4L9EA

Structure of ppsr q-pas1 from rb. sphaeroides
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
115
structure length
115
Chain Sequence
TQREMETRYRVVLDVSRDPMVLVSMSTGRIVDLNSAAGLLLGGVRQDLLGAAIAQEFEGRRRGEFMETMTNLAATESAAPVEVLARRSQKRLLVVPRVFRAAGERLLLCQIDPAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Transcriptional regulator, PpsR
publication title Multi-PAS domain-mediated protein oligomerization of PpsR from Rhodobacter sphaeroides.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
total genus 39
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2013-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13188 PAS_8 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4l9eA00
3A0VA 3ZQ5A 1EW0A 2VV7A 3BWLA 1DRMA 3FG8A 4I3JA 4WF0A 1LSWA 4KUOA 5J7EA 3HJKA 4RQ9A 3KX0X 3LIFA 2QWSA 1XJ6A 3H7WB 1N9LA 1LSXA 1LT0A 1T1BA 5HDCA 3H7WA 3UE6A 4L9GA 3CAXA 1TS6A 4HP4A 3LIEA 5HWTA 3SW1A 4GW9A 4LRXC 4LPZA 1TS7A 4R70A 1UGUA 3G6OA 2JHEA 3A0SA 5IS1A 3GDIA 4EW7A 5HWWA 4B9OA 4EESA 1OTBA 1KOUA 3F1NA 2WKPA 3MQOA 3UB7A 4GHIB 5HD3A 4R38A 2H28A 3D72A 4HQAA 2ZBBA 4HJ4A 3ICYA 5F5YA 2V9AA 4EEPA 3EEHA 4JGQA 4LRZE 3UMDA 1T1AA 4H6JB 3UB8A 1S1YA 1Y28A 4H6JA 5F68A 5HDSA 2QJ5A 4GCZA 4HH3A 4F3LA 2INWA 4MN6A 1XFQA 1MZUA 2WKRA 3F1PA 1T18A 2EA9A 3IS2B 2J80A 4DJ2A 3IS2A 1UWPX 3A0RA 4KQDA 3VE3A 3MJQA 5TBMB 2PDRA 5G4YA 3NOTC 4PKYA 1S66L 1TS8A 4XT2B 1OT9A 4WN5A 3B33A 1X0OA 3CWFA 2YKFA 2L4RA 1JNUA 2W0NA 1WA9A 2YKHA 3HJIA 1P0ZA 3LYXA 5AVFA 4KUKA 3MFXA 1OTEA 1F9IA 4M4XA 4NXEA 4WUJA 3ULFA 2ZOHA 5A8BA 3P7NA 3E4OA 3MXQA 2V0WA 3LIDA 3OLOA 3H82B 1G28A 1S4RA 2Z6CA 3NJAA 1GSWA 2QJ7A 1F98A 5AVEA 1XJ2A 1OTAA 1GSVA 2P7JA 4DJ3A 2L0WA 1OJ5A 2HV1A 5I5LA 3LIBA 1D06A 2QKPA 3NHQA 1S4SA 4I39A 3BY8A 2OOLA 4HIAA 4EEUA 1LSVA 1T1CA 4GHIA 2D02A 2KX6A 2PR6A 3UMEA 1XFNA 2W27A 4NXFA 1D7EA 3FC7A 4GS9B 2K7SA 2BASA 2B02A 4JGPA 1DP8A 2PR5A 1OT6A 4GS9A 3K3CA 3LUQA 3RH8B 2V1AA 4HHDA 3CLOA 3E4QA 1TS0A 4L9EA 4EQ1A 4EERA 4HY8A 1N9NA 2QHKA 4WL9A 5DJTA 2JN7A 2R78A 4HH2A 5HZHA 3F1OB 4NXBA 3LIAA 4LRYC 5KIZA 4BBTA 3C2WA 2PHYA 3PYPA 1V9ZA 4R3AA 5TBMA 2L1MA 2GJ3A 1V9YA 3E4PA 4EXOA 2OWJA 1LL8A 5HWVA 4BBUA 2D01A 2PD7A 2WKQA 4XT2A 5DJUA 4YWZA 4HOIA 1S67L 2VEAA 5HD5A 2V0UA 2M1CA 4I5SA 1DP9A 2VLGA 1UWNX 4I3AA 1P97A 5DKLA 5HSQA 4R6LA 4K08A 3H82A 4HI4A 2A24B 1XJ3A 1T19A 3PHYA 4JGRA 1VB6A 4I3IA 3H9WA 2A24A 3BY9A 4NXGA 4I38A 1GSXA 4LLOB 3GECA 3NOUC 3MR0A 4BBVA 1S1ZA 2VV8A 1NWZA 4L9FA 1N9OA 2PYRA 1ODVA 4E04A 3VE4A 2OWHA 2I9VA 3IBRA 4MN5A 2V1BA 3F1NB 1DP6A 3UB6A 2ZOIA 4EETB 1BYWA 5HDDA 5G4ZA 5DKKA 5EFWA 5F69A 3K3DA 3LICA 3C8CA 2KDKA 5F6AA 4PKYG 5IU1A 3RTYA 1OTIA 1OJGA 4HJ6A 3EWKA 3T50A 3MQQA 3NOPC 4F3LB 3UB9A 5J4EA 3F1OA 2PD8A 5J3WA 3F1PB 4HNBA 2Z6DA 2VV6A 3VOLA 1OTDA 4HJ3A 4JGOA 1XJ4A 2CMNA 3LI8A 3LI9A 4WLAA 2PYPA 4HP9A
chains in the Genus database with same CATH superfamily
4GN2A 4DE3A 1QMEA 3S7OA 2V20A 2JKGA 3N8RA 2Y2GA 2Y2LA 1ERQA 1ONGA 3QHYA 2J3TC 4KUOA 4ZRRA 3H7WB 3MKFA 1HVBA 4DXCA 4OKPA 3H7WA 4L9GA 4OOLA 4N9KA 4UA9A 1TS6A 4HP4A 4KG6A 1PW8A 5F1FA 4GW9A 2HP6A 2HDSA 5HL1A 5CRFA 4U3TA 5HX9A 2XROA 1UGUA 3G6OA 4EUVA 2OLVA 4DE1A 4X56A 3BM6A 4B9OA 1Z09A 4EESA 1OTBA 3F1NA 2WKPA 1QMFA 3DWZA 3MQOA 4GHIB 2XH9A 2WAFA 3EOIA 1E3UD 2V9AA 2W3EA 3MXSA 1ZC2A 3EEHA 3L7HA 4JGQA 4LRZE 3NBLA 1YSQA 1O7EA 5FAPA 1S1YA 3IF5A 5F68A 5HDSA 2WGWB 3NECA 2QJ5A 3HUMA 4ETZA 2OAQ1 3SH7A 4CLCC 4QD4A 3HUOA 3VP0A 3PAEA 1MZUA 2WKRA 4OQGA 3QP5A 2I72A 3F1PA 4B4XA 2DRWA 4U0XA 2E8JA 2WZXA 4LCLA 4QB8A 2QZ6A 1YLZA 2V2FF 3VE3A 3MJQA 4B4ZA 4CJNA 3HLDA 3TOIA 2Y2QA 5L10A 1BLPA 4A5RA 2JCHA 4DE2A 2O9BA 4X68A 1TS8A 1ESUA 4WN5A 3T4JA 3S7QA 4BENA 2O9AA 3ZFZA 4ZJ2A 3IH9A 2Y79A 1SCWA 2YKHA 2G7UA 1LLBA 1Q2QA 1FCOA 1KE3A 3OPLA 1L0DA 4MEZA 4M4XA 4KZ8A 2ZOHA 4X53A 3NDEA 1STZA 4OLGA 1KE4A 2J9PA 3MXQA 4ZTKA 3OLOA 4Y3IA 4R3BA 4ZDXA 2PAVP 1MWSA 2JE5A 2QJ7A 1P9WA 4KQRA 1WYBA 2P7JA 1FSWA 2GZAA 1ALQA 4E3OA 3NY4A 4GZBA 2XK1A 5KSCA 2XSSA 3FPVA 3A3DA 3S4XA 4OOMA 3RXWA 2QKPA 2WGVA 3U4LP 3EGXC 3BY8A 2PBYA 2Q9MA 4K0XA 2ZC6B 1W63Q 2OOLA 3BFEA 2Y2KA 1LSVA 2OV5A 4DF6A 3UN7A 4IVKA 1PI4A 3AGFA 4QY6A 5L09A 1SKOB 2W27A 2WGIA 4GOGA 5CTNA 1SKOA 3ZG9B 1ES4A 4B88A 2B02A 2O99A 3O5YA 4OQHA 4JF4A 3QP8A 3LUQA 4N9LA 4QPRA 4FH4A 3E4QA 3ZGAB 3SS4A 1TS0A 4L9EA 5HAIA 4HY8A 4D2OA 4ZJ3A 4WL9A 4G3WA 2JN7A 3MZEA 4MNRA 4Y2FA 4P0MA 3F1OB 4LRYC 4DRTA 2JKTM 2ZQAA 4O01A 4OOYA 5FQMA 2L1MA 3BLSA 4KG5A 3FYZA 2FH5A 2QYBA 1FR1A 2R9WA 4EXOA 3VOYA 4RYEA 4BBUA 2ZQ8A 3GTCA 5EOEA 2PD7A 3V50A 5CGSA 5DJUA 5AQ7A 2EX6A 3MKEA 2VEAA 1ES2A 2R9XA 1M6KA 2JC7A 3G30A 3W4QA 1UWNX 4I3AA 1G68A 1BUEA 3UO9A 1H8ZA 3IWQA 5DKLA 1DJAA 4K0WA 1TVFA 4HI4A 5EV0A 3QP1A 1XJ3A 2P04A 2PU4A 2WADA 4RA7A 5CEDA 4JGRA 1FCNA 4C75A 3KYQA 4K91A 5DTTA 5CHJA 4S2JA 3UE1A 3MQ0A 2J3WA 2EFUA 1MPLA 1VEUA 1MWTA 3CZDA 2VV8A 1N9OA 2JKRM 3KYZA 3SZTA 1VHMA 4H8RA 3VE4A 2HPBA 4D60A 2I9VA 2P9VA 3W4PA 4MLLA 3UNWA 1DP6A 1NLYA 4HESA 1XKZA 2VGJA 4DE0A 2NUTC 1BYWA 3MF0A 5HDDA 3DTEA 2HZ5A 3DBAA 1GHPA 4NK3A 2UWXA 2LB5A 5HW3A 3LICA 1D1JA 4JXSA 1Y4OA 2VX8A 3JVUA 4OVDA 3N6IA 3WWXA 2KDKA 