2H10A

Crystal structure of the m69v e166a double mutant of shv-1 b-lactamase complexed to tazobactam
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
265
structure length
265
Chain Sequence
SPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADERFPMVSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWATELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase SHV-1
publication title Effect of the inhibitor-resistant M69V substitution on the structures and populations of trans-enamine beta-lactamase intermediates.
pubmed doi rcsb
source organism Klebsiella pneumoniae
total genus 97
structure length 265
sequence length 265
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2006-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2h10A00
2WAEA 3JYIA 4H8RA 1BTLA 1IKIA 2UWXA 4Y0UA 1XGIA 3ZNTA 1SDEA 5EOEA 1TVFA 1ES2A 1JTDA 2G2UA 5CEBA 4OPQA 3V3SA 1BSGA 4BL2A 5JYPA 1NZOA 5FQQA 2JC7A 1EROA 5F1GA 4DDYA 4JKTA 4XXRA 1MXOA 5M1AA 5GLCA 1FCNA 4WMCA 3UDIA 5EOOA 1PWGA 3LY4A 1K25A 1PI5A 2R9WA 3WS1A 4DRTA 3IXHA 1L0DA 4X55A 5CRFA 1OMEA 5DTSA 5EE8A 3AGFA 2WADA 4L0LA 5CERA 5HARA 3UE3A 5AQ7A 3VOYA 3MZEA 1HVBA 2XQZA 2IWDA 1BLPA 3UE0A 4JXVA 4U3TA 3IF6A 3S1YA 4E3MA 4PM5A 1PWCA 3BECA 4B88A 4E6WA 2C5WB 3ZDJA 4KG5A 1J9MA 4NETA 1CI8A 3HUMA 3LY3A 5TGFA 5EVID 5A92A 1XX2A 3HREA 5FASA 3IXDA 2WAFA 4P87A 5CHUA 4LV1A 5E2HA 4C6YA 3FKWA 3LCEA 3Q82A 4XUXA 2Y2JA 3BM6A 3LEZA 5KSHA 2HDSA 4E6XA 3E2LA 2BG1A 3IT9A 4WZ4A 1KGFA 2H0TA 4O7DA 3SH9A 4WBGA 1XP4A 1FSWA 5CHMA 5HL1A 2A49A 5TR7A 1BT5A 5CGXA 1SCWA 1M6KA 2Y2NA 3AGDA 3NC8A 3P09A 4PPRA 3ZG8B 3M6BA 4BD1A 3HL9A 2P9VA 3VP3A 3ISGA 4OP5A 1MKIA 1KGGA 3A3IA 4S2NA 2IWCA 2XH9A 4PM7A 4BL3A 3G34A 2OLVA 2WKHA 3GV9A 4ID4A 3TG9A 1PZOA 3SOIA 3VSKA 3M2KA 2PBYA 5EVLA 2ZQDA 4QU3A 1HZOA 4P85A 2V20A 5DF7A 3S4XA 5HAIA 1YMXA 2EX6A 1BZAA 5A90A 2P74A 4C75A 4Q8IA 5HX9A 3ITBA 3OCLA 2ZD8A 2ZQ9A 5CECA 1JWZA 5DVAA 4C3QA 1IEMA 2CC1A 1YLYA 5EVIC 4ZBEA 1YLWA 3SH7A 2XLNA 5GL9A 3A3DA 3G35A 1DY6A 3CZDA 4ZTKA 5FAOA 3EQUA 4KZ9A 3W4OA 1LL9A 1BLHA 4OP8A 1KE3A 3DTMA 4DE3A 4IBRA 2ZC5B 3PBNA 2Q9NA 5AQAA 3WS4A 1N9BA 4KZBA 1MWRA 2DNSA 3VP0A 3M6HA 5G18A 3PTEA 1W8YA 1C3BA 2HDQA 4DF6A 1Q2PA 1CI9A 1M40A 2E8IA 2XDMA 5DTTA 2EXAA 4RA7A 4QHCA 4S2IA 4XUZA 3IHBA 3WS2A 4A5RA 3NI9A 4K0XA 3MKFA 3MFDA 2QPNA 3G31A 3BLMA 3N6IA 5HFOA 1RGYA 1KDWA 4GN2A 1ES4A 2XR0A 4R3JA 1ES5A 4GNUA 2Y2MA 2ZMAA 3UPOA 1RP5A 2Y2LA 3SS5A 4GOGA 4JF5A 3OPLA 3HLFA 5FDHA 4E3KA 4WMCD 2XD1A 3MXSA 2ZJ9A 1K55C 2H10A 4OQ0A 4ZJ1A 2WKIA 4K0WA 1GHPA 2V1ZA 2I72A 4OLDA 4UA6A 3SS4A 3GR2A 5M18A 2ZQ7A 3MBZA 2ZC4B 3CJMA 3N8RA 3GQZA 3V5MA 1XKZA 4GB7A 3O88A 1BUEA 1K38A 3BYDA 1U60A 3GTCA 3NDGA 4BQMA 4JPMA 4MBFA 3UPPA 3IF5A 3BFEA 3OCNA 4WM9A 4KG6A 4MNRA 5E43A 1TDLA 4RYEA 3VFFA 1PYYA 2HP5A 3BFGA 5FSRA 4JBFA 4ZJ2A 3HUNA 1MPLA 1K57C 3IWQA 2ZC7A 3PAGA 1K54C 1H8YA 4GZBA 5CHJA 3MXRA 2HP6A 4HBUA 2PU4A 4UA7A 5FAQA 1E3UA 4BD0A 4IVIA 2WZXA 2HP9A 1XA7A 2Z2MB 1IYPA 4KZ4A 2Y91A 3A3EA 1BULA 1QMFA 1WE4A 3ZHHA 1XGJA 2EX2A 4WEKA 1W79A 1LLBA 3B3XA 3E2KA 4HEFA 4EWFA 4YFMA 2RCXA 4S2JA 4EBLA 1IKGA 1ESUA 1ONHA 2XK1A 2BLSA 1HD8A 1MWUA 4KZ8A 3HBRA 3GRJA 3OPHA 2X02A 4OVDA 3C7VA 3W4QA 1H5XA 3Q07A 2ZLYA 4KG2A 1ALQA 2G2WA 2XD5A 1YLTA 4S2LA 3V50A 1LI0A 4CPKA 3PBSA 1W5DA 1KE4A 1IELA 1SDNA 4FD8A 4WZ5C 5DF9A 3VP4A 3Q81A 3UN7A 1ESIA 3BFDA 1SKFA 4QY6A 1NY0A 4NK3A 3I7JA 3QHYA 2QZ6A 2H5SA 2QMIA 5AQBA 2WGIA 4JXSA 1XXMA 1Y54A 3FWLA 1FOFA 2Y2PA 3EQVA 1ES3A 3ZNYA 3N8SA 4R1GA 3TOIA 2A3UA 3CG5A 4IVKA 4X68A 3C4PA 4R3BA 4P6BA 4DDSA 4EV4A 2H0YA 3Q7VA 1O7EA 2ZQAA 4QD4A 2VGKA 5EECA 1GA0A 2FFYA 2Z2LB 4EBPA 4E3LA 4R23A 1NRFA 3HLDA 4PM9A 3IWIA 3WRTA 4E3NA 3ZG0A 1TDGA 3DWZA 4OPYA 1I5QA 3UDXA 4YINA 3ZVWA 5F1FA 2EX9A 1GHIA 4U0TA 3OPRA 5CGWA 2HPBA 3Q7ZA 2WZZA 5D3OA 4F94A 4RVAA 2XEPA 4JXWA 1O07A 4Y0OA 3RXXA 4CJNA 2GDNA 2ZQ8A 4Y0TA 3G30A 1IYSA 1CEFA 5HAQA 1DJCA 4OOYA 3IF6B 2Y2IA 3NIAA 3BFFA 4S2PA 3MKEA 3V3RA 4WELA 4JLFA 4GDNA 2JBFA 1SHVA 3VP2A 1K6RA 4KQOA 3V39A 1K56A 4DE2A 1W7FA 1Z6FA 2HDRA 4IBXA 4MLLA 5FAPA 3SS3A 2Y59A 5E2EA 3UNWA 4MEZA 3W4PA 2XGNA 3OZHA 2Y2HA 1ZG4A 5GLAA 1Q2QA 2WYXA 1QMEA 4FH4A 4N92A 1KE0A 1W8QA 2ZQCA 4PM8A 4UA9A 1GA9A 4WEJA 4JXGA 4R0QA 2ZC6B 4GD8A 1JWVA 4MBKA 3FKVA 1NJ4A 1ERMA 4LV0A 4PM6A 1MBLA 3LO7A 4Z9QA 1JWPA 2P9VB 5CTMA 3NDEA 1DJBA 3G2ZA 2JCHA 5L2FA 1K55A 3VP1A 3HLCA 1PWDA 2C6WB 3OPPA 1MWSA 4ZAMA 5IHVA 3Q1FA 3BEBA 1FCOA 3BFCA 5DF8A 3FZCA 3M2JA 4E3OA 1E3UD 2Y55A 3PBOA 3S22A 4OQHA 3O86A 4LENA 1NXYA 2X71A 1EI5A 3G4PA 3PAEA 2J7VA 4OKPA 4DXCA 5F83A 1TEMA 4X6TA 2J9PA 5E2FA 4BENA 1VM1A 4KZ3A 5FI7A 4KZ6A 2WK0A 1FQGA 3D4FA 1K57A 4GKUA 4B4XA 1DJAA 1K54A 3HLBA 4GD6A 1E25A 1VQQA 4DE0A 5A93A 4FSFA 4OPRA 1I2WA 4DE1A 2ZM0A 2VGJA 4R4RA 2OSUA 4LCMA 5FA7A 1YQSA 2J9OA 3ZGAB 3IQAA 3N7WA 1HTZA 1JTGA 1L0EA 1MWTA 4IEDA 1YLJA 3RXWA 4RX3A 1ZG6A 4E3IA 5EUAA 2JE5A 3MZFA 3WRZA 1NYMA 2ZM2A 3ZFZA 4OOMA 5E2GA 1YT4A 2WKEA 2X01A 2PU2A 3A3FA 3OC2A 5GHZA 5HW3A 1EWZA 3IWOA 5KMWA 3DWKA 3BLSA 3N4IA 3IXBA 1KVMA 2WUQA 4ZDXA 5JYOA 1YLPA 1ZC2A 4KQQA 3ITAA 5FATA 5KZHA 2Y2GA 1XPBA 2V2FF 4N9KA 4RX2A 1KDSA 4E3JA 4KZ5A 1BLCA 1PZPA 3N8LA 5HAPA 3MZDA 1CK3A 3PBTA 4HESA 4WZ5A 4OPZA 5GLDA 3IF6C 5FQ9A 3HLGA 3O3VA 5CGSA 1JVJA 1RGZA 3O87A 1AXBA 2WGVA 4UHUA 4X56A 3NY4A 4FCFA 3CMZA 4S2KA 3HLWA 1E4DA 4B4ZA 4BJPA 1K4EA 4JF6A 4P0MA 3GSGA 4OQIA 2RL3A 1ERQA 3QNBA 5I94A 1LI9A 2J8YA 4EUZA 3QNCA 4QB8A 5AQ9A 3C7UA 3BRMA 5KSCA 5FI6A 3ZVTA 3AGEA 1K4FA 1GHMA 5J8XA 4UAAA 4DXBA 3PBQA 3G2YA 1K6SA 4S2MA 1L0FA 5F82A 3UE1A 4KZAA 1YM1A 3ZG9B 3HUOA 3NBLA 3NCKA 5A91A 3SH8A 2EX8A 1L0GA 4FH2A 2DRWA 3WS5A 3FV7A 1K56D 5FQJA 4EBNA 1I2SA 2WGWA 5EVIA 2OV5A 3UY6A 2EFUA 3IH9A 5U47A 1KGEA 4QJGA 4QY5A 4OH0A 4S2NC 1N4OA 1IYQA 2Y2KA 1WYBA 3IHAA 1FR6A 1BLSA 3UO9A 3PBRA 4HBTA 3VMAA 5GLBA 3IH8A 1MY8A 1S6RA 4BLMA 4EQIA 2OLUA 5FQMA 3C4OA 1G68A 4K91A 2Y2QA 4D2OA 2B5RA 1YLZA 4JF4A 4N1HA 1NZUA 3HLEA 1PW1A 3FYZA 4OLGA 1ZKJA 3GVBA 2DCFA 2FFFB 1ONGA 1LL5A 4X53A 5FQKA 4LCLA 4LV2A 4KENB 1L2SA 4OOLA 3VOZA 2IWBA 2EXBA 5EPHA 1PI4A 1LHYA 4WYYA 3UPNA 5CXWA 3GMWA 3WWXA 5CTNA 3G32A 2EFXA 3IXGA 1PIOA 4DKIA 4PMAA 3RJUA 3WS0A 5GHYA 1FSYA 4OONA 3ZG7B 1FCMA 4S2OA 4ZJ3A 4MBHA 5FQIA 1GCEA 4N1XA 4X69A 3VSLA 5M19A 3UDFA 4GDBA 5FI2A 3ZCZA 3DW0A 5TFQA 3Q7VB 1KVLA 1YMSA 1NYYA 4KQRA 5DTKA 1H8ZA 1XA1A 2ZC3B 1FR1A 5GHXA 2XFTA 4Y7PA 5BOHA 2XF3A 2Y4AA 1S0WA 1IYOA 2Y2OA 2HDUA 3HVFA 4LV3A 4KZ7A 1G6AA 2R9XA 2Q9MA 2XFSA 4U0XA 1WYCA 2WGWB 3A3JA 1RCJA 4R4SA 5EVIB 3W8KA 5CEDA 3VFHA 3P98A 3ZG5A 3TSGA 4M3KA 3C5AA 4OQGA 1PW8A 4N9LA 2ZM8A 1CEGA
chains in the Genus database with same CATH superfamily
