4GB7A

Putative 6-aminohexanoate-dimer hydrolase from bacillus anthracis
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
388
structure length
388
Chain Sequence
TTPSKNNVTKKNWLDDPYLRWSYTHMKEFTLINDVKNNPDQIARFPSALQNLDDFAVQRRFGSATPLKELLDDNKTDAFVVVHNGQLVYERYFNGYNESEPHGMASLAKVFTGAIIQSLAEENRIDLEKTADTYIKELKNTPFGKATLQQLMDMQVSVEYPTHGYEHPALENQDAQLYLASNILPRDKNYDGPMKIYDMLQEAKETAPPGSVFSYNNGSTETLAWIIRTITGKSLAENVSERIWSQIGMEENAYYVTDETKIEQASAGLNATARDMARFGQLLLNNGEYNGKQILPSSITEDIKNVQEGELAIGPGASISYHNQWWIPHNEQGAFEVLGSYGQTLYIDPKAKMVIVHFSSNATPSNEIHSVYSNMYIDIAHHLEKLPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 6-aminohexanoate-dimer hydrolase
publication title Putative 6-aminohexanoate-dimer hydrolase from Bacillus anthracis.
rcsb
source organism Bacillus anthracis
total genus 118
structure length 388
sequence length 388
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4gb7A00
3NC8A 1N4OA 2ZMAA 4LV3A 4P87A 4HEFA 3IF5A 2P9VA 5EE8A 1IYSA 4KZ3A 2RL3A 1MWSA 3HLWA 1FR1A 4QY5A 3ZVWA 3Q82A 1LLBA 3OPHA 4P85A 4Y0TA 2Y55A 1LL9A 1HTZA 2VGJA 5DF8A 5FAPA 5A93A 2WAFA 2WKIA 2ZC5B 2V2FF 1RCJA 2V1ZA 3O88A 5DTTA 1K25A 1W79A 5A92A 4BD1A 2WKEA 1E3UA 2HDUA 2XK1A 5CECA 3N8LA 4UHUA 2A3UA 2Y2QA 2WGWB 3RXWA 4KZ6A 1FCOA 1H5XA 3HBRA 4LENA 3OCNA 4NK3A 1Q2PA 4BENA 4WZ4A 3S22A 4DE3A 5KSCA 1EI5A 1RGZA 1PWCA 1E4DA 2BG1A 1VQQA 3IHAA 5EUAA 3TOIA 3FV7A 3SH7A 3HLCA 3BFGA 3O87A 5KZHA 5HAQA 5EECA 2Y2PA 3UO9A 3MZEA 4EUZA 3MXRA 1QMFA 2Y2KA 1JWVA 5FI7A 4N92A 5EVIB 4IVKA 4DE0A 4MBKA 4N1XA 2ZLYA 4K0WA 2Q9MA 3V3SA 3A3IA 3DW0A 2ZM0A 1H8ZA 1IYOA 1SDEA 3G2YA 5CEBA 3A3JA 4ZDXA 1PW1A 4X56A 2UWXA 1PWDA 3B3XA 2HP9A 2Y2OA 1BLSA 5F1GA 1GHPA 3NDEA 4KZ7A 4FH4A 5CHMA 1NRFA 3SH9A 4EQIA 3GVBA 5JYOA 4QD4A 4JXVA 1YLWA 4ID4A 4KG2A 3VSKA 4WMCA 1NZUA 1SCWA 1XXMA 2ZC3B 3VOZA 5E2GA 3VMAA 3BFDA 3G34A 4C75A 2XH9A 4Y0UA 3A3FA 3E2LA 3N4IA 4WEJA 5FI6A 3ZG8B 3NCKA 1S0WA 3ZG7B 3ZGAB 5IHVA 4N9LA 3Q7VB 4UA9A 3HL9A 2IWDA 5DF7A 1BT5A 5E2EA 4WYYA 1CI9A 3V39A 1ONHA 3G35A 3E2KA 1NY0A 3PBRA 3NIAA 1IYQA 1M40A 2WGWA 4KG5A 1K56A 4WZ5C 5FI2A 1MWTA 4E6WA 2EX2A 1E3UD 3IQAA 5DTSA 3WS1A 4QU3A 4S2KA 3PAGA 3TG9A 3GR2A 4PMAA 4OPQA 3GV9A 3DWZA 4GNUA 3A3EA 3GTCA 4UAAA 5FASA 4PM8A 1SDNA 3MKFA 3M2KA 1KE3A 3FYZA 3Q81A 3IXGA 1HVBA 1QMEA 5EVIA 1W8QA 1XA7A 3ZHHA 5GLDA 3HUMA 3ZFZA 1KGFA 3HLFA 5M19A 2XGNA 5FQMA 1YLPA 1JWPA 1N9BA 3PBSA 3BFCA 4OLDA 5FQQA 4EV4A 3MFDA 3PBNA 1AXBA 5FQKA 5HX9A 3IF6C 4E3IA 5DVAA 2FFYA 3UPOA 1KDWA 2JE5A 2XEPA 4OOYA 1K57C 3O3VA 3TSGA 2WKHA 3QHYA 5AQ7A 1IYPA 3QNBA 1LHYA 1XKZA 4OPRA 3OPPA 4X68A 1C3BA 1K55C 3VP2A 3FKWA 2XD5A 2C5WB 2PU4A 2Y2LA 3IXBA 2IWCA 5HAIA 4K0XA 2EXAA 1BTLA 4JF4A 1PYYA 2V20A 4WMCD 3RJUA 3UPNA 5EVLA 2WK0A 4WELA 1O07A 4DDSA 1MWRA 1I2WA 4OONA 2X01A 4S2IA 3Q7VA 3WRTA 4ZTKA 3CJMA 4Y7PA 2XQZA 3V3RA 3C4PA 1PWGA 3G32A 1ES4A 2RCXA 5E2FA 5FQJA 2IWBA 2OV5A 1BZAA 4GD8A 4B88A 5KMWA 2DCFA 1DJCA 5E2HA 5M1AA 4S2LA 4U0TA 3HLGA 3UY6A 5BOHA 2Z2LB 3VFHA 3VP4A 4E3LA 1HZOA 5CTMA 5EOOA 4A5RA 4JF6A 5FQ9A 4MNRA 1KVLA 2Y91A 2EX6A 4U3TA 4OQ0A 4FSFA 2ZJ9A 3HUOA 5GHZA 3FZCA 2Y2HA 3ZG5A 4DXBA 1LL5A 1MKIA 5CHUA 4QHCA 3G2ZA 2H0YA 5F82A 3W4OA 1FSYA 4DKIA 2Y2MA 1IEMA 3FWLA 1ESUA 5D3OA 1ES3A 1CK3A 2Y59A 2J7VA 3ZNYA 1K6RA 3NBLA 5HFOA 1YQSA 1L0FA 4S2MA 1BSGA 3CZDA 3GRJA 4UA7A 4Y0OA 4E3MA 1GHIA 1MXOA 4MBFA 1FQGA 4S2JA 1KE0A 3BLSA 3IF6B 1YLTA 4JXSA 2X02A 1TDLA 1PI4A 4ZAMA 3VP3A 1K38A 3PBQA 4ZBEA 3VFFA 1MBLA 3O86A 1DJAA 2Y4AA 4S2PA 1K54C 1FR6A 2CC1A 4BD0A 4CJNA 1SHVA 3VP0A 2PBYA 2QZ6A 2WADA 3BM6A 3BLMA 5E43A 3WS0A 3UDFA 4ZJ3A 2ZC6B 4DF6A 4EWFA 2HDQA 2Z2MB 5FAQA 1DY6A 1Y54A 4P0MA 1W5DA 1ALQA 2Q9NA 3UNWA 2FFFB 3NI9A 4X6TA 3CMZA 4JXWA 4C3QA 1YLZA 4BL2A 5CGXA 3MXSA 5FDHA 4MBHA 1RGYA 2HP6A 4ZJ1A 3HLDA 3LEZA 2EXBA 4BL3A 1SKFA 4WZ5A 4RYEA 1ONGA 3ZDJA 4E3JA 3N7WA 5JYPA 2Y2IA 1PZPA 1NYYA 5GL9A 1K4EA 3EQVA 2EFUA 3WS5A 1FCMA 4BLMA 4IBXA 4LV0A 1BLPA 4O7DA 3Q1FA 4RA7A 4GOGA 3C7VA 3LY4A 1L0EA 4E3OA 4PM9A 1W7FA 4K91A 4U0XA 4CPKA 3V50A 2QMIA 2I72A 3ZG9B 3P98A 4OOLA 4S2NC 3Q7ZA 1Z6FA 3IF6A 3SS3A 5GLAA 1KDSA 2P9VB 4EBNA 1MY8A 4KQQA 2XFTA 1K57A 3AGFA 1XX2A 3M6HA 3UDXA 2J8YA 4Q8IA 2HDSA 5M18A 3IHBA 3ZG0A 1NYMA 4XUXA 1ES5A 4FD8A 4MEZA 2ZQAA 4X53A 3UPPA 1K6SA 4DXCA 4OQIA 5KSHA 5A91A 1BUEA 1L0GA 1U60A 1GA0A 1PZOA 3W4QA 3FKVA 1ZG4A 4KZ5A 4OPZA 5GHYA 2ZC4B 3W4PA 2BLSA 4XXRA 3PTEA 1FOFA 3C5AA 4R1GA 3JYIA 4GB7A 1BULA 1EROA 1FCNA 2WAEA 4R0QA 2ZQ7A 2HDRA 4EBPA 5HL1A 1ZC2A 2JCHA 4PM7A 2EX9A 2WGVA 4IVIA 4QY6A 4KG6A 5CXWA 2Y2GA 4KQRA 4KENB 1TDGA 1S6RA 2Y2NA 4DRTA 1YMSA 5CERA 3SS4A 4PPRA 1JWZA 5TGFA 5CGWA 4RX3A 5GLCA 2JBFA 3OPLA 3VOYA 3G4PA 2A49A 2XFSA 1ESIA 1K56D 2XF3A 1GCEA 4Z9QA 1DJBA 2R9WA 4B4ZA 2H10A 4EBLA 1XGIA 1ES2A 3BFEA 2EX8A 1WE4A 3IH8A 1XPBA 1J9MA 1H8YA 3N8RA 3EQUA 4BQMA 4DDYA 2WUQA 4HBTA 5CGSA 4OH0A 4WEKA 2WYXA 3IT9A 5CHJA 3S4XA 3WWXA 1IELA 1L2SA 4NETA 4P6BA 5AQ9A 5EVID 5FAOA 3M2JA 3IXDA 4R23A 4R4RA 4OVDA 3GMWA 4RX2A 2QPNA 4D2OA 2B5RA 2ZQ8A 4PM5A 2G2UA 4UA6A 4OKPA 4S2OA 4HESA 1FSWA 1ZG6A 4JBFA 4KQOA 5TFQA 2JC7A 3PAEA 2ZD8A 1IKGA 4HBUA 2J9OA 1I2SA 3Q07A 1OMEA 2X71A 3SS5A 5F83A 5FATA 1LI9A 2ZC7A 4GDBA 4OP8A 1WYCA 3UE0A 1K54A 3OZHA 2ZM8A 1G6AA 3UE1A 1RP5A 1GHMA 3BFFA 3G31A 3OC2A 3C7UA 3MBZA 2DRWA 1YT4A 2ZM2A 3PBOA 5AQAA 2HP5A 4R3BA 3IWQA 4JKTA 4E3NA 1NJ4A 3M6BA 2ZQDA 3LY3A 1KE4A 3CG5A 3PBTA 1ZKJA 3IWIA 4ZJ2A 1XA1A 5DTKA 5FA7A 5FSRA 3WS4A 4OPYA 3OPRA 4LV2A 3S1YA 4F94A 5CTNA 3QNCA 1KGEA 2PU2A 1JTGA 2DNSA 4BJPA 1CEFA 4YFMA 5EPHA 2C6WB 3V5MA 3A3DA 3N6IA 2HPBA 2R9XA 1NZOA 4OP5A 2J9PA 1TVFA 1TEMA 4E3KA 3C4OA 2WZXA 3BECA 5HAPA 3WS2A 3ZNTA 1E25A 2ZQCA 3BRMA 4YINA 3ISGA 1BLCA 3HREA 4JPMA 5A90A 3ITBA 2E8IA 3HLEA 1L0DA 1O7EA 1HD8A 3DWKA 3NY4A 3BEBA 5U47A 3UE3A 4QJGA 1YLYA 2H5SA 1EWZA 3IH9A 3SH8A 2XR0A 3LO7A 2OLVA 4S2NA 4R3JA 1WYBA 3G30A 1Q2QA 5FQIA 5DF9A 1ERQA 1GA9A 3ZVTA 4B4XA 2ZQ9A 3VP1A 5HW3A 3UN7A 1PI5A 2XLNA 3MZDA 3OCLA 4IBRA 5GHXA 2EFXA 4X69A 5G18A 4H8RA 4LV1A 1PIOA 3D4FA 4GD6A 4X55A 4QB8A 3IXHA 1CI8A 4GN2A 5GLBA 1M6KA 3ZCZA 3HLBA 1K55A 1BLHA 5J8XA 1ERMA 5AQBA 3VSLA 4JLFA 4IEDA 4KZ4A 5HARA 4DE1A 3WRZA 2XDMA 3BYDA 4RVAA 5CRFA 5CEDA 1KVMA 1YM1A 4OOMA 1XGJA 2OLUA 4M3KA 5EVIC 4KZ9A 4MLLA 3NDGA 3SOIA 4OQHA 1K4FA 1YMXA 4WBGA 4WM9A 4OQGA 4XUZA 1YLJA 5L2FA 3DTMA 1JVJA 3HUNA 1KGGA 1W8YA 3MKEA 1IKIA 4N9KA 1MPLA 3I7JA 4GZBA 5F1FA 1NXYA 4FH2A 3IWOA 3P09A 4C6YA 4GDNA 2VGKA 4FCFA 5TR7A 2OSUA 1PW8A 4OLGA 1LI0A 2G2WA 1MWUA 2Y2JA 4DE2A 2GDNA 1VM1A 3N8SA 3W8KA 4LCLA 3ITAA 1JTDA 4L0LA 4KZAA 4JXGA 3HVFA 4JF5A 3GQZA 3UDIA 2WZZA 1G68A 4E6XA 4KZ8A 1I5QA 4R4SA 3AGEA 4LCMA 2P74A 4PM6A 5I94A 1CEGA 3GSGA 4GKUA 2WGIA 3MZFA 5EOEA 2H0TA 3AGDA 4N1HA 4KZBA 2XD1A 3LCEA 3RXXA 1XP4A
chains in the Genus database with same CATH superfamily
