2H10A

Crystal structure of the m69v e166a double mutant of shv-1 b-lactamase complexed to tazobactam
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
265
structure length
265
Chain Sequence
SPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADERFPMVSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWATELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Effect of the inhibitor-resistant M69V substitution on the structures and populations of trans-enamine beta-lactamase intermediates.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Hydrolase
molecule keywords Beta-lactamase SHV-1
total genus 97
structure length 265
sequence length 265
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2006-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2h10A00
4X6TA 1ZKJA 5EVLA 3HL9A 5FAOA 4EBLA 3A3EA 1WYCA 5E2HA 3OPRA 1IKIA 3Q7ZA 4JF6A 1ZG4A 5GHXA 1PW8A 2Y2LA 3C4OA 1ERQA 5L2FA 3IWQA 1MWUA 3BYDA 2BLSA 3RXWA 3IHBA 4ZJ3A 3FZCA 2HDSA 4S2LA 2HDQA 2WZXA 1L2SA 4K0XA 5FSRA 3A3FA 1SKFA 1XGIA 1EWZA 4ZBEA 2V20A 1MPLA 2WKHA 4KZ4A 3SOIA 2Y2OA 2DCFA 3VMAA 2A3UA 1G68A 4GKUA 4GOGA 3DW0A 1DJCA 2XK1A 3WS0A 3ITAA 3HLDA 2X71A 4U0TA 4L0LA 4KZ6A 1L0DA 4C75A 4PM5A 2ZC4B 3I7JA 2V1ZA 3B3XA 4P6BA 4UAAA 4WM9A 5M19A 5EVIB 2QPNA 4KG6A 5FASA 3C4PA 4GB7A 2ZJ9A 1LI0A 4H8RA 5AQBA 1LL9A 4E3KA 1K4FA 5DTSA 1QMFA 4JXSA 5KSHA 3O88A 1ZG6A 3HVFA 4KQOA 5DVAA 4D2OA 1K38A 4B88A 1J9MA 2ZQ7A 4FH4A 3ZG9B 5A92A 1XX2A 3HREA 4HESA 4R3BA 1XXMA 3HUOA 5CHJA 5A93A 1H8ZA 3MKFA 3UE0A 2Y2QA 3WS5A 4A5RA 3ZCZA 1BTLA 4E3OA 1KGFA 5HAIA 4DE3A 1E3UA 4WZ5A 4K0WA 4LCMA 3HLEA 3FKVA 2IWCA 4QU3A 3S4XA 3WS2A 4WMCA 4P87A 3LO7A 5EVIC 3MBZA 5CGSA 3IF6A 5FA7A 2ZM0A 4RX3A 2ZQ9A 3IQAA 4XUZA 3BRMA 4Y0OA 3UY6A 1W8QA 4OP8A 3DWKA 4R4SA 3Q81A 4GD8A 2Q9MA 3MZFA 1K6SA 1LLBA 1N9BA 1YLPA 3ZG7B 4HEFA 3NI9A 4BD1A 4C6YA 1RGYA 3CG5A 4P0MA 4S2IA 4JF5A 5BOHA 2XR0A 4KG2A 5FQMA 5A90A 3GQZA 4OPQA 5HAPA 4PM9A 4XXRA 2Y2NA 5FAQA 4B4ZA 4BL2A 3GSGA 4CJNA 1JWPA 3RXXA 1FR6A 3UPPA 1FQGA 3V3SA 4ZTKA 1PWCA 3NDEA 1PZOA 4Y0UA 5I94A 2EX9A 1FCMA 1K54A 3PBQA 2WGWA 1ONHA 1GCEA 2QZ6A 4N1HA 4X53A 4KZ9A 1M6KA 4WELA 3LY3A 3UPOA 1PW1A 1U60A 1TDLA 1ERMA 2H0YA 4E6XA 1NZUA 4RA7A 1NYYA 3N6IA 1PZPA 1ZC2A 2JC7A 2J7VA 1IYPA 3C7UA 3WRTA 3VP4A 4DDSA 4B4XA 2R9XA 4HBUA 1XPBA 1YT4A 4QHCA 5FI2A 1I2WA 4EWFA 4OOYA 2P9VB 3HLFA 1MWTA 4S2MA 4X68A 3BM6A 2OLVA 1C3BA 4OPYA 5GHYA 5IHVA 5U47A 1HD8A 3LCEA 1K57A 3MKEA 3Q07A 2WYXA 4OP5A 5FQ9A 3WS4A 4O7DA 3V5MA 4QY5A 2HDUA 3A3JA 1NRFA 2XGNA 4IVKA 2XD1A 3IXBA 2ZLYA 2WKIA 3IF6B 1ES4A 4Z9QA 4KG5A 1ES2A 4PM6A 2ZM2A 2OLUA 4FH2A 2XH9A 5FI6A 4JXVA 5AQAA 1RGZA 5CERA 5HW3A 3WS1A 2ZM8A 1K54C 1TDGA 1SDNA 3GTCA 3PBTA 4N92A 3VP0A 1LL5A 3N8SA 3HLBA 4BENA 3IHAA 3PBOA 2RL3A 2C6WB 1M40A 3Q7VA 1LI9A 4WYYA 3A3IA 1K56A 3FWLA 3OC2A 1MWRA 1DJBA 3IH9A 1YLZA 3UDIA 3ZDJA 3MZEA 2Y55A 4IBXA 2ZC5B 1EI5A 4HBTA 5AQ7A 5DF9A 1KGGA 2CC1A 3MXRA 5JYOA 3HLWA 1L0GA 1KDWA 1DJAA 4LENA 4JPMA 2ZC6B 4MEZA 1GHPA 3VFFA 2G2WA 1CI8A 3ZG5A 3Q1FA 4X56A 4E3MA 1XP4A 1W79A 1JWZA 5EECA 5TFQA 1OMEA 4S2NA 3DTMA 2P9VA 5CXWA 3ZVWA 1H8YA 5GLBA 1S0WA 3OCNA 5EPHA 3W4OA 4RX2A 2JCHA 4R3JA 4RVAA 3EQVA 3HLCA 4GZBA 5EUAA 5GLAA 3HUMA 3UPNA 1CEFA 5DF8A 1YLWA 3CJMA 1VM1A 4QD4A 4FSFA 3W4PA 1W7FA 1S6RA 1K56D 1K4EA 4P85A 5CTNA 1SDEA 4OQ0A 4DKIA 4OPZA 4ZJ2A 3W4QA 4OH0A 1RP5A 1ONGA 2R9WA 3ITBA 3Q7VB 2PBYA 2JE5A 1DY6A 4XUXA 4EQIA 5J8XA 4OQHA 3UE1A 1IEMA 2HP9A 3S22A 3G2YA 3E2LA 5CEBA 1JWVA 1XGJA 3QNCA 5HARA 4PM7A 5E43A 2Y91A 1MKIA 2Y2JA 2V2FF 3VFHA 3DWZA 3VP2A 5CRFA 1BLPA 1NXYA 5AQ9A 4OQGA 2ZQDA 2C5WB 3BFFA 3VSKA 3C5AA 3M6BA 3NIAA 1XKZA 4E3IA 3OCLA 1PI4A 4OKPA 3PTEA 1SHVA 5FDHA 3VOZA 4DE1A 3CMZA 3P09A 4S2OA 4RYEA 5FQIA 4KZ8A 3AGEA 4JF4A 4E6WA 4OOLA 1QMEA 3UDXA 2WGVA 2XFSA 3BLSA 2J9PA 4U3TA 2P74A 1YM1A 2G2UA 1KE4A 2EX8A 3BECA 5E2EA 2VGKA 4DE0A 1BSGA 5CECA 3ZFZA 1Q2PA 5GHZA 1KVLA 3PAGA 4NETA 2HP6A 5GLCA 3UDFA 5FAPA 3C7VA 1ESIA 4UA7A 1PYYA 2B5RA 5FQQA 3O3VA 2Y2PA 2E8IA 3BEBA 4LV2A 3M2JA 4IVIA 3TOIA 3HUNA 3TG9A 1GHMA 1K25A 2WKEA 1E3UD 2XDMA 3FYZA 4PMAA 1FOFA 3ISGA 1YLJA 1YLYA 5E2GA 4WEKA 4BJPA 2EX6A 1G6AA 1ES3A 3LY4A 1K55C 1W8YA 1NY0A 4Y0TA 2J9OA 3MZDA 5G18A 3NY4A 3IXGA 1FSYA 3D4FA 1BZAA 4E3LA 1K55A 5KSCA 1E4DA 3Q82A 2Z2MB 1IELA 2XEPA 1EROA 2J8YA 4MBFA 4N9LA 5A91A 3SS3A 2HP5A 1ESUA 3PAEA 2X01A 4KZ5A 4GNUA 4DF6A 3E2KA 3UE3A 3ZNTA 4Y7PA 4R0QA 1JTGA 5DTKA 4WZ4A 1IKGA 3G35A 2ZC7A 1I5QA 3NBLA 3P98A 2H5SA 1TVFA 2BG1A 3AGDA 2ZQAA 1NYMA 3ZG0A 4M3KA 4E3NA 2WAFA 2IWDA 3SH7A 1PIOA 2QMIA 1PWGA 2GDNA 3AGFA 3IF6C 4PM8A 4E3JA 4JKTA 3OZHA 3N8LA 4GDNA 4KZ3A 5FATA 2EFXA 5FQKA 3FV7A 3W8KA 2ZQ8A 1W5DA 4EUZA 1E25A 3BFEA 4F94A 1SCWA 4QJGA 5DF7A 5EOOA 4S2PA 2IWBA 3BLMA 4R1GA 2HDRA 2Y59A 1LHYA 2PU4A 1IYOA 1NZOA 2Y2HA 3G34A 1CEGA 1VQQA 3PBRA 4OOMA 3V3RA 4K91A 1MXOA 5F1GA 4NK3A 2H0TA 4JLFA 1BT5A 1KGEA 4JXGA 5DTTA 4BQMA 4R4RA 3WWXA 4KZ7A 4YINA 4BL3A 1MBLA 2H10A 1PI5A 4KZBA 3ZHHA 1HVBA 1FCOA 5HL1A 4UHUA 3SH9A 5HFOA 4LV3A 2HPBA 4YFMA 5EOEA 4JBFA 2DRWA 3IXDA 4ID4A 3UNWA 2I72A 2XFTA 4UA6A 3GMWA 4FD8A 1MWSA 3GRJA 4GDBA 1WYBA 2FFFB 4S2NC 1NJ4A 2OSUA 4PPRA 3V39A 4UA9A 1YMXA 3V50A 3NDGA 1KVMA 3FKWA 4IBRA 5GL9A 4EBNA 2OV5A 1IYQA 3BFCA 3RJUA 5M18A 3VP1A 2DNSA 4IEDA 5TGFA 3ZNYA 5JYPA 3MFDA 3SS4A 3UN7A 3PBSA 3JYIA 3UO9A 2FFYA 5FQJA 1K6RA 4BLMA 2EXBA 4DDYA 4MBHA 5CGXA 3HBRA 3LEZA 3OPLA 4U0XA 4X55A 4ZDXA 4LCLA 4Q8IA 1WE4A 3M2KA 4R23A 4OLDA 4C3QA 4FCFA 5HAQA 3ZG8B 1GA9A 2ZD8A 1ALQA 4KENB 4MNRA 1KE0A 3G32A 3IT9A 4BD0A 5EE8A 3PBNA 4ZAMA 1JVJA 2EFUA 3BFGA 4MBKA 2ZMAA 4KQRA 3IWOA 1H5XA 3NC8A 2WGIA 2X02A 1XA7A 1YQSA 1BLCA 1HZOA 5CTMA 3QHYA 5HX9A 1YLTA 1KE3A 1MY8A 2XF3A 3IWIA 3OPPA 2ZC3B 2JBFA 3GVBA 1K57C 3QNBA 4JXWA 4KQQA 4LV0A 3GR2A 3HLGA 3VP3A 4S2JA 4QB8A 5CGWA 3BFDA 5TR7A 2EXAA 3IF5A 4X69A 1O7EA 3N8RA 3A3DA 1PWDA 3S1YA 5KZHA 3O86A 1FR1A 3OPHA 1GA0A 4OLGA 3EQUA 1KDSA 4ZJ1A 2Y4AA 2XD5A 2A49A 4OVDA 5E2FA 1CK3A 5F83A 5FI7A 1JTDA 4S2KA 5F1FA 1L0FA 2WAEA 2RCXA 4QY6A 4DE2A 3SS5A 3VSLA 1FCNA 4LV1A 2PU2A 4MLLA 3G4PA 1O07A 1BULA 1BUEA 3G30A 2VGJA 1AXBA 2Y2KA 1ES5A 1Z6FA 2XQZA 4EBPA 2Y2IA 2ZQCA 4WEJA 4OQIA 3MXSA 3IH8A 3ZGAB 2WK0A 1Y54A 1I2SA 4GD6A 2WADA 4WMCD 1BLHA 3NCKA 4N9KA 2Y2MA 1FSWA 2XLNA 2UWXA 4OONA 4DRTA 4EV4A 5GLDA 2EX2A 3N7WA 5CHMA 4OPRA 5EVID 3O87A 1CI9A 3TSGA 5CEDA 2WGWB 2Y2GA 1XA1A 1Q2QA 2Q9NA 3VOYA 5KMWA 3IXHA 5F82A 3SH8A 1HTZA 1RCJA 1N4OA 1YMSA 2Z2LB 3GV9A 1GHIA 5D3OA 4GN2A 4N1XA 4KZAA 3M6HA 5EVIA 5M1AA 1L0EA 2WZZA 3N4IA 1IYSA 3G2ZA 5CHUA 3ZVTA 4DXCA 4DXBA 3WRZA 4WBGA 3G31A 4WZ5C 4CPKA 1TEMA 2WUQA 1BLSA 3CZDA
chains in the Genus database with same CATH superfamily