1K57C 4S2LA 2NUPC 4PKYG 3RTYA 1W63M 5GHZA 2XFSA 4F3LB 3E2KA 3UB9A 1JWVA 4ARZA 3ZCZA 3V67A 3OPHA 2JKTI 2BLSA 1ZKJA 4P87A 1J3WA 2K31A 3P01A 4E3LA 4GD6A 3WS4A 3TG9A 1I2SA 2ZQDA 4OONA 1OTDA 2EXBA 3AGEA 4S2KA 3DTIA 4RVAA 3W2ZA 1KDSA 2FFYA 3ITBA 4KZ7A 3LI8A 5E2HA 2XR0A 4WLAA 2PYPA 3NCKA 1H0MA 4S2MA 4ETXA 2ZD8A 1GHIA 3HUNA 3A0VA 3HL9A 1E3UA 5U47A 2G2WA 4S2IA 5FI7A 3C7VA 3ZQ5A 1KGFA 4L0LA 2VKSA 3BWLA 4KZ5A 1K6RA 4GKUA 4WF0A 2GDNA 5KZHA 1LSWA 4ZJ1A 4S2PA 4M3KA 5J7EA 1MKIA 3WS5A 3UE6A 3CAXA 2BTFP 2K2NA 4LV0A 4S2NA 4KG2A 1E4DA 5CHMA 5CERA 4OQIA 3VSLA 2Y8HA 4G3VA 2JKRI 3SH8A 2XA7M 4NETA 3IWOA 4GNUA 4UA6A 3HLCA 2C5WB 2JHEA 4IBXA 1BT5A 4BWIA 3A0SA 4U0TA 2ZL1B 4EW7A 5HWWA 4ID4A 4YINA 3EGDC 3UPNA 3V5MA 3WRZA 5CHUA 1PZOA 1W8YA 4WZ5C 5HD3A 4DDYA 5LBRA 3IT9A 4OP5A 3PBQA 4MBKA 3UPPA 3MS6A 4HJ4A 3ICYA 5F5YA 5DF8A 3GR2A 5FA7A 1XP4A 3SH9A 1KDWA 1LI0A 4Y5FA 1MWRA 5FSRA 2Z2MB 4GCZA 3UDFA 1BLHA 4JXGA 5A92A 2PU2A 3T4TA 4EUZA 1T18A 1VETB 4KZBA 2X71A 4UHUA 1VETA 2XF3A 4WEKA 3ZDJA 2OSUA 4R0QA 1BULA 1YKDA 1N9BA 4RX2A 2ZLYA 4DN0A 5E2FA 4DXBA 1K57A 1TDGA 2P08A 3GSGA 2Y4AA 2Y2OA 2Y2IA 5EVID 4Q0IA 1TF1A 1ES3A 1PWDA 3FKVA 3O87A 3B33A 2YKFA 2L4RA 1BTLA 1WA9A 4Y0UA 2ZMFA 3LYXA 5DVAA 4KUKA 2Y55A 4PM5A 2EX2A 4Y0TA 1CJFA 1F9IA 5CGWA 5FASA 1YM1A 4WUJA 3ULFA 5J8XA 1OPXA 3GVBA 3P7NA 4PM8A 2H10A 1I2WA 2Z2LB 3V3RA 4UAAA 4Z9QA 2DMWA 4KZ9A 3NI9A 1FOFA 1MWUA 3A3JA 1G28A 3GRJA 5DFYA 1L2SA 1HLUP 3TW8A 1F98A 2HP5A 5AVEA 2G2UA 4Z1WA 1K56D 1OTAA 1YLPA 3OCNA 5CTMA 1NZUA 3LEZA 4DJ3A 1FCMA 1OJ5A 4Y13A 1RCJA 1XGIA 5I5LA 4HBUA 1D06A 1HD8A 3K2NA 3PTEA 1SKFA 3G4PA 2H5SA 2Y59A 4O0PA 4EEUA 2HDRA 4UEYA 2OAP1 3MZDA 4GHIA 3BYDA 1PRQA 1L0EA 2A49A 3SS5A 2J8YA 3C38A 2KX6A 3MFDA 5GL9A 3ZG8B 1XFNA 3A3EA 1D7EA 4KZ4A 3FC7A 4FH2A 5HARA 4F94A 2K7SA 1SHVA 4JGPA 1DP8A 2PR5A 2XRNA 3LR0A 5FQ9A 1U60A 3DWKA 2XD1A 5GHYA 2WGWA 3DW0A 2V1AA 4LV1A 4BL2A 5EM1A 2QHKA 3A3IA 4WZ5A 2WUQA 4HH2A 2V1ZA 1EI5A 2ZM2A 3KSGA 5HZHA 3OOVA 5HPIA 3IBJA 5KMWA 5KIZA 3CUEC 4KQQA 3PBTA 4BBTA 2PHYA 4QWOA 1WE4A 1V9ZA 2ZC4B 4JKTA 2HJEA 5BOHA 3Q7VB 4X1LA 4MMNA 3Q7VA 3O3VA 4PMAA 1ZTUA 4IBRA 2W3HA 3KSIA 5FATA 2WKQA 3Q81A 1YSPA 3N8SA 5FEGA 4HOIA 3NDGA 1S67L 5DF9A 2XEPA 4DKIA 5EPHA 1DJBA 3G2YA 1Y54A 4JPMA 4OQ0A 1P97A 5EVIC 3OZHA 3IHAA 4OPRA 3ZG5A 1ZHHB 4N1XA 5HSQA 1GCEA 4B93A 3HCYA 5TJJA 4WMCD 3WS1A 2W1TB 1T19A 1VB6A 1GHMA 3H9WA 3G2ZA 2W1TA 2RCXA 1IOUA 3C30A 3ZVWA 1L3LA 3IXHA 3GQZA 4IVIA 1S1ZA 4L9FA 4KENB 1NYYA 5CEBA 4IUHA 4QJGA 2PYRA 4PM7A 1YLYA 2OWHA 1F5MA 4MN5A 1YLJA 2V1BA 5A91A 1TEMA 3CJMA 3HLFA 4CPKA 1NYMA 4EETB 3CMZA 3BEBA 3BW6A 2W3DA 2UV0E 2IWDA 5F69A 3K3DA 3FZCA 2VZWA 5DTKA 2ZC3B 3T12B 2ZC5B 3C8CA 4OPZA 3AGDA 1H8MA 4BQMA 3T4OA 1OTIA 3Q7ZA 4GLQA 3M6HA 3T50A 3MQQA 1G5UA 3KYEA 3PR6A 3GV9A 3F1OA 4QY5A 2PD8A 3ZYTA 4OH0A 4HNBA 3LR5A 2VV6A 3VOLA 3LR4A 1AWIA 3S7PA 1GA9A 5FDHA 4P85A 2JKFA 2WYXA 3TSGA 3QP2A 4MBFA 4JGOA 1XJ4A 1H8YA 3LI9A 2P74A 1YLWA 2W1RA 4S2NC 1EROA 2Y2NA 2GX5A 3P98A 1MKMA 4Y0OA 3T4SA 2W3GA 3NC8A 5JYOA 5FAOA 4UA7A 3T4KA 3ZG0A 3N4IA 4S2OA 3FG8A 3CUEA 5KSHA 4I3JA 2IA2A 2QPNA 3HJKA 4RQ9A 4GDBA 2A3UA 2QWSA 1JWPA 1MXOA 1N9LA 1LSXA 3QNBA 1ERMA 1IELA 4G3KA 4QHCA 5HFOA 2X01A 2AVXA 1NJ4A 1O07A 3LIEA 3LEQA 5HWTA 3SW1A 3LGOA 5AQAA 5FDSA 4EBLA 5IHVA 3JVVA 5K5BA 4JF5A 4NEED 4XUZA 5E2EA 4OPYA 3PBRA 3JYIA 4IHQA 2ZMVA 4R70A 5EVIB 5HL6A 5CXWA 5EVIA 3UE0A 2EX8A 3EQUA 2VGKA 5IS1A 3GDIA 2EWWA 3BFGA 2GNXA 2IWCA 2Y2HA 1W5DA 3UB7A 2H28A 3D72A 4LCMA 2H0YA 3OPRA 4HQAA 2ZBBA 3V3SA 4RX3A 3U2AA 4EEPA 1K25A 4WBGA 4YFMA 3UMDA 2XD5A 2B18A 4H6JB 4WEJA 1SZVA 4Y7PA 5GLAA 3ISGA 4EBNA 3LY4A 4H6JA 5FQIA 1K56A 4F3LA 1JVJA 2INWA 4MN6A 3VP4A 3T1QB 1XFQA 2X02A 2EA9A 2LB9A 3G34A 3ZG7B 4DJ2A 3DTMA 3A0RA 1ZG6A 4KQDA 2QMIA 2Y2MA 4E3KA 1FR6A 2ZM0A 3Q1FA 3EEAA 2ZJ9A 5TBMB 1L0FA 1YQSA 1KGEA 1DY6A 2PDRA 3D4FA 3HVFA 1ES5A 5EUAA 5G4YA 3LFVA 4PKYA 5JYPA 3IX4A 5EECA 2J3TD 4R4RA 4XT2B 1OT9A 1F2KA 5F82A 4MBHA 2M7UA 5I94A 3VP1A 4FUWA 1P0ZA 5AVFA 4LENA 3MFXA 2ZM8A 1L0GA 4GB7A 3IH8A 4CLCE 3T1XA 1OTEA 3QP6A 4OPQA 3HLGA 5A93A 1A0KA 3NULA 1NY0A 2V0WA 4HEFA 3H82B 1S4RA 2VGLS 4Q0JA 3FPWA 2Z6CA 4LGWA 3NJAA 1GSWA 4WM9A 1H3QA 3UE3A 5GLDA 1XJ2A 1GSVA 5DFXA 2XQZA 2HV1A 5CECA 5GLCA 3UDXA 1KVLA 3LO7A 4BD0A 3ITAA 1P9RA 2IWBA 3MBZA 3NHQA 1S4SA 4WZ4A 2EFXA 2ZL1A 4LFUA 3TE8A 4JXWA 3R4KA 4HIAA 3IF6B 1LI9A 4DMZA 2PR6A 2HDUA 4NXFA 3GMWA 4CLCD 5EE8A 5G18A 2ZQ9A 3ZVTA 2HF6A 1PYYA 1S6RA 1OT6A 5L8MA 4WMCA 1IYSA 4C3QA 3PXPA 3BJNA 1M40A 3CLOA 5E2GA 3VP2A 4EERA 1KE0A 1K4FA 3VP3A 2A2LA 1K6SA 1N9NA 4FCFA 5DJTA 1N4OA 3LIAA 3M2KA 2RL3A 1MY8A 3C4OA 3VMAA 3N8LA 3IWIA 4UQIS 3OBFA 4KQOA 2J9OA 2GJ3A 3QNCA 3BFCA 3BLMA 1V9YA 3E4PA 3M6BA 1YMSA 4BL3A 1LL8A 5HWVA 2XA7S 2D01A 2PBDP 2JBFA 4YWZA 3HREA 4KZ6A 3VOZA 1PWGA 2V0UA 5FAQA 4P6ZS 2ZC7A 1NRFA 2Q9NA 3B42A 1IYQA 4FTXA 4ZAMA 4Q8IA 3OPPA 2DCFA 1RGYA 4R6LA 4K08A 5E43A 3BQ8A 4MCWA 3S22A 3G31A 1IKGA 5EM0A 2A24B 3VFFA 3KSHA 2Y91A 3MSHA 4I3IA 2XFTA 2A24A 5L2FA 4I38A 1GSXA 3HLEA 1PIOA 3C7UA 4ME4A 2EWVA 4LLOB 4AFIA 2PT7A 1Q2PA 4N1HA 1RP5A 1CK3A 1WYCA 1YPRA 3BRMA 1ZG4A 3IBRA 2ZQCA 3F1NB 2ZOIA 