4HIAA

Crystal structure of rhodobacter sphaeroides lov protein
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
176
structure length
176
Chain Sequence
MDQKQFEKIRAVFDRSGVALTLVDMSLPEQPVVLANPPFLRMTGYTEGQILGFNCRFLQRGDENAQARADIRDALKLGRELQVVLRNYRANDEPFDNLLFLHPVGGRPDAPDYFLGSQFELGRSGNSEEAAAAGHAGALTGELARIGTVAARLEMDSRRHLAQAAAALVRAWERRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LOV protein
publication title Light-induced subunit dissociation by a light-oxygen-voltage domain photoreceptor from Rhodobacter sphaeroides.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Signaling protein
total genus 59
structure length 176
sequence length 176
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4hiaA00
2V1AA 3EWKA 3VE4A 3NOUC 2OWHA 5KIZA 1XFNA 2QJ5A 3F1NB 2PYRA 2OOLA 2EA9A 1S67L 1BYWA 3BY8A 4LRZE 3VE3A 2A24B 5DKKA 3MR0A 3LIEA 5DJUA 4L9FA 3HJIA 1S4RA 1LSXA 4PKYA 4I3AA 4E04A 2VLGA 5TBMA 2HV1A 3T50A 4EEUA 2KDKA 2V1BA 3CLOA 2D02A 4EERA 5J7EA 1XJ2A 2V0UA 3K3CA 1OT9A 5DKLA 3FC7A 4BBUA 1OT6A 1KOUA 4R6LA 1N9LA 5F69A 4WUJA 3NHQA 2OWJA 2I9VA 2Z6DA 3OLOA 3LI9A 2V9AA 2ZOIA 3LIBA 1GSWA 2WKRA 4XT2A 4HJ4A 4EESA 4WN5A 4HOIA 5HD5A 4LRXC 2L0WA 3UMDA 1N9NA 1T18A 5TBMB 3ZQ5A 4EEPA 3LYXA 5HSQA 4WL9A 3MJQA 4I38A 1TS7A 3E4OA 1NWZA 5EFWA 2PR6A 4PKYG 4LRYC 4R3AA 5F5YA 4EETB 4NXEA 3F1OA 1N9OA 3E4QA 4GS9B 4HP9A 2VV7A 3HJKA 4NXFA 3H9WA 1F98A 1LSVA 4GHIA 1VB6A 3A0RA 4R38A 2QJ7A 1MZUA 4WLAA 5F6AA 3A0SA 4B9OA 3UE6A 5G4YA 2P7JA 2YKFA 4I3IA 2VV6A 4NXBA 3MQOA 3UB7A 4JGPA 4I5SA 4H6JB 5AVFA 2L4RA 4EQ1A 5AVEA 2PHYA 1P97A 3LIDA 4KUKA 4MN5A 2PYPA 2B02A 3LI8A 1Y28A 4NXGA 1T1BA 3LIAA 1D06A 3FG8A 3C8CA 3NOTC 2WKPA 2H28A 2Z6CA 4HJ6A 1S66L 1OTDA 5IS1A 2GJ3A 2ZOHA 4HNBA 1EW0A 4KQDA 1LL8A 2VV8A 4HH2A 3H7WA 3NJAA 2M1CA 5F68A 5HWVA 1TS0A 4HIAA 4EXOA 5DJTA 3UMEA 4JGRA 3CAXA 3B33A 2W0NA 4L9GA 3ULFA 5HZHA 4HH3A 3RTYA 1S1ZA 1T1AA 1JNUA 2A24A 1S4SA 3A0VA 1DP6A 1XFQA 3IS2A 2J80A 2YKHA 2R78A 2L1MA 1OTAA 1LT0A 2PD7A 3GECA 3P7NA 3H82A 4GCZA 1WA9A 4GW9A 5HDSA 3MQQA 5A8BA 4JGQA 2JN7A 4DJ3A 3LUQA 5HWWA 4KUOA 4I39A 3BY9A 3LICA 2BASA 3H7WB 4HJ3A 4RQ9A 1UWPX 2QHKA 2WKQA 2CMNA 5G4ZA 3UB6A 1OJ5A 1ODVA 3CWFA 4XT2B 1UGUA 2KX6A 4L9EA 4F3LA 3NOPC 2PD8A 3VOLA 1OTIA 5IU1A 3EEHA 5HWTA 3K3DA 4M4XA 4EW7A 3D72A 3F1PA 3IS2B 1TS6A 3IBRA 1X0OA 5HD3A 4HHDA 2K7SA 1D7EA 3PYPA 3F1OB 3E4PA 4I3JA 3H82B 5I5LA 4BBTA 1T19A 4LLOB 2W27A 5HDDA 1GSVA 1GSXA 4GHIB 3RH8B 3BWLA 2PR5A 3LIFA 4HY8A 5J4EA 1XJ6A 4GS9A 4HQAA 1DP8A 1LSWA 3GDIA 1F9IA 4YWZA 4K08A 4MN6A 3UB9A 3F1NA 1S1YA 5HDCA 4F3LB 2QWSA 2D01A 3C2WA 1T1CA 3G6OA 1V9YA 3ICYA 4JGOA 3UB8A 4BBVA 4WF0A 1P0ZA 4H6JA 3F1PB 2QKPA 3KX0X 2JHEA 2VEAA 1XJ4A 1G28A 2ZBBA 4HP4A 3PHYA 3SW1A 1OTEA 4DJ2A 3MXQA 1TS8A 4HI4A 1OJGA 4R70A 1XJ3A 1DP9A 2V0WA 1DRMA 2INWA 3MFXA 5J3WA 1OTBA 1UWNX 2PDRA 4LPZA 1V9ZA