4X6TA 1ZKJA 3HL9A 4ZRRA 4HOIA 5E2HA 2PDRA 3A0VA 1MWUA 1TS0A 3IHBA 3ULFA 4ZJ3A 3FZCA 2HDSA 2WZXA 2LB5A 1XGIA 4ZBEA 4GCZA 2V20A 4JGQA 1F98A 2Y2OA 4GKUA 4Y5FA 4KZ6A 1MZUA 4ARZA 2ZC4B 4WM9A 2V1ZA 3P7NA 2QPNA 3E4PA 3C4PA 4GB7A 2KX6A 1LI0A 4H8RA 1K0KA 1QMFA 4JXSA 1ZG6A 4D2OA 4KQOA 2QYBA 4B88A 2ZQ7A 3ZG9B 5A92A 1XX2A 1XXMA 5CHJA 3C2WA 2Y2QA 4A5RA 4L9FA 3NHQA 4DE3A 3SZTA 2A2LA 2IWCA 3IQAA 5CX7A 5EV0A 1W8QA 4R4SA 3LR5A 1N9BA 3CG5A 4S2IA 4JF5A 4MDZA 2VX8A 5A90A 3GQZA 5FAQA 4BL2A 4CJNA 3UPPA 3V3SA 1PZOA 3PBQA 1ONHA 2QZ6A 2HJ9C 4H6JB 1TDLA 1ERMA 2H0YA 2Z6DA 3HJIA 4RA7A 1NYYA 3N6IA 1IYPA 2R9XA 5FI2A 4OOYA 2OLVA 3LCEA 3T1QB 4QY5A 2XD1A 5EFWA 5FI6A 3WS1A 3NJAA 3PBTA 1K54C 4Q0JA 3W2ZA 2GNXA 4Y3IA 1K56A 2AVXA 3FWLA 3IH9A 1KGGA 3LIFA 2PRFA 4LENA 2ZL1A 4O0PA 1D7EA 1GHPA 5HPIA 1CI8A 4QPRA 5TFQA 4PAUA 4GHIB 5CXWA 1S0WA 3OCNA 4DN0A 3W4OA 2JKRM 4RX2A 2EWVA 2PHYA 2V0UA 3UPNA 4WUJA 3CJMA 1VM1A 1UWNX 5AJGA 1K56D 1K4EA 4BMWA 1SDEA 4OQ0A 1NLYA 4GW9A 2R9WA 3ITBA 4G3KA 1T1AA 3MQ0A 1OT6A 3ZYTA 5E43A 1MKIA 3H7WA 3LICA 5AQ9A 1S1YA 1SKOB 3BFFA 3NIAA 5FDHA 1SHVA 3CMZA 4RYEA 5FQIA 3AGEA 2WGVA 2XFSA 3BECA 4DE0A 5CECA 4I3AA 5GHZA 1KVLA 2W27A 5HPFA 5GLCA 5TJJA 2A24A 3UDFA 1PYYA 4ETZA 5FQQA 3O3VA 2E8IA 4I3IA 5L8MA 4IVIA 4WEKA 2EX6A 1ES3A 2VGLM 3IXGA 4E3LA 1K55A 3LR0A 1E4DA 1N9NA 4MBFA 4GNUA 3F1NB 3E2KA 2P08A 2XROA 3UB8A 2W3HA 1IKGA 2HJEA 4CQHA 3NBLA 3AGDA 2PBDP 4M3KA 4E3NA 4Y17A 3SH7A 1PIOA 2QMIA 3AGFA 4HP4A 3NOTC 3OZHA 4JKTA 4KZ3A 5FQKA 2IA2A 3W8KA 3T4TA 3KYQA 2V1AA 5EOOA 5DKKA 4EW7A 1OPXA 1T1BA 1MXOA 3KYZA 1KGEA 4JXGA 2JKFA 4BQMA 3WWXA 3F1NA 2PYPA 4NG2A 5HFOA 1FILA 3IXDA 3S7OA 3GRJA 2VKSA 3KSHA 5J7EA 1NJ4A 2OSUA 1XJ6A 1YMXA 1KVMA 4IBRA 3LIAA 3BFCA 3VP1A 2KOIA 3LYXA 3ZNYA 4K08A 2W3FA 3UN7A 3UO9A 4YNRA 2W1TA 3F1OB 3FG8A 4HI4A 4U0XA 4Q8IA 1WE4A 5HAQA 4JGOA 3UB9A 1GA9A 2ZD8A 1KE0A 4ZAMA 4KQRA 1H5XA 3VV4A 1XA7A 1YQSA 2FZ0A 5C5KA 3U2AA 1SZVA 2ACGA 3QP4A 2B18A 2JBFA 3QNBA 1BYWA 3HLGA 3VP3A 2OAQ1 3O86A 3OPHA 1GA0A 4OLGA 2W1TB 3F1OA 2JN7A 2XD5A 4OVDA 1CK3A 4NXFA 1JTDA 4S2KA 5F1FA 3SS5A 4CLCC 4LV1A 3G4PA 1AWIA 3G30A 1L3LA 1ES5A 3T1RA 1LSVA 3SW1A 4EBPA 3LIDA 4Q0HA 4WEJA 3QP8A 3RTYA 1Y54A 1I2SA 2WADA 1BLHA 1FSWA 3H82B 4LLOB 5F68A 3HCYA 3O87A 4I38A 3TSGA 5DFYA 3VOYA 3IXHA 4O01A 5F82A 1YMSA 3O5YA 1N4OA 4GN2A 4KZAA 1YPRA 3M6HA 5G4ZA 1L0EA 3RFBA 4X1MA 4CPKA 3CZDA 4MMNA 5EVLA 5FAOA 1OTEA 1IKIA 4JF6A 4O8GA 1ZG4A 5GHXA 1PW8A 3E4OA 3IWQA 3BYDA 2M7VA 2V9AA 3LIBA 5A8BA 5DJUA 3A3FA 1SKFA 1EWZA 4RQ9A 1PNEA 3OOVA 3SOIA 4GOGA 2XK1A 3ITAA 4U0TA 1OTDA 3B3XA 4P6BA 4KG6A 5FASA 2ZJ9A 1DP8A 4HIAA 1LL9A 4E3KA 1K4FA 2PD7A 3TE8A 3CHWP 3HVFA 5DVAA 3LEQA 3UB7A 4I3JA 3PHYA 1BTLA 5HL6A 2GX5A 4K0WA 3FKVA 3LUQA 3WS2A 3A0SA 4WMCA 5FDSA 4PKYG 3IF6A 5FA7A 4XUZA 3BRMA 4Y0OA 4OP8A 3DWKA 2E8JA 1LLBA 4C6YA 1RGYA 5BOHA 2R78A 2XR0A 5HAPA 2O9AA 2PR5A 2VV6A 4PM9A 4EEPA 1YSPA 3RXXA 1FR6A 1K54A 4CLCA 4WELA 3LY3A 5MC7A 1PW1A 3T4OA 4E6XA 1NZUA 2XSSA 2J7VA 3VP4A 5HD5A 4B4XA 4HBUA 1XPBA 3R7WA 4EWFA 4X68A 4OPYA 1C3BA 5GHYA 5U47A 3WS4A 2WYXA 4O7DA 4MN6A 2HDUA 1NRFA 4HNBA 3PYPA 1ES2A 2ZM2A 2OLUA 2XH9A 5AQAA 1RGZA 5CERA 2ZM8A 3VP0A 3GTCA 3CLOA 3IHAA 2C6WB 1M40A 2J3WA 3E4QA 3Q7VA 1LI9A 1YLZA 3UDIA 3MZEA 4HBTA 5DF9A 4KUOA 3T1XA 4JPMA 3UB6A 3R4KA 2G2WA 1H3QA 4X56A 2G7UA 3S7QA 5LBRA 1OMEA 2P9VA 1IOUA 5EPHA 2XA7M 1TD5A 2V8CA 3HLCA 3HUMA 5DF8A 1YLWA 4LPZA 4QD4A 4FSFA 1W7FA 1S6RA 5CTNA 4II7A 3W4QA 4OH0A 4HHDA 3Q7VB 2PBYA 4NXGA 1DY6A 4HY8A 4PKYA 3S22A 1XGJA 5FL3A 4PM7A 1P97A 3VOLA 3DWZA 2NUTC 1NXYA 4OQGA 2C5WB 3S7PA 3C5AA 3M6BA 4OKPA 3PTEA 1Y28A 4GJ4A 3P09A 4S2OA 3JPUA 3R7WB 1SKOA 1QMEA 2J9PA 2P74A 2EX8A 4NXBA 1BSGA 3ZFZA 1TS8A 1P9WA 1FIKA 3OLOA 3PAGA 3LR4A 3NOPC 1H0MA 4HP9A 1WA9A 4UA7A 2O9BA 2L0WA 4NXEA 3M2JA 1GSWA 1OJGA 1GHMA 1E3UD 2ZOHA 1FOFA 3NECA 4MCWA 4BJPA 1X0OA 1G6AA 4DJ3A 2W1RA 1FSYA 3MQOA 1IELA 4F3LA 3IBJA 3UE3A 4Y7PA 4R0QA 3TJZC 4EXOA 1JTGA 4WZ4A 2O99A 1XJ3A 2BTFP 3QP1A 4DMZA 2WAFA 3P01A 4PM8A 3IF6C 5EM1A 3FV7A 3C8CA 2V1BA 1E25A 3BFEA 4GLQA 5DF7A 4KQDA 1NZOA 2Y2HA 3PBRA 1VQQA 3IX3A 4OOMA 3MQQA 4JLFA 3CWFA 3MXQA 4R4RA 4KZ7A 1MBLA 5HWWA 3ZHHA 4KZBA 1HVBA 3SH9A 4ME4A 4LV3A 3EOIA 1YAXA 4JBFA 2DRWA 1VEUA 3UNWA 4UA6A 1WYBA 4S2NC 5EM0A 4WLAA 3RH8B 3V39A 2Y8HA 4EBNA 2OV5A 4HH2A 4LRZE 4IEDA 2FH5A 5JYPA 3SS4A 3PBSA 4M4XA 3KSIA 2W3GA 4MBHA 3LEZA 4L9GA 1ZHHB 3EGXC 4ZDXA 4LCLA 4WN5A 3M2KA 4R23A 3BY8A 2JKTI 1PRQA 4BD0A 3G32A 3MS6A 5EE8A 3PBNA 2ZMAA 2UV0E 3IWOA 4EEUA 2X02A 1HZOA 1V9ZA 5CTMA 1YLTA 3HJKA 1S66L 4GHIA 4QB8A 3BFDA 4MN7A 1O7EA 2QKPA 3S1YA 5KZHA 4ZJ1A 2Y4AA 2A49A 1CQAA 4QY6A 2RCXA 4DE2A 2V0WA 3VSLA 1W63M 4P6ZS 1O07A 4PHTA 4EERA 1Z6FA 5HWVA 3TRCA 2ZQCA 4OQIA 3ZGAB 4GD6A 5L07A 1S4RA 4P6ZM 4OONA 3K3CA 4DRTA 5GLDA 5CHMA 1CI9A 5CEDA 2Y2GA 1Q2QA 2Q9NA 3T4SA 3SH8A 2Z2LB 3H7WB 5D3OA 1D1JA 2QWSA 5M1AA 2WZZA 2W3DA 1IYSA 3G2ZA 3G31A 2I9VA 2WUQA 3ICYA 4EBLA 2Z6CA 3H9WA 3Q7ZA 4I5SA 2Y2LA 2XRNA 4XT2B 2BLSA 3RXWA 1T18A 1L2SA 4EETB 4K0XA 4LGWA 5FSRA 4EQ1A 3EWKA 4R38A 1G5UA 3VMAA 2A3UA 3WS0A 2X71A 5FEFA 4L0LA 1L0DA 4PM5A 4UAAA 1LT0A 2VGLS 4H6JA 3O88A 3FPVA 2VLGA 1K38A 5A93A 4R3BA 3HUOA 3GECA 3MKFA 4Y13A 3WS5A 1J3WA 5HWTA 4Y15A 1KGFA 5HAIA 4IUHA 1E3UA 1S4SA 2MJ6A 5EVIC 5CGSA 3T4KA 5DKLA 1GSXA 1JNUA 2WKQA 4GD8A 2Q9MA 3MZFA 4Y2FA 1K6SA 4B9OA 4HEFA 3NI9A 4QWOA 4LFUA 4KG2A 5FQMA 4XXRA 1VETA 3GSGA 1JWPA 3U4LP 4ZTKA 2Q0OA 3LR3A 2OWHA 2WGWA 1GCEA 1OT9A 1M6KA 3UPOA 1U60A 1XJ4A 1PZPA 3C7UA 5TBMA 4IHQA 4DDSA 4QHCA 3GDIA 1I2WA 1MWTA 3BM6A 2PYRA 1T19A 1HD8A 3MKEA 1K57A 5FQ9A 3V5MA 3A3JA 4IVKA 3IXBA 4KG5A 1DP6A 4PM6A 4FH2A 2VV8A 3N8SA 4BENA 2RL3A 3IX8A 1IFQA 4L9EA 3OC2A 1MWRA 4HJ6A 3ZDJA 2Y55A 4ARZB 3UE6A 2HV1A 3MMHA 3VE3A 2ZC5B 1EI5A 5AQ7A 3MXRA 5JYOA 3E98A 5K5BA 4CLCD 4I39A 5G4YA 3VFFA 1KOUA 3ZG5A 3Q1FA 4IUKA 3IS2A 1XFQA 4R3JA 1NLZA 1F2KA 3EQVA 5GLAA 4P85A 4DKIA 4OPZA 4ZJ2A 2NUPC 3DTIA 1ONGA 3LI8A 5J8XA 4OQHA 3UE1A 2P7JA 2ZL1B 3UMEA 1IEMA 2HP9A 4G3WA 3E2LA 3MFXA 5EVEA 3QNCA 3C30A 4B93A 2Y2JA 3VFHA 5IT5A 3FC7A 3LI9A 1CF0A 4E3IA 3OCLA 1PI4A 1OTIA 2ZBBA 3VOZA 4DE1A 4JF4A 4E6WA 4OOLA 1YKDA 3UDXA 5TBMB 3BLSA 2HGVA 4U3TA 5E2EA 2VGKA 1Q2PA 1PFLA 2HP6A 2OAP1 5FAPA 2L4RA 1ESIA 3C7VA 3T12B 3BEBA 3JVUA 3TOIA 4D60A 3TG9A 2WKEA 2XDMA 3FYZA 3ISGA 1YLYA 4JGPA 3LY4A 1K55C 1W8YA 2J9OA 3MZDA 2CMNA 1BZAA 2XEPA 2J8YA 5A91A 2HP5A 4JGRA 4KZ5A 5I5LA 3IBRA 3G35A 2ZC7A 1I5QA 2H5SA 1TVFA 2BG1A 2ZQAA 5KIZA 2LB9A 1NYMA 1PWGA 2GDNA 3N8LA 4GDNA 5FATA 3LIEA 4KUKA 1W5DA 1SCWA 4QJGA 4S2PA 2J80A 1V9YA 3BLMA 4R1GA 1LHYA 2PU4A 3G34A 1CEGA 3T4LA 1TS6A 5DTTA 2INWA 3C38A 4CLCB 4YINA 2K31A 2H10A 1PI5A 1FCOA 4YFMA 2XFTA 3CI6A 3GMWA 4FD8A 4GDBA 2FFFB 4UA9A 3NDGA 3FKWA 3RJUA 5TGFA 4EU0A 3EEAA 1K6RA 2JKTM 4ETXA 5CGXA 3HBRA 2HZ5A 3FPWA 4OLDA 1STZA 2WKPA 4FCFA 2Y79A 3ZG8B 1ALQA 4KENB 2EWWA 4Z1WA 1JVJA 3BFGA 1W63Q 3EGDC 1F5MA 2PR6A 2WGIA 1BLCA 3H82A 2BASA 3QHYA 2YKHA 5HX9A 4X25A 1MY8A 4HQAA 3IWIA 2ZC3B 4JXWA 3JVVA 1K57C 4KQQA 4LV0A 3GR2A 4S2JA 2JKGA 2EXAA 4X69A 3NULA 4CLCE 3LGOA 1PWDA 1FR1A 3EQUA 1KDSA 5J3WA 1H8MA 5E2FA 5F83A 5FI7A 1L0FA 2PU2A 3PXPA 1BUEA 1AXBA 2XQZA 2Y2IA 2H28A 2JKRI 3IH8A 