2WAEA 5FDSA 4DMZA 4NKPA 4F3LA 1IKIA 2HF6A 3VE3A 5EOEA 3ZQ5A 5JYPA 5FQQA 2JC7A 1F98A 3D3OA 5M1AA 5GLCA 4WMCA 5EOOA 1PWGA 1PI5A 2R9WA 4R6LA 3WS1A 4DRTA 3IXHA 2FH5A 4H6JA 5CRFA 5DTSA 4MMNA 4PAUA 5HARA 3MZEA 1HVBA 2XQZA 2IWDA 1TS7A 4WLAA 1BLPA 4E3MA 1PWCA 5MC7A 4KG5A 2P08A 3LY3A 3IS2A 5A92A 1CQAA 3A0SA 3IXDA 3NOUC 5E2HA 3NECA 3LEZA 2HDSA 3OBFA 4WZ4A 3C2WA 2Q0OA 4EEPA 5CHMA 3BJNA 2A49A 1M6KA 1LSWA 1TS6A 3UE6A 2P9VA 4EERA 3ISGA 4OP5A 5HD3A 4WL9A 1KGGA 4PM7A 3GV9A 2OLVA 3LI9A 3VSKA 3M2KA 4QU3A 4P85A 2V20A 3QP6A 3S4XA 5HAIA 3K2NA 5HX9A 2ZD8A 1JWZA 4C3QA 1YLYA 4ZBEA 3IX8A 3G35A 1DY6A 3EQUA 2O9BA 3W4OA 3IX3A 4DE3A 4R3AA 5AQAA 3WS4A 4KZBA 1MWRA 1W8YA 1C3BA 1Y28A 4ETXA 1M40A 4B93A 2EXAA 3NOPC 3MR0A 4RA7A 3LIDA 3IHBA 4K0XA 3MFDA 2WKRA 3BLMA 3N6IA 3H82B 5HD5A 1K0KA 2HJ9C 1KDWA 1XJ3A 4DJ2A 2XR0A 2VEAA 4GNUA 2JKRM 2VV7A 1S1YA 4I3AA 1NWZA 2H10A 3JPUA 4L9GA 1GSXA 4HP4A 3CJMA 3GQZA 1BUEA 2ZBBA 4NEED 1LT0A 3RH8B 2I9VA 5FSRA 1MPLA 3IWQA 1K54C 1LSVA 5CHJA 3LFVA 3MXRA 4HBUA 4UA7A 2XA7M 3LUQA 1XA7A 1V9ZA 1QMFA 1WE4A 3ZHHA 1W79A 3B3XA 3E2KA 4S2JA 2XK1A 1MWUA 3IX4A 3C7VA 3Q07A 3LEQA 2ZMVA 3TRCA 4S2LA 3V50A 1SDNA 4FD8A 1N9OA 1CJFA 2BASA 3VP4A 3HJIA 3UN7A 4BBVA 3E4QA 1FOFA 4LFUA 2JKRI 2M7VA 4EV4A 2VZWA 4QD4A 2VGKA 2Z2LB 2VV6A 3F1PB 3IBJA 4HH2A 4OPYA 1G5UA 2W1RA 3OPRA 5CGWA 2B02A 2EWWA 2HPBA 2WZZA 4JXWA 4Y0TA 2INWA 4OOYA 3IF6B 3MSHA 3NIAA 4WF0A 3BFFA 4WELA 4HJ4A 1K6RA 2GNXA 1K56A 3H7WA 1Z6FA 3SS3A 4EUVA 1H0MA 2XGNA 3OZHA 1ZG4A 4G3VA 1Q2QA 2WYXA 4II7A 2OAP1 3DTKA 3B42A 3GDIA 1GA9A 4L9FA 4HJ3A 3T1RA 3FPWA 1NJ4A 4PM6A 3LO7A 4Z9QA 3NDEA 3RTYA 4O0PA 3R4KA 1PWDA 1F5MA 3Q1FA 2L1MA 5DF8A 3FZCA 1E3UD 3P7NA 2D02A 4OKPA 5E2FA 5J4EA 5FI7A 5HL6A 1FQGA 4GKUA 4LPZA 4DE0A 1NLZA 4R4RA 1STZA 4LCMA 2J9OA 2JKFA 2VA0A 3NJAA 2Y8HA 5AVEA 4EW7A 3UB8A 1YT4A 2NUTC 4MN7A 3A3FA 1HLUP 3DTIA 3BLSA 3S7PA 3CPTB 4KQQA 4Q0IA 5FATA 5KZHA 2XROA 1XPBA 4RX2A 3N8LA 1CK3A 3PBTA 3UB9A 4WZ5A 4OPZA 2M7UA 5GLDA 2HZ5A 5FQ9A 3O3VA 5CGSA 1E4DA 1SKOA 4BJPA 4I5SA 4P0MA 4OQIA 2RL3A 5I94A 4K08A 4QB8A 1S4RA 4LLOB 5EFWA 2K31A 1K6SA 4KZAA 1YM1A 3ZG9B 3HUOA 3NBLA 3SH8A 4EESA 2DRWA 5FQJA 2WGWA 3UY6A 5U47A 4QY5A 1V9YA 3MXQA 1IYQA 3LIFA 1WYBA 2OWJA 3UO9A 4MN5A 5L09A 3S7OA 1S6RA 1ODVA 4N1HA 2O0YA 3HLEA 4OLGA 1ZKJA 1LL5A 1XFNA 2KX6A 4X53A 2NUPC 4KENB 2EXBA 1UWPX 3WWXA 5CTNA 3IXGA 5GHYA 4OONA 3ZG7B 4S2OA 4ZJ3A 4MBHA 4X69A 3TE8A 3UDFA 1N9NA 5FI2A 5TFQA 4B9OA 1NYYA 4UQIS 4Y7PA 2XF3A 2HDUA 3DTEA 4LV3A 1G6AA 4U0XA 2Q9MA 3FC7A 5EVIB 4RQ9A 5CEDA 3P98A 3ZG5A 2LB5A 3MF0A 3R7WB 4H8RA 3P01A 1X0OA 2KOIA 3TJZC 2UWXA 3ZNTA 2XRNA 4GHIA 3V3SA 1DP9A 4KUKA 2H28A 4DDYA 1MXOA 3VV4A 4Y3IA 1K25A 2ZL1B 2O9CA 1OMEA 3AGFA 2WADA 3LR5A 3CAXA 3VOYA 4DN0A 2PDRA 4JXVA 3IF6A 2VGLS 3ZDJA 5HPIA 3QP5A 5F68A 3HREA 5FASA 4NG2A 4P87A 3BW6A 3CUEA 5TBMB 4C6YA 4ETZA 3LCEA 1YAXA 2Y2JA 5KSHA 1LL8A 3E2LA 2BG1A 3OLOA 4O01A 2J3TD 1BT5A 2V9AA 5CGXA 3BQ8A 4PPRA 3AGDA 3P09A 5DFYA 3ZG8B 1TS0A 3G6OA 4BD1A 1DP6A 1MKIA 2GJ3A 3A3IA 4S2NA 1H8MA 3TG9A 3SOIA 2PBYA 2ZQDA 1S4SA 2W3EA 5FL3A 4BBTA 2JKTM 3OCLA 2ZQ9A 1VETB 1PRQA 5GL9A 2VX8A 5FAOA 4OP8A 1KE3A 4IBRA 3MJQA 3PBNA 2JKGA 4ARZA 3VP0A 2DNSA 3BQAA 3M6HA 1Q2PA 1CI9A 2XDMA 2O9AA 4QHCA 2PAVP 3FG8A 4XT2B 5HSQA 3PR6A 4XUZA 3NI9A 5HPFA 3OOVA 3CPTA 3G31A 4QPRA 5HFOA 2AVXA 4R3JA 2Y2MA 3UPOA 3T4JA 2Y2LA 4GOGA 5FDHA 4X25A 2B18A 1T18A 1S67L 4OQ0A 5DJUA 2K7SA 2I72A 4UA6A 3SS4A 3GR2A 2ZQ7A 3K3DA 2ZC4B 3N8RA 3V5MA 1K38A 3BYDA 3QP4A 3NDGA 1D1JA 4MBFA 3U2AA 3IF5A 4WM9A 5E43A 3MMHA 1D06A 1ZHHB 4ZJ2A 2ZOIA 2ZMFA 2PU4A 5FAQA 1E3UA 4BD0A 4MN6A 1H3QA 2HP9A 3KYQA 3A3EA 3C8CA 1P97A 1BYWA 4EBLA 1ONHA 1HD8A 3GRJA 2X02A 4WUJA 4CLCE 3W4QA 3HCYA 1H5XA 4KG2A 2P7JA 4HNBA 1LI0A 4GS9B 1W5DA 1IELA 4WZ5C 3BFDA 3I7JA 4JGOA 3QHYA 3JVVA 2QZ6A 1Y4OA 5AQBA 3FWLA 3N8SA 3TOIA 3C38A 1VHMA 3UMDA 4X68A 3C4PA 2ZQAA 5EECA 4PM9A 3T4TA 1TDGA 1I5QA 4EETB 2EX9A 1GHIA 4U0TA 5HDDA 5L10A 3Q7ZA 3R7WA 5D3OA 4F94A 4KUOA 3EGDC 3O5YA 2ZQ8A 4S2PA 3MKEA 4JLFA 1SHVA 4DE2A 2Y59A 5E2EA 3PYPA 2ZL1A 4FH4A 1QMEA 4MDZA 4PHTA 3E4OA 1W8QA 2ZQCA 4WEJA 4R0QA 2PRFA 3KO6A 1UWNX 3FKVA 1ERMA 1LSXA 3G2ZA 1K55A 3F1OB 2HGVA 3HLCA 1MWSA 3BEBA 1FCOA 5TBMA 2Y55A 2VV8A 2X71A 2J7VA 2J9PA 1VM1A 2PR6A 4KZ6A 2W1TB 4B4XA 1DJAA 4GD6A 3HLBA 3PHYA 4FSFA 2PHYA 1G6OA 4DE1A 2OSUA 3ZGAB 3IQAA 4UQIM 3JVUA 1JTGA 4OOMA 1YSQA 2L0WA 2WKEA 2PU2A 3IWOA 5EM0A 2EWVA 1KVMA 3L7HA 4ZDXA 3UB7A 1KDSA 1BLCA 5HAPA 3T4OA 3LI8A 3IF6C 1JVJA 1RGZA 4R70A 1AXBA 2WGVA 4UHUA 3E4PA 4FCFA 3HLWA 4B4ZA 4JF6A 1ZTUA 3GSGA 1MKMA 2W3HA 4XT2A 3CUEC 5HWVA 5AQ9A 3ZVTA 1GHMA 1YKDA 5HWTA 3KX0X 1L0FA 5F82A 1GSVA 3BY8A 3LYXA 3WS5A 3FV7A 2VGLM 1CF0A 3IH9A 1T19A 4I3JA 4EEUA 4S2NC 3PBRA 4Y5FA 1W63M 2OLUA 3C4OA 4GJ4A 2B5RA 1YLZA 1XJ4A 2V8FA 2CMNA 5DKKA 3FYZA 1FILA 5FQKA 4LV2A 1L2SA 4IUHA 4OOLA 1LHYA 4WYYA 2PT7A 1T1BA 3T50A 3NOTC 1GCEA 4IUKA 3VSLA 3F1NB 4GDBA 3QP2A 1PNEA 3Q7VB 1KVLA 4KQRA 5DTKA 1H8ZA 2LB9A 1FR1A 4GS9A 2R9XA 5L8MA 3A3JA 4R4SA 3W8KA 3NULA 3VFHA 1D7EA 4NXEA 1WA9A 1CEGA 4HH3A 4X1MA 3C30A 1XGIA 4CLCD 1ES2A 1JTDA 2G2UA 5CEBA 3U4LP 1NZOA 3CITA 1EW0A 5IU1A 5EE8A 4FTXA 3UE3A 3DBAA 5F5YA 4U3TA 3S1YA 4PM5A 2C5WB 4NETA 1J9MA 1CI8A 3HUMA 5TGFA 5EVID 1XX2A 2WAFA 4G3KA 2W3FA 3BM6A 2K2NA 3IT9A 3EGXC 4O7DA 3H82A 3SH9A 1FSWA 5TR7A 2Y2NA 1SZVA 4BBUA 2OAQ1 3M6BA 4QWOA 2W3DA 3F1OA 4ME4A 2XH9A 4BL3A 2WKHA 1PZOA 5EVLA 1HZOA 2XSSA 5A90A 4C75A 3KSHA 2J80A 1IEMA 5EVIC 3KSIA 1KOUA 3SH7A 3A3DA 3CZDA 2W1TA 1LL9A 5DFXA 2ZC5B 4CLCB 2Q9NA 5G18A 3PTEA 2PR5A 4NXFA 3CI6A 4DF6A 5AJGA 3IS2B 2FZ0A 3TW8A 5CX7A 4KQDA 3MKFA 2QPNA 2PYRA 4L9EA 1RGYA 1TS8A 2E8JA 1F9IA 1ES4A 2HV1A 4GN2A 4AFIA 1IOUA 1ES5A 2ZMAA 1RP5A 3SS5A 3OPLA 4E3KA 3MXSA 2V0WA 2ZJ9A 1K55C 3CHWP 5J3WA 3CWFA 2WKIA 3LR4A 2V1ZA 4G3WA 4GLQA 5M18A 4BMWA 2O99A 4GB7A 4BQMA 4JPMA 3UPPA 3BFEA 3OCNA 4KG6A 4MNRA 3F1PA 4RYEA 4JBFA 3HUNA 2ZC7A 3PAGA 1H8YA 1ACFA 2HP6A 2WKPA 4HI4A 2G7UA 4JGRA 2Z2MB 1IYPA 1XGJA 1J3WA 4WEKA 1F2KA 4YFMA 2RCXA 1ESUA 4LGWA 4P6ZS 1XJ6A 1ALQA 3SW1A 1YLTA 4CPKA 5DF9A 2P04A 1OTDA 5G4YA 1NY0A 4NK3A 2H5SA 4DJ3A 2WGIA 4JXSA 1Y54A 3QP8A 1VEUB 3EQVA 3ZNYA 5K5BA 4R1GA 2QJ7A 4O8GA 5EV0A 3F1NA 4R3BA 4WN5A 4P6BA 4DDSA 3Q7VA 1O7EA 2FFYA 3EOIA 1NRFA 3HLDA 3WRTA 3LIEA 4E3NA 3MQQA 3UDXA 2V8CA 2PYPA 3ZVWA 5F1FA 1OJGA 1S1ZA 3KYZA 1YSPA 1OPXA 1O07A 3T1XA 2J3TC 2Y2IA 3V3RA 3KSGA 3MQ0A 2JBFA 3VP2A 3V39A 5FAPA 2W0NA 5EM1A 4MEZA 5DKLA 3B47A 4N92A 1KE0A 1IFQA 2V1AA 4Y2FA 2ZC6B 4GD8A 1JWVA 5LBRA 4LV0A 3CLOA 1GSWA 1JWPA 5CTMA 3T4QA 2JCHA 5L2FA 3T12B 2BTFP 3OPPA 4ZAMA 5IHVA 2MJ6A 3M2JA 4E3OA 4OQHA 1NXYA 3G4PA 3PAEA 5F83A 2A24B 1G28A 2WK0A 4UEYA 1T1CA 3D4FA 1K57A 1VQQA 2JKTI 4HQAA 1I2WA 2ZM0A 2GX5A 5FA7A 2PBDP 3N7WA 3RXWA 5EUAA 2JE5A 3MZFA 5A8BA 3WRZA 1NYMA 2IA2A 5HDSA 3ZFZA 3LR3A 3H7WB 5E2GA 3OC2A 1MZUA 3DWKA 2WUQA 5JYOA 1YLPA 1ZC2A 2V2FF 4N9KA 4E3JA 4KZ5A 3MZDA 2WKQA 2D01A 4CLCA 2J3WA 3LGOA 3HLGA 3O87A 4YWZA 3SZTA 4S2KA 1DRMA 3H9WA 3FPVA 1ERQA 1LI9A 2J8YA 4EUZA 3BRMA 1OT6A 5KSCA 5FI6A 1K4FA 5G4ZA 3PBQA 4S2MA 4ESPA 3NHQA 2EX8A 2VLGA 2QJ5A 4EXOA 4EBNA 1I2SA 5TJJA 5EVIA 4HHDA 3LICA 2EFUA 1OTEA 4Y15A 2VKSA 1KGEA 4E04A 4QJGA 2HJEA 1N4OA 