chains in the Genus database with same CATH superfamily
3IWQA 1ERMA 2V1AA 3NOUC 1VEUA 1IYPA 1Z6FA 2EA9A 1K57C 1XGIA 4U0XA 4FCFA 3E2KA 3Q1FA 4L9FA 4YOFA 5HAQA 1FR6A 5J8XA 4X69A 5L07A 3Q7ZA 2DMWA 1MKIA 4OQ0A 3IF6C 1NLYA 2MJ6A 2LB5A 1C3BA 3CLOA 4E6WA 3ZNTA 2D02A 2VGKA 3GMWA 1BLCA 3S7OA 2H5SA 4JPMA 3LEQA 3CI6A 2OLVA 1XA1A 1BLPA 1TVFA 2QZ6A 4FH2A 4BBUA 4KZ7A 4OOYA 3A3EA 2J3TC 3OZHA 2Y2NA 4R6LA 1HLUP 1N9LA 3IHBA 1K55C 4OQGA 2VZWA 4MLLA 4X25A 2A49A 4DXCA 3OLOA 1CEGA 2ZOIA 1E3UD 4OOLA 4DRTA 3LEZA 5HFOA 4QJGA 2WZZA 3NDGA 4KZ5A 4EESA 3TJZC 4WN5A 2NUTC 4OQHA 5HD5A 1WYCA 4LRXC 2L0WA 4LENA 4S2PA 1T18A 3T4LA 4EEPA 3LYXA 4Y3IA 3OC2A 5K5BA 1MWRA 3BLSA 4OP8A 3MJQA 3ZG0A 3T12B 4I38A 3HVFA 1H5XA 3FKVA 5EFWA 3AGFA 4PKYG 3Q81A 2ZC6B 4LRYC 4U3TA 3D4FA 4EETB 4MCWA 5CHMA 1PZPA 5FA7A 3S4XA 2VV7A 3M6BA 4NXFA 5DFYA 4EU0A 1ZC2A 4UA6A 4GN2A 3W4QA 4ZBEA 2EX8A 1LSVA 1VB6A 3PBNA 1MZUA 5A90A 3A0SA 5IT5A 1Q2QA 3UE6A 5BOHA 4X1LA 2ZM0A 3T4KA 2P7JA 4KZ8A 3IXHA 4WZ5A 4Y15A 5CTMA 2VV6A 3MQOA 3UB7A 4R4SA 4JGPA 3O3VA 2JKRI 4DE2A 4ME4A 2ZQAA 2XFSA 2L4RA 4EQ1A 5AQAA 3R4KA 4HEFA 3WS1A 1P97A 2Y2GA 4EUZA 3N8RA 4HBUA 1Y28A 4PMAA 2WGIA 4WMCD 5KSHA 1BLSA 1T1BA 1KGFA 4B93A 1YKDA 5GHYA 2H28A 2Z6CA 2WUQA 4Q8IA 4KQRA 3P98A 4QPRA 1SDNA 4HNBA 1EW0A 3ZHHA 3FPVA 3UE0A 1ONHA 5DF9A 2J3TD 3NJAA 1M6KA 1TS0A 2P04A 3CUEA 4R23A 5L8MA 2Y2KA 1H3QA 3D3OA 4L9GA 3GV9A 4HH3A 2VGLS 1T1AA 3A0VA 3VMAA 1DP6A 3PAGA 4N1HA 4P6BA 2Y2QA 3MS6A 2L1MA 1P9RA 4OQIA 1OTAA 1CI8A 2PD7A 3U2AA 3H82A 1OPXA 1NZOA 4E6XA 4GW9A 4O01A 5HDSA 3S22A 4BENA 5I94A 4DJ3A 4OH0A 3DW0A 5GHZA 1MXOA 4X56A 3VV4A 4KG2A 4E3JA 3LICA 3H7WB 4OLGA 4OVDA 2B95A 4RQ9A 5EVID 3V3SA 2QHKA 2WKQA 3S1YA 5G4ZA 3UB6A 3N8SA 4EUVA 1FCMA 4XT2B 4ZRRA 1RCJA 3VOLA 4PM7A 5TFQA 1OTIA 3M2JA 3WWXA 3EEHA 1YLWA 1I5QA 3SOIA 4NK3A 3D72A 3UDXA 3F1PA 3QNBA 1IYOA 1X0OA 2KLIA 5MC7A 3IX8A 3WRZA 4DE0A 1D7EA 2IWDA 2HJ9C 2V20A 3F1OB 5FEFA 5FQ9A 3O5YA 2HF6A 2W1TB 1YT4A 4BBTA 4PM9A 1SDEA 4P85A 3VP1A 2Y2HA 1GSXA 2XRNA 4N9LA 3RH8B 3LIFA 5L10A 4HY8A 2JBFA 4K0XA 4XUXA 5J4EA 3G4PA 1L0EA 1DP8A 2W3DA 1H8MA 3GDIA 1K0KA 1L2SA 5CGWA 1ESIA 1RP5A 3AGDA 1S1YA 3C7UA 5CEBA 1BTLA 1FR1A 1SKOA 4F3LB 2ZJ9A 2D01A 1E3UA 5F82A 3BFFA 1V9YA 2O0YA 1G6OA 5M1AA 3UB8A 2ZMAA 4E3LA 3Q7VB 2VGLM 4DE1A 1P9WA 1P0ZA 3DWKA 4O8GA 1LI0A 2VEAA 2K31A 2PU4A 3DTIA 4GOGA 3PHYA 1OTEA 3HREA 1VM1A 3MXQA 4HI4A 3NY4A 1OJGA 4R4RA 4DDYA 3T1RA 4CPKA 2V0WA 3MQ0A 2ZC3B 4S2IA 1FCNA 4X55A 5CERA 3UPOA 1WE4A 5FATA 3VE4A 3M6HA 4ZJ2A 3F1NB 3IXDA 2WADA 2DRWA 3BY8A 4LRZE 2IA2A 4BD1A 1NLZA 5FDSA 3BQAA 2A24B 4KZ6A 5DKKA 4GB7A 3V3RA 4AFIA 2Q9NA 2V1ZA 3MR0A 3ZFZA 3LIEA 3MZEA 3ZCZA 1K4FA 3HJIA 1DY6A 2O9BA 1I2WA 1K57A 1LSXA 4PKYA 5TJJA 4I3AA 3LGOA 4E04A 4XUZA 3ISGA 1CK3A 4Y0UA 1PI5A 2HV1A 5TBMA 3BFDA 2Y79A 3T50A 4EEUA 2KDKA 3CPTB 3S7QA 5CTNA 1XJ2A 4WMCA 3ZG8B 3NI9A 2OAQ1 5CXWA 4HBTA 4WBGA 1FSWA 3IF6A 1Y4OA 4IEDA 