2ZMAA 3IF5A 1MWSA 4QY5A 1XJ6A 3T1SA 1LL9A 1HTZA 2VGJA 5FAPA 5A93A 2V1ZA 3FPWA 1W79A 4LLOB 4LENA 5KSCA 2LB9A 1PWCA 1E4DA 1IFQA 2BG1A 3SW1A 3SH7A 3UO9A 2Y2KA 4N92A 4DE0A 3A3IA 3DW0A 1SDEA 5CEBA 3A3JA 4ZDXA 1PW1A 4HQAA 2UWXA 1BLSA 4KZ7A 1NRFA 3SH9A 5JYOA 4JXVA 4WMCA 3PYPA 3BFDA 3G34A 3EEAA 4CLCC 4WEJA 3E2LA 4KQDA 3ZGAB 4UA9A 3HL9A 2EA9A 4WYYA 4KG5A 4E6WA 1MWTA 2EX2A 3RFBA 3TG9A 3GR2A 4PMAA 4I3IA 3UB5P 3GV9A 3Q81A 1XA7A 4EETB 3HUMA 3MFDA 3MXQA 3PBNA 1AXBA 5HPIA 3UPOA 2JE5A 2XEPA 1K57C 3O3VA 3QHYA 5AQ7A 3K2NA 4OPRA 3FKWA 2C5WB 4K0XA 4JF4A 1BTLA 1EW0A 3UPNA 5EVLA 1O07A 4OONA 3CJMA 2KDKA 4Y7PA 5E2FA 2OV5A 4GD8A 4PHTA 1DJCA 5E2HA 2JKRM 3LICA 3UY6A 2Z2LB 1LL8A 1HZOA 5EOOA 4JF6A 3CUEC 3DBAA 1KVLA 4OQ0A 2ZJ9A 3FZCA 4DXBA 4QHCA 3G2ZA 2H0YA 3E4PA 1FSYA 4NXBA 3FWLA 2W27A 3EOIA 3UMEA 1CK3A 1OJ5A 2PR6A 4Z1WA 3NBLA 2QYBA 1L0FA 3CZDA 4Y0OA 1GHIA 1FQGA 4S2JA 3IF6B 1YLTA 4JXSA 1TDLA 4ZAMA 1K38A 3NJAA 4ZBEA 3T50A 3VFFA 3S7PA 1MBLA 1DJAA 1DP9A 1K54C 1CQAA 4BD0A 3EGXC 3BLMA 4LFUA 2HDQA 2Z2MB 1Y54A 3NI9A 4X6TA 4C3QA 4BL2A 5FDHA 2HP6A 4ZJ1A 3T4TA 3MQQA 4E3JA 4Y17A 2I9VA 4EESA 3IX3A 1PZPA 2EFUA 2D02A 2L1MA 4IBXA 4O7DA 4GOGA 4LPZA 2J3WA 1L0EA 4HP9A 3V50A 3ZG9B 1IOUA 4S2NC 2ZL1B 3IF6A 3SS3A 2ACGA 1OTBA 5GLAA 3T1RA 2XFTA 1XX2A 3M6HA 4G3KA 4EEPA 4Q8IA 5M18A 3ICYA 4MDZA 4XUXA 4MEZA 2ZQAA 4OQIA 1L0GA 1PZOA 3W4QA 1ZG4A 4OPZA 3BQAA 3W4PA 2BLSA 1FOFA 1BULA 4PM7A 2EX9A 2GNXA 2WGVA 4QY6A 2Y2GA 4KQRA 5F5YA 4KENB 4DRTA 4KUKA 3P01A 1JWZA 4MN7A 4ETXA 5TGFA 2XSSA 5GLCA 3LEQA 2OWHA 5HL6A 1K56D 2XF3A 4Z9QA 4B4ZA 5HWWA 2H10A 1XGIA 3BFEA 2EX8A 4EUVA 2VX8A 2ZL1A 1YKDA 3QP5A 3H9WA 3T12B 5CX7A 4MCWA 4OVDA 4R4RA 4NKPA 3IS2A 2G2UA 2W3EA 2J9OA 1OMEA 3SS5A 2ZC7A 1WYCA 3NHQA 3OZHA 2ZM8A 3LFVA 3P7NA 1GHMA 3BFFA 3MBZA 2ZM2A 5DKKA 1DP8A 4IHQA 3IWQA 4E3NA 3LY3A 4B9OA 1ZKJA 3IWIA 5FSRA 3E0YA 3PXPA 3S1YA 1CEFA 2C6WB 3N6IA 2HPBA 2R9XA 1NZOA 2J9PA 1TVFA 3NULA 4GW9A 4MMNA 4JPMA 4MN5A 1O7EA 3UE3A 5U47A 1D1JA 1EWZA 3R7WB 1WYBA 4JGPA 3TW8A 5DF9A 4B4XA 5HSQA 5HW3A 3B33A 5EV0A 2XLNA 3MSHA 5G18A 5FL3A 1S67L 5AJGA 3D4FA 4GD6A 4QB8A 1CI8A 4GN2A 1P97A 5AQBA 4JLFA 4WUJA 4KZ4A 5HARA 4DE1A 4RVAA 4EW7A 5CEDA 1KVMA 1YM1A 1XGJA 4CLCD 4M3KA 5EVIC 2XA7S 5IU1A 2LB5A 4YWZA 4OQGA 3DTMA 1JVJA 3VOLA 1MPLA 3I7JA 4GZBA 3IWOA 4C6YA 4GDNA 2G2WA 2GDNA 3N8SA 2WKRA 4LCLA 1JTDA 4KZAA 4JXGA 1HLUP 3HVFA 3GQZA 4O0PA 3R7WA 4E6XA 4KZ8A 4F3LB 4R4SA 3AGEA 4LCMA 1F5MA 5EOEA 4N1HA 2XD1A 2XRNA 2A49A 1XP4A 4P87A 3LYXA 4HEFA 5EE8A 2RL3A 3HLWA 3Q82A 3OPHA 4Y0TA 1S1YA 1F98A 2G7UA 2ZC5B 3OOVA 3KYZA 4ESPA 3O88A 2OAP1 1K25A 2FH5A 4BD1A 2XK1A 3FPVA 3LIEA 4KZ6A 1FCOA 2YKHA 1ACFA 3S22A 1EI5A 3TOIA 3FV7A 5I5LA 3BFGA 5HZHA 5KZHA 2WKQA 5EECA 2Y2PA 4EUZA 3MXRA 1P0ZA 4MBKA 4PAUA 2Q9MA 3VE4A 2ZM0A 4QPRA 4FH4A 3LR5A 1YLWA 4ID4A 3VSKA 2ZC3B 3VOZA 3VMAA 3A3FA 3B42A 3NECA 3NCKA 1OTIA 2ZMFA 3Q7VB 1ONHA 3G35A 4YNRA 2D01A 3KSGA 1K56A 4WZ5C 1VEUA 4O01A 1E3UD 1GSXA 3IQAA 1YSQA 5IT5A 2JKFA 4H6JA 3DWZA 1OTAA 3A3EA 3E98A 4UAAA 5FASA 4PM8A 3C30A 3IXGA 2CMNA 1QMEA 2HZ5A 1W8QA 4HH2A 3ZHHA 3FC7A 2XGNA 5FQMA 3DTKA 4OLDA 4IJGA 5G4ZA 1T18A 4UQIS 5HD3A 2ZOHA 2FFYA 1W63Q 1OPXA 1G28A 3TSGA 1IYPA 4X68A 1K55C 1NLZA 2XD5A 2Y2LA 3IXBA 2IWCA 5HAIA 3ZYTA 4NXEA 4WELA 4EXOA 5K5BA 1I2WA 5G4YA 4S2IA 3Q7VA 4ZTKA 3S7QA 5L10A 2XQZA 3C4PA 5LBRA 4CLCB 3G32A 1ES4A 2IWBA 4B88A 5KMWA 2DCFA 3A0SA 3HLGA 3PR6A 3VFHA 2V0UA 5CTMA 4A5RA 2L4RA 3H82A 1YPRA 4MNRA 4U3TA 5GHZA 4I3AA 3G6OA 1P9RA 4DKIA 2Y2MA 1IEMA 3KYEA 5D3OA 2J7VA 2VGLS 1K6RA 3EEHA 5HFOA 4S2MA 3BLSA 4RQ9A 4JGOA 1PI4A 4I5SA 4Y3IA 3PBQA 1TS6A 5DJTA 4Y2FA 4S2PA 4FUWA 1FR6A 4CJNA 3CI6A 2QZ6A 2WADA 2VV6A 2P04A 4ZJ3A 2ZC6B 4DF6A 5HPFA 4FTXA 1ALQA 4JXWA 1LT0A 2EXBA 2O9BA 5JYPA 4X1LA 2Y2IA 1NYYA 1FCMA 4BLMA 2V0WA 3Q1FA 1T19A 4U0XA 3MQ0A 3HJKA 5FDSA 3Q7ZA 1Z6FA 4HY8A 4ARZB 2PAVP 2P9VB 3UB6A 4KQQA 1K57A 1ODVA 4EQ1A 3ZG0A 1NYMA 1T1CA 3NOTC 2J3TC 1F9IA 1GA0A 5L07A 4KZ5A 1VHMA 2ZC4B 4G3VA 3PTEA 3JVVA 3C5AA 5HL1A 4O8GA 4KG6A 1XFNA 3QP4A 3UMDA 1STZA 2Y2NA 3T4QA 3G4PA 4HIAA 4K08A 4EBLA 1ES2A 1XPBA 1J9MA 1H8YA 3EQUA 4DDYA 4YOFA 4HBTA 3LR3A 3WWXA 1IELA 3T4KA 5AQ9A 5EVID 3HCYA 3IXDA 4R23A 4GLQA 3GMWA 2QPNA 4E04A 4PM5A 4UA6A 3L7HA 4JBFA 1FSWA 1ZG6A 1I2SA 3Q07A 2X71A 1LI9A 4GS9B 3LUQA 1K54A 4X1MA 2EWWA 5AQAA 4JKTA 2V8FA 2BTFP 3LI9A 3D9YA 3K3CA 1XA1A 3ULFA 1N9LA 4F94A 4I3JA 3W2ZA 2DNSA 4PKYG 4BJPA 4YFMA 2EWVA 1TEMA 2W1TB 3C4OA 3WS2A 1E25A 3BRMA 2DMWA 3HREA 3HLEA 3CPTB 1L0DA 5J7EA 3BEBA 3OLOA 1ZTUA 3VV4A 2H5SA 3LO7A 4S2NA 4I38A 5HD5A 1Q2QA 4L9FA 1GA9A 1LSWA 1OT6A 3MZDA 5GHXA 3CHWP 5F69A 4H8RA 4X55A 3IXHA 5GLBA 2Y8HA 2PR5A 4R70A 4IEDA 3BYDA 4HP4A 3NDGA 5AVFA 1D7EA 1K4FA 5L2FA 4XUZA 1ZHHB 3QP8A 1W8YA 5C5KA 1IKIA 3P09A 2OWJA 2W1TA 2ZMVA 3QP6A 3BY9A 1MWUA 3TRCA 1L3LA 1VM1A 3W8KA 2QHKA 3ITAA 1H0MA 1CF0A 2WZZA 1G68A 2Q0OA 4DJ3A 4PM6A 1CEGA 4GKUA 2WGIA 3SOIA 4IUKA 1N4OA 4LV3A 1IYSA 3ZVWA 1FR1A 4P6ZM 3CLOA 4GJ4A 1LLBA 3DTIA 4P85A 5DF8A 2PD7A 2WKIA 2NUTC 1H8MA 5A92A 3B47A 3ZQ5A 4UHUA 5CECA 2A3UA 3RXWA 4II7A 3HBRA 3OCNA 4NK3A 1Q2PA 4BENA 4DE3A 4B93A 1RGZA 5EUAA 1VQQA 3RTYA 3HLCA 3O87A 5HAQA 1T1BA 5HDSA 3MZEA 1QMFA 4LRXC 5EVIB 2ZLYA 3V3SA 5HWVA 1IYOA 3G2YA 1Y28A 3MF0A 3B3XA 3IX8A 2HP9A 5F1GA 1GHPA 3NOUC 5CHMA 4EQIA 3GVBA 4KG2A 3F1PB 4BBTA 3EGDC 5EM0A 4C75A 4Y0UA 3N4IA 3ZG8B 1S0WA 3ZG7B 5IHVA 2VLGA 2IWDA 5DF7A 1BT5A 5E2EA 1CI9A 3S7NA 3E2KA 4BMWA 1NY0A 1WA9A 2HF6A 3NIAA 1IYQA 3C38A 1OTDA 5AVEA 3WS1A 1UGUA 4QU3A 4S2KA 3PAGA 4OPQA 4L9GA 1XJ3A 4GNUA 4G3WA 3MKFA 1KE3A 2PBDP 1HVBA 4Q0HA 5EVIA 4BBUA 4JGRA 5EFWA 2IA2A 3ZFZA 1KGFA 3HLFA 1YLPA 1JWPA 1N9BA 5IS1A 3SZTA 5FQKA 5HX9A 4QWOA 4E3IA 5DVAA 1G6OA 1KDWA 4OOYA 1CJFA 4GHIB 3FG8A 1XKZA 2KLIA 3F1PA 2PU4A 2EXAA 2PYRA 1PYYA 4WMCD 3RJUA 1P9WA 2WK0A 4DDSA 1MWRA 2AVXA 3KSFA 2W0NA 2X01A 1VB6A 1OT9A 2GX5A 3MS6A 3KSHA 2RCXA 5FQJA 5TBMB 5BOHA 3MMHA 3TJZC 4BBVA 3IX4A 4HHDA 2J3TD 2FZ0A 2EX6A 5HDCA 2Y2HA 3U4LP 1MKIA 5F82A 3S7OA 3W4OA 4D60A 1NLYA 1ESUA 2Y59A 3ZNYA 1YQSA 2PYPA 4GHIA 1BSGA 3GRJA 4MN6A 4JGQA 4MBFA 2PT7A 1KE0A 5TJJA 2Y4AA 3BQ8A 4F3LA 3UB9A 2W3DA 1S1ZA 2PBYA 3BM6A 4R3AA 3WS0A 3UDFA 4PKYA 5FAQA 1DY6A 1W5DA 4FOFA 2Q9NA 3UNWA 2FFFB 2E8JA 3LGOA 3MXSA 4BL3A 4WZ5A 4RYEA 1ONGA 3ZDJA 5GL9A 3T1XA 1K4EA 2Z6CA 2VZWA 5FEGA 3MFXA 1T1AA 4R38A 4LV0A 1BLPA 5MC7A 3CITA 3C7VA 2BASA 3UB7A 4CPKA 2I72A 3P98A 4EEUA 2NUPC 3LR4A 1KDSA 4EBNA 3GECA 5FEFA 1MY8A 3A0RA 3D3OA 3BY8A 2HGVA 2W3GA 2W3FA 4FD8A 5KSHA 3UPPA 1K6SA 5A91A 1BUEA 1TS0A 5HWTA 2INWA 4XXRA 3T4LA 4GB7A 1EROA 1FCNA 2WAEA 4R0QA 2HDRA 1ZC2A 2JCHA 4NXFA 4IVIA 2K7SA 5CXWA 4I39A 4L9EA 4KUOA 4AFIA 4ZRRA 3NOPC 5CERA 3SS4A 4PPRA 4Y13A 3DAVA 2P7JA 2V1AA 4RX3A 3KYQA 2JBFA 3OPLA 3VOYA 1ESIA 1DJBA 2R9WA 3LIBA 2PRFA 1WE4A 5CGSA 1XFQA 3MQOA 4OH0A 3S4XA 4P6BA 4WLAA 5FAOA 3R4KA 3T4SA 3A0VA 4UEYA 4OKPA 4S2OA 1KOUA 4HESA 4KQOA 5TFQA 2JC7A 1H3QA 1V9ZA 4HBUA 1NRJA 5FATA 3UE0A 1RP5A 4XT2B 2DRWA 3PBOA 2HP5A 4R3BA 2B95A 1NJ4A 3M6BA 2GZAA 4CLCA 2ZQDA 1KE4A 2J80A 3PBTA 2ZBBA 5FA7A 3WS4A 3MR0A 3OPRA 2GJ3A 4LV2A 5CTNA 1W63M 