3A0RA 1FR6A 3VMAA 4HBTA 5GLBA 5F6AA 4GW9A 5L07A 5FQMA 1G68A 2JN7A 2Y2QA 2YKFA 2W27A 1NZUA 4HJ6A 2QKPA 3GVBA 2FFFB 1ONGA 4D60A 4LCLA 2IWBA 3VOLA 1PI4A 4I3IA 3UPNA 1P9RA 3GMWA 3G32A 2EFXA 4PMAA 3RJUA 2QWSA 3WS0A 1SKOB 1FSYA 5DJTA 5FQIA 1S66L 2W3GA 5M19A 3EWKA 4MCWA 3DW0A 1YMSA 1XA1A 2KLIA 2ZC3B 3E0YA 5BOHA 2Y4AA 1S0WA 3HVFA 4KZ7A 2XFSA 1WYCA 2R78A 2WGWB 3V67A 2V1BA 1AWIA 1VEUA 3KSFA 3JYIA 1BTLA 1P0ZA 4YNRA 4Y0UA 1SDEA 1TVFA 4OPQA 1BSGA 4BL2A 1EROA 5F1GA 4JKTA 4XXRA 1FCNA 1VETA 3UDIA 3LY4A 1L0DA 4X55A 5CERA 4L0LA 5AQ7A 4I38A 3UE0A 1NRJA 3BECA 4B88A 4E6WA 3B33A 2L4RA 3ULFA 1TF1A 3MS6A 5CHUA 4LV1A 3FKWA 3Q82A 4HIAA 4XUXA 3UB5P 4E6XA 1KGFA 2H0TA 4WBGA 1XP4A 5HL1A 1SCWA 2GZAA 4M4XA 3BY9A 3NC8A 4NXBA 1XFQA 3HL9A 3VP3A 4P6ZM 2VK3A 4LRZE 2IWCA 3G34A 4JGQA 4ID4A 3T4SA 4GHIB 5DF7A 1YMXA 2EX6A 1BZAA 2P74A 4Q8IA 2A24A 3S7QA 3ITBA 5CECA 5DVAA 5C5KA 2CC1A 4LRXC 1YLWA 2XLNA 4ZTKA 1A0KA 4KZ9A 4Q0JA 1BLHA 2B95A 3DTMA 5AVFA 1N9BA 4HOIA 3ZYTA 2HDQA 4IHQA 2E8IA 5DTTA 4S2IA 5HZHA 2KDKA 3WS2A 4A5RA 1PFLA 4CQHA 1L3LA 1OJ5A 4JF5A 5FEGA 3HLFA 5EVEA 4WMCD 2XD1A 3D9YA 4ZJ1A 4K0WA 1GHPA 2EA9A 3EEHA 4OLDA 2YKHA 4R38A 2ACGA 3MBZA 1XKZA 1VB6A 3O88A 3GTCA 1TD5A 1U60A 3BWLA 3A0VA 3VFFA 1TDLA 1PYYA 2HP5A 3BFGA 1K57C 4NXGA 4GZBA 3UB6A 4HP9A 4IVIA 2WZXA 4KZ4A 2Y91A 3T1SA 4ARZB 1BULA 2EX2A 3LR0A 1LLBA 4HEFA 4EWFA 1IKGA 2BLSA 4KZ8A 3HBRA 3OPHA 4OVDA 1FIKA 2ZLYA 2G2WA 2XD5A 5F69A 2A2LA 3PBSA 1KE4A 4CLCC 3Q81A 1ESIA 1SKFA 4QY6A 2QMIA 1OTIA 4FUWA 1XXMA 2V0UA 2Y2PA 1ES3A 4JGPA 4F3LB 2A3UA 3CG5A 4Q0HA 4IVKA 2H0YA 3UMEA 3GECA 1OT9A 1GA0A 4EBPA 4E3LA 4R23A 3IWIA 3K3CA 4IJGA 3ZG0A 3DWZA 4YINA 4H6JB 3MQOA 4RVAA 2XEPA 2PD8A 4YOFA 4Y0OA 3RXXA 4CJNA 2GDNA 3G30A 1IYSA 1CEFA 5HAQA 1DJCA 5IS1A 4GDNA 2ZOHA 4KQOA 1W7FA 2HDRA 4IBXA 4EQ1A 4MLLA 3UNWA 3W4PA 4LRYC 2Y2HA 5GLAA 4PM8A 4UA9A 2M1CA 4JXGA 3E98A 3DAVA 4MBKA 2OWHA 4Y17A 1MBLA 1T1AA 2P9VB 1DJBA 3VP1A 5IT5A 2C6WB 3KYEA 3MFXA 3BFCA 3ICYA 2XA7S 3PBOA 4ZRRA 3S22A 3O86A 3VE4A 4EU0A 4LENA 1EI5A 2OOLA 4DXCA 1TEMA 4X6TA 3D72A 3RFBA 4BENA 4KZ3A 2QHKA 1MC0A 2Y79A 2UV0E 1K54A 1E25A 1OTAA 5A93A 4OPRA 1W63Q 2VGJA 1XJ2A 1YQSA 2Z6DA 1HTZA 4IEDA 1L0EA 1MWTA 1YLJA 4E3IA 4RX3A 1ZG6A 2ZM2A 1NLYA 4BWIA 3HJKA 2X01A 5GHZA 5HW3A 1EWZA 5KMWA 3N4IA 3IXBA 3ITAA 2Y2GA 5KIZA 1OTBA 1PZPA 4Y13A 4HESA 4PKYG 3LIBA 2JHEA 4X56A 3NY4A 3CMZA 1DP8A 1Z09A 1K4EA 3QNBA 3LIAA 3QNCA 1UGUA 3C7UA 3AGEA 5I5LA 2Z6CA 5J8XA 4UAAA 4DXBA 2PD7A 3EEAA 3G2YA 3UE1A 4Z1WA 5HDCA 3NCKA 5A91A 3W2ZA 1L0GA 4FH2A 1K56D 5HWWA 4X1LA 3S7NA 3QP1A 2OV5A 2QYBA 4GCZA 2VJWA 4OH0A 3L9KA 2Y2KA 3IHAA 1BLSA 3IH8A 1MY8A 4BLMA 4EQIA 4K91A 4D2OA 5J7EA 4JF4A 1PW1A 2DCFA 4I39A 3VOZA 5EPHA 1JNUA 5CXWA 4DKIA 1PIOA 1YPRA 3IBRA 1FCMA 4PKYA 3T1QB 3T4KA 3PXPA 4N1XA 5FEFA 2DMWA 4FOFA 3ZCZA 1N9LA 4HY8A 5GHXA 2XFTA 3T4LA 1IYOA 2Y2OA 1P9WA 1RCJA 3TSGA 4M3KA 3C5AA 4OQGA 1PW8A 4N9LA 2ZM8A
chains in the Genus database with same CATH topology
2WAEA 3JYIA 4H8RA 1BTLA 1IKIA 2UWXA 4Y0UA 1XGIA 3ZNTA 1SDEA 5EOEA 1TVFA 1ES2A 1JTDA 2G2UA 5CEBA 4OPQA 3V3SA 1BSGA 4BL2A 5JYPA 1NZOA 5FQQA 2JC7A 1EROA 5F1GA 4DDYA 4JKTA 4XXRA 1MXOA 5M1AA 5GLCA 1FCNA 4WMCA 3UDIA 5EOOA 1PWGA 3LY4A 1K25A 1PI5A 2R9WA 3WS1A 4DRTA 3IXHA 1L0DA 4X55A 5CRFA 1OMEA 5DTSA 5EE8A 3AGFA 2WADA 4L0LA 5CERA 5HARA 3UE3A 5AQ7A 3VOYA 3MZEA 1HVBA 2XQZA 2IWDA 1BLPA 3UE0A 4JXVA 4U3TA 3IF6A 3S1YA 4E3MA 4PM5A 1PWCA 3BECA 4B88A 4E6WA 2C5WB 3ZDJA 4KG5A 1J9MA 4NETA 1CI8A 3HUMA 3LY3A 5TGFA 5EVID 5A92A 1XX2A 3HREA 5FASA 3IXDA 2WAFA 4P87A 5CHUA 4LV1A 5E2HA 4C6YA 3FKWA 3LCEA 3Q82A 4XUXA 2Y2JA 3BM6A 3LEZA 5KSHA 2HDSA 4E6XA 3E2LA 2BG1A 3IT9A 4WZ4A 1KGFA 2H0TA 4O7DA 3SH9A 4WBGA 1XP4A 1FSWA 5CHMA 5HL1A 2A49A 5TR7A 1BT5A 5CGXA 1SCWA 1M6KA 2Y2NA 3AGDA 3NC8A 3P09A 4PPRA 3ZG8B 3M6BA 4BD1A 3HL9A 2P9VA 3VP3A 3ISGA 4OP5A 1MKIA 1KGGA 3A3IA 4S2NA 2IWCA 2XH9A 4PM7A 4BL3A 3G34A 2OLVA 2WKHA 3GV9A 4ID4A 3TG9A 1PZOA 3SOIA 3VSKA 3M2KA 2PBYA 5EVLA 2ZQDA 4QU3A 1HZOA 4P85A 2V20A 5DF7A 3S4XA 5HAIA 1YMXA 2EX6A 1BZAA 5A90A 2P74A 4C75A 4Q8IA 5HX9A 3ITBA 3OCLA 2ZD8A 2ZQ9A 5CECA 1JWZA 5DVAA 4C3QA 1IEMA 2CC1A 1YLYA 5EVIC 4ZBEA 1YLWA 3SH7A 2XLNA 5GL9A 3A3DA 3G35A 1DY6A 3CZDA 4ZTKA 5FAOA 3EQUA 4KZ9A 3W4OA 1LL9A 1BLHA 4OP8A 1KE3A 3DTMA 4DE3A 4IBRA 2ZC5B 3PBNA 2Q9NA 5AQAA 3WS4A 1N9BA 4KZBA 1MWRA 2DNSA 3VP0A 3M6HA 5G18A 3PTEA 1W8YA 1C3BA 2HDQA 4DF6A 1Q2PA 1CI9A 1M40A 2E8IA 2XDMA 5DTTA 2EXAA 4RA7A 4QHCA 4S2IA 4XUZA 3IHBA 3WS2A 4A5RA 3NI9A 4K0XA 3MKFA 3MFDA 2QPNA 3G31A 3BLMA 3N6IA 5HFOA 1RGYA 1KDWA 4GN2A 1ES4A 2XR0A 4R3JA 1ES5A 4GNUA 2Y2MA 2ZMAA 3UPOA 1RP5A 2Y2LA 3SS5A 4GOGA 4JF5A 3OPLA 3HLFA 5FDHA 4E3KA 4WMCD 2XD1A 3MXSA 2ZJ9A 1K55C 2H10A 4OQ0A 4ZJ1A 2WKIA 4K0WA 1GHPA 2V1ZA 2I72A 4OLDA 4UA6A 3SS4A 3GR2A 5M18A 2ZQ7A 3MBZA 2ZC4B 3CJMA 3N8RA 3GQZA 3V5MA 1XKZA 4GB7A 3O88A 1BUEA 1K38A 3BYDA 1U60A 3GTCA 3NDGA 4BQMA 4JPMA 4MBFA 3UPPA 3IF5A 3BFEA 3OCNA 4WM9A 4KG6A 4MNRA 5E43A 1TDLA 4RYEA 3VFFA 1PYYA 2HP5A 3BFGA 5FSRA 4JBFA 4ZJ2A 3HUNA 1MPLA 1K57C 3IWQA 2ZC7A 3PAGA 1K54C 1H8YA 4GZBA 5CHJA 3MXRA 2HP6A 4HBUA 2PU4A 4UA7A 5FAQA 1E3UA 4BD0A 4IVIA 2WZXA 2HP9A 1XA7A 2Z2MB 1IYPA 4KZ4A 2Y91A 3A3EA 1BULA 1QMFA 1WE4A 3ZHHA 1XGJA 2EX2A 4WEKA 1W79A 1LLBA 3B3XA 3E2KA 4HEFA 4EWFA 4YFMA 2RCXA 4S2JA 4EBLA 1IKGA 1ESUA 1ONHA 2XK1A 2BLSA 1HD8A 1MWUA 4KZ8A 3HBRA 3GRJA 3OPHA 2X02A 4OVDA 3C7VA 3W4QA 1H5XA 3Q07A 2ZLYA 4KG2A 1ALQA 2G2WA 2XD5A 1YLTA 4S2LA 3V50A 1LI0A 4CPKA 3PBSA 1W5DA 1KE4A 1IELA 1SDNA 4FD8A 4WZ5C 5DF9A 3VP4A 3Q81A 3UN7A 1ESIA 3BFDA 1SKFA 4QY6A 1NY0A 4NK3A 3I7JA 3QHYA 2QZ6A 2H5SA 2QMIA 5AQBA 2WGIA 4JXSA 1XXMA 1Y54A 3FWLA 1FOFA 2Y2PA 3EQVA 1ES3A 3ZNYA 3N8SA 4R1GA 3TOIA 2A3UA 3CG5A 4IVKA 4X68A 3C4PA 4R3BA 4P6BA 4DDSA 4EV4A 2H0YA 3Q7VA 1O7EA 2ZQAA 4QD4A 2VGKA 5EECA 1GA0A 2FFYA 2Z2LB 4EBPA 4E3LA 4R23A 1NRFA 3HLDA 4PM9A 3IWIA 3WRTA 4E3NA 3ZG0A 1TDGA 3DWZA 4OPYA 1I5QA 3UDXA 4YINA 3ZVWA 5F1FA 2EX9A 1GHIA 4U0TA 3OPRA 5CGWA 2HPBA 3Q7ZA 2WZZA 5D3OA 4F94A 4RVAA 2XEPA 4JXWA 1O07A 4Y0OA 3RXXA 4CJNA 2GDNA 2ZQ8A 4Y0TA 3G30A 1IYSA 1CEFA 5HAQA 1DJCA 4OOYA 3IF6B 2Y2IA 3NIAA 3BFFA 4S2PA 3MKEA 3V3RA 4WELA 4JLFA 4GDNA 2JBFA 1SHVA 3VP2A 1K6RA 4KQOA 3V39A 1K56A 4DE2A 1W7FA 1Z6FA 2HDRA 4IBXA 4MLLA 5FAPA 3SS3A 2Y59A 5E2EA 3UNWA 4MEZA 3W4PA 2XGNA 3OZHA 2Y2HA 1ZG4A 5GLAA 1Q2QA 2WYXA 1QMEA 4FH4A 4N92A 1KE0A 1W8QA 2ZQCA 4PM8A 4UA9A 1GA9A 4WEJA 4JXGA 4R0QA 2ZC6B 4GD8A 1JWVA 4MBKA 3FKVA 1NJ4A 1ERMA 4LV0A 4PM6A 1MBLA 3LO7A 4Z9QA 1JWPA 2P9VB 5CTMA 3NDEA 1DJBA 3G2ZA 2JCHA 5L2FA 1K55A 3VP1A 3HLCA 1PWDA 2C6WB 3OPPA 1MWSA 4ZAMA 5IHVA 3Q1FA 3BEBA 1FCOA 3BFCA 5DF8A 3FZCA 3M2JA 4E3OA 1E3UD 2Y55A 3PBOA 3S22A 4OQHA 3O86A 4LENA 1NXYA 2X71A 1EI5A 3G4PA 3PAEA 2J7VA 4OKPA 4DXCA 5F83A 1TEMA 4X6TA 2J9PA 5E2FA 4BENA 1VM1A 4KZ3A 5FI7A 4KZ6A 2WK0A 1FQGA 3D4FA 1K57A 4GKUA 4B4XA 1DJAA 1K54A 3HLBA 4GD6A 1E25A 1VQQA 4DE0A 5A93A 4FSFA 4OPRA 1I2WA 4DE1A 