3UO9A 3B42A 5IHVA 2W1RA 3N4IA 3BYDA 3NHQA 4KG5A 4LCMA 3ZG5A 4QHCA 3FPWA 3HLWA 1BUEA 1ES3A 2Y2JA 4N1XA 2UV0E 3QP8A 1PWDA 1NRFA 3UE3A 3CG5A 3TSGA 3WS0A 3LI9A 2V9AA 1K55A 4OPYA 1LLBA 4WELA 4KENB 4ID4A 4P6ZS 3TW8A 1YMSA 2VGJA 3DWZA 3S7NA 3ZYTA 2J9PA 2KOIA 3DTEA 5F1FA 2Y4AA 3BRMA 3EQUA 3BW6A 1TS7A 4LCLA 2JKRM 1NWZA 3MMHA 2WKEA 3EGXC 5F5YA 2WGVA 3IBJA 4S2JA 4CLCC 2PT7A 4GS9B 3HJKA 3FV7A 2WGWA 3B47A 2WK0A 1K56D 2K2NA 4GHIA 1IYQA 3O86A 3QNCA 3W4OA 1ONGA 4ETXA 5EVIA 5JYOA 1D1JA 1JWVA 1SCWA 3P01A 5HL1A 5FI2A 2XR0A 1AXBA 2HZ5A 4GDNA 2PU2A 2YKFA 4I3IA 4K0WA 2PBDP 4R1GA 4OP5A 4I5SA 1JVJA 4ZAMA 2EX6A 5FEGA 4H6JB 2BLSA 3G31A 3FWLA 3IWIA 5CHJA 2R9XA 2Y2LA 3NC8A 2PYPA 3OPLA 5L09A 4FOFA 4MDZA 3JPUA 5G18A 2A2LA 4UEYA 3NOTC 1GHMA 1VETA 1QMFA 1YLYA 1IKGA 4LV0A 3KYZA 2IWCA 4Y13A 5HAPA 5CHUA 3FKWA 1LL8A 1K4EA 2XF3A 1PW8A 5EECA 2M1CA 5F68A 1N9BA 4EXOA 1IOUA 3VP0A 1HD8A 5CEDA 5E2GA 5HL6A 5DF7A 3B33A 3IXBA 2W0NA 2PBYA 4KQOA 3WS4A 4FUWA 4P6ZM 2XEPA 4P87A 2E8IA 2EX9A 4QY6A 3VSKA 2VJWA 3A3DA 1ES2A 1VQQA 4X1MA 3IS2A 2J80A 3QP6A 4M3KA 5M19A 4JF4A 3HUMA 1LT0A 1H0MA 3HLDA 3GECA 4D2OA 5EVIC 2LB9A 1IKIA 1L0DA 4PPRA 2WAFA 3N7WA 1XXMA 4FTXA 3LUQA 4I39A 3HL9A 2W3HA 1IEMA 4PM8A 3OBFA 5C5KA 3BY9A 4CLCD 4A5RA 4HJ3A 2GZAA 1UWPX 3HUNA 4OPRA 4BD0A 2CMNA 3C4OA 1OJ5A 3CWFA 4G3KA 5CGSA 4DMZA 3UPNA 4RYEA 3NOPC 3PBTA 2UWXA 5TGFA 4YFMA 3UB5P 5HWTA 3G34A 5KMWA 1MY8A 4D60A 2Y91A 4M4XA 4KG6A 4KZAA 4QB8A 1MC0A 1XA7A 2ZC5B 1W8YA 2B18A 5AQ9A 1L0GA 3SH8A 2Z2LB 4I3JA 3H82B 5I5LA 2XD5A 4EV4A 4IVKA 4PAUA 3U4LP 3BWLA 1LHYA 1EI5A 2VKSA 4GD6A 4ZJ3A 1XJ6A 4C75A 3QHYA 1F9IA 4KZ9A 2VK3A 3LFVA 4R0QA 1K6RA 4BL3A 3S7PA 4ETZA 4OPZA 5FQKA 5HDCA 2HDQA 1SKFA 1PW1A 2QWSA 3C2WA 1SHVA 4F94A 1JWZA 4JGOA 1TEMA 4R3BA 4DXBA 1U60A 1EROA 3OCNA 4NETA 4WYYA 4DF6A 2XSSA 1HTZA 3F1PB 3ZGAB 3KX0X 1XKZA 3EGDC 3UY6A 2PAVP 5E2HA 3IWOA 3GSGA 3KYEA 3TRCA 2WKHA 4PHTA 1IELA 3MF0A 4WZ4A 1J3WA 4B4XA 3IX4A 2GNXA 3G2YA 4IUHA 3KSHA 1DP9A 3VSLA 1JTGA 5DF8A 3CZDA 4G3WA 3C5AA 3MKFA 4JKTA 1GCEA 1OTBA 1UWNX 2ACGA 4LPZA 4LV1A 1K56A 3EWKA 3HLCA 3RJUA 2HP6A 5KIZA 1PIOA 2QJ5A 2PYRA 2EWVA 1S67L 1BYWA 4B88A 1ESUA 4Z1WA 3WS2A 5HW3A 3VE3A 3C4PA 5DJUA 2Q9MA 1S4RA 3KYQA 3BECA 2EWWA 5DTSA 1VHMA 3PBSA 1GA0A 2Y2IA 2XLNA 1W79A 3ZG7B 1BLHA 4N92A 2ZQCA 1PNEA 4OPQA 2XH9A 2HPBA 2QYBA 1PWGA 4E3IA 4BJPA 3HLEA 4ZDXA 1XP4A 4UA9A 5DKLA 3W4PA 3GRJA 5FI6A 3QP5A 3LR4A 2NUPC 3W8KA 3I7JA 1W5DA 2JE5A 1FIKA 3DTMA 3TOIA 5FQJA 2XD1A 1CI9A 2XFTA 1GSWA 4JF5A 3EQVA 4JXSA 4XT2A 2HP5A 4S2NC 3T4JA 3C7VA 4JXVA 3UMDA 2H10A 4GJ4A 3VP4A 4CQHA 2ZM8A 2P74A 3JVUA 5TBMB 2Y8HA 2HDUA 2ZQ7A 2P08A 4BQMA 3VFFA 5GLAA 3BJNA 4GKUA 1H8ZA 3E4OA 4FD8A 1GHPA 5A93A 4WEJA 1PWCA 4EBPA 5M18A 2Z2MB 4NXEA 3F1OA 1W8QA 5D3OA 2C6WB 4ARZB 4Y5FA 4RVAA 1N9OA 4EBLA 3A3IA 2P9VA 2H0YA 4HP9A 3H9WA 1F98A 3PAEA 3MBZA 3IXGA 4G3VA 4NEED 5GLCA 3CMZA 3A0RA 