1MKMA 3A3DA 3F1OB 4DMZA 2O9AA 4OP5A 2QWSA 4E3KA 1SZVA 5HAPA 4YINA 3ISGA 5A90A 5DJUA 2E8IA 5KIZA 4QJGA 3NY4A 3DWKA 2VKSA 2KOIA 1TS8A 3IH9A 3SH8A 2HV1A 1N9NA 1VETB 5FQIA 1ERQA 3BW6A 3VP1A 1PI5A 3T1QB 1PIOA 4EU0A 4XT2A 1M6KA 3HLBA 1BLHA 5J8XA 2OOLA 3WRZA 2XDMA 3MJQA 4HJ3A 2A2LA 4OOMA 2OLUA 2UV0E 2JN7A 2V1BA 4OQHA 1YMXA 4WM9A 1KGGA 3F1OA 3MKEA 4HJ6A 4N9KA 5F1FA 4FH2A 5TR7A 1PW8A 2VV7A 4OLGA 3F1NB 1LI0A 2Y2JA 4DE2A 3BJNA 3CUEA 1TF1A 1I5QA 1VETA 2OAQ1 3U2AA 5I94A 4WL9A 3MZFA 2M1CA 4CLCE 3AGDA 3LIFA 4KZBA 4EWFA 4ARZA 3NC8A 1PNEA 2P9VA 1YAXA 4KZ3A 5L8MA 2Y55A 2WAFA 2JKTI 2V2FF 1RCJA 1YSPA 3E4QA 2R78A 5DTTA 4Q0IA 2WKEA 1E3UA 2HDUA 3N8LA 2O0YA 2V8CA 4CQHA 2Y2QA 2WGWB 3KO6A 4WZ4A 3IHAA 3L9KA 1FILA 1FIKA 3GDIA 1V9YA 2JKGA 1JWVA 3F1NA 5FI7A 3HJIA 4IVKA 2M7UA 4N1XA 1XJ4A 4K0WA 3K3DA 2VJWA 1H8ZA 1XJ2A 3LR0A 4Y5FA 4X56A 1PWDA 4X25A 2Y2OA 2QJ5A 3NDEA 2QJ7A 4QD4A 1NZUA 1XXMA 1AWIA 1SCWA 5L09A 5E2GA 2XH9A 1JNUA 2YKFA 5FI6A 1TS7A 2XROA 4N9LA 3LIDA 1PFLA 2K31A 4HNBA 1K0KA 3V39A 1A0KA 4NG2A 1G5UA 4GS9A 2W3HA 3PBRA 1M40A 2WGWA 5FI2A 5DTSA 1BYWA 2O9CA 5J4EA 2HJ9C 2K2NA 3GTCA 5HDDA 1SDNA 3M2KA 3FYZA 1J3WA 5GLDA 3D72A 5M19A 2VV8A 1TD5A 3PBSA 3BFCA 5FQQA 4EV4A 3IF6C 5DFYA 3IS2B 2M7VA 3CAXA 2WKHA 3QNBA 1LHYA 3OPPA 2PHYA 1C3BA 3VP2A 3CPTA 2V20A 3H7WB 3UE6A 3WRTA 1N9OA 1PRQA 3V3RA 4DN0A 1PWGA 3JPUA 1BZAA 4ME4A 5M1AA 4S2LA 4U0TA 2VA0A 3VE3A 1DRMA 2VEAA 3KX0X 3UB8A 3VP4A 4E3LA 5FQ9A 2Y91A 4FSFA 3EWKA 3HUOA 3ZG5A 1LL5A 5CHUA 1OTEA 2ZOIA 4WF0A 1ES3A 4UA7A 4E3MA 2P08A 1MXOA 5DKLA 2XA7M 4EERA 2X02A 1MZUA 2PD8A 3H7WA 3VP3A 3O86A 2CC1A 1SHVA 3VP0A 5E43A 3C8CA 4LRYC 1F2KA 4P0MA 4HOIA 3CMZA 3QP1A 1YLZA 5CGXA 4MBHA 1RGYA 3HLDA 3LEZA 1SKFA 5J3WA 4DJ2A 3N7WA 3LIAA 2A24B 3EQVA 3LI8A 3WS5A 1NWZA 4P6ZS 5A8BA 4RA7A 3LY4A 4E3OA 4PM9A 1W7FA 4K91A 2QMIA 4OOLA 4LGWA 3OBFA 1SKOB 5EVEA 3AGFA 3UDXA 3T4JA 2J8YA 2HDSA 3BWLA 3IHBA 1ES5A 4X53A 4DXCA 1GSWA 1U60A 3FKVA 3C2WA 5GHYA 4HH3A 5F6AA 4R1GA 3JYIA 2ZQ7A 4EBPA 3O5YA 1S4SA 1TDGA 1S6RA 1YMSA 5EM1A 2A24A 1OJGA 5CGWA 2XFSA 5F68A 1GCEA 2JKRI 1X0OA 2Z6DA 3IH8A 3KSIA 2JHEA 3N8RA 4BQMA 2WUQA 5DFXA 4WEKA 2WYXA 3IT9A 5CHJA 1L2SA 4NETA 1SKOA 1Y4OA 3M2JA 2JKTM 4RX2A 1MC0A 4D2OA 2B5RA 2O99A 2ZQ8A 4LRZE 3PAEA 2ZD8A 1IKGA 5F83A 4GDBA 1UWNX 4OP8A 4BWIA 1G6AA 1VEUB 2KX6A 3UE1A 4UQIM 3G31A 3OC2A 3C7UA 1YT4A 2B02A 2L0WA 4H6JB 3CG5A 3IBRA 4WN5A 4ZJ2A 5DTKA 3V67A 5TBMA 4OPYA 3QNCA 2VK3A 1KGEA 2PU2A 1JTGA 1Z09A 5EPHA 3V5MA 2WKPA 2WZXA 3IBJA 3BECA 3T4OA 4ETZA 3ZNTA 3PHYA 2ZQCA 1BLCA 3ITBA 4R6LA 1HD8A 3QP2A 4HJ4A 1YLYA 1LSVA 3CWFA 2XR0A 2OLVA 4GCZA 4R3JA 3G30A 4NXGA 4M4XA 3ZVTA 4IUHA 2ZQ9A 2QKPA 3UN7A 3OCLA 4IBRA 4Y15A 2EFXA 4X69A 2B18A 4LV1A 2VGLM 3ZCZA 1UWPX 2V9AA 1S4RA 1K55A 1ERMA 3VSLA 3JVUA 3H82B 2Y79A 4NEED 5CRFA 1D06A 2W1RA 4KZ9A 4MLLA 3E4OA 1S66L 4WBGA 1YLJA 3HUNA 2MJ6A 4Q0JA 3RH8B 1NXYA 2VGKA 4FCFA 2OSUA 1GSVA 3TE8A 2HJEA 3DTEA 4L0LA 4JF5A 3UDIA 1DP6A 2P74A 3GSGA 2H28A 1LSXA 2H0TA 4HI4A 3LCEA 3RXXA 2PDRA 1H5XA
chains in the Genus database with same CATH topology
3NC8A 1N4OA 2ZMAA 4LV3A 4P87A 4HEFA 3IF5A 2P9VA 5EE8A 1IYSA 4KZ3A 2RL3A 1MWSA 3HLWA 1FR1A 4QY5A 3ZVWA 3Q82A 1LLBA 3OPHA 4P85A 4Y0TA 2Y55A 1LL9A 1HTZA 2VGJA 5DF8A 5FAPA 5A93A 2WAFA 2WKIA 2ZC5B 2V2FF 1RCJA 2V1ZA 3O88A 5DTTA 1K25A 1W79A 5A92A 4BD1A 2WKEA 1E3UA 2HDUA 2XK1A 5CECA 3N8LA 4UHUA 2A3UA 2Y2QA 2WGWB 3RXWA 4KZ6A 1FCOA 1H5XA 3HBRA 4LENA 3OCNA 4NK3A 1Q2PA 4BENA 4WZ4A 3S22A 4DE3A 5KSCA 1EI5A 1RGZA 1PWCA 1E4DA 2BG1A 1VQQA 3IHAA 5EUAA 3TOIA 3FV7A 3SH7A 3HLCA 3BFGA 3O87A 5KZHA 5HAQA 5EECA 2Y2PA 3UO9A 3MZEA 4EUZA 3MXRA 1QMFA 2Y2KA 1JWVA 5FI7A 4N92A 5EVIB 4IVKA 4DE0A 4MBKA 4N1XA 2ZLYA 4K0WA 2Q9MA 3V3SA 3A3IA 3DW0A 2ZM0A 1H8ZA 1IYOA 1SDEA 3G2YA 5CEBA 3A3JA 4ZDXA 1PW1A 4X56A 2UWXA 1PWDA 3B3XA 2HP9A 2Y2OA 1BLSA 5F1GA 1GHPA 3NDEA 4KZ7A 4FH4A 5CHMA 1NRFA 3SH9A 4EQIA 3GVBA 5JYOA 4QD4A 4JXVA 1YLWA 4ID4A 4KG2A 3VSKA 4WMCA 1NZUA 1SCWA 1XXMA 2ZC3B 3VOZA 5E2GA 3VMAA 3BFDA 3G34A 4C75A 2XH9A 4Y0UA 3A3FA 3E2LA 3N4IA 4WEJA 5FI6A 3ZG8B 3NCKA 1S0WA 3ZG7B 3ZGAB 5IHVA 4N9LA 3Q7VB 4UA9A 3HL9A 2IWDA 5DF7A 1BT5A 5E2EA 4WYYA 1CI9A 3V39A 1ONHA 3G35A 3E2KA 1NY0A 3PBRA 3NIAA 1IYQA 1M40A 2WGWA 4KG5A 1K56A 4WZ5C 5FI2A 1MWTA 4E6WA 2EX2A 1E3UD 3IQAA 5DTSA 3WS1A 4QU3A 4S2KA 3PAGA 3TG9A 3GR2A 4PMAA 4OPQA 3GV9A 3DWZA 4GNUA 3A3EA 3GTCA 4UAAA 5FASA 4PM8A 1SDNA 3MKFA 3M2KA 1KE3A 3FYZA 3Q81A 3IXGA 1HVBA 1QMEA 5EVIA 1W8QA 1XA7A 3ZHHA 5GLDA 3HUMA 3ZFZA 1KGFA 3HLFA 5M19A 2XGNA 5FQMA 1YLPA 1JWPA 1N9BA 3PBSA 3BFCA 4OLDA 5FQQA 4EV4A 3MFDA 3PBNA 1AXBA 5FQKA 5HX9A 3IF6C 4E3IA 5DVAA 2FFYA 3UPOA 1KDWA 2JE5A 2XEPA 4OOYA 1K57C 3O3VA 3TSGA 2WKHA 3QHYA 5AQ7A 1IYPA 3QNBA 1LHYA 1XKZA 4OPRA 3OPPA 4X68A 1C3BA 1K55C 3VP2A 3FKWA 2XD5A 2C5WB 2PU4A 2Y2LA 3IXBA 2IWCA 5HAIA 4K0XA 2EXAA 1BTLA 4JF4A 1PYYA 2V20A 4WMCD 3RJUA 3UPNA 5EVLA 2WK0A 4WELA 1O07A 4DDSA 1MWRA 1I2WA 4OONA 2X01A 4S2IA 3Q7VA 3WRTA 4ZTKA 3CJMA 4Y7PA 2XQZA 3V3RA 3C4PA 1PWGA 3G32A 1ES4A 2RCXA 5E2FA 5FQJA 2IWBA 2OV5A 1BZAA 4GD8A 4B88A 5KMWA 2DCFA 1DJCA 5E2HA 5M1AA 4S2LA 4U0TA 3HLGA 3UY6A 5BOHA 2Z2LB 3VFHA 3VP4A 4E3LA 1HZOA 5CTMA 5EOOA 4A5RA 4JF6A 5FQ9A 4MNRA 1KVLA 2Y91A 2EX6A 4U3TA 4OQ0A 4FSFA 2ZJ9A 3HUOA 5GHZA 3FZCA 2Y2HA 3ZG5A 4DXBA 1LL5A 1MKIA 5CHUA 4QHCA 3G2ZA 2H0YA 5F82A 3W4OA 1FSYA 4DKIA 2Y2MA 1IEMA 3FWLA 1ESUA 5D3OA 1ES3A 1CK3A 2Y59A 2J7VA 3ZNYA 1K6RA 3NBLA 5HFOA 1YQSA 1L0FA 4S2MA 1BSGA 3CZDA 3GRJA 4UA7A 4Y0OA 4E3MA 1GHIA 1MXOA 4MBFA 1FQGA 4S2JA 1KE0A 3BLSA 3IF6B 1YLTA 4JXSA 2X02A 1TDLA 1PI4A 4ZAMA 3VP3A 1K38A 3PBQA 4ZBEA 3VFFA 1MBLA 3O86A 1DJAA 2Y4AA 4S2PA 1K54C 1FR6A 2CC1A 4BD0A 4CJNA 1SHVA 3VP0A 2PBYA 2QZ6A 2WADA 3BM6A 3BLMA 5E43A 3WS0A 3UDFA 4ZJ3A 2ZC6B 4DF6A 4EWFA 2HDQA 2Z2MB 5FAQA 1DY6A 1Y54A 4P0MA 1W5DA 1ALQA 2Q9NA 3UNWA 2FFFB 3NI9A 4X6TA 3CMZA 4JXWA 4C3QA 1YLZA 4BL2A 5CGXA 3MXSA 5FDHA 4MBHA 1RGYA 2HP6A 4ZJ1A 3HLDA 3LEZA 2EXBA 4BL3A 1SKFA 4WZ5A 4RYEA 1ONGA 3ZDJA 4E3JA 3N7WA 5JYPA 2Y2IA 1PZPA 1NYYA 5GL9A 1K4EA 3EQVA 2EFUA 3WS5A 1FCMA 4BLMA 4IBXA 4LV0A 1BLPA 4O7DA 3Q1FA 4RA7A 4GOGA 3C7VA 3LY4A 1L0EA 4E3OA 4PM9A 1W7FA 4K91A 4U0XA 4CPKA 3V50A 2QMIA 2I72A 3ZG9B 3P98A 4OOLA 4S2NC 3Q7ZA 1Z6FA 3IF6A 3SS3A 5GLAA 1KDSA 2P9VB 4EBNA 1MY8A 4KQQA 2XFTA 1K57A 3AGFA 1XX2A 3M6HA 3UDXA 2J8YA 4Q8IA 2HDSA 5M18A 3IHBA 3ZG0A 1NYMA 4XUXA 1ES5A 4FD8A 4MEZA 2ZQAA 4X53A 3UPPA 1K6SA 4DXCA 4OQIA 5KSHA 5A91A 1BUEA 1L0GA 1U60A 1GA0A 1PZOA 3W4QA 3FKVA 1ZG4A 4KZ5A 4OPZA 5GHYA 2ZC4B 3W4PA 2BLSA 4XXRA 3PTEA 1FOFA 3C5AA 4R1GA 3JYIA 4GB7A 1BULA 1EROA 1FCNA 2WAEA 4R0QA 2ZQ7A 2HDRA 4EBPA 5HL1A 1ZC2A 2JCHA 4PM7A 2EX9A 2WGVA 4IVIA 4QY6A 4KG6A 5CXWA 2Y2GA 4KQRA 4KENB 1TDGA 1S6RA 2Y2NA 4DRTA 1YMSA 5CERA 3SS4A 4PPRA 1JWZA 5TGFA 5CGWA 4RX3A 5GLCA 2JBFA 3OPLA 3VOYA 3G4PA 2A49A 2XFSA 1ESIA 1K56D 2XF3A 1GCEA 4Z9QA 1DJBA 2R9WA 4B4ZA 2H10A 4EBLA 1XGIA 1ES2A 3BFEA 2EX8A 1WE4A 3IH8A 1XPBA 1J9MA 1H8YA 3N8RA 