2WK0A 4WMCD 3NCKA 4N9KA 2Y2MA 4LRYC 2XLNA 2UWXA 1MC0A 2EX2A 3N7WA 1LL8A 4HJ4A 4UQIS 3KX0X 1XA1A 5KMWA 3T4JA 3GV9A 1UGUA 2VK3A 3N4IA 3BW6A 5CHUA 3KSGA 4BBTA 4DXCA 4DXBA 3WRZA 2WKRA 4WZ5C 1TEMA 1BLSA 1P0ZA 5CEBA 1TS7A 5DFXA 4DJ2A 3A3EA 1WYCA 3OPRA 3C4OA 1ERQA 5L2FA 1Z09A 1YSQA 1ACFA 4S2LA 2HDQA 4EUVA 3KSFA 2OOLA 5L09A 1MPLA 2WKHA 4KZ4A 2DCFA 3QP5A 2OWJA 1G68A 3DW0A 1DJCA 4NKPA 3HLDA 2GJ3A 2PD8A 4C75A 3L9KA 3I7JA 5M19A 5EVIB 1OJ5A 5AQBA 3IS2B 5DTSA 5KSHA 1EW0A 1N9LA 1J9MA 4FH4A 3HREA 4HESA 3CAXA 1H8ZA 4F3LB 3UE0A 4AFIA 4LRXC 5J4EA 3ZCZA 1A0KA 5IU1A 4E3OA 1ZTUA 4WZ5A 4LCMA 3HLEA 4QU3A 3S4XA 4P87A 3LO7A 2QJ7A 3MBZA 1DRMA 2ZM0A 4RX3A 2ZQ9A 2K2NA 2YKFA 3OBFA 3UY6A 1GSVA 2M1CA 3Q81A 1YLPA 3ZG7B 1TF1A 3K2NA 4BD1A 4P0MA 3D72A 3CUEC 4Q0IA 4OPQA 1UWPX 2Y2NA 4B4ZA 1FQGA 3L7HA 5L10A 1PWCA 3NDEA 4Y0UA 5I94A 1FCMA 2EX9A 4X53A 4N1HA 4KZ9A 5F6AA 3KYEA 3MR0A 1ZC2A 2JC7A 3WRTA 2JHEA 1YT4A 2QJ5A 3T4QA 5F69A 1Y4OA 2P9VB 3HLFA 4ESPA 3KO6A 4S2MA 5IHVA 4OP5A 3Q07A 3T50A 2XGNA 2ZLYA 2WKIA 3IF6B 1ES4A 4Z9QA 2V8FA 2KDKA 3DBAA 4JXVA 5HW3A 2O9CA 3DTKA 1TDGA 1F9IA 1SDNA 3MSHA 4N92A 1LL5A 4UEYA 3HLBA 3PBOA 1CJFA 3BY9A 2EA9A 4WYYA 3A3IA 5AVEA 3TW8A 1NWZA 1DJBA 4IBXA 2K7SA 2CC1A 3HLWA 1L0GA 1KDWA 1DJAA 3T1SA 2ZC6B 4MEZA 1OTAA 5HDSA 2ZOIA 1S67L 3A0RA 4E3MA 4XT2A 1XP4A 2ZMVA 1W79A 1JWZA 5EECA 4S2NA 3DTMA 4R6LA 3ZVWA 3CPTA 1H8YA 5GLBA 2JCHA 4RVAA 4GZBA 5EUAA 2W3EA 3BWLA 3CITA 4R3AA 1CEFA 3MJQA 4HJ3A 3BJNA 3W4PA 3MF0A 2A24B 4GS9B 1RP5A 1S1ZA 2KLIA 2JE5A 4XUXA 4EQIA 1D06A 4IJGA 4HH3A 3ZQ5A 3G2YA 1VETB 1JWVA 5HARA 4R70A 2Y91A 4EESA 3D3OA 2V2FF 3VP2A 5HZHA 5CRFA 1BLPA 2ZQDA 1P9RA 3VSKA 1XKZA 2P04A 4KZ8A 4MN5A 3UB5P 2VZWA 1YM1A 2G2UA 1KE4A 3BQAA 3B42A 4NETA 2ZMFA 1VHMA 2J3TC 2PT7A 2B5RA 2Y2PA 1NRJA 2M7UA 3F1PB 4LV2A 1MKMA 3VE4A 3HUNA 1K25A 4PMAA 1YLJA 5E2GA 1DP9A 5AVFA 3F1PA 2VV7A 4Y0TA 1NY0A 5G18A 3NY4A 3D4FA 5KSCA 5F5YA 3Q82A 2XA7S 2Z2MB 1EROA 2VEAA 4N9LA 3SS3A 3PR6A 1ESUA 3PAEA 2X01A 4DF6A 3ZNTA 3CPTB 3CUEA 3QP6A 5DTKA 4FTXA 3P98A 4BWIA 3ZG0A 2IWDA 3LFVA 3G6OA 3B33A 4E3JA 2EFXA 3B47A 3V67A 4BBVA 2O0YA 1OTBA 4WF0A 2ZQ8A 4UQIM 4EUZA 3UMDA 4F94A 5HDCA 2IWBA 5HSQA 2W0NA 2HDRA 2Y59A 3S7NA 1IYOA 3V3RA 4K91A 5F1GA 4NK3A 2H0TA 2DMWA 1BT5A 1G6OA 1VEUB 3EEHA 4BL3A 1ODVA 5HL1A 4UHUA 2HPBA 5EOEA 4ID4A 2I72A 2J3TD 1MWSA 3QP2A 4X1LA 4PPRA 3V50A 2VJWA 2D02A 5GL9A 1T1CA 2B95A 1IYQA 5FEGA 5M18A 2DNSA 3MFDA 1LSWA 3JYIA 4YOFA 2FFYA 5FQJA 4BLMA 2EXBA 4FOFA 4DDYA 3OPLA 4X55A 2L1MA 4C3QA 4MNRA 3IT9A 4BBUA 2EFUA 4MBKA 3NC8A 2GZAA 5DJTA 1HLUP 2D01A 4NEED 1KE3A 2XF3A 3K3DA 3OPPA 4E04A 3GVBA 5HDDA 5TR7A 1G28A 5CGWA 3IF5A 4WL9A 3N8RA 4YWZA 3A3DA 1VB6A 5IS1A 3DAVA 4FUWA 2QHKA 3E0YA 1XFNA 2WAEA 1FCNA 4MLLA 1BULA 1XJ2A 2VGJA 2Y2KA 2VA0A 4G3VA 4GS9A 1N9OA 5HD3A 3MXSA 3DTEA 4EV4A 5EVID 4OPRA 2HF6A 2WGWB 3NOUC 1HTZA 1RCJA 1LSXA 1GHIA 4N1XA 5EVIA 3ZVTA 4WBGA 3IX4A 3BQ8A 2PAVP 2B02A 3D9YA
chains in the Genus database with same CATH topology
4X6TA 1ZKJA 5EVLA 3HL9A 5FAOA 4EBLA 3A3EA 1WYCA 5E2HA 3OPRA 1IKIA 3Q7ZA 4JF6A 1ZG4A 5GHXA 1PW8A 2Y2LA 3C4OA 1ERQA 5L2FA 3IWQA 1MWUA 3BYDA 2BLSA 3RXWA 3IHBA 4ZJ3A 3FZCA 2HDSA 4S2LA 2HDQA 2WZXA 1L2SA 4K0XA 5FSRA 3A3FA 1SKFA 1XGIA 1EWZA 4ZBEA 2V20A 1MPLA 2WKHA 4KZ4A 3SOIA 2Y2OA 2DCFA 3VMAA 2A3UA 1G68A 4GKUA 4GOGA 3DW0A 1DJCA 2XK1A 3WS0A 3ITAA 3HLDA 2X71A 4U0TA 4L0LA 4KZ6A 1L0DA 4C75A 4PM5A 2ZC4B 3I7JA 2V1ZA 3B3XA 4P6BA 4UAAA 4WM9A 5M19A 5EVIB 2QPNA 4KG6A 5FASA 3C4PA 4GB7A 2ZJ9A 1LI0A 4H8RA 5AQBA 1LL9A 4E3KA 1K4FA 5DTSA 1QMFA 4JXSA 5KSHA 3O88A 1ZG6A 3HVFA 4KQOA 5DVAA 4D2OA 1K38A 4B88A 1J9MA 2ZQ7A 4FH4A 3ZG9B 5A92A 1XX2A 3HREA 4HESA 4R3BA 1XXMA 3HUOA 5CHJA 5A93A 1H8ZA 3MKFA 3UE0A 2Y2QA 3WS5A 4A5RA 3ZCZA 1BTLA 4E3OA 1KGFA 5HAIA 4DE3A 1E3UA 4WZ5A 4K0WA 4LCMA 3HLEA 3FKVA 2IWCA 4QU3A 3S4XA 3WS2A 4WMCA 4P87A 3LO7A 5EVIC 3MBZA 5CGSA 3IF6A 5FA7A 2ZM0A 4RX3A 2ZQ9A 3IQAA 4XUZA 3BRMA 4Y0OA 3UY6A 1W8QA 4OP8A 3DWKA 4R4SA 3Q81A 4GD8A 2Q9MA 3MZFA 1K6SA 1LLBA 1N9BA 1YLPA 3ZG7B 4HEFA 3NI9A 4BD1A 4C6YA 1RGYA 3CG5A 4P0MA 4S2IA 4JF5A 5BOHA 2XR0A 4KG2A 5FQMA 5A90A 3GQZA 4OPQA 5HAPA 4PM9A 4XXRA 2Y2NA 5FAQA 4B4ZA 4BL2A 3GSGA 4CJNA 1JWPA 3RXXA 1FR6A 3UPPA 1FQGA 3V3SA 4ZTKA 1PWCA 3NDEA 1PZOA 4Y0UA 5I94A 2EX9A 1FCMA 1K54A 3PBQA 2WGWA 1ONHA 1GCEA 2QZ6A 4N1HA 4X53A 4KZ9A 1M6KA 4WELA 3LY3A 3UPOA 1PW1A 1U60A 1TDLA 1ERMA 2H0YA 4E6XA 1NZUA 4RA7A 1NYYA 3N6IA 1PZPA 1ZC2A 2JC7A 2J7VA 1IYPA 3C7UA 3WRTA 3VP4A 4DDSA 4B4XA 2R9XA 4HBUA 1XPBA 1YT4A 4QHCA 5FI2A 1I2WA 4EWFA 4OOYA 2P9VB 3HLFA 1MWTA 4S2MA 4X68A 3BM6A 2OLVA 1C3BA 4OPYA 5GHYA 5IHVA 5U47A 1HD8A 3LCEA 1K57A 3MKEA 3Q07A 2WYXA 4OP5A 5FQ9A 3WS4A 4O7DA 3V5MA 4QY5A 2HDUA 3A3JA 1NRFA 2XGNA 4IVKA 2XD1A 3IXBA 2ZLYA 2WKIA 3IF6B 1ES4A 4Z9QA 4KG5A 1ES2A 4PM6A 2ZM2A 2OLUA 4FH2A 2XH9A 5FI6A 4JXVA 5AQAA 1RGZA 5CERA 5HW3A 3WS1A 2ZM8A 1K54C 1TDGA 1SDNA 3GTCA 3PBTA 4N92A 3VP0A 1LL5A 3N8SA 3HLBA 4BENA 3IHAA 3PBOA 2RL3A 2C6WB 1M40A 3Q7VA 1LI9A 4WYYA 3A3IA 1K56A 3FWLA 3OC2A 1MWRA 1DJBA 3IH9A 1YLZA 3UDIA 3ZDJA 3MZEA 2Y55A 4IBXA 2ZC5B 1EI5A 4HBTA 5AQ7A 5DF9A 1KGGA 2CC1A 3MXRA 5JYOA 3HLWA 1L0GA 1KDWA 1DJAA 4LENA 4JPMA 2ZC6B 4MEZA 1GHPA 3VFFA 2G2WA 1CI8A 3ZG5A 3Q1FA 4X56A 4E3MA 1XP4A 1W79A 1JWZA 5EECA 5TFQA 1OMEA 4S2NA 3DTMA 2P9VA 5CXWA 3ZVWA 1H8YA 5GLBA 1S0WA 3OCNA 5EPHA 3W4OA 4RX2A 2JCHA 4R3JA 4RVAA 3EQVA 3HLCA 4GZBA 5EUAA 5GLAA 3HUMA 3UPNA 1CEFA 5DF8A 1YLWA 3CJMA 1VM1A 4QD4A 4FSFA 3W4PA 1W7FA 1S6RA 1K56D 1K4EA 4P85A 5CTNA 1SDEA 4OQ0A 4DKIA 4OPZA 4ZJ2A 3W4QA 4OH0A 1RP5A 1ONGA 2R9WA 3ITBA 3Q7VB 2PBYA 2JE5A 1DY6A 4XUXA 4EQIA 5J8XA 4OQHA 3UE1A 1IEMA 2HP9A 3S22A 3G2YA 3E2LA 5CEBA 1JWVA 1XGJA 3QNCA 5HARA 4PM7A 5E43A 2Y91A 1MKIA 2Y2JA 2V2FF 3VFHA 3DWZA 3VP2A 5CRFA 1BLPA 1NXYA 5AQ9A 4OQGA 2ZQDA 2C5WB 3BFFA 3VSKA 3C5AA 3M6BA 3NIAA 1XKZA 4E3IA 3OCLA 1PI4A 4OKPA 3PTEA 1SHVA 5FDHA 3VOZA 4DE1A 3CMZA 3P09A 4S2OA 4RYEA 5FQIA 4KZ8A 3AGEA 4JF4A 4E6WA 4OOLA 1QMEA 3UDXA 2WGVA 2XFSA 3BLSA 2J9PA 4U3TA 2P74A 1YM1A 2G2UA 1KE4A 2EX8A 3BECA 5E2EA 2VGKA 4DE0A 1BSGA 5CECA 3ZFZA 1Q2PA 5GHZA 1KVLA 3PAGA 4NETA 2HP6A 5GLCA 3UDFA 5FAPA 3C7VA 1ESIA 4UA7A 1PYYA 2B5RA 5FQQA 3O3VA 2Y2PA 2E8IA 3BEBA 4LV2A 3M2JA 4IVIA 3TOIA 3HUNA 3TG9A 1GHMA 1K25A 2WKEA 1E3UD 2XDMA 3FYZA 4PMAA 1FOFA 3ISGA 1YLJA 1YLYA 5E2GA 4WEKA 4BJPA 2EX6A 1G6AA 1ES3A 3LY4A 1K55C 1W8YA 1NY0A 4Y0TA 2J9OA 3MZDA 5G18A 3NY4A 3IXGA 1FSYA 3D4FA 1BZAA 4E3LA 1K55A 5KSCA 1E4DA 3Q82A 2Z2MB 1IELA 2XEPA 1EROA 2J8YA 4MBFA 4N9LA 5A91A 3SS3A 2HP5A 1ESUA 3PAEA 2X01A 4KZ5A 4GNUA 4DF6A 3E2KA 3UE3A 3ZNTA 4Y7PA 4R0QA 1JTGA 5DTKA 4WZ4A 1IKGA 3G35A 2ZC7A 1I5QA 3NBLA 3P98A 2H5SA 1TVFA 2BG1A 3AGDA 2ZQAA 1NYMA 3ZG0A 4M3KA 4E3NA 2WAFA 2IWDA 3SH7A 1PIOA 2QMIA 1PWGA 2GDNA 3AGFA 3IF6C 4PM8A 4E3JA 4JKTA 3OZHA 3N8LA 4GDNA 4KZ3A 5FATA 2EFXA 5FQKA 3FV7A 3W8KA 2ZQ8A 1W5DA 4EUZA 1E25A 3BFEA 4F94A 1SCWA 4QJGA 5DF7A 5EOOA 4S2PA 2IWBA 3BLMA 4R1GA 