2ZM0A 2VGJA 4R4RA 2OSUA 4LCMA 5FA7A 1YQSA 2J9OA 3ZGAB 3IQAA 3N7WA 1HTZA 1JTGA 1L0EA 1MWTA 4IEDA 1YLJA 3RXWA 4RX3A 1ZG6A 4E3IA 5EUAA 2JE5A 3MZFA 3WRZA 1NYMA 2ZM2A 3ZFZA 4OOMA 5E2GA 1YT4A 2WKEA 2X01A 2PU2A 3A3FA 3OC2A 5GHZA 5HW3A 1EWZA 3IWOA 5KMWA 3DWKA 3BLSA 3N4IA 3IXBA 1KVMA 2WUQA 4ZDXA 5JYOA 1YLPA 1ZC2A 4KQQA 3ITAA 5FATA 5KZHA 2Y2GA 1XPBA 2V2FF 4N9KA 4RX2A 1KDSA 4E3JA 4KZ5A 1BLCA 1PZPA 3N8LA 5HAPA 3MZDA 1CK3A 3PBTA 4HESA 4WZ5A 4OPZA 5GLDA 3IF6C 5FQ9A 3HLGA 3O3VA 5CGSA 1JVJA 1RGZA 3O87A 1AXBA 2WGVA 4UHUA 4X56A 3NY4A 4FCFA 3CMZA 4S2KA 3HLWA 1E4DA 4B4ZA 4BJPA 1K4EA 4JF6A 4P0MA 3GSGA 4OQIA 2RL3A 1ERQA 3QNBA 5I94A 1LI9A 2J8YA 4EUZA 3QNCA 4QB8A 5AQ9A 3C7UA 3BRMA 5KSCA 5FI6A 3ZVTA 3AGEA 1K4FA 1GHMA 5J8XA 4UAAA 4DXBA 3PBQA 3G2YA 1K6SA 4S2MA 1L0FA 5F82A 3UE1A 4KZAA 1YM1A 3ZG9B 3HUOA 3NBLA 3NCKA 5A91A 3SH8A 2EX8A 1L0GA 4FH2A 2DRWA 3WS5A 3FV7A 1K56D 5FQJA 4EBNA 1I2SA 2WGWA 5EVIA 2OV5A 3UY6A 2EFUA 3IH9A 5U47A 1KGEA 4QJGA 4QY5A 4OH0A 4S2NC 1N4OA 1IYQA 2Y2KA 1WYBA 3IHAA 1FR6A 1BLSA 3UO9A 3PBRA 4HBTA 3VMAA 5GLBA 3IH8A 1MY8A 1S6RA 4BLMA 4EQIA 2OLUA 5FQMA 3C4OA 1G68A 4K91A 2Y2QA 4D2OA 2B5RA 1YLZA 4JF4A 4N1HA 1NZUA 3HLEA 1PW1A 3FYZA 4OLGA 1ZKJA 3GVBA 2DCFA 2FFFB 1ONGA 1LL5A 4X53A 5FQKA 4LCLA 4LV2A 4KENB 1L2SA 4OOLA 3VOZA 2IWBA 2EXBA 5EPHA 1PI4A 1LHYA 4WYYA 3UPNA 5CXWA 3GMWA 3WWXA 5CTNA 3G32A 2EFXA 3IXGA 1PIOA 4DKIA 4PMAA 3RJUA 3WS0A 5GHYA 1FSYA 4OONA 3ZG7B 1FCMA 4S2OA 4ZJ3A 4MBHA 5FQIA 1GCEA 4N1XA 4X69A 3VSLA 5M19A 3UDFA 4GDBA 5FI2A 3ZCZA 3DW0A 5TFQA 3Q7VB 1KVLA 1YMSA 1NYYA 4KQRA 5DTKA 1H8ZA 1XA1A 2ZC3B 1FR1A 5GHXA 2XFTA 4Y7PA 5BOHA 2XF3A 2Y4AA 1S0WA 1IYOA 2Y2OA 2HDUA 3HVFA 4LV3A 4KZ7A 1G6AA 2R9XA 2Q9MA 2XFSA 4U0XA 1WYCA 2WGWB 3A3JA 1RCJA 4R4SA 5EVIB 3W8KA 5CEDA 3VFHA 3P98A 3ZG5A 3TSGA 4M3KA 3C5AA 4OQGA 1PW8A 4N9LA 2ZM8A 1CEGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WAE A;  3JYI A;  4H8R A;  1BTL A;  1IKI A;  2UWX A;  4Y0U A;  1XGI A;  3ZNT A;  1SDE A;  5EOE A;  1TVF A;  1ES2 A;  1JTD A;  2G2U A;  5CEB A;  4OPQ A;  3V3S A;  1BSG A;  4BL2 A;  5JYP A;  1NZO A;  5FQQ A;  2JC7 A;  1ERO A;  5F1G A;  4DDY A;  4JKT A;  4XXR A;  1MXO A;  5M1A A;  5GLC A;  1FCN A;  4WMC A;  3UDI A;  5EOO A;  1PWG A;  3LY4 A;  1K25 A;  1PI5 A;  2R9W A;  3WS1 A;  4DRT A;  3IXH A;  1L0D A;  4X55 A;  5CRF A;  1OME A;  5DTS A;  5EE8 A;  3AGF A;  2WAD A;  4L0L A;  5CER A;  5HAR A;  3UE3 A;  5AQ7 A;  3VOY A;  3MZE A;  1HVB A;  2XQZ A;  2IWD A;  1BLP A;  3UE0 A;  4JXV A;  4U3T A;  3IF6 A;  3S1Y A;  4E3M A;  4PM5 A;  1PWC A;  3BEC A;  4B88 A;  4E6W A;  2C5W B;  3ZDJ A;  4KG5 A;  1J9M A;  4NET A;  1CI8 A;  3HUM A;  3LY3 A;  5TGF A;  5EVI D;  5A92 A;  1XX2 A;  3HRE A;  5FAS A;  3IXD A;  2WAF A;  4P87 A;  5CHU A;  4LV1 A;  5E2H A;  4C6Y A;  3FKW A;  3LCE A;  3Q82 A;  4XUX A;  2Y2J A;  3BM6 A;  3LEZ A;  5KSH A;  2HDS A;  4E6X A;  3E2L A;  2BG1 A;  3IT9 A;  4WZ4 A;  1KGF A;  2H0T A;  4O7D A;  3SH9 A;  4WBG A;  1XP4 A;  1FSW A;  5CHM A;  5HL1 A;  2A49 A;  5TR7 A;  1BT5 A;  5CGX A;  1SCW A;  1M6K A;  2Y2N A;  3AGD A;  3NC8 A;  3P09 A;  4PPR A;  3ZG8 B;  3M6B A;  4BD1 A;  3HL9 A;  2P9V A;  3VP3 A;  3ISG A;  4OP5 A;  1MKI A;  1KGG A;  3A3I A;  4S2N A;  2IWC A;  2XH9 A;  4PM7 A;  4BL3 A;  3G34 A;  2OLV A;  2WKH A;  3GV9 A;  4ID4 A;  3TG9 A;  1PZO A;  3SOI A;  3VSK A;  3M2K A;  2PBY A;  5EVL A;  2ZQD A;  4QU3 A;  1HZO A;  4P85 A;  2V20 A;  5DF7 A;  3S4X A;  5HAI A;  1YMX A;  2EX6 A;  1BZA A;  5A90 A;  2P74 A;  4C75 A;  4Q8I A;  5HX9 A;  3ITB A;  3OCL A;  2ZD8 A;  2ZQ9 A;  5CEC A;  1JWZ A;  5DVA A;  4C3Q A;  1IEM A;  2CC1 A;  1YLY A;  5EVI C;  4ZBE A;  1YLW A;  3SH7 A;  2XLN A;  5GL9 A;  3A3D A;  3G35 A;  1DY6 A;  3CZD A;  4ZTK A;  5FAO A;  3EQU A;  4KZ9 A;  3W4O A;  1LL9 A;  1BLH A;  4OP8 A;  1KE3 A;  3DTM A;  4DE3 A;  4IBR A;  2ZC5 B;  3PBN A;  2Q9N A;  5AQA A;  3WS4 A;  1N9B A;  4KZB A;  1MWR A;  2DNS A;  3VP0 A;  3M6H A;  5G18 A;  3PTE A;  1W8Y A;  1C3B A;  2HDQ A;  4DF6 A;  1Q2P A;  1CI9 A;  1M40 A;  2E8I A;  2XDM A;  5DTT A;  2EXA A;  4RA7 A;  4QHC A;  4S2I A;  4XUZ A;  3IHB A;  3WS2 A;  4A5R A;  3NI9 A;  4K0X A;  3MKF A;  3MFD A;  2QPN A;  3G31 A;  3BLM A;  3N6I A;  5HFO A;  1RGY A;  1KDW A;  4GN2 A;  1ES4 A;  2XR0 A;  4R3J A;  1ES5 A;  4GNU A;  2Y2M A;  2ZMA A;  3UPO A;  1RP5 A;  2Y2L A;  3SS5 A;  4GOG A;  4JF5 A;  3OPL A;  3HLF A;  5FDH A;  4E3K A;  4WMC D;  2XD1 A;  3MXS A;  2ZJ9 A;  1K55 C;  2H10 A;  4OQ0 A;  4ZJ1 A;  2WKI A;  4K0W A;  1GHP A;  2V1Z A;  2I72 A;  4OLD A;  4UA6 A;  3SS4 A;  3GR2 A;  5M18 A;  2ZQ7 A;  3MBZ A;  2ZC4 B;  3CJM A;  3N8R A;  3GQZ A;  3V5M A;  1XKZ A;  4GB7 A;  3O88 A;  1BUE A;  1K38 A;  3BYD A;  1U60 A;  3GTC A;  3NDG A;  4BQM A;  4JPM A;  4MBF A;  3UPP A;  3IF5 A;  3BFE A;  3OCN A;  4WM9 A;  4KG6 A;  4MNR A;  5E43 A;  1TDL A;  4RYE A;  3VFF A;  1PYY A;  2HP5 A;  3BFG A;  5FSR A;  4JBF A;  4ZJ2 A;  3HUN A;  1MPL A;  1K57 C;  3IWQ A;  2ZC7 A;  3PAG A;  1K54 C;  1H8Y A;  4GZB A;  5CHJ A;  3MXR A;  2HP6 A;  4HBU A;  2PU4 A;  4UA7 A;  5FAQ A;  1E3U A;  4BD0 A;  4IVI A;  2WZX A;  2HP9 A;  1XA7 A;  2Z2M B;  1IYP A;  4KZ4 A;  2Y91 A;  3A3E A;  1BUL A;  1QMF A;  1WE4 A;  3ZHH A;  1XGJ A;  2EX2 A;  4WEK A;  1W79 A;  1LLB A;  3B3X A;  3E2K A;  4HEF A;  4EWF A;  4YFM A;  2RCX A;  4S2J A;  4EBL A;  1IKG A;  1ESU A;  1ONH A;  2XK1 A;  2BLS A;  1HD8 A;  1MWU A;  4KZ8 A;  3HBR A;  3GRJ A;  3OPH A;  2X02 A;  4OVD A;  3C7V A;  3W4Q A;  1H5X A;  3Q07 A;  2ZLY A;  4KG2 A;  1ALQ A;  2G2W A;  2XD5 A;  1YLT A;  4S2L A;  3V50 A;  1LI0 A;  4CPK A;  3PBS A;  1W5D A;  1KE4 A;  1IEL A;  1SDN A;  4FD8 A;  4WZ5 C;  5DF9 A;  3VP4 A;  3Q81 A;  3UN7 A;  1ESI A;  3BFD A;  1SKF A;  4QY6 A;  1NY0 A;  4NK3 A;  3I7J A;  3QHY A;  2QZ6 A;  2H5S A;  2QMI A;  5AQB A;  2WGI A;  4JXS A;  1XXM A;  1Y54 A;  3FWL A;  1FOF A;  2Y2P A;  3EQV A;  1ES3 A;  3ZNY A;  3N8S A;  4R1G A;  3TOI A;  2A3U A;  3CG5 A;  4IVK A;  4X68 A;  3C4P A;  4R3B A;  4P6B A;  4DDS A;  4EV4 A;  2H0Y A;  3Q7V A;  1O7E A;  2ZQA A;  4QD4 A;  2VGK A;  5EEC A;  1GA0 A;  2FFY A;  2Z2L B;  4EBP A;  4E3L A;  4R23 A;  1NRF A;  3HLD A;  4PM9 A;  3IWI A;  3WRT A;  4E3N A;  3ZG0 A;  1TDG A;  3DWZ A;  4OPY A;  1I5Q A;  3UDX A;  4YIN A;  3ZVW A;  5F1F A;  2EX9 A;  1GHI A;  4U0T A;  3OPR A;  5CGW A;  2HPB A;  3Q7Z A;  2WZZ A;  5D3O A;  4F94 A;  4RVA A;  2XEP A;  4JXW A;  1O07 A;  4Y0O A;  3RXX A;  4CJN A;  2GDN A;  2ZQ8 A;  4Y0T A;  3G30 A;  1IYS A;  1CEF A;  5HAQ A;  1DJC A;  4OOY A;  3IF6 B;  2Y2I A;  3NIA A;  3BFF A;  4S2P A;  3MKE A;  3V3R A;  4WEL A;  4JLF A;  4GDN A;  2JBF A;  1SHV A;  3VP2 A;  1K6R A;  4KQO A;  3V39 A;  1K56 A;  4DE2 A;  1W7F A;  1Z6F A;  2HDR A;  4IBX A;  4MLL A;  5FAP A;  3SS3 A;  2Y59 A;  5E2E A;  3UNW A;  4MEZ A;  3W4P A;  2XGN A;  3OZH A;  2Y2H A;  1ZG4 A;  5GLA A;  