1ZTUA 4R38A 2W3FA 4GZBA 4WLAA 5EE8A 4CLCA 5F6AA 4B9OA 4P0MA 2PRFA 2O9AA 5EV0A 3UDFA 1I2SA 1H8YA 3B3XA 3AGEA 3C30A 4NXBA 2RL3A 3JYIA 4O7DA 1ES5A 4H8RA 1KE0A 3UN7A 3ITBA 4OLDA 5E2FA 3ITAA 1YAXA 5HPFA 3T4OA 1PI4A 4KUKA 3Q7VA 4MN5A 4E3OA 1MWSA 5GLDA 2ZL1A 4NXGA 5FSRA 1NXYA 4JXGA 1PFLA 2ZC4B 3Q82A 3SS5A 3FG8A 5EVLA 2M7UA 4L0LA 2QPNA 4MMNA 2WKPA 3PBQA 4BWIA 3HUOA 4HJ6A 2XQZA 1BSGA 1OTDA 4K91A 3R7WA 4YINA 2GJ3A 2O99A 1VEUB 3BLMA 2JC7A 3L7HA 3T4TA 5FAQA 3G35A 1HVBA 5HWVA 2V2FF 5DJTA 4DKIA 2V8CA 3IF5A 3UMEA 4S2LA 4JBFA 4PM5A 1PRQA 3V67A 3CAXA 3M2KA 2OSUA 2WYXA 4Z9QA 3UE1A 5HZHA 4QY5A 2A24A 1S4SA 1KE4A 4LV2A 3ZVWA 2V8FA 1XFQA 2ZMFA 4CLCE 2YKHA 3T4QA 2R78A 2G2WA 4LFUA 4MN7A 4ZJ1A 1F2KA 3P7NA 3GQZA 4GCZA 2EFXA 1O07A 1CQAA 5L2FA 2FFFB 5A8BA 4JGQA 2Y2OA 4BMWA 3LR5A 1S6RA 3LR0A 4HESA 4LGWA 4S2KA 1MWTA 4JXWA 1Y54A 3E0YA 3V50A 3KSFA 1J9MA 4JLFA 5E2EA 3CJMA 1YSQA 1ODVA 4MBHA 5DFXA 3KSGA 1UGUA 2KX6A 4L9EA 1YQSA 2PD8A 1DJBA 4GLQA 2XGNA 5EOOA 1NJ4A 4OONA 5IU1A 4Y17A 3MKEA 3D9YA 3IS2B 1TS6A 3FZCA 3PBRA 3IBRA 1KE3A 4HHDA 2K7SA 2WKIA 3E4PA 1YLJA 3LO7A 1MBLA 2ZC7A 1L0FA 1RGZA 1MPLA 4E3NA 4LLOB 5JYPA 5HDDA 2J9OA 1BT5A 2PR5A 4S2MA 1W63Q 2GX5A 3BFGA 3O88A 4GS9A 3MXSA 4HQAA 2G7UA 3WRTA 2BG1A 4II7A 4K08A 4MN6A 4UA7A 3MZFA 2DCFA 4MBFA 2BTFP 3V5MA 1WYBA 2E8JA 1OMEA 2QMIA 4IBRA 1M40A 5DTKA 2EXBA 5GHXA 3G6OA 4KQQA 3RXWA 1CEFA 1XGJA 3C38A 4WF0A 5FAOA 3VP3A 4H6JA 3E98A 3BFCA 2QKPA 2W3EA 2JHEA 3PBOA 2CC1A 3DAVA 3A3FA 1FOFA 2ZBBA 3RXXA 5FQQA 3SS3A 4C3QA 1YPRA 3SW1A 4DJ2A 3EEAA 1LL5A 1TS8A 3IQAA 4O0PA 4N9KA 4R3JA 1XJ3A 4R70A 1GA9A 1DRMA 2J8YA 4BL2A 2Y55A 3OOVA 5J3WA 2JKTM 2X71A 3NCKA 3TG9A 4B4ZA 3SS4A 4RA7A 1E4DA 5FAPA 2OWHA 3VOYA 3GTCA 4UQIS 2RCXA 1XFNA 5FQIA 2ZQDA 2M7VA 2OOLA 4EWFA 3O87A 5FQMA 1BZAA 4BLMA 5AJGA 4Q0IA 2WZXA 5F83A 3NULA 3G32A 1E25A 3GVBA 4ZTKA 4EBNA 1F5MA 4XXRA 4DE3A 1ZKJA 4MNRA 2VLGA 4OKPA 3IX3A 4LV3A 1KVLA 3DTKA 3OCLA 2V1BA 1LI9A 1EWZA 4EERA 5J7EA 5AQ7A 1S0WA 4PM6A 3VFHA 2V0UA 3K3CA 1OT9A 2J3WA 5GLBA 2HP9A 3FC7A 1DJAA 1NZUA 5HPIA 5EUAA 4KZBA 1OT6A 1KOUA 4IVIA 4IJGA 1K6SA 1IFQA 3FYZA 4X53A 3OPRA 4KZ3A 5F69A 1BULA 2JCHA 4WUJA 4ESPA 2OWJA 5FL3A 2I9VA 2HDSA 3HCYA 2HGVA 2Z6DA 1RGYA 3IH8A 1YM1A 5A92A 5E43A 2ZM2A 3T1XA 3LIBA 2WKRA 4YNRA 4HJ4A 2VX8A 3GR2A 2ZMVA 2JKGA 1ZG6A 4HOIA 5DVAA 1N4OA 1MKMA 1N9NA 3NDEA 1MWUA 2Y2PA 2HJEA 3MZDA 3ZQ5A 5TR7A 5HSQA 4WL9A 2HDRA 1CJFA 1GHIA 2XA7S 3IHAA 3PTEA 4WEKA 4S2NA 2PR6A 3UPPA 1W7FA 1L3LA 4R3AA 5KZHA 1ES4A 3QP4A 1YMXA 1K25A 3E4QA 4X6TA 3BEBA 1TF1A 2W3GA 2R9WA 3ZVTA 5AQBA 4GD8A 3IH9A 3BQ8A 1ALQA 5HX9A 4WZ5C 1KDSA 2B5RA 2QJ7A 3OPHA 5LBRA 1DJCA 3OPPA 4UQIM 4Y2FA 1SKOB 4IHQA 2A3UA 1W63M 5G4YA 2XROA 1YSPA 1XX2A 3KO6A 2I72A 2J7VA 3RFBA 4FSFA 2O9CA 3HBRA 3K2NA 5AVFA 1O7EA 4MEZA 3UNWA 5FASA 5AVEA 2X02A 2PHYA 3SZTA 2JKTI 3LIDA 2B02A 3LI8A 1FILA 5DTTA 3SH7A 3VOZA 3EOIA 1YLPA 3LY4A 