4L9EA

Structure of ppsr q-pas1 from rb. sphaeroides
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
115
structure length
115
Chain Sequence
b'TQREMETRYRVVLDVSRDPMVLVSMSTGRIVDLNSAAGLLLGGVRQDLLGAAIAQEFEGRRRGEFMETMTNLAATESAAPVEVLARRSQKRLLVVPRVFRAAGERLLLCQIDPAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcriptional regulator, PpsR
molecule tags Transcription
source organism Rhodobacter sphaeroides
publication title Multi-PAS domain-mediated protein oligomerization of PpsR from Rhodobacter sphaeroides.
pubmed doi rcsb
total genus 39
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2013-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13188 PAS_8 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4l9eA00
3MR0A 2YKFA 3H82B 3LIFA 3H7WA 1P0ZA 3MQQA 4XT2A 1T1BA 4EERA 4EEPA 1S1ZA 3UB7A 1N9OA 4HJ3A 4F3LA 1OTBA 4LRZE 1KOUA 3FC7A 2M1CA 4EQ1A 2V1AA 3LI8A 3E4QA 1DP9A 2YKHA 3H82A 4GHIA 5J7EA 1D06A 4EEUA 3E4PA 4HOIA 2ZOIA 3LIBA 5IU1A 1GSWA 2OOLA 3VOLA 4I3JA 4GCZA 2B02A 3IS2B 4HY8A 5G4ZA 4BBVA 3K3CA 3A0RA 5HWTA 2HV1A 4LRYC 3NOTC 4PKYG 2KDKA 1WA9A 4WF0A 1DP6A 5HD3A 1V9YA 3PYPA 2PDRA 4K08A 1TS0A 3ICYA 3K3DA 3NOUC 1T19A 4HNBA 4R3AA 2L4RA 3A0VA 3IBRA 2V0WA 1LSVA 2A24B 3F1OB 2EA9A 4MN6A 4PKYA 4H6JA 4MN5A 3RTYA 4E04A 1ODVA 3NOPC 1EW0A 1S1YA 2JN7A 4NXGA 3HJIA 5I5LA 4F3LB 5TBMB 4KUOA 1OTIA 1N9NA 2WKPA 5DJTA 5A8BA 1T18A 2PD8A 1T1CA 2L0WA 3EWKA 4EXOA 2VV8A 1OJ5A 4NXFA 4XT2B 5HDSA 1XJ3A 3UMEA 1MZUA 5AVFA 1XJ4A 2VV7A 1DRMA 3CAXA 3FG8A 3NHQA 5DKLA 5J4EA 3NJAA 2QKPA 4GS9A 3IS2A 1TS8A 1N9LA 3F1NB 4HH3A 4HJ4A 1Y28A 4I3IA 5KIZA 2VLGA 1S4SA 3A0SA 4EETB 1BYWA 3F1PB 3P7NA 5HDCA 4NXEA 4HIAA 4WUJA 1X0OA 1UGUA 4R6LA 5DJUA 3HJKA 3D72A 1OTEA 1XJ2A 5EFWA 4I38A 4I39A 5F69A 3GDIA 1LSXA 3LI9A 4I5SA 4RQ9A 5IS1A 3ZQ5A 4EESA 4L9EA 5TBMA 5F6AA 1XFNA 2ZBBA 5HWVA 1P97A 5HDDA 1T1AA 3MFXA 5DKKA 3MJQA 2A24A 3ULFA 2VEAA 4H6JB 3C2WA 1JNUA 5J3WA 4HP9A 4LPZA 3RH8B 3KX0X 2W0NA 4HI4A 2QJ7A 1NWZA 4L9FA 5HSQA 2P7JA 3SW1A 2D02A 5HWWA 1GSVA 3EEHA 4HJ6A 2I9VA 3UE6A 1UWNX 3LICA 3F1PA 1UWPX 2PR6A 3H9WA 5HZHA 1DP8A 2PYPA 3VE3A 5HD5A 3UMDA 3CLOA 2BASA 1TS6A 1OT6A 2L1MA 4GS9B 1F98A 4GW9A 4HHDA 1GSXA 4JGQA 3T50A 1VB6A 4WN5A 4R70A 2Z6CA 2R78A 3LUQA 4HP4A 4JGRA 2WKRA 3LYXA 2JHEA 2QHKA 4HQAA 5AVEA 4DJ3A 1S4RA 2PD7A 3BY8A 1D7EA 2J80A 4KQDA 3MQOA 2Z6DA 3GECA 4WLAA 1LL8A 1OT9A 4JGPA 3PHYA 1OJGA 4GHIB 4M4XA 4BBTA 4L9GA 3MXQA 4JGOA 3H7WB 2V0UA 4R38A 4KUKA 5F68A 3C8CA 3VE4A 1XFQA 2OWHA 2V9AA 3CWFA 3LIEA 4LRXC 1LSWA 2VV6A 3OLOA 5F5YA 3F1OA 2K7SA 2GJ3A 3BY9A 3G6OA 4DJ2A 3E4OA 2PHYA 4BBUA 2H28A 4B9OA 2INWA 2W27A 1OTAA 3LIDA 4WL9A 4HH2A 2WKQA 4LLOB 4EW7A 2V1BA 2CMNA 4NXBA 4YWZA 2ZOHA 2D01A 3B33A 1G28A 1OTDA 3UB8A 2OWJA 2PYRA 3LIAA 1F9IA 2QWSA 4I3AA 3UB9A 2KX6A 1V9ZA 5G4YA 1TS7A 1XJ6A 1LT0A 2PR5A 3F1NA 3UB6A 2QJ5A 1S67L 1S66L 3BWLA
chains in the Genus database with same CATH superfamily
1BT5A 5GLAA 1GA0A 1Y4OA 2YKFA 2HF6A 3T4OA 4QU3A 3UB7A 1NLZA 1KGGA 2JCHA 1D06A 4OPQA 3LIBA 4E3NA 4E3MA 3VOLA 4HBTA 1LI9A 3NOTC 1VQQA 3NCKA 4K08A 4KZ6A 3A0VA 2V0WA 1WYCA 1YSPA 2WGWB 3S22A 5CRFA 3IF6C 3OCNA 3UE0A 1O7EA 1RP5A 2L0WA 2ZL1A 1MWSA 3A3IA 1TS8A 3S7OA 3OBFA 2P08A 1MWRA 1YM1A 4WUJA 2J3TC 3SS5A 1UGUA 4PAUA 3LEZA 3DTIA 3IQAA 2H0YA 4FH2A 2ZMVA 4L9EA 1XFNA 3MFXA 4IHQA 5DKKA 2A24A 2JKTM 4F94A 4H6JB 3U4LP 3KX0X 4HI4A 3N6IA 3SW1A 5FAPA 1K54A 3WS1A 2PYPA 3IWIA 2OLVA 4OQIA 4ME4A 3Q07A 4HQAA 3BY8A 3ZDJA 1TDLA 4P0MA 5KSCA 3G32A 1ZG6A 2PHYA 3G31A 2G2UA 4RA7A 3UE3A 3IH8A 3IWOA 5GL9A 3MMHA 3UB8A 1SDNA 4WMCD 3MXSA 3HVFA 1SDEA 5EECA 4MNRA 4KZ4A 5HWVA 3P01A 4LV1A 4DDSA 3WWXA 1MC0A 3IF6A 3LI8A 1W8QA 4OKPA 2OV5A 3HUNA 2IWCA 1FQGA 3PTEA 2ACGA 2B02A 2WKIA 2Y2HA 3GRJA 4HY8A 3K3CA 1WYBA 2KDKA 3IWQA 1TS0A 4KUOA 1H8MA 3EWKA 1OJ5A 4NXFA 1NZOA 1FIKA 5DF7A 3IXGA 4CLCC 4S2OA 5FAOA 3P7NA 2V8FA 3UDXA 5DJUA 1VHMA 1XJ2A 2Y55A 4BLMA 5M19A 5F6AA 3LO7A 2WADA 1ONHA 1W63M 1NWZA 2D02A 1FR1A 3G34A 4ZBEA 2XF3A 1BLHA 3MZFA 3T1XA 3CLOA 1VETB 2L1MA 1GSXA 3MS6A 5IU1A 2Z6CA 1K38A 2LB9A 2WKRA 2HGVA 2Y2MA 5GHYA 3ZG5A 2Z6DA 1RGZA 1OJGA 4M4XA 4GN2A 3E2LA 3G30A 4E3OA 3FZCA 3IX8A 4A5RA 4WL9A 2V1BA 2EXBA 4MCWA 2D01A 1OTDA 4OOYA 2B5RA 5CTMA 1Q2PA 1KGEA 3LIFA 4XT2A 2NUPC 4PHTA 4U3TA 4O01A 4GLQA 2JC7A 4WZ5A 3EOIA 4X25A 4CLCE 5G4ZA 3IXBA 5HWTA 5FQQA 4WF0A 4X68A 5FQIA 2L4RA 3F1OB 4IUHA 1K25A 3T12B 4S2JA 5C5KA 1EW0A 3ZHHA 4DE0A 2WKPA 3QP5A 1XJ4A 4EUVA 5D3OA 2EWWA 5AQ9A 4P6BA 1BYWA 4X6TA 3Q81A 3VFHA 1IEMA 5FQMA 2HPBA 5F69A 3P98A 1F2KA 2ZBBA 1JWZA 3WRZA 2XD1A 3M2KA 1I5QA 5DTSA 4ETXA 3A3JA 5A93A 3NULA 4GDNA 5GHZA 4QWOA 3FKVA 3LICA 5E43A 1L0GA 1CI8A 3BFGA 4K91A 3M6BA 4IUKA 4JF4A 1E4DA 1W5DA 4S2MA 4JGRA 4Y5FA 3TW8A 3HBRA 1G6OA 2XA7M 2WZXA 1MBLA 4DE3A 2Y2JA 3W4QA 3FPWA 3TE8A 4E3LA 5TGFA 5FDSA 2WKQA 3IHBA 4O7DA 1FSWA 3RJUA 2AVXA 3LCEA 3PBOA 2J8YA 3ITBA 3F1NA 3BEBA 1RGYA 4KG5A 1ZKJA 3BWLA 1XA7A 4DXCA 1F5MA 1T1BA 2WUQA 3BFDA 4DDYA 3H82A 3KYEA 4HOIA 4P87A 3S1YA 1M6KA 4GB7A 2ZQ7A 1SCWA 2HDQA 4CJNA 4E04A 1ODVA 5CGWA 2JN7A 2MJ6A 3UB5P 3C30A 4R4SA 3NJAA 5CHJA 1L2SA 1MWUA 1NRFA 1E3UD 2X71A 1G6AA 