3EQUA 4BQMA 4DDYA 2WUQA 4HBTA 5CGSA 4OH0A 4WEKA 2WYXA 3IT9A 5CHJA 3S4XA 3WWXA 1IELA 1L2SA 4NETA 4P6BA 5AQ9A 5EVID 5FAOA 3M2JA 3IXDA 4R23A 4R4RA 4OVDA 3GMWA 4RX2A 2QPNA 4D2OA 2B5RA 2ZQ8A 4PM5A 2G2UA 4UA6A 4OKPA 4S2OA 4HESA 1FSWA 1ZG6A 4JBFA 4KQOA 5TFQA 2JC7A 3PAEA 2ZD8A 1IKGA 4HBUA 2J9OA 1I2SA 3Q07A 1OMEA 2X71A 3SS5A 5F83A 5FATA 1LI9A 2ZC7A 4GDBA 4OP8A 1WYCA 3UE0A 1K54A 3OZHA 2ZM8A 1G6AA 3UE1A 1RP5A 1GHMA 3BFFA 3G31A 3OC2A 3C7UA 3MBZA 2DRWA 1YT4A 2ZM2A 3PBOA 5AQAA 2HP5A 4R3BA 3IWQA 4JKTA 4E3NA 1NJ4A 3M6BA 2ZQDA 3LY3A 1KE4A 3CG5A 3PBTA 1ZKJA 3IWIA 4ZJ2A 1XA1A 5DTKA 5FA7A 5FSRA 3WS4A 4OPYA 3OPRA 4LV2A 3S1YA 4F94A 5CTNA 3QNCA 1KGEA 2PU2A 1JTGA 2DNSA 4BJPA 1CEFA 4YFMA 5EPHA 2C6WB 3V5MA 3A3DA 3N6IA 2HPBA 2R9XA 1NZOA 4OP5A 2J9PA 1TVFA 1TEMA 4E3KA 3C4OA 2WZXA 3BECA 5HAPA 3WS2A 3ZNTA 1E25A 2ZQCA 3BRMA 4YINA 3ISGA 1BLCA 3HREA 4JPMA 5A90A 3ITBA 2E8IA 3HLEA 1L0DA 1O7EA 1HD8A 3DWKA 3NY4A 3BEBA 5U47A 3UE3A 4QJGA 1YLYA 2H5SA 1EWZA 3IH9A 3SH8A 2XR0A 3LO7A 2OLVA 4S2NA 4R3JA 1WYBA 3G30A 1Q2QA 5FQIA 5DF9A 1ERQA 1GA9A 3ZVTA 4B4XA 2ZQ9A 3VP1A 5HW3A 3UN7A 1PI5A 2XLNA 3MZDA 3OCLA 4IBRA 5GHXA 2EFXA 4X69A 5G18A 4H8RA 4LV1A 1PIOA 3D4FA 4GD6A 4X55A 4QB8A 3IXHA 1CI8A 4GN2A 5GLBA 1M6KA 3ZCZA 3HLBA 1K55A 1BLHA 5J8XA 1ERMA 5AQBA 3VSLA 4JLFA 4IEDA 4KZ4A 5HARA 4DE1A 3WRZA 2XDMA 3BYDA 4RVAA 5CRFA 5CEDA 1KVMA 1YM1A 4OOMA 1XGJA 2OLUA 4M3KA 5EVIC 4KZ9A 4MLLA 3NDGA 3SOIA 4OQHA 1K4FA 1YMXA 4WBGA 4WM9A 4OQGA 4XUZA 1YLJA 5L2FA 3DTMA 1JVJA 3HUNA 1KGGA 1W8YA 3MKEA 1IKIA 4N9KA 1MPLA 3I7JA 4GZBA 5F1FA 1NXYA 4FH2A 3IWOA 3P09A 4C6YA 4GDNA 2VGKA 4FCFA 5TR7A 2OSUA 1PW8A 4OLGA 1LI0A 2G2WA 1MWUA 2Y2JA 4DE2A 2GDNA 1VM1A 3N8SA 3W8KA 4LCLA 3ITAA 1JTDA 4L0LA 4KZAA 4JXGA 3HVFA 4JF5A 3GQZA 3UDIA 2WZZA 1G68A 4E6XA 4KZ8A 1I5QA 4R4SA 3AGEA 4LCMA 2P74A 4PM6A 5I94A 1CEGA 3GSGA 4GKUA 2WGIA 3MZFA 5EOEA 2H0TA 3AGDA 4N1HA 4KZBA 2XD1A 3LCEA 3RXXA 1XP4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NC8 A;  1N4O A;  2ZMA A;  4LV3 A;  4P87 A;  4HEF A;  3IF5 A;  2P9V A;  5EE8 A;  1IYS A;  4KZ3 A;  2RL3 A;  1MWS A;  3HLW A;  1FR1 A;  4QY5 A;  3ZVW A;  3Q82 A;  1LLB A;  3OPH A;  4P85 A;  4Y0T A;  2Y55 A;  1LL9 A;  1HTZ A;  2VGJ A;  5DF8 A;  5FAP A;  5A93 A;  2WAF A;  2WKI A;  2ZC5 B;  2V2F F;  1RCJ A;  2V1Z A;  3O88 A;  5DTT A;  1K25 A;  1W79 A;  5A92 A;  4BD1 A;  2WKE A;  1E3U A;  2HDU A;  2XK1 A;  5CEC A;  3N8L A;  4UHU A;  2A3U A;  2Y2Q A;  2WGW B;  3RXW A;  4KZ6 A;  1FCO A;  1H5X A;  3HBR A;  4LEN A;  3OCN A;  4NK3 A;  1Q2P A;  4BEN A;  4WZ4 A;  3S22 A;  4DE3 A;  5KSC A;  1EI5 A;  1RGZ A;  1PWC A;  1E4D A;  2BG1 A;  1VQQ A;  3IHA A;  5EUA A;  3TOI A;  3FV7 A;  3SH7 A;  3HLC A;  3BFG A;  3O87 A;  5KZH A;  5HAQ A;  5EEC A;  2Y2P A;  3UO9 A;  3MZE A;  4EUZ A;  3MXR A;  1QMF A;  2Y2K A;  1JWV A;  5FI7 A;  4N92 A;  5EVI B;  4IVK A;  4DE0 A;  4MBK A;  4N1X A;  2ZLY A;  4K0W A;  2Q9M A;  3V3S A;  3A3I A;  3DW0 A;  2ZM0 A;  1H8Z A;  1IYO A;  1SDE A;  3G2Y A;  5CEB A;  3A3J A;  4ZDX A;  1PW1 A;  4X56 A;  2UWX A;  1PWD A;  3B3X A;  2HP9 A;  2Y2O A;  1BLS A;  5F1G A;  1GHP A;  3NDE A;  4KZ7 A;  4FH4 A;  5CHM A;  1NRF A;  3SH9 A;  4EQI A;  3GVB A;  5JYO A;  4QD4 A;  4JXV A;  1YLW A;  4ID4 A;  4KG2 A;  3VSK A;  4WMC A;  1NZU A;  1SCW A;  1XXM A;  2ZC3 B;  3VOZ A;  5E2G A;  3VMA A;  3BFD A;  3G34 A;  4C75 A;  2XH9 A;  4Y0U A;  3A3F A;  3E2L A;  3N4I A;  4WEJ A;  5FI6 A;  3ZG8 B;  3NCK A;  1S0W A;  3ZG7 B;  3ZGA B;  5IHV A;  4N9L A;  3Q7V B;  4UA9 A;  3HL9 A;  2IWD A;  5DF7 A;  1BT5 A;  5E2E A;  4WYY A;  1CI9 A;  3V39 A;  1ONH A;  3G35 A;  3E2K A;  1NY0 A;  3PBR A;  3NIA A;  1IYQ A;  1M40 A;  2WGW A;  4KG5 A;  1K56 A;  4WZ5 C;  5FI2 A;  1MWT A;  4E6W A;  2EX2 A;  1E3U D;  3IQA A;  5DTS A;  3WS1 A;  4QU3 A;  4S2K A;  3PAG A;  3TG9 A;  3GR2 A;  4PMA A;  4OPQ A;  3GV9 A;  3DWZ A;  4GNU A;  3A3E A;  3GTC A;  4UAA A;  5FAS A;  4PM8 A;  1SDN A;  3MKF A;  3M2K A;  1KE3 A;  3FYZ A;  3Q81 A;  3IXG A;  1HVB A;  1QME A;  5EVI A;  1W8Q A;  1XA7 A;  3ZHH A;  5GLD A;  3HUM A;  3ZFZ A;  1KGF A;  3HLF A;  5M19 A;  2XGN A;  5FQM A;  1YLP A;  1JWP A;  1N9B A;  3PBS A;  3BFC A;  4OLD A;  5FQQ A;  4EV4 A;  3MFD A;  3PBN A;  1AXB A;  5FQK A;  5HX9 A;  3IF6 C;  4E3I A;  5DVA A;  2FFY A;  3UPO A;  1KDW A;  2JE5 A;  2XEP A;  4OOY A;  1K57 C;  3O3V A;  3TSG A;  2WKH A;  3QHY A;  5AQ7 A;  1IYP A;  3QNB A;  1LHY A;  1XKZ A;  4OPR A;  3OPP A;  4X68 A;  1C3B A;  1K55 C;  3VP2 A;  3FKW A;  2XD5 A;  2C5W B;  2PU4 A;  2Y2L A;  3IXB A;  2IWC A;  5HAI A;  4K0X A;  2EXA A;  1BTL A;  4JF4 A;  1PYY A;  2V20 A;  4WMC D;  3RJU A;  3UPN A;  5EVL A;  2WK0 A;  4WEL A;  1O07 A;  4DDS A;  1MWR A;  1I2W A;  4OON A;  2X01 A;  4S2I A;  3Q7V A;  3WRT A;  4ZTK A;  3CJM A;  4Y7P A;  2XQZ A;  3V3R A;  3C4P A;  1PWG A;  3G32 A;  1ES4 A;  2RCX A;  5E2F A;  5FQJ A;  2IWB A;  2OV5 A;  1BZA A;  4GD8 A;  4B88 A;  5KMW A;  2DCF A;  1DJC A;  5E2H A;  5M1A A;  4S2L A;  4U0T A;  3HLG A;  3UY6 A;  5BOH A;  2Z2L B;  3VFH A;  3VP4 A;  4E3L A;  1HZO A;  5CTM A;  5EOO A;  4A5R A;  4JF6 A;  5FQ9 A;  4MNR A;  1KVL A;  2Y91 A;  2EX6 A;  4U3T A;  4OQ0 A;  4FSF A;  2ZJ9 A;  3HUO A;  5GHZ A;  3FZC A;  2Y2H A;  3ZG5 A;  4DXB A;  1LL5 A;  1MKI A;  5CHU A;  4QHC A;  3G2Z A;  2H0Y A;  5F82 A;  3W4O A;  1FSY A;  4DKI A;  2Y2M A;  1IEM A;  3FWL A;  1ESU A;  5D3O A;  1ES3 A;  1CK3 A;  2Y59 A;  2J7V A;  3ZNY A;  1K6R A;  3NBL A;  5HFO A;  1YQS A;  1L0F A;  4S2M A;  1BSG A;  3CZD A;  3GRJ A;  4UA7 A;  4Y0O A;  4E3M A;  1GHI A;  1MXO A;  4MBF A;  1FQG A;  4S2J A;  1KE0 A;  3BLS A;  3IF6 B;  1YLT A;  4JXS A;  2X02 A;  1TDL A;  1PI4 A;  4ZAM A;  3VP3 A;  1K38 A;  3PBQ A;  4ZBE A;  3VFF A;  1MBL A;  3O86 A;  1DJA A;  2Y4A A;  4S2P A;  1K54 C;  1FR6 A;  2CC1 A;  4BD0 A;  4CJN A;  1SHV A;  3VP0 A;  2PBY A;  2QZ6 A;  2WAD A;  3BM6 A;  3BLM A;  5E43 A;  3WS0 A;  3UDF A;  4ZJ3 A;  2ZC6 B;  4DF6 A;  4EWF A;  2HDQ A;  2Z2M B;  5FAQ A;  1DY6 A;  1Y54 A;  4P0M A;  1W5D A;  1ALQ A;  2Q9N A;  3UNW A;  2FFF B;  3NI9 A;  4X6T A;  3CMZ A;  4JXW A;  4C3Q A;  1YLZ A;  4BL2 A;  5CGX A;  3MXS A;  5FDH A;  4MBH A;  1RGY A;  2HP6 A;  4ZJ1 A;  3HLD A;  3LEZ A;  2EXB A;  4BL3 A;  1SKF A;  4WZ5 A;  4RYE A;  1ONG A;  3ZDJ A;  4E3J A;  3N7W A;  5JYP A;  2Y2I A;  1PZP A;  1NYY A;  5GL9 A;  1K4E A;  3EQV A;  2EFU A;  3WS5 A;  1FCM A;  4BLM A;  4IBX A;  4LV0 A;  1BLP A;  4O7D A;  3Q1F A;  4RA7 A;  4GOG A;  3C7V A;  3LY4 A;  1L0E A;  4E3O A;  4PM9 A;  1W7F A;  4K91 A;  4U0X A;  4CPK A;  3V50 A;  2QMI A;  2I72 A;  3ZG9 B;  3P98 A;  4OOL A;  4S2N C;  3Q7Z A;  1Z6F A;  3IF6 A;  3SS3 A;  5GLA A;  1KDS A;  2P9V B;  4EBN A;  1MY8 A;  4KQQ A;  2XFT A;  1K57 A;  3AGF A;  1XX2 A;  3M6H A;  3UDX A;  2J8Y A;  4Q8I A;  2HDS A;  5M18 A;  3IHB A;  3ZG0 A;  1NYM A;  4XUX A;  1ES5 A;  4FD8 A;  4MEZ A;  2ZQA A;  