4L9EA

Structure of ppsr q-pas1 from rb. sphaeroides
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
115
structure length
115
Chain Sequence
TQREMETRYRVVLDVSRDPMVLVSMSTGRIVDLNSAAGLLLGGVRQDLLGAAIAQEFEGRRRGEFMETMTNLAATESAAPVEVLARRSQKRLLVVPRVFRAAGERLLLCQIDPAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcriptional regulator, PpsR
publication title Multi-PAS domain-mediated protein oligomerization of PpsR from Rhodobacter sphaeroides.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Transcription
total genus 39
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2013-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13188 PAS_8 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4l9eA00
1OTDA 4YWZA 1OT9A 4WN5A 3GDIA 3HJKA 4I3IA 3E4PA 2PR6A 2B02A 4HI4A 2QWSA 5IS1A 5G4YA 1XFQA 4WL9A 3EEHA 1G28A 2OWHA 4HY8A 2KX6A 4GS9B 5EFWA 1T18A 4R6LA 3CLOA 3C8CA 1D06A 3NJAA 4HH2A 4R38A 3HJIA 4PKYG 2Z6CA 1N9OA 2INWA 3KX0X 2VV6A 2D02A 1S4SA 4K08A 4GHIB 3K3CA 1EW0A 1N9LA 2L4RA 3MQOA 1DP9A 4HJ3A 2HV1A 2R78A 1F9IA 4L9FA 3K3DA 3MR0A 1P0ZA 5HWWA 4RQ9A 1LT0A 4NXEA 4HOIA 4JGRA 4HNBA 3MXQA 1V9YA 2V0UA 2W0NA 3G6OA 3H7WB 4PKYA 1DRMA 1OTAA 1KOUA 3NOUC 5A8BA 3H82B 3ULFA 1T19A 3MJQA 1VB6A 1DP8A 4KQDA 3LIAA 2VV7A 3LI9A 2GJ3A 4JGOA 4I3AA 4HHDA 2WKQA 1OTBA 3IS2B 4GS9A 5F69A 2V1AA 5HD3A 2A24B 3LIDA 2QJ7A 3A0SA 4LRZE 4DJ2A 2PDRA 3H9WA 3T50A 5HSQA 1TS8A 4GHIA 1Y28A 1XJ4A 3E4OA 3FC7A 4I39A 1TS7A 2ZBBA 4WLAA 3LUQA 1XJ2A 3LIBA 2W27A 1V9ZA 2WKRA 3GECA 3F1NB 4KUOA 4WUJA 4HQAA 5DJUA 1GSWA 2L0WA 2Z6DA 4EESA 4EEPA 4M4XA 3MQQA 3H7WA 2PR5A 4GCZA 5AVEA 4I38A 3IBRA 5KIZA 3H82A 1BYWA 3VE4A 4L9GA 1GSXA 3OLOA 4R3AA 5F68A 1XJ3A 4EW7A 3A0VA 5HZHA 3IS2A 5G4ZA 3P7NA 1OJ5A 5HWVA 2P7JA 5HDCA 5J3WA 2A24A 1LSXA 4BBTA 3PYPA 3F1PB 5I5LA 5HWTA 1N9NA 3NHQA 1LSWA 4NXGA 4BBUA 1XJ6A 2EA9A 2VV8A 1TS0A 4F3LB 5F5YA 2V1BA 1T1BA 1MZUA 2V9AA 4LRYC 3ICYA 4LRXC 2YKFA 4KUKA 3LIEA 5J4EA 5F6AA 3UB7A 3A0RA 1ODVA 2V0WA 3B33A 4E04A 1TS6A 1UGUA 4EXOA 2PHYA 3F1NA 2CMNA 4GW9A 2OWJA 1OTEA 3ZQ5A 4HP4A 4I5SA 4XT2B 1D7EA 5J7EA 1S4RA 2PD7A 5IU1A 2YKHA 4MN6A 3VE3A 3RH8B 5TBMB 3EWKA 1OT6A 3UMDA 1LL8A 5HD5A 3NOPC 3F1OB 2QJ5A 4HP9A 1UWNX 4HJ6A 4EQ1A 1JNUA 1OTIA 3C2WA 3NOTC 2PD8A 4EERA 4HJ4A 3LICA 3LI8A 1GSVA 4R70A 4H6JB 2JN7A 1OJGA 2OOLA 1S1ZA 3FG8A 3LIFA 4DJ3A 1S66L 3RTYA 3UE6A 2WKPA 3F1PA 1S67L 5DJTA 5HDSA 2K7SA 2QKPA 4HH3A 4NXFA 4F3LA 5AVFA 1X0OA 4LLOB 3UB6A 1XFNA 3BWLA 1NWZA 4I3JA 4B9OA 2I9VA 4JGQA 2VEAA 3UMEA 4EETB 4BBVA 1S1YA 1WA9A 4L9EA 2H28A 1LSVA 2KDKA 3UB8A 4NXBA 1UWPX 5HDDA 4XT2A 2L1MA 1T1AA 4MN5A 3VOLA 1F98A 1T1CA 3PHYA 3LYXA 2JHEA 2ZOHA 5DKKA 4EEUA 3SW1A 2D01A 3D72A 3MFXA 5TBMA 3BY8A 1P97A 2BASA 2M1CA 3F1OA 4HIAA 2PYPA 5DKLA 3BY9A 2J80A 2PYRA 4H6JA 2ZOIA 3E4QA 4WF0A 4JGPA 3CAXA 3CWFA 1DP6A 2QHKA 2VLGA 4LPZA 3UB9A
chains in the Genus database with same CATH superfamily
4EUVA 2VKSA 1OTDA 3R7WB 4ZRRA 4DRTA 4IUKA 1K57C 4OLDA 1OT9A 4R0QA 3HJKA 3PTEA 4BQMA 1ESUA 5CECA 4X1MA 4OVDA 1YT4A 3GR2A 4HI4A 5IS1A 5G4YA 1XFQA 2ZMAA 3IX8A 3C30A 1C3BA 3CLOA 3D3OA 3C8CA 1D06A 3NJAA 4R38A 3V3SA 3B3XA 3ZG0A 2INWA 3RXWA 2VV6A 3PBQA 4S2OA 5E43A 4K08A 4KENB 2OV5A 3D9YA 4GHIB 5CTMA 2BTFP 3I7JA 3HLEA 2GDNA 1MKMA 5FAPA 2XFTA 4K0WA 5AQBA 3GVBA 3BRMA 5HW3A 3Q7VA 3MR0A 1ES4A 1RGZA 3PBTA 3OOVA 2EX2A 1BT5A 4BJPA 4LV3A 3S7QA 3HLWA 4RQ9A 3DW0A 4P85A 4KG6A 3M2KA 4UQIM 3MXQA 2C5WB 5EM0A 2P04A 3NY4A 1V9YA 4MBKA 1PW8A 4OOMA 3HLFA 1PRQA 4GOGA 2OAQ1 2XFSA 1K6SA 1BLHA 2WADA 1L0GA 1K56D 1KOUA 2UWXA 1IKGA 3H82B 3ULFA 3S1YA 3NULA 5L10A 4CLCB 1AXBA 2Y2NA 1DP8A 2HDUA 2Y2PA 5TR7A 4KQDA 3SOIA 1KE0A 5D3OA 2K2NA 1BUEA 3CPTA 5DFXA 3WS2A 1ACFA 3LI9A 4JGOA 3KSFA 1HLUP 4HHDA 3N8SA 3IS2B 3VFHA 5FI2A 2Y2MA 3G30A 2Y2KA 5F69A 3QP4A 4N9KA 3B47A 1JTGA 2EX8A 1CEFA 3VFFA 5HD3A 2JCHA 4XUXA 4UHUA 3UE3A 2WGWA 3E4OA 5DF7A 4I39A 4LCLA 4WEJA 1EWZA 4EBLA 5E2HA 1U60A 4IBXA 1K25A 4PAUA 5KSHA 3LGOA 5L07A 2VZWA 3LR0A 3MSHA 3G2YA 3Q81A 5FQIA 4KZ7A 1PW1A 1GSWA 1BZAA 1FQGA 1K57A 3HLBA 3R4KA 3WRTA 2KLIA 4EEPA 1PI5A 1PFLA 3ISGA 3W2ZA 3S4XA 3QNCA 1YSQA 3H7WA 1K55A 1ZTUA 5AVEA 4QY5A 3KYQA 3A3FA 1PIOA 4RVAA 3OLOA 4DXBA 3VV4A 1IYQA 4EW7A 2P9VB 4OPZA 4FSFA 2NUTC 3C4OA 3CJMA 3IXHA 1OJ5A 2P7JA 5A92A 1NRFA 5J3WA 2ACGA 2FZ0A 4BBTA 1IFQA 2PT7A 4OPQA 5I5LA 1PZPA 4WZ5A 4WBGA 3KSIA 2WZXA 2GZAA 4NXGA 1YLZA 3T4QA 1MWRA 2C6WB 2EA9A 1TS0A 4MEZA 5FQKA 4DF6A 4FH2A 2X02A 4LRYC 4UA7A 4KUKA 4NG2A 3PBNA 4WMCD 1GCEA 1ODVA 4PPRA 3HREA 3B33A 3WS4A 4R3BA 3LR3A 5F1FA 5C5KA 1RCJA 1ZC2A 2HJ9C 2OWJA 2EFUA 4E3IA 1YLJA 1KVMA 1XXMA 5BOHA 5L09A 2X71A 3NDGA 5IHVA 1MWUA 2Y2IA 2YKHA 1YLWA 3VE3A 4LENA 2HF6A 5FQMA 2H10A 5TBMB 1OT6A 1ESIA 4RA7A 4RX2A 1LL8A 4JKTA 3OPRA 3NOPC 5E2GA 3F1OB 3BLSA 5F83A 4HJ6A 4JPMA 4R23A 2A3UA 3RJUA 1OTIA 3NOTC 4Q0IA 4ID4A 2JN7A 1OJGA 3IXGA 2OOLA 3K2NA 4AFIA 4GDBA 1S66L 3RTYA 3BLMA 2O9AA 3F1PA 3M6HA 1ERMA 5DJTA 2Y55A 3P01A 4R1GA 2JE5A 2PBYA 2ZL1A 3IX4A 4Y3IA 4LV0A 2V1ZA 3BJNA 5LBRA 1Y4OA 4LLOB 2VX8A 3N8LA 3BFFA 1JVJA 4G3WA 2ZC3B 4O8GA 1NWZA 1PNEA 2WAFA 3DTIA 2I9VA 4L0LA 4MMNA 4CLCE 4Y2FA 5CHJA 1H8ZA 