1S4SA 1X0OA 2VGJA 4N1HA 2HP9A 3LI9A 4I5SA 1P9RA 5EVIA 2VGLM 5L07A 3ZCZA 4FTXA 4JLFA 3R4KA 2GDNA 1GHMA 3N7WA 1GSVA 3E2KA 3EEHA 1W79A 5F83A 5CGSA 4HHDA 4WN5A 4HEFA 2J80A 5EOEA 3N8SA 4HESA 5F68A 1NYYA 2OWHA 5EVIB 2XK1A 3T4JA 3UPPA 3LFVA 3PAGA 3DWZA 1N4OA 2XA7S 3CI6A 2Y2IA 4NKPA 3MKFA 5G4YA 1LT0A 1S6RA 3WS4A 2CC1A 2Y2KA 4UA7A 3MFDA 2PBYA 5FL3A 1N9OA 5CXWA 2YKHA 4JPMA 5EUAA 3LR3A 3IH9A 4MMNA 4YOFA 3DAVA 2BTFP 2ZC3B 2KLIA 3WS0A 2ZC7A 1LI0A 3MKEA 3IXHA 2HP5A 3IBRA 5AQBA 2A24B 3KSFA 4B4XA 3CPTA 5DJTA 2VV8A 2R9XA 3HUOA 2VV7A 3CAXA 1BULA 2H10A 1K55C 4IVIA 3QP2A 1Y28A 1KE0A 2OAQ1 4BJPA 4OPRA 1M40A 3I7JA 4DN0A 5A92A 2B95A 2FFFB 3GQZA 2VEAA 4KZAA 5CHUA 4MEZA 1CK3A 2K2NA 1JTDA 3G4PA 4BENA 4MLLA 4O8GA 3H9WA 5CERA 2C5WB 5EV0A 3IF5A 1F98A 4GW9A 2WYXA 4OPYA 2XLNA 2M7VA 3HLWA 1RCJA 3GECA 3IF6B 4GHIB 5FATA 3ZG8B 4PM8A 5EVIC 5FI7A 5F5YA 2H5SA 4BBUA 4B9OA 5FQJA 1D1JA 2XDMA 3KO6A 1G28A 2DRWA 5JYPA 4R3BA 1YQSA 5GLDA 2A3UA 4QD4A 4FH4A 5E2FA 4S2PA 4I3JA 5HZHA 4O0PA 2EXAA 3MR0A 4QB8A 3C38A 4F3LA 3PBSA 3LR5A 1DP9A 5EVLA 4K0WA 4KQQA 2EFUA 4Y0TA 3ZVTA 2Y2QA 1WA9A 1IELA 2PDRA 3NOUC 2QMIA 5I5LA 3MZDA 2G2WA 1YLTA 5A8BA 3ISGA 2PD8A 3GMWA 1MZUA 1WE4A 4IJGA 2O99A 4HIAA 4ZDXA 2ZMFA 4GD6A 1GA9A 4EQIA 1PRQA 1CQAA 2K31A 1A0KA 5DTKA 5A90A 1TVFA 2I72A 2W0NA 2W3GA 3CMZA 5HWWA 3IX3A 3PXPA 4WEKA 1FOFA 3VE3A 3QNCA 3T1QB 5J3WA 4OONA 5AQ7A 3SS3A 1K4FA 4YFMA 2QHKA 3NIAA 5DF8A 3V5MA 1I2WA 2W3HA 2O9CA 3MXQA 3SH9A 3HLFA 2VV6A 2JKGA 2VA0A 4Q0JA 1YLZA 5CEBA 3HLGA 1DJCA 3MXRA 1PIOA 2EX8A 2A49A 3KSHA 4YWZA 4KZ9A 3LY4A 2P04A 3OZHA 3T4QA 1GCEA 3EGDC 4I3AA 2O9BA 4UQIS 3UB6A 2J9OA 1S67L 1KDWA 1HZOA 3VSKA 4II7A 2V2FF 1S1ZA 2ZM2A 1OTBA 2Y4AA 1FCMA 3LGOA 2HJEA 5L09A 4LRYC 2PU2A 1PNEA 2XEPA 3GSGA 1PW8A 3RTYA 4Y17A 3BRMA 4YINA 4EXOA 3AGDA 4C3QA 4DE2A 1Q2QA 5HDSA 3U2AA 3HCYA 5CGXA 3FKWA 2VLGA 2O9AA 1FILA 3ZVWA 4WZ4A 3CUEA 5JYOA 2IA2A 4N92A 3D72A 1Z09A 4PPRA 5EFWA 5E2GA 2ZL1B 5IS1A 1MY8A 4CQHA 1JWVA 1P97A 4JF5A 3ULFA 5E2EA 5KMWA 1JNUA 1YT4A 2JBFA 3NC8A 4Y0UA 4UA9A 1G5UA 2VGLS 1DP8A 3AGFA 5FDHA 4ZAMA 1YMXA 3NECA 4HP4A 4K0XA 3O87A 4QJGA 2W1RA 1DY6A 1CJFA 1QMEA 4KZBA 4LRXC 1TD5A 3C4OA 2C6WB 1N9BA 3CITA 4BD0A 4R23A 4LFUA 3MQQA 3W4OA 4HJ3A 3UO9A 5EM1A 1K0KA 2WGWA 3VOYA 1EI5A 1KVLA 3C5AA 1MWTA 5EPHA 3OCLA 1V9YA 4WEJA 3K3DA 1PFLA 1LL5A 3ZG7B 4QY6A 1LSVA 1NLYA 4MN6A 4WYYA 3S7PA 3NDEA 4MBHA 1PI4A 1T1CA 3OOVA 5GHXA 4LCLA 3FG8A 4FUWA 1IKIA 2ZC5B 1E3UA 4HJ4A 5HAPA 4JXSA 5HPIA 1JWPA 4EETB 3GR2A 4EBPA 4NEED 1HLUP 5M18A 2DMWA 4S2NC 1XGJA 3UPNA 3K2NA 1PZPA 5MC7A 4L9FA 4OPZA 2FZ0A 3UNWA 2ZC4B 3P09A 1UWNX 2PR6A 2ZQCA 3B3XA 2OSUA 1K6SA 2ZQDA 4BQMA 2LB5A 4DJ3A 2PD7A 4EBLA 4KQDA 1LL8A 3BLMA 1AWIA 2GX5A 4DXBA 2Z2LB 1PW1A 4GKUA 3LIEA 1VETA 2XFTA 3BY9A 1H8ZA 1OTAA 3LIDA 4GNUA 5EVEA 3B47A 2EWVA 4Q0HA 4NK3A 3OC2A 1L3LA 1LLBA 1TS7A 2R9WA 3QP1A 2HDRA 3G35A 1HTZA 3SZTA 4X53A 5HAIA 1CF0A 5F1FA 4KZ3A 3JVUA 3QP6A 3ITAA 1GSWA 4GCZA 5E2HA 1IFQA 1SKFA 4NG2A 3DTKA 3C7UA 4R4RA 3PYPA 1C3BA 3MZEA 1MKMA 1KE4A 1KE3A 3PBRA 4QY5A 4B88A 2XR0A 3SOIA 2IWDA 5AVFA 2JKTI 3ZGAB 4X55A 4WZ5C 5DVAA 4I3IA 3BM6A 1BLSA 4IBRA 5HDCA 4U0XA 4R6LA 3DWKA 3GV9A 4Y15A 4KZ8A 5U47A 3EEAA 4Z9QA 4GD8A 3VP2A 3L9KA 1O07A 3BFCA 3WS2A 4EWFA 2EX9A 3UE6A 1UWPX 5EM0A 1LHYA 2PBDP 4D60A 3IX4A 5KSHA 2JKRI 3CUEC 3LYXA 4WLAA 3E98A 1Y54A 2ZC6B 5CTNA 1ERMA 1NRJA 2Y79A 3A3DA 4KUKA 2Y2PA 5CX7A 2V1ZA 4CLCD 3PR6A 3MSHA 4CLCA 1K57C 4X1MA 5L10A 2H0TA 2XD5A 3B42A 2OWJA 3T4SA 3UB9A 3GVBA 4PM9A 4N1XA 5DFXA 4D2OA 2XH9A 3A3FA 2EX2A 2PAVP 3FC7A 2ZLYA 1GHPA 3MBZA 4X56A 3NBLA 4S2LA 3HLEA 1BSGA 3BJNA 3KSIA 2ZQ8A 1K6RA 4HNBA 3CPTB 3IXDA 1STZA 2J3WA 5DTTA 4DMZA 3NOPC 3WS5A 4JBFA 3HJIA 3T1SA 1FCOA 1XA1A 2XGNA 1YMSA 4LCMA 3BYDA 3BQ8A 3D9YA 3D4FA 4BD1A 4BL2A 3ZG9B 3GDIA 3HLBA 1NZUA 4RQ9A 4GDBA 1IYOA 4ESPA 5HL1A 2E8JA 5TR7A 3C2WA 1SZVA 4N9KA 3T4TA 3ZNTA 3VP3A 2P7JA 5G18A 4JXGA 1LL9A 1ZG4A 4ZTKA 2Q0OA 2ZD8A 1VEUB 3JVVA 4H8RA 4X1LA 3QNBA 1VB6A 4R70A 2R78A 4WBGA 3S7QA 3M2JA 2HZ5A 5GLBA 3VE4A 4S2IA 1IYQA 2VKSA 1AXBA 3VP0A 4QPRA 3ZFZA 4DKIA 4E3KA 2PRFA 4HH2A 3N8LA 3HLCA 4MBFA 3LIAA 1ZHHB 5M1AA 2PR5A 4N9LA 1YLPA 4GJ4A 4FD8A 2OLUA 3VFFA 4PM6A 5TFQA 4ETZA 4P6ZS 1ES2A 2ZOIA 2ZMAA 1VM1A 1XX2A 5HD3A 4G3KA 3S4XA 3ICYA 1ZC2A 2P9VA 4H6JA 1PYYA 1HD8A 1S1YA 4NXGA 5L2FA 4F3LB 3BW6A 3GTCA 4Y13A 2J9PA 4KG2A 1ACFA 4PM7A 1YAXA 4KQOA 4GS9A 1H0MA 1N9LA 3F1NB 3R7WB 4E6XA 2Y2GA 2XRNA 2ZQAA 4U0TA 4WM9A 3JPUA 4I39A 1LSXA 5IHVA 1ERQA 3E0YA 3RXWA 5F82A 3LEQA 3MJQA 2WAEA 1ES4A 4HP9A 1SKOB 3SH8A 4ARZA 3D3OA 2XSSA 3Q7VA 4HJ6A 1ZTUA 4XUXA 5LBRA 4ZJ3A 2HJ9C 3LUQA 3T1RA 4OLDA 1SKOA 3EQVA 3H7WB 4XXRA 3RFBA 4ID4A 3F1OA 4UQIM 3G6OA 1H3QA 1QMFA 4OVDA 2CMNA 3TRCA 2Z2MB 3Q7VB 4OP5A 5I94A 3EGXC 5DF9A 1IYSA 1V9ZA 3QP4A 1PZOA 1XJ6A 3N8RA 5FEFA 1CEFA 2V8CA 3H7WA 2O0YA 3PBQA 1H8YA 2VX8A 4EQ1A 3E4QA 4GHIA 4QHCA 1IKGA 2PT7A 3JYIA 4RVAA 2OOLA 4E6WA 4JXVA 4S2KA 2VK3A 3A0RA 4KZ7A 1NJ4A 1YKDA 2Y2OA 3WRTA 5KZHA 5J8XA 3SS4A 2W1TA 5FI6A 3OPRA 1N9NA 3DTEA 3FYZA 4XT2B 1XJ3A 1K55A 5BOHA 3IS2A 5HPFA 2A2LA 4Y3IA 3V39A 3OPHA 2IWBA 2DNSA 4RYEA 1IYPA 2ZQ9A 3F1PB 4PMAA 2WKEA 