4X53 A;  3UPP A;  1K6S A;  4DXC A;  4OQI A;  5KSH A;  5A91 A;  1BUE A;  1L0G A;  1U60 A;  1GA0 A;  1PZO A;  3W4Q A;  3FKV A;  1ZG4 A;  4KZ5 A;  4OPZ A;  5GHY A;  2ZC4 B;  3W4P A;  2BLS A;  4XXR A;  3PTE A;  1FOF A;  3C5A A;  4R1G A;  3JYI A;  4GB7 A;  1BUL A;  1ERO A;  1FCN A;  2WAE A;  4R0Q A;  2ZQ7 A;  2HDR A;  4EBP A;  5HL1 A;  1ZC2 A;  2JCH A;  4PM7 A;  2EX9 A;  2WGV A;  4IVI A;  4QY6 A;  4KG6 A;  5CXW A;  2Y2G A;  4KQR A;  4KEN B;  1TDG A;  1S6R A;  2Y2N A;  4DRT A;  1YMS A;  5CER A;  3SS4 A;  4PPR A;  1JWZ A;  5TGF A;  5CGW A;  4RX3 A;  5GLC A;  2JBF A;  3OPL A;  3VOY A;  3G4P A;  2A49 A;  2XFS A;  1ESI A;  1K56 D;  2XF3 A;  1GCE A;  4Z9Q A;  1DJB A;  2R9W A;  4B4Z A;  2H10 A;  4EBL A;  1XGI A;  1ES2 A;  3BFE A;  2EX8 A;  1WE4 A;  3IH8 A;  1XPB A;  1J9M A;  1H8Y A;  3N8R A;  3EQU A;  4BQM A;  4DDY A;  2WUQ A;  4HBT A;  5CGS A;  4OH0 A;  4WEK A;  2WYX A;  3IT9 A;  5CHJ A;  3S4X A;  3WWX A;  1IEL A;  1L2S A;  4NET A;  4P6B A;  5AQ9 A;  5EVI D;  5FAO A;  3M2J A;  3IXD A;  4R23 A;  4R4R A;  4OVD A;  3GMW A;  4RX2 A;  2QPN A;  4D2O A;  2B5R A;  2ZQ8 A;  4PM5 A;  2G2U A;  4UA6 A;  4OKP A;  4S2O A;  4HES A;  1FSW A;  1ZG6 A;  4JBF A;  4KQO A;  5TFQ A;  2JC7 A;  3PAE A;  2ZD8 A;  1IKG A;  4HBU A;  2J9O A;  1I2S A;  3Q07 A;  1OME A;  2X71 A;  3SS5 A;  5F83 A;  5FAT A;  1LI9 A;  2ZC7 A;  4GDB A;  4OP8 A;  1WYC A;  3UE0 A;  1K54 A;  3OZH A;  2ZM8 A;  1G6A A;  3UE1 A;  1RP5 A;  1GHM A;  3BFF A;  3G31 A;  3OC2 A;  3C7U A;  3MBZ A;  2DRW A;  1YT4 A;  2ZM2 A;  3PBO A;  5AQA A;  2HP5 A;  4R3B A;  3IWQ A;  4JKT A;  4E3N A;  1NJ4 A;  3M6B A;  2ZQD A;  3LY3 A;  1KE4 A;  3CG5 A;  3PBT A;  1ZKJ A;  3IWI A;  4ZJ2 A;  1XA1 A;  5DTK A;  5FA7 A;  5FSR A;  3WS4 A;  4OPY A;  3OPR A;  4LV2 A;  3S1Y A;  4F94 A;  5CTN A;  3QNC A;  1KGE A;  2PU2 A;  1JTG A;  2DNS A;  4BJP A;  1CEF A;  4YFM A;  5EPH A;  2C6W B;  3V5M A;  3A3D A;  3N6I A;  2HPB A;  2R9X A;  1NZO A;  4OP5 A;  2J9P A;  1TVF A;  1TEM A;  4E3K A;  3C4O A;  2WZX A;  3BEC A;  5HAP A;  3WS2 A;  3ZNT A;  1E25 A;  2ZQC A;  3BRM A;  4YIN A;  3ISG A;  1BLC A;  3HRE A;  4JPM A;  5A90 A;  3ITB A;  2E8I A;  3HLE A;  1L0D A;  1O7E A;  1HD8 A;  3DWK A;  3NY4 A;  3BEB A;  5U47 A;  3UE3 A;  4QJG A;  1YLY A;  2H5S A;  1EWZ A;  3IH9 A;  3SH8 A;  2XR0 A;  3LO7 A;  2OLV A;  4S2N A;  4R3J A;  1WYB A;  3G30 A;  1Q2Q A;  5FQI A;  5DF9 A;  1ERQ A;  1GA9 A;  3ZVT A;  4B4X A;  2ZQ9 A;  3VP1 A;  5HW3 A;  3UN7 A;  1PI5 A;  2XLN A;  3MZD A;  3OCL A;  4IBR A;  5GHX A;  2EFX A;  4X69 A;  5G18 A;  4H8R A;  4LV1 A;  1PIO A;  3D4F A;  4GD6 A;  4X55 A;  4QB8 A;  3IXH A;  1CI8 A;  4GN2 A;  5GLB A;  1M6K A;  3ZCZ A;  3HLB A;  1K55 A;  1BLH A;  5J8X A;  1ERM A;  5AQB A;  3VSL A;  4JLF A;  4IED A;  4KZ4 A;  5HAR A;  4DE1 A;  3WRZ A;  2XDM A;  3BYD A;  4RVA A;  5CRF A;  5CED A;  1KVM A;  1YM1 A;  4OOM A;  1XGJ A;  2OLU A;  4M3K A;  5EVI C;  4KZ9 A;  4MLL A;  3NDG A;  3SOI A;  4OQH A;  1K4F A;  1YMX A;  4WBG A;  4WM9 A;  4OQG A;  4XUZ A;  1YLJ A;  5L2F A;  3DTM A;  1JVJ A;  3HUN A;  1KGG A;  1W8Y A;  3MKE A;  1IKI A;  4N9K A;  1MPL A;  3I7J A;  4GZB A;  5F1F A;  1NXY A;  4FH2 A;  3IWO A;  3P09 A;  4C6Y A;  4GDN A;  2VGK A;  4FCF A;  5TR7 A;  2OSU A;  1PW8 A;  4OLG A;  1LI0 A;  2G2W A;  1MWU A;  2Y2J A;  4DE2 A;  2GDN A;  1VM1 A;  3N8S A;  3W8K A;  4LCL A;  3ITA A;  1JTD A;  4L0L A;  4KZA A;  4JXG A;  3HVF A;  4JF5 A;  3GQZ A;  3UDI A;  2WZZ A;  1G68 A;  4E6X A;  4KZ8 A;  1I5Q A;  4R4S A;  3AGE A;  4LCM A;  2P74 A;  4PM6 A;  5I94 A;  1CEG A;  3GSG A;  4GKU A;  2WGI A;  3MZF A;  5EOE A;  2H0T A;  3AGD A;  4N1H A;  4KZB A;  2XD1 A;  3LCE A;  3RXX A;  1XP4 A; 
#chains in the Genus database with same CATH topology
 2ZMA A;  3IF5 A;  1MWS A;  4QY5 A;  1XJ6 A;  3T1S A;  1LL9 A;  1HTZ A;  2VGJ A;  5FAP A;  5A93 A;  2V1Z A;  3FPW A;  1W79 A;  4LLO B;  4LEN A;  5KSC A;  2LB9 A;  1PWC A;  1E4D A;  1IFQ A;  2BG1 A;  3SW1 A;  3SH7 A;  3UO9 A;  2Y2K A;  4N92 A;  4DE0 A;  3A3I A;  3DW0 A;  1SDE A;  5CEB A;  3A3J A;  4ZDX A;  1PW1 A;  4HQA A;  2UWX A;  1BLS A;  4KZ7 A;  1NRF A;  3SH9 A;  5JYO A;  4JXV A;  4WMC A;  3PYP A;  3BFD A;  3G34 A;  3EEA A;  4CLC C;  4WEJ A;  3E2L A;  4KQD A;  3ZGA B;  4UA9 A;  3HL9 A;  2EA9 A;  4WYY A;  4KG5 A;  4E6W A;  1MWT A;  2EX2 A;  3RFB A;  3TG9 A;  3GR2 A;  4PMA A;  4I3I A;  3UB5 P;  3GV9 A;  3Q81 A;  1XA7 A;  4EET B;  3HUM A;  3MFD A;  3MXQ A;  3PBN A;  1AXB A;  5HPI A;  3UPO A;  2JE5 A;  2XEP A;  1K57 C;  3O3V A;  3QHY A;  5AQ7 A;  3K2N A;  4OPR A;  3FKW A;  2C5W B;  4K0X A;  4JF4 A;  1BTL A;  1EW0 A;  3UPN A;  5EVL A;  1O07 A;  4OON A;  3CJM A;  2KDK A;  4Y7P A;  5E2F A;  2OV5 A;  4GD8 A;  4PHT A;  1DJC A;  5E2H A;  2JKR M;  3LIC A;  3UY6 A;  2Z2L B;  1LL8 A;  1HZO A;  5EOO A;  4JF6 A;  3CUE C;  3DBA A;  1KVL A;  4OQ0 A;  2ZJ9 A;  3FZC A;  4DXB A;  4QHC A;  3G2Z A;  2H0Y A;  3E4P A;  1FSY A;  4NXB A;  3FWL A;  2W27 A;  3EOI A;  3UME A;  1CK3 A;  1OJ5 A;  2PR6 A;  4Z1W A;  3NBL A;  2QYB A;  1L0F A;  3CZD A;  4Y0O A;  1GHI A;  1FQG A;  4S2J A;  3IF6 B;  1YLT A;  4JXS A;  1TDL A;  4ZAM A;  1K38 A;  3NJA A;  4ZBE A;  3T50 A;  3VFF A;  3S7P A;  1MBL A;  1DJA A;  1DP9 A;  1K54 C;  1CQA A;  4BD0 A;  3EGX C;  3BLM A;  4LFU A;  2HDQ A;  2Z2M B;  1Y54 A;  3NI9 A;  4X6T A;  4C3Q A;  4BL2 A;  5FDH A;  2HP6 A;  4ZJ1 A;  3T4T A;  3MQQ A;  4E3J A;  4Y17 A;  2I9V A;  4EES A;  3IX3 A;  1PZP A;  2EFU A;  2D02 A;  2L1M A;  4IBX A;  4O7D A;  4GOG A;  4LPZ A;  2J3W A;  1L0E A;  4HP9 A;  3V50 A;  3ZG9 B;  1IOU A;  4S2N C;  2ZL1 B;  3IF6 A;  3SS3 A;  2ACG A;  1OTB A;  5GLA A;  3T1R A;  2XFT A;  1XX2 A;  3M6H A;  4G3K A;  4EEP A;  4Q8I A;  5M18 A;  3ICY A;  4MDZ A;  4XUX A;  4MEZ A;  2ZQA A;  4OQI A;  1L0G A;  1PZO A;  3W4Q A;  1ZG4 A;  4OPZ A;  3BQA A;  3W4P A;  2BLS A;  1FOF A;  1BUL A;  4PM7 A;  2EX9 A;  2GNX A;  2WGV A;  4QY6 A;  2Y2G A;  4KQR A;  5F5Y A;  4KEN B;  4DRT A;  4KUK A;  3P01 A;  1JWZ A;  4MN7 A;  4ETX A;  5TGF A;  2XSS A;  5GLC A;  3LEQ A;  2OWH A;  5HL6 A;  1K56 D;  2XF3 A;  4Z9Q A;  4B4Z A;  5HWW A;  2H10 A;  1XGI A;  3BFE A;  2EX8 A;  4EUV A;  2VX8 A;  2ZL1 A;  1YKD A;  3QP5 A;  3H9W A;  3T12 B;  5CX7 A;  4MCW A;  4OVD A;  4R4R A;  4NKP A;  3IS2 A;  2G2U A;  2W3E A;  2J9O A;  1OME A;  3SS5 A;  2ZC7 A;  1WYC A;  3NHQ A;  3OZH A;  2ZM8 A;  3LFV A;  3P7N A;  1GHM A;  3BFF A;  3MBZ A;  2ZM2 A;  5DKK A;  1DP8 A;  4IHQ A;  3IWQ A;  4E3N A;  3LY3 A;  4B9O A;  1ZKJ A;  3IWI A;  5FSR A;  3E0Y A;  3PXP A;  3S1Y A;  1CEF A;  2C6W B;  3N6I A;  2HPB A;  2R9X A;  1NZO A;  2J9P A;  1TVF A;  3NUL A;  4GW9 A;  4MMN A;  4JPM A;  4MN5 A;  1O7E A;  3UE3 A;  5U47 A;  1D1J A;  1EWZ A;  3R7W B;  1WYB A;  4JGP A;  3TW8 A;  5DF9 A;  4B4X A;  5HSQ A;  5HW3 A;  3B33 A;  5EV0 A;  2XLN A;  3MSH A;  5G18 A;  5FL3 A;  1S67 