5GL9A 1IYSA 3LIAA 1D06A 2FZ0A 3C8CA 4QD4A 3MFDA 2GDNA 1Q2PA 1G68A 4MBKA 2DNSA 1S66L 2P9VB 1K54A 5IS1A 1TDGA 3SH9A 3TE8A 2ZOHA 4QU3A 3QP2A 3CUEC 4E3KA 1YLTA 4KQDA 3CHWP 1KDWA 1ZG4A 2Y59A 2VV8A 3W2ZA 4HH2A 3T4SA 3H7WA 4CLCB 4OOMA 4GDBA 2ZQ9A 3L9KA 5CECA 1ACFA 4HIAA 4Q0JA 1PYYA 1AWIA 1G5UA 4JGRA 4UAAA 5CRFA 3Q07A 5EOEA 2ZLYA 4WM9A 3ULFA 3RTYA 1S1ZA 1JNUA 4Y0TA 3V39A 1A0KA 5F1GA 2VA0A 3BFEA 1ZHHB 3VP2A 3LY3A 5EVEA 3NECA 3IT9A 3HLBA 2ZL1B 1FSYA 3T1SA 2H0TA 4IBXA 5HAIA 5A91A 2XK1A 5U47A 2XA7M 3IF6B 2ZQ8A 2C5WB 3E2LA 3NIAA 1QMEA 1WA9A 2W1TA 4S2OA 3JVVA 4GNUA 3MQQA 2XDMA 4DDSA 2JN7A 3R7WB 3ZDJA 5HWWA 4KUOA 3WS5A 3QP1A 4Y7PA 1CF0A 4EQIA 2ZD8A 1LL9A 2BASA 3PXPA 2EX2A 3HLGA 3ZNYA 3P09A 1SZVA 1PZOA 2OV5A 4F3LA 2Q0OA 4FH4A 5HARA 1NYYA 1NYMA 2FFYA 3KSIA 3K3DA 4E3MA 4Q0HA 5EM1A 4EW7A 2OLUA 3MSHA 3N6IA 1K54C 1G6AA 3BM6A 5HD3A 1ERQA 2FH5A 4X68A 3PYPA 4CJNA 1Z09A 3G2ZA 2AVXA 1NY0A 1FQGA 4JF6A 4Y0OA 5FI7A 4QWOA 1XPBA 4DN0A 1T19A 2WGWB 2W27A 1JWPA 3A3JA 1FCOA 2IWBA 1KVMA 4U0TA 1GSVA 3UDIA 3CITA 5KSCA 4GHIB 1JTDA 1K38A 4ARZA 4RX2A 2EXAA 1YLZA 5EVIB 1LSWA 5FDHA 4C6YA 4YWZA 2WAEA 4IUKA 3UB9A 3F1NA 4RX3A 3MXRA 3G30A 3NBLA 1NRJA 2OAP1 4NG2A 1TD5A 5EPHA 1T1CA 3ZG9B 2EFUA 3ICYA 5EM0A 2JKFA 3DBAA 4BBVA 4UHUA 1KGGA 3HLFA 2X01A 3N8LA 4KZ4A 1XJ4A 1G28A 3CPTA 3LR3A 5CGXA 4HP4A 1VETB 5CX7A 3LCEA 3PR6A 1STZA 2Y2MA 2G2UA 1KGEA 1TDLA 2INWA 3MFXA 1HZOA 2PDRA 3T1QB 4NKPA 1V9ZA
chains in the Genus database with same CATH topology
2V1AA 3EWKA 3VE4A 3NOUC 2OWHA 4UQIS 5KIZA 1XFNA 2QJ5A 3F1NB 2PYRA 2EWVA 2OOLA 2M7VA 2EA9A 1S67L 1BYWA 3BY8A 4LRZE 2IA2A 5AJGA 4Q0IA 1NLZA 4Z1WA 3VE3A 3BQAA 2A24B 5DKKA 4AFIA 3MR0A 3LIEA 5DJUA 4L9FA 4YOFA 3HJIA 2O9BA 1S4RA 1LSXA 1F5MA 3KYQA 2EWWA 4PKYA 1VHMA 3PBSA 5TJJA 4I3AA 4E04A 2DMWA 2VLGA 5TBMA 2HV1A 1NLYA 2MJ6A 2Y79A 2LB5A 3T50A 4EEUA 3OCLA 2KDKA 2V1BA 3CLOA 3S7QA 2QYBA 2D02A 4EERA 5J7EA 3S7OA 1XJ2A 4BJPA 3CI6A 2V0UA 3K3CA 1OT9A 2OAQ1 5DKLA 2J3WA 3FC7A 4BBUA 2J3TC 5HPIA 1OT6A 1KOUA 4R6LA 4IJGA 3B42A 1IFQA 1N9LA 3LR4A 2NUPC 2W1RA 5F69A 4WUJA 3NHQA 2VZWA 3FPWA 2OWJA 5FL3A 2I9VA 3HCYA 2HGVA 2Z6DA 3OLOA 3UE3A 3LI9A 2V9AA 2ZOIA 4OOLA 3LIBA 1GSWA 2WKRA 4WELA 3EQVA 4P6ZS 4XT2A 4YNRA 4HJ4A 3TW8A 2VX8A 4EESA 2ZMVA 3T4JA 4WN5A 3TJZC 4HOIA 2NUTC 3S7NA 5HD5A 3ZYTA 4LRXC 2L0WA 1MKMA 3UMDA 1N9NA 1T18A 4GJ4A 4CQHA 2KOIA 3T4LA 2HJEA 3JVUA 5TBMB 3ZQ5A 4EEPA 3LYXA 4Y3IA 5HSQA 4WL9A 2Y8HA 3OC2A 5K5BA 3EQUA 3MJQA 2P08A 2XA7S 3BW6A 4I38A 1TS7A 3BJNA 4WEKA 3E4OA 2JKRM 1NWZA 4WEJA 5EFWA 2PR6A 3MMHA 4PKYG 4LRYC 4R3AA 3EGXC 5F5YA 4EETB 4NXEA 3F1OA 4MCWA 4ARZB 3IBJA 4Y5FA 4CLCC 1N9OA 3E4QA 2PT7A 4GS9B 4HP9A 2VV7A 1TF1A 3HJKA 2W3GA 3H9WA 4NXFA 5DFYA 4EU0A 3B47A 1F98A 3BQ8A 4G3VA 4NEED 1LSVA 2K2NA 4GHIA 1VB6A 3A0RA 1ZTUA 4R38A 2QJ7A 2W3FA 3PBNA 1MZUA 5LBRA 4WLAA 4CLCA 4ETXA 5F6AA 3A0SA 5IT5A 4UQIM 4Y2FA 4B9OA 