4BJPA 1K54C 4BMWA 1PWCA 5CX7A 4PAUA 3TJZC 1IEMA 3IXBA 1IYOA 1IKIA 3LY3A 3HLWA 1K0KA 4R1GA 5F1GA 4QU3A 3B3XA 1W7FA 5IU1A 4YOFA 4LV2A 4HJ6A 1XA1A 3UY6A 3WRTA 3SS3A 5TGFA 4XXRA 3F1PB 1FILA 3L9KA 1FSYA 3O86A 4X1MA 3G35A 3RFBA 3CG5A 1JTDA 4X6TA 3W8KA 1NZOA 4HP9A 2WAEA 4GJ4A 1EW0A 2VV7A 1HTZA 3Q07A 5TR7A 1DRMA 1PNEA 3JPUA 3WS0A 1FQGA 4R3JA 4X69A 3I7JA 3KX0X 3LIFA 1BLCA 1XJ6A 4KZ3A 1TD5A 3VSKA 3S1YA 1NLZA 1DJCA 1LT0A 1T1BA 1IYPA 5HDCA 5HAPA 3PBNA 3HBRA 4WYYA 3E0YA 4EBPA 1H5XA 1BLSA 3T1RA 2DNSA 5L07A 4LRXC 2HGVA 4LPZA 5A90A 1TS7A 3T1SA 1XPBA 3S7NA 2KOIA 3BFFA 4E6XA 3IHBA 2B95A 2V8CA 1IFQA 4X25A 5M19A 2WKHA 4ZBEA 1KOUA 1TDLA 1NXYA 1C3BA 3IX8A 2E8IA 4P6BA 1K55C 2XLNA 4R38A 3CI6A 2C6WB 4PM6A 5FQKA 2W3FA 3N7WA 1YAXA 2BG1A 1SDEA 4O8GA 1PI5A 4GDNA 4OP8A 1T1AA 5EVLA 3UB8A 4E6WA 3IXDA 1Y28A 3FWLA 3FV7A 2V8FA 1PFLA 3D3OA 4HH3A 4IUKA 3LR3A 1VM1A 1K54A 1LL9A 4WELA 5M1AA 2KLIA 3DTKA 3IS2B 5EOOA 5M18A 3CPTB 5AJGA 2J80A 3IS2A 4NG2A 3CPTA 3R7WB 1UWPX 1EWZA 2CC1A 3R7WA 5AQ9A 4MDZA 3T4QA 1I5QA 1KVMA 3NOTC 4JLFA 5FQQA 4CLCB 3Q82A 1S66L 2O9CA 1ONHA 1XA7A 1Z6FA 4CLCA 1X0OA 3CWFA 2Y2PA 1MC0A 3TRCA 1JNUA 2W0NA 2WKEA 5FI2A 1CF0A 3UB5P 3HJIA 4JF6A 2XGNA 3IXGA 3EQVA 3M2JA 2WKIA 2OLUA 1CI8A 3KO6A 1K4EA 4NXEA 4MN7A 2VK3A 3OCLA 5A8BA 1ESIA 5DTSA 2HDQA 3VFHA 1CEFA 3E4OA 1VQQA 4C6YA 3IF6C 1G6OA 4HBTA 1W8QA 3LIDA 4E3JA 1CI9A 1HZOA 2J7VA 4OLDA 3MZFA 3BQAA 3LCEA 5HAQA 3IX3A 3A3FA 2L0WA 4E3IA 2XDMA 5CGXA 1VEUB 3DAVA 3LIBA 3QP4A 4I39A 4IJGA 1KGGA 5HPFA 4BD1A 2Q0OA 1T1CA 5AQBA 3W4OA 2P9VB 2D02A 1NRJA 3PAGA 4EQIA 5DF7A 3UMEA 2WZZA 4KZAA 4O7DA 5C5KA 4CQHA 3MMHA 4GS9B 2BASA 3E2LA 1G6AA 1RGZA 4N92A 4JXVA 4GS9A 3K3CA 2VA0A 3RH8B 2FFFB 2VGLM 3KSFA 4ESPA 4IEDA 4HHDA 5D3OA 4EQ1A 3B47A 1PW1A 1LL5A 2ZMAA 3FKWA 1J9MA 2R78A 5F83A 3IQAA 1K55A 4ARZB 1YMXA 4NXBA 1SDNA 5FQJA 1W79A 1YLTA 1S0WA 4R4SA 4GD8A 5FL3A 5MC7A 2EX9A 3C2WA 2Y2JA 3PYPA 3PBSA 4R3AA 5TBMA 4FOFA 1AXBA 2OWJA 1PZPA 4EWFA 1ACFA 4XT2A 4E3MA 5HD5A 2HP9A 4PM9A 4FSFA 2WK0A 2M1CA 2ZQ7A 4I5SA 3BFDA 1DP9A 4BLMA 3V39A 3CITA 2VLGA 1FIKA 1E25A 3O88A 4XUXA 3RXXA 2O0YA 3SOIA 2FZ0A 2M7VA 1CQAA 5TFQA 3H82A 3HLBA 3ZNYA 1LHYA 1XXMA 4DDSA 3MXRA 3PHYA 2VJWA 3BY9A 4R23A 4EV4A 4NXGA 5GLBA 4UQIM 2HJ9C 4II7A 4NKPA 4JBFA 3C5AA 3GECA 1K38A 4Y15A 3NOUC 3MR0A 1BSGA 4BBVA 4FD8A 3PBOA 1NWZA 5IT5A 1ODVA 4E04A 3IF6A 4YNRA 1XX2A 1GA0A 5GHXA 3UB6A 4P6ZM 3UPOA 3UDIA 5FEFA 4LV3A 4Q0HA 5G4ZA 5DKKA 5EFWA 1JWZA 5EVEA 4EU0A 3D9YA 1BZAA 3RJUA 3WS2A 3CHWP 1MBLA 3OC2A 1YT4A 4Y17A 5F6AA 2ACGA 3NIAA 1OJGA 4E3NA 3EWKA 5FI6A 3NOPC 1CEGA 2PRFA 3ZHHA 3T4LA 5J4EA 2EXAA 3P09A 3G32A 3BECA 5J3WA 1JTGA 2Z6DA 2B5RA 3ZNTA 1XGJA 1OMEA 3C4PA 3VV4A 4PPRA 3E98A 2MJ6A 2H0TA 4HJ3A 4X55A 2CMNA 4PHTA
chains in the Genus database with same CATH topology
4ETXA 2GX5A 4GJ4A 3S7OA 3A0VA 1MKMA 3T4SA 3ZQ5A 1EW0A 4L0LA 2W3GA 2VV7A 2VKSA 3BWLA 3T4KA 1DRMA 3FG8A 3CUEA 5KSHA 4I3JA 4WF0A 2IA2A 2J3TC 1LSWA 4KUOA 5J7EA 3HJKA 4RQ9A 3KX0X 3LIFA 4ZRRA 2QWSA 1XJ6A 3H7WB 1TD5A 1N9LA 1LSXA 1NLZA 1LT0A 1T1BA 5HDCA 3H7WA 4G3KA 3UE6A 4L9GA 3CAXA 3PBNA 4OOLA 1TS6A 2K2NA 4HP4A 3LIEA 3E0YA 5HWTA 3SW1A 3JVVA 4GW9A 5K5BA 4NEED 4LRXC 2HGVA 4LPZA 1TS7A 3PBRA 2Y8HA 4G3VA 3S7NA 2KOIA 2JKRI 4IHQA 2XA7M 2ZMVA 4R70A 5HL6A 2XROA 1UGUA 3G6OA 4EUVA 2JHEA 4BWIA 1IFQA 3A0SA 3EQUA 5IS1A 3GDIA 2EWWA 4EW7A 5HWWA 4B9OA 3EGDC 4EESA 1OTBA 2GNXA 1KOUA 3F1NA 2WKPA 3MQOA 3UB7A 4GHIB 5HD3A 5LBRA 3CI6A 2H28A 4R38A 3D72A 3PBQA 4HQAA 2ZBBA 4HJ4A 3EOIA 2W3FA 3ICYA 5F5YA 3U2AA 2V9AA 4EEPA 2W3EA 1YAXA 3EEHA 4JGQA 4LRZE 4O8GA 3UMDA 1YSQA 2B18A 1T1AA 4H6JB 3UB8A 4WEJA 1S1YA 1Y28A 4H6JA 4Y5FA 5F68A 5HDSA 2QJ5A 4GCZA 4ETZA 2OAQ1 4CLCC 3D3OA 4HH3A 4IUKA 3LR3A 2INWA 4MN6A 4F3LA 1XFQA 1MZUA 2WKRA 4WELA 3T4TA 2KLIA 3F1PA 1T18A 2EA9A 3IS2B 5AJGA 2LB9A 2J80A 4DJ2A 3IS2A 3R7WB 1UWPX 3A0RA 4KQDA 4WEKA 3VE3A 3MJQA 3R7WA 3EEAA 1YKDA 5TBMB 4MDZA 4DN0A 3T4QA 2P08A 2PDRA 5G4YA 3NOTC 4Q0IA 3LFVA 4PKYA 1TF1A 4CLCB 1S66L 2J3TD 2O9BA 2O9CA 1TS8A 4XT2B 1OT9A 4WN5A 3B33A 1X0OA 3CWFA 3T4JA 3S7QA 2YKFA 4CLCA 2M7UA 1MC0A 2L4RA 1JNUA 2O9AA 3TRCA 2W0NA 2Y79A 1WA9A 2YKHA 2G7UA 3HJIA 1P0ZA 2ZMFA 3LYXA 5AVFA 4KUKA 3MFXA 4CLCE 3EQVA 1OTEA 1F9IA 4M4XA 3KO6A 4NXEA 4WUJA 4MN7A 3ULFA 2ZOHA 3OCLA 5A8BA 1OPXA 3P7NA 1STZA 3E4OA 3MXQA 2V0WA 1G6OA 2DMWA 3LIDA 3OLOA 4Y3IA 3H82B 1G28A 1S4RA 2VGLS 4Q0JA 3FPWA 3BQAA 2Z6CA 3NJAA 1GSWA 5DFYA 1H3QA 2QJ7A 3TW8A 3UE3A 1F98A 1P9WA 5AVEA 4Z1WA 1XJ2A 1OTAA 3OCNA 1GSVA 2P7JA 2GZAA 5DFXA 4DJ3A 2L0WA 1OJ5A 2HV1A 2XSSA 5I5LA 3FPVA 3LIBA 1D06A 1P9RA 4OOMA 2QKPA 3NHQA 1S4SA 4I39A 3K2NA 3TE8A 3EGXC 3BY8A 4IJGA 1W63Q 2OOLA 3R4KA 4HIAA 4O0PA 4EEUA 5HPFA 4UEYA 1LSVA 1T1CA 2OAP1 4GHIA 2D02A 4DMZA 1NRJA 3C38A 2KX6A 2PR6A 3UMEA 1XFNA 2W27A 5C5KA 4NXFA 1D7EA 4CQHA 3MMHA 3FC7A 4CLCD 4GS9B 2K7SA 2BASA 2B02A 4JGPA 2O99A 3O5YA 1DP8A 2HF6A 2PR5A 2XRNA 3LR0A 1OT6A 4GS9A 5L8MA 3K3CA 2VA0A 3LUQA 3RH8B 2VGLM 3KSFA 4QPRA 3PXPA 2V1AA 3BJNA 4HHDA 3CLOA 3E4QA 1TS0A 4L9EA 4EQ1A 4EERA 3B47A 4HY8A 2A2LA 1N9NA 2QHKA 4WL9A 4G3WA 5DJTA 2JN7A 2R78A 4Y2FA 4ARZB 4HH2A 3KSGA 5HZHA 3F1OB 4NXBA 