4OLGA 2QPNA 3ZQ5A 3PBTA 4R3JA 2QZ6A 1T1AA 3RH8B 4UHUA 5IT5A 2GNXA 3SH7A 2XQZA 1CEGA 2I9VA 2WKHA 4EBNA 1JTGA 5HD5A 4C6YA 1CI9A 1W7FA 4GS9B 3QHYA 3HL9A 4UA6A 4MN7A 4Y2FA 3VSLA 4PM5A 1S4RA 2HP6A 3PHYA 3BFFA 4L9GA 4R38A 5HDDA 1LSWA 2Y8HA 3E4OA 2BLSA 2UWXA 2ZJ9A 3UPOA 3MQ0A 4NXBA 1OMEA 4WELA 3B33A 3O5YA 4FOFA 2QYBA 1NY0A 3C7VA 4EUZA 3Q7ZA 2VZWA 4EERA 3G2YA 4LRZE 2V1AA 4G3WA 4LENA 5J7EA 4EU0A 2KOIA 3UDIA 1NYMA 2Y2NA 5TJJA 3BECA 2HV1A 4CLCB 1GHIA 3ZYTA 4CPKA 4ARZB 2J7VA 4MN5A 1K56D 2J3TD 5AQAA 3T4KA 5HFOA 5A91A 1G68A 2UV0E 3UMEA 4LV0A 4C75A 5DKLA 3NHQA 1L0FA 4P6ZM 3M6HA 3Q82A 1PI5A 4Q0IA 5EOOA 3CZDA 3HJKA 1OTEA 5L8MA 5CECA 4ZRRA 5EVID 3HREA 4XUZA 3HUMA 4L0LA 4E3IA 4EESA 2DCFA 3O86A 2W3FA 2Q9NA 2QJ7A 2W1TB 3KSGA 2FFYA 3RXXA 3BQAA 3NI9A 1TS6A 5FQ9A 4R1GA 1H5XA 3TOIA 2G7UA 1OT9A 3N4IA 4JGOA 2V0UA 5EE8A 1FSYA 4BL3A 1XFQA 3OLOA 2GJ3A 4S2NA 2H28A 3V3RA 2ZOHA 5CHMA 3TG9A 3W2ZA 4WMCA 2QJ5A 2WAFA 4OQ0A 3V67A 2P9VB 1P0ZA 1SHVA 1BLPA 2Y91A 5GLCA 1KOUA 3UY6A 3FPVA 4DF6A 3VP1A 4BBVA 2ZM8A 1YPRA 4IEDA 5HARA 1XP4A 2Q9MA 1TDGA 1DJBA 5K5BA 5TBMB 4IBXA 1T18A 2E8IA 2X02A 3HLDA 4IVKA 4YNRA 2QKPA 3PAEA 3A0SA 1HVBA 1BLCA 4JXWA 4ZJ1A 3ZNYA 4I38A 4KG6A 4FCFA 5TBMA 1ESIA 1YSQA 4DE1A 4BWIA 2VGKA 3TSGA 3LR0A 5HSQA 1EROA 4X69A 2OAP1 2HDUA 1ES5A 4EV4A 1FCNA 3W4PA 1BZAA 3O3VA 2BASA 1ES3A 5FI2A 5AJGA 4OQHA 5FEGA 3MQOA 5HAQA 1I2SA 3IBJA 2P74A 1JVJA 1J3WA 1YLWA 2K7SA 4OOMA 5HX9A 2W27A 3FV7A 3LY3A 2Y59A 4LLOB 4EW7A 1XGIA 1L0DA 4LV2A 1NXYA 3OPLA 4OQGA 2EFXA 3CJMA 3BLSA 4MDZA 2JE5A 2M1CA 4KZ5A 3E4PA 1KVMA 4E3JA 2WGVA 3W8KA 3IS2B 3NY4A 4PKYG 2Y2LA 5F1GA 4Z1WA 1DP6A 1P9WA 1T19A 3O88A 3R7WA 2EA9A 2WGIA 1ALQA 4Y0OA 5FAQA 4UAAA 4GZBA 2RL3A 3L7HA 1J9MA 4KENB 4Q8IA 2XFSA 3OPPA 3LR4A 5J4EA 1DRMA 1VEUA 1EWZA 3Q1FA 5KIZA 3CG5A 2BG1A 3CHWP 4B4ZA 4LV3A 2NUTC 1K56A 4OP8A 2FH5A 1S0WA 3A3EA 3DBAA 1ONGA 1YLJA 5DFYA 3UDFA 1MPLA 3EQUA 1BTLA 3F1PA 1Z6FA 1MXOA 3MF0A 2EX6A 3VV4A 1TEMA 4JGQA 1IOUA 2W3DA 4ZJ2A 1XKZA 3T4LA 1PWCA 2WZZA 3V50A 5HW3A 3UE1A 4JGPA 1W63Q 1K4EA 1TF1A 3G2ZA 3VP4A 3VMAA 1E25A 1ESUA 4JF6A 3CWFA 4M3KA 1U60A 3VOZA 4DJ2A 1DJAA 3KYQA 2INWA 4MBKA 4OH0A 4HBUA 2X01A 2PYRA 1F9IA 2QWSA 4DRTA 3DW0A 4NETA 4JKTA 3ZG0A 5FSRA 4KQRA 3S7NA 3H82B 4LGWA 4EEPA 2M7UA 4G3VA 1K54C 4EEUA 5CEDA 4OOLA 1K57A 1OPXA 1KDSA 4R3AA 1XPBA 2B18A 4PKYA 3NDGA 2VJWA 1YLYA 1OTIA 2HDSA 3PBNA 4RX2A 3BFEA 4BMWA 4HH3A 1W8YA 3IHAA 2RCXA 1PWGA 4NXEA 3QP8A 4FSFA 1XXMA 5FA7A 1BUEA 3FWLA 4Y7PA 1KGFA 2PU4A 4LPZA 3V3SA 3IT9A 4UEYA 4B93A 3KYZA 1FR6A 5FQKA 2ZM0A 3DTMA 3UMDA 1OT6A 3TJZC 4R0QA 3T50A 5FASA 2V20A 4RX3A 5AVEA 2WK0A 2JHEA 1D7EA 3AGEA 4BBTA 2JKFA 3C8CA 2V9AA 2GZAA 2XROA 2W3EA 4P85A 3UN7A 3C4PA 1PWDA 4AFIA 4GOGA 1L0EA 2KX6A 2JKRM 5HL6A 1S66L 1MKIA
chains in the Genus database with same CATH topology
2VZWA 2YKFA 4EERA 2HF6A 3T4OA 5FL3A 3UB7A 1N9OA 1NLZA 4LRZE 2V1AA 2YKHA 4G3WA 5J7EA 3LR3A 1D06A 4MMNA 4EU0A 3JVUA 4YOFA 2KOIA 3LIBA 1GSWA 3VOLA 4GCZA 5TJJA 2KLIA 1IFQA 2HV1A 3NOTC 4CLCB 3ZYTA 3PYPA 4ARZB 4K08A 3A0VA 3IBRA 2V0WA 2A24B 1YSPA 3KSFA 1MKMA 4MN5A 3PBRA 2J3TD 3T4KA 5DJTA 3OCNA 2L0WA 2VV8A 3UMEA 5AVFA 2JKTI 2VV7A 3CAXA 5DKLA 3NHQA 4P6ZM 1TS8A 4I3IA 1Y28A 3S7OA 3OBFA 2OAQ1 2P08A 4BJPA 5HDCA 4Q0IA 4WUJA 2J3TC 1UGUA 4R6LA 3HJKA 1OTEA 5L8MA 4PAUA 4ZRRA 2ZMVA 4L0LA 4EESA 4L9EA 4DN0A 1XFNA 3EEAA 2W3FA 3MFXA 4IHQA 5DKKA 2A24A 2JKTM 2VEAA 4H6JB 3KX0X 4HI4A 2QJ7A 2W1TB 3KSGA 3SW1A 2K2NA 4O8GA 3UE6A 1UWPX 3H9WA 2PYPA 3BQAA 1TS6A 1F98A 4GW9A 2JKRI 5KSHA 3CUEC 4ME4A 3LYXA 4HQAA 2M7VA 3BY8A 4WLAA 3GECA 2G7UA 1OT9A 3E98A 4GHIB 4JGOA 1NRJA 2Y79A 2V0UA 4KUKA 1XFQA 5CX7A 3OLOA 5F5YA 2GJ3A 2PHYA 4BBUA 2H28A 4B9OA 4CLCD 3PR6A 4CLCA 3UE3A 2ZOHA 3MMHA 3KO6A 1G28A 3B42A 3UB8A 2OWJA 3T4SA 3UB9A 5DFXA 3W2ZA 2QJ5A 4I3JA 5HWVA 4O0PA 5HZHA 3MR0A 3P01A 3V67A 1P0ZA 3C38A 4F3LA 1MC0A 1KOUA 3FC7A 3PBSA 3LI8A 3LR5A 1DP9A 3FPVA 2B02A 4HY8A 4BBVA 3K3CA 3BJNA 2KDKA 1WA9A 3KSIA 2PDRA 1TS0A 4HNBA 3NOUC 1STZA 2J3WA 4DMZA 3NOPC 5K5BA 3HJIA 5I5LA 5TBMB 4KUOA 5A8BA 1T18A 1H8MA 2PD8A 3EWKA 1OJ5A 4NXFA 4YNRA 1MZUA 3BQ8A 2QKPA 4CLCC 4IJGA 2O99A 3A0SA 3P7NA 4HIAA 2ZMFA 5DJUA 1VHMA 1XJ2A 4I38A 3GDIA 4RQ9A 2K31A 5TBMA 5F6AA 1YSQA 4BWIA 3C2WA 2W0NA 3LR0A 1W63M 1NWZA 2W3GA 3T4TA 5HSQA 2OAP1 2P7JA 2D02A 5HWWA 3PXPA 4WEKA 3VE3A 3JVVA 3CLOA 2BASA 2L1MA 5J3WA 5AJGA 1GSXA 1VB6A 5IU1A 4R70A 2Z6CA 2R78A 2LB9A 2WKRA 2QHKA 3S7QA 2HGVA 3MQOA 2Z6DA 1OJGA 4M4XA 2W3HA 3IBJA 2O9CA 3MXQA 3VE4A 2VV6A 2K7SA 2VA0A 2VKSA 4OOMA 4Q0JA 4QPRA 2W27A 4WL9A 4HH2A 4LLOB 4EW7A 2V1BA 3KSHA 4MCWA 4YWZA 2D01A 1OTDA 2P04A 3T4QA 3LIAA 3EGDC 1ZHHB 4I3AA 2O9BA 4UQIS 2PR5A 3UB6A 1S67L 3LIFA 4GJ4A 4II7A 4XT2A 2NUPC 1S1ZA 4PHTA 4MDZA 1OTBA 2M1CA 4ETZA 3E4PA 4P6ZS 2ZOIA 4O01A 4GLQA 3EOIA 4CLCE 2HJEA 5G4ZA 3IS2B 5HWTA 4LRYC 4PKYG 4Z1WA 4WF0A 1DP6A 4G3KA 5HD3A 1P9WA 3ICYA 1T19A 2L4RA 3R7WA 3F1OB 4IUHA 2EA9A 3RTYA 4H6JA 5C5KA 1EW0A 1S1YA 4NXGA 4F3LB 3BW6A 2WKPA 4EXOA 5HDSA 3LR4A 1XJ4A 1YAXA 1DRMA 3HCYA 4KQOA 3U2AA 4EUVA 2EWWA 5J4EA 4GS9A 1N9LA 3F1NB 5KIZA 3R7WB 2VLGA 2O9AA 3CUEA 1BYWA 2IA2A 2XRNA 3D72A 5EFWA 5F69A 