  4G3K A;  4WUJ A;  3BY8 A;  4XT2 B;  4R70 A;  4EXO A;  2ZOI A;  2Y8H A;  3LR3 A;  2M7V A;  4JGR A;  4Z1W A;  3LIA A;  5HPF A;  3EEH A;  4B9O A;  1T1B A;  1XFN A;  5DJU A;  2VLG A;  4I3J A;  3SW1 A;  3E4Q A;  4OOM A;  3EEA A;  3LI9 A;  2VV6 A;  5CX7 A;  1T1C A;  4GLQ A;  4EEP A;  3IS2 B;  3H82 A;  4CLC A;  2PR5 A;  4HJ4 A;  4EW7 A;  2YKH A;  3C30 A;  4Q0J A;  4HH3 A;  4ARZ B;  5IS1 A;  1XFQ A;  2GNX A;  3LIB A;  3VV4 A;  2A24 A;  4BBT A;  4HQA A;  4LRY C;  1V9Y A;  3LUQ A;  1UGU A;  3C2W A;  3H7W B;  3GEC A;  4PAU A;  2OWH A;  2W3F A;  5AVF A;  3A0S A;  3K3D A;  1S1Y A;  3LIE A;  2O9C A;  4GS9 B;  2QKP A;  4FOF A;  4LPZ A;  1TS0 A;  5HSQ A;  3PBQ A;  2W0N A;  3TRC A;  4FSF A;  4OOL A;  3EWK A;  1T1A A;  4WN5 A;  4JGQ A;  2NUP C;  3KX0 X;  2VA0 A;  3LI8 A;  2K7S A;  3KSG A;  4ETZ A;  2W27 A;  1TD5 A;  4HI4 A;  4EES A;  3IBJ A;  4DJ3 A;  1XJ3 A;  1OPX A;  1S1Z A;  2V1A A;  3EOI A;  4AFI A;  2GX5 A;  5FL3 A;  1N9N A;  1OJ5 A;  3F1O B;  2VGL S;  2JN7 A;  1IFQ A;  2QJ7 A;  3CUE A;  4E04 A;  3PBN A;  1VB6 A;  4UQI S;  3MQ0 A;  1NRJ A;  2HJE A;  3BWL A;  4O0P A;  1STZ A;  4WEL A;  3ZQ5 A;  4HJ3 A;  3NOU C;  3NHQ A;  2ZMV A;  3IS2 A;  2B18 A;  4GHI B;  4HNB A;  4R38 A;  3RH8 B;  3UB9 A;  4MDZ A;  4PKY A;  4DN0 A;  2V0U A;  3E4P A;  1T18 A;  3H7W A;  3H82 B;  2HGV A;  2QWS A;  5F69 A;  3MJQ A;  3OOV A;  3PHY A;  5HD5 A;  4BBU A;  2XA7 M;  4II7 A;  2PD8 A;  3KYQ A;  4G3W A;  3OCL A;  2K31 A;  2WKP A;  3T4J A;  4LLO B;  5IT5 A;  3R4K A;  4H6J A;  2YKF A;  2VEA A;  5DF9 A;  2LB9 A;  2EWW A;  1S4S A;  1Y28 A;  2GJ3 A;  3LR4 A;  4LRZ E;  3T4L A;  4P6Z S;  2J3T D;  3LYX A;  1F98 A;  4NKP A;  1H3Q A;  3RFB A;  1N9L A;  2Z6D A;  1EW0 A;  1TS6 A;  3KSI A;  4CLC B;  4G3V A;  4UEY A;  4BWI A;  4F3L A;  2K2N A;  1S66 L;  4R6L A;  2P7J A;  1UWN X;  1P0Z A;  5LBR A;  4HIA A;  3IBR A;  3F1P B;  2P08 A;  2KOI A;  3ULF A;  3CIT A;  3JVV A;  5G4Y A;  1OTB A;  4L9E A;  3BW6 A;  4NXG A;  2D01 A;  4R3A A;  3HCY A;  4EU0 A;  3R7W B;  2FZ0 A;  2JKT M;  5TJJ A;  3BQA A;  2PYP A;  2FH5 A;  4MCW A;  1MZU A;  4NXE A;  5DFX A;  5C5K A;  4HP4 A;  3MQQ A;  3HJI A;  4ME4 A;  1DRM A;  4CLC E;  1XJ6 A;  4MN5 A;  2H28 A;  3MQO A;  4O8G A;  3PYP A;  4CLC C;  5TBM A;  3LFV A;  2KDK A;  4EET B;  4HHD A;  4WEJ A;  1YKD A;  3PR6 A;  3DBA A;  3F1O A;  3B42 A;  3UE3 A;  4Q0I A;  1IOU A;  3VOL A;  4P6Z M;  2M7U A;  3O5Y A;  2DMW A;  2PYR A;  3B33 A;  3LR5 A;  4HH2 A;  2V9A A;  4YWZ A;  1NWZ A;  3T4K A;  1XJ2 A;  3CAX A;  3ICY A;  2W3D A;  4BMW A;  3A0R A;  3MXQ A;  1OT6 A;  2R78 A;  4KQO A;  2O0Y A;  4Y3I A;  4I38 A;  5HDS A;  4I3A A;  1OTA A;  3E4O A;  2WKQ A;  3PBS A;  3H9W A;  3RTY A;  5HWT A;  4B93 A;  2W3H A;  5MC7 A;  3FG8 A;  4IUH A;  5DKL A;  1X0O A;  3E98 A;  2OAP 1;  2QHK A;  2W3G A;  2VV7 A;  1P9R A;  4NEE D;  5HD3 A;  2JKR I;  4HP9 A;  5HZH A;  3UME A;  4DJ2 A;  3C8C A;  1OT9 A;  3W2Z A;  4KQD A;  5F6A A;  5HL6 A;  4HY8 A;  3U2A A;  4I39 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...