3OOVA 3LIAA 5HPIA 4LRYC 3IBJA 5FL3A 5KIZA 3CUEC 5MC7A 3PBTA 2JKTM 3C2WA 4BBTA 2PHYA 4O01A 3PYPA 4UQIS 3OBFA 4KQOA 3PBSA 1V9ZA 4R3AA 5TBMA 2L1MA 2GJ3A 4FOFA 2HJEA 1V9YA 3E4PA 2FH5A 2QYBA 4EXOA 4MMNA 2OWJA 1LL8A 1ZTUA 5HWVA 4BBUA 2W3HA 3KSIA 2D01A 2PD7A 2XA7S 2WKQA 1YSPA 4XT2A 5DJUA 4YWZA 4HOIA 1S67L 2VEAA 5DF9A 5HD5A 4FSFA 2V0UA 2M1CA 4I5SA 1DP9A 4P6ZS 3CITA 2VLGA 1UWNX 4I3AA 3B42A 1P97A 2O0YA 1ZHHB 5DKLA 5HSQA 2FZ0A 2M7VA 4B93A 4R6LA 4K08A 3BQ8A 3HCYA 4MCWA 3H82A 4HI4A 5TJJA 2A24B 1XJ3A 3KSHA 2P04A 2W1TB 1T19A 3PHYA 4JGRA 1VB6A 2VJWA 4I3IA 3H9WA 2A24A 3BY9A 3KYQA 2W1TA 4NXGA 1IOUA 4I38A 3C30A 1GSXA 4UQIM 2HJ9C 4II7A 4ME4A 2EWVA 4NKPA 3MQ0A 4LLOB 2J3WA 4AFIA 2PT7A 3GECA 3NOUC 3MR0A 4BBVA 1S1ZA 2VV8A 3PBOA 1NWZA 4L9FA 1N9OA 2JKRM 3KYZA 4IUHA 2PYRA 5IT5A 1ODVA 4E04A 1VHMA 3VE4A 2OWHA 1F5MA 4YNRA 2I9VA 3IBRA 4MN5A 2V1BA 3F1NB 1DP6A 4P6ZM 1NLYA 3UB6A 2ZOIA 4BJPA 2NUTC 4BMWA 4EETB 1BYWA 3MF0A 5HDDA 4Q0HA 5G4ZA 5CX7A 3DBAA 4PAUA 5DKKA 3TJZC 3BW6A 2W3DA 5EFWA 2LB5A 5F69A 3K3DA 4EU0A 2VZWA 3LICA 2VX8A 3JVUA 3C8CA 3OC2A 2KDKA 5F6AA 1H8MA 2NUPC 4PKYG 5IU1A 3RTYA 1W63M 4YOFA 3T4OA 1OTIA 1OJGA 4HJ6A 3EWKA 4GLQA 3T50A 3MQQA 3NOPC 4F3LB 3UB9A 3T4LA 4ARZA 3V67A 5J4EA 3PR6A 2JKTI 3F1OA 2PD8A 3ZYTA 5J3WA 3F1PB 4HNBA 2Z6DA 3LR5A 2VV6A 3VOLA 2K31A 3LR4A 3P01A 3RFBA 3S7PA 3VV4A 1OTDA 3W2ZA 3E98A 2MJ6A 4HJ3A 4JGOA 1XJ4A 2CMNA 3LI8A 3LI9A 4PHTA 4WLAA 2PYPA 4HP9A 2W1RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A0V A;  3ZQ5 A;  1EW0 A;  2VV7 A;  3BWL A;  1DRM A;  3FG8 A;  4I3J A;  4WF0 A;  1LSW A;  4KUO A;  5J7E A;  3HJK A;  4RQ9 A;  3KX0 X;  3LIF A;  2QWS A;  1XJ6 A;  3H7W B;  1N9L A;  1LSX A;  1LT0 A;  1T1B A;  5HDC A;  3H7W A;  3UE6 A;  4L9G A;  3CAX A;  1TS6 A;  4HP4 A;  3LIE A;  5HWT A;  3SW1 A;  4GW9 A;  4LRX C;  4LPZ A;  1TS7 A;  4R70 A;  1UGU A;  3G6O A;  2JHE A;  3A0S A;  5IS1 A;  3GDI A;  4EW7 A;  5HWW A;  4B9O A;  4EES A;  1OTB A;  1KOU A;  3F1N A;  2WKP A;  3MQO A;  3UB7 A;  4GHI B;  5HD3 A;  4R38 A;  2H28 A;  3D72 A;  4HQA A;  2ZBB A;  4HJ4 A;  3ICY A;  5F5Y A;  2V9A A;  4EEP A;  3EEH A;  4JGQ A;  4LRZ E;  3UMD A;  1T1A A;  4H6J B;  3UB8 A;  1S1Y A;  1Y28 A;  4H6J A;  5F68 A;  5HDS A;  2QJ5 A;  4GCZ A;  4HH3 A;  4F3L A;  2INW A;  4MN6 A;  1XFQ A;  1MZU A;  2WKR A;  3F1P A;  1T18 A;  2EA9 A;  3IS2 B;  2J80 A;  4DJ2 A;  3IS2 A;  1UWP X;  3A0R A;  4KQD A;  3VE3 A;  3MJQ A;  5TBM B;  2PDR A;  5G4Y A;  3NOT C;  4PKY A;  1S66 L;  1TS8 A;  4XT2 B;  1OT9 A;  4WN5 A;  3B33 A;  1X0O A;  3CWF A;  2YKF A;  2L4R A;  1JNU A;  2W0N A;  1WA9 A;  2YKH A;  3HJI A;  1P0Z A;  3LYX A;  5AVF A;  4KUK A;  3MFX A;  1OTE A;  1F9I A;  4M4X A;  4NXE A;  4WUJ A;  3ULF A;  2ZOH A;  5A8B A;  3P7N A;  3E4O A;  3MXQ A;  2V0W A;  3LID A;  3OLO A;  3H82 B;  1G28 A;  1S4R A;  2Z6C A;  3NJA A;  1GSW A;  2QJ7 A;  1F98 A;  5AVE A;  1XJ2 A;  1OTA A;  1GSV A;  2P7J A;  4DJ3 A;  2L0W A;  1OJ5 A;  2HV1 A;  5I5L A;  3LIB A;  1D06 A;  2QKP A;  3NHQ A;  1S4S A;  4I39 A;  3BY8 A;  2OOL A;  4HIA A;  4EEU A;  1LSV A;  1T1C A;  4GHI A;  2D02 A;  2KX6 A;  2PR6 A;  3UME A;  1XFN A;  2W27 A;  4NXF A;  1D7E A;  3FC7 A;  4GS9 B;  2K7S A;  2BAS A;  2B02 A;  4JGP A;  1DP8 A;  2PR5 A;  1OT6 A;  4GS9 A;  3K3C A;  3LUQ A;  3RH8 B;  2V1A A;  4HHD A;  3CLO A;  3E4Q A;  1TS0 A;  4L9E A;  4EQ1 A;  4EER A;  4HY8 A;  1N9N A;  2QHK A;  4WL9 A;  5DJT A;  2JN7 A;  2R78 A;  4HH2 A;  5HZH A;  3F1O B;  4NXB A;  3LIA A;  4LRY C;  5KIZ A;  4BBT A;  3C2W A;  2PHY A;  3PYP A;  1V9Z A;  4R3A A;  5TBM A;  2L1M A;  2GJ3 A;  1V9Y A;  3E4P A;  4EXO A;  2OWJ A;  1LL8 A;  5HWV A;  4BBU A;  2D01 A;  2PD7 A;  2WKQ A;  4XT2 A;  5DJU A;  4YWZ A;  4HOI A;  1S67 L;  2VEA A;  5HD5 A;  2V0U A;  2M1C A;  4I5S A;  1DP9 A;  2VLG A;  1UWN X;  4I3A A;  1P97 A;  5DKL A;  5HSQ A;  4R6L A;  4K08 A;  3H82 A;  4HI4 A;  2A24 B;  1XJ3 A;  1T19 A;  3PHY A;  4JGR A;  1VB6 A;  4I3I A;  3H9W A;  2A24 A;  3BY9 A;  4NXG A;  4I38 A;  1GSX A;  4LLO B;  3GEC A;  3NOU C;  3MR0 A;  4BBV A;  1S1Z A;  2VV8 A;  1NWZ A;  4L9F A;  1N9O A;  2PYR A;  1ODV A;  4E04 A;  3VE4 A;  2OWH A;  2I9V A;  3IBR A;  4MN5 A;  2V1B A;  3F1N B;  1DP6 A;  3UB6 A;  2ZOI A;  4EET B;  1BYW A;  5HDD A;  5G4Z A;  5DKK A;  5EFW A;  5F69 A;  3K3D A;  3LIC A;  3C8C A;  2KDK A;  5F6A A;  4PKY G;  5IU1 A;  3RTY A;  1OTI A;  1OJG A;  4HJ6 A;  3EWK A;  3T50 A;  3MQQ A;  3NOP C;  4F3L B;  3UB9 A;  5J4E A;  3F1O A;  2PD8 A;  5J3W A;  3F1P B;  4HNB A;  2Z6D A;  2VV6 A;  3VOL A;  1OTD A;  4HJ3 A;  4JGO A;  1XJ4 A;  2CMN A;  3LI8 A;  3LI9 A;  4WLA A;  2PYP A;  4HP9 A; 
#chains in the Genus database with same CATH topology