1Q2Q A;  2WYX A;  1QME A;  4FH4 A;  4N92 A;  1KE0 A;  1W8Q A;  2ZQC A;  4PM8 A;  4UA9 A;  1GA9 A;  4WEJ A;  4JXG A;  4R0Q A;  2ZC6 B;  4GD8 A;  1JWV A;  4MBK A;  3FKV A;  1NJ4 A;  1ERM A;  4LV0 A;  4PM6 A;  1MBL A;  3LO7 A;  4Z9Q A;  1JWP A;  2P9V B;  5CTM A;  3NDE A;  1DJB A;  3G2Z A;  2JCH A;  5L2F A;  1K55 A;  3VP1 A;  3HLC A;  1PWD A;  2C6W B;  3OPP A;  1MWS A;  4ZAM A;  5IHV A;  3Q1F A;  3BEB A;  1FCO A;  3BFC A;  5DF8 A;  3FZC A;  3M2J A;  4E3O A;  1E3U D;  2Y55 A;  3PBO A;  3S22 A;  4OQH A;  3O86 A;  4LEN A;  1NXY A;  2X71 A;  1EI5 A;  3G4P A;  3PAE A;  2J7V A;  4OKP A;  4DXC A;  5F83 A;  1TEM A;  4X6T A;  2J9P A;  5E2F A;  4BEN A;  1VM1 A;  4KZ3 A;  5FI7 A;  4KZ6 A;  2WK0 A;  1FQG A;  3D4F A;  1K57 A;  4GKU A;  4B4X A;  1DJA A;  1K54 A;  3HLB A;  4GD6 A;  1E25 A;  1VQQ A;  4DE0 A;  5A93 A;  4FSF A;  4OPR A;  1I2W A;  4DE1 A;  2ZM0 A;  2VGJ A;  4R4R A;  2OSU A;  4LCM A;  5FA7 A;  1YQS A;  2J9O A;  3ZGA B;  3IQA A;  3N7W A;  1HTZ A;  1JTG A;  1L0E A;  1MWT A;  4IED A;  1YLJ A;  3RXW A;  4RX3 A;  1ZG6 A;  4E3I A;  5EUA A;  2JE5 A;  3MZF A;  3WRZ A;  1NYM A;  2ZM2 A;  3ZFZ A;  4OOM A;  5E2G A;  1YT4 A;  2WKE A;  2X01 A;  2PU2 A;  3A3F A;  3OC2 A;  5GHZ A;  5HW3 A;  1EWZ A;  3IWO A;  5KMW A;  3DWK A;  3BLS A;  3N4I A;  3IXB A;  1KVM A;  2WUQ A;  4ZDX A;  5JYO A;  1YLP A;  1ZC2 A;  4KQQ A;  3ITA A;  5FAT A;  5KZH A;  2Y2G A;  1XPB A;  2V2F F;  4N9K A;  4RX2 A;  1KDS A;  4E3J A;  4KZ5 A;  1BLC A;  1PZP A;  3N8L A;  5HAP A;  3MZD A;  1CK3 A;  3PBT A;  4HES A;  4WZ5 A;  4OPZ A;  5GLD A;  3IF6 C;  5FQ9 A;  3HLG A;  3O3V A;  5CGS A;  1JVJ A;  1RGZ A;  3O87 A;  1AXB A;  2WGV A;  4UHU A;  4X56 A;  3NY4 A;  4FCF A;  3CMZ A;  4S2K A;  3HLW A;  1E4D A;  4B4Z A;  4BJP A;  1K4E A;  4JF6 A;  4P0M A;  3GSG A;  4OQI A;  2RL3 A;  1ERQ A;  3QNB A;  5I94 A;  1LI9 A;  2J8Y A;  4EUZ A;  3QNC A;  4QB8 A;  5AQ9 A;  3C7U A;  3BRM A;  5KSC A;  5FI6 A;  3ZVT A;  3AGE A;  1K4F A;  1GHM A;  5J8X A;  4UAA A;  4DXB A;  3PBQ A;  3G2Y A;  1K6S A;  4S2M A;  1L0F A;  5F82 A;  3UE1 A;  4KZA A;  1YM1 A;  3ZG9 B;  3HUO A;  3NBL A;  3NCK A;  5A91 A;  3SH8 A;  2EX8 A;  1L0G A;  4FH2 A;  2DRW A;  3WS5 A;  3FV7 A;  1K56 D;  5FQJ A;  4EBN A;  1I2S A;  2WGW A;  5EVI A;  2OV5 A;  3UY6 A;  2EFU A;  3IH9 A;  5U47 A;  1KGE A;  4QJG A;  4QY5 A;  4OH0 A;  4S2N C;  1N4O A;  1IYQ A;  2Y2K A;  1WYB A;  3IHA A;  1FR6 A;  1BLS A;  3UO9 A;  3PBR A;  4HBT A;  3VMA A;  5GLB A;  3IH8 A;  1MY8 A;  1S6R A;  4BLM A;  4EQI A;  2OLU A;  5FQM A;  3C4O A;  1G68 A;  4K91 A;  2Y2Q A;  4D2O A;  2B5R A;  1YLZ A;  4JF4 A;  4N1H A;  1NZU A;  3HLE A;  1PW1 A;  3FYZ A;  4OLG A;  1ZKJ A;  3GVB A;  2DCF A;  2FFF B;  1ONG A;  1LL5 A;  4X53 A;  5FQK A;  4LCL A;  4LV2 A;  4KEN B;  1L2S A;  4OOL A;  3VOZ A;  2IWB A;  2EXB A;  5EPH A;  1PI4 A;  1LHY A;  4WYY A;  3UPN A;  5CXW A;  3GMW A;  3WWX A;  5CTN A;  3G32 A;  2EFX A;  3IXG A;  1PIO A;  4DKI A;  4PMA A;  3RJU A;  3WS0 A;  5GHY A;  1FSY A;  4OON A;  3ZG7 B;  1FCM A;  4S2O A;  4ZJ3 A;  4MBH A;  5FQI A;  1GCE A;  4N1X A;  4X69 A;  3VSL A;  5M19 A;  3UDF A;  4GDB A;  5FI2 A;  3ZCZ A;  3DW0 A;  5TFQ A;  3Q7V B;  1KVL A;  1YMS A;  1NYY A;  4KQR A;  5DTK A;  1H8Z A;  1XA1 A;  2ZC3 B;  1FR1 A;  5GHX A;  2XFT A;  4Y7P A;  5BOH A;  2XF3 A;  2Y4A A;  1S0W A;  1IYO A;  2Y2O A;  2HDU A;  3HVF A;  4LV3 A;  4KZ7 A;  1G6A A;  2R9X A;  2Q9M A;  2XFS A;  4U0X A;  1WYC A;  2WGW B;  3A3J A;  1RCJ A;  4R4S A;  5EVI B;  3W8K A;  5CED A;  3VFH A;  3P98 A;  3ZG5 A;  3TSG A;  4M3K A;  3C5A A;  4OQG A;  1PW8 A;  4N9L A;  2ZM8 A;  1CEG A; 
#chains in the Genus database with same CATH topology
 2WAE A;  5FDS A;  4DMZ A;  4NKP A;  4F3L A;  1IKI A;  2HF6 A;  3VE3 A;  5EOE A;  3ZQ5 A;  5JYP A;  5FQQ A;  2JC7 A;  1F98 A;  3D3O A;  5M1A A;  5GLC A;  4WMC A;  5EOO A;  1PWG A;  1PI5 A;  2R9W A;  4R6L A;  3WS1 A;  4DRT A;  3IXH A;  2FH5 A;  4H6J A;  5CRF A;  5DTS A;  4MMN A;  4PAU A;  5HAR A;  3MZE A;  1HVB A;  2XQZ A;  2IWD A;  1TS7 A;  4WLA A;  1BLP A;  4E3M A;  1PWC A;  5MC7 A;  4KG5 A;  2P08 A;  3LY3 A;  3IS2 A;  5A92 A;  1CQA A;  3A0S A;  3IXD A;  3NOU C;  5E2H A;  3NEC A;  3LEZ A;  2HDS A;  3OBF A;  4WZ4 A;  3C2W A;  2Q0O A;  4EEP A;  5CHM A;  3BJN A;  2A49 A;  1M6K A;  1LSW A;  1TS6 A;  3UE6 A;  2P9V A;  4EER A;  3ISG A;  4OP5 A;  5HD3 A;  4WL9 A;  1KGG A;  4PM7 A;  3GV9 A;  2OLV A;  3LI9 A;  3VSK A;  3M2K A;  4QU3 A;  4P85 A;  2V20 A;  3QP6 A;  3S4X A;  5HAI A;  3K2N A;  5HX9 A;  2ZD8 A;  1JWZ A;  4C3Q A;  1YLY A;  4ZBE A;  3IX8 A;  3G35 A;  1DY6 A;  3EQU A;  2O9B A;  3W4O A;  3IX3 A;  4DE3 A;  4R3A A;  5AQA A;  3WS4 A;  4KZB A;  1MWR A;  1W8Y A;  1C3B A;  1Y28 A;  4ETX A;  1M40 A;  4B93 A;  2EXA A;  3NOP C;  3MR0 A;  4RA7 A;  3LID A;  3IHB A;  4K0X A;  3MFD A;  2WKR A;  3BLM A;  3N6I A;  3H82 B;  5HD5 A;  1K0K A;  2HJ9 C;  1KDW A;  1XJ3 A;  4DJ2 A;  2XR0 A;  2VEA A;  4GNU A;  2JKR M;  2VV7 A;  1S1Y A;  4I3A A;  1NWZ A;  2H10 A;  3JPU A;  4L9G A;  1GSX A;  4HP4 A;  3CJM A;  3GQZ A;  1BUE A;  2ZBB A;  4NEE D;  1LT0 A;  3RH8 B;  2I9V A;  5FSR A;  1MPL A;  3IWQ A;  1K54 C;  1LSV A;  5CHJ A;  3LFV A;  3MXR A;  4HBU A;  4UA7 A;  2XA7 M;  3LUQ A;  1XA7 A;  1V9Z A;  1QMF A;  1WE4 A;  3ZHH A;  1W79 A;  3B3X A;  3E2K A;  4S2J A;  2XK1 A;  1MWU A;  3IX4 A;  3C7V A;  3Q07 A;  3LEQ A;  2ZMV A;  3TRC A;  4S2L A;  3V50 A;  1SDN A;  4FD8 A;  1N9O A;  1CJF A;  2BAS A;  3VP4 A;  3HJI A;  3UN7 A;  4BBV A;  3E4Q A;  1FOF A;  4LFU A;  2JKR I;  2M7V A;  4EV4 A;  2VZW A;  4QD4 A;  2VGK A;  2Z2L B;  2VV6 A;  3F1P B;  3IBJ A;  4HH2 A;  4OPY A;  1G5U A;  2W1R A;  3OPR A;  5CGW A;  2B02 A;  2EWW A;  2HPB A;  2WZZ A;  4JXW A;  4Y0T A;  2INW A;  4OOY A;  3IF6 B;  3MSH A;  3NIA A;  4WF0 A;  3BFF A;  4WEL A;  4HJ4 A;  1K6R A;  2GNX A;  1K56 A;  3H7W A;  1Z6F A;  3SS3 A;  4EUV A;  1H0M A;  2XGN A;  3OZH A;  1ZG4 A;  4G3V A;  1Q2Q A;  2WYX A;  4II7 A;  2OAP 1;  3DTK A;  3B42 A;  3GDI A;  1GA9 A;  4L9F A;  4HJ3 A;  3T1R A;  3FPW A;  1NJ4 A;  4PM6 A;  3LO7 A;  4Z9Q A;  3NDE A;  3RTY A;  4O0P A;  3R4K A;  1PWD A;  1F5M A;  3Q1F A;  2L1M A;  5DF8 A;  3FZC A;  1E3U D;  3P7N A;  2D02 A;  4OKP A;  5E2F A;  5J4E A;  5FI7 A;  5HL6 A;  1FQG A;  4GKU A;  4LPZ A;  4DE0 A;  1NLZ A;  4R4R A;  1STZ A;  4LCM A;  2J9O A;  2JKF A;  2VA0 A;  3NJA A;  2Y8H A;  5AVE A;  4EW7 A;  3UB8 A;  1YT4 A;  2NUT C;  4MN7 A;  3A3F A;  1HLU P;  3DTI A;  3BLS A;  3S7P A;  3CPT B;  4KQQ A;  4Q0I A;  5FAT A;  5KZH A;  2XRO A;  1XPB A;  4RX2 A;  3N8L A;  1CK3 A;  3PBT A;  3UB9 A;  4WZ5 A;  4OPZ A;  2M7U A;  5GLD A;  2HZ5 A;  5FQ9 A;  3O3V A;  5CGS A;  1E4D A;  1SKO A;  4BJP A;  4I5S A;  4P0M A;  4OQI A;  2RL3 A;  5I94 A;  4K08 A;  4QB8 A;  1S4R A;  4LLO B;  5EFW A;  2K31 A;  1K6S A;  4KZA A;  1YM1 A;  3ZG9 B;  