2GNXA 1VETA 1GA0A 3T4TA 1S1YA 3T4SA 4GKUA 5EOOA 5FQ9A 4LV1A 2KDKA 1XGJA 2ZQCA 4JF5A 3N8RA 3TE8A 4NXBA 5GLCA 5EE8A 2HJEA 3DTEA 2OLUA 5AQAA 3TW8A 4U0XA 4EEUA 4DE2A 4E3KA 3MS6A 3BY8A 3PBRA 1SCWA 4JF4A 2HGVA 3NI9A 4OPRA 4HIAA 3CHWP 4RX3A 3MKEA 4JXSA 3UB5P 2XRNA 2XF3A 4H6JA 3IWQA 3VOZA 4NKPA 4Y0OA 4BLMA 5CTNA 3UE1A 3JPUA 1L2SA 3CAXA 3EGXC 2FFYA 2EFXA 4GB7A 1HD8A 1LI0A 3WWXA 3UB9A 3UY6A 4E3MA 4D60A 3L7HA 2HDSA 4YWZA 2NUPC 4WN5A 4I3IA 3N7WA 4DDYA 2I72A 3KYZA 2JKGA 4JLFA 3C5AA 4Y0TA 2ZMVA 4PM7A 2OWHA 5EFWA 2KX6A 3SH8A 2W1TB 5E2FA 3E0YA 4CLCC 1T18A 4MCWA 3HJIA 3MXRA 2Z6CA 3VMAA 3DAVA 1N9OA 4P0MA 3CZDA 1ALQA 4ZJ2A 3NC8A 1XP4A 1MKIA 3OPPA 3K3CA 4KG5A 4X6TA 3UDIA 2XDMA 3FYZA 2ZQAA 1ES2A 2H0TA 4K91A 3MQOA 2UV0E 4WZ4A 2EWWA 4M3KA 1DP9A 5EVIB 2V8FA 1F9IA 5IT5A 5DFYA 4NK3A 4E6WA 1XPBA 5F1GA 4PM5A 4E6XA 4NXEA 4JGRA 4R4SA 4HNBA 5CHUA 5GHXA 2J3WA 3ZVTA 2HP9A 1ES3A 2W0NA 4S2IA 4MLLA 3PBOA 2AVXA 1EI5A 2XGNA 4PKYA 5FI6A 1DRMA 4C75A 1OTAA 3CMZA 3SS4A 4DXCA 2HP5A 3EGDC 3NOUC 3FPWA 3R7WA 1WE4A 3LR4A 3MJQA 1KDSA 1VB6A 1KE4A 5HL1A 4QHCA 2Y2JA 1LL9A 1K6RA 2WZZA 2VV7A 3KYEA 3A3JA 4I3AA 5FQQA 1SDNA 4OOLA 3EEAA 5EV0A 4ZJ3A 1YLTA 1E3UA 4Q8IA 2V1AA 1YAXA 1K4FA 2P08A 4DE0A 4DJ2A 5FSRA 3LR5A 4S2KA 3T50A 3T4JA 4MN7A 1TS8A 4GHIA 3W4QA 2PBDP 2RCXA 4WYYA 4IUHA 3LY4A 2O99A 1H0MA 2ZBBA 3FKVA 1K55C 2W3EA 5HPFA 3LUQA 1XJ2A 1JWZA 4QPRA 3UPPA 1VM1A 3ITAA 2LB9A 3IX3A 3MF0A 1V9ZA 3F1NB 2J7VA 5AQ7A 2XROA 2L0WA 4OOYA 3IHBA 4DDSA 3VP0A 3ZG8B 1VQQA 2H5SA 2Y4AA 4N92A 4B4ZA 2K31A 3AGFA 3IF6B 1ZG4A 4CQHA 2VA0A 1L3LA 3H82A 4WZ5C 1BYWA 4CLCA 3BQ8A 3VE4A 3SH7A 1KGGA 3OC2A 3BFGA 1FILA 4GDNA 5M18A 5F68A 4MDZA 1HZOA 3A0VA 3ZG5A 1VHMA 4GD8A 1RP5A 3IS2A 3P7NA 2ZC7A 5JYOA 4N1HA 1H5XA 2IWBA 4KZ5A 3UE0A 1KE3A 4OQIA 4EBNA 5CHMA 1FCNA 2HP6A 4ZDXA 2XA7M 2Q9NA 4BENA 3D4FA 4G3KA 3HLGA 1XJ6A 3A3IA 3TG9A 5F5YA 4KZ6A 3O3VA 3VSKA 2V1BA 5I94A 3ICYA 1ZHHB 1F5MA 3LIEA 1SZVA 3A0RA 5HFOA 4KZAA 3T1SA 1CJFA 3KO6A 1TS6A 3QHYA 3DWKA 1W5DA 2PU2A 1OTEA 1FR6A 1KVLA 4HP4A 2H0YA 3TJZC 5CGSA 1P9RA 3ZNYA 4Y5FA 4N1XA 1CQAA 3E2LA 3GTCA 4HEFA 1MWSA 1BULA 1K4EA 5HD5A 1NLZA 3IQAA 3BQAA 4HP9A 1UWNX 4ME4A 2WGIA 2P9VA 4JXGA 2XLNA 4EERA 2B18A 4KZ3A 3ZCZA 3LI8A 1GSVA 5EECA 5L8MA 1S1ZA 3FG8A 2IA2A 4UQIS 3U4LP 3G2ZA 5FA7A 5FEGA 1S67L 1CK3A 1Q2QA 4X69A 3S22A 4FH4A 3IF5A 4NXFA 3UO9A 2Y2LA 5AVFA 1X0OA 1FCMA 4OP8A 5TJJA 4IEDA 1WYBA 2EX9A 2XK1A 3V39A 1TEMA 2XSSA 3V67A 1MC0A 3WS0A 4FD8A 3O86A 2HDRA 4ZBEA 1LSVA 1W63M 4EUZA 3BFCA 4MN5A 1F98A 1T1CA 4IBRA 2R9XA 4Y15A 2JHEA 2ZOHA 4Z1WA 2PRFA 3SS3A 2JKTI 3SW1A 1K54C 1VEUB 5TBMA 4O7DA 1M6KA 4A5RA 2KOIA 4YINA 3F1OA 4GN2A 4EWFA 2GX5A 5HAIA 1SKOB 1GA9A 4H8RA 5DKLA 1QMEA 2DMWA 2VGKA 5DVAA 4Z9QA 5MC7A 2VGLM 2Y2HA 3VP3A 2V8CA 2O9BA 4E3JA 4E3NA 2JKFA 5HAPA 3MZEA 4LCMA 3NCKA 5FQJA 5A90A 4OQHA 3E4QA 3A3DA 2ZQ8A 4S2PA 4JGPA 5M1AA 3NECA 1ES5A 4NETA 3FWLA 2JKRI 4X68A 4LFUA 3S7NA 1W63Q 4X56A 1JTDA 2WYXA 1IKIA 2PR6A 1CI8A 1CF0A 2G2WA 5J8XA 5K5BA 2ZJ9A 3EEHA 1G28A 1GHIA 3NIAA 4GS9B 3HLCA 1BLPA 1G6OA 2WK0A 3KX0X 1NXYA 2XQZA 4PMAA 4DE3A 1S4SA 4OLGA 4ZAMA 1OPXA 1OMEA 3IWOA 1EW0A 1N9LA 4E3LA 1MY8A 4JXWA 3FPVA 4JXVA 2FFFB 5A91A 1SHVA 4HJ3A 4S2NC 1NJ4A 3OPLA 4FCFA 4Y13A 3HBRA 4BD0A 3K3DA 3PAEA 4ZJ1A 1P0ZA 1E4DA 2G7UA 4O01A 5HWWA 1P9WA 5KSCA 1LT0A 4U0TA 4U3TA 3DTMA 2EX6A 1KGFA 3MZDA 4WMCA 3T1QB 5HAQA 4BL2A 4OONA 3G6OA 5DF8A 4WEKA 4PHTA 2ZC4B 3HUNA 3LEZA 3PR6A 5A8BA 3IBJA 1T19A 3BECA 1TD5A 4R3JA 3VP2A 4K0XA 2RL3A 2ZD8A 2LB5A 3WRZA 5TGFA 1PWCA 1PWDA 2W3FA 3IF6C 3LIAA 5CX7A 2M7VA 3Q07A 3G35A 3P98A 5E2EA 3LCEA 3QP6A 3GRJA 2W1TA 5AQ9A 5L2FA 3Q1FA 4PM9A 2JKTM 1IELA 2A24B 2ZMFA 1K54A 2QJ7A 3A0SA 3LIDA 5FEFA 3G4PA 3LY3A 2DNSA 3H9WA 5HSQA 1Y28A 1XJ4A 1FCOA 3FC7A 3QP2A 4Q0HA 1NYYA 2E8IA 1MBLA 5EPHA 3IXDA 5EVIA 1E3UD 1CEGA 3EOIA 3Q7ZA 3FV7A 3TOIA 3W8KA 2XH9A 2ZM8A 3NBLA 2Z2MB 4QJGA 2WKRA 3GECA 3IHAA 4WUJA 2P74A 1SKFA 4HQAA 4P6ZM 3MQ0A 3KSGA 4CJNA 3KSHA 5DTTA 4M4XA 3MQQA 1I2SA 3M2JA 1L0FA 1WYCA 2G2UA 2WKEA 2PR5A 4DMZA 3IBRA 3SZTA 3ZG9B 2Y91A 4ARZB 3W4OA 1NYMA 3QP8A 3P09A 5FASA 3HUOA 1ONHA 2Y8HA 4OPYA 2J9PA 2JC7A 3BFDA 5HZHA 2J3TC 5G4ZA 4KQRA 5HWVA 2V2FF 3T4LA 1LSXA 2BLSA 3PYPA 4B88A 1L0EA 4G3VA 4S2NA 3E2KA 4CLCD 1LI9A 3UN7A 5HWTA 2MJ6A 1O7EA 4B4XA 4S2MA 3NHQA 5TFQA 4FOFA 1LSWA 3IXBA 3Q82A 4BBUA 1Z09A 4F3LB 5A93A 1MXOA 3BW6A 1DJAA 4IHQA 3IH9A 3T4OA 1T1BA 1MZUA 2V9AA 2M7UA 3V50A 2YKFA 5J4EA 5DTKA 3UB7A 3ZG7B 4UEYA 5HX9A 3QP1A 4D2OA 2V0WA 4R4RA 3PBSA 4E04A 4EXOA 3U2AA 3F1NA 5G18A 1BTLA 1E25A 4BD1A 4XT2B 2QYBA 3O5YA 4BWIA 5CGWA 1O07A 1S4RA 3IF6A 4E3OA 2J3TD 2HDQA 1ZKJA 3V5MA 4GD6A 2DCFA 5FDSA 2A49A 1DJCA 2QJ5A 2Y59A 3VOYA 1YMSA 1JNUA 4FUWA 3C38A 2PD8A 3JVVA 3C7VA 4QU3A 4JF6A 3ZDJA 4BL3A 4DJ3A 4WELA 3UE6A 5EVEA 1GHMA 4DE1A 5FAOA 5HDSA 2QKPA 4KQOA 4MBHA 4HH3A 4MNRA 3UNWA 4EU0A 4P6BA 1IYOA 4Q0JA 1XFNA 4XXRA 3BWLA 5EUAA 3W4PA 4I3JA 3T4KA 1AWIA 4KZ4A 1IEMA 2W3HA 1DJBA 4Y17A 4IVIA 4EETB 4BBVA 3T1XA 2IWCA 1YMXA 2H28A 4B93A 4KQQA 3DBAA 1H8YA 3UB8A 3VP1A 1UWPX 5HDDA 1M40A 1YPRA 3VOLA 5CEDA 3QNBA 1A0KA 1NZOA 4GLQA 4FTXA 2DRWA 5DKKA 3LFVA 1FOFA 2J9OA 