L;  5AJG A;  3D4F A;  4GD6 A;  4QB8 A;  1CI8 A;  4GN2 A;  1P97 A;  5AQB A;  4JLF A;  4WUJ A;  4KZ4 A;  5HAR A;  4DE1 A;  4RVA A;  4EW7 A;  5CED A;  1KVM A;  1YM1 A;  1XGJ A;  4CLC D;  4M3K A;  5EVI C;  2XA7 S;  5IU1 A;  2LB5 A;  4YWZ A;  4OQG A;  3DTM A;  1JVJ A;  3VOL A;  1MPL A;  3I7J A;  4GZB A;  3IWO A;  4C6Y A;  4GDN A;  2G2W A;  2GDN A;  3N8S A;  2WKR A;  4LCL A;  1JTD A;  4KZA A;  4JXG A;  1HLU P;  3HVF A;  3GQZ A;  4O0P A;  3R7W A;  4E6X A;  4KZ8 A;  4F3L B;  4R4S A;  3AGE A;  4LCM A;  1F5M A;  5EOE A;  4N1H A;  2XD1 A;  2XRN A;  2A49 A;  1XP4 A;  4P87 A;  3LYX A;  4HEF A;  5EE8 A;  2RL3 A;  3HLW A;  3Q82 A;  3OPH A;  4Y0T A;  1S1Y A;  1F98 A;  2G7U A;  2ZC5 B;  3OOV A;  3KYZ A;  4ESP A;  3O88 A;  2OAP 1;  1K25 A;  2FH5 A;  4BD1 A;  2XK1 A;  3FPV A;  3LIE A;  4KZ6 A;  1FCO A;  2YKH A;  1ACF A;  3S22 A;  1EI5 A;  3TOI A;  3FV7 A;  5I5L A;  3BFG A;  5HZH A;  5KZH A;  2WKQ A;  5EEC A;  2Y2P A;  4EUZ A;  3MXR A;  1P0Z A;  4MBK A;  4PAU A;  2Q9M A;  3VE4 A;  2ZM0 A;  4QPR A;  4FH4 A;  3LR5 A;  1YLW A;  4ID4 A;  3VSK A;  2ZC3 B;  3VOZ A;  3VMA A;  3A3F A;  3B42 A;  3NEC A;  3NCK A;  1OTI A;  2ZMF A;  3Q7V B;  1ONH A;  3G35 A;  4YNR A;  2D01 A;  3KSG A;  1K56 A;  4WZ5 C;  1VEU A;  4O01 A;  1E3U D;  1GSX A;  3IQA A;  1YSQ A;  5IT5 A;  2JKF A;  4H6J A;  3DWZ A;  1OTA A;  3A3E A;  3E98 A;  4UAA A;  5FAS A;  4PM8 A;  3C30 A;  3IXG A;  2CMN A;  1QME A;  2HZ5 A;  1W8Q A;  4HH2 A;  3ZHH A;  3FC7 A;  2XGN A;  5FQM A;  3DTK A;  4OLD A;  4IJG A;  5G4Z A;  1T18 A;  4UQI S;  5HD3 A;  2ZOH A;  2FFY A;  1W63 Q;  1OPX A;  1G28 A;  3TSG A;  1IYP A;  4X68 A;  1K55 C;  1NLZ A;  2XD5 A;  2Y2L A;  3IXB A;  2IWC A;  5HAI A;  3ZYT A;  4NXE A;  4WEL A;  4EXO A;  5K5B A;  1I2W A;  5G4Y A;  4S2I A;  3Q7V A;  4ZTK A;  3S7Q A;  5L10 A;  2XQZ A;  3C4P A;  5LBR A;  4CLC B;  3G32 A;  1ES4 A;  2IWB A;  4B88 A;  5KMW A;  2DCF A;  3A0S A;  3HLG A;  3PR6 A;  3VFH A;  2V0U A;  5CTM A;  4A5R A;  2L4R A;  3H82 A;  1YPR A;  4MNR A;  4U3T A;  5GHZ A;  4I3A A;  3G6O A;  1P9R A;  4DKI A;  2Y2M A;  1IEM A;  3KYE A;  5D3O A;  2J7V A;  2VGL S;  1K6R A;  3EEH A;  5HFO A;  4S2M A;  3BLS A;  4RQ9 A;  4JGO A;  1PI4 A;  4I5S A;  4Y3I A;  3PBQ A;  1TS6 A;  5DJT A;  4Y2F A;  4S2P A;  4FUW A;  1FR6 A;  4CJN A;  3CI6 A;  2QZ6 A;  2WAD A;  2VV6 A;  2P04 A;  4ZJ3 A;  2ZC6 B;  4DF6 A;  5HPF A;  4FTX A;  1ALQ A;  4JXW A;  1LT0 A;  2EXB A;  2O9B A;  5JYP A;  4X1L A;  2Y2I A;  1NYY A;  1FCM A;  4BLM A;  2V0W A;  3Q1F A;  1T19 A;  4U0X A;  3MQ0 A;  3HJK A;  5FDS A;  3Q7Z A;  1Z6F A;  4HY8 A;  4ARZ B;  2PAV P;  2P9V B;  3UB6 A;  4KQQ A;  1K57 A;  1ODV A;  4EQ1 A;  3ZG0 A;  1NYM A;  1T1C A;  3NOT C;  2J3T C;  1F9I A;  1GA0 A;  5L07 A;  4KZ5 A;  1VHM A;  2ZC4 B;  4G3V A;  3PTE A;  3JVV A;  3C5A A;  5HL1 A;  4O8G A;  4KG6 A;  1XFN A;  3QP4 A;  3UMD A;  1STZ A;  2Y2N A;  3T4Q A;  3G4P A;  4HIA A;  4K08 A;  4EBL A;  1ES2 A;  1XPB A;  1J9M A;  1H8Y A;  3EQU A;  4DDY A;  4YOF A;  4HBT A;  3LR3 A;  3WWX A;  1IEL A;  3T4K A;  5AQ9 A;  5EVI D;  3HCY A;  3IXD A;  4R23 A;  4GLQ A;  3GMW A;  2QPN A;  4E04 A;  4PM5 A;  4UA6 A;  3L7H A;  4JBF A;  1FSW A;  1ZG6 A;  1I2S A;  3Q07 A;  2X71 A;  1LI9 A;  4GS9 B;  3LUQ A;  1K54 A;  4X1M A;  2EWW A;  5AQA A;  4JKT A;  2V8F A;  2BTF P;  3LI9 A;  3D9Y A;  3K3C A;  1XA1 A;  3ULF A;  1N9L A;  4F94 A;  4I3J A;  3W2Z A;  2DNS A;  4PKY G;  4BJP A;  4YFM A;  2EWV A;  1TEM A;  2W1T B;  3C4O A;  3WS2 A;  1E25 A;  3BRM A;  2DMW A;  3HRE A;  3HLE A;  3CPT B;  1L0D A;  5J7E A;  3BEB A;  3OLO A;  1ZTU A;  3VV4 A;  2H5S A;  3LO7 A;  4S2N A;  4I38 A;  5HD5 A;  1Q2Q A;  4L9F A;  1GA9 A;  1LSW A;  1OT6 A;  3MZD A;  5GHX A;  3CHW P;  5F69 A;  4H8R A;  4X55 A;  3IXH A;  5GLB A;  2Y8H A;  2PR5 A;  4R70 A;  4IED A;  3BYD A;  4HP4 A;  3NDG A;  5AVF A;  1D7E A;  1K4F A;  5L2F A;  4XUZ A;  1ZHH B;  3QP8 A;  1W8Y A;  5C5K A;  1IKI A;  3P09 A;  2OWJ A;  2W1T A;  2ZMV A;  3QP6 A;  3BY9 A;  1MWU A;  3TRC A;  1L3L A;  1VM1 A;  3W8K A;  2QHK A;  3ITA A;  1H0M A;  1CF0 A;  2WZZ A;  1G68 A;  2Q0O A;  4DJ3 A;  4PM6 A;  1CEG A;  4GKU A;  2WGI A;  3SOI A;  4IUK A;  1N4O A;  4LV3 A;  1IYS A;  3ZVW A;  1FR1 A;  4P6Z M;  3CLO A;  4GJ4 A;  1LLB A;  3DTI A;  4P85 A;  5DF8 A;  2PD7 A;  2WKI A;  2NUT C;  1H8M A;  5A92 A;  3B47 A;  3ZQ5 A;  4UHU A;  5CEC A;  2A3U A;  3RXW A;  4II7 A;  3HBR A;  3OCN A;  4NK3 A;  1Q2P A;  4BEN A;  4DE3 A;  4B93 A;  1RGZ A;  5EUA A;  1VQQ A;  3RTY A;  3HLC A;  3O87 A;  5HAQ A;  1T1B A;  5HDS A;  3MZE A;  1QMF A;  4LRX C;  5EVI B;  2ZLY A;  3V3S A;  5HWV A;  1IYO A;  3G2Y A;  1Y28 A;  3MF0 A;  3B3X A;  3IX8 A;  2HP9 A;  5F1G A;  1GHP A;  3NOU C;  5CHM A;  4EQI A;  3GVB A;  4KG2 A;  3F1P B;  4BBT A;  3EGD C;  5EM0 A;  4C75 A;  4Y0U A;  3N4I A;  3ZG8 B;  1S0W A;  3ZG7 B;  5IHV A;  2VLG A;  2IWD A;  5DF7 A;  1BT5 A;  5E2E A;  1CI9 A;  3S7N A;  3E2K A;  4BMW A;  1NY0 A;  1WA9 A;  2HF6 A;  3NIA A;  1IYQ A;  3C38 A;  1OTD A;  5AVE A;  3WS1 A;  1UGU A;  4QU3 A;  4S2K A;  3PAG A;  4OPQ A;  4L9G A;  1XJ3 A;  4GNU A;  4G3W A;  3MKF A;  1KE3 A;  2PBD P;  1HVB A;  4Q0H A;  5EVI A;  4BBU A;  4JGR A;  5EFW A;  2IA2 A;  3ZFZ A;  1KGF A;  3HLF A;  1YLP A;  1JWP A;  1N9B A;  5IS1 A;  3SZT A;  5FQK A;  5HX9 A;  4QWO A;  4E3I A;  5DVA A;  1G6O A;  1KDW A;  4OOY A;  1CJF A;  4GHI B;  3FG8 A;  1XKZ A;  2KLI A;  3F1P A;  2PU4 A;  2EXA A;  2PYR A;  1PYY A;  4WMC D;  3RJU A;  1P9W A;  2WK0 A;  4DDS A;  1MWR A;  2AVX A;  3KSF A;  2W0N A;  2X01 A;  1VB6 A;  1OT9 A;  2GX5 A;  3MS6 A;  3KSH A;  2RCX A;  5FQJ A;  5TBM B;  5BOH A;  3MMH A;  3TJZ C;  4BBV A;  3IX4 A;  4HHD A;  2J3T D;  2FZ0 A;  2EX6 A;  5HDC A;  2Y2H A;  3U4L P;  1MKI A;  5F82 A;  3S7O A;  3W4O A;  4D60 A;  1NLY A;  1ESU A;  2Y59 A;  3ZNY A;  1YQS A;  2PYP A;  4GHI A;  1BSG A;  3GRJ A;  4MN6 A;  4JGQ A;  4MBF A;  2PT7 A;  1KE0 A;  5TJJ A;  2Y4A A;  3BQ8 A;  4F3L A;  3UB9 A;  2W3D A;  1S1Z A;  2PBY A;  3BM6 A;  4R3A A;  3WS0 A;  3UDF A;  4PKY A;  5FAQ A;  1DY6 A;  1W5D A;  4FOF A;  2Q9N A;  3UNW A;  2FFF B;  2E8J A;  3LGO A;  3MXS A;  4BL3 A;  4WZ5 A;  4RYE A;  1ONG A;  3ZDJ A;  5GL9 A;  3T1X A;  1K4E A;  2Z6C A;  2VZW A;  5FEG A;  3MFX A;  1T1A A;  4R38 A;  4LV0 A;  1BLP A;  5MC7 A;  3CIT A;  3C7V A;  2BAS A;  3UB7 A;  4CPK A;  2I72 A;  3P98 A;  4EEU A;  2NUP C;  3LR4 A;  1KDS A;  4EBN A;  3GEC A;  5FEF A;  1MY8 A;  3A0R A;  3D3O A;  3BY8 A;  2HGV A;  2W3G A;  2W3F A;  4FD8 A;  5KSH A;  3UPP A;  1K6S A;  5A91 A;  1BUE A;  1TS0 A;  5HWT A;  2INW A;  4XXR A;  3T4L A;  4GB7 A;  1ERO A;  1FCN A;  2WAE A;  4R0Q A;  2HDR A;  1ZC2 A;  2JCH A;  4NXF A;  4IVI A;  2K7S A;  5CXW A;  4I39 A;  4L9E A;  4KUO A;  4AFI A;  4ZRR A;  3NOP C;  5CER A;  3SS4 A;  4PPR A;  4Y13 A;  3DAV A;  2P7J A;  2V1A A;  4RX3 A;  3KYQ A;  2JBF A;  3OPL