3HUO A;  3NBL A;  3SH8 A;  4EES A;  2DRW A;  5FQJ A;  2WGW A;  3UY6 A;  5U47 A;  4QY5 A;  1V9Y A;  3MXQ A;  1IYQ A;  3LIF A;  1WYB A;  2OWJ A;  3UO9 A;  4MN5 A;  5L09 A;  3S7O A;  1S6R A;  1ODV A;  4N1H A;  2O0Y A;  3HLE A;  4OLG A;  1ZKJ A;  1LL5 A;  1XFN A;  2KX6 A;  4X53 A;  2NUP C;  4KEN B;  2EXB A;  1UWP X;  3WWX A;  5CTN A;  3IXG A;  5GHY A;  4OON A;  3ZG7 B;  4S2O A;  4ZJ3 A;  4MBH A;  4X69 A;  3TE8 A;  3UDF A;  1N9N A;  5FI2 A;  5TFQ A;  4B9O A;  1NYY A;  4UQI S;  4Y7P A;  2XF3 A;  2HDU A;  3DTE A;  4LV3 A;  1G6A A;  4U0X A;  2Q9M A;  3FC7 A;  5EVI B;  4RQ9 A;  5CED A;  3P98 A;  3ZG5 A;  2LB5 A;  3MF0 A;  3R7W B;  4H8R A;  3P01 A;  1X0O A;  2KOI A;  3TJZ C;  2UWX A;  3ZNT A;  2XRN A;  4GHI A;  3V3S A;  1DP9 A;  4KUK A;  2H28 A;  4DDY A;  1MXO A;  3VV4 A;  4Y3I A;  1K25 A;  2ZL1 B;  2O9C A;  1OME A;  3AGF A;  2WAD A;  3LR5 A;  3CAX A;  3VOY A;  4DN0 A;  2PDR A;  4JXV A;  3IF6 A;  2VGL S;  3ZDJ A;  5HPI A;  3QP5 A;  5F68 A;  3HRE A;  5FAS A;  4NG2 A;  4P87 A;  3BW6 A;  3CUE A;  5TBM B;  4C6Y A;  4ETZ A;  3LCE A;  1YAX A;  2Y2J A;  5KSH A;  1LL8 A;  3E2L A;  2BG1 A;  3OLO A;  4O01 A;  2J3T D;  1BT5 A;  2V9A A;  5CGX A;  3BQ8 A;  4PPR A;  3AGD A;  3P09 A;  5DFY A;  3ZG8 B;  1TS0 A;  3G6O A;  4BD1 A;  1DP6 A;  1MKI A;  2GJ3 A;  3A3I A;  4S2N A;  1H8M A;  3TG9 A;  3SOI A;  2PBY A;  2ZQD A;  1S4S A;  2W3E A;  5FL3 A;  4BBT A;  2JKT M;  3OCL A;  2ZQ9 A;  1VET B;  1PRQ A;  5GL9 A;  2VX8 A;  5FAO A;  4OP8 A;  1KE3 A;  4IBR A;  3MJQ A;  3PBN A;  2JKG A;  4ARZ A;  3VP0 A;  2DNS A;  3BQA A;  3M6H A;  1Q2P A;  1CI9 A;  2XDM A;  2O9A A;  4QHC A;  2PAV P;  3FG8 A;  4XT2 B;  5HSQ A;  3PR6 A;  4XUZ A;  3NI9 A;  5HPF A;  3OOV A;  3CPT A;  3G31 A;  4QPR A;  5HFO A;  2AVX A;  4R3J A;  2Y2M A;  3UPO A;  3T4J A;  2Y2L A;  4GOG A;  5FDH A;  4X25 A;  2B18 A;  1T18 A;  1S67 L;  4OQ0 A;  5DJU A;  2K7S A;  2I72 A;  4UA6 A;  3SS4 A;  3GR2 A;  2ZQ7 A;  3K3D A;  2ZC4 B;  3N8R A;  3V5M A;  1K38 A;  3BYD A;  3QP4 A;  3NDG A;  1D1J A;  4MBF A;  3U2A A;  3IF5 A;  4WM9 A;  5E43 A;  3MMH A;  1D06 A;  1ZHH B;  4ZJ2 A;  2ZOI A;  2ZMF A;  2PU4 A;  5FAQ A;  1E3U A;  4BD0 A;  4MN6 A;  1H3Q A;  2HP9 A;  3KYQ A;  3A3E A;  3C8C A;  1P97 A;  1BYW A;  4EBL A;  1ONH A;  1HD8 A;  3GRJ A;  2X02 A;  4WUJ A;  4CLC E;  3W4Q A;  3HCY A;  1H5X A;  4KG2 A;  2P7J A;  4HNB A;  1LI0 A;  4GS9 B;  1W5D A;  1IEL A;  4WZ5 C;  3BFD A;  3I7J A;  4JGO A;  3QHY A;  3JVV A;  2QZ6 A;  1Y4O A;  5AQB A;  3FWL A;  3N8S A;  3TOI A;  3C38 A;  1VHM A;  3UMD A;  4X68 A;  3C4P A;  2ZQA A;  5EEC A;  4PM9 A;  3T4T A;  1TDG A;  1I5Q A;  4EET B;  2EX9 A;  1GHI A;  4U0T A;  5HDD A;  5L10 A;  3Q7Z A;  3R7W A;  5D3O A;  4F94 A;  4KUO A;  3EGD C;  3O5Y A;  2ZQ8 A;  4S2P A;  3MKE A;  4JLF A;  1SHV A;  4DE2 A;  2Y59 A;  5E2E A;  3PYP A;  2ZL1 A;  4FH4 A;  1QME A;  4MDZ A;  4PHT A;  3E4O A;  1W8Q A;  2ZQC A;  4WEJ A;  4R0Q A;  2PRF A;  3KO6 A;  1UWN X;  3FKV A;  1ERM A;  1LSX A;  3G2Z A;  1K55 A;  3F1O B;  2HGV A;  3HLC A;  1MWS A;  3BEB A;  1FCO A;  5TBM A;  2Y55 A;  2VV8 A;  2X71 A;  2J7V A;  2J9P A;  1VM1 A;  2PR6 A;  4KZ6 A;  2W1T B;  4B4X A;  1DJA A;  4GD6 A;  3HLB A;  3PHY A;  4FSF A;  2PHY A;  1G6O A;  4DE1 A;  2OSU A;  3ZGA B;  3IQA A;  4UQI M;  3JVU A;  1JTG A;  4OOM A;  1YSQ A;  2L0W A;  2WKE A;  2PU2 A;  3IWO A;  5EM0 A;  2EWV A;  1KVM A;  3L7H A;  4ZDX A;  3UB7 A;  1KDS A;  1BLC A;  5HAP A;  3T4O A;  3LI8 A;  3IF6 C;  1JVJ A;  1RGZ A;  4R70 A;  1AXB A;  2WGV A;  4UHU A;  3E4P A;  4FCF A;  3HLW A;  4B4Z A;  4JF6 A;  1ZTU A;  3GSG A;  1MKM A;  2W3H A;  4XT2 A;  3CUE C;  5HWV A;  5AQ9 A;  3ZVT A;  1GHM A;  1YKD A;  5HWT A;  3KX0 X;  1L0F A;  5F82 A;  1GSV A;  3BY8 A;  3LYX A;  3WS5 A;  3FV7 A;  2VGL M;  1CF0 A;  3IH9 A;  1T19 A;  4I3J A;  4EEU A;  4S2N C;  3PBR A;  4Y5F A;  1W63 M;  2OLU A;  3C4O A;  4GJ4 A;  2B5R A;  1YLZ A;  1XJ4 A;  2V8F A;  2CMN A;  5DKK A;  3FYZ A;  1FIL A;  5FQK A;  4LV2 A;  1L2S A;  4IUH A;  4OOL A;  1LHY A;  4WYY A;  2PT7 A;  1T1B A;  3T50 A;  3NOT C;  1GCE A;  4IUK A;  3VSL A;  3F1N B;  4GDB A;  3QP2 A;  1PNE A;  3Q7V B;  1KVL A;  4KQR A;  5DTK A;  1H8Z A;  2LB9 A;  1FR1 A;  4GS9 A;  2R9X A;  5L8M A;  3A3J A;  4R4S A;  3W8K A;  3NUL A;  3VFH A;  1D7E A;  4NXE A;  1WA9 A;  1CEG A;  4HH3 A;  4X1M A;  3C30 A;  1XGI A;  4CLC D;  1ES2 A;  1JTD A;  2G2U A;  5CEB A;  3U4L P;  1NZO A;  3CIT A;  1EW0 A;  5IU1 A;  5EE8 A;  4FTX A;  3UE3 A;  3DBA A;  5F5Y A;  4U3T A;  3S1Y A;  4PM5 A;  2C5W B;  4NET A;  1J9M A;  1CI8 A;  3HUM A;  5TGF A;  5EVI D;  1XX2 A;  2WAF A;  4G3K A;  2W3F A;  3BM6 A;  2K2N A;  3IT9 A;  3EGX C;  4O7D A;  3H82 A;  3SH9 A;  1FSW A;  5TR7 A;  2Y2N A;  1SZV A;  4BBU A;  2OAQ 1;  3M6B A;  4QWO A;  2W3D A;  3F1O A;  4ME4 A;  2XH9 A;  4BL3 A;  2WKH A;  1PZO A;  5EVL A;  1HZO A;  2XSS A;  5A90 A;  4C75 A;  3KSH A;  2J80 A;  1IEM A;  5EVI C;  3KSI A;  1KOU A;  3SH7 A;  3A3D A;  3CZD A;  2W1T A;  1LL9 A;  5DFX A;  2ZC5 B;  4CLC B;  2Q9N A;  5G18 A;  3PTE A;  2PR5 A;  4NXF A;  3CI6 A;  4DF6 A;  5AJG A;  3IS2 B;  2FZ0 A;  3TW8 A;  5CX7 A;  4KQD A;  3MKF A;  2QPN A;  2PYR A;  4L9E A;  1RGY A;  1TS8 A;  2E8J A;  1F9I A;  1ES4 A;  2HV1 A;  4GN2 A;  4AFI A;  1IOU A;  1ES5 A;  2ZMA A;  1RP5 A;  3SS5 A;  3OPL A;  4E3K A;  3MXS A;  2V0W A;  2ZJ9 A;  1K55 C;  3CHW P;  5J3W A;  3CWF A;  2WKI A;  3LR4 A;  2V1Z A;  4G3W A;  4GLQ A;  5M18 A;  4BMW A;  2O99 A;  4GB7 A;  4BQM A;  4JPM A;  3UPP A;  3BFE A;  3OCN A;  4KG6 A;  4MNR A;  3F1P A;  4RYE A;  4JBF A;  3HUN A;  2ZC7 A;  3PAG A;  1H8Y A;  1ACF A;  2HP6 A;  2WKP A;  4HI4 A;  2G7U A;  4JGR A;  2Z2M B;  1IYP A;  1XGJ A;  1J3W A;  4WEK A;  1F2K A;  4YFM A;  2RCX A;  1ESU A;  4LGW A;  4P6Z S;  1XJ6 A;  1ALQ A;  3SW1 A;  1YLT A;  4CPK A;  5DF9 A;  2P04 A;  1OTD A;  5G4Y A;  1NY0 A;  4NK3 A;  2H5S A;  4DJ3 A;  2WGI A;  4JXS A;  1Y54 A;  3QP8 A;  1VEU B;  3EQV A;  3ZNY A;  5K5B A;  4R1G A;  2QJ7 A;  4O8G A;  5EV0 A;  3F1N A;  4R3B A;  4WN5 A;  4P6B A;  4DDS A;  3Q7V A;  1O7E A;  2FFY A;  3EOI A;  1NRF A;  3HLD A;  3WRT A;  3LIE A;  4E3N A;  3MQQ A;  3UDX A;  2V8C A;  2PYP A;  3ZVW A;  5F1F A;  1OJG A;  1S1Z A;  3KYZ A;  1YSP A;  1OPX A;  1O07 A;  3T1X A;  2J3T C;  2Y2I A;  3V3R A;  3KSG A;  3MQ0 A;  2JBF A;  3VP2 A;  3V39 A;  5FAP A;  2W0N A;  5EM1 A;  4MEZ A;  5DKL A;  3B47 A;  4N92 A;  1KE0 A;  1IFQ A;  2V1A A;  4Y2F A;  2ZC6 B;  4GD8 A;  1JWV A;  5LBR A;  4LV0 A;  3CLO A;  1GSW A;  1JWP A;  5CTM A;  3T4Q A;  2JCH A;  5L2F A;  3T12 B;  2BTF P;  3OPP A;  4ZAM A;  5IHV A;  2MJ6 A;  3M2J A;  4E3O A;  4OQH A;  1NXY A;  3G4P A;  3PAE A;  5F83 A;  2A24 B;  1G28 A;  2WK0 A;  4UEY A;  1T1C A;  3D4F A;  1K57 A;  1VQQ A;  2JKT I;  4HQA A;  1I2W A;  2ZM0 A;  2GX5 A;  5FA7 A;  2PBD P;  3N7W A;  3RXW A;  5EUA A;  