2QPNA 2WUQA 2BASA 2M1CA 2BG1A 5M19A 1QMFA 3Q7VB 1DY6A 4ZTKA 5JYPA 4EBPA 3JVUA 4N9LA 3BEBA 1PYYA 2PYRA 5U47A 3GSGA 3HVFA 2W3GA 5EVLA 5FI7A 3TRCA 1HVBA 2ZQ9A 3MKFA 2PAVP 4WF0A 3CWFA 5GLBA 1DP6A 2ZM0A 4LPZA 3UDXA 4OQGA 1K0KA 2EXBA 3T1RA 1W8YA 4RYEA 1S0WA 1G68A 4LGWA 1IOUA 3GDIA 3GQZA 1LLBA 3E4PA 1I2WA 4UA9A 2XD5A 3CPTB 4YFMA 3CI6A 2B02A 1XKZA 2QWSA 4IVKA 4WL9A 3CUEA 4IJGA 4YNRA 1IYSA 4HY8A 1FSYA 3HUMA 4R6LA 1JWVA 2XD1A 4HH2A 5CEBA 4PKYG 2O0YA 3G31A 2Y2OA 2Y79A 2D02A 4GNUA 2XA7S 1JWPA 4EQIA 2WGWB 1GHPA 3LO7A 3OZHA 3G32A 4P87A 2L4RA 2JBFA 1VEUA 3WS5A 1W8QA 2W1RA 3HCYA 5HL6A 4DKIA 2HV1A 3VP4A 2R78A 5GLDA 4L9FA 1K56A 3JYIA 1SKOA 2QMIA 4OKPA 2O9CA 3ITBA 2A2LA 2ZQDA 4HOIA 4KZ8A 3EQVA 2V0UA 3MZFA 2Q0OA 1NRJA 3H7WB 3OPHA 1LHYA 2XEPA 1PWGA 2ZM2A 1RGYA 4BMWA 5GHYA 3MBZA 3OCLA 1TDLA 4X1LA 4CPKA 2CC1A 1L0DA 4GJ4A 1YLYA 3TSGA 1YSPA 4LV2A 1FIKA 2GJ3A 2FH5A 4XUZA 2WKQA 1OTBA 3HLDA 5EVIC 3ZFZA 1IYPA 2OLVA 4GS9A 1Y54A 3RXXA 1FR1A 3ZGAB 3B42A 3MXSA 5FL3A 3M6BA 3G34A 4LRZE 5DF9A 1KDWA 3N4IA 2X01A 4S2LA 4PM6A 5FATA 5EOEA 4UA6A 4QY6A 2PDRA 5EM1A 3ZVWA 4WM9A 4X55A 3O88A 2WAEA 5CRFA 1I5QA 1TS7A 4ESPA 4II7A 3UDFA 1H8MA 5CGXA 1PI4A 4WLAA 3DWZA 4QWOA 3LIBA 4HBTA 2W27A 3FZCA 1J9MA 5HARA 3T12B 3IH8A 4KUOA 5DJUA 4QD4A 2Z6DA 4EESA 3OBFA 1YKDA 4EV4A 1MPLA 4YOFA 3SS5A 4GZBA 5EVID 3PAGA 1STZA 1XA1A 3WS1A 4GCZA 1G6AA 1W79A 4I38A 1BSGA 1XGIA 2VJWA 5KIZA 1S6RA 1G5UA 1Q2PA 4L9GA 1GSXA 4R3AA 5HPIA 4QB8A 4S2JA 1XJ3A 4MBFA 1F2KA 3O87A 3BM6A 3BYDA 3S7OA 3C4PA 2J8YA 2VGLS 1N9BA 2ZQ7A 4OP5A 5KZHA 1TVFA 3GMWA 5HDCA 2OSUA 3OCNA 1Z6FA 2E8JA 2IWDA 2A24A 2V20A 1YLPA 3F1PB 2VGJA 1K38A 2ZLYA 3CITA 1N9NA 3IT9A 2ZL1B 3V3RA 1XX2A 1D1JA 4X25A 2VV8A 5CERA 1TDGA 4LRXC 1H3QA 1ZG6A 3BFEA 1N4OA 1SDEA 4Y0UA 5F6AA 1CI9A 3AGDA 4ETZA 1UGUA 5FAQA 2W3DA 2PHYA 3ZHHA 1VETB 2CMNA 4GW9A 3EQUA 2ZC6B 1PZOA 3ZQ5A 4OH0A 4I5SA 1D7EA 5J7EA 2PD7A 2B5RA 5IU1A 4C3QA 4MN6A 5FDHA 4KZBA 3RH8B 4ARZA 3EWKA 3UMDA 4PM8A 2Y2QA 4C6YA 3MMHA 4DN0A 2Y2GA 3QP5A 1W7FA 4EQ1A 4JBFA 3C2WA 4HJ4A 3LICA 2WKHA 3ZNTA 4HBUA 4HESA 1J3WA 2JKRM 1ERQA 4R70A 5DTSA 4H6JB 1NZUA 3ZYTA 1LL5A 2WKIA 1YQSA 3LIFA 2EWVA 1BLCA 2R9WA 2WKPA 4NEED 3PXPA 2K7SA 2ZC5B 3VSLA 3AGEA 5F82A 4OQ0A 5KMWA 5GL9A 3LEQA 4F3LA 3GV9A 3UPNA 2WGVA 4F94A 3UB6A 2HZ5A 2XR0A 3DTKA 4B9OA 3FKWA 4JGQA 4KG2A 2VEAA 1ONGA 3UMEA 1TF1A 2PU4A 3RFBA 1WA9A 1XA7A 4L9EA 2OAP1 5AJGA 1HTZA 1KGEA 3MFDA 1FSWA 4XT2A 2L1MA 3UPOA 1T1AA 3HL9A 3PHYA 3NDEA 3LYXA 2B95A 1BLSA 2Z2LB 4KZ9A 2D01A 3D72A 5GHZA 3MFXA 4X53A 1P97A 2HPBA 2Q9MA 5GLAA 3L9KA 4UAAA 3S7PA 2QZ6A 2PYPA 3E98A 1YM1A 3BY9A 1NLYA 2J80A 4Y7PA 2VK3A 1MWTA 5CXWA 4P6ZS 3IWIA 3CUEC 2EXAA 2ZOIA 1NY0A 3N6IA 1EROA 3CG5A 3C7UA 3A3EA 4O0PA 4ETXA 2QHKA 2VLGA 3SH9A
chains in the Genus database with same CATH topology
4EUVA 2VKSA 1OTDA 3R7WB 4ZRRA 2JKRI 4YWZA 4IUKA 2NUPC 3S7NA 1OT9A 4WN5A 1IOUA 3GDIA 1W63Q 3HJKA 4I3IA 3E4PA 3KYZA 2PR6A 3CI6A 2B02A 4HI4A 2QWSA 5IS1A 5G4YA 1XFQA 4WL9A 5K5BA 3CUEA 3EEHA 4IJGA 2ZMVA 1G28A 4YNRA 2OWHA 4HY8A 2KX6A 4GS9B 5EFWA 2W1TB 3E0YA 4CLCC 1T18A 3C30A 4R6LA 3CLOA 1G6OA 3D3OA 3C8CA 1D06A 3NJAA 4HH2A 4R38A 4MCWA 3HJIA 4PKYG 2O0YA 2Z6CA 1N9OA 2Y79A 2INWA 3KX0X 2VV6A 2D02A 3PBQA 1S4SA 4K08A 2XA7S 1OPXA 4GHIB 3K3CA 1MKMA 1EW0A 1N9LA 2L4RA 3MQOA 2EWWA 3FPVA 1DP9A 4HJ3A 2W1RA 3HCYA 5HL6A 2HV1A 2R78A 1F9IA 5IT5A 4L9FA 3K3DA 3MR0A 5DFYA 1P0ZA 3PBTA 3OOVA 2G7UA 2O9CA 4BJPA 4O01A 3S7QA 5HWWA 4RQ9A 1P9WA 1LT0A 2A2LA 4NXEA 4HOIA 4JGRA 4UQIM 4HNBA 3MXQA 3EQVA 2P04A 1V9YA 2J3WA 2V0UA 4OOMA 2W0NA 1NRJA 3G6OA 3H7WB 2OAQ1 3PBOA 4WEKA 4PKYA 4PHTA 1DRMA 1OTAA 1KOUA 3EGDC 3NOUC 3PR6A 4BMWA 5A8BA 3FPWA 3IBJA 3H82B 3R7WA 1T19A 3ULFA 3LR4A 3MJQA 3OCLA 1TD5A 1VB6A 4CLCB 1DP8A 2LB5A 4GJ4A 4KQDA 1YSPA 2K2NA 2W3FA 5CX7A 3LIAA 2VV7A 2M7VA 5DFXA 3LI9A 2GJ3A 2FH5A 4JGOA 3KSFA 4I3AA 4HHDA 2WKQA 1OTBA 3IS2B 4GS9A 2W1TA 4OOLA 3EEAA 5F69A 3B42A 2V1AA 1YAXA 3B47A 2JKTM 5FL3A 5HD3A 2A24B 2ZMFA 2QJ7A 3A0SA 3LIDA 4LRZE 5DF9A 2P08A 4DJ2A 2PDRA 3LR5A 3H9WA 3T50A 5HSQA 3T4JA 4MN7A 1TS8A 4GHIA 3UE3A 1Y28A 1XJ4A 3E4OA 3FC7A 4IUHA 4I39A 4WEJA 2O99A 1TS7A 4II7A 4Q0HA 2ZBBA 1H8MA 2W3EA 4WLAA 4PAUA 5HPFA 5KSHA 3LUQA 1XJ2A 4QPRA 3EOIA 2LB9A 2VZWA 3LIBA 3MF0A 2W27A 3LR0A 1V9ZA 2WKRA 3GECA 3F1NB 4KUOA 4WUJA 2XROA 4HQAA 5DJUA 1GSWA 2L0WA 4P6ZM 3MQ0A 3KSGA 3KSHA 2Z6DA 4EESA 3R4KA 2KLIA 3OBFA 1YKDA 4EEPA 4M4XA 3MQQA 2K31A 3W2ZA 4YOFA 1YSQA 3H7WA 1STZA 2PR5A 4CQHA 1ZTUA 4DMZA 2VA0A 4GCZA 5AVEA 4I38A 3IBRA 3KYQA 5KIZA 2VJWA 3H82A 4ARZB 1BYWA 4CLCA 3BQ8A 3VE4A 4L9GA 1GSXA 3OLOA 3OC2A 4R3AA 5HPIA 3VV4A 5F68A 2Y8HA 1XJ3A 4MDZA 4EW7A 3S7OA 3A0VA 4FSFA 2NUTC 5HZHA 1VHMA 2J3TC 3IS2A 5G4ZA 3P7NA 2VGLS 1OJ5A 5HWVA 2P7JA 5HDCA 3OCNA 3T4LA 5J3WA 2A24A 1LSXA 2FZ0A 4BBTA 3PYPA 1IFQA 2PT7A 3F1PB 4G3VA 4CLCD 5I5LA 5HWTA 2MJ6A 2XA7M 3CITA 1N9NA 3KSIA 3NHQA 2GZAA 4FOFA 1LSWA 4NXGA 4G3KA 3T4QA 4BBUA 1XJ6A 2EA9A 2VV8A 1TS0A 4F3LB 5F5YA 3BW6A 4IHQA 2V1BA 3T4OA 1T1BA 1MZUA 2V9AA 4LRYC 2M7UA 3ICYA 4LRXC 2YKFA 4KUKA 1H3QA 1ZHHB 1F5MA 3LIEA 3PBNA 5F6AA 5J4EA 3UB7A 3A0RA 4UEYA 1ODVA 2V0WA 3B33A 3PBSA 3KO6A 