4I39A 2NUTC 1LSXA 5IS1A 3E0YA 2FH5A 4CQHA 2ZBBA 1P97A 3DBAA 3MJQA 3ULFA 4ETXA 5DFYA 1JNUA 4HP9A 4ARZA 3D3OA 2XSSA 4HJ6A 3EQUA 3LICA 3F1PA 1ZTUA 2VGLS 1DP8A 3MF0A 5LBRA 3VV4A 4JGQA 1IOUA 2W3DA 3T4LA 2HJ9C 4IUKA 4HP4A 3LUQA 4JGRA 4Y5FA 3TW8A 4JGPA 1G6OA 2W1RA 2XA7M 1W63Q 1TF1A 3EQVA 3H7WB 3RFBA 4LRXC 3CWFA 1TD5A 3F1OA 3FPWA 4UQIM 3G6OA 3TE8A 4DJ2A 3KYQA 2INWA 2WKQA 3CITA 1H3QA 2CMNA 3TRCA 3EGXC 5DF9A 2PYRA 1F9IA 2QWSA 3PBOA 1V9ZA 1XJ6A 3F1NA 3BWLA 3MQQA 3H82B 3S7NA 3H7WA 1F5MA 1T1BA 2O0YA 3PBQA 4EEPA 2VX8A 4HJ3A 2M7UA 4EQ1A 3E4QA 4G3VA 4GHIA 3H82A 4EEUA 2PT7A 4HOIA 2OOLA 4OOLA 1OPXA 3A0RA 3OCLA 1V9YA 4WEJA 1YKDA 3K3DA 4R3AA 1LSVA 2B18A 1NLYA 4PKYA 4MN6A 3S7PA 4E04A 1ODVA 2W1TA 2JN7A 2MJ6A 2VJWA 1OTIA 1N9NA 1T1CA 3OOVA 3C30A 4XT2B 1XJ3A 3PBNA 3FG8A 4BMWA 3NJAA 3IS2A 4HH3A 4HJ4A 5HPFA 2A2LA 4Y3IA 5HPIA 1S4SA 4EETB 3F1PB 4NXEA 1X0OA 4FSFA 4NEED 2DMWA 3LI9A 4I5SA 1P9RA 3ZQ5A 3PBTA 2VGLM 1T1AA 3K2NA 5MC7A 3RH8B 4LPZA 5IT5A 4L9FA 3R4KA 2FZ0A 4UEYA 2GNXA 3KYZA 4B93A 1GSVA 3EEHA 2I9VA 1UWNX 2PR6A 5HD5A 3UMDA 4GS9B 1OT6A 4HHDA 3TJZC 3T50A 4WN5A 4MN7A 5AVEA 4Y2FA 2JHEA 2LB5A 4DJ3A 1S4RA 2PD7A 1D7EA 2J80A 4KQDA 1LL8A 3PHYA 4BBTA 4L9GA 2GX5A 4R38A 5F68A 3C8CA 2OWHA 2V9AA 3LIEA 2GZAA 5HDDA 1LSWA 2Y8HA 3BY9A 3T4JA 3E4OA 3LFVA 2XROA 1OTAA 3LIDA 3B47A 2W3EA 3MQ0A 2XA7S 3CI6A 2EWVA 4NXBA 4WELA 4NKPA 4Q0HA 4AFIA 3B33A 3OC2A 3O5YA 4FOFA 2KX6A 2QYBA 5G4YA 1TS7A 1LT0A 2JKRM 5HL6A 1S66L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MR0 A;  2YKF A;  3H82 B;  3LIF A;  3H7W A;  1P0Z A;  3MQQ A;  4XT2 A;  1T1B A;  4EER A;  4EEP A;  1S1Z A;  3UB7 A;  1N9O A;  4HJ3 A;  4F3L A;  1OTB A;  4LRZ E;  1KOU A;  3FC7 A;  2M1C A;  4EQ1 A;  2V1A A;  3LI8 A;  3E4Q A;  1DP9 A;  2YKH A;  3H82 A;  4GHI A;  5J7E A;  1D06 A;  4EEU A;  3E4P A;  4HOI A;  2ZOI A;  3LIB A;  5IU1 A;  1GSW A;  2OOL A;  3VOL A;  4I3J A;  4GCZ A;  2B02 A;  3IS2 B;  4HY8 A;  5G4Z A;  4BBV A;  3K3C A;  3A0R A;  5HWT A;  2HV1 A;  4LRY C;  3NOT C;  4PKY G;  2KDK A;  1WA9 A;  4WF0 A;  1DP6 A;  5HD3 A;  1V9Y A;  3PYP A;  2PDR A;  4K08 A;  1TS0 A;  3ICY A;  3K3D A;  3NOU C;  1T19 A;  4HNB A;  4R3A A;  2L4R A;  3A0V A;  3IBR A;  2V0W A;  1LSV A;  2A24 B;  3F1O B;  2EA9 A;  4MN6 A;  4PKY A;  4H6J A;  4MN5 A;  3RTY A;  4E04 A;  1ODV A;  3NOP C;  1EW0 A;  1S1Y A;  2JN7 A;  4NXG A;  3HJI A;  5I5L A;  4F3L B;  5TBM B;  4KUO A;  1OTI A;  1N9N A;  2WKP A;  5DJT A;  5A8B A;  1T18 A;  2PD8 A;  1T1C A;  2L0W A;  3EWK A;  4EXO A;  2VV8 A;  1OJ5 A;  4NXF A;  4XT2 B;  5HDS A;  1XJ3 A;  3UME A;  1MZU A;  5AVF A;  1XJ4 A;  2VV7 A;  1DRM A;  3CAX A;  3FG8 A;  3NHQ A;  5DKL A;  5J4E A;  3NJA A;  2QKP A;  4GS9 A;  3IS2 A;  1TS8 A;  1N9L A;  3F1N B;  4HH3 A;  4HJ4 A;  1Y28 A;  4I3I A;  5KIZ A;  2VLG A;  1S4S A;  3A0S A;  4EET B;  1BYW A;  3F1P B;  3P7N A;  5HDC A;  4NXE A;  4HIA A;  4WUJ A;  1X0O A;  1UGU A;  4R6L A;  5DJU A;  3HJK A;  3D72 A;  1OTE A;  1XJ2 A;  5EFW A;  4I38 A;  4I39 A;  5F69 A;  3GDI A;  1LSX A;  3LI9 A;  4I5S A;  4RQ9 A;  5IS1 A;  3ZQ5 A;  4EES A;  4L9E A;  5TBM A;  5F6A A;  1XFN A;  2ZBB A;  5HWV A;  1P97 A;  5HDD A;  1T1A A;  3MFX A;  5DKK A;  3MJQ A;  2A24 A;  3ULF A;  2VEA A;  4H6J B;  3C2W A;  1JNU A;  5J3W A;  4HP9 A;  4LPZ A;  3RH8 B;  3KX0 X;  2W0N A;  4HI4 A;  2QJ7 A;  1NWZ A;  4L9F A;  5HSQ A;  2P7J A;  3SW1 A;  2D02 A;  5HWW A;  1GSV A;  3EEH A;  4HJ6 A;  2I9V A;  3UE6 A;  1UWN X;  3LIC A;  3F1P A;  1UWP X;  2PR6 A;  3H9W A;  5HZH A;  1DP8 A;  2PYP A;  3VE3 A;  5HD5 A;  3UMD A;  3CLO A;  2BAS A;  1TS6 A;  1OT6 A;  2L1M A;  4GS9 B;  1F98 A;  4GW9 A;  4HHD A;  1GSX A;  4JGQ A;  3T50 A;  1VB6 A;  4WN5 A;  4R70 A;  2Z6C A;  2R78 A;  3LUQ A;  4HP4 A;  4JGR A;  2WKR A;  3LYX A;  2JHE A;  2QHK A;  4HQA A;  5AVE A;  4DJ3 A;  1S4R A;  2PD7 A;  3BY8 A;  1D7E A;  2J80 A;  4KQD A;  3MQO A;  2Z6D A;  3GEC A;  4WLA A;  1LL8 A;  1OT9 A;  4JGP A;  3PHY A;  1OJG A;  4GHI B;  4M4X A;  4BBT A;  4L9G A;  3MXQ A;  4JGO A;  3H7W B;  2V0U A;  4R38 A;  4KUK A;  5F68 A;  3C8C A;  3VE4 A;  1XFQ A;  2OWH A;  2V9A A;  3CWF A;  3LIE A;  4LRX C;  1LSW A;  2VV6 A;  3OLO A;  5F5Y A;  3F1O A;  2K7S A;  2GJ3 A;  3BY9 A;  3G6O A;  4DJ2 A;  3E4O A;  2PHY A;  4BBU A;  2H28 A;  4B9O A;  2INW A;  2W27 A;  1OTA A;  3LID A;  4WL9 A;  4HH2 A;  2WKQ A;  4LLO B;  4EW7 A;  2V1B A;  2CMN A;  4NXB A;  4YWZ A;  2ZOH A;  2D01 A;  3B33 A;  1G28 A;  1OTD A;  3UB8 A;  2OWJ A;  2PYR A;  3LIA A;  1F9I A;  2QWS A;  4I3A A;  3UB9 A;  2KX6 A;  1V9Z A;  5G4Y A;  1TS7 A;  1XJ6 A;  1LT0 A;  2PR5 A;  3F1N A;  3UB6 A;  2QJ5 A;  1S67 L;  1S66 L;  3BWL A; 
#chains in the Genus database with same CATH topology