3UE6A 2O9AA 3P01A 4IHQA 1W63M 5G4YA 3T4KA 2P7JA 2YKFA 4I3IA 2XROA 2VV6A 1YSPA 3C30A 4NXBA 3MQOA 3UB7A 3KO6A 4JGPA 3RFBA 4I5SA 4FSFA 2O9CA 2JKRI 4H6JB 3K2NA 4ME4A 5AVFA 2L4RA 4EQ1A 5AVEA 1YAXA 2PHYA 3R4KA 5HPFA 3T4OA 1P97A 2JKTI 3LIDA 4KUKA 4MN5A 2PYPA 2B02A 3LI8A 1Y28A 4NXGA 5KSHA 4FOFA 1T1BA 3EOIA 4MDZA 2A2LA 4UEYA 4B93A 3LIAA 1D06A 3FG8A 2M7UA 2FZ0A 3C8CA 1YKDA 3NOTC 4L0LA 4MMNA 2WKPA 2H28A 3PBQA 2Z6CA 4BWIA 4HJ6A 1S66L 1OTDA 5IS1A 4QPRA 3KYZA 3R7WA 2O99A 2GJ3A 2ZOHA 3TE8A 3CUEC 4HNBA 1EW0A 4KQDA 1LL8A 3FPVA 3T4TA 5DF9A 2VV8A 3W2ZA 4HH2A 3T4SA 3H7WA 2J3TD 3NJAA 4OOMA 4CLCB 2M1CA 5F68A 5HWVA 1TS0A 4HIAA 4EXOA 5DJTA 2P04A 1IOUA 4Q0JA 3CUEA 3UMEA 4JGRA 5L8MA 1H3QA 3D3OA 3V67A 3CAXA 5HL6A 3B33A 2W0NA 4L9GA 3ULFA 5HZHA 4HH3A 3RTYA 2VGLS 4KQOA 1S1ZA 1T1AA 1JNUA 2A24A 4P6ZM 1S4SA 3A0VA 1DP6A 2VJWA 1XFQA 2VA0A 2ZMFA 1ZHHB 3IS2A 2J80A 4CLCE 2YKHA 3T4QA 2R78A 2L1MA 1P9RA 1OTAA 2XA7M 1LT0A 2PD7A 4MN7A 3GECA 3U2AA 3P7NA 3H82A 1OPXA 1WA9A 4GCZA 2LB9A 2W1TA 3JVVA 4GW9A 4O01A 5HDSA 3MQQA 5A8BA 4JGQA 4BMWA 3LR5A 3LR0A 2JN7A 3R7WB 4DJ3A 3LUQA 5HWWA 4KUOA 4I39A 2W3HA 3E0YA 3OBFA 5C5KA 3VV4A 3BY9A 3LICA 4CLCD 2BASA 3H7WB 3PXPA 4HJ3A 3KSFA 4RQ9A 2GZAA 1UWPX 2QHKA 2WKQA 2CMNA 5G4ZA 3UB6A 1OJ5A 1YSQA 1ODVA 5DFXA 3CWFA 4G3KA 4EUVA 4DMZA 4XT2B 3KSGA 1UGUA 2KX6A 4L9EA 4F3LA 4ZRRA 3NOPC 2PD8A 3VOLA 3PBTA 4GLQA 1OTIA 5IU1A 3EEHA 5HWTA 3KSIA 3K3DA 4M4XA 4Q0HA 4EW7A 3D72A 3F1PA 3IS2B 1TS6A 3PBRA 1MC0A 3IBRA 1X0OA 2KLIA 5MC7A 5HD3A 4HHDA 2FH5A 2K7SA 1D7EA 3PYPA 2HJ9C 2B18A 3F1OB 3E4PA 4I3JA 3O5YA 3H82B 5I5LA 2HF6A 2W1TB 4BBTA 4DN0A 1T19A 4LLOB 2W27A 5HDDA 1GSVA 4PAUA 3CITA 2XRNA 1GSXA 4GHIB 3RH8B 3BWLA 2PR5A 3LIFA 4ARZA 1W63Q 4HY8A 2VKSA 2GX5A 5J4EA 1XJ6A 4GS9A 4HQAA 1DP8A 2G7UA 2W3DA 1H8MA 3GDIA 1LSWA 1F9IA 4II7A 4YWZA 4K08A 4MN6A 4IUKA 3UB9A 3F1NA 3LFVA 3S7PA 1S1YA 1NRJA 4ETZA 2OAP1 5HDCA 4F3LB 2QWSA 2D01A 1TD5A 3C2WA 1T1CA 3G6OA 1V9YA 3ICYA 4JGOA 2O0YA 1G6OA 3UB8A 3DBAA 4BBVA 2VGLM 4WF0A 3C38A 1P9WA 3OCNA 1P0ZA 4H6JA 3E98A 2XSSA 3F1PB 4O8GA 2QKPA 2W3EA 2JHEA 3KX0X 3PBOA 2VEAA 1XJ4A 1G28A 3EGDC 3LR3A 2ZBBA 3TRCA 2K31A 4HP4A 5CX7A 4PHTA 3PR6A 3MF0A 3PHYA 1STZA 3SW1A 1OTEA 4DJ2A 2GNXA 3EEAA 3MXQA 1TS8A 4HI4A 4IUHA 4O0PA 1OJGA 4R70A 1XJ3A 3KSHA 1DP9A 2V0WA 1DRMA 2INWA 3MFXA 3MQ0A 4G3WA 3OOVA 5J3WA 2JKTM 1OTBA 1UWNX 2PDRA 4LPZA 4NKPA 1V9ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V1A A;  3EWK A;  3VE4 A;  3NOU C;  2OWH A;  5KIZ A;  1XFN A;  2QJ5 A;  3F1N B;  2PYR A;  2OOL A;  2EA9 A;  1S67 L;  1BYW A;  3BY8 A;  4LRZ E;  3VE3 A;  2A24 B;  5DKK A;  3MR0 A;  3LIE A;  5DJU A;  4L9F A;  3HJI A;  1S4R A;  1LSX A;  4PKY A;  4I3A A;  4E04 A;  2VLG A;  5TBM A;  2HV1 A;  3T50 A;  4EEU A;  2KDK A;  2V1B A;  3CLO A;  2D02 A;  4EER A;  5J7E A;  1XJ2 A;  2V0U A;  3K3C A;  1OT9 A;  5DKL A;  3FC7 A;  4BBU A;  1OT6 