4ETZA 3LR3A 4E04A 1TS6A 1UGUA 3U2AA 2W3DA 4EXOA 2PHYA 5C5KA 3F1NA 2CMNA 4GW9A 2HJ9C 2OWJA 3EQUA 1OTEA 3ZQ5A 4HP4A 3TJZC 4I5SA 4XT2B 1D7EA 2QYBA 1P9RA 5J7EA 3O5YA 4Y5FA 4BWIA 1S4RA 2PD7A 5IU1A 2YKHA 2J3TD 4MN6A 3VE3A 2HF6A 3RH8B 4ARZA 5TBMB 3EWKA 1OT6A 3UMDA 1LL8A 5HD5A 1NLZA 3NOPC 3F1OB 3BQAA 2QJ5A 3MMHA 4HP9A 4DN0A 1UWNX 4ME4A 4HJ6A 4EQ1A 1JNUA 1OTIA 3C38A 3C2WA 3NOTC 2PD8A 4Q0IA 4HJ4A 4EERA 2B18A 3LICA 3JVVA 3LI8A 1GSVA 2JKRM 4R70A 5L8MA 4H6JB 2JN7A 1OJGA 3ZYTA 3K2NA 2OOLA 4AFIA 1S1ZA 3FG8A 2EWVA 2IA2A 3LIFA 4UQIS 4DJ3A 4WELA 1S66L 3RTYA 3UE6A 2WKPA 2O9AA 3F1PA 4NEED 3PXPA 1S67L 5DJTA 5HDSA 2K7SA 3P01A 2QKPA 4KQOA 4Y3IA 4HH3A 4NXFA 4F3LA 5AVFA 4EU0A 3BJNA 5LBRA 1X0OA 4LLOB 2VX8A 3UB6A 4Q0JA 1XFNA 3BWLA 4G3WA 4O8GA 5TJJA 1NWZA 4I3JA 4B9OA 3T4KA 2I9VA 4JGQA 4L0LA 2VEAA 2W3HA 4MMNA 4CLCE 4Y2FA 3UMEA 2GNXA 2XSSA 3V67A 4EETB 4BBVA 3T4TA 1MC0A 1S1YA 3T4SA 1TF1A 3RFBA 1WA9A 4L9EA 2H28A 1LSVA 2OAP1 4B93A 2KDKA 3DBAA 1W63M 5AJGA 3UB8A 3TE8A 4NXBA 1UWPX 5HDDA 4XT2A 2L1MA 1T1AA 4MN5A 3VOLA 1F98A 1T1CA 2HJEA 3PHYA 3LYXA 2JHEA 2ZOHA 4GLQA 4Z1WA 3TW8A 5DKKA 4EEUA 2JKTI 3LFVA 2D01A 3D72A 3SW1A 3MFXA 5TBMA 3BY8A 3PBRA 1P97A 2HGVA 2BASA 2M1CA 2KOIA 3F1OA 3S7PA 2GX5A 4HIAA 2PYPA 5DKLA 3E98A 2DMWA 3BY9A 3JVUA 1NLYA 2J80A 2XRNA 5MC7A 2PYRA 2VGLM 4H6JA 2O9BA 4P6ZS 4NKPA 3CUEC 2W3GA 2ZOIA 3TRCA 3E4QA 4WF0A 4JGPA 3CAXA 3EGXC 4O0PA 3CWFA 4ETXA 1DP6A 2QHKA 2VLGA 4LPZA 3UB9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OTD A;  4YWZ A;  1OT9 A;  4WN5 A;  3GDI A;  3HJK A;  4I3I A;  3E4P A;  2PR6 A;  2B02 A;  4HI4 A;  2QWS A;  5IS1 A;  5G4Y A;  1XFQ A;  4WL9 A;  3EEH A;  1G28 A;  2OWH A;  4HY8 A;  2KX6 A;  4GS9 B;  5EFW A;  1T18 A;  4R6L A;  3CLO A;  3C8C A;  1D06 A;  3NJA A;  4HH2 A;  4R38 A;  3HJI A;  4PKY G;  2Z6C A;  1N9O A;  2INW A;  3KX0 X;  2VV6 A;  2D02 A;  1S4S A;  4K08 A;  4GHI B;  3K3C A;  1EW0 A;  1N9L A;  2L4R A;  3MQO A;  1DP9 A;  4HJ3 A;  2HV1 A;  2R78 A;  1F9I A;  4L9F A;  3K3D A;  3MR0 A;  1P0Z A;  5HWW A;  4RQ9 A;  1LT0 A;  4NXE A;  4HOI A;  4JGR A;  4HNB A;  3MXQ A;  1V9Y A;  2V0U A;  2W0N A;  3G6O A;  3H7W B;  4PKY A;  1DRM A;  1OTA A;  1KOU A;  3NOU C;  5A8B A;  3H82 B;  3ULF A;  1T19 A;  3MJQ A;  1VB6 A;  1DP8 A;  4KQD A;  3LIA A;  2VV7 A;  3LI9 A;  2GJ3 A;  4JGO A;  4I3A A;  4HHD A;  2WKQ A;  1OTB A;  3IS2 B;  4GS9 A;  5F69 A;  2V1A A;  5HD3 A;  2A24 B;  3LID A;  2QJ7 A;  3A0S A;  4LRZ E;  4DJ2 A;  2PDR A;  3H9W A;  3T50 A;  5HSQ A;  1TS8 A;  4GHI A;  1Y28 A;  1XJ4 A;  3E4O A;  3FC7 A;  4I39 A;  1TS7 A;  2ZBB A;  4WLA A;  3LUQ A;  1XJ2 A;  3LIB A;  2W27 A;  1V9Z A;  2WKR A;  3GEC A;  3F1N B;  4KUO A;  4WUJ A;  4HQA A;  5DJU A;  1GSW A;  2L0W A;  2Z6D A;  4EES A;  4EEP A;  4M4X A;  3MQQ A;  3H7W A;  2PR5 A;  4GCZ A;  5AVE A;  4I38 A;  3IBR A;  5KIZ A;  3H82 A;  1BYW A;  3VE4 A;  4L9G A;  1GSX A;  3OLO A;  4R3A A;  5F68 A;  1XJ3 A;  4EW7 A;  3A0V A;  5HZH A;  3IS2 A;  5G4Z A;  3P7N A;  1OJ5 A;  5HWV A;  2P7J A;  5HDC A;  5J3W A;  2A24 A;  1LSX A;  4BBT A;  3PYP A;  3F1P B;  5I5L A;  5HWT A;  1N9N A;  3NHQ A;  1LSW A;  4NXG A;  4BBU A;  1XJ6 A;  2EA9 A;  2VV8 A;  1TS0 A;  4F3L B;  5F5Y A;  2V1B A;  1T1B A;  1MZU A;  2V9A A;  4LRY C;  3ICY A;  4LRX C;  2YKF A;  4KUK A;  3LIE A;  5J4E A;  5F6A A;  3UB7 A;  3A0R A;  1ODV A;  2V0W A;  3B33 A;  4E04 A;  1TS6 A;  1UGU A;  4EXO A;  2PHY A;  3F1N A;  2CMN A;  4GW9 A;  2OWJ A;  1OTE A;  3ZQ5 A;  4HP4 A;  4I5S A;  4XT2 B;  1D7E A;  5J7E A;  1S4R A;  2PD7 A;  5IU1 A;  2YKH A;  4MN6 A;  3VE3 A;  3RH8 B;  5TBM B;  3EWK A;  1OT6 A;  3UMD A;  1LL8 A;  5HD5 A;  3NOP C;  3F1O B;  2QJ5 A;  4HP9 A;  1UWN X;  4HJ6 A;  4EQ1 A;  1JNU A;  1OTI A;  3C2W A;  3NOT C;  2PD8 A;  4EER A;  4HJ4 A;  3LIC A;  3LI8 A;  1GSV A;  4R70 A;  4H6J B;  2JN7 A;  1OJG A;  2OOL A;  1S1Z A;  3FG8 A;  3LIF A;  4DJ3 A;  1S66 L;  3RTY A;  3UE6 A;  2WKP A;  3F1P A;  1S67 L;  5DJT A;  5HDS A;  2K7S A;  2QKP A;  4HH3 A;  4NXF A;  4F3L A;  5AVF A;  1X0O A;  4LLO B;  3UB6 A;  1XFN A;  3BWL A;  1NWZ A;  4I3J A;  4B9O A;  2I9V A;  4JGQ A;  2VEA A;  3UME A;  4EET B;  4BBV A;  1S1Y A;  1WA9 A;  4L9E A;  2H28 A;  1LSV A;  2KDK A;  3UB8 A;  4NXB A;  1UWP X;  5HDD A;  4XT2 A;  2L1M A;  1T1A A;  4MN5 A;  3VOL A;  1F98 A;  1T1C A;  3PHY A;  3LYX A;  2JHE A;  2ZOH A;  5DKK A;  4EEU A;  3SW1 A;  2D01 A;  3D72 A;  3MFX A;  5TBM A;  3BY8 A;  1P97 A;  2BAS A;  2M1C A;  3F1O A;  4HIA A;  2PYP A;  5DKL A;  3BY9 A;  2J80 A;  2PYR A;  4H6J A;  2ZOI A;  3E4Q A;  4WF0 A;  4JGP A;  3CAX A;  3CWF A;  1DP6 A;  2QHK A;  2VLG A;  4LPZ A;  3UB9 A; 
#chains in the Genus database with same CATH topology