2JE5 A;  3MZF A;  5A8B A;  3WRZ A;  1NYM A;  2IA2 A;  5HDS A;  3ZFZ A;  3LR3 A;  3H7W B;  5E2G A;  3OC2 A;  1MZU A;  3DWK A;  2WUQ A;  5JYO A;  1YLP A;  1ZC2 A;  2V2F F;  4N9K A;  4E3J A;  4KZ5 A;  3MZD A;  2WKQ A;  2D01 A;  4CLC A;  2J3W A;  3LGO A;  3HLG A;  3O87 A;  4YWZ A;  3SZT A;  4S2K A;  1DRM A;  3H9W A;  3FPV A;  1ERQ A;  1LI9 A;  2J8Y A;  4EUZ A;  3BRM A;  1OT6 A;  5KSC A;  5FI6 A;  1K4F A;  5G4Z A;  3PBQ A;  4S2M A;  4ESP A;  3NHQ A;  2EX8 A;  2VLG A;  2QJ5 A;  4EXO A;  4EBN A;  1I2S A;  5TJJ A;  5EVI A;  4HHD A;  3LIC A;  2EFU A;  1OTE A;  4Y15 A;  2VKS A;  1KGE A;  4E04 A;  4QJG A;  2HJE A;  1N4O A;  3A0R A;  1FR6 A;  3VMA A;  4HBT A;  5GLB A;  5F6A A;  4GW9 A;  5L07 A;  5FQM A;  1G68 A;  2JN7 A;  2Y2Q A;  2YKF A;  2W27 A;  1NZU A;  4HJ6 A;  2QKP A;  3GVB A;  2FFF B;  1ONG A;  4D60 A;  4LCL A;  2IWB A;  3VOL A;  1PI4 A;  4I3I A;  3UPN A;  1P9R A;  3GMW A;  3G32 A;  2EFX A;  4PMA A;  3RJU A;  2QWS A;  3WS0 A;  1SKO B;  1FSY A;  5DJT A;  5FQI A;  1S66 L;  2W3G A;  5M19 A;  3EWK A;  4MCW A;  3DW0 A;  1YMS A;  1XA1 A;  2KLI A;  2ZC3 B;  3E0Y A;  5BOH A;  2Y4A A;  1S0W A;  3HVF A;  4KZ7 A;  2XFS A;  1WYC A;  2R78 A;  2WGW B;  3V67 A;  2V1B A;  1AWI A;  1VEU A;  3KSF A;  3JYI A;  1BTL A;  1P0Z A;  4YNR A;  4Y0U A;  1SDE A;  1TVF A;  4OPQ A;  1BSG A;  4BL2 A;  1ERO A;  5F1G A;  4JKT A;  4XXR A;  1FCN A;  1VET A;  3UDI A;  3LY4 A;  1L0D A;  4X55 A;  5CER A;  4L0L A;  5AQ7 A;  4I38 A;  3UE0 A;  1NRJ A;  3BEC A;  4B88 A;  4E6W A;  3B33 A;  2L4R A;  3ULF A;  1TF1 A;  3MS6 A;  5CHU A;  4LV1 A;  3FKW A;  3Q82 A;  4HIA A;  4XUX A;  3UB5 P;  4E6X A;  1KGF A;  2H0T A;  4WBG A;  1XP4 A;  5HL1 A;  1SCW A;  2GZA A;  4M4X A;  3BY9 A;  3NC8 A;  4NXB A;  1XFQ A;  3HL9 A;  3VP3 A;  4P6Z M;  2VK3 A;  4LRZ E;  2IWC A;  3G34 A;  4JGQ A;  4ID4 A;  3T4S A;  4GHI B;  5DF7 A;  1YMX A;  2EX6 A;  1BZA A;  2P74 A;  4Q8I A;  2A24 A;  3S7Q A;  3ITB A;  5CEC A;  5DVA A;  5C5K A;  2CC1 A;  4LRX C;  1YLW A;  2XLN A;  4ZTK A;  1A0K A;  4KZ9 A;  4Q0J A;  1BLH A;  2B95 A;  3DTM A;  5AVF A;  1N9B A;  4HOI A;  3ZYT A;  2HDQ A;  4IHQ A;  2E8I A;  5DTT A;  4S2I A;  5HZH A;  2KDK A;  3WS2 A;  4A5R A;  1PFL A;  4CQH A;  1L3L A;  1OJ5 A;  4JF5 A;  5FEG A;  3HLF A;  5EVE A;  4WMC D;  2XD1 A;  3D9Y A;  4ZJ1 A;  4K0W A;  1GHP A;  2EA9 A;  3EEH A;  4OLD A;  2YKH A;  4R38 A;  2ACG A;  3MBZ A;  1XKZ A;  1VB6 A;  3O88 A;  3GTC A;  1TD5 A;  1U60 A;  3BWL A;  3A0V A;  3VFF A;  1TDL A;  1PYY A;  2HP5 A;  3BFG A;  1K57 C;  4NXG A;  4GZB A;  3UB6 A;  4HP9 A;  4IVI A;  2WZX A;  4KZ4 A;  2Y91 A;  3T1S A;  4ARZ B;  1BUL A;  2EX2 A;  3LR0 A;  1LLB A;  4HEF A;  4EWF A;  1IKG A;  2BLS A;  4KZ8 A;  3HBR A;  3OPH A;  4OVD A;  1FIK A;  2ZLY A;  2G2W A;  2XD5 A;  5F69 A;  2A2L A;  3PBS A;  1KE4 A;  4CLC C;  3Q81 A;  1ESI A;  1SKF A;  4QY6 A;  2QMI A;  1OTI A;  4FUW A;  1XXM A;  2V0U A;  2Y2P A;  1ES3 A;  4JGP A;  4F3L B;  2A3U A;  3CG5 A;  4Q0H A;  4IVK A;  2H0Y A;  3UME A;  3GEC A;  1OT9 A;  1GA0 A;  4EBP A;  4E3L A;  4R23 A;  3IWI A;  3K3C A;  4IJG A;  3ZG0 A;  3DWZ A;  4YIN A;  4H6J B;  3MQO A;  4RVA A;  2XEP A;  2PD8 A;  4YOF A;  4Y0O A;  3RXX A;  4CJN A;  2GDN A;  3G30 A;  1IYS A;  1CEF A;  5HAQ A;  1DJC A;  5IS1 A;  4GDN A;  2ZOH A;  4KQO A;  1W7F A;  2HDR A;  4IBX A;  4EQ1 A;  4MLL A;  3UNW A;  3W4P A;  4LRY C;  2Y2H A;  5GLA A;  4PM8 A;  4UA9 A;  2M1C A;  4JXG A;  3E98 A;  3DAV A;  4MBK A;  2OWH A;  4Y17 A;  1MBL A;  1T1A A;  2P9V B;  1DJB A;  3VP1 A;  5IT5 A;  2C6W B;  3KYE A;  3MFX A;  3BFC A;  3ICY A;  2XA7 S;  3PBO A;  4ZRR A;  3S22 A;  3O86 A;  3VE4 A;  4EU0 A;  4LEN A;  1EI5 A;  2OOL A;  4DXC A;  1TEM A;  4X6T A;  3D72 A;  3RFB A;  4BEN A;  4KZ3 A;  2QHK A;  1MC0 A;  2Y79 A;  2UV0 E;  1K54 A;  1E25 A;  1OTA A;  5A93 A;  4OPR A;  1W63 Q;  2VGJ A;  1XJ2 A;  1YQS A;  2Z6D A;  1HTZ A;  4IED A;  1L0E A;  1MWT A;  1YLJ A;  4E3I A;  4RX3 A;  1ZG6 A;  2ZM2 A;  1NLY A;  4BWI A;  3HJK A;  2X01 A;  5GHZ A;  5HW3 A;  1EWZ A;  5KMW A;  3N4I A;  3IXB A;  3ITA A;  2Y2G A;  5KIZ A;  1OTB A;  1PZP A;  4Y13 A;  4HES A;  4PKY G;  3LIB A;  2JHE A;  4X56 A;  3NY4 A;  3CMZ A;  1DP8 A;  1Z09 A;  1K4E A;  3QNB A;  3LIA A;  3QNC A;  1UGU A;  3C7U A;  3AGE A;  5I5L A;  2Z6C A;  5J8X A;  4UAA A;  4DXB A;  2PD7 A;  3EEA A;  3G2Y A;  3UE1 A;  4Z1W A;  5HDC A;  3NCK A;  5A91 A;  3W2Z A;  1L0G A;  4FH2 A;  1K56 D;  5HWW A;  4X1L A;  3S7N A;  3QP1 A;  2OV5 A;  2QYB A;  4GCZ A;  2VJW A;  4OH0 A;  3L9K A;  2Y2K A;  3IHA A;  1BLS A;  3IH8 A;  1MY8 A;  4BLM A;  4EQI A;  4K91 A;  4D2O A;  5J7E A;  4JF4 A;  1PW1 A;  2DCF A;  4I39 A;  3VOZ A;  5EPH A;  1JNU A;  5CXW A;  4DKI A;  1PIO A;  1YPR A;  3IBR A;  1FCM A;  4PKY A;  3T1Q B;  3T4K A;  3PXP A;  4N1X A;  5FEF A;  2DMW A;  4FOF A;  3ZCZ A;  1N9L A;  4HY8 A;  5GHX A;  2XFT A;  3T4L A;  1IYO A;  2Y2O A;  1P9W A;  1RCJ A;  3TSG A;  4M3K A;  3C5A A;  4OQG A;  1PW8 A;  4N9L A;  2ZM8 A; 
#chains in the Genus database with same CATH homology
 2WAE A;  3JYI A;  4H8R A;  1BTL A;  1IKI A;  2UWX A;  4Y0U A;  1XGI A;  3ZNT A;  1SDE A;  5EOE A;  1TVF A;  1ES2 A;  1JTD A;  2G2U A;  5CEB A;  4OPQ A;  3V3S A;  1BSG A;  4BL2 A;  5JYP A;  1NZO A;  5FQQ A;  2JC7 A;  1ERO A;  5F1G A;  4DDY A;  4JKT A;  4XXR A;  1MXO A;  5M1A A;  5GLC A;  1FCN A;  4WMC A;  3UDI A;  5EOO A;  1PWG A;  3LY4 A;  1K25 A;  1PI5 A;  2R9W A;  3WS1 A;  4DRT A;  3IXH A;  1L0D A;  4X55 A;  5CRF A;  1OME A;  5DTS A;  5EE8 A;  3AGF A;  2WAD A;  4L0L A;  5CER A;  5HAR A;  3UE3 A;  5AQ7 A;  3VOY A;  3MZE A;  1HVB A;  2XQZ A;  2IWD A;  1BLP A;  3UE0 A;  4JXV A;  4U3T A;  3IF6 A;  3S1Y A;  4E3M A;  4PM5 A;  1PWC A;  3BEC A;  4B88 A;  4E6W A;  2C5W B;  3ZDJ A;  4KG5 A;  1J9M A;  4NET A;  1CI8 A;  3HUM A;  3LY3 A;  5TGF A;  5EVI D;  5A92 A;  1XX2 A;  3HRE A;  5FAS A;  3IXD A;  2WAF A;  4P87 A;  5CHU A;  4LV1 A;  5E2H A;  4C6Y A;  3FKW A;  3LCE A;  3Q82 A;  4XUX A;  2Y2J A;  3BM6 A;  3LEZ A;  5KSH A;  2HDS A;  4E6X A;  3E2L A;  2BG1 A;  3IT9 A;  4WZ4 A;  1KGF A;  2H0T A;  4O7D A;  3SH9 A;  4WBG A;  1XP4 A;  1FSW A;  5CHM A;  5HL1 A;  2A49 A;  5TR7 A;  1BT5 A;  5CGX A;  1SCW A;  1M6K A;  2Y2N A;  3AGD A;  3NC8 A;  3P09 A;  4PPR A;  3ZG8 B;  3M6B A;  4BD1 A;  3HL9 A;  2P9V A;  3VP3 A;  3ISG A;  4OP5 A;  1MKI A;  1KGG A;  3A3I A;  4S2N A;  2IWC A;  2XH9 A;  4PM7 A;  4BL3 A;  3G34 A;  2OLV A;  2WKH A;  3GV9 A;  4ID4 A;  3TG9 A;  1PZO A;  3SOI A;  3VSK A;  3M2K A;  2PBY A;  5EVL A;  2ZQD A;  4QU3 A;  1HZO A;  4P85 A;  2V20 A;  5DF7 A;  3S4X A;  5HAI A;  1YMX A;  2EX6 A;  1BZA A;  5A90 A;  2P74 A;  4C75 A;  4Q8I A;  5HX9 A;  3ITB A;  3OCL A;  2ZD8 A;  2ZQ9 A;  5CEC A;  1JWZ A;  5DVA A;  4C3Q A;  1IEM A;  2CC1 A;  1YLY A;  5EVI C;  4ZBE A;  1YLW A;  3SH7 A;  2XLN A;  5GL9 A;  3A3D