 4GN2 A;  4DE3 A;  1QME A;  3S7O A;  2V20 A;  2JKG A;  3N8R A;  2Y2G A;  2Y2L A;  1ERQ A;  1ONG A;  3QHY A;  2J3T C;  4KUO A;  4ZRR A;  3H7W B;  3MKF A;  1HVB A;  4DXC A;  4OKP A;  3H7W A;  4L9G A;  4OOL A;  4N9K A;  4UA9 A;  1TS6 A;  4HP4 A;  4KG6 A;  1PW8 A;  5F1F A;  4GW9 A;  2HP6 A;  2HDS A;  5HL1 A;  5CRF A;  4U3T A;  5HX9 A;  2XRO A;  1UGU A;  3G6O A;  4EUV A;  2OLV A;  4DE1 A;  4X56 A;  3BM6 A;  4B9O A;  1Z09 A;  4EES A;  1OTB A;  3F1N A;  2WKP A;  1QMF A;  3DWZ A;  3MQO A;  4GHI B;  2XH9 A;  2WAF A;  3EOI A;  1E3U D;  2V9A A;  2W3E A;  3MXS A;  1ZC2 A;  3EEH A;  3L7H A;  4JGQ A;  4LRZ E;  3NBL A;  1YSQ A;  1O7E A;  5FAP A;  1S1Y A;  3IF5 A;  5F68 A;  5HDS A;  2WGW B;  3NEC A;  2QJ5 A;  3HUM A;  4ETZ A;  2OAQ 1;  3SH7 A;  4CLC C;  4QD4 A;  3HUO A;  3VP0 A;  3PAE A;  1MZU A;  2WKR A;  4OQG A;  3QP5 A;  2I72 A;  3F1P A;  4B4X A;  2DRW A;  4U0X A;  2E8J A;  2WZX A;  4LCL A;  4QB8 A;  2QZ6 A;  1YLZ A;  2V2F F;  3VE3 A;  3MJQ A;  4B4Z A;  4CJN A;  3HLD A;  3TOI A;  2Y2Q A;  5L10 A;  1BLP A;  4A5R A;  2JCH A;  4DE2 A;  2O9B A;  4X68 A;  1TS8 A;  1ESU A;  4WN5 A;  3T4J A;  3S7Q A;  4BEN A;  2O9A A;  3ZFZ A;  4ZJ2 A;  3IH9 A;  2Y79 A;  1SCW A;  2YKH A;  2G7U A;  1LLB A;  1Q2Q A;  1FCO A;  1KE3 A;  3OPL A;  1L0D A;  4MEZ A;  4M4X A;  4KZ8 A;  2ZOH A;  4X53 A;  3NDE A;  1STZ A;  4OLG A;  1KE4 A;  2J9P A;  3MXQ A;  4ZTK A;  3OLO A;  4Y3I A;  4R3B A;  4ZDX A;  2PAV P;  1MWS A;  2JE5 A;  2QJ7 A;  1P9W A;  4KQR A;  1WYB A;  2P7J A;  1FSW A;  2GZA A;  1ALQ A;  4E3O A;  3NY4 A;  4GZB A;  2XK1 A;  5KSC A;  2XSS A;  3FPV A;  3A3D A;  3S4X A;  4OOM A;  3RXW A;  2QKP A;  2WGV A;  3U4L P;  3EGX C;  3BY8 A;  2PBY A;  2Q9M A;  4K0X A;  2ZC6 B;  1W63 Q;  2OOL A;  3BFE A;  2Y2K A;  1LSV A;  2OV5 A;  4DF6 A;  3UN7 A;  4IVK A;  1PI4 A;  3AGF A;  4QY6 A;  5L09 A;  1SKO B;  2W27 A;  2WGI A;  4GOG A;  5CTN A;  1SKO A;  3ZG9 B;  1ES4 A;  4B88 A;  2B02 A;  2O99 A;  3O5Y A;  4OQH A;  4JF4 A;  3QP8 A;  3LUQ A;  4N9L A;  4QPR A;  4FH4 A;  3E4Q A;  3ZGA B;  3SS4 A;  1TS0 A;  4L9E A;  5HAI A;  4HY8 A;  4D2O A;  4ZJ3 A;  4WL9 A;  4G3W A;  2JN7 A;  3MZE A;  4MNR A;  4Y2F A;  4P0M A;  3F1O B;  4LRY C;  4DRT A;  2JKT M;  2ZQA A;  4O01 A;  4OOY A;  5FQM A;  2L1M A;  3BLS A;  4KG5 A;  3FYZ A;  2FH5 A;  2QYB A;  1FR1 A;  2R9W A;  4EXO A;  3VOY A;  4RYE A;  4BBU A;  2ZQ8 A;  3GTC A;  5EOE A;  2PD7 A;  3V50 A;  5CGS A;  5DJU A;  5AQ7 A;  2EX6 A;  3MKE A;  2VEA A;  1ES2 A;  2R9X A;  1M6K A;  2JC7 A;  3G30 A;  3W4Q A;  1UWN X;  4I3A A;  1G68 A;  1BUE A;  3UO9 A;  1H8Z A;  3IWQ A;  5DKL A;  1DJA A;  4K0W A;  1TVF A;  4HI4 A;  5EV0 A;  3QP1 A;  1XJ3 A;  2P04 A;  2PU4 A;  2WAD A;  4RA7 A;  5CED A;  4JGR A;  1FCN A;  4C75 A;  3KYQ A;  4K91 A;  5DTT A;  5CHJ A;  4S2J A;  3UE1 A;  3MQ0 A;  2J3W A;  2EFU A;  1MPL A;  1VEU A;  1MWT A;  3CZD A;  2VV8 A;  1N9O A;  2JKR M;  3KYZ A;  3SZT A;  1VHM A;  4H8R A;  3VE4 A;  2HPB A;  4D60 A;  2I9V A;  2P9V A;  3W4P A;  4MLL A;  3UNW A;  1DP6 A;  1NLY A;  4HES A;  1XKZ A;  2VGJ A;  4DE0 A;  2NUT C;  1BYW A;  3MF0 A;  5HDD A;  3DTE A;  2HZ5 A;  3DBA A;  1GHP A;  4NK3 A;  2UWX A;  2LB5 A;  5HW3 A;  3LIC A;  1D1J A;  4JXS A;  1Y4O A;  2VX8 A;  3JVU A;  4OVD A;  3N6I A;  3WWX A;  2KDK A;  1K57 C;  4S2L A;  2NUP C;  4PKY G;  3RTY A;  1W63 M;  5GHZ A;  2XFS A;  4F3L B;  3E2K A;  3UB9 A;  1JWV A;  4ARZ A;  3ZCZ A;  3V67 A;  3OPH A;  2JKT I;  2BLS A;  1ZKJ A;  4P87 A;  1J3W A;  2K31 A;  3P01 A;  4E3L A;  4GD6 A;  3WS4 A;  3TG9 A;  1I2S A;  2ZQD A;  4OON A;  1OTD A;  2EXB A;  3AGE A;  4S2K A;  3DTI A;  4RVA A;  3W2Z A;  1KDS A;  2FFY A;  3ITB A;  4KZ7 A;  3LI8 A;  5E2H A;  2XR0 A;  4WLA A;  2PYP A;  3NCK A;  1H0M A;  4S2M A;  4ETX A;  2ZD8 A;  1GHI A;  3HUN A;  3A0V A;  3HL9 A;  1E3U A;  5U47 A;  2G2W A;  4S2I A;  5FI7 A;  3C7V A;  3ZQ5 A;  1KGF A;  4L0L A;  2VKS A;  3BWL A;  4KZ5 A;  1K6R A;  4GKU A;  4WF0 A;  2GDN A;  5KZH A;  1LSW A;  4ZJ1 A;  4S2P A;  4M3K A;  5J7E A;  1MKI A;  3WS5 A;  3UE6 A;  3CAX A;  2BTF P;  2K2N A;  4LV0 A;  4S2N A;  4KG2 A;  1E4D A;  5CHM A;  5CER A;  4OQI A;  3VSL A;  2Y8H A;  4G3V A;  2JKR I;  3SH8 A;  2XA7 M;  4NET A;  3IWO A;  4GNU A;  4UA6 A;  3HLC A;  2C5W B;  2JHE A;  4IBX A;  1BT5 A;  4BWI A;  3A0S A;  4U0T A;  2ZL1 B;  4EW7 A;  5HWW A;  4ID4 A;  4YIN A;  3EGD C;  3UPN A;  3V5M A;  3WRZ A;  5CHU A;  1PZO A;  1W8Y A;  4WZ5 C;  5HD3 A;  4DDY A;  5LBR A;  3IT9 A;  4OP5 A;  3PBQ A;  4MBK A;  3UPP A;  3MS6 A;  4HJ4 A;  3ICY A;  5F5Y A;  5DF8 A;  3GR2 A;  5FA7 A;  1XP4 A;  3SH9 A;  1KDW A;  1LI0 A;  4Y5F A;  1MWR A;  5FSR A;  2Z2M B;  4GCZ A;  3UDF A;  1BLH A;  4JXG A;  5A92 A;  2PU2 A;  3T4T A;  4EUZ A;  1T18 A;  1VET B;  4KZB A;  2X71 A;  4UHU A;  1VET A;  2XF3 A;  4WEK A;  3ZDJ A;  2OSU A;  4R0Q A;  1BUL A;  1YKD A;  1N9B A;  4RX2 A;  2ZLY A;  4DN0 A;  5E2F A;  4DXB A;  1K57 A;  1TDG A;  2P08 A;  3GSG A;  2Y4A A;  2Y2O A;  2Y2I A;  5EVI D;  4Q0I A;  1TF1 A;  1ES3 A;  1PWD A;  3FKV A;  3O87 A;  3B33 A;  2YKF A;  2L4R A;  1BTL A;  1WA9 A;  4Y0U A;  2ZMF A;  3LYX A;  5DVA A;  4KUK A;  2Y55 A;  4PM5 A;  2EX2 A;  4Y0T A;  1CJF A;  1F9I A;  5CGW A;  5FAS A;  1YM1 A;  4WUJ A;  3ULF A;  5J8X A;  1OPX A;  3GVB A;  3P7N A;  4PM8 A;  2H10 A;  1I2W A;  2Z2L B;  3V3R A;  4UAA A;  4Z9Q A;  2DMW A;  4KZ9 A;  3NI9 A;  1FOF A;  1MWU A;  3A3J A;  1G28 A;  3GRJ A;  5DFY A;  1L2S A;  1HLU P;  3TW8 A;  1F98 A;  2HP5 A;  