 4EUV A;  2VKS A;  1OTD A;  3R7W B;  4ZRR A;  4DRT A;  4IUK A;  1K57 C;  4OLD A;  1OT9 A;  4R0Q A;  3HJK A;  3PTE A;  4BQM A;  1ESU A;  5CEC A;  4X1M A;  4OVD A;  1YT4 A;  3GR2 A;  4HI4 A;  5IS1 A;  5G4Y A;  1XFQ A;  2ZMA A;  3IX8 A;  3C30 A;  1C3B A;  3CLO A;  3D3O A;  3C8C A;  1D06 A;  3NJA A;  4R38 A;  3V3S A;  3B3X A;  3ZG0 A;  2INW A;  3RXW A;  2VV6 A;  3PBQ A;  4S2O A;  5E43 A;  4K08 A;  4KEN B;  2OV5 A;  3D9Y A;  4GHI B;  5CTM A;  2BTF P;  3I7J A;  3HLE A;  2GDN A;  1MKM A;  5FAP A;  2XFT A;  4K0W A;  5AQB A;  3GVB A;  3BRM A;  5HW3 A;  3Q7V A;  3MR0 A;  1ES4 A;  1RGZ A;  3PBT A;  3OOV A;  2EX2 A;  1BT5 A;  4BJP A;  4LV3 A;  3S7Q A;  3HLW A;  4RQ9 A;  3DW0 A;  4P85 A;  4KG6 A;  3M2K A;  4UQI M;  3MXQ A;  2C5W B;  5EM0 A;  2P04 A;  3NY4 A;  1V9Y A;  4MBK A;  1PW8 A;  4OOM A;  3HLF A;  1PRQ A;  4GOG A;  2OAQ 1;  2XFS A;  1K6S A;  1BLH A;  2WAD A;  1L0G A;  1K56 D;  1KOU A;  2UWX A;  1IKG A;  3H82 B;  3ULF A;  3S1Y A;  3NUL A;  5L10 A;  4CLC B;  1AXB A;  2Y2N A;  1DP8 A;  2HDU A;  2Y2P A;  5TR7 A;  4KQD A;  3SOI A;  1KE0 A;  5D3O A;  2K2N A;  1BUE A;  3CPT A;  5DFX A;  3WS2 A;  1ACF A;  3LI9 A;  4JGO A;  3KSF A;  1HLU P;  4HHD A;  3N8S A;  3IS2 B;  3VFH A;  5FI2 A;  2Y2M A;  3G30 A;  2Y2K A;  5F69 A;  3QP4 A;  4N9K A;  3B47 A;  1JTG A;  2EX8 A;  1CEF A;  3VFF A;  5HD3 A;  2JCH A;  4XUX A;  4UHU A;  3UE3 A;  2WGW A;  3E4O A;  5DF7 A;  4I39 A;  4LCL A;  4WEJ A;  1EWZ A;  4EBL A;  5E2H A;  1U60 A;  4IBX A;  1K25 A;  4PAU A;  5KSH A;  3LGO A;  5L07 A;  2VZW A;  3LR0 A;  3MSH A;  3G2Y A;  3Q81 A;  5FQI A;  4KZ7 A;  1PW1 A;  1GSW A;  1BZA A;  1FQG A;  1K57 A;  3HLB A;  3R4K A;  3WRT A;  2KLI A;  4EEP A;  1PI5 A;  1PFL A;  3ISG A;  3W2Z A;  3S4X A;  3QNC A;  1YSQ A;  3H7W A;  1K55 A;  1ZTU A;  5AVE A;  4QY5 A;  3KYQ A;  3A3F A;  1PIO A;  4RVA A;  3OLO A;  4DXB A;  3VV4 A;  1IYQ A;  4EW7 A;  2P9V B;  4OPZ A;  4FSF A;  2NUT C;  3C4O A;  3CJM A;  3IXH A;  1OJ5 A;  2P7J A;  5A92 A;  1NRF A;  5J3W A;  2ACG A;  2FZ0 A;  4BBT A;  1IFQ A;  2PT7 A;  4OPQ A;  5I5L A;  1PZP A;  4WZ5 A;  4WBG A;  3KSI A;  2WZX A;  2GZA A;  4NXG A;  1YLZ A;  3T4Q A;  1MWR A;  2C6W B;  2EA9 A;  1TS0 A;  4MEZ A;  5FQK A;  4DF6 A;  4FH2 A;  2X02 A;  4LRY C;  4UA7 A;  4KUK A;  4NG2 A;  3PBN A;  4WMC D;  1GCE A;  1ODV A;  4PPR A;  3HRE A;  3B33 A;  3WS4 A;  4R3B A;  3LR3 A;  5F1F A;  5C5K A;  1RCJ A;  1ZC2 A;  2HJ9 C;  2OWJ A;  2EFU A;  4E3I A;  1YLJ A;  1KVM A;  1XXM A;  5BOH A;  5L09 A;  2X71 A;  3NDG A;  5IHV A;  1MWU A;  2Y2I A;  2YKH A;  1YLW A;  3VE3 A;  4LEN A;  2HF6 A;  5FQM A;  2H10 A;  5TBM B;  1OT6 A;  1ESI A;  4RA7 A;  4RX2 A;  1LL8 A;  4JKT A;  3OPR A;  3NOP C;  5E2G A;  3F1O B;  3BLS A;  5F83 A;  4HJ6 A;  4JPM A;  4R23 A;  2A3U A;  3RJU A;  1OTI A;  3NOT C;  4Q0I A;  4ID4 A;  2JN7 A;  1OJG A;  3IXG A;  2OOL A;  3K2N A;  4AFI A;  4GDB A;  1S66 L;  3RTY A;  3BLM A;  2O9A A;  3F1P A;  3M6H A;  1ERM A;  5DJT A;  2Y55 A;  3P01 A;  4R1G A;  2JE5 A;  2PBY A;  2ZL1 A;  3IX4 A;  4Y3I A;  4LV0 A;  2V1Z A;  3BJN A;  5LBR A;  1Y4O A;  4LLO B;  2VX8 A;  3N8L A;  3BFF A;  1JVJ A;  4G3W A;  2ZC3 B;  4O8G A;  1NWZ A;  1PNE A;  2WAF A;  3DTI A;  2I9V A;  4L0L A;  4MMN A;  4CLC E;  4Y2F A;  5CHJ A;  1H8Z A;  2GNX A;  1VET A;  1GA0 A;  3T4T A;  1S1Y A;  3T4S A;  4GKU A;  5EOO A;  5FQ9 A;  4LV1 A;  2KDK A;  1XGJ A;  2ZQC A;  4JF5 A;  3N8R A;  3TE8 A;  4NXB A;  5GLC A;  5EE8 A;  2HJE A;  3DTE A;  2OLU A;  5AQA A;  3TW8 A;  4U0X A;  4EEU A;  4DE2 A;  4E3K A;  3MS6 A;  3BY8 A;  3PBR A;  1SCW A;  4JF4 A;  2HGV A;  3NI9 A;  4OPR A;  4HIA A;  3CHW P;  4RX3 A;  3MKE A;  4JXS A;  3UB5 P;  2XRN A;  2XF3 A;  4H6J A;  3IWQ A;  3VOZ A;  4NKP A;  4Y0O A;  4BLM A;  5CTN A;  3UE1 A;  3JPU A;  1L2S A;  3CAX A;  3EGX C;  2FFY A;  2EFX A;  4GB7 A;  1HD8 A;  1LI0 A;  3WWX A;  3UB9 A;  3UY6 A;  4E3M A;  4D60 A;  3L7H A;  2HDS A;  4YWZ A;  2NUP C;  4WN5 A;  4I3I A;  3N7W A;  4DDY A;  2I72 A;  3KYZ A;  2JKG A;  4JLF A;  3C5A A;  4Y0T A;  2ZMV A;  4PM7 A;  2OWH A;  5EFW A;  2KX6 A;  3SH8 A;  2W1T B;  5E2F A;  3E0Y A;  4CLC C;  1T18 A;  4MCW A;  3HJI A;  3MXR A;  2Z6C A;  3VMA A;  3DAV A;  1N9O A;  4P0M A;  3CZD A;  1ALQ A;  4ZJ2 A;  3NC8 A;  1XP4 A;  1MKI A;  3OPP A;  3K3C A;  4KG5 A;  4X6T A;  3UDI A;  2XDM A;  3FYZ A;  2ZQA A;  1ES2 A;  2H0T A;  4K91 A;  3MQO A;  2UV0 E;  4WZ4 A;  2EWW A;  4M3K A;  1DP9 A;  5EVI B;  2V8F A;  1F9I A;  5IT5 A;  5DFY A;  4NK3 A;  4E6W A;  1XPB A;  5F1G A;  4PM5 A;  4E6X A;  4NXE A;  4JGR A;  4R4S A;  4HNB A;  5CHU A;  5GHX A;  2J3W A;  3ZVT A;  2HP9 A;  1ES3 A;  2W0N A;  4S2I A;  4MLL A;  3PBO A;  2AVX A;  1EI5 A;  2XGN A;  4PKY A;  5FI6 A;  1DRM A;  4C75 A;  1OTA A;  3CMZ A;  3SS4 A;  4DXC A;  2HP5 A;  3EGD C;  3NOU C;  3FPW A;  3R7W A;  1WE4 A;  3LR4 A;  3MJQ A;  1KDS A;  1VB6 A;  1KE4 A;  5HL1 A;  4QHC A;  2Y2J A;  1LL9 A;  1K6R A;  2WZZ A;  2VV7 A;  3KYE A;  3A3J A;  4I3A A;  5FQQ A;  1SDN A;  4OOL A;  3EEA A;  5EV0 A;  4ZJ3 A;  1YLT A;  1E3U A;  4Q8I A;  2V1A A;  1YAX A;  1K4F A;  2P08 A;  4DE0 A;  4DJ2 A;  5FSR A;  3LR5 A;  4S2K A;  3T50 A;  3T4J A;  4MN7 A;  1TS8 A;  4GHI A;  3W4Q A;  2PBD P;  2RCX A;  4WYY A;  4IUH A;  3LY4 A;  2O99 A;  1H0M A;  2ZBB A;  3FKV A;  1K55 C;  2W3E A;  5HPF A;  3LUQ A;  1XJ2 A;  1JWZ A;  4QPR A;  3UPP A;  1VM1 A;  3ITA A;  2LB9 A;  3IX3 A;  3MF0 A;  1V9Z A;  3F1N B;  2J7V A;  5AQ7 A;  2XRO A;  2L0W A;  4OOY