A;  3VOY A;  1ESI A;  1DJB A;  2R9W A;  3LIB A;  2PRF A;  1WE4 A;  5CGS A;  1XFQ A;  3MQO A;  4OH0 A;  3S4X A;  4P6B A;  4WLA A;  5FAO A;  3R4K A;  3T4S A;  3A0V A;  4UEY A;  4OKP A;  4S2O A;  1KOU A;  4HES A;  4KQO A;  5TFQ A;  2JC7 A;  1H3Q A;  1V9Z A;  4HBU A;  1NRJ A;  5FAT A;  3UE0 A;  1RP5 A;  4XT2 B;  2DRW A;  3PBO A;  2HP5 A;  4R3B A;  2B95 A;  1NJ4 A;  3M6B A;  2GZA A;  4CLC A;  2ZQD A;  1KE4 A;  2J80 A;  3PBT A;  2ZBB A;  5FA7 A;  3WS4 A;  3MR0 A;  3OPR A;  2GJ3 A;  4LV2 A;  5CTN A;  1W63 M;  1MKM A;  3A3D A;  3F1O B;  4DMZ A;  2O9A A;  4OP5 A;  2QWS A;  4E3K A;  1SZV A;  5HAP A;  4YIN A;  3ISG A;  5A90 A;  5DJU A;  2E8I A;  5KIZ A;  4QJG A;  3NY4 A;  3DWK A;  2VKS A;  2KOI A;  1TS8 A;  3IH9 A;  3SH8 A;  2HV1 A;  1N9N A;  1VET B;  5FQI A;  1ERQ A;  3BW6 A;  3VP1 A;  1PI5 A;  3T1Q B;  1PIO A;  4EU0 A;  4XT2 A;  1M6K A;  3HLB A;  1BLH A;  5J8X A;  2OOL A;  3WRZ A;  2XDM A;  3MJQ A;  4HJ3 A;  2A2L A;  4OOM A;  2OLU A;  2UV0 E;  2JN7 A;  2V1B A;  4OQH A;  1YMX A;  4WM9 A;  1KGG A;  3F1O A;  3MKE A;  4HJ6 A;  4N9K A;  5F1F A;  4FH2 A;  5TR7 A;  1PW8 A;  2VV7 A;  4OLG A;  3F1N B;  1LI0 A;  2Y2J A;  4DE2 A;  3BJN A;  3CUE A;  1TF1 A;  1I5Q A;  1VET A;  2OAQ 1;  3U2A A;  5I94 A;  4WL9 A;  3MZF A;  2M1C A;  4CLC E;  3AGD A;  3LIF A;  4KZB A;  4EWF A;  4ARZ A;  3NC8 A;  1PNE A;  2P9V A;  1YAX A;  4KZ3 A;  5L8M A;  2Y55 A;  2WAF A;  2JKT I;  2V2F F;  1RCJ A;  1YSP A;  3E4Q A;  2R78 A;  5DTT A;  4Q0I A;  2WKE A;  1E3U A;  2HDU A;  3N8L A;  2O0Y A;  2V8C A;  4CQH A;  2Y2Q A;  2WGW B;  3KO6 A;  4WZ4 A;  3IHA A;  3L9K A;  1FIL A;  1FIK A;  3GDI A;  1V9Y A;  2JKG A;  1JWV A;  3F1N A;  5FI7 A;  3HJI A;  4IVK A;  2M7U A;  4N1X A;  1XJ4 A;  4K0W A;  3K3D A;  2VJW A;  1H8Z A;  1XJ2 A;  3LR0 A;  4Y5F A;  4X56 A;  1PWD A;  4X25 A;  2Y2O A;  2QJ5 A;  3NDE A;  2QJ7 A;  4QD4 A;  1NZU A;  1XXM A;  1AWI A;  1SCW A;  5L09 A;  5E2G A;  2XH9 A;  1JNU A;  2YKF A;  5FI6 A;  1TS7 A;  2XRO A;  4N9L A;  3LID A;  1PFL A;  2K31 A;  4HNB A;  1K0K A;  3V39 A;  1A0K A;  4NG2 A;  1G5U A;  4GS9 A;  2W3H A;  3PBR A;  1M40 A;  2WGW A;  5FI2 A;  5DTS A;  1BYW A;  2O9C A;  5J4E A;  2HJ9 C;  2K2N A;  3GTC A;  5HDD A;  1SDN A;  3M2K A;  3FYZ A;  1J3W A;  5GLD A;  3D72 A;  5M19 A;  2VV8 A;  1TD5 A;  3PBS A;  3BFC A;  5FQQ A;  4EV4 A;  3IF6 C;  5DFY A;  3IS2 B;  2M7V A;  3CAX A;  2WKH A;  3QNB A;  1LHY A;  3OPP A;  2PHY A;  1C3B A;  3VP2 A;  3CPT A;  2V20 A;  3H7W B;  3UE6 A;  3WRT A;  1N9O A;  1PRQ A;  3V3R A;  4DN0 A;  1PWG A;  3JPU A;  1BZA A;  4ME4 A;  5M1A A;  4S2L A;  4U0T A;  2VA0 A;  3VE3 A;  1DRM A;  2VEA A;  3KX0 X;  3UB8 A;  3VP4 A;  4E3L A;  5FQ9 A;  2Y91 A;  4FSF A;  3EWK A;  3HUO A;  3ZG5 A;  1LL5 A;  5CHU A;  1OTE A;  2ZOI A;  4WF0 A;  1ES3 A;  4UA7 A;  4E3M A;  2P08 A;  1MXO A;  5DKL A;  2XA7 M;  4EER A;  2X02 A;  1MZU A;  2PD8 A;  3H7W A;  3VP3 A;  3O86 A;  2CC1 A;  1SHV A;  3VP0 A;  5E43 A;  3C8C A;  4LRY C;  1F2K A;  4P0M A;  4HOI A;  3CMZ A;  3QP1 A;  1YLZ A;  5CGX A;  4MBH A;  1RGY A;  3HLD A;  3LEZ A;  1SKF A;  5J3W A;  4DJ2 A;  3N7W A;  3LIA A;  2A24 B;  3EQV A;  3LI8 A;  3WS5 A;  1NWZ A;  4P6Z S;  5A8B A;  4RA7 A;  3LY4 A;  4E3O A;  4PM9 A;  1W7F A;  4K91 A;  2QMI A;  4OOL A;  4LGW A;  3OBF A;  1SKO B;  5EVE A;  3AGF A;  3UDX A;  3T4J A;  2J8Y A;  2HDS A;  3BWL A;  3IHB A;  1ES5 A;  4X53 A;  4DXC A;  1GSW A;  1U60 A;  3FKV A;  3C2W A;  5GHY A;  4HH3 A;  5F6A A;  4R1G A;  3JYI A;  2ZQ7 A;  4EBP A;  3O5Y A;  1S4S A;  1TDG A;  1S6R A;  1YMS A;  5EM1 A;  2A24 A;  1OJG A;  5CGW A;  2XFS A;  5F68 A;  1GCE A;  2JKR I;  1X0O A;  2Z6D A;  3IH8 A;  3KSI A;  2JHE A;  3N8R A;  4BQM A;  2WUQ A;  5DFX A;  4WEK A;  2WYX A;  3IT9 A;  5CHJ A;  1L2S A;  4NET A;  1SKO A;  1Y4O A;  3M2J A;  2JKT M;  4RX2 A;  1MC0 A;  4D2O A;  2B5R A;  2O99 A;  2ZQ8 A;  4LRZ E;  3PAE A;  2ZD8 A;  1IKG A;  5F83 A;  4GDB A;  1UWN X;  4OP8 A;  4BWI A;  1G6A A;  1VEU B;  2KX6 A;  3UE1 A;  4UQI M;  3G31 A;  3OC2 A;  3C7U A;  1YT4 A;  2B02 A;  2L0W A;  4H6J B;  3CG5 A;  3IBR A;  4WN5 A;  4ZJ2 A;  5DTK A;  3V67 A;  5TBM A;  4OPY A;  3QNC A;  2VK3 A;  1KGE A;  2PU2 A;  1JTG A;  1Z09 A;  5EPH A;  3V5M A;  2WKP A;  2WZX A;  3IBJ A;  3BEC A;  3T4O A;  4ETZ A;  3ZNT A;  3PHY A;  2ZQC A;  1BLC A;  3ITB A;  4R6L A;  1HD8 A;  3QP2 A;  4HJ4 A;  1YLY A;  1LSV A;  3CWF A;  2XR0 A;  2OLV A;  4GCZ A;  4R3J A;  3G30 A;  4NXG A;  4M4X A;  3ZVT A;  4IUH A;  2ZQ9 A;  2QKP A;  3UN7 A;  3OCL A;  4IBR A;  4Y15 A;  2EFX A;  4X69 A;  2B18 A;  4LV1 A;  2VGL M;  3ZCZ A;  1UWP X;  2V9A A;  1S4R A;  1K55 A;  1ERM A;  3VSL A;  3JVU A;  3H82 B;  2Y79 A;  4NEE D;  5CRF A;  1D06 A;  2W1R A;  4KZ9 A;  4MLL A;  3E4O A;  1S66 L;  4WBG A;  1YLJ A;  3HUN A;  2MJ6 A;  4Q0J A;  3RH8 B;  1NXY A;  2VGK A;  4FCF A;  2OSU A;  1GSV A;  3TE8 A;  2HJE A;  3DTE A;  4L0L A;  4JF5 A;  3UDI A;  1DP6 A;  2P74 A;  3GSG A;  2H28 A;  1LSX A;  2H0T A;  4HI4 A;  3LCE A;  3RXX A;  2PDR A;  1H5X A; 
#chains in the Genus database with same CATH homology
 3NC8 A;  1N4O A;  2ZMA A;  4LV3 A;  4P87 A;  4HEF A;  3IF5 A;  2P9V A;  5EE8 A;  1IYS A;  4KZ3 A;  2RL3 A;  1MWS A;  3HLW A;  1FR1 A;  4QY5 A;  3ZVW A;  3Q82 A;  1LLB A;  3OPH A;  4P85 A;  4Y0T A;  2Y55 A;  1LL9 A;  1HTZ A;  2VGJ A;  5DF8 A;  5FAP A;  5A93 A;  2WAF A;  2WKI A;  2ZC5 B;  2V2F F;  1RCJ A;  2V1Z A;  3O88 A;  5DTT A;  1K25 A;  1W79 A;  5A92 A;  4BD1 A;  2WKE A;  1E3U A;  2HDU A;  2XK1 A;  5CEC A;  3N8L A;  4UHU A;  2A3U A;  2Y2Q A;  2WGW B;  3RXW A;  4KZ6 A;  1FCO A;  1H5X A;  3HBR A;  4LEN A;  3OCN A;  4NK3 A;  1Q2P A;  4BEN A;  4WZ4 A;  3S22 A;  4DE3 A;  5KSC A;  1EI5 A;  1RGZ A;  1PWC A;  1E4D A;  2BG1 A;  1VQQ A;  3IHA A;  5EUA A;  3TOI A;  3FV7 A;  3SH7 A;  3HLC A;  3BFG A;  3O87 A;  5KZH A;  5HAQ A;  5EEC A;  2Y2P A;  3UO9 A;  3MZE A;  4EUZ A;  3MXR A;  1QMF A;  2Y2K A;  1JWV A;  5FI7 A;  4N92 A;  5EVI B;  4IVK A;  4DE0 A;  4MBK A;  4N1X A;  2ZLY A;  4K0W A;  2Q9M A;  3V3S A;  3A3I A;  3DW0 A;  2ZM0 A;  1H8Z A;  1IYO A;  1SDE A;  3G2Y A;  5CEB A;  3A3J A;  4ZDX A;  1PW1 A;  4X56 A;  2UWX A;  1PWD A;  3B3X A;  2HP9 A;  2Y2O A;  1BLS A;  5F1G A;  1GHP A;  3NDE A;  4KZ7 A;  4FH4 A;  5CHM A;  1NRF A;  3SH9 A;  4EQI A;  3GVB A;  5JYO A;  4QD4 A;  4JXV A;  1YLW A;  4ID4 A;  4KG2 A;  3VSK A;  4WMC A;  1NZU A;  1SCW A;  1XXM A;  2ZC3 B;  3VOZ A;  5E2G A;  3VMA A;  3BFD A;  3G34 A;  4C75 A;  2XH9 A;  4Y0U A;  3A3F A;  3E2L A;  3N4I A;  4WEJ A;  5FI6 A;  3ZG8 B;  3NCK A;  1S0W A;  3ZG7 B;  3ZGA B;  5IHV A;  4N9L A;  3Q7V B;  4UA9 A;  3HL9 A;  2IWD A;  5DF7 A;  1BT5 A;  5E2E A;  4WYY A;  1CI9 A;  3V39 A;  1ONH A;  3G35 A;  3E2K A;  1NY0 A;  3PBR A;  3NIA A;  1IYQ A;  1M40 A;  2WGW A;  4KG5 A;  1K56 A;  4WZ5 C;  5FI2 A;  1MWT A;  4E6W A;  2EX2 A;  1E3U D;  3IQA A;  