A;  1KOU A;  4R6L A;  1N9L A;  5F69 A;  4WUJ A;  3NHQ A;  2OWJ A;  2I9V A;  2Z6D A;  3OLO A;  3LI9 A;  2V9A A;  2ZOI A;  3LIB A;  1GSW A;  2WKR A;  4XT2 A;  4HJ4 A;  4EES A;  4WN5 A;  4HOI A;  5HD5 A;  4LRX C;  2L0W A;  3UMD A;  1N9N A;  1T18 A;  5TBM B;  3ZQ5 A;  4EEP A;  3LYX A;  5HSQ A;  4WL9 A;  3MJQ A;  4I38 A;  1TS7 A;  3E4O A;  1NWZ A;  5EFW A;  2PR6 A;  4PKY G;  4LRY C;  4R3A A;  5F5Y A;  4EET B;  4NXE A;  3F1O A;  1N9O A;  3E4Q A;  4GS9 B;  4HP9 A;  2VV7 A;  3HJK A;  4NXF A;  3H9W A;  1F98 A;  1LSV A;  4GHI A;  1VB6 A;  3A0R A;  4R38 A;  2QJ7 A;  1MZU A;  4WLA A;  5F6A A;  3A0S A;  4B9O A;  3UE6 A;  5G4Y A;  2P7J A;  2YKF A;  4I3I A;  2VV6 A;  4NXB A;  3MQO A;  3UB7 A;  4JGP A;  4I5S A;  4H6J B;  5AVF A;  2L4R A;  4EQ1 A;  5AVE A;  2PHY A;  1P97 A;  3LID A;  4KUK A;  4MN5 A;  2PYP A;  2B02 A;  3LI8 A;  1Y28 A;  4NXG A;  1T1B A;  3LIA A;  1D06 A;  3FG8 A;  3C8C A;  3NOT C;  2WKP A;  2H28 A;  2Z6C A;  4HJ6 A;  1S66 L;  1OTD A;  5IS1 A;  2GJ3 A;  2ZOH A;  4HNB A;  1EW0 A;  4KQD A;  1LL8 A;  2VV8 A;  4HH2 A;  3H7W A;  3NJA A;  2M1C A;  5F68 A;  5HWV A;  1TS0 A;  4HIA A;  4EXO A;  5DJT A;  3UME A;  4JGR A;  3CAX A;  3B33 A;  2W0N A;  4L9G A;  3ULF A;  5HZH A;  4HH3 A;  3RTY A;  1S1Z A;  1T1A A;  1JNU A;  2A24 A;  1S4S A;  3A0V A;  1DP6 A;  1XFQ A;  3IS2 A;  2J80 A;  2YKH A;  2R78 A;  2L1M A;  1OTA A;  1LT0 A;  2PD7 A;  3GEC A;  3P7N A;  3H82 A;  4GCZ A;  1WA9 A;  4GW9 A;  5HDS A;  3MQQ A;  5A8B A;  4JGQ A;  2JN7 A;  4DJ3 A;  3LUQ A;  5HWW A;  4KUO A;  4I39 A;  3BY9 A;  3LIC A;  2BAS A;  3H7W B;  4HJ3 A;  4RQ9 A;  1UWP X;  2QHK A;  2WKQ A;  2CMN A;  5G4Z A;  3UB6 A;  1OJ5 A;  1ODV A;  3CWF A;  4XT2 B;  1UGU A;  2KX6 A;  4L9E A;  4F3L A;  3NOP C;  2PD8 A;  3VOL A;  1OTI A;  5IU1 A;  3EEH A;  5HWT A;  3K3D A;  4M4X A;  4EW7 A;  3D72 A;  3F1P A;  3IS2 B;  1TS6 A;  3IBR A;  1X0O A;  5HD3 A;  4HHD A;  2K7S A;  1D7E A;  3PYP A;  3F1O B;  3E4P A;  4I3J A;  3H82 B;  5I5L A;  4BBT A;  1T19 A;  4LLO B;  2W27 A;  5HDD A;  1GSV A;  1GSX A;  4GHI B;  3RH8 B;  3BWL A;  2PR5 A;  3LIF A;  4HY8 A;  5J4E A;  1XJ6 A;  4GS9 A;  4HQA A;  1DP8 A;  1LSW A;  3GDI A;  1F9I A;  4YWZ A;  4K08 A;  4MN6 A;  3UB9 A;  3F1N A;  1S1Y A;  5HDC A;  4F3L B;  2QWS A;  2D01 A;  3C2W A;  1T1C A;  3G6O A;  1V9Y A;  3ICY A;  4JGO A;  3UB8 A;  4BBV A;  4WF0 A;  1P0Z A;  4H6J A;  3F1P B;  2QKP A;  3KX0 X;  2JHE A;  2VEA A;  1XJ4 A;  1G28 A;  2ZBB A;  4HP4 A;  3PHY A;  3SW1 A;  1OTE A;  4DJ2 A;  3MXQ A;  1TS8 A;  4HI4 A;  1OJG A;  4R70 A;  1XJ3 A;  1DP9 A;  2V0W A;  1DRM A;  2INW A;  3MFX A;  5J3W A;  1OTB A;  1UWN X;  2PDR A;  4LPZ A;  1V9Z A; 
#chains in the Genus database with same CATH topology