 1BT5 A;  5GLA A;  1GA0 A;  1Y4O A;  2YKF A;  2HF6 A;  3T4O A;  4QU3 A;  3UB7 A;  1NLZ A;  1KGG A;  2JCH A;  1D06 A;  4OPQ A;  3LIB A;  4E3N A;  4E3M A;  3VOL A;  4HBT A;  1LI9 A;  3NOT C;  1VQQ A;  3NCK A;  4K08 A;  4KZ6 A;  3A0V A;  2V0W A;  1WYC A;  1YSP A;  2WGW B;  3S22 A;  5CRF A;  3IF6 C;  3OCN A;  3UE0 A;  1O7E A;  1RP5 A;  2L0W A;  2ZL1 A;  1MWS A;  3A3I A;  1TS8 A;  3S7O A;  3OBF A;  2P08 A;  1MWR A;  1YM1 A;  4WUJ A;  2J3T C;  3SS5 A;  1UGU A;  4PAU A;  3LEZ A;  3DTI A;  3IQA A;  2H0Y A;  4FH2 A;  2ZMV A;  4L9E A;  1XFN A;  3MFX A;  4IHQ A;  5DKK A;  2A24 A;  2JKT M;  4F94 A;  4H6J B;  3U4L P;  3KX0 X;  4HI4 A;  3N6I A;  3SW1 A;  5FAP A;  1K54 A;  3WS1 A;  2PYP A;  3IWI A;  2OLV A;  4OQI A;  4ME4 A;  3Q07 A;  4HQA A;  3BY8 A;  3ZDJ A;  1TDL A;  4P0M A;  5KSC A;  3G32 A;  1ZG6 A;  2PHY A;  3G31 A;  2G2U A;  4RA7 A;  3UE3 A;  3IH8 A;  3IWO A;  5GL9 A;  3MMH A;  3UB8 A;  1SDN A;  4WMC D;  3MXS A;  3HVF A;  1SDE A;  5EEC A;  4MNR A;  4KZ4 A;  5HWV A;  3P01 A;  4LV1 A;  4DDS A;  3WWX A;  1MC0 A;  3IF6 A;  3LI8 A;  1W8Q A;  4OKP A;  2OV5 A;  3HUN A;  2IWC A;  1FQG A;  3PTE A;  2ACG A;  2B02 A;  2WKI A;  2Y2H A;  3GRJ A;  4HY8 A;  3K3C A;  1WYB A;  2KDK A;  3IWQ A;  1TS0 A;  4KUO A;  1H8M A;  3EWK A;  1OJ5 A;  4NXF A;  1NZO A;  1FIK A;  5DF7 A;  3IXG A;  4CLC C;  4S2O A;  5FAO A;  3P7N A;  2V8F A;  3UDX A;  5DJU A;  1VHM A;  1XJ2 A;  2Y55 A;  4BLM A;  5M19 A;  5F6A A;  3LO7 A;  2WAD A;  1ONH A;  1W63 M;  1NWZ A;  2D02 A;  1FR1 A;  3G34 A;  4ZBE A;  2XF3 A;  1BLH A;  3MZF A;  3T1X A;  3CLO A;  1VET B;  2L1M A;  1GSX A;  3MS6 A;  5IU1 A;  2Z6C A;  1K38 A;  2LB9 A;  2WKR A;  2HGV A;  2Y2M A;  5GHY A;  3ZG5 A;  2Z6D A;  1RGZ A;  1OJG A;  4M4X A;  4GN2 A;  3E2L A;  3G30 A;  4E3O A;  3FZC A;  3IX8 A;  4A5R A;  4WL9 A;  2V1B A;  2EXB A;  4MCW A;  2D01 A;  1OTD A;  4OOY A;  2B5R A;  5CTM A;  1Q2P A;  1KGE A;  3LIF A;  4XT2 A;  2NUP C;  4PHT A;  4U3T A;  4O01 A;  4GLQ A;  2JC7 A;  4WZ5 A;  3EOI A;  4X25 A;  4CLC E;  5G4Z A;  3IXB A;  5HWT A;  5FQQ A;  4WF0 A;  4X68 A;  5FQI A;  2L4R A;  3F1O B;  4IUH A;  1K25 A;  3T12 B;  4S2J A;  5C5K A;  1EW0 A;  3ZHH A;  4DE0 A;  2WKP A;  3QP5 A;  1XJ4 A;  4EUV A;  5D3O A;  2EWW A;  5AQ9 A;  4P6B A;  1BYW A;  4X6T A;  3Q81 A;  3VFH A;  1IEM A;  5FQM A;  2HPB A;  5F69 A;  3P98 A;  1F2K A;  2ZBB A;  1JWZ A;  3WRZ A;  2XD1 A;  3M2K A;  1I5Q A;  5DTS A;  4ETX A;  3A3J A;  5A93 A;  3NUL A;  4GDN A;  5GHZ A;  4QWO A;  3FKV A;  3LIC A;  5E43 A;  1L0G A;  1CI8 A;  3BFG A;  4K91 A;  3M6B A;  4IUK A;  4JF4 A;  1E4D A;  1W5D A;  4S2M A;  4JGR A;  4Y5F A;  3TW8 A;  3HBR A;  1G6O A;  2XA7 M;  2WZX A;  1MBL A;  4DE3 A;  2Y2J A;  3W4Q A;  3FPW A;  3TE8 A;  4E3L A;  5TGF A;  5FDS A;  2WKQ A;  3IHB A;  4O7D A;  1FSW A;  3RJU A;  2AVX A;  3LCE A;  3PBO A;  2J8Y A;  3ITB A;  3F1N A;  3BEB A;  1RGY A;  4KG5 A;  1ZKJ A;  3BWL A;  1XA7 A;  4DXC A;  1F5M A;  1T1B A;  2WUQ A;  3BFD A;  4DDY A;  3H82 A;  3KYE A;  4HOI A;  4P87 A;  3S1Y A;  1M6K A;  4GB7 A;  2ZQ7 A;  1SCW A;  2HDQ A;  4CJN A;  4E04 A;  1ODV A;  5CGW A;  2JN7 A;  2MJ6 A;  3UB5 P;  3C30 A;  4R4S A;  3NJA A;  5CHJ A;  1L2S A;  1MWU A;  1NRF A;  1E3U D;  2X71 A;  1G6A A;  1S4S A;  1X0O A;  2VGJ A;  4N1H A;  2HP9 A;  3LI9 A;  4I5S A;  1P9R A;  5EVI A;  2VGL M;  5L07 A;  3ZCZ A;  4FTX A;  4JLF A;  3R4K A;  2GDN A;  1GHM A;  3N7W A;  1GSV A;  3E2K A;  3EEH A;  1W79 A;  5F83 A;  5CGS A;  4HHD A;  4WN5 A;  4HEF A;  2J80 A;  5EOE A;  3N8S A;  4HES A;  5F68 A;  1NYY A;  2OWH A;  5EVI B;  2XK1 A;  3T4J A;  3UPP A;  3LFV A;  3PAG A;  3DWZ A;  1N4O A;  2XA7 S;  3CI6 A;  2Y2I A;  4NKP A;  3MKF A;  5G4Y A;  1LT0 A;  1S6R A;  3WS4 A;  2CC1 A;  2Y2K A;  4UA7 A;  3MFD A;  2PBY A;  5FL3 A;  1N9O A;  5CXW A;  2YKH A;  4JPM A;  5EUA A;  3LR3 A;  3IH9 A;  4MMN A;  4YOF A;  3DAV A;  2BTF P;  2ZC3 B;  2KLI A;  3WS0 A;  2ZC7 A;  1LI0 A;  3MKE A;  3IXH A;  2HP5 A;  3IBR A;  5AQB A;  2A24 B;  3KSF A;  4B4X A;  3CPT A;  5DJT A;  2VV8 A;  2R9X A;  3HUO A;  2VV7 A;  3CAX A;  1BUL A;  2H10 A;  1K55 C;  4IVI A;  3QP2 A;  1Y28 A;  1KE0 A;  2OAQ 1;  4BJP A;  4OPR A;  1M40 A;  3I7J A;  4DN0 A;  5A92 A;  2B95 A;  2FFF B;  3GQZ A;  2VEA A;  4KZA A;  5CHU A;  4MEZ A;  1CK3 A;  2K2N A;  1JTD A;  3G4P A;  4BEN A;  4MLL A;  4O8G A;  3H9W A;  5CER A;  2C5W B;  5EV0 A;  3IF5 A;  1F98 A;  4GW9 A;  2WYX A;  4OPY A;  2XLN A;  2M7V A;  3HLW A;  1RCJ A;  3GEC A;  3IF6 B;  4GHI B;  5FAT A;  3ZG8 B;  4PM8 A;  5EVI C;  5FI7 A;  5F5Y A;  2H5S A;  4BBU A;  4B9O A;  5FQJ A;  1D1J A;  2XDM A;  3KO6 A;  1G28 A;  2DRW A;  5JYP A;  4R3B A;  1YQS A;  5GLD A;  2A3U A;  4QD4 A;  4FH4 A;  5E2F A;  4S2P A;  4I3J A;  5HZH A;  4O0P A;  2EXA A;  3MR0 A;  4QB8 A;  3C38 A;  4F3L A;  3PBS A;  3LR5 A;  1DP9 A;  5EVL A;  4K0W A;  4KQQ A;  2EFU A;  4Y0T A;  3ZVT A;  2Y2Q A;  1WA9 A;  1IEL A;  2PDR A;  3NOU C;  2QMI A;  5I5L A;  3MZD A;  2G2W A;  1YLT A;  5A8B A;  3ISG A;  2PD8 A;  3GMW A;  1MZU A;  1WE4 A;  4IJG A;  2O99 A;  4HIA A;  4ZDX A;  2ZMF A;  4GD6 A;  1GA9 A;  4EQI A;  1PRQ A;  1CQA A;  2K31 A;  1A0K A;  5DTK A;  5A90 A;  1TVF A;  2I72 A;  2W0N A;  2W3G A;  3CMZ A;  5HWW A;  3IX3 A;  3PXP A;  4WEK A;  1FOF A;  3VE3 A;  3QNC A;  3T1Q B;  5J3W A;  4OON A;  5AQ7 A;  3SS3 A;  1K4F A;  4YFM A;  2QHK A;  3NIA A;  5DF8 A;  3V5M A;  1I2W A;  2W3H A;  2O9C A;  3MXQ A;  3SH9 A;  3HLF A;  2VV6 A;  2JKG A;  