A;  3G35 A;  1DY6 A;  3CZD A;  4ZTK A;  5FAO A;  3EQU A;  4KZ9 A;  3W4O A;  1LL9 A;  1BLH A;  4OP8 A;  1KE3 A;  3DTM A;  4DE3 A;  4IBR A;  2ZC5 B;  3PBN A;  2Q9N A;  5AQA A;  3WS4 A;  1N9B A;  4KZB A;  1MWR A;  2DNS A;  3VP0 A;  3M6H A;  5G18 A;  3PTE A;  1W8Y A;  1C3B A;  2HDQ A;  4DF6 A;  1Q2P A;  1CI9 A;  1M40 A;  2E8I A;  2XDM A;  5DTT A;  2EXA A;  4RA7 A;  4QHC A;  4S2I A;  4XUZ A;  3IHB A;  3WS2 A;  4A5R A;  3NI9 A;  4K0X A;  3MKF A;  3MFD A;  2QPN A;  3G31 A;  3BLM A;  3N6I A;  5HFO A;  1RGY A;  1KDW A;  4GN2 A;  1ES4 A;  2XR0 A;  4R3J A;  1ES5 A;  4GNU A;  2Y2M A;  2ZMA A;  3UPO A;  1RP5 A;  2Y2L A;  3SS5 A;  4GOG A;  4JF5 A;  3OPL A;  3HLF A;  5FDH A;  4E3K A;  4WMC D;  2XD1 A;  3MXS A;  2ZJ9 A;  1K55 C;  2H10 A;  4OQ0 A;  4ZJ1 A;  2WKI A;  4K0W A;  1GHP A;  2V1Z A;  2I72 A;  4OLD A;  4UA6 A;  3SS4 A;  3GR2 A;  5M18 A;  2ZQ7 A;  3MBZ A;  2ZC4 B;  3CJM A;  3N8R A;  3GQZ A;  3V5M A;  1XKZ A;  4GB7 A;  3O88 A;  1BUE A;  1K38 A;  3BYD A;  1U60 A;  3GTC A;  3NDG A;  4BQM A;  4JPM A;  4MBF A;  3UPP A;  3IF5 A;  3BFE A;  3OCN A;  4WM9 A;  4KG6 A;  4MNR A;  5E43 A;  1TDL A;  4RYE A;  3VFF A;  1PYY A;  2HP5 A;  3BFG A;  5FSR A;  4JBF A;  4ZJ2 A;  3HUN A;  1MPL A;  1K57 C;  3IWQ A;  2ZC7 A;  3PAG A;  1K54 C;  1H8Y A;  4GZB A;  5CHJ A;  3MXR A;  2HP6 A;  4HBU A;  2PU4 A;  4UA7 A;  5FAQ A;  1E3U A;  4BD0 A;  4IVI A;  2WZX A;  2HP9 A;  1XA7 A;  2Z2M B;  1IYP A;  4KZ4 A;  2Y91 A;  3A3E A;  1BUL A;  1QMF A;  1WE4 A;  3ZHH A;  1XGJ A;  2EX2 A;  4WEK A;  1W79 A;  1LLB A;  3B3X A;  3E2K A;  4HEF A;  4EWF A;  4YFM A;  2RCX A;  4S2J A;  4EBL A;  1IKG A;  1ESU A;  1ONH A;  2XK1 A;  2BLS A;  1HD8 A;  1MWU A;  4KZ8 A;  3HBR A;  3GRJ A;  3OPH A;  2X02 A;  4OVD A;  3C7V A;  3W4Q A;  1H5X A;  3Q07 A;  2ZLY A;  4KG2 A;  1ALQ A;  2G2W A;  2XD5 A;  1YLT A;  4S2L A;  3V50 A;  1LI0 A;  4CPK A;  3PBS A;  1W5D A;  1KE4 A;  1IEL A;  1SDN A;  4FD8 A;  4WZ5 C;  5DF9 A;  3VP4 A;  3Q81 A;  3UN7 A;  1ESI A;  3BFD A;  1SKF A;  4QY6 A;  1NY0 A;  4NK3 A;  3I7J A;  3QHY A;  2QZ6 A;  2H5S A;  2QMI A;  5AQB A;  2WGI A;  4JXS A;  1XXM A;  1Y54 A;  3FWL A;  1FOF A;  2Y2P A;  3EQV A;  1ES3 A;  3ZNY A;  3N8S A;  4R1G A;  3TOI A;  2A3U A;  3CG5 A;  4IVK A;  4X68 A;  3C4P A;  4R3B A;  4P6B A;  4DDS A;  4EV4 A;  2H0Y A;  3Q7V A;  1O7E A;  2ZQA A;  4QD4 A;  2VGK A;  5EEC A;  1GA0 A;  2FFY A;  2Z2L B;  4EBP A;  4E3L A;  4R23 A;  1NRF A;  3HLD A;  4PM9 A;  3IWI A;  3WRT A;  4E3N A;  3ZG0 A;  1TDG A;  3DWZ A;  4OPY A;  1I5Q A;  3UDX A;  4YIN A;  3ZVW A;  5F1F A;  2EX9 A;  1GHI A;  4U0T A;  3OPR A;  5CGW A;  2HPB A;  3Q7Z A;  2WZZ A;  5D3O A;  4F94 A;  4RVA A;  2XEP A;  4JXW A;  1O07 A;  4Y0O A;  3RXX A;  4CJN A;  2GDN A;  2ZQ8 A;  4Y0T A;  3G30 A;  1IYS A;  1CEF A;  5HAQ A;  1DJC A;  4OOY A;  3IF6 B;  2Y2I A;  3NIA A;  3BFF A;  4S2P A;  3MKE A;  3V3R A;  4WEL A;  4JLF A;  4GDN A;  2JBF A;  1SHV A;  3VP2 A;  1K6R A;  4KQO A;  3V39 A;  1K56 A;  4DE2 A;  1W7F A;  1Z6F A;  2HDR A;  4IBX A;  4MLL A;  5FAP A;  3SS3 A;  2Y59 A;  5E2E A;  3UNW A;  4MEZ A;  3W4P A;  2XGN A;  3OZH A;  2Y2H A;  1ZG4 A;  5GLA A;  1Q2Q A;  2WYX A;  1QME A;  4FH4 A;  4N92 A;  1KE0 A;  1W8Q A;  2ZQC A;  4PM8 A;  4UA9 A;  1GA9 A;  4WEJ A;  4JXG A;  4R0Q A;  2ZC6 B;  4GD8 A;  1JWV A;  4MBK A;  3FKV A;  1NJ4 A;  1ERM A;  4LV0 A;  4PM6 A;  1MBL A;  3LO7 A;  4Z9Q A;  1JWP A;  2P9V B;  5CTM A;  3NDE A;  1DJB A;  3G2Z A;  2JCH A;  5L2F A;  1K55 A;  3VP1 A;  3HLC A;  1PWD A;  2C6W B;  3OPP A;  1MWS A;  4ZAM A;  5IHV A;  3Q1F A;  3BEB A;  1FCO A;  3BFC A;  5DF8 A;  3FZC A;  3M2J A;  4E3O A;  1E3U D;  2Y55 A;  3PBO A;  3S22 A;  4OQH A;  3O86 A;  4LEN A;  1NXY A;  2X71 A;  1EI5 A;  3G4P A;  3PAE A;  2J7V A;  4OKP A;  4DXC A;  5F83 A;  1TEM A;  4X6T A;  2J9P A;  5E2F A;  4BEN A;  1VM1 A;  4KZ3 A;  5FI7 A;  4KZ6 A;  2WK0 A;  1FQG A;  3D4F A;  1K57 A;  4GKU A;  4B4X A;  1DJA A;  1K54 A;  3HLB A;  4GD6 A;  1E25 A;  1VQQ A;  4DE0 A;  5A93 A;  4FSF A;  4OPR A;  1I2W A;  4DE1 A;  2ZM0 A;  2VGJ A;  4R4R A;  2OSU A;  4LCM A;  5FA7 A;  1YQS A;  2J9O A;  3ZGA B;  3IQA A;  3N7W A;  1HTZ A;  1JTG A;  1L0E A;  1MWT A;  4IED A;  1YLJ A;  3RXW A;  4RX3 A;  1ZG6 A;  4E3I A;  5EUA A;  2JE5 A;  3MZF A;  3WRZ A;  1NYM A;  2ZM2 A;  3ZFZ A;  4OOM A;  5E2G A;  1YT4 A;  2WKE A;  2X01 A;  2PU2 A;  3A3F A;  3OC2 A;  5GHZ A;  5HW3 A;  1EWZ A;  3IWO A;  5KMW A;  3DWK A;  3BLS A;  3N4I A;  3IXB A;  1KVM A;  2WUQ A;  4ZDX A;  5JYO A;  1YLP A;  1ZC2 A;  4KQQ A;  3ITA A;  5FAT A;  5KZH A;  2Y2G A;  1XPB A;  2V2F F;  4N9K A;  4RX2 A;  1KDS A;  4E3J A;  4KZ5 A;  1BLC A;  1PZP A;  3N8L A;  5HAP A;  3MZD A;  1CK3 A;  3PBT A;  4HES A;  4WZ5 A;  4OPZ A;  5GLD A;  3IF6 C;  5FQ9 A;  3HLG A;  3O3V A;  5CGS A;  1JVJ A;  1RGZ A;  3O87 A;  1AXB A;  2WGV A;  4UHU A;  4X56 A;  3NY4 A;  4FCF A;  3CMZ A;  4S2K A;  3HLW A;  1E4D A;  4B4Z A;  4BJP A;  1K4E A;  4JF6 A;  4P0M A;  3GSG A;  4OQI A;  2RL3 A;  1ERQ A;  3QNB A;  5I94 A;  1LI9 A;  2J8Y A;  4EUZ A;  3QNC A;  4QB8 A;  5AQ9 A;  3C7U A;  3BRM A;  5KSC A;  5FI6 A;  3ZVT A;  3AGE A;  1K4F A;  1GHM A;  5J8X A;  4UAA A;  4DXB A;  3PBQ A;  3G2Y A;  1K6S A;  4S2M A;  1L0F A;  5F82 A;  3UE1 A;  4KZA A;  1YM1 A;  3ZG9 B;  3HUO A;  3NBL A;  3NCK A;  5A91 A;  3SH8 A;  2EX8 A;  1L0G A;  4FH2 A;  2DRW A;  3WS5 A;  3FV7 A;  1K56 D;  5FQJ A;  4EBN A;  1I2S A;  2WGW A;  5EVI A;  2OV5 A;  3UY6 A;  2EFU A;  3IH9 A;  5U47 A;  1KGE A;  4QJG A;  4QY5 A;  4OH0 A;  4S2N C;  1N4O A;  1IYQ A;  2Y2K A;  1WYB A;  3IHA A;  1FR6 A;  1BLS A;  3UO9 A;  3PBR A;  4HBT A;  3VMA A;  5GLB A;  3IH8 A;  1MY8 A;  1S6R A;  4BLM A;  4EQI A;  2OLU A;  5FQM A;  3C4O A;  1G68 A;  4K91 A;  2Y2Q A;  4D2O A;  2B5R A;  1YLZ A;  4JF4 A;  4N1H A;  1NZU A;  3HLE A;  1PW1 A;  3FYZ A;  4OLG A;  1ZKJ A;  3GVB A;  2DCF A;  2FFF B;  1ONG A;  1LL5 A;  4X53 A;  5FQK A;  4LCL A;  4LV2 A;  4KEN B;  1L2S A;  4OOL A;  3VOZ A;  2IWB A;  2EXB A;  5EPH A;  1PI4 A;  1LHY A;  4WYY A;  3UPN A;  5CXW A;  3GMW A;  3WWX A;  5CTN A;  3G32 A;  2EFX A;  3IXG A;  1PIO A;  4DKI A;  4PMA A;  3RJU A;  3WS0 A;  5GHY A;  1FSY A;  4OON A;  3ZG7 B;  1FCM A;  4S2O A;  4ZJ3 A;  4MBH A;  5FQI A;  1GCE A;  4N1X A;  4X69 A;  3VSL A;  5M19 A;  3UDF A;  4GDB A;  5FI2 A;  3ZCZ A;  3DW0 A;  5TFQ A;  3Q7V B;  1KVL A;  1YMS A;  1NYY A;  4KQR A;  5DTK A;  1H8Z A;  1XA1 A;  2ZC3 B;  1FR1 A;  5GHX A;  2XFT A;  4Y7P A;  5BOH A;  2XF3 A;  2Y4A A;  1S0W A;  1IYO A;  2Y2O A;  2HDU A;  3HVF A;  4LV3 A;  4KZ7 A;  1G6A A;  2R9X A;  2Q9M A;  2XFS A;  4U0X A;  1WYC A;  2WGW B;  3A3J A;  1RCJ A;  4R4S A;  5EVI B;  3W8K A;  5CED A;  3VFH A;  3P98 A;  3ZG5 A;  3TSG A;  4M3K A;  3C5A A;  4OQG A;  1PW8 A;  4N9L A;  2ZM8 A;  1CEG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...