 3IWQ A;  1ERM A;  2V1A A;  3NOU C;  1VEU A;  1IYP A;  1Z6F A;  2EA9 A;  1K57 C;  1XGI A;  4U0X A;  4FCF A;  3E2K A;  3Q1F A;  4L9F A;  4YOF A;  5HAQ A;  1FR6 A;  5J8X A;  4X69 A;  5L07 A;  3Q7Z A;  2DMW A;  1MKI A;  4OQ0 A;  3IF6 C;  1NLY A;  2MJ6 A;  2LB5 A;  1C3B A;  3CLO A;  4E6W A;  3ZNT A;  2D02 A;  2VGK A;  3GMW A;  1BLC A;  3S7O A;  2H5S A;  4JPM A;  3LEQ A;  3CI6 A;  2OLV A;  1XA1 A;  1BLP A;  1TVF A;  2QZ6 A;  4FH2 A;  4BBU A;  4KZ7 A;  4OOY A;  3A3E A;  2J3T C;  3OZH A;  2Y2N A;  4R6L A;  1HLU P;  1N9L A;  3IHB A;  1K55 C;  4OQG A;  2VZW A;  4MLL A;  4X25 A;  2A49 A;  4DXC A;  3OLO A;  1CEG A;  2ZOI A;  1E3U D;  4OOL A;  4DRT A;  3LEZ A;  5HFO A;  4QJG A;  2WZZ A;  3NDG A;  4KZ5 A;  4EES A;  3TJZ C;  4WN5 A;  2NUT C;  4OQH A;  5HD5 A;  1WYC A;  4LRX C;  2L0W A;  4LEN A;  4S2P A;  1T18 A;  3T4L A;  4EEP A;  3LYX A;  4Y3I A;  3OC2 A;  5K5B A;  1MWR A;  3BLS A;  4OP8 A;  3MJQ A;  3ZG0 A;  3T12 B;  4I38 A;  3HVF A;  1H5X A;  3FKV A;  5EFW A;  3AGF A;  4PKY G;  3Q81 A;  2ZC6 B;  4LRY C;  4U3T A;  3D4F A;  4EET B;  4MCW A;  5CHM A;  1PZP A;  5FA7 A;  3S4X A;  2VV7 A;  3M6B A;  4NXF A;  5DFY A;  4EU0 A;  1ZC2 A;  4UA6 A;  4GN2 A;  3W4Q A;  4ZBE A;  2EX8 A;  1LSV A;  1VB6 A;  3PBN A;  1MZU A;  5A90 A;  3A0S A;  5IT5 A;  1Q2Q A;  3UE6 A;  5BOH A;  4X1L A;  2ZM0 A;  3T4K A;  2P7J A;  4KZ8 A;  3IXH A;  4WZ5 A;  4Y15 A;  5CTM A;  2VV6 A;  3MQO A;  3UB7 A;  4R4S A;  4JGP A;  3O3V A;  2JKR I;  4DE2 A;  4ME4 A;  2ZQA A;  2XFS A;  2L4R A;  4EQ1 A;  5AQA A;  3R4K A;  4HEF A;  3WS1 A;  1P97 A;  2Y2G A;  4EUZ A;  3N8R A;  4HBU A;  1Y28 A;  4PMA A;  2WGI A;  4WMC D;  5KSH A;  1BLS A;  1T1B A;  1KGF A;  4B93 A;  1YKD A;  5GHY A;  2H28 A;  2Z6C A;  2WUQ A;  4Q8I A;  4KQR A;  3P98 A;  4QPR A;  1SDN A;  4HNB A;  1EW0 A;  3ZHH A;  3FPV A;  3UE0 A;  1ONH A;  5DF9 A;  2J3T D;  3NJA A;  1M6K A;  1TS0 A;  2P04 A;  3CUE A;  4R23 A;  5L8M A;  2Y2K A;  1H3Q A;  3D3O A;  4L9G A;  3GV9 A;  4HH3 A;  2VGL S;  1T1A A;  3A0V A;  3VMA A;  1DP6 A;  3PAG A;  4N1H A;  4P6B A;  2Y2Q A;  3MS6 A;  2L1M A;  1P9R A;  4OQI A;  1OTA A;  1CI8 A;  2PD7 A;  3U2A A;  3H82 A;  1OPX A;  1NZO A;  4E6X A;  4GW9 A;  4O01 A;  5HDS A;  3S22 A;  4BEN A;  5I94 A;  4DJ3 A;  4OH0 A;  3DW0 A;  5GHZ A;  1MXO A;  4X56 A;  3VV4 A;  4KG2 A;  4E3J A;  3LIC A;  3H7W B;  4OLG A;  4OVD A;  2B95 A;  4RQ9 A;  5EVI D;  3V3S A;  2QHK A;  2WKQ A;  3S1Y A;  5G4Z A;  3UB6 A;  3N8S A;  4EUV A;  1FCM A;  4XT2 B;  4ZRR A;  1RCJ A;  3VOL A;  4PM7 A;  5TFQ A;  1OTI A;  3M2J A;  3WWX A;  3EEH A;  1YLW A;  1I5Q A;  3SOI A;  4NK3 A;  3D72 A;  3UDX A;  3F1P A;  3QNB A;  1IYO A;  1X0O A;  2KLI A;  5MC7 A;  3IX8 A;  3WRZ A;  4DE0 A;  1D7E A;  2IWD A;  2HJ9 C;  2V20 A;  3F1O B;  5FEF A;  5FQ9 A;  3O5Y A;  2HF6 A;  2W1T B;  1YT4 A;  4BBT A;  4PM9 A;  1SDE A;  4P85 A;  3VP1 A;  2Y2H A;  1GSX A;  2XRN A;  4N9L A;  3RH8 B;  3LIF A;  5L10 A;  4HY8 A;  2JBF A;  4K0X A;  4XUX A;  