2VA0 A;  4Q0J A;  1YLZ A;  5CEB A;  3HLG A;  1DJC A;  3MXR A;  1PIO A;  2EX8 A;  2A49 A;  3KSH A;  4YWZ A;  4KZ9 A;  3LY4 A;  2P04 A;  3OZH A;  3T4Q A;  1GCE A;  3EGD C;  4I3A A;  2O9B A;  4UQI S;  3UB6 A;  2J9O A;  1S67 L;  1KDW A;  1HZO A;  3VSK A;  4II7 A;  2V2F F;  1S1Z A;  2ZM2 A;  1OTB A;  2Y4A A;  1FCM A;  3LGO A;  2HJE A;  5L09 A;  4LRY C;  2PU2 A;  1PNE A;  2XEP A;  3GSG A;  1PW8 A;  3RTY A;  4Y17 A;  3BRM A;  4YIN A;  4EXO A;  3AGD A;  4C3Q A;  4DE2 A;  1Q2Q A;  5HDS A;  3U2A A;  3HCY A;  5CGX A;  3FKW A;  2VLG A;  2O9A A;  1FIL A;  3ZVW A;  4WZ4 A;  3CUE A;  5JYO A;  2IA2 A;  4N92 A;  3D72 A;  1Z09 A;  4PPR A;  5EFW A;  5E2G A;  2ZL1 B;  5IS1 A;  1MY8 A;  4CQH A;  1JWV A;  1P97 A;  4JF5 A;  3ULF A;  5E2E A;  5KMW A;  1JNU A;  1YT4 A;  2JBF A;  3NC8 A;  4Y0U A;  4UA9 A;  1G5U A;  2VGL S;  1DP8 A;  3AGF A;  5FDH A;  4ZAM A;  1YMX A;  3NEC A;  4HP4 A;  4K0X A;  3O87 A;  4QJG A;  2W1R A;  1DY6 A;  1CJF A;  1QME A;  4KZB A;  4LRX C;  1TD5 A;  3C4O A;  2C6W B;  1N9B A;  3CIT A;  4BD0 A;  4R23 A;  4LFU A;  3MQQ A;  3W4O A;  4HJ3 A;  3UO9 A;  5EM1 A;  1K0K A;  2WGW A;  3VOY A;  1EI5 A;  1KVL A;  3C5A A;  1MWT A;  5EPH A;  3OCL A;  1V9Y A;  4WEJ A;  3K3D A;  1PFL A;  1LL5 A;  3ZG7 B;  4QY6 A;  1LSV A;  1NLY A;  4MN6 A;  4WYY A;  3S7P A;  3NDE A;  4MBH A;  1PI4 A;  1T1C A;  3OOV A;  5GHX A;  4LCL A;  3FG8 A;  4FUW A;  1IKI A;  2ZC5 B;  1E3U A;  4HJ4 A;  5HAP A;  4JXS A;  5HPI A;  1JWP A;  4EET B;  3GR2 A;  4EBP A;  4NEE D;  1HLU P;  5M18 A;  2DMW A;  4S2N C;  1XGJ A;  3UPN A;  3K2N A;  1PZP A;  5MC7 A;  4L9F A;  4OPZ A;  2FZ0 A;  3UNW A;  2ZC4 B;  3P09 A;  1UWN X;  2PR6 A;  2ZQC A;  3B3X A;  2OSU A;  1K6S A;  2ZQD A;  4BQM A;  2LB5 A;  4DJ3 A;  2PD7 A;  4EBL A;  4KQD A;  1LL8 A;  3BLM A;  1AWI A;  2GX5 A;  4DXB A;  2Z2L B;  1PW1 A;  4GKU A;  3LIE A;  1VET A;  2XFT A;  3BY9 A;  1H8Z A;  1OTA A;  3LID A;  4GNU A;  5EVE A;  3B47 A;  2EWV A;  4Q0H A;  4NK3 A;  3OC2 A;  1L3L A;  1LLB A;  1TS7 A;  2R9W A;  3QP1 A;  2HDR A;  3G35 A;  1HTZ A;  3SZT A;  4X53 A;  5HAI A;  1CF0 A;  5F1F A;  4KZ3 A;  3JVU A;  3QP6 A;  3ITA A;  1GSW A;  4GCZ A;  5E2H A;  1IFQ A;  1SKF A;  4NG2 A;  3DTK A;  3C7U A;  4R4R A;  3PYP A;  1C3B A;  3MZE A;  1MKM A;  1KE4 A;  1KE3 A;  3PBR A;  4QY5 A;  4B88 A;  2XR0 A;  3SOI A;  2IWD A;  5AVF A;  2JKT I;  3ZGA B;  4X55 A;  4WZ5 C;  5DVA A;  4I3I A;  3BM6 A;  1BLS A;  4IBR A;  5HDC A;  4U0X A;  4R6L A;  3DWK A;  3GV9 A;  4Y15 A;  4KZ8 A;  5U47 A;  3EEA A;  4Z9Q A;  4GD8 A;  3VP2 A;  3L9K A;  1O07 A;  3BFC A;  3WS2 A;  4EWF A;  2EX9 A;  3UE6 A;  1UWP X;  5EM0 A;  1LHY A;  2PBD P;  4D60 A;  3IX4 A;  5KSH A;  2JKR I;  3CUE C;  3LYX A;  4WLA A;  3E98 A;  1Y54 A;  2ZC6 B;  5CTN A;  1ERM A;  1NRJ A;  2Y79 A;  3A3D A;  4KUK A;  2Y2P A;  5CX7 A;  2V1Z A;  4CLC D;  3PR6 A;  3MSH A;  4CLC A;  1K57 C;  4X1M A;  5L10 A;  2H0T A;  2XD5 A;  3B42 A;  2OWJ A;  3T4S A;  3UB9 A;  3GVB A;  4PM9 A;  4N1X A;  5DFX A;  4D2O A;  2XH9 A;  3A3F A;  2EX2 A;  2PAV P;  3FC7 A;  2ZLY A;  1GHP A;  3MBZ A;  4X56 A;  3NBL A;  4S2L A;  3HLE A;  1BSG A;  3BJN A;  3KSI A;  2ZQ8 A;  1K6R A;  4HNB A;  3CPT B;  3IXD A;  1STZ A;  2J3W A;  5DTT A;  4DMZ A;  3NOP C;  3WS5 A;  4JBF A;  3HJI A;  3T1S A;  1FCO A;  1XA1 A;  2XGN A;  1YMS A;  4LCM A;  3BYD A;  3BQ8 A;  3D9Y A;  3D4F A;  4BD1 A;  4BL2 A;  3ZG9 B;  3GDI A;  3HLB A;  1NZU A;  4RQ9 A;  4GDB A;  1IYO A;  4ESP A;  5HL1 A;  2E8J A;  5TR7 A;  3C2W A;  1SZV A;  4N9K A;  3T4T A;  3ZNT A;  3VP3 A;  2P7J A;  5G18 A;  4JXG A;  1LL9 A;  1ZG4 A;  4ZTK A;  2Q0O A;  2ZD8 A;  1VEU B;  3JVV A;  4H8R A;  4X1L A;  3QNB A;  1VB6 A;  4R70 A;  2R78 A;  4WBG A;  3S7Q A;  3M2J A;  2HZ5 A;  5GLB A;  3VE4 A;  4S2I A;  1IYQ A;  2VKS A;  1AXB A;  3VP0 A;  4QPR A;  3ZFZ A;  4DKI A;  4E3K A;  2PRF A;  4HH2 A;  3N8L A;  3HLC A;  4MBF A;  3LIA A;  1ZHH B;  5M1A A;  2PR5 A;  4N9L A;  1YLP A;  4GJ4 A;  4FD8 A;  2OLU A;  3VFF A;  4PM6 A;  5TFQ A;  4ETZ A;  4P6Z S;  1ES2 A;  2ZOI A;  2ZMA A;  1VM1 A;  1XX2 A;  5HD3 A;  4G3K A;  3S4X A;  3ICY A;  1ZC2 A;  2P9V A;  4H6J A;  1PYY A;  1HD8 A;  1S1Y A;  4NXG A;  5L2F A;  4F3L B;  3BW6 A;  3GTC A;  4Y13 A;  2J9P A;  4KG2 A;  1ACF A;  4PM7 A;  1YAX A;  4KQO A;  4GS9 A;  1H0M A;  1N9L A;  3F1N B;  3R7W B;  4E6X A;  2Y2G A;  2XRN A;  2ZQA A;  4U0T A;  4WM9 A;  3JPU A;  4I39 A;  1LSX A;  5IHV A;  1ERQ A;  3E0Y A;  3RXW A;  5F82 A;  3LEQ A;  3MJQ A;  2WAE A;  1ES4 A;  4HP9 A;  1SKO B;  3SH8 A;  4ARZ A;  3D3O A;  2XSS A;  3Q7V A;  4HJ6 A;  1ZTU A;  4XUX A;  5LBR A;  4ZJ3 A;  2HJ9 C;  3LUQ A;  3T1R A;  4OLD A;  1SKO A;  3EQV A;  3H7W B;  4XXR A;  3RFB A;  4ID4 A;  3F1O A;  4UQI M;  3G6O A;  1H3Q A;  1QMF A;  4OVD A;  2CMN A;  3TRC A;  2Z2M B;  3Q7V B;  4OP5 A;  5I94 A;  3EGX C;  5DF9 A;  1IYS A;  1V9Z A;  3QP4 A;  1PZO A;  1XJ6 A;  3N8R A;  5FEF A;  1CEF A;  2V8C A;  3H7W A;  2O0Y A;  3PBQ A;  1H8Y A;  2VX8 A;  4EQ1 A;  3E4Q A;  4GHI A;  4QHC A;  1IKG A;  2PT7 A;  3JYI A;  4RVA A;  2OOL A;  4E6W A;  4JXV A;  