2HDRA 2Y59A 1LHYA 2PU4A 1IYOA 1NZOA 2Y2HA 3G34A 1CEGA 1VQQA 3PBRA 4OOMA 3V3RA 4K91A 1MXOA 5F1GA 4NK3A 2H0TA 4JLFA 1BT5A 1KGEA 4JXGA 5DTTA 4BQMA 4R4RA 3WWXA 4KZ7A 4YINA 4BL3A 1MBLA 2H10A 1PI5A 4KZBA 3ZHHA 1HVBA 1FCOA 5HL1A 4UHUA 3SH9A 5HFOA 4LV3A 2HPBA 4YFMA 5EOEA 4JBFA 2DRWA 3IXDA 4ID4A 3UNWA 2I72A 2XFTA 4UA6A 3GMWA 4FD8A 1MWSA 3GRJA 4GDBA 1WYBA 2FFFB 4S2NC 1NJ4A 2OSUA 4PPRA 3V39A 4UA9A 1YMXA 3V50A 3NDGA 1KVMA 3FKWA 4IBRA 5GL9A 4EBNA 2OV5A 1IYQA 3BFCA 3RJUA 5M18A 3VP1A 2DNSA 4IEDA 5TGFA 3ZNYA 5JYPA 3MFDA 3SS4A 3UN7A 3PBSA 3JYIA 3UO9A 2FFYA 5FQJA 1K6RA 4BLMA 2EXBA 4DDYA 4MBHA 5CGXA 3HBRA 3LEZA 3OPLA 4U0XA 4X55A 4ZDXA 4LCLA 4Q8IA 1WE4A 3M2KA 4R23A 4OLDA 4C3QA 4FCFA 5HAQA 3ZG8B 1GA9A 2ZD8A 1ALQA 4KENB 4MNRA 1KE0A 3G32A 3IT9A 4BD0A 5EE8A 3PBNA 4ZAMA 1JVJA 2EFUA 3BFGA 4MBKA 2ZMAA 4KQRA 3IWOA 1H5XA 3NC8A 2WGIA 2X02A 1XA7A 1YQSA 1BLCA 1HZOA 5CTMA 3QHYA 5HX9A 1YLTA 1KE3A 1MY8A 2XF3A 3IWIA 3OPPA 2ZC3B 2JBFA 3GVBA 1K57C 3QNBA 4JXWA 4KQQA 4LV0A 3GR2A 3HLGA 3VP3A 4S2JA 4QB8A 5CGWA 3BFDA 5TR7A 2EXAA 3IF5A 4X69A 1O7EA 3N8RA 3A3DA 1PWDA 3S1YA 5KZHA 3O86A 1FR1A 3OPHA 1GA0A 4OLGA 3EQUA 1KDSA 4ZJ1A 2Y4AA 2XD5A 2A49A 4OVDA 5E2FA 1CK3A 5F83A 5FI7A 1JTDA 4S2KA 5F1FA 1L0FA 2WAEA 2RCXA 4QY6A 4DE2A 3SS5A 3VSLA 1FCNA 4LV1A 2PU2A 4MLLA 3G4PA 1O07A 1BULA 1BUEA 3G30A 2VGJA 1AXBA 2Y2KA 1ES5A 1Z6FA 2XQZA 4EBPA 2Y2IA 2ZQCA 4WEJA 4OQIA 3MXSA 3IH8A 3ZGAB 2WK0A 1Y54A 1I2SA 4GD6A 2WADA 4WMCD 1BLHA 3NCKA 4N9KA 2Y2MA 1FSWA 2XLNA 2UWXA 4OONA 4DRTA 4EV4A 5GLDA 2EX2A 3N7WA 5CHMA 4OPRA 5EVID 3O87A 1CI9A 3TSGA 5CEDA 2WGWB 2Y2GA 1XA1A 1Q2QA 2Q9NA 3VOYA 5KMWA 3IXHA 5F82A 3SH8A 1HTZA 1RCJA 1N4OA 1YMSA 2Z2LB 3GV9A 1GHIA 5D3OA 4GN2A 4N1XA 4KZAA 3M6HA 5EVIA 5M1AA 1L0EA 2WZZA 3N4IA 1IYSA 3G2ZA 5CHUA 3ZVTA 4DXCA 4DXBA 3WRZA 4WBGA 3G31A 4WZ5C 4CPKA 1TEMA 2WUQA 1BLSA 3CZDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X6T A;  1ZKJ A;  5EVL A;  3HL9 A;  5FAO A;  4EBL A;  3A3E A;  1WYC A;  5E2H A;  3OPR A;  1IKI A;  3Q7Z A;  4JF6 A;  1ZG4 A;  5GHX A;  1PW8 A;  2Y2L A;  3C4O A;  1ERQ A;  5L2F A;  3IWQ A;  1MWU A;  3BYD A;  2BLS A;  3RXW A;  3IHB A;  4ZJ3 A;  3FZC A;  2HDS A;  4S2L A;  2HDQ A;  2WZX A;  1L2S A;  4K0X A;  5FSR A;  3A3F A;  1SKF A;  1XGI A;  1EWZ A;  4ZBE A;  2V20 A;  1MPL A;  2WKH A;  4KZ4 A;  3SOI A;  2Y2O A;  2DCF A;  3VMA A;  2A3U A;  1G68 A;  4GKU A;  4GOG A;  3DW0 A;  1DJC A;  2XK1 A;  3WS0 A;  3ITA A;  3HLD A;  2X71 A;  4U0T A;  4L0L A;  4KZ6 A;  1L0D A;  4C75 A;  4PM5 A;  2ZC4 B;  3I7J A;  2V1Z A;  3B3X A;  4P6B A;  4UAA A;  4WM9 A;  5M19 A;  5EVI B;  2QPN A;  4KG6 A;  5FAS A;  3C4P A;  4GB7 A;  2ZJ9 A;  1LI0 A;  4H8R A;  5AQB A;  1LL9 A;  4E3K A;  1K4F A;  5DTS A;  1QMF A;  4JXS A;  5KSH A;  3O88 A;  1ZG6 A;  3HVF A;  4KQO A;  5DVA A;  4D2O A;  1K38 A;  4B88 A;  1J9M A;  2ZQ7 A;  4FH4 A;  3ZG9 B;  5A92 A;  1XX2 A;  3HRE A;  4HES A;  4R3B A;  1XXM A;  3HUO A;  5CHJ A;  5A93 A;  1H8Z A;  3MKF A;  3UE0 A;  2Y2Q A;  3WS5 A;  4A5R A;  3ZCZ A;  1BTL A;  4E3O A;  1KGF A;  5HAI A;  4DE3 A;  1E3U A;  4WZ5 A;  4K0W A;  4LCM A;  3HLE A;  3FKV A;  2IWC A;  4QU3 A;  3S4X A;  3WS2 A;  4WMC A;  4P87 A;  3LO7 A;  5EVI C;  3MBZ A;  5CGS A;  3IF6 A;  5FA7 A;  2ZM0 A;  4RX3 A;  2ZQ9 A;  3IQA A;  4XUZ A;  3BRM A;  4Y0O A;  3UY6 A;  1W8Q A;  4OP8 A;  3DWK A;  4R4S A;  3Q81 A;  4GD8 A;  2Q9M A;  3MZF A;  1K6S A;  1LLB A;  1N9B A;  1YLP A;  3ZG7 B;  4HEF A;  3NI9 A;  4BD1 A;  4C6Y A;  1RGY A;  3CG5 A;  4P0M A;  4S2I A;  4JF5 A;  5BOH A;  2XR0 A;  4KG2 A;  5FQM A;  5A90 A;  3GQZ A;  4OPQ A;  5HAP A;  4PM9 A;  4XXR A;  2Y2N A;  5FAQ A;  4B4Z A;  4BL2 A;  3GSG A;  4CJN A;  1JWP A;  3RXX A;  1FR6 A;  3UPP A;  1FQG A;  3V3S A;  4ZTK A;  1PWC A;  3NDE A;  1PZO A;  4Y0U A;  5I94 A;  2EX9 A;  1FCM A;  1K54 A;  3PBQ A;  2WGW A;  1ONH A;  1GCE A;  2QZ6 A;  4N1H A;  4X53 A;  4KZ9 A;  1M6K A;  4WEL A;  3LY3 A;  3UPO A;  1PW1 A;  1U60 A;  1TDL A;  1ERM A;  2H0Y A;  4E6X A;  1NZU A;  4RA7 A;  1NYY A;  3N6I A;  1PZP A;  1ZC2 A;  2JC7 A;  2J7V A;  1IYP A;  3C7U A;  3WRT A;  3VP4 A;  4DDS A;  4B4X A;  2R9X A;  4HBU A;  1XPB A;  1YT4 A;  4QHC A;  5FI2 A;  1I2W A;  4EWF A;  4OOY A;  2P9V B;  3HLF A;  1MWT A;  4S2M A;  4X68 A;  3BM6 A;  2OLV A;  1C3B A;  4OPY A;  5GHY A;  5IHV A;  5U47 A;  1HD8 A;  3LCE A;  1K57 A;  3MKE A;  3Q07 A;  2WYX A;  4OP5 A;  5FQ9 A;  3WS4 A;  4O7D A;  3V5M A;  4QY5 A;  2HDU A;  3A3J A;  1NRF A;  2XGN A;  4IVK A;  2XD1 A;  3IXB A;  2ZLY A;  2WKI A;  3IF6 B;  1ES4 A;  4Z9Q A;  4KG5 A;  1ES2 A;  4PM6 A;  2ZM2 A;  2OLU A;  4FH2 A;  2XH9 A;  5FI6 A;  4JXV A;  5AQA A;  1RGZ A;  5CER A;  5HW3 A;  3WS1 A;  2ZM8 A;  1K54 C;  1TDG A;  1SDN A;  3GTC A;  3PBT A;  4N92 A;  3VP0 A;  1LL5 A;  3N8S A;  3HLB A;  4BEN A;  3IHA A;  3PBO A;  2RL3 A;  2C6W B;  1M40 A;  3Q7V A;  1LI9 A;  4WYY A;  3A3I A;  1K56 A;  3FWL A;  3OC2 A;  1MWR A;  1DJB A;  3IH9 A;  1YLZ A;  3UDI A;  3ZDJ A;  3MZE A;  2Y55 A;  4IBX A;  2ZC5 B;  1EI5 A;  4HBT A;  5AQ7 A;  5DF9 A;  1KGG A;  2CC1 A;  3MXR A;  5JYO A;  3HLW A;  1L0G A;  1KDW A;  1DJA A;  4LEN A;  4JPM A;  2ZC6 B;  4MEZ A;  1GHP A;  3VFF A;  2G2W A;  1CI8 A;  3ZG5 A;  3Q1F A;  4X56 A;  4E3M A;  1XP4 A;  1W79 A;  1JWZ A;  5EEC A;  5TFQ A;  1OME A;  4S2N A;  3DTM A;  2P9V A;  5CXW A;  3ZVW A;  1H8Y A;  5GLB A;  1S0W A;  3OCN A;  5EPH A;  3W4O A;  4RX2 A;  2JCH A;  4R3J A;  4RVA A;  3EQV A;  3HLC A;  4GZB A;  5EUA A;  5GLA A;  3HUM A;  3UPN A;  1CEF A;  5DF8 A;  1YLW A;  3CJM A;  1VM1 A;  4QD4 A;  4FSF A;  3W4P A;  1W7F A;  1S6R A;  1K56 D;  1K4E A;  4P85 A;  5CTN A;  1SDE A;  4OQ0 A;  4DKI A;  4OPZ A;  4ZJ2 A;  3W4Q A;  4OH0 A;  1RP5 A;  1ONG A;  2R9W A;  3ITB A;  3Q7V B;  2PBY A;  2JE5 A;  1DY6 A;  4XUX A;  4EQI A;  5J8X A;  4OQH A;  3UE1 A;  1IEM A;  2HP9 A;  3S22 A;  3G2Y A;  3E2L A;  5CEB A;  1JWV A;  1XGJ A;  3QNC A;  5HAR A;  4PM7 A;  5E43 A;  2Y91 A;  1MKI A;  2Y2J A;  2V2F F;  3VFH A;  3DWZ A;  3VP2 A;  5CRF A;  1BLP A;  1NXY A;  5AQ9 A;  4OQG A;  2ZQD A;  2C5W B;  3BFF A;  3VSK A;  3C5A A;  3M6B A;  3NIA A;  1XKZ A;  4E3I A;  3OCL A;  1PI4 A;  4OKP A;  3PTE A;  1SHV A;  5FDH A;  3VOZ A;  4DE1 A;  3CMZ A;  3P09 A;  4S2O A;  4RYE A;  5FQI A;  4KZ8 A;  3AGE A;  4JF4 A;  4E6W A;  4OOL A;  1QME A;  3UDX A;  2WGV A;  2XFS A;  3BLS A;  2J9P A;  4U3T A;  2P74 A;  1YM1 A;  2G2U A;  1KE4 A;  2EX8 A;  3BEC A;  5E2E A;  2VGK A;  4DE0 A;  1BSG A;  5CEC A;  3ZFZ A;  1Q2P A;  5GHZ A;  1KVL A;  3PAG A;  4NET A;  2HP6 A;  5GLC A;  3UDF A;  5FAP A;  3C7V A;  1ESI A;  4UA7 A;  1PYY A;  2B5R A;  5FQQ A;  3O3V A;  2Y2P A;  2E8I A;  3BEB A;  4LV2 A;  3M2J A;  4IVI A;  3TOI A;  3HUN A;  3TG9 A;  1GHM A;  1K25 A;  2WKE A;  1E3U D;  2XDM A;  3FYZ A;  4PMA A;  1FOF A;  3ISG A;  1YLJ A;  1YLY A;  5E2G A;  4WEK A;  4BJP A;  2EX6 A;  1G6A A;  