A;  3IHB A;  4DDS A;  3VP0 A;  3ZG8 B;  1VQQ A;  2H5S A;  2Y4A A;  4N92 A;  4B4Z A;  2K31 A;  3AGF A;  3IF6 B;  1ZG4 A;  4CQH A;  2VA0 A;  1L3L A;  3H82 A;  4WZ5 C;  1BYW A;  4CLC A;  3BQ8 A;  3VE4 A;  3SH7 A;  1KGG A;  3OC2 A;  3BFG A;  1FIL A;  4GDN A;  5M18 A;  5F68 A;  4MDZ A;  1HZO A;  3A0V A;  3ZG5 A;  1VHM A;  4GD8 A;  1RP5 A;  3IS2 A;  3P7N A;  2ZC7 A;  5JYO A;  4N1H A;  1H5X A;  2IWB A;  4KZ5 A;  3UE0 A;  1KE3 A;  4OQI A;  4EBN A;  5CHM A;  1FCN A;  2HP6 A;  4ZDX A;  2XA7 M;  2Q9N A;  4BEN A;  3D4F A;  4G3K A;  3HLG A;  1XJ6 A;  3A3I A;  3TG9 A;  5F5Y A;  4KZ6 A;  3O3V A;  3VSK A;  2V1B A;  5I94 A;  3ICY A;  1ZHH B;  1F5M A;  3LIE A;  1SZV A;  3A0R A;  5HFO A;  4KZA A;  3T1S A;  1CJF A;  3KO6 A;  1TS6 A;  3QHY A;  3DWK A;  1W5D A;  2PU2 A;  1OTE A;  1FR6 A;  1KVL A;  4HP4 A;  2H0Y A;  3TJZ C;  5CGS A;  1P9R A;  3ZNY A;  4Y5F A;  4N1X A;  1CQA A;  3E2L A;  3GTC A;  4HEF A;  1MWS A;  1BUL A;  1K4E A;  5HD5 A;  1NLZ A;  3IQA A;  3BQA A;  4HP9 A;  1UWN X;  4ME4 A;  2WGI A;  2P9V A;  4JXG A;  2XLN A;  4EER A;  2B18 A;  4KZ3 A;  3ZCZ A;  3LI8 A;  1GSV A;  5EEC A;  5L8M A;  1S1Z A;  3FG8 A;  2IA2 A;  4UQI S;  3U4L P;  3G2Z A;  5FA7 A;  5FEG A;  1S67 L;  1CK3 A;  1Q2Q A;  4X69 A;  3S22 A;  4FH4 A;  3IF5 A;  4NXF A;  3UO9 A;  2Y2L A;  5AVF A;  1X0O A;  1FCM A;  4OP8 A;  5TJJ A;  4IED A;  1WYB A;  2EX9 A;  2XK1 A;  3V39 A;  1TEM A;  2XSS A;  3V67 A;  1MC0 A;  3WS0 A;  4FD8 A;  3O86 A;  2HDR A;  4ZBE A;  1LSV A;  1W63 M;  4EUZ A;  3BFC A;  4MN5 A;  1F98 A;  1T1C A;  4IBR A;  2R9X A;  4Y15 A;  2JHE A;  2ZOH A;  4Z1W A;  2PRF A;  3SS3 A;  2JKT I;  3SW1 A;  1K54 C;  1VEU B;  5TBM A;  4O7D A;  1M6K A;  4A5R A;  2KOI A;  4YIN A;  3F1O A;  4GN2 A;  4EWF A;  2GX5 A;  5HAI A;  1SKO B;  1GA9 A;  4H8R A;  5DKL A;  1QME A;  2DMW A;  2VGK A;  5DVA A;  4Z9Q A;  5MC7 A;  2VGL M;  2Y2H A;  3VP3 A;  2V8C A;  2O9B A;  4E3J A;  4E3N A;  2JKF A;  5HAP A;  3MZE A;  4LCM A;  3NCK A;  5FQJ A;  5A90 A;  4OQH A;  3E4Q A;  3A3D A;  2ZQ8 A;  4S2P A;  4JGP A;  5M1A A;  3NEC A;  1ES5 A;  4NET A;  3FWL A;  2JKR I;  4X68 A;  4LFU A;  3S7N A;  1W63 Q;  4X56 A;  1JTD A;  2WYX A;  1IKI A;  2PR6 A;  1CI8 A;  1CF0 A;  2G2W A;  5J8X A;  5K5B A;  2ZJ9 A;  3EEH A;  1G28 A;  1GHI A;  3NIA A;  4GS9 B;  3HLC A;  1BLP A;  1G6O A;  2WK0 A;  3KX0 X;  1NXY A;  2XQZ A;  4PMA A;  4DE3 A;  1S4S A;  4OLG A;  4ZAM A;  1OPX A;  1OME A;  3IWO A;  1EW0 A;  1N9L A;  4E3L A;  1MY8 A;  4JXW A;  3FPV A;  4JXV A;  2FFF B;  5A91 A;  1SHV A;  4HJ3 A;  4S2N C;  1NJ4 A;  3OPL A;  4FCF A;  4Y13 A;  3HBR A;  4BD0 A;  3K3D A;  3PAE A;  4ZJ1 A;  1P0Z A;  1E4D A;  2G7U A;  4O01 A;  5HWW A;  1P9W A;  5KSC A;  1LT0 A;  4U0T A;  4U3T A;  3DTM A;  2EX6 A;  1KGF A;  3MZD A;  4WMC A;  3T1Q B;  5HAQ A;  4BL2 A;  4OON A;  3G6O A;  5DF8 A;  4WEK A;  4PHT A;  2ZC4 B;  3HUN A;  3LEZ A;  3PR6 A;  5A8B A;  3IBJ A;  1T19 A;  3BEC A;  1TD5 A;  4R3J A;  3VP2 A;  4K0X A;  2RL3 A;  2ZD8 A;  2LB5 A;  3WRZ A;  5TGF A;  1PWC A;  1PWD A;  2W3F A;  3IF6 C;  3LIA A;  5CX7 A;  2M7V A;  3Q07 A;  3G35 A;  3P98 A;  5E2E A;  3LCE A;  3QP6 A;  3GRJ A;  2W1T A;  5AQ9 A;  5L2F A;  3Q1F A;  4PM9 A;  2JKT M;  1IEL A;  2A24 B;  2ZMF A;  1K54 A;  2QJ7 A;  3A0S A;  3LID A;  5FEF A;  3G4P A;  3LY3 A;  2DNS A;  3H9W A;  5HSQ A;  1Y28 A;  1XJ4 A;  1FCO A;  3FC7 A;  3QP2 A;  4Q0H A;  1NYY A;  2E8I A;  1MBL A;  5EPH A;  3IXD A;  5EVI A;  1E3U D;  1CEG A;  3EOI A;  3Q7Z A;  3FV7 A;  3TOI A;  3W8K A;  2XH9 A;  2ZM8 A;  3NBL A;  2Z2M B;  4QJG A;  2WKR A;  3GEC A;  3IHA A;  4WUJ A;  2P74 A;  1SKF A;  4HQA A;  4P6Z M;  3MQ0 A;  3KSG A;  4CJN A;  3KSH A;  5DTT A;  4M4X A;  3MQQ A;  1I2S A;  3M2J A;  1L0F A;  1WYC A;  2G2U A;  2WKE A;  2PR5 A;  4DMZ A;  3IBR A;  3SZT A;  3ZG9 B;  2Y91 A;  4ARZ B;  3W4O A;  1NYM A;  3QP8 A;  3P09 A;  5FAS A;  3HUO A;  1ONH A;  2Y8H A;  4OPY A;  2J9P A;  2JC7 A;  3BFD A;  5HZH A;  2J3T C;  5G4Z A;  4KQR A;  5HWV A;  2V2F F;  3T4L A;  1LSX A;  2BLS A;  3PYP A;  4B88 A;  1L0E A;  4G3V A;  4S2N A;  3E2K A;  4CLC D;  1LI9 A;  3UN7 A;  5HWT A;  2MJ6 A;  1O7E A;  4B4X A;  4S2M A;  3NHQ A;  5TFQ A;  4FOF A;  1LSW A;  3IXB A;  3Q82 A;  4BBU A;  1Z09 A;  4F3L B;  5A93 A;  1MXO A;  3BW6 A;  1DJA A;  4IHQ A;  3IH9 A;  3T4O A;  1T1B A;  1MZU A;  2V9A A;  2M7U A;  3V50 A;  2YKF A;  5J4E A;  5DTK A;  3UB7 A;  3ZG7 B;  4UEY A;  5HX9 A;  3QP1 A;  4D2O A;  2V0W A;  4R4R A;  3PBS A;  4E04 A;  4EXO A;  3U2A A;  3F1N A;  5G18 A;  1BTL A;  1E25 A;  4BD1 A;  4XT2 B;  2QYB A;  3O5Y A;  4BWI A;  5CGW A;  1O07 A;  1S4R A;  3IF6 A;  4E3O A;  2J3T D;  2HDQ A;  1ZKJ A;  3V5M A;  4GD6 A;  2DCF A;  5FDS A;  2A49 A;  1DJC A;  2QJ5 A;  2Y59 A;  3VOY A;  1YMS A;  1JNU A;  4FUW A;  3C38 A;  2PD8 A;  3JVV A;  3C7V A;  4QU3 A;  4JF6 A;  3ZDJ A;  4BL3 A;  4DJ3 A;  4WEL A;  3UE6 A;  5EVE A;  1GHM A;  4DE1 A;  5FAO A;  5HDS A;  2QKP A;  4KQO A;  4MBH A;  4HH3 A;  4MNR A;  3UNW A;  4EU0 A;  4P6B A;  1IYO A;  4Q0J A;  1XFN A;  4XXR A;  3BWL A;  5EUA A;  3W4P A;  4I3J