4S2K A;  2VK3 A;  3A0R A;  4KZ7 A;  1NJ4 A;  1YKD A;  2Y2O A;  3WRT A;  5KZH A;  5J8X A;  3SS4 A;  2W1T A;  5FI6 A;  3OPR A;  1N9N A;  3DTE A;  3FYZ A;  4XT2 B;  1XJ3 A;  1K55 A;  5BOH A;  3IS2 A;  5HPF A;  2A2L A;  4Y3I A;  3V39 A;  3OPH A;  2IWB A;  2DNS A;  4RYE A;  1IYP A;  2ZQ9 A;  3F1P B;  4PMA A;  2WKE A;  4OLG A;  2QPN A;  3ZQ5 A;  3PBT A;  4R3J A;  2QZ6 A;  1T1A A;  3RH8 B;  4UHU A;  5IT5 A;  2GNX A;  3SH7 A;  2XQZ A;  1CEG A;  2I9V A;  2WKH A;  4EBN A;  1JTG A;  5HD5 A;  4C6Y A;  1CI9 A;  1W7F A;  4GS9 B;  3QHY A;  3HL9 A;  4UA6 A;  4MN7 A;  4Y2F A;  3VSL A;  4PM5 A;  1S4R A;  2HP6 A;  3PHY A;  3BFF A;  4L9G A;  4R38 A;  5HDD A;  1LSW A;  2Y8H A;  3E4O A;  2BLS A;  2UWX A;  2ZJ9 A;  3UPO A;  3MQ0 A;  4NXB A;  1OME A;  4WEL A;  3B33 A;  3O5Y A;  4FOF A;  2QYB A;  1NY0 A;  3C7V A;  4EUZ A;  3Q7Z A;  2VZW A;  4EER A;  3G2Y A;  4LRZ E;  2V1A A;  4G3W A;  4LEN A;  5J7E A;  4EU0 A;  2KOI A;  3UDI A;  1NYM A;  2Y2N A;  5TJJ A;  3BEC A;  2HV1 A;  4CLC B;  1GHI A;  3ZYT A;  4CPK A;  4ARZ B;  2J7V A;  4MN5 A;  1K56 D;  2J3T D;  5AQA A;  3T4K A;  5HFO A;  5A91 A;  1G68 A;  2UV0 E;  3UME A;  4LV0 A;  4C75 A;  5DKL A;  3NHQ A;  1L0F A;  4P6Z M;  3M6H A;  3Q82 A;  1PI5 A;  4Q0I A;  5EOO A;  3CZD A;  3HJK A;  1OTE A;  5L8M A;  5CEC A;  4ZRR A;  5EVI D;  3HRE A;  4XUZ A;  3HUM A;  4L0L A;  4E3I A;  4EES A;  2DCF A;  3O86 A;  2W3F A;  2Q9N A;  2QJ7 A;  2W1T B;  3KSG A;  2FFY A;  3RXX A;  3BQA A;  3NI9 A;  1TS6 A;  5FQ9 A;  4R1G A;  1H5X A;  3TOI A;  2G7U A;  1OT9 A;  3N4I A;  4JGO A;  2V0U A;  5EE8 A;  1FSY A;  4BL3 A;  1XFQ A;  3OLO A;  2GJ3 A;  4S2N A;  2H28 A;  3V3R A;  2ZOH A;  5CHM A;  3TG9 A;  3W2Z A;  4WMC A;  2QJ5 A;  2WAF A;  4OQ0 A;  3V67 A;  2P9V B;  1P0Z A;  1SHV A;  1BLP A;  2Y91 A;  5GLC A;  1KOU A;  3UY6 A;  3FPV A;  4DF6 A;  3VP1 A;  4BBV A;  2ZM8 A;  1YPR A;  4IED A;  5HAR A;  1XP4 A;  2Q9M A;  1TDG A;  1DJB A;  5K5B A;  5TBM B;  4IBX A;  1T18 A;  2E8I A;  2X02 A;  3HLD A;  4IVK A;  4YNR A;  2QKP A;  3PAE A;  3A0S A;  1HVB A;  1BLC A;  4JXW A;  4ZJ1 A;  3ZNY A;  4I38 A;  4KG6 A;  4FCF A;  5TBM A;  1ESI A;  1YSQ A;  4DE1 A;  4BWI A;  2VGK A;  3TSG A;  3LR0 A;  5HSQ A;  1ERO A;  4X69 A;  2OAP 1;  2HDU A;  1ES5 A;  4EV4 A;  1FCN A;  3W4P A;  1BZA A;  3O3V A;  2BAS A;  1ES3 A;  5FI2 A;  5AJG A;  4OQH A;  5FEG A;  3MQO A;  5HAQ A;  1I2S A;  3IBJ A;  2P74 A;  1JVJ A;  1J3W A;  1YLW A;  2K7S A;  4OOM A;  5HX9 A;  2W27 A;  3FV7 A;  3LY3 A;  2Y59 A;  4LLO B;  4EW7 A;  1XGI A;  1L0D A;  4LV2 A;  1NXY A;  3OPL A;  4OQG A;  2EFX A;  3CJM A;  3BLS A;  4MDZ A;  2JE5 A;  2M1C A;  4KZ5 A;  3E4P A;  1KVM A;  4E3J A;  2WGV A;  3W8K A;  3IS2 B;  3NY4 A;  4PKY G;  2Y2L A;  5F1G A;  4Z1W A;  1DP6 A;  1P9W A;  1T19 A;  3O88 A;  3R7W A;  2EA9 A;  2WGI A;  1ALQ A;  4Y0O A;  5FAQ A;  4UAA A;  4GZB A;  2RL3 A;  3L7H A;  1J9M A;  4KEN B;  4Q8I A;  2XFS A;  3OPP A;  3LR4 A;  5J4E A;  1DRM A;  1VEU A;  1EWZ A;  3Q1F A;  5KIZ A;  3CG5 A;  2BG1 A;  3CHW P;  4B4Z A;  4LV3 A;  2NUT C;  1K56 A;  4OP8 A;  2FH5 A;  1S0W A;  3A3E A;  3DBA A;  1ONG A;  1YLJ A;  5DFY A;  3UDF A;  1MPL A;  3EQU A;  1BTL A;  3F1P A;  1Z6F A;  1MXO A;  3MF0 A;  2EX6 A;  3VV4 A;  1TEM A;  4JGQ A;  1IOU A;  2W3D A;  4ZJ2 A;  1XKZ A;  3T4L A;  1PWC A;  2WZZ A;  3V50 A;  5HW3 A;  3UE1 A;  4JGP A;  1W63 Q;  1K4E A;  1TF1 A;  3G2Z A;  3VP4 A;  3VMA A;  1E25 A;  1ESU A;  4JF6 A;  3CWF A;  4M3K A;  1U60 A;  3VOZ A;  4DJ2 A;  1DJA A;  3KYQ A;  2INW A;  4MBK A;  4OH0 A;  4HBU A;  2X01 A;  2PYR A;  1F9I A;  2QWS A;  4DRT A;  3DW0 A;  4NET A;  4JKT A;  3ZG0 A;  5FSR A;  4KQR A;  3S7N A;  3H82 B;  4LGW A;  4EEP A;  2M7U A;  4G3V A;  1K54 C;  4EEU A;  5CED A;  4OOL A;  1K57 A;  1OPX A;  1KDS A;  4R3A A;  1XPB A;  2B18 A;  4PKY A;  3NDG A;  2VJW A;  1YLY A;  1OTI A;  2HDS A;  3PBN A;  4RX2 A;  3BFE A;  4BMW A;  4HH3 A;  1W8Y A;  3IHA A;  2RCX A;  1PWG A;  4NXE A;  3QP8 A;  4FSF A;  1XXM A;  5FA7 A;  1BUE A;  3FWL A;  4Y7P A;  1KGF A;  2PU4 A;  4LPZ A;  3V3S A;  3IT9 A;  4UEY A;  4B93 A;  3KYZ A;  1FR6 A;  5FQK A;  2ZM0 A;  3DTM A;  3UMD A;  1OT6 A;  3TJZ C;  4R0Q A;  3T50 A;  5FAS A;  2V20 A;  4RX3 A;  5AVE A;  2WK0 A;  2JHE A;  1D7E A;  3AGE A;  4BBT A;  2JKF A;  3C8C A;  2V9A A;  2GZA A;  2XRO A;  2W3E A;  4P85 A;  3UN7 A;  3C4P A;  1PWD A;  4AFI A;  4GOG A;  1L0E A;  2KX6 A;  2JKR M;  5HL6 A;  1S66 L;  1MKI A; 
#chains in the Genus database with same CATH homology