1ES3 A;  3LY4 A;  1K55 C;  1W8Y A;  1NY0 A;  4Y0T A;  2J9O A;  3MZD A;  5G18 A;  3NY4 A;  3IXG A;  1FSY A;  3D4F A;  1BZA A;  4E3L A;  1K55 A;  5KSC A;  1E4D A;  3Q82 A;  2Z2M B;  1IEL A;  2XEP A;  1ERO A;  2J8Y A;  4MBF A;  4N9L A;  5A91 A;  3SS3 A;  2HP5 A;  1ESU A;  3PAE A;  2X01 A;  4KZ5 A;  4GNU A;  4DF6 A;  3E2K A;  3UE3 A;  3ZNT A;  4Y7P A;  4R0Q A;  1JTG A;  5DTK A;  4WZ4 A;  1IKG A;  3G35 A;  2ZC7 A;  1I5Q A;  3NBL A;  3P98 A;  2H5S A;  1TVF A;  2BG1 A;  3AGD A;  2ZQA A;  1NYM A;  3ZG0 A;  4M3K A;  4E3N A;  2WAF A;  2IWD A;  3SH7 A;  1PIO A;  2QMI A;  1PWG A;  2GDN A;  3AGF A;  3IF6 C;  4PM8 A;  4E3J A;  4JKT A;  3OZH A;  3N8L A;  4GDN A;  4KZ3 A;  5FAT A;  2EFX A;  5FQK A;  3FV7 A;  3W8K A;  2ZQ8 A;  1W5D A;  4EUZ A;  1E25 A;  3BFE A;  4F94 A;  1SCW A;  4QJG A;  5DF7 A;  5EOO A;  4S2P A;  2IWB A;  3BLM A;  4R1G A;  2HDR A;  2Y59 A;  1LHY A;  2PU4 A;  1IYO A;  1NZO A;  2Y2H A;  3G34 A;  1CEG A;  1VQQ A;  3PBR A;  4OOM A;  3V3R A;  4K91 A;  1MXO A;  5F1G A;  4NK3 A;  2H0T A;  4JLF A;  1BT5 A;  1KGE A;  4JXG A;  5DTT A;  4BQM A;  4R4R A;  3WWX A;  4KZ7 A;  4YIN A;  4BL3 A;  1MBL A;  2H10 A;  1PI5 A;  4KZB A;  3ZHH A;  1HVB A;  1FCO A;  5HL1 A;  4UHU A;  3SH9 A;  5HFO A;  4LV3 A;  2HPB A;  4YFM A;  5EOE A;  4JBF A;  2DRW A;  3IXD A;  4ID4 A;  3UNW A;  2I72 A;  2XFT A;  4UA6 A;  3GMW A;  4FD8 A;  1MWS A;  3GRJ A;  4GDB A;  1WYB A;  2FFF B;  4S2N C;  1NJ4 A;  2OSU A;  4PPR A;  3V39 A;  4UA9 A;  1YMX A;  3V50 A;  3NDG A;  1KVM A;  3FKW A;  4IBR A;  5GL9 A;  4EBN A;  2OV5 A;  1IYQ A;  3BFC A;  3RJU A;  5M18 A;  3VP1 A;  2DNS A;  4IED A;  5TGF A;  3ZNY A;  5JYP A;  3MFD A;  3SS4 A;  3UN7 A;  3PBS A;  3JYI A;  3UO9 A;  2FFY A;  5FQJ A;  1K6R A;  4BLM A;  2EXB A;  4DDY A;  4MBH A;  5CGX A;  3HBR A;  3LEZ A;  3OPL A;  4U0X A;  4X55 A;  4ZDX A;  4LCL A;  4Q8I A;  1WE4 A;  3M2K A;  4R23 A;  4OLD A;  4C3Q A;  4FCF A;  5HAQ A;  3ZG8 B;  1GA9 A;  2ZD8 A;  1ALQ A;  4KEN B;  4MNR A;  1KE0 A;  3G32 A;  3IT9 A;  4BD0 A;  5EE8 A;  3PBN A;  4ZAM A;  1JVJ A;  2EFU A;  3BFG A;  4MBK A;  2ZMA A;  4KQR A;  3IWO A;  1H5X A;  3NC8 A;  2WGI A;  2X02 A;  1XA7 A;  1YQS A;  1BLC A;  1HZO A;  5CTM A;  3QHY A;  5HX9 A;  1YLT A;  1KE3 A;  1MY8 A;  2XF3 A;  3IWI A;  3OPP A;  2ZC3 B;  2JBF A;  3GVB A;  1K57 C;  3QNB A;  4JXW A;  4KQQ A;  4LV0 A;  3GR2 A;  3HLG A;  3VP3 A;  4S2J A;  4QB8 A;  5CGW A;  3BFD A;  5TR7 A;  2EXA A;  3IF5 A;  4X69 A;  1O7E A;  3N8R A;  3A3D A;  1PWD A;  3S1Y A;  5KZH A;  3O86 A;  1FR1 A;  3OPH A;  1GA0 A;  4OLG A;  3EQU A;  1KDS A;  4ZJ1 A;  2Y4A A;  2XD5 A;  2A49 A;  4OVD A;  5E2F A;  1CK3 A;  5F83 A;  5FI7 A;  1JTD A;  4S2K A;  5F1F A;  1L0F A;  2WAE A;  2RCX A;  4QY6 A;  4DE2 A;  3SS5 A;  3VSL A;  1FCN A;  4LV1 A;  2PU2 A;  4MLL A;  3G4P A;  1O07 A;  1BUL A;  1BUE A;  3G30 A;  2VGJ A;  1AXB A;  2Y2K A;  1ES5 A;  1Z6F A;  2XQZ A;  4EBP A;  2Y2I A;  2ZQC A;  4WEJ A;  4OQI A;  3MXS A;  3IH8 A;  3ZGA B;  2WK0 A;  1Y54 A;  1I2S A;  4GD6 A;  2WAD A;  4WMC D;  1BLH A;  3NCK A;  4N9K A;  2Y2M A;  1FSW A;  2XLN A;  2UWX A;  4OON A;  4DRT A;  4EV4 A;  5GLD A;  2EX2 A;  3N7W A;  5CHM A;  4OPR A;  5EVI D;  3O87 A;  1CI9 A;  3TSG A;  5CED A;  2WGW B;  2Y2G A;  1XA1 A;  1Q2Q A;  2Q9N A;  3VOY A;  5KMW A;  3IXH A;  5F82 A;  3SH8 A;  1HTZ A;  1RCJ A;  1N4O A;  1YMS A;  2Z2L B;  3GV9 A;  1GHI A;  5D3O A;  4GN2 A;  4N1X A;  4KZA A;  3M6H A;  5EVI A;  5M1A A;  1L0E A;  2WZZ A;  3N4I A;  1IYS A;  3G2Z A;  5CHU A;  3ZVT A;  4DXC A;  4DXB A;  3WRZ A;  4WBG A;  3G31 A;  4WZ5 C;  4CPK A;  1TEM A;  2WUQ A;  1BLS A;  3CZD A; 
#chains in the Genus database with same CATH topology
 4X6T A;  1ZKJ A;  3HL9 A;  4ZRR A;  4HOI A;  5E2H A;  2PDR A;  3A0V A;  1MWU A;  1TS0 A;  3IHB A;  3ULF A;  4ZJ3 A;  3FZC A;  2HDS A;  2WZX A;  2LB5 A;  1XGI A;  4ZBE A;  4GCZ A;  2V20 A;  4JGQ A;  1F98 A;  2Y2O A;  4GKU A;  4Y5F A;  4KZ6 A;  1MZU A;  4ARZ A;  2ZC4 B;  4WM9 A;  2V1Z A;  3P7N A;  2QPN A;  3E4P A;  3C4P A;  4GB7 A;  2KX6 A;  1LI0 A;  4H8R A;  1K0K A;  1QMF A;  4JXS A;  1ZG6 A;  4D2O A;  4KQO A;  2QYB A;  4B88 A;  2ZQ7 A;  3ZG9 B;  5A92 A;  1XX2 A;  1XXM A;  5CHJ A;  3C2W A;  2Y2Q A;  4A5R A;  4L9F A;  3NHQ A;  4DE3 A;  3SZT A;  2A2L A;  2IWC A;  3IQA A;  5CX7 A;  5EV0 A;  1W8Q A;  4R4S A;  3LR5 A;  1N9B A;  3CG5 A;  4S2I A;  4JF5 A;  4MDZ A;  2VX8 A;  5A90 A;  3GQZ A;  5FAQ A;  4BL2 A;  4CJN A;  3UPP A;  3V3S A;  1PZO A;  3PBQ A;  1ONH A;  2QZ6 A;  2HJ9 C;  4H6J B;  1TDL A;  1ERM A;  2H0Y A;  2Z6D A;  3HJI A;  4RA7 A;  1NYY A;  3N6I A;  1IYP A;  2R9X A;  5FI2 A;  4OOY A;  2OLV A;  3LCE A;  3T1Q B;  4QY5 A;  2XD1 A;  5EFW A;  5FI6 A;  3WS1 A;  3NJA A;  3PBT A;  1K54 C;  4Q0J A;  3W2Z A;  2GNX A;  4Y3I A;  1K56 A;  2AVX A;  3FWL A;  3IH9 A;  1KGG A;  3LIF A;  2PRF A;  4LEN A;  2ZL1 A;  4O0P A;  1D7E A;  1GHP A;  5HPI A;  1CI8 A;  4QPR A;  5TFQ A;  4PAU A;  4GHI B;  5CXW A;  1S0W A;  3OCN A;  4DN0 A;  3W4O A;  2JKR M;  4RX2 A;  2EWV A;  2PHY A;  2V0U A;  3UPN A;  4WUJ A;  3CJM A;  1VM1 A;  1UWN X;  5AJG A;  1K56 D;  1K4E A;  4BMW A;  1SDE A;  4OQ0 A;  1NLY A;  4GW9 A;  2R9W A;  3ITB A;  4G3K A;  1T1A A;  3MQ0 A;  1OT6 A;  3ZYT A;  5E43 A;  1MKI A;  3H7W A;  3LIC A;  5AQ9 A;  1S1Y A;  1SKO B;  3BFF A;  3NIA A;  5FDH A;  1SHV A;  3CMZ A;  4RYE A;  5FQI A;  3AGE A;  2WGV A;  2XFS A;  3BEC A;  4DE0 A;  5CEC A;  4I3A A;  5GHZ A;  1KVL A;  2W27 A;  5HPF A;  5GLC A;  5TJJ A;  2A24 A;  3UDF A;  1PYY A;  4ETZ A;  5FQQ A;  3O3V A;  2E8I A;  4I3I A;  5L8M A;  4IVI A;  4WEK A;  2EX6 A;  1ES3 A;  2VGL M;  3IXG A;  4E3L A;  1K55 A;  3LR0 A;  1E4D A;  1N9N A;  4MBF A;  4GNU A;  3F1N B;  3E2K A;  2P08 A;  2XRO A;  3UB8 A;  2W3H A;  1IKG A;  2HJE A;  4CQH A;  3NBL A;  3AGD A;  2PBD P;  4M3K A;  4E3N A;  4Y17 A;  3SH7 A;  1PIO A;  2QMI A;  3AGF A;  4HP4 A;  3NOT C;  3OZH A;  4JKT A;  4KZ3 A;  5FQK A;  2IA2 A;  3W8K A;  3T4T A;  3KYQ A;  2V1A A;  5EOO A;  5DKK A;  4EW7 A;  1OPX A;  1T1B A;  1MXO A;  3KYZ A;  1KGE A;  4JXG A;  2JKF A;  4BQM A;  3WWX A;  3F1N A;  2PYP A;  4NG2 A;  5HFO A;  1FIL A;  3IXD A;  3S7O A;  3GRJ A;  2VKS A;  3KSH A;  5J7E A;  1NJ4 A;  2OSU A;  1XJ6 A;  1YMX A;  1KVM A;  4IBR A;  3LIA A;  3BFC A;  3VP1 A;  2KOI A;  3LYX A;  3ZNY A;  4K08 A;  2W3F A;  3UN7 A;  3UO9 A;  4YNR A;  2W1T A;  3F1O B;  3FG8 A;  4HI4 A;  4U0X A;  4Q8I A;  1WE4 A;  5HAQ A;  4JGO A;  3UB9 A;  1GA9 A;  2ZD8 A;  1KE0 A;  4ZAM A;  4KQR A;  1H5X A;  3VV4 A;  1XA7 A;  1YQS A;  2FZ0 A;  5C5K A;  3U2A A;  1SZV A;  2ACG A;  3QP4 A;  2B18 A;  2JBF A;  3QNB A;  1BYW A;  3HLG A;  3VP3 A;  2OAQ 1;  3O86 A;  3OPH A;  1GA0 A;  4OLG A;  2W1T B;  3F1O A;  2JN7 A;  2XD5 A;  4OVD A;  1CK3 A;  4NXF A;  1JTD A;  4S2K A;  5F1F A;  3SS5 A;  4CLC C;  4LV1 A;  3G4P A;  1AWI A;  