A;  3T4K A;  1AWI A;  4KZ4 A;  1IEM A;  2W3H A;  1DJB A;  4Y17 A;  4IVI A;  4EET B;  4BBV A;  3T1X A;  2IWC A;  1YMX A;  2H28 A;  4B93 A;  4KQQ A;  3DBA A;  1H8Y A;  3UB8 A;  3VP1 A;  1UWP X;  5HDD A;  1M40 A;  1YPR A;  3VOL A;  5CED A;  3QNB A;  1A0K A;  1NZO A;  4GLQ A;  4FTX A;  2DRW A;  5DKK A;  3LFV A;  1FOF A;  2J9O A;  2QPN A;  2WUQ A;  2BAS A;  2M1C A;  2BG1 A;  5M19 A;  1QMF A;  3Q7V B;  1DY6 A;  4ZTK A;  5JYP A;  4EBP A;  3JVU A;  4N9L A;  3BEB A;  1PYY A;  2PYR A;  5U47 A;  3GSG A;  3HVF A;  2W3G A;  5EVL A;  5FI7 A;  3TRC A;  1HVB A;  2ZQ9 A;  3MKF A;  2PAV P;  4WF0 A;  3CWF A;  5GLB A;  1DP6 A;  2ZM0 A;  4LPZ A;  3UDX A;  4OQG A;  1K0K A;  2EXB A;  3T1R A;  1W8Y A;  4RYE A;  1S0W A;  1G68 A;  4LGW A;  1IOU A;  3GDI A;  3GQZ A;  1LLB A;  3E4P A;  1I2W A;  4UA9 A;  2XD5 A;  3CPT B;  4YFM A;  3CI6 A;  2B02 A;  1XKZ A;  2QWS A;  4IVK A;  4WL9 A;  3CUE A;  4IJG A;  4YNR A;  1IYS A;  4HY8 A;  1FSY A;  3HUM A;  4R6L A;  1JWV A;  2XD1 A;  4HH2 A;  5CEB A;  4PKY G;  2O0Y A;  3G31 A;  2Y2O A;  2Y79 A;  2D02 A;  4GNU A;  2XA7 S;  1JWP A;  4EQI A;  2WGW B;  1GHP A;  3LO7 A;  3OZH A;  3G32 A;  4P87 A;  2L4R A;  2JBF A;  1VEU A;  3WS5 A;  1W8Q A;  2W1R A;  3HCY A;  5HL6 A;  4DKI A;  2HV1 A;  3VP4 A;  2R78 A;  5GLD A;  4L9F A;  1K56 A;  3JYI A;  1SKO A;  2QMI A;  4OKP A;  2O9C A;  3ITB A;  2A2L A;  2ZQD A;  4HOI A;  4KZ8 A;  3EQV A;  2V0U A;  3MZF A;  2Q0O A;  1NRJ A;  3H7W B;  3OPH A;  1LHY A;  2XEP A;  1PWG A;  2ZM2 A;  1RGY A;  4BMW A;  5GHY A;  3MBZ A;  3OCL A;  1TDL A;  4X1L A;  4CPK A;  2CC1 A;  1L0D A;  4GJ4 A;  1YLY A;  3TSG A;  1YSP A;  4LV2 A;  1FIK A;  2GJ3 A;  2FH5 A;  4XUZ A;  2WKQ A;  1OTB A;  3HLD A;  5EVI C;  3ZFZ A;  1IYP A;  2OLV A;  4GS9 A;  1Y54 A;  3RXX A;  1FR1 A;  3ZGA B;  3B42 A;  3MXS A;  5FL3 A;  3M6B A;  3G34 A;  4LRZ E;  5DF9 A;  1KDW A;  3N4I A;  2X01 A;  4S2L A;  4PM6 A;  5FAT A;  5EOE A;  4UA6 A;  4QY6 A;  2PDR A;  5EM1 A;  3ZVW A;  4WM9 A;  4X55 A;  3O88 A;  2WAE A;  5CRF A;  1I5Q A;  1TS7 A;  4ESP A;  4II7 A;  3UDF A;  1H8M A;  5CGX A;  1PI4 A;  4WLA A;  3DWZ A;  4QWO A;  3LIB A;  4HBT A;  2W27 A;  3FZC A;  1J9M A;  5HAR A;  3T12 B;  3IH8 A;  4KUO A;  5DJU A;  4QD4 A;  2Z6D A;  4EES A;  3OBF A;  1YKD A;  4EV4 A;  1MPL A;  4YOF A;  3SS5 A;  4GZB A;  5EVI D;  3PAG A;  1STZ A;  1XA1 A;  3WS1 A;  4GCZ A;  1G6A A;  1W79 A;  4I38 A;  1BSG A;  1XGI A;  2VJW A;  5KIZ A;  1S6R A;  1G5U A;  1Q2P A;  4L9G A;  1GSX A;  4R3A A;  5HPI A;  4QB8 A;  4S2J A;  1XJ3 A;  4MBF A;  1F2K A;  3O87 A;  3BM6 A;  3BYD A;  3S7O A;  3C4P A;  2J8Y A;  2VGL S;  1N9B A;  2ZQ7 A;  4OP5 A;  5KZH A;  1TVF A;  3GMW A;  5HDC A;  2OSU A;  3OCN A;  1Z6F A;  2E8J A;  2IWD A;  2A24 A;  2V20 A;  1YLP A;  3F1P B;  2VGJ A;  1K38 A;  2ZLY A;  3CIT A;  1N9N A;  3IT9 A;  2ZL1 B;  3V3R A;  1XX2 A;  1D1J A;  4X25 A;  2VV8 A;  5CER A;  1TDG A;  4LRX C;  1H3Q A;  1ZG6 A;  3BFE A;  1N4O A;  1SDE A;  4Y0U A;  5F6A A;  1CI9 A;  3AGD A;  4ETZ A;  1UGU A;  5FAQ A;  2W3D A;  2PHY A;  3ZHH A;  1VET B;  2CMN A;  4GW9 A;  3EQU A;  2ZC6 B;  1PZO A;  3ZQ5 A;  4OH0 A;  4I5S A;  1D7E A;  5J7E A;  2PD7 A;  2B5R A;  5IU1 A;  4C3Q A;  4MN6 A;  5FDH A;  4KZB A;  3RH8 B;  4ARZ A;  3EWK A;  3UMD A;  4PM8 A;  2Y2Q A;  4C6Y A;  3MMH A;  4DN0 A;  2Y2G A;  3QP5 A;  1W7F A;  4EQ1 A;  4JBF A;  3C2W A;  4HJ4 A;  3LIC A;  2WKH A;  3ZNT A;  4HBU A;  4HES A;  1J3W A;  2JKR M;  1ERQ A;  4R70 A;  5DTS A;  4H6J B;  1NZU A;  3ZYT A;  1LL5 A;  2WKI A;  1YQS A;  3LIF A;  2EWV A;  1BLC A;  2R9W A;  2WKP A;  4NEE D;  3PXP A;  2K7S A;  2ZC5 B;  3VSL A;  3AGE A;  5F82 A;  4OQ0 A;  5KMW A;  5GL9 A;  3LEQ A;  4F3L A;  3GV9 A;  3UPN A;  2WGV A;  4F94 A;  3UB6 A;  2HZ5 A;  2XR0 A;  3DTK A;  4B9O A;  3FKW A;  4JGQ A;  4KG2 A;  2VEA A;  1ONG A;  3UME A;  1TF1 A;  2PU4 A;  3RFB A;  1WA9 A;  1XA7 A;  4L9E A;  2OAP 1;  5AJG A;  1HTZ A;  1KGE A;  3MFD A;  1FSW A;  4XT2 A;  2L1M A;  3UPO A;  1T1A A;  3HL9 A;  3PHY A;  3NDE A;  3LYX A;  2B95 A;  1BLS A;  2Z2L B;  4KZ9 A;  2D01 A;  3D72 A;  5GHZ A;  3MFX A;  4X53 A;  1P97 A;  2HPB A;  2Q9M A;  5GLA A;  3L9K A;  4UAA A;  3S7P A;  2QZ6 A;  2PYP A;  3E98 A;  1YM1 A;  3BY9 A;  1NLY A;  2J80 A;  4Y7P A;  2VK3 A;  1MWT A;  5CXW A;  4P6Z S;  3IWI A;  3CUE C;  2EXA A;  2ZOI A;  1NY0 A;  3N6I A;  1ERO A;  3CG5 A;  3C7U A;  3A3E A;  4O0P A;  4ETX A;  2QHK A;  2VLG A;  3SH9 A; 
#chains in the Genus database with same CATH homology