5AVE A;  2G2U A;  4Z1W A;  1K56 D;  1OTA A;  1YLP A;  3OCN A;  5CTM A;  1NZU A;  3LEZ A;  4DJ3 A;  1FCM A;  1OJ5 A;  4Y13 A;  1RCJ A;  1XGI A;  5I5L A;  4HBU A;  1D06 A;  1HD8 A;  3K2N A;  3PTE A;  1SKF A;  3G4P A;  2H5S A;  2Y59 A;  4O0P A;  4EEU A;  2HDR A;  4UEY A;  2OAP 1;  3MZD A;  4GHI A;  3BYD A;  1PRQ A;  1L0E A;  2A49 A;  3SS5 A;  2J8Y A;  3C38 A;  2KX6 A;  3MFD A;  5GL9 A;  3ZG8 B;  1XFN A;  3A3E A;  1D7E A;  4KZ4 A;  3FC7 A;  4FH2 A;  5HAR A;  4F94 A;  2K7S A;  1SHV A;  4JGP A;  1DP8 A;  2PR5 A;  2XRN A;  3LR0 A;  5FQ9 A;  1U60 A;  3DWK A;  2XD1 A;  5GHY A;  2WGW A;  3DW0 A;  2V1A A;  4LV1 A;  4BL2 A;  5EM1 A;  2QHK A;  3A3I A;  4WZ5 A;  2WUQ A;  4HH2 A;  2V1Z A;  1EI5 A;  2ZM2 A;  3KSG A;  5HZH A;  3OOV A;  5HPI A;  3IBJ A;  5KMW A;  5KIZ A;  3CUE C;  4KQQ A;  3PBT A;  4BBT A;  2PHY A;  4QWO A;  1WE4 A;  1V9Z A;  2ZC4 B;  4JKT A;  2HJE A;  5BOH A;  3Q7V B;  4X1L A;  4MMN A;  3Q7V A;  3O3V A;  4PMA A;  1ZTU A;  4IBR A;  2W3H A;  3KSI A;  5FAT A;  2WKQ A;  3Q81 A;  1YSP A;  3N8S A;  5FEG A;  4HOI A;  3NDG A;  1S67 L;  5DF9 A;  2XEP A;  4DKI A;  5EPH A;  1DJB A;  3G2Y A;  1Y54 A;  4JPM A;  4OQ0 A;  1P97 A;  5EVI C;  3OZH A;  3IHA A;  4OPR A;  3ZG5 A;  1ZHH B;  4N1X A;  5HSQ A;  1GCE A;  4B93 A;  3HCY A;  5TJJ A;  4WMC D;  3WS1 A;  2W1T B;  1T19 A;  1VB6 A;  1GHM A;  3H9W A;  3G2Z A;  2W1T A;  2RCX A;  1IOU A;  3C30 A;  3ZVW A;  1L3L A;  3IXH A;  3GQZ A;  4IVI A;  1S1Z A;  4L9F A;  4KEN B;  1NYY A;  5CEB A;  4IUH A;  4QJG A;  2PYR A;  4PM7 A;  1YLY A;  2OWH A;  1F5M A;  4MN5 A;  1YLJ A;  2V1B A;  5A91 A;  1TEM A;  3CJM A;  3HLF A;  4CPK A;  1NYM A;  4EET B;  3CMZ A;  3BEB A;  3BW6 A;  2W3D A;  2UV0 E;  2IWD A;  5F69 A;  3K3D A;  3FZC A;  2VZW A;  5DTK A;  2ZC3 B;  3T12 B;  2ZC5 B;  3C8C A;  4OPZ A;  3AGD A;  1H8M A;  4BQM A;  3T4O A;  1OTI A;  3Q7Z A;  4GLQ A;  3M6H A;  3T50 A;  3MQQ A;  1G5U A;  3KYE A;  3PR6 A;  3GV9 A;  3F1O A;  4QY5 A;  2PD8 A;  3ZYT A;  4OH0 A;  4HNB A;  3LR5 A;  2VV6 A;  3VOL A;  3LR4 A;  1AWI A;  3S7P A;  1GA9 A;  5FDH A;  4P85 A;  2JKF A;  2WYX A;  3TSG A;  3QP2 A;  4MBF A;  4JGO A;  1XJ4 A;  1H8Y A;  3LI9 A;  2P74 A;  1YLW A;  2W1R A;  4S2N C;  1ERO A;  2Y2N A;  2GX5 A;  3P98 A;  1MKM A;  4Y0O A;  3T4S A;  2W3G A;  3NC8 A;  5JYO A;  5FAO A;  4UA7 A;  3T4K A;  3ZG0 A;  3N4I A;  4S2O A;  3FG8 A;  3CUE A;  5KSH A;  4I3J A;  2IA2 A;  2QPN A;  3HJK A;  4RQ9 A;  4GDB A;  2A3U A;  2QWS A;  1JWP A;  1MXO A;  1N9L A;  1LSX A;  3QNB A;  1ERM A;  1IEL A;  4G3K A;  4QHC A;  5HFO A;  2X01 A;  2AVX A;  1NJ4 A;  1O07 A;  3LIE A;  3LEQ A;  5HWT A;  3SW1 A;  3LGO A;  5AQA A;  5FDS A;  4EBL A;  5IHV A;  3JVV A;  5K5B A;  4JF5 A;  4NEE D;  4XUZ A;  5E2E A;  4OPY A;  3PBR A;  3JYI A;  4IHQ A;  2ZMV A;  4R70 A;  5EVI B;  5HL6 A;  5CXW A;  5EVI A;  3UE0 A;  2EX8 A;  3EQU A;  2VGK A;  5IS1 A;  3GDI A;  2EWW A;  3BFG A;  2GNX A;  2IWC A;  2Y2H A;  1W5D A;  3UB7 A;  2H28 A;  3D72 A;  4LCM A;  2H0Y A;  3OPR A;  4HQA A;  2ZBB A;  3V3S A;  4RX3 A;  3U2A A;  4EEP A;  1K25 A;  4WBG A;  4YFM A;  3UMD A;  2XD5 A;  2B18 A;  4H6J B;  4WEJ A;  1SZV A;  4Y7P A;  5GLA A;  3ISG A;  4EBN A;  3LY4 A;  4H6J A;  5FQI A;  1K56 A;  4F3L A;  1JVJ A;  2INW A;  4MN6 A;  3VP4 A;  3T1Q B;  1XFQ A;  2X02 A;  2EA9 A;  2LB9 A;  3G34 A;  3ZG7 B;  4DJ2 A;  3DTM A;  3A0R A;  1ZG6 A;  4KQD A;  2QMI A;  2Y2M A;  4E3K A;  1FR6 A;  2ZM0 A;  3Q1F A;  3EEA A;  2ZJ9 A;  5TBM B;  1L0F A;  1YQS A;  1KGE A;  1DY6 A;  2PDR A;  3D4F A;  3HVF A;  1ES5 A;  5EUA A;  5G4Y A;  3LFV A;  4PKY A;  5JYP A;  3IX4 A;  5EEC A;  2J3T D;  4R4R A;  4XT2 B;  1OT9 A;  1F2K A;  5F82 A;  4MBH A;  2M7U A;  5I94 A;  3VP1 A;  4FUW A;  1P0Z A;  5AVF A;  4LEN A;  3MFX A;  2ZM8 A;  1L0G A;  4GB7 A;  3IH8 A;  4CLC E;  3T1X A;  1OTE A;  3QP6 A;  4OPQ A;  3HLG A;  5A93 A;  1A0K A;  3NUL A;  1NY0 A;  2V0W A;  4HEF A;  3H82 B;  1S4R A;  2VGL S;  4Q0J A;  3FPW A;  2Z6C A;  4LGW A;  3NJA A;  1GSW A;  4WM9 A;  1H3Q A;  3UE3 A;  5GLD A;  1XJ2 A;  1GSV A;  5DFX A;  2XQZ A;  2HV1 A;  5CEC A;  5GLC A;  3UDX A;  1KVL A;  3LO7 A;  4BD0 A;  3ITA A;  1P9R A;  2IWB A;  3MBZ A;  3NHQ A;  1S4S A;  4WZ4 A;  2EFX A;  2ZL1 A;  4LFU A;  3TE8 A;  4JXW A;  3R4K A;  4HIA A;  3IF6 B;  1LI9 A;  4DMZ A;  2PR6 A;  2HDU A;  4NXF A;  3GMW A;  4CLC D;  5EE8 A;  5G18 A;  2ZQ9 A;  3ZVT A;  2HF6 A;  1PYY A;  1S6R A;  1OT6 A;  5L8M A;  4WMC A;  1IYS A;  4C3Q A;  3PXP A;  3BJN A;  1M40 A;  3CLO A;  5E2G A;  3VP2 A;  4EER A;  1KE0 A;  1K4F A;  3VP3 A;  2A2L A;  1K6S A;  1N9N A;  4FCF A;  5DJT A;  1N4O A;  3LIA A;  3M2K A;  2RL3 A;  1MY8 A;  3C4O A;  3VMA A;  3N8L A;  3IWI A;  4UQI S;  3OBF A;  4KQO A;  2J9O A;  2GJ3 A;  3QNC A;  3BFC A;  3BLM A;  1V9Y A;  3E4P A;  3M6B A;  1YMS A;  4BL3 A;  1LL8 A;  5HWV A;  2XA7 S;  2D01 A;  2PBD P;  2JBF A;  4YWZ A;  3HRE A;  4KZ6 A;  3VOZ A;  1PWG A;  2V0U A;  5FAQ A;  4P6Z S;  2ZC7 A;  1NRF A;  2Q9N A;  3B42 A;  1IYQ A;  4FTX A;  4ZAM A;  4Q8I A;  3OPP A;  2DCF A;  1RGY A;  4R6L A;  4K08 A;  5E43 A;  