 2VZW A;  2YKF A;  4EER A;  2HF6 A;  3T4O A;  5FL3 A;  3UB7 A;  1N9O A;  1NLZ A;  4LRZ E;  2V1A A;  2YKH A;  4G3W A;  5J7E A;  3LR3 A;  1D06 A;  4MMN A;  4EU0 A;  3JVU A;  4YOF A;  2KOI A;  3LIB A;  1GSW A;  3VOL A;  4GCZ A;  5TJJ A;  2KLI A;  1IFQ A;  2HV1 A;  3NOT C;  4CLC B;  3ZYT A;  3PYP A;  4ARZ B;  4K08 A;  3A0V A;  3IBR A;  2V0W A;  2A24 B;  1YSP A;  3KSF A;  1MKM A;  4MN5 A;  3PBR A;  2J3T D;  3T4K A;  5DJT A;  3OCN A;  2L0W A;  2VV8 A;  3UME A;  5AVF A;  2JKT I;  2VV7 A;  3CAX A;  5DKL A;  3NHQ A;  4P6Z M;  1TS8 A;  4I3I A;  1Y28 A;  3S7O A;  3OBF A;  2OAQ 1;  2P08 A;  4BJP A;  5HDC A;  4Q0I A;  4WUJ A;  2J3T C;  1UGU A;  4R6L A;  3HJK A;  1OTE A;  5L8M A;  4PAU A;  4ZRR A;  2ZMV A;  4L0L A;  4EES A;  4L9E A;  4DN0 A;  1XFN A;  3EEA A;  2W3F A;  3MFX A;  4IHQ A;  5DKK A;  2A24 A;  2JKT M;  2VEA A;  4H6J B;  3KX0 X;  4HI4 A;  2QJ7 A;  2W1T B;  3KSG A;  3SW1 A;  2K2N A;  4O8G A;  3UE6 A;  1UWP X;  3H9W A;  2PYP A;  3BQA A;  1TS6 A;  1F98 A;  4GW9 A;  2JKR I;  5KSH A;  3CUE C;  4ME4 A;  3LYX A;  4HQA A;  2M7V A;  3BY8 A;  4WLA A;  3GEC A;  2G7U A;  1OT9 A;  3E98 A;  4GHI B;  4JGO A;  1NRJ A;  2Y79 A;  2V0U A;  4KUK A;  1XFQ A;  5CX7 A;  3OLO A;  5F5Y A;  2GJ3 A;  2PHY A;  4BBU A;  2H28 A;  4B9O A;  4CLC D;  3PR6 A;  4CLC A;  3UE3 A;  2ZOH A;  3MMH A;  3KO6 A;  1G28 A;  3B42 A;  3UB8 A;  2OWJ A;  3T4S A;  3UB9 A;  5DFX A;  3W2Z A;  2QJ5 A;  4I3J A;  5HWV A;  4O0P A;  5HZH A;  3MR0 A;  3P01 A;  3V67 A;  1P0Z A;  3C38 A;  4F3L A;  1MC0 A;  1KOU A;  3FC7 A;  3PBS A;  3LI8 A;  3LR5 A;  1DP9 A;  3FPV A;  2B02 A;  4HY8 A;  4BBV A;  3K3C A;  3BJN A;  2KDK A;  1WA9 A;  3KSI A;  2PDR A;  1TS0 A;  4HNB A;  3NOU C;  1STZ A;  2J3W A;  4DMZ A;  3NOP C;  5K5B A;  3HJI A;  5I5L A;  5TBM B;  4KUO A;  5A8B A;  1T18 A;  1H8M A;  2PD8 A;  3EWK A;  1OJ5 A;  4NXF A;  4YNR A;  1MZU A;  3BQ8 A;  2QKP A;  4CLC C;  4IJG A;  2O99 A;  3A0S A;  3P7N A;  4HIA A;  2ZMF A;  5DJU A;  1VHM A;  1XJ2 A;  4I38 A;  3GDI A;  4RQ9 A;  2K31 A;  5TBM A;  5F6A A;  1YSQ A;  4BWI A;  3C2W A;  2W0N A;  3LR0 A;  1W63 M;  1NWZ A;  2W3G A;  3T4T A;  5HSQ A;  2OAP 1;  2P7J A;  2D02 A;  5HWW A;  3PXP A;  4WEK A;  3VE3 A;  3JVV A;  3CLO A;  2BAS A;  2L1M A;  5J3W A;  5AJG A;  1GSX A;  1VB6 A;  5IU1 A;  4R70 A;  2Z6C A;  2R78 A;  2LB9 A;  2WKR A;  2QHK A;  3S7Q A;  2HGV A;  3MQO A;  2Z6D A;  1OJG A;  4M4X A;  2W3H A;  3IBJ A;  2O9C A;  3MXQ A;  3VE4 A;  2VV6 A;  2K7S A;  2VA0 A;  2VKS A;  4OOM A;  4Q0J A;  4QPR A;  2W27 A;  4WL9 A;  4HH2 A;  4LLO B;  4EW7 A;  2V1B A;  3KSH A;  4MCW A;  4YWZ A;  2D01 A;  1OTD A;  2P04 A;  3T4Q A;  3LIA A;  3EGD C;  1ZHH B;  4I3A A;  2O9B A;  4UQI S;  2PR5 A;  3UB6 A;  1S67 L;  3LIF A;  4GJ4 A;  4II7 A;  4XT2 A;  2NUP C;  1S1Z A;  4PHT A;  4MDZ A;  1OTB A;  2M1C A;  4ETZ A;  3E4P A;  4P6Z S;  2ZOI A;  4O01 A;  4GLQ A;  3EOI A;  4CLC E;  2HJE A;  5G4Z A;  3IS2 B;  5HWT A;  4LRY C;  4PKY G;  4Z1W A;  4WF0 A;  1DP6 A;  4G3K A;  5HD3 A;  1P9W A;  3ICY A;  1T19 A;  2L4R A;  3R7W A;  3F1O B;  4IUH A;  2EA9 A;  3RTY A;  4H6J A;  5C5K A;  1EW0 A;  1S1Y A;  4NXG A;  4F3L B;  3BW6 A;  2WKP A;  4EXO A;  5HDS A;  3LR4 A;  1XJ4 A;  1YAX A;  1DRM A;  3HCY A;  4KQO A;  3U2A A;  4EUV A;  2EWW A;  5J4E A;  4GS9 A;  1N9L A;  3F1N B;  5KIZ A;  3R7W B;  2VLG A;  2O9A A;  3CUE A;  1BYW A;  2IA2 A;  2XRN A;  3D72 A;  5EFW A;  5F69 A;  4I39 A;  2NUT C;  1LSX A;  5IS1 A;  3E0Y A;  2FH5 A;  4CQH A;  2ZBB A;  1P97 A;  3DBA A;  3MJQ A;  3ULF A;  4ETX A;  5DFY A;  1JNU A;  4HP9 A;  4ARZ A;  3D3O A;  2XSS A;  4HJ6 A;  3EQU A;  3LIC A;  3F1P A;  1ZTU A;  2VGL S;  1DP8 A;  3MF0 A;  5LBR A;  3VV4 A;  4JGQ A;  1IOU A;  2W3D A;  3T4L A;  2HJ9 C;  4IUK A;  4HP4 A;  3LUQ A;  4JGR A;  4Y5F A;  3TW8 A;  4JGP A;  1G6O A;  2W1R A;  2XA7 M;  1W63 Q;  1TF1 A;  3EQV A;  3H7W B;  3RFB A;  4LRX C;  3CWF A;  1TD5 A;  3F1O A;  3FPW A;  4UQI M;  3G6O A;  3TE8 A;  4DJ2 A;  3KYQ A;  2INW A;  2WKQ A;  3CIT A;  1H3Q A;  2CMN A;  3TRC A;  3EGX C;  5DF9 A;  2PYR A;  1F9I A;  2QWS A;  3PBO A;  1V9Z A;  1XJ6 A;  3F1N A;  3BWL A;  3MQQ A;  3H82 B;  3S7N A;  3H7W A;  1F5M A;  1T1B A;  2O0Y A;  3PBQ A;  4EEP A;  2VX8 A;  4HJ3 A;  2M7U A;  4EQ1 A;  3E4Q A;  4G3V A;  4GHI A;  3H82 A;  4EEU A;  2PT7 A;  4HOI A;  2OOL A;  4OOL A;  1OPX A;  3A0R A;  3OCL A;  1V9Y A;  4WEJ A;  1YKD A;  3K3D A;  4R3A A;  1LSV A;  2B18 A;  1NLY A;  4PKY A;  4MN6 A;  3S7P A;  4E04 A;  1ODV A;  2W1T A;  2JN7 A;  2MJ6 A;  2VJW A;  1OTI A;  1N9N A;  1T1C A;  3OOV A;  3C30 A;  4XT2 B;  1XJ3 A;  3PBN A;  3FG8 A;  4BMW A;  3NJA A;  3IS2 A;  4HH3 A;  4HJ4 A;  5HPF A;  2A2L A;  4Y3I A;  5HPI A;  1S4S A;  4EET B;  3F1P B;  4NXE A;  1X0O A;  4FSF A;  4NEE D;  2DMW A;  3LI9 A;  4I5S A;  1P9R A;  3ZQ5 A;  3PBT A;  2VGL M;  1T1A A;  3K2N A;  5MC7 A;  3RH8 B;  4LPZ A;  5IT5 A;  4L9F A;  3R4K A;  2FZ0 A;  4UEY A;  2GNX A;  3KYZ A;  4B93 A;  1GSV A;  3EEH A;  2I9V A;  1UWN X;  2PR6 A;  5HD5 A;  3UMD A;  4GS9 B;  1OT6 A;  4HHD A;  3TJZ C;  3T50 A;  4WN5 A;  4MN7 A;  5AVE A;  4Y2F A;  2JHE A;  2LB5 A;  4DJ3 A;  1S4R A;  2PD7 A;  1D7E A;  2J80 A;  4KQD A;  1LL8 A;  3PHY A;  4BBT A;  4L9G A;  2GX5 A;  4R38 A;  5F68 A;  3C8C A;  2OWH A;  2V9A A;  3LIE A;  2GZA A;  5HDD A;  1LSW A;  2Y8H A;  3BY9 A;  3T4J A;  3E4O A;  3LFV A;  2XRO A;  1OTA A;  3LID A;  3B47 A;  2W3E A;  3MQ0 A;  2XA7 S;  3CI6 A;  2EWV A;  4NXB A;  4WEL A;  4NKP A;  4Q0H A;  4AFI A;  3B33 A;  3OC2 A;  3O5Y A;  4FOF A;  2KX6 A;  2QYB A;  5G4Y A;  1TS7 A;  1LT0 A;  2JKR M;  5HL6 A;  1S66 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...