3G30 A;  1L3L A;  1ES5 A;  3T1R A;  1LSV A;  3SW1 A;  4EBP A;  3LID A;  4Q0H A;  4WEJ A;  3QP8 A;  3RTY A;  1Y54 A;  1I2S A;  2WAD A;  1BLH A;  1FSW A;  3H82 B;  4LLO B;  5F68 A;  3HCY A;  3O87 A;  4I38 A;  3TSG A;  5DFY A;  3VOY A;  3IXH A;  4O01 A;  5F82 A;  1YMS A;  3O5Y A;  1N4O A;  4GN2 A;  4KZA A;  1YPR A;  3M6H A;  5G4Z A;  1L0E A;  3RFB A;  4X1M A;  4CPK A;  3CZD A;  4MMN A;  5EVL A;  5FAO A;  1OTE A;  1IKI A;  4JF6 A;  4O8G A;  1ZG4 A;  5GHX A;  1PW8 A;  3E4O A;  3IWQ A;  3BYD A;  2M7V A;  2V9A A;  3LIB A;  5A8B A;  5DJU A;  3A3F A;  1SKF A;  1EWZ A;  4RQ9 A;  1PNE A;  3OOV A;  3SOI A;  4GOG A;  2XK1 A;  3ITA A;  4U0T A;  1OTD A;  3B3X A;  4P6B A;  4KG6 A;  5FAS A;  2ZJ9 A;  1DP8 A;  4HIA A;  1LL9 A;  4E3K A;  1K4F A;  2PD7 A;  3TE8 A;  3CHW P;  3HVF A;  5DVA A;  3LEQ A;  3UB7 A;  4I3J A;  3PHY A;  1BTL A;  5HL6 A;  2GX5 A;  4K0W A;  3FKV A;  3LUQ A;  3WS2 A;  3A0S A;  4WMC A;  5FDS A;  4PKY G;  3IF6 A;  5FA7 A;  4XUZ A;  3BRM A;  4Y0O A;  4OP8 A;  3DWK A;  2E8J A;  1LLB A;  4C6Y A;  1RGY A;  5BOH A;  2R78 A;  2XR0 A;  5HAP A;  2O9A A;  2PR5 A;  2VV6 A;  4PM9 A;  4EEP A;  1YSP A;  3RXX A;  1FR6 A;  1K54 A;  4CLC A;  4WEL A;  3LY3 A;  5MC7 A;  1PW1 A;  3T4O A;  4E6X A;  1NZU A;  2XSS A;  2J7V A;  3VP4 A;  5HD5 A;  4B4X A;  4HBU A;  1XPB A;  3R7W A;  4EWF A;  4X68 A;  4OPY A;  1C3B A;  5GHY A;  5U47 A;  3WS4 A;  2WYX A;  4O7D A;  4MN6 A;  2HDU A;  1NRF A;  4HNB A;  3PYP A;  1ES2 A;  2ZM2 A;  2OLU A;  2XH9 A;  5AQA A;  1RGZ A;  5CER A;  2ZM8 A;  3VP0 A;  3GTC A;  3CLO A;  3IHA A;  2C6W B;  1M40 A;  2J3W A;  3E4Q A;  3Q7V A;  1LI9 A;  1YLZ A;  3UDI A;  3MZE A;  4HBT A;  5DF9 A;  4KUO A;  3T1X A;  4JPM A;  3UB6 A;  3R4K A;  2G2W A;  1H3Q A;  4X56 A;  2G7U A;  3S7Q A;  5LBR A;  1OME A;  2P9V A;  1IOU A;  5EPH A;  2XA7 M;  1TD5 A;  2V8C A;  3HLC A;  3HUM A;  5DF8 A;  1YLW A;  4LPZ A;  4QD4 A;  4FSF A;  1W7F A;  1S6R A;  5CTN A;  4II7 A;  3W4Q A;  4OH0 A;  4HHD A;  3Q7V B;  2PBY A;  4NXG A;  1DY6 A;  4HY8 A;  4PKY A;  3S22 A;  1XGJ A;  5FL3 A;  4PM7 A;  1P97 A;  3VOL A;  3DWZ A;  2NUT C;  1NXY A;  4OQG A;  2C5W B;  3S7P A;  3C5A A;  3M6B A;  4OKP A;  3PTE A;  1Y28 A;  4GJ4 A;  3P09 A;  4S2O A;  3JPU A;  3R7W B;  1SKO A;  1QME A;  2J9P A;  2P74 A;  2EX8 A;  4NXB A;  1BSG A;  3ZFZ A;  1TS8 A;  1P9W A;  1FIK A;  3OLO A;  3PAG A;  3LR4 A;  3NOP C;  1H0M A;  4HP9 A;  1WA9 A;  4UA7 A;  2O9B A;  2L0W A;  4NXE A;  3M2J A;  1GSW A;  1OJG A;  1GHM A;  1E3U D;  2ZOH A;  1FOF A;  3NEC A;  4MCW A;  4BJP A;  1X0O A;  1G6A A;  4DJ3 A;  2W1R A;  1FSY A;  3MQO A;  1IEL A;  4F3L A;  3IBJ A;  3UE3 A;  4Y7P A;  4R0Q A;  3TJZ C;  4EXO A;  1JTG A;  4WZ4 A;  2O99 A;  1XJ3 A;  2BTF P;  3QP1 A;  4DMZ A;  2WAF A;  3P01 A;  4PM8 A;  3IF6 C;  5EM1 A;  3FV7 A;  3C8C A;  2V1B A;  1E25 A;  3BFE A;  4GLQ A;  5DF7 A;  4KQD A;  1NZO A;  2Y2H A;  3PBR A;  1VQQ A;  3IX3 A;  4OOM A;  3MQQ A;  4JLF A;  3CWF A;  3MXQ A;  4R4R A;  4KZ7 A;  1MBL A;  5HWW A;  3ZHH A;  4KZB A;  1HVB A;  3SH9 A;  4ME4 A;  4LV3 A;  3EOI A;  1YAX A;  4JBF A;  2DRW A;  1VEU A;  3UNW A;  4UA6 A;  1WYB A;  4S2N C;  5EM0 A;  4WLA A;  3RH8 B;  3V39 A;  2Y8H A;  4EBN A;  2OV5 A;  4HH2 A;  4LRZ E;  4IED A;  2FH5 A;  5JYP A;  3SS4 A;  3PBS A;  4M4X A;  3KSI A;  2W3G A;  4MBH A;  3LEZ A;  4L9G A;  1ZHH B;  3EGX C;  4ZDX A;  4LCL A;  4WN5 A;  3M2K A;  4R23 A;  3BY8 A;  2JKT I;  1PRQ A;  4BD0 A;  3G32 A;  3MS6 A;  5EE8 A;  3PBN A;  2ZMA A;  2UV0 E;  3IWO A;  4EEU A;  2X02 A;  1HZO A;  1V9Z A;  5CTM A;  1YLT A;  3HJK A;  1S66 L;  4GHI A;  4QB8 A;  3BFD A;  4MN7 A;  1O7E A;  2QKP A;  3S1Y A;  5KZH A;  4ZJ1 A;  2Y4A A;  2A49 A;  1CQA A;  4QY6 A;  2RCX A;  4DE2 A;  2V0W A;  3VSL A;  1W63 M;  4P6Z S;  1O07 A;  4PHT A;  4EER A;  1Z6F A;  5HWV A;  3TRC A;  2ZQC A;  4OQI A;  3ZGA B;  4GD6 A;  5L07 A;  1S4R A;  4P6Z M;  4OON A;  3K3C A;  4DRT A;  5GLD A;  5CHM A;  1CI9 A;  5CED A;  2Y2G A;  1Q2Q A;  2Q9N A;  3T4S A;  3SH8 A;  2Z2L B;  3H7W B;  5D3O A;  1D1J A;  2QWS A;  5M1A A;  2WZZ A;  2W3D A;  1IYS A;  3G2Z A;  3G31 A;  2I9V A;  2WUQ A;  3ICY A;  4EBL A;  2Z6C A;  3H9W A;  3Q7Z A;  4I5S A;  2Y2L A;  2XRN A;  4XT2 B;  2BLS A;  3RXW A;  1T18 A;  1L2S A;  4EET B;  4K0X A;  4LGW A;  5FSR A;  4EQ1 A;  3EWK A;  4R38 A;  1G5U A;  3VMA A;  2A3U A;  3WS0 A;  2X71 A;  5FEF A;  4L0L A;  1L0D A;  4PM5 A;  4UAA A;  1LT0 A;  2VGL S;  4H6J A;  3O88 A;  3FPV A;  2VLG A;  1K38 A;  5A93 A;  4R3B A;  3HUO A;  3GEC A;  3MKF A;  4Y13 A;  3WS5 A;  1J3W A;  5HWT A;  4Y15 A;  1KGF A;  5HAI A;  4IUH A;  1E3U A;  1S4S A;  2MJ6 A;  5EVI C;  5CGS A;  3T4K A;  5DKL A;  1GSX A;  1JNU A;  2WKQ A;  4GD8 A;  2Q9M A;  3MZF A;  4Y2F A;  1K6S A;  4B9O A;  4HEF A;  3NI9 A;  4QWO A;  4LFU A;  4KG2 A;  5FQM A;  4XXR A;  1VET A;  3GSG A;  1JWP A;  3U4L P;  4ZTK A;  2Q0O A;  3LR3 A;  2OWH A;  2WGW A;  1GCE A;  1OT9 A;  1M6K A;  3UPO A;  1U60 A;  1XJ4 A;  1PZP A;  3C7U A;  5TBM A;  4IHQ A;  4DDS A;  4QHC A;  3GDI A;  1I2W A;  1MWT A;  3BM6 A;  2PYR A;  1T19 A;  1HD8 A;  3MKE A;  1K57 A;  5FQ9 A;  3V5M A;  3A3J A;  4IVK A;  3IXB A;  4KG5 A;  1DP6 A;  4PM6 A;  4FH2 A;  2VV8 A;  3N8S A;  4BEN A;  2RL3 A;  3IX8 A;  1IFQ A;  4L9E A;  3OC2 A;  1MWR A;  4HJ6 A;  3ZDJ A;  2Y55 A;  4ARZ B;  3UE6 A;  2HV1 A;  3MMH A;  3VE3 A;  2ZC5 B;  1EI5 A;  5AQ7 A;  3MXR A;  5JYO A;  3E98 A;  5K5B A;  4CLC D;  4I39 A;  5G4Y A;  3VFF A;  1KOU A;  3ZG5 A;  3Q1F A;  4IUK A;  3IS2 A;  1XFQ A;  4R3J A;  1NLZ A;  1F2K A;  3EQV A;  5GLA A;  4P85 A;  4DKI A;  4OPZ A;  4ZJ2 A;  2NUP C;  3DTI A;  1ONG A;  3LI8 A;  5J8X A;  4OQH A;  3UE1 A;  2P7J A;  2ZL1 B;  3UME A;  1IEM A;  2HP9 A;  4G3W A;  3E2L A;  3MFX A;  5EVE A;  3QNC A;  3C30 A;  4B93 A;  2Y2J A;  3VFH A;  5IT5 A;  3FC7 A;  3LI9 A;  1CF0 A;  4E3I A;  3OCL A;  1PI4 A;  1OTI A;  2ZBB A;  3VOZ A;  4DE1 A;  4JF4 A;  4E6W A;  4OOL A;  1YKD A;  3UDX A;  5TBM B;  3BLS A;  2HGV A;  4U3T A;  5E2E A;  2VGK A;  1Q2P A;  1PFL A;  2HP6 A;  2OAP 1;  5FAP A;  2L4R A;  1ESI A;  3C7V A;  3T12 B;  3BEB A;  3JVU A;  3TOI A;  4D60 A;  3TG9 A;  2WKE A;  2XDM A;  3FYZ A;  3ISG A;  1YLY A;  4JGP A;  3LY4 A;  1K55 C;  1W8Y A;  2J9O A;  3MZD A;  2CMN A;  1BZA A;  2XEP A;  2J8Y A;  5A91 A;  2HP5 A;  4JGR A;  4KZ5 A;  5I5L A;  3IBR A;  3G35 A;  2ZC7 A;  1I5Q A;  2H5S A;  1TVF A;  2BG1 A;  2ZQA A;  5KIZ A;  2LB9 A;  1NYM A;  1PWG A;  2GDN A;  3N8L A;  4GDN A;  5FAT A;  3LIE A;  4KUK A;  1W5D A;  1SCW A;  4QJG A;  4S2P A;  2J80 A;  1V9Y A;  3BLM A;  4R1G A;  1LHY A;  2PU4 A;  3G34 A;  1CEG A;  3T4L A;  1TS6 A;  5DTT A;  2INW A;  3C38 A;  4CLC B;  4YIN A;  2K31 A;  2H10 A;  1PI5 A;  1FCO A;  4YFM A;  2XFT A;  3CI6 A;  3GMW A;  4FD8 A;  4GDB A;  2FFF B;  4UA9 A;  3NDG A;  3FKW A;  3RJU A;  5TGF A;  4EU0 A;  3EEA A;  1K6R