3BQ8 A;  4MCW A;  3S22 A;  3G31 A;  1IKG A;  5EM0 A;  2A24 B;  3VFF A;  3KSH A;  2Y91 A;  3MSH A;  4I3I A;  2XFT A;  2A24 A;  5L2F A;  4I38 A;  1GSX A;  3HLE A;  1PIO A;  3C7U A;  4ME4 A;  2EWV A;  4LLO B;  4AFI A;  2PT7 A;  1Q2P A;  4N1H A;  1RP5 A;  1CK3 A;  1WYC A;  1YPR A;  3BRM A;  1ZG4 A;  3IBR A;  2ZQC A;  3F1N B;  2ZOI A;  4BJP A;  1K54 C;  4BMW A;  1PWC A;  5CX7 A;  4PAU A;  3TJZ C;  1IEM A;  3IXB A;  1IYO A;  1IKI A;  3LY3 A;  3HLW A;  1K0K A;  4R1G A;  5F1G A;  4QU3 A;  3B3X A;  1W7F A;  5IU1 A;  4YOF A;  4LV2 A;  4HJ6 A;  1XA1 A;  3UY6 A;  3WRT A;  3SS3 A;  5TGF A;  4XXR A;  3F1P B;  1FIL A;  3L9K A;  1FSY A;  3O86 A;  4X1M A;  3G35 A;  3RFB A;  3CG5 A;  1JTD A;  4X6T A;  3W8K A;  1NZO A;  4HP9 A;  2WAE A;  4GJ4 A;  1EW0 A;  2VV7 A;  1HTZ A;  3Q07 A;  5TR7 A;  1DRM A;  1PNE A;  3JPU A;  3WS0 A;  1FQG A;  4R3J A;  4X69 A;  3I7J A;  3KX0 X;  3LIF A;  1BLC A;  1XJ6 A;  4KZ3 A;  1TD5 A;  3VSK A;  3S1Y A;  1NLZ A;  1DJC A;  1LT0 A;  1T1B A;  1IYP A;  5HDC A;  5HAP A;  3PBN A;  3HBR A;  4WYY A;  3E0Y A;  4EBP A;  1H5X A;  1BLS A;  3T1R A;  2DNS A;  5L07 A;  4LRX C;  2HGV A;  4LPZ A;  5A90 A;  1TS7 A;  3T1S A;  1XPB A;  3S7N A;  2KOI A;  3BFF A;  4E6X A;  3IHB A;  2B95 A;  2V8C A;  1IFQ A;  4X25 A;  5M19 A;  2WKH A;  4ZBE A;  1KOU A;  1TDL A;  1NXY A;  1C3B A;  3IX8 A;  2E8I A;  4P6B A;  1K55 C;  2XLN A;  4R38 A;  3CI6 A;  2C6W B;  4PM6 A;  5FQK A;  2W3F A;  3N7W A;  1YAX A;  2BG1 A;  1SDE A;  4O8G A;  1PI5 A;  4GDN A;  4OP8 A;  1T1A A;  5EVL A;  3UB8 A;  4E6W A;  3IXD A;  1Y28 A;  3FWL A;  3FV7 A;  2V8F A;  1PFL A;  3D3O A;  4HH3 A;  4IUK A;  3LR3 A;  1VM1 A;  1K54 A;  1LL9 A;  4WEL A;  5M1A A;  2KLI A;  3DTK A;  3IS2 B;  5EOO A;  5M18 A;  3CPT B;  5AJG A;  2J80 A;  3IS2 A;  4NG2 A;  3CPT A;  3R7W B;  1UWP X;  1EWZ A;  2CC1 A;  3R7W A;  5AQ9 A;  4MDZ A;  3T4Q A;  1I5Q A;  1KVM A;  3NOT C;  4JLF A;  5FQQ A;  4CLC B;  3Q82 A;  1S66 L;  2O9C A;  1ONH A;  1XA7 A;  1Z6F A;  4CLC A;  1X0O A;  3CWF A;  2Y2P A;  1MC0 A;  3TRC A;  1JNU A;  2W0N A;  2WKE A;  5FI2 A;  1CF0 A;  3UB5 P;  3HJI A;  4JF6 A;  2XGN A;  3IXG A;  3EQV A;  3M2J A;  2WKI A;  2OLU A;  1CI8 A;  3KO6 A;  1K4E A;  4NXE A;  4MN7 A;  2VK3 A;  3OCL A;  5A8B A;  1ESI A;  5DTS A;  2HDQ A;  3VFH A;  1CEF A;  3E4O A;  1VQQ A;  4C6Y A;  3IF6 C;  1G6O A;  4HBT A;  1W8Q A;  3LID A;  4E3J A;  1CI9 A;  1HZO A;  2J7V A;  4OLD A;  3MZF A;  3BQA A;  3LCE A;  5HAQ A;  3IX3 A;  3A3F A;  2L0W A;  4E3I A;  2XDM A;  5CGX A;  1VEU B;  3DAV A;  3LIB A;  3QP4 A;  4I39 A;  4IJG A;  1KGG A;  5HPF A;  4BD1 A;  2Q0O A;  1T1C A;  5AQB A;  3W4O A;  2P9V B;  2D02 A;  1NRJ A;  3PAG A;  4EQI A;  5DF7 A;  3UME A;  2WZZ A;  4KZA A;  4O7D A;  5C5K A;  4CQH A;  3MMH A;  4GS9 B;  2BAS A;  3E2L A;  1G6A A;  1RGZ A;  4N92 A;  4JXV A;  4GS9 A;  3K3C A;  2VA0 A;  3RH8 B;  2FFF B;  2VGL M;  3KSF A;  4ESP A;  4IED A;  4HHD A;  5D3O A;  4EQ1 A;  3B47 A;  1PW1 A;  1LL5 A;  2ZMA A;  3FKW A;  1J9M A;  2R78 A;  5F83 A;  3IQA A;  1K55 A;  4ARZ B;  1YMX A;  4NXB A;  1SDN A;  5FQJ A;  1W79 A;  1YLT A;  1S0W A;  4R4S A;  4GD8 A;  5FL3 A;  5MC7 A;  2EX9 A;  3C2W A;  2Y2J A;  3PYP A;  3PBS A;  4R3A A;  5TBM A;  4FOF A;  1AXB A;  2OWJ A;  1PZP A;  4EWF A;  1ACF A;  4XT2 A;  4E3M A;  5HD5 A;  2HP9 A;  4PM9 A;  4FSF A;  2WK0 A;  2M1C A;  2ZQ7 A;  4I5S A;  3BFD A;  1DP9 A;  4BLM A;  3V39 A;  3CIT A;  2VLG A;  1FIK A;  1E25 A;  3O88 A;  4XUX A;  3RXX A;  2O0Y A;  3SOI A;  2FZ0 A;  2M7V A;  1CQA A;  5TFQ A;  3H82 A;  3HLB A;  3ZNY A;  1LHY A;  1XXM A;  4DDS A;  3MXR A;  3PHY A;  2VJW A;  3BY9 A;  4R23 A;  4EV4 A;  4NXG A;  5GLB A;  4UQI M;  2HJ9 C;  4II7 A;  4NKP A;  4JBF A;  3C5A A;  3GEC A;  1K38 A;  4Y15 A;  3NOU C;  3MR0 A;  1BSG A;  4BBV A;  4FD8 A;  3PBO A;  1NWZ A;  5IT5 A;  1ODV A;  4E04 A;  3IF6 A;  4YNR A;  1XX2 A;  1GA0 A;  5GHX A;  3UB6 A;  4P6Z M;  3UPO A;  3UDI A;  5FEF A;  4LV3 A;  4Q0H A;  5G4Z A;  5DKK A;  5EFW A;  1JWZ A;  5EVE A;  4EU0 A;  3D9Y A;  1BZA A;  3RJU A;  3WS2 A;  3CHW P;  1MBL A;  3OC2 A;  1YT4 A;  4Y17 A;  5F6A A;  2ACG A;  3NIA A;  1OJG A;  4E3N A;  3EWK A;  5FI6 A;  3NOP C;  1CEG A;  2PRF A;  3ZHH A;  3T4L A;  5J4E A;  2EXA A;  3P09 A;  3G32 A;  3BEC A;  5J3W A;  1JTG A;  2Z6D A;  2B5R A;  3ZNT A;  1XGJ A;  1OME A;  3C4P A;  3VV4 A;  4PPR A;  3E98 A;  2MJ6 A;  2H0T A;  4HJ3 A;  4X55 A;  2CMN A;  4PHT A; 
#chains in the Genus database with same CATH homology