 4EUV A;  2VKS A;  1OTD A;  3R7W B;  4ZRR A;  2JKR I;  4YWZ A;  4IUK A;  2NUP C;  3S7N A;  1OT9 A;  4WN5 A;  1IOU A;  3GDI A;  1W63 Q;  3HJK A;  4I3I A;  3E4P A;  3KYZ A;  2PR6 A;  3CI6 A;  2B02 A;  4HI4 A;  2QWS A;  5IS1 A;  5G4Y A;  1XFQ A;  4WL9 A;  5K5B A;  3CUE A;  3EEH A;  4IJG A;  2ZMV A;  1G28 A;  4YNR A;  2OWH A;  4HY8 A;  2KX6 A;  4GS9 B;  5EFW A;  2W1T B;  3E0Y A;  4CLC C;  1T18 A;  3C30 A;  4R6L A;  3CLO A;  1G6O A;  3D3O A;  3C8C A;  1D06 A;  3NJA A;  4HH2 A;  4R38 A;  4MCW A;  3HJI A;  4PKY G;  2O0Y A;  2Z6C A;  1N9O A;  2Y79 A;  2INW A;  3KX0 X;  2VV6 A;  2D02 A;  3PBQ A;  1S4S A;  4K08 A;  2XA7 S;  1OPX A;  4GHI B;  3K3C A;  1MKM A;  1EW0 A;  1N9L A;  2L4R A;  3MQO A;  2EWW A;  3FPV A;  1DP9 A;  4HJ3 A;  2W1R A;  3HCY A;  5HL6 A;  2HV1 A;  2R78 A;  1F9I A;  5IT5 A;  4L9F A;  3K3D A;  3MR0 A;  5DFY A;  1P0Z A;  3PBT A;  3OOV A;  2G7U A;  2O9C A;  4BJP A;  4O01 A;  3S7Q A;  5HWW A;  4RQ9 A;  1P9W A;  1LT0 A;  2A2L A;  4NXE A;  4HOI A;  4JGR A;  4UQI M;  4HNB A;  3MXQ A;  3EQV A;  2P04 A;  1V9Y A;  2J3W A;  2V0U A;  4OOM A;  2W0N A;  1NRJ A;  3G6O A;  3H7W B;  2OAQ 1;  3PBO A;  4WEK A;  4PKY A;  4PHT A;  1DRM A;  1OTA A;  1KOU A;  3EGD C;  3NOU C;  3PR6 A;  4BMW A;  5A8B A;  3FPW A;  3IBJ A;  3H82 B;  3R7W A;  1T19 A;  3ULF A;  3LR4 A;  3MJQ A;  3OCL A;  1TD5 A;  1VB6 A;  4CLC B;  1DP8 A;  2LB5 A;  4GJ4 A;  4KQD A;  1YSP A;  2K2N A;  2W3F A;  5CX7 A;  3LIA A;  2VV7 A;  2M7V A;  5DFX A;  3LI9 A;  2GJ3 A;  2FH5 A;  4JGO A;  3KSF A;  4I3A A;  4HHD A;  2WKQ A;  1OTB A;  3IS2 B;  4GS9 A;  2W1T A;  4OOL A;  3EEA A;  5F69 A;  3B42 A;  2V1A A;  1YAX A;  3B47 A;  2JKT M;  5FL3 A;  5HD3 A;  2A24 B;  2ZMF A;  2QJ7 A;  3A0S A;  3LID A;  4LRZ E;  5DF9 A;  2P08 A;  4DJ2 A;  2PDR A;  3LR5 A;  3H9W A;  3T50 A;  5HSQ A;  3T4J A;  4MN7 A;  1TS8 A;  4GHI A;  3UE3 A;  1Y28 A;  1XJ4 A;  3E4O A;  3FC7 A;  4IUH A;  4I39 A;  4WEJ A;  2O99 A;  1TS7 A;  4II7 A;  4Q0H A;  2ZBB A;  1H8M A;  2W3E A;  4WLA A;  4PAU A;  5HPF A;  5KSH A;  3LUQ A;  1XJ2 A;  4QPR A;  3EOI A;  2LB9 A;  2VZW A;  3LIB A;  3MF0 A;  2W27 A;  3LR0 A;  1V9Z A;  2WKR A;  3GEC A;  3F1N B;  4KUO A;  4WUJ A;  2XRO A;  4HQA A;  5DJU A;  1GSW A;  2L0W A;  4P6Z M;  3MQ0 A;  3KSG A;  3KSH A;  2Z6D A;  4EES A;  3R4K A;  2KLI A;  3OBF A;  1YKD A;  4EEP A;  4M4X A;  3MQQ A;  2K31 A;  3W2Z A;  4YOF A;  1YSQ A;  3H7W A;  1STZ A;  2PR5 A;  4CQH A;  1ZTU A;  4DMZ A;  2VA0 A;  4GCZ A;  5AVE A;  4I38 A;  3IBR A;  3KYQ A;  5KIZ A;  2VJW A;  3H82 A;  4ARZ B;  1BYW A;  4CLC A;  3BQ8 A;  3VE4 A;  4L9G A;  1GSX A;  3OLO A;  3OC2 A;  4R3A A;  5HPI A;  3VV4 A;  5F68 A;  2Y8H A;  1XJ3 A;  4MDZ A;  4EW7 A;  3S7O A;  3A0V A;  4FSF A;  2NUT C;  5HZH A;  1VHM A;  2J3T C;  3IS2 A;  5G4Z A;  3P7N A;  2VGL S;  1OJ5 A;  5HWV A;  2P7J A;  5HDC A;  3OCN A;  3T4L A;  5J3W A;  2A24 A;  1LSX A;  2FZ0 A;  4BBT A;  3PYP A;  1IFQ A;  2PT7 A;  3F1P B;  4G3V A;  4CLC D;  5I5L A;  5HWT A;  2MJ6 A;  2XA7 M;  3CIT A;  1N9N A;  3KSI A;  3NHQ A;  2GZA A;  4FOF A;  1LSW A;  4NXG A;  4G3K A;  3T4Q A;  4BBU A;  1XJ6 A;  2EA9 A;  2VV8 A;  1TS0 A;  4F3L B;  5F5Y A;  3BW6 A;  4IHQ A;  2V1B A;  3T4O A;  1T1B A;  1MZU A;  2V9A A;  4LRY C;  2M7U A;  3ICY A;  4LRX C;  2YKF A;  4KUK A;  1H3Q A;  1ZHH B;  1F5M A;  3LIE A;  3PBN A;  5F6A A;  5J4E A;  3UB7 A;  3A0R A;  4UEY A;  1ODV A;  2V0W A;  3B33 A;  3PBS A;  3KO6 A;  4ETZ A;  3LR3 A;  4E04 A;  1TS6 A;  1UGU A;  3U2A A;  2W3D A;  4EXO A;  2PHY A;  5C5K A;  3F1N A;  2CMN A;  4GW9 A;  2HJ9 C;  2OWJ A;  3EQU A;  1OTE A;  3ZQ5 A;  4HP4 A;  3TJZ C;  4I5S A;  4XT2 B;  1D7E A;  2QYB A;  1P9R A;  5J7E A;  3O5Y A;  4Y5F A;  4BWI A;  1S4R A;  2PD7 A;  5IU1 A;  2YKH A;  2J3T D;  4MN6 A;  3VE3 A;  2HF6 A;  3RH8 B;  4ARZ A;  5TBM B;  3EWK A;  1OT6 A;  3UMD A;  1LL8 A;  5HD5 A;  1NLZ A;  3NOP C;  3F1O B;  3BQA A;  2QJ5 A;  3MMH A;  4HP9 A;  4DN0 A;  1UWN X;  4ME4 A;  4HJ6 A;  4EQ1 A;  1JNU A;  1OTI A;  3C38 A;  3C2W A;  3NOT C;  2PD8 A;  4Q0I A;  4HJ4 A;  4EER A;  2B18 A;  3LIC A;  3JVV A;  3LI8 A;  1GSV A;  2JKR M;  4R70 A;  5L8M A;  4H6J B;  2JN7 A;  1OJG A;  3ZYT A;  3K2N A;  2OOL A;  4AFI A;  1S1Z A;  3FG8 A;  2EWV A;  2IA2 A;  3LIF A;  4UQI S;  4DJ3 A;  4WEL A;  1S66 L;  3RTY A;  3UE6 A;  2WKP A;  2O9A A;  3F1P A;  4NEE D;  3PXP A;  1S67 L;  5DJT A;  5HDS A;  2K7S A;  3P01 A;  2QKP A;  4KQO A;  4Y3I A;  4HH3 A;  4NXF A;  4F3L A;  5AVF A;  4EU0 A;  3BJN A;  5LBR A;  1X0O A;  4LLO B;  2VX8 A;  3UB6 A;  4Q0J A;  1XFN A;  3BWL A;  4G3W A;  4O8G A;  5TJJ A;  1NWZ A;  4I3J A;  4B9O A;  3T4K A;  2I9V A;  4JGQ A;  4L0L A;  2VEA A;  2W3H A;  4MMN A;  4CLC E;  4Y2F A;  3UME A;  2GNX A;  2XSS A;  3V67 A;  4EET B;  4BBV A;  3T4T A;  1MC0 A;  1S1Y A;  3T4S A;  1TF1 A;  3RFB A;  1WA9 A;  4L9E A;  2H28 A;  1LSV A;  2OAP 1;  4B93 A;  2KDK A;  3DBA A;  1W63 M;  5AJG A;  3UB8 A;  3TE8 A;  4NXB A;  1UWP X;  5HDD A;  4XT2 A;  2L1M A;  1T1A A;  4MN5 A;  3VOL A;  1F98 A;  1T1C A;  2HJE A;  3PHY A;  3LYX A;  2JHE A;  2ZOH A;  4GLQ A;  4Z1W A;  3TW8 A;  5DKK A;  4EEU A;  2JKT I;  3LFV A;  2D01 A;  3D72 A;  3SW1 A;  3MFX A;  5TBM A;  3BY8 A;  3PBR A;  1P97 A;  2HGV A;  2BAS A;  2M1C A;  2KOI A;  3F1O A;  3S7P A;  2GX5 A;  4HIA A;  2PYP A;  5DKL A;  3E98 A;  2DMW A;  3BY9 A;  3JVU A;  1NLY A;  2J80 A;  2XRN A;  5MC7 A;  2PYR A;  2VGL M;  4H6J A;  2O9B A;  4P6Z S;  4NKP A;  3CUE C;  2W3G A;  2ZOI A;  3TRC A;  3E4Q A;  4WF0 A;  4JGP A;  3CAX A;  3EGX C;  4O0P A;  3CWF A;  4ETX A;  1DP6 A;  2QHK A;  2VLG A;  4LPZ A;  3UB9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...