5DTS A;  3WS1 A;  4QU3 A;  4S2K A;  3PAG A;  3TG9 A;  3GR2 A;  4PMA A;  4OPQ A;  3GV9 A;  3DWZ A;  4GNU A;  3A3E A;  3GTC A;  4UAA A;  5FAS A;  4PM8 A;  1SDN A;  3MKF A;  3M2K A;  1KE3 A;  3FYZ A;  3Q81 A;  3IXG A;  1HVB A;  1QME A;  5EVI A;  1W8Q A;  1XA7 A;  3ZHH A;  5GLD A;  3HUM A;  3ZFZ A;  1KGF A;  3HLF A;  5M19 A;  2XGN A;  5FQM A;  1YLP A;  1JWP A;  1N9B A;  3PBS A;  3BFC A;  4OLD A;  5FQQ A;  4EV4 A;  3MFD A;  3PBN A;  1AXB A;  5FQK A;  5HX9 A;  3IF6 C;  4E3I A;  5DVA A;  2FFY A;  3UPO A;  1KDW A;  2JE5 A;  2XEP A;  4OOY A;  1K57 C;  3O3V A;  3TSG A;  2WKH A;  3QHY A;  5AQ7 A;  1IYP A;  3QNB A;  1LHY A;  1XKZ A;  4OPR A;  3OPP A;  4X68 A;  1C3B A;  1K55 C;  3VP2 A;  3FKW A;  2XD5 A;  2C5W B;  2PU4 A;  2Y2L A;  3IXB A;  2IWC A;  5HAI A;  4K0X A;  2EXA A;  1BTL A;  4JF4 A;  1PYY A;  2V20 A;  4WMC D;  3RJU A;  3UPN A;  5EVL A;  2WK0 A;  4WEL A;  1O07 A;  4DDS A;  1MWR A;  1I2W A;  4OON A;  2X01 A;  4S2I A;  3Q7V A;  3WRT A;  4ZTK A;  3CJM A;  4Y7P A;  2XQZ A;  3V3R A;  3C4P A;  1PWG A;  3G32 A;  1ES4 A;  2RCX A;  5E2F A;  5FQJ A;  2IWB A;  2OV5 A;  1BZA A;  4GD8 A;  4B88 A;  5KMW A;  2DCF A;  1DJC A;  5E2H A;  5M1A A;  4S2L A;  4U0T A;  3HLG A;  3UY6 A;  5BOH A;  2Z2L B;  3VFH A;  3VP4 A;  4E3L A;  1HZO A;  5CTM A;  5EOO A;  4A5R A;  4JF6 A;  5FQ9 A;  4MNR A;  1KVL A;  2Y91 A;  2EX6 A;  4U3T A;  4OQ0 A;  4FSF A;  2ZJ9 A;  3HUO A;  5GHZ A;  3FZC A;  2Y2H A;  3ZG5 A;  4DXB A;  1LL5 A;  1MKI A;  5CHU A;  4QHC A;  3G2Z A;  2H0Y A;  5F82 A;  3W4O A;  1FSY A;  4DKI A;  2Y2M A;  1IEM A;  3FWL A;  1ESU A;  5D3O A;  1ES3 A;  1CK3 A;  2Y59 A;  2J7V A;  3ZNY A;  1K6R A;  3NBL A;  5HFO A;  1YQS A;  1L0F A;  4S2M A;  1BSG A;  3CZD A;  3GRJ A;  4UA7 A;  4Y0O A;  4E3M A;  1GHI A;  1MXO A;  4MBF A;  1FQG A;  4S2J A;  1KE0 A;  3BLS A;  3IF6 B;  1YLT A;  4JXS A;  2X02 A;  1TDL A;  1PI4 A;  4ZAM A;  3VP3 A;  1K38 A;  3PBQ A;  4ZBE A;  3VFF A;  1MBL A;  3O86 A;  1DJA A;  2Y4A A;  4S2P A;  1K54 C;  1FR6 A;  2CC1 A;  4BD0 A;  4CJN A;  1SHV A;  3VP0 A;  2PBY A;  2QZ6 A;  2WAD A;  3BM6 A;  3BLM A;  5E43 A;  3WS0 A;  3UDF A;  4ZJ3 A;  2ZC6 B;  4DF6 A;  4EWF A;  2HDQ A;  2Z2M B;  5FAQ A;  1DY6 A;  1Y54 A;  4P0M A;  1W5D A;  1ALQ A;  2Q9N A;  3UNW A;  2FFF B;  3NI9 A;  4X6T A;  3CMZ A;  4JXW A;  4C3Q A;  1YLZ A;  4BL2 A;  5CGX A;  3MXS A;  5FDH A;  4MBH A;  1RGY A;  2HP6 A;  4ZJ1 A;  3HLD A;  3LEZ A;  2EXB A;  4BL3 A;  1SKF A;  4WZ5 A;  4RYE A;  1ONG A;  3ZDJ A;  4E3J A;  3N7W A;  5JYP A;  2Y2I A;  1PZP A;  1NYY A;  5GL9 A;  1K4E A;  3EQV A;  2EFU A;  3WS5 A;  1FCM A;  4BLM A;  4IBX A;  4LV0 A;  1BLP A;  4O7D A;  3Q1F A;  4RA7 A;  4GOG A;  3C7V A;  3LY4 A;  1L0E A;  4E3O A;  4PM9 A;  1W7F A;  4K91 A;  4U0X A;  4CPK A;  3V50 A;  2QMI A;  2I72 A;  3ZG9 B;  3P98 A;  4OOL A;  4S2N C;  3Q7Z A;  1Z6F A;  3IF6 A;  3SS3 A;  5GLA A;  1KDS A;  2P9V B;  4EBN A;  1MY8 A;  4KQQ A;  2XFT A;  1K57 A;  3AGF A;  1XX2 A;  3M6H A;  3UDX A;  2J8Y A;  4Q8I A;  2HDS A;  5M18 A;  3IHB A;  3ZG0 A;  1NYM A;  4XUX A;  1ES5 A;  4FD8 A;  4MEZ A;  2ZQA A;  4X53 A;  3UPP A;  1K6S A;  4DXC A;  4OQI A;  5KSH A;  5A91 A;  1BUE A;  1L0G A;  1U60 A;  1GA0 A;  1PZO A;  3W4Q A;  3FKV A;  1ZG4 A;  4KZ5 A;  4OPZ A;  5GHY A;  2ZC4 B;  3W4P A;  2BLS A;  4XXR A;  3PTE A;  1FOF A;  3C5A A;  4R1G A;  3JYI A;  4GB7 A;  1BUL A;  1ERO A;  1FCN A;  2WAE A;  4R0Q A;  2ZQ7 A;  2HDR A;  4EBP A;  5HL1 A;  1ZC2 A;  2JCH A;  4PM7 A;  2EX9 A;  2WGV A;  4IVI A;  4QY6 A;  4KG6 A;  5CXW A;  2Y2G A;  4KQR A;  4KEN B;  1TDG A;  1S6R A;  2Y2N A;  4DRT A;  1YMS A;  5CER A;  3SS4 A;  4PPR A;  1JWZ A;  5TGF A;  5CGW A;  4RX3 A;  5GLC A;  2JBF A;  3OPL A;  3VOY A;  3G4P A;  2A49 A;  2XFS A;  1ESI A;  1K56 D;  2XF3 A;  1GCE A;  4Z9Q A;  1DJB A;  2R9W A;  4B4Z A;  2H10 A;  4EBL A;  1XGI A;  1ES2 A;  3BFE A;  2EX8 A;  1WE4 A;  3IH8 A;  1XPB A;  1J9M A;  1H8Y A;  3N8R A;  3EQU A;  4BQM A;  4DDY A;  2WUQ A;  4HBT A;  5CGS A;  4OH0 A;  4WEK A;  2WYX A;  3IT9 A;  5CHJ A;  3S4X A;  3WWX A;  1IEL A;  1L2S A;  4NET A;  4P6B A;  5AQ9 A;  5EVI D;  5FAO A;  3M2J A;  3IXD A;  4R23 A;  4R4R A;  4OVD A;  3GMW A;  4RX2 A;  2QPN A;  4D2O A;  2B5R A;  2ZQ8 A;  4PM5 A;  2G2U A;  4UA6 A;  4OKP A;  4S2O A;  4HES A;  1FSW A;  1ZG6 A;  4JBF A;  4KQO A;  5TFQ A;  2JC7 A;  3PAE A;  2ZD8 A;  1IKG A;  4HBU A;  2J9O A;  1I2S A;  3Q07 A;  1OME A;  2X71 A;  3SS5 A;  5F83 A;  5FAT A;  1LI9 A;  2ZC7 A;  4GDB A;  4OP8 A;  1WYC A;  3UE0 A;  1K54 A;  3OZH A;  2ZM8 A;  1G6A A;  3UE1 A;  1RP5 A;  1GHM A;  3BFF A;  3G31 A;  3OC2 A;  3C7U A;  3MBZ A;  2DRW A;  1YT4 A;  2ZM2 A;  3PBO A;  5AQA A;  2HP5 A;  4R3B A;  3IWQ A;  4JKT A;  4E3N A;  1NJ4 A;  3M6B A;  2ZQD A;  3LY3 A;  1KE4 A;  3CG5 A;  3PBT A;  1ZKJ A;  3IWI A;  4ZJ2 A;  1XA1 A;  5DTK A;  5FA7 A;  5FSR A;  3WS4 A;  4OPY A;  3OPR A;  4LV2 A;  3S1Y A;  4F94 A;  5CTN A;  3QNC A;  1KGE A;  2PU2 A;  1JTG A;  2DNS A;  4BJP A;  1CEF A;  4YFM A;  5EPH A;  2C6W B;  3V5M A;  3A3D A;  3N6I A;  2HPB A;  2R9X A;  1NZO A;  4OP5 A;  2J9P A;  1TVF A;  1TEM A;  4E3K A;  3C4O A;  2WZX A;  3BEC A;  5HAP A;  3WS2 A;  3ZNT A;  1E25 A;  2ZQC A;  3BRM A;  4YIN A;  3ISG A;  1BLC A;  3HRE A;  4JPM A;  5A90 A;  3ITB A;  2E8I A;  3HLE A;  1L0D A;  1O7E A;  1HD8 A;  3DWK A;  3NY4 A;  3BEB A;  5U47 A;  3UE3 A;  4QJG A;  1YLY A;  2H5S A;  1EWZ A;  3IH9 A;  3SH8 A;  2XR0 A;  3LO7 A;  2OLV A;  4S2N A;  4R3J A;  1WYB A;  3G30 A;  1Q2Q A;  5FQI A;  5DF9 A;  1ERQ A;  1GA9 A;  3ZVT A;  4B4X A;  2ZQ9 A;  3VP1 A;  5HW3 A;  3UN7 A;  1PI5 A;  2XLN A;  3MZD A;  3OCL A;  4IBR A;  5GHX A;  2EFX A;  4X69 A;  5G18 A;  4H8R A;  4LV1 A;  1PIO A;  3D4F A;  4GD6 A;  4X55 A;  4QB8 A;  3IXH A;  1CI8 A;  4GN2 A;  5GLB A;  1M6K A;  3ZCZ A;  3HLB A;  1K55 A;  1BLH A;  5J8X A;  1ERM A;  5AQB A;  3VSL A;  4JLF A;  4IED A;  4KZ4 A;  5HAR A;  4DE1 A;  3WRZ A;  2XDM A;  3BYD A;  4RVA A;  5CRF A;  5CED A;  1KVM A;  1YM1 A;  4OOM A;  1XGJ A;  2OLU A;  4M3K A;  5EVI C;  4KZ9 A;  4MLL A;  3NDG A;  3SOI A;  4OQH A;  1K4F A;  1YMX A;  4WBG A;  4WM9 A;  4OQG A;  4XUZ A;  1YLJ A;  5L2F A;  3DTM A;  1JVJ A;  3HUN A;  1KGG A;  1W8Y A;  3MKE A;  1IKI A;  4N9K A;  1MPL A;  3I7J A;  4GZB A;  5F1F A;  1NXY A;  4FH2 A;  3IWO A;  3P09 A;  4C6Y A;  4GDN A;  2VGK A;  4FCF A;  5TR7 A;  2OSU A;  1PW8 A;  4OLG A;  1LI0 A;  2G2W A;  1MWU A;  2Y2J A;  4DE2 A;  2GDN A;  1VM1 A;  3N8S A;  3W8K A;  4LCL A;  3ITA A;  1JTD A;  4L0L A;  4KZA A;  4JXG A;  3HVF A;  4JF5 A;  3GQZ A;  3UDI A;  2WZZ A;  1G68 A;  4E6X A;  4KZ8 A;  1I5Q A;  4R4S A;  3AGE A;  4LCM A;  2P74 A;  4PM6 A;  5I94 A;  1CEG A;  3GSG A;  4GKU A;  2WGI A;  3MZF A;  5EOE A;  2H0T A;  3AGD A;  4N1H A;  4KZB A;  2XD1 A;  3LCE A;  3RXX A;  1XP4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...