 4ETX A;  2GX5 A;  4GJ4 A;  3S7O A;  3A0V A;  1MKM A;  3T4S A;  3ZQ5 A;  1EW0 A;  4L0L A;  2W3G A;  2VV7 A;  2VKS A;  3BWL A;  3T4K A;  1DRM A;  3FG8 A;  3CUE A;  5KSH A;  4I3J A;  4WF0 A;  2IA2 A;  2J3T C;  1LSW A;  4KUO A;  5J7E A;  3HJK A;  4RQ9 A;  3KX0 X;  3LIF A;  4ZRR A;  2QWS A;  1XJ6 A;  3H7W B;  1TD5 A;  1N9L A;  1LSX A;  1NLZ A;  1LT0 A;  1T1B A;  5HDC A;  3H7W A;  4G3K A;  3UE6 A;  4L9G A;  3CAX A;  3PBN A;  4OOL A;  1TS6 A;  2K2N A;  4HP4 A;  3LIE A;  3E0Y A;  5HWT A;  3SW1 A;  3JVV A;  4GW9 A;  5K5B A;  4NEE D;  4LRX C;  2HGV A;  4LPZ A;  1TS7 A;  3PBR A;  2Y8H A;  4G3V A;  3S7N A;  2KOI A;  2JKR I;  4IHQ A;  2XA7 M;  2ZMV A;  4R70 A;  5HL6 A;  2XRO A;  1UGU A;  3G6O A;  4EUV A;  2JHE A;  4BWI A;  1IFQ A;  3A0S A;  3EQU A;  5IS1 A;  3GDI A;  2EWW A;  4EW7 A;  5HWW A;  4B9O A;  3EGD C;  4EES A;  1OTB A;  2GNX A;  1KOU A;  3F1N A;  2WKP A;  3MQO A;  3UB7 A;  4GHI B;  5HD3 A;  5LBR A;  3CI6 A;  2H28 A;  4R38 A;  3D72 A;  3PBQ A;  4HQA A;  2ZBB A;  4HJ4 A;  3EOI A;  2W3F A;  3ICY A;  5F5Y A;  3U2A A;  2V9A A;  4EEP A;  2W3E A;  1YAX A;  3EEH A;  4JGQ A;  4LRZ E;  4O8G A;  3UMD A;  1YSQ A;  2B18 A;  1T1A A;  4H6J B;  3UB8 A;  4WEJ A;  1S1Y A;  1Y28 A;  4H6J A;  4Y5F A;  5F68 A;  5HDS A;  2QJ5 A;  4GCZ A;  4ETZ A;  2OAQ 1;  4CLC C;  3D3O A;  4HH3 A;  4IUK A;  3LR3 A;  2INW A;  4MN6 A;  4F3L A;  1XFQ A;  1MZU A;  2WKR A;  4WEL A;  3T4T A;  2KLI A;  3F1P A;  1T18 A;  2EA9 A;  3IS2 B;  5AJG A;  2LB9 A;  2J80 A;  4DJ2 A;  3IS2 A;  3R7W B;  1UWP X;  3A0R A;  4KQD A;  4WEK A;  3VE3 A;  3MJQ A;  3R7W A;  3EEA A;  1YKD A;  5TBM B;  4MDZ A;  4DN0 A;  3T4Q A;  2P08 A;  2PDR A;  5G4Y A;  3NOT C;  4Q0I A;  3LFV A;  4PKY A;  1TF1 A;  4CLC B;  1S66 L;  2J3T D;  2O9B A;  2O9C A;  1TS8 A;  4XT2 B;  1OT9 A;  4WN5 A;  3B33 A;  1X0O A;  3CWF A;  3T4J A;  3S7Q A;  2YKF A;  4CLC A;  2M7U A;  1MC0 A;  2L4R A;  1JNU A;  2O9A A;  3TRC A;  2W0N A;  2Y79 A;  1WA9 A;  2YKH A;  2G7U A;  3HJI A;  1P0Z A;  2ZMF A;  3LYX A;  5AVF A;  4KUK A;  3MFX A;  4CLC E;  3EQV A;  1OTE A;  1F9I A;  4M4X A;  3KO6 A;  4NXE A;  4WUJ A;  4MN7 A;  3ULF A;  2ZOH A;  3OCL A;  5A8B A;  1OPX A;  3P7N A;  1STZ A;  3E4O A;  3MXQ A;  2V0W A;  1G6O A;  2DMW A;  3LID A;  3OLO A;  4Y3I A;  3H82 B;  1G28 A;  1S4R A;  2VGL S;  4Q0J A;  3FPW A;  3BQA A;  2Z6C A;  3NJA A;  1GSW A;  5DFY A;  1H3Q A;  2QJ7 A;  3TW8 A;  3UE3 A;  1F98 A;  1P9W A;  5AVE A;  4Z1W A;  1XJ2 A;  1OTA A;  3OCN A;  1GSV A;  2P7J A;  2GZA A;  5DFX A;  4DJ3 A;  2L0W A;  1OJ5 A;  2HV1 A;  2XSS A;  5I5L A;  3FPV A;  3LIB A;  1D06 A;  1P9R A;  4OOM A;  2QKP A;  3NHQ A;  1S4S A;  4I39 A;  3K2N A;  3TE8 A;  3EGX C;  3BY8 A;  4IJG A;  1W63 Q;  2OOL A;  3R4K A;  4HIA A;  4O0P A;  4EEU A;  5HPF A;  4UEY A;  1LSV A;  1T1C A;  2OAP 1;  4GHI A;  2D02 A;  4DMZ A;  1NRJ A;  3C38 A;  2KX6 A;  2PR6 A;  3UME A;  1XFN A;  2W27 A;  5C5K A;  4NXF A;  1D7E A;  4CQH A;  3MMH A;  3FC7 A;  4CLC D;  4GS9 B;  2K7S A;  2BAS A;  2B02 A;  4JGP A;  2O99 A;  3O5Y A;  1DP8 A;  2HF6 A;  2PR5 A;  2XRN A;  3LR0 A;  1OT6 A;  4GS9 A;  5L8M A;  3K3C A;  2VA0 A;  3LUQ A;  3RH8 B;  2VGL M;  3KSF A;  4QPR A;  3PXP A;  2V1A A;  3BJN A;  4HHD A;  3CLO A;  3E4Q A;  1TS0 A;  4L9E A;  4EQ1 A;  4EER A;  3B47 A;  4HY8 A;  2A2L A;  1N9N A;  2QHK A;  4WL9 A;  4G3W A;  5DJT A;  2JN7 A;  2R78 A;  4Y2F A;  4ARZ B;  4HH2 A;  3KSG A;  5HZH A;  3F1O B;  4NXB A;  3OOV A;  3LIA A;  5HPI A;  4LRY C;  3IBJ A;  5FL3 A;  5KIZ A;  3CUE C;  5MC7 A;  3PBT A;  2JKT M;  3C2W A;  4BBT A;  2PHY A;  4O01 A;  3PYP A;  4UQI S;  3OBF A;  4KQO A;  3PBS A;  1V9Z A;  4R3A A;  5TBM A;  2L1M A;  2GJ3 A;  4FOF A;  2HJE A;  1V9Y A;  3E4P A;  2FH5 A;  2QYB A;  4EXO A;  4MMN A;  2OWJ A;  1LL8 A;  1ZTU A;  5HWV A;  4BBU A;  2W3H A;  3KSI A;  2D01 A;  2PD7 A;  2XA7 S;  2WKQ A;  1YSP A;  4XT2 A;  5DJU A;  4YWZ A;  4HOI A;  1S67 L;  2VEA A;  5DF9 A;  5HD5 A;  4FSF A;  2V0U A;  2M1C A;  4I5S A;  1DP9 A;  4P6Z S;  3CIT A;  2VLG A;  1UWN X;  4I3A A;  3B42 A;  1P97 A;  2O0Y A;  1ZHH B;  5DKL A;  5HSQ A;  2FZ0 A;  2M7V A;  4B93 A;  4R6L A;  4K08 A;  3BQ8 A;  3HCY A;  4MCW A;  3H82 A;  4HI4 A;  5TJJ A;  2A24 B;  1XJ3 A;  3KSH A;  2P04 A;  2W1T B;  1T19 A;  3PHY A;  4JGR A;  1VB6 A;  2VJW A;  4I3I A;  3H9W A;  2A24 A;  3BY9 A;  3KYQ A;  2W1T A;  4NXG A;  1IOU A;  4I38 A;  3C30 A;  1GSX A;  4UQI M;  2HJ9 C;  4II7 A;  4ME4 A;  2EWV A;  4NKP A;  3MQ0 A;  4LLO B;  2J3W A;  4AFI A;  2PT7 A;  3GEC A;  3NOU C;  3MR0 A;  4BBV A;  1S1Z A;  2VV8 A;  3PBO A;  1NWZ A;  4L9F A;  1N9O A;  2JKR M;  3KYZ A;  4IUH A;  2PYR A;  5IT5 A;  1ODV A;  4E04 A;  1VHM A;  3VE4 A;  2OWH A;  1F5M A;  4YNR A;  2I9V A;  3IBR A;  4MN5 A;  2V1B A;  3F1N B;  1DP6 A;  4P6Z M;  1NLY A;  3UB6 A;  2ZOI A;  4BJP A;  2NUT C;  4BMW A;  4EET B;  1BYW A;  3MF0 A;  5HDD A;  4Q0H A;  5G4Z A;  5CX7 A;  3DBA A;  4PAU A;  5DKK A;  3TJZ C;  3BW6 A;  2W3D A;  5EFW A;  2LB5 A;  5F69 A;  3K3D A;  4EU0 A;  2VZW A;  3LIC A;  2VX8 A;  3JVU A;  3C8C A;  3OC2 A;  2KDK A;  5F6A A;  1H8M A;  2NUP C;  4PKY G;  5IU1 A;  3RTY A;  1W63 M;  4YOF A;  3T4O A;  1OTI A;  1OJG A;  4HJ6 A;  3EWK A;  4GLQ A;  3T50 A;  3MQQ A;  3NOP C;  4F3L B;  3UB9 A;  3T4L A;  4ARZ A;  3V67 A;  5J4E A;  3PR6 A;  2JKT I;  3F1O A;  2PD8 A;  3ZYT A;  5J3W A;  3F1P B;  4HNB A;  2Z6D A;  3LR5 A;  2VV6 A;  3VOL A;  2K31 A;  3LR4 A;  3P01 A;  3RFB A;  3S7P A;  3VV4 A;  1OTD A;  3W2Z A;  3E98 A;  2MJ6 A;  4HJ3 A;  4JGO A;  1XJ4 A;  2CMN A;  3LI8 A;  3LI9 A;  4PHT A;  4WLA A;  2PYP A;  4HP9 A;  2W1R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...