A;  2JKT M;  4ETX A;  5CGX A;  3HBR A;  2HZ5 A;  3FPW A;  4OLD A;  1STZ A;  2WKP A;  4FCF A;  2Y79 A;  3ZG8 B;  1ALQ A;  4KEN B;  2EWW A;  4Z1W A;  1JVJ A;  3BFG A;  1W63 Q;  3EGD C;  1F5M A;  2PR6 A;  2WGI A;  1BLC A;  3H82 A;  2BAS A;  3QHY A;  2YKH A;  5HX9 A;  4X25 A;  1MY8 A;  4HQA A;  3IWI A;  2ZC3 B;  4JXW A;  3JVV A;  1K57 C;  4KQQ A;  4LV0 A;  3GR2 A;  4S2J A;  2JKG A;  2EXA A;  4X69 A;  3NUL A;  4CLC E;  3LGO A;  1PWD A;  1FR1 A;  3EQU A;  1KDS A;  5J3W A;  1H8M A;  5E2F A;  5F83 A;  5FI7 A;  1L0F A;  2PU2 A;  3PXP A;  1BUE A;  1AXB A;  2XQZ A;  2Y2I A;  2H28 A;  2JKR I;  3IH8 A;  2WK0 A;  4WMC D;  3NCK A;  4N9K A;  2Y2M A;  4LRY C;  2XLN A;  2UWX A;  1MC0 A;  2EX2 A;  3N7W A;  1LL8 A;  4HJ4 A;  4UQI S;  3KX0 X;  1XA1 A;  5KMW A;  3T4J A;  3GV9 A;  1UGU A;  2VK3 A;  3N4I A;  3BW6 A;  5CHU A;  3KSG A;  4BBT A;  4DXC A;  4DXB A;  3WRZ A;  2WKR A;  4WZ5 C;  1TEM A;  1BLS A;  1P0Z A;  5CEB A;  1TS7 A;  5DFX A;  4DJ2 A;  3A3E A;  1WYC A;  3OPR A;  3C4O A;  1ERQ A;  5L2F A;  1Z09 A;  1YSQ A;  1ACF A;  4S2L A;  2HDQ A;  4EUV A;  3KSF A;  2OOL A;  5L09 A;  1MPL A;  2WKH A;  4KZ4 A;  2DCF A;  3QP5 A;  2OWJ A;  1G68 A;  3DW0 A;  1DJC A;  4NKP A;  3HLD A;  2GJ3 A;  2PD8 A;  4C75 A;  3L9K A;  3I7J A;  5M19 A;  5EVI B;  1OJ5 A;  5AQB A;  3IS2 B;  5DTS A;  5KSH A;  1EW0 A;  1N9L A;  1J9M A;  4FH4 A;  3HRE A;  4HES A;  3CAX A;  1H8Z A;  4F3L B;  3UE0 A;  4AFI A;  4LRX C;  5J4E A;  3ZCZ A;  1A0K A;  5IU1 A;  4E3O A;  1ZTU A;  4WZ5 A;  4LCM A;  3HLE A;  4QU3 A;  3S4X A;  4P87 A;  3LO7 A;  2QJ7 A;  3MBZ A;  1DRM A;  2ZM0 A;  4RX3 A;  2ZQ9 A;  2K2N A;  2YKF A;  3OBF A;  3UY6 A;  1GSV A;  2M1C A;  3Q81 A;  1YLP A;  3ZG7 B;  1TF1 A;  3K2N A;  4BD1 A;  4P0M A;  3D72 A;  3CUE C;  4Q0I A;  4OPQ A;  1UWP X;  2Y2N A;  4B4Z A;  1FQG A;  3L7H A;  5L10 A;  1PWC A;  3NDE A;  4Y0U A;  5I94 A;  1FCM A;  2EX9 A;  4X53 A;  4N1H A;  4KZ9 A;  5F6A A;  3KYE A;  3MR0 A;  1ZC2 A;  2JC7 A;  3WRT A;  2JHE A;  1YT4 A;  2QJ5 A;  3T4Q A;  5F69 A;  1Y4O A;  2P9V B;  3HLF A;  4ESP A;  3KO6 A;  4S2M A;  5IHV A;  4OP5 A;  3Q07 A;  3T50 A;  2XGN A;  2ZLY A;  2WKI A;  3IF6 B;  1ES4 A;  4Z9Q A;  2V8F A;  2KDK A;  3DBA A;  4JXV A;  5HW3 A;  2O9C A;  3DTK A;  1TDG A;  1F9I A;  1SDN A;  3MSH A;  4N92 A;  1LL5 A;  4UEY A;  3HLB A;  3PBO A;  1CJF A;  3BY9 A;  2EA9 A;  4WYY A;  3A3I A;  5AVE A;  3TW8 A;  1NWZ A;  1DJB A;  4IBX A;  2K7S A;  2CC1 A;  3HLW A;  1L0G A;  1KDW A;  1DJA A;  3T1S A;  2ZC6 B;  4MEZ A;  1OTA A;  5HDS A;  2ZOI A;  1S67 L;  3A0R A;  4E3M A;  4XT2 A;  1XP4 A;  2ZMV A;  1W79 A;  1JWZ A;  5EEC A;  4S2N A;  3DTM A;  4R6L A;  3ZVW A;  3CPT A;  1H8Y A;  5GLB A;  2JCH A;  4RVA A;  4GZB A;  5EUA A;  2W3E A;  3BWL A;  3CIT A;  4R3A A;  1CEF A;  3MJQ A;  4HJ3 A;  3BJN A;  3W4P A;  3MF0 A;  2A24 B;  4GS9 B;  1RP5 A;  1S1Z A;  2KLI A;  2JE5 A;  4XUX A;  4EQI A;  1D06 A;  4IJG A;  4HH3 A;  3ZQ5 A;  3G2Y A;  1VET B;  1JWV A;  5HAR A;  4R70 A;  2Y91 A;  4EES A;  3D3O A;  2V2F F;  3VP2 A;  5HZH A;  5CRF A;  1BLP A;  2ZQD A;  1P9R A;  3VSK A;  1XKZ A;  2P04 A;  4KZ8 A;  4MN5 A;  3UB5 P;  2VZW A;  1YM1 A;  2G2U A;  1KE4 A;  3BQA A;  3B42 A;  4NET A;  2ZMF A;  1VHM A;  2J3T C;  2PT7 A;  2B5R A;  2Y2P A;  1NRJ A;  2M7U A;  3F1P B;  4LV2 A;  1MKM A;  3VE4 A;  3HUN A;  1K25 A;  4PMA A;  1YLJ A;  5E2G A;  1DP9 A;  5AVF A;  3F1P A;  2VV7 A;  4Y0T A;  1NY0 A;  5G18 A;  3NY4 A;  3D4F A;  5KSC A;  5F5Y A;  3Q82 A;  2XA7 S;  2Z2M B;  1ERO A;  2VEA A;  4N9L A;  3SS3 A;  3PR6 A;  1ESU A;  3PAE A;  2X01 A;  4DF6 A;  3ZNT A;  3CPT B;  3CUE A;  3QP6 A;  5DTK A;  4FTX A;  3P98 A;  4BWI A;  3ZG0 A;  2IWD A;  3LFV A;  3G6O A;  3B33 A;  4E3J A;  2EFX A;  3B47 A;  3V67 A;  4BBV A;  2O0Y A;  1OTB A;  4WF0 A;  2ZQ8 A;  4UQI M;  4EUZ A;  3UMD A;  4F94 A;  5HDC A;  2IWB A;  5HSQ A;  2W0N A;  2HDR A;  2Y59 A;  3S7N A;  1IYO A;  3V3R A;  4K91 A;  5F1G A;  4NK3 A;  2H0T A;  2DMW A;  1BT5 A;  1G6O A;  1VEU B;  3EEH A;  4BL3 A;  1ODV A;  5HL1 A;  4UHU A;  2HPB A;  5EOE A;  4ID4 A;  2I72 A;  2J3T D;  1MWS A;  3QP2 A;  4X1L A;  4PPR A;  3V50 A;  2VJW A;  2D02 A;  5GL9 A;  1T1C A;  2B95 A;  1IYQ A;  5FEG A;  5M18 A;  2DNS A;  3MFD A;  1LSW A;  3JYI A;  4YOF A;  2FFY A;  5FQJ A;  4BLM A;  2EXB A;  4FOF A;  4DDY A;  3OPL A;  4X55 A;  2L1M A;  4C3Q A;  4MNR A;  3IT9 A;  4BBU A;  2EFU A;  4MBK A;  3NC8 A;  2GZA A;  5DJT A;  1HLU P;  2D01 A;  4NEE D;  1KE3 A;  2XF3 A;  3K3D A;  3OPP A;  4E04 A;  3GVB A;  5HDD A;  5TR7 A;  1G28 A;  5CGW A;  3IF5 A;  4WL9 A;  3N8R A;  4YWZ A;  3A3D A;  1VB6 A;  5IS1 A;  3DAV A;  4FUW A;  2QHK A;  3E0Y A;  1XFN A;  2WAE A;  1FCN A;  4MLL A;  1BUL A;  1XJ2 A;  2VGJ A;  2Y2K A;  2VA0 A;  4G3V A;  4GS9 A;  1N9O A;  5HD3 A;  3MXS A;  3DTE A;  4EV4 A;  5EVI D;  4OPR A;  2HF6 A;  2WGW B;  3NOU C;  1HTZ A;  1RCJ A;  1LSX A;  1GHI A;  4N1X A;  5EVI A;  3ZVT A;  4WBG A;  3IX4 A;  3BQ8 A;  2PAV P;  2B02 A;  3D9Y A; 
#chains in the Genus database with same CATH homology
 4X6T A;  1ZKJ A;  5EVL A;  3HL9 A;  5FAO A;  4EBL A;  3A3E A;  1WYC A;  5E2H A;  3OPR A;  1IKI A;  3Q7Z A;  4JF6 A;  1ZG4 A;  5GHX A;  1PW8 A;  2Y2L A;  3C4O A;  1ERQ A;  5L2F A;  3IWQ A;  1MWU A;  3BYD A;  2BLS A;  3RXW A;  3IHB A;  4ZJ3 A;  3FZC A;  2HDS A;  4S2L A;  2HDQ A;  2WZX A;  1L2S A;  4K0X A;  5FSR A;  3A3F A;  1SKF A;  1XGI A;  1EWZ A;  4ZBE A;  2V20 A;  1MPL A;  2WKH A;  4KZ4 A;  3SOI A;  2Y2O A;  2DCF A;  3VMA A;  2A3U A;  1G68 A;  4GKU A;  4GOG A;  3DW0 A;  1DJC A;  2XK1 A;  3WS0 A;  3ITA A;  3HLD A;  2X71 A;  4U0T A;  4L0L A;  4KZ6 A;  1L0D A;  4C75 A;  4PM5 A;  2ZC4 B;  3I7J A;  2V1Z A;  3B3X A;  4P6B A;  4UAA A;  4WM9 A;  5M19 A;  5EVI B;  2QPN A;  4KG6 A;  5FAS A;  3C4P A;  4GB7 A;  2ZJ9 A;  1LI0 A;  4H8R A;  5AQB A;  1LL9 A;  4E3K A;  1K4F A;  5DTS A;  1QMF A;  4JXS A;  5KSH A;  3O88 A;  1ZG6 A;  3HVF A;  4KQO A;  5DVA A;  4D2O A;  1K38 A;  4B88 A;  1J9M A;  2ZQ7 A;  4FH4 A;  3ZG9 B;  5A92 A;  1XX2 A;  3HRE A;  4HES A;  4R3B A;  1XXM A;  3HUO A;  5CHJ A;  5A93 A;  1H8Z A;  3MKF A;  3UE0 A;  2Y2Q A;  3WS5 A;  4A5R A;  3ZCZ A;  1BTL A;  4E3O A;  1KGF A;  5HAI A;  4DE3 A;  1E3U A;  4WZ5 A;  4K0W A;  4LCM A;  3HLE A;  3FKV A;  2IWC A;  4QU3 A;  3S4X A;  3WS2 A;  4WMC A;  4P87 A;  3LO7 A;  5EVI C;  3MBZ A;  5CGS A;  3IF6 A;  5FA7 A;  2ZM0 A;  4RX3 A;  2ZQ9 A;  3IQA A;  4XUZ A;  3BRM A;  4Y0O A;  3UY6 A;  1W8Q A;  4OP8 A;  3DWK A;  4R4S A;  3Q81 A;  4GD8 A;  2Q9M A;  3MZF A;  1K6S A;  1LLB A;  1N9B A;  1YLP A;  3ZG7 B;  4HEF A;  3NI9 A;  4BD1 A;  4C6Y A;  1RGY A;  3CG5 A;  4P0M A;  4S2I A;  4JF5 A;  5BOH A;  2XR0 A;  4KG2 A;  5FQM A;  5A90 A;  3GQZ A;  4OPQ A;  5HAP A;  4PM9 A;  4XXR A;  2Y2N A;  5FAQ A;  4B4Z A;  4BL2 A;  3GSG A;  4CJN A;  1JWP A;  3RXX A;  1FR6 A;  3UPP A;  1FQG A;  3V3S A;  4ZTK A;  1PWC A;  3NDE A;  1PZO A;  4Y0U A;  5I94 A;  2EX9 A;  1FCM A;  1K54 A;  3PBQ A;  2WGW A;  1ONH A;  1GCE A;  2QZ6 A;  4N1H A;  4X53 A;  4KZ9 A;  1M6K A;  4WEL A;  3LY3 A;  3UPO A;  1PW1 A;  1U60 A;  1TDL A;  1ERM A;  2H0Y A;  4E6X A;  1NZU A;  4RA7 A;  1NYY A;  3N6I A;  1PZP A;  1ZC2 A;  2JC7 A;  2J7V A;  1IYP A;  3C7U A;  3WRT A;  3VP4 A;  4DDS A;  4B4X A;  2R9X A;  4HBU A;  1XPB A;  1YT4 A;  4QHC A;  5FI2 A;  1I2W A;  4EWF A;  4OOY A;  2P9V B;  3HLF A;  1MWT A;  4S2M A;  4X68 A;  3BM6 A;  2OLV A;  1C3B A;  4OPY A;  5GHY A;  5IHV A;  5U47 A;  1HD8 A;  3LCE A;  1K57 A;  3MKE A;  3Q07 A;  2WYX A;  4OP5 A;  5FQ9 A;  3WS4 A;  4O7D A;  3V5M A;  4QY5 A;  2HDU A;  3A3J A;  1NRF A;  2XGN A;  4IVK A;  2XD1 A;  3IXB A;  2ZLY A;  2WKI A;  3IF6 B;  1ES4 A;  4Z9Q A;  4KG5 A;  1ES2 A;  4PM6 A;  2ZM2 A;  2OLU A;  4FH2 A;  2XH9 A;  5FI6 A;  4JXV A;  5AQA A;  1RGZ A;  5CER A;  5HW3 A;  3WS1 A;  2ZM8 A;  1K54 C;  1TDG A;  1SDN A;  3GTC A;  3PBT A;  4N92 A;  3VP0 A;  1LL5 A;  3N8S A;  3HLB A;  4BEN A;  3IHA A;  3PBO A;  2RL3 A;  2C6W B;  1M40 A;  3Q7V A;  1LI9 A;  4WYY A;  3A3I A;  1K56 A;  3FWL A;  3OC2 A;  1MWR A;  1DJB A;  3IH9 A;  1YLZ A;  3UDI A;  3ZDJ A;  3MZE A;  2Y55 A;  4IBX A;  2ZC5 B;  1EI5 A;  4HBT A;  5AQ7 A;  5DF9 A;  1KGG A;  2CC1 A;  3MXR A;  5JYO A;  3HLW A;  1L0G A;  1KDW A;  1DJA A;  4LEN A;  4JPM A;  2ZC6 B;  4MEZ A;  1GHP A;  3VFF A;  2G2W A;  1CI8 A;  3ZG5 A;  3Q1F A;  4X56 A;  4E3M A;  1XP4 A;  1W79 A;  1JWZ A;  5EEC A;  5TFQ A;  1OME A;  4S2N A;  3DTM A;  2P9V A;  5CXW A;  3ZVW A;  1H8Y A;  5GLB A;  1S0W A;  3OCN A;  5EPH A;  3W4O A;  4RX2 A;  2JCH A;  4R3J A;  4RVA A;  3EQV A;  3HLC A;  4GZB A;  5EUA A;  5GLA A;  3HUM A;  3UPN A;  1CEF A;  5DF8 A;  1YLW A;  3CJM A;  1VM1 A;  4QD4 A;  4FSF A;  3W4P A;  1W7F A;  1S6R A;  1K56 D;  1K4E A;  4P85 A;  5CTN A;  1SDE A;  4OQ0 A;  4DKI A;  4OPZ A;  4ZJ2 A;  3W4Q A;  4OH0 A;  1RP5 A;  1ONG A;  2R9W A;  3ITB A;  3Q7V B;  2PBY A;  2JE5 A;  1DY6 A;  4XUX A;  4EQI A;  5J8X A;  4OQH A;  3UE1 A;  1IEM A;  2HP9 A;  3S22 A;  3G2Y A;  3E2L A;  5CEB A;  1JWV A;  1XGJ A;  3QNC A;  5HAR A;  4PM7 A;  5E43 A;  2Y91 A;  1MKI A;  2Y2J A;  2V2F F;  3VFH A;  3DWZ A;  3VP2 A;  5CRF A;  1BLP A;  1NXY A;  5AQ9 A;  4OQG A;  2ZQD A;  2C5W B;  3BFF A;  3VSK A;  3C5A A;  3M6B A;  3NIA A;  1XKZ A;  4E3I A;  3OCL A;  1PI4 A;  4OKP A;  3PTE A;  1SHV A;  5FDH A;  3VOZ A;  4DE1 A;  3CMZ A;  3P09 A;  4S2O A;  4RYE A;  5FQI A;  4KZ8 A;  3AGE A;  4JF4 A;  4E6W A;  4OOL A;  1QME A;  3UDX A;  2WGV A;  2XFS A;  3BLS A;  2J9P A;  4U3T A;  2P74 A;  1YM1 A;  2G2U A;  1KE4 A;  2EX8 A;  3BEC A;  5E2E A;  2VGK A;  4DE0 A;  1BSG A;  5CEC A;  3ZFZ A;  1Q2P A;  5GHZ A;  1KVL A;  3PAG A;  4NET A;  2HP6 A;  5GLC A;  3UDF A;  5FAP A;  3C7V A;  1ESI A;  4UA7 A;  1PYY A;  2B5R A;  5FQQ A;  3O3V A;  2Y2P A;  2E8I A;  3BEB A;  4LV2 A;  3M2J A;  4IVI A;  3TOI A;  3HUN A;  3TG9 A;  1GHM A;  1K25 A;  2WKE A;  1E3U D;  2XDM A;  3FYZ A;  4PMA A;  1FOF A;  3ISG A;  1YLJ A;  1YLY A;  5E2G A;  4WEK A;  4BJP A;  2EX6 A;  1G6A A;  1ES3 A;  3LY4 A;  1K55 C;  1W8Y A;  1NY0 A;  4Y0T A;  2J9O A;  3MZD A;  5G18 A;  3NY4 A;  3IXG A;  1FSY A;  3D4F A;  1BZA A;  4E3L A;  1K55 A;  5KSC A;  1E4D A;  3Q82 A;  2Z2M B;  1IEL A;  2XEP A;  1ERO A;  2J8Y A;  4MBF A;  4N9L A;  5A91 A;  3SS3 A;  2HP5 A;  1ESU A;  3PAE A;  2X01 A;  4KZ5 A;  4GNU A;  4DF6 A;  3E2K A;  3UE3 A;  3ZNT A;  4Y7P A;  4R0Q A;  1JTG A;  5DTK A;  4WZ4 A;  1IKG A;  3G35 A;  2ZC7 A;  1I5Q A;  3NBL A;  3P98 A;  2H5S A;  1TVF A;  2BG1 A;  3AGD A;  2ZQA A;  1NYM A;  3ZG0 A;  4M3K A;  4E3N A;  2WAF A;  2IWD A;  3SH7 A;  1PIO A;  2QMI A;  1PWG A;  2GDN A;  3AGF A;  3IF6 C;  4PM8 A;  4E3J A;  4JKT A;  3OZH A;  3N8L A;  4GDN A;  4KZ3 A;  5FAT A;  2EFX A;  5FQK A;  3FV7 A;  3W8K A;  2ZQ8 A;  1W5D A;  4EUZ A;  1E25 A;  3BFE A;  4F94 A;  1SCW A;  4QJG A;  5DF7 A;  5EOO A;  4S2P A;  2IWB A;  3BLM A;  4R1G A;  2HDR A;  2Y59 A;  1LHY A;  2PU4 A;  1IYO A;  1NZO A;  2Y2H A;  3G34 A;  1CEG A;  1VQQ A;  3PBR A;  4OOM A;  3V3R A;  4K91 A;  1MXO A;  5F1G A;  4NK3 A;  2H0T A;  4JLF A;  1BT5 A;  1KGE A;  4JXG A;  5DTT A;  4BQM A;  4R4R A;  3WWX A;  4KZ7 A;  4YIN A;  4BL3 A;  1MBL A;  2H10 A;  1PI5 A;  4KZB A;  3ZHH A;  1HVB A;  1FCO A;  5HL1 A;  4UHU A;  3SH9 A;  5HFO A;  4LV3 A;  2HPB A;  4YFM A;  5EOE A;  4JBF A;  2DRW A;  3IXD A;  4ID4 A;  3UNW A;  2I72 A;  2XFT A;  4UA6 A;  3GMW A;  4FD8 A;  1MWS A;  3GRJ A;  4GDB A;  1WYB A;  2FFF B;  4S2N C;  1NJ4 A;  2OSU A;  4PPR A;  3V39 A;  4UA9 A;  1YMX A;  3V50 A;  3NDG A;  1KVM A;  3FKW A;  4IBR A;  5GL9 A;  4EBN A;  2OV5 A;  1IYQ A;  3BFC A;  3RJU A;  5M18 A;  3VP1 A;  2DNS A;  4IED A;  5TGF A;  3ZNY A;  5JYP A;  3MFD A;  3SS4 A;  3UN7 A;  3PBS A;  3JYI A;  3UO9 A;  2FFY A;  5FQJ A;  1K6R A;  4BLM A;  2EXB A;  4DDY A;  4MBH A;  5CGX A;  3HBR A;  3LEZ A;  3OPL A;  4U0X A;  4X55 A;  4ZDX A;  4LCL A;  4Q8I A;  1WE4 A;  3M2K A;  4R23 A;  4OLD A;  4C3Q A;  4FCF A;  5HAQ A;  3ZG8 B;  1GA9 A;  2ZD8 A;  1ALQ A;  4KEN B;  4MNR A;  1KE0 A;  3G32 A;  3IT9 A;  4BD0 A;  5EE8 A;  3PBN A;  4ZAM A;  1JVJ A;  2EFU A;  3BFG A;  4MBK A;  2ZMA A;  4KQR A;  3IWO A;  1H5X A;  3NC8 A;  2WGI A;  2X02 A;  1XA7 A;  1YQS A;  1BLC A;  1HZO A;  5CTM A;  3QHY A;  5HX9 A;  1YLT A;  1KE3 A;  1MY8 A;  2XF3 A;  3IWI A;  3OPP A;  2ZC3 B;  2JBF A;  3GVB A;  1K57 C;  3QNB A;  4JXW A;  4KQQ A;  4LV0 A;  3GR2 A;  3HLG A;  3VP3 A;  4S2J A;  4QB8 A;  5CGW A;  3BFD A;  5TR7 A;  2EXA A;  3IF5 A;  4X69 A;  1O7E A;  3N8R A;  3A3D A;  1PWD A;  3S1Y A;  5KZH A;  3O86 A;  1FR1 A;  3OPH A;  1GA0 A;  4OLG A;  3EQU A;  1KDS A;  4ZJ1 A;  2Y4A A;  2XD5 A;  2A49 A;  4OVD A;  5E2F A;  1CK3 A;  5F83 A;  5FI7 A;  1JTD A;  4S2K A;  5F1F A;  1L0F A;  2WAE A;  2RCX A;  4QY6 A;  4DE2 A;  3SS5 A;  3VSL A;  1FCN A;  4LV1 A;  2PU2 A;  4MLL A;  3G4P A;  1O07 A;  1BUL A;  1BUE A;  3G30 A;  2VGJ A;  1AXB A;  2Y2K A;  1ES5 A;  1Z6F A;  2XQZ A;  4EBP A;  2Y2I A;  2ZQC A;  4WEJ A;  4OQI A;  3MXS A;  3IH8 A;  3ZGA B;  2WK0 A;  1Y54 A;  1I2S A;  4GD6 A;  2WAD A;  4WMC D;  1BLH A;  3NCK A;  4N9K A;  2Y2M A;  1FSW A;  2XLN A;  2UWX A;  4OON A;  4DRT A;  4EV4 A;  5GLD A;  2EX2 A;  3N7W A;  5CHM A;  4OPR A;  5EVI D;  3O87 A;  1CI9 A;  3TSG A;  5CED A;  2WGW B;  2Y2G A;  1XA1 A;  1Q2Q A;  2Q9N A;  3VOY A;  5KMW A;  3IXH A;  5F82 A;  3SH8 A;  1HTZ A;  1RCJ A;  1N4O A;  1YMS A;  2Z2L B;  3GV9 A;  1GHI A;  5D3O A;  4GN2 A;  4N1X A;  4KZA A;  3M6H A;  5EVI A;  5M1A A;  1L0E A;  2WZZ A;  3N4I A;  1IYS A;  3G2Z A;  5CHU A;  3ZVT A;  4DXC A;  4DXB A;  3WRZ A;  4WBG A;  3G31 A;  4WZ5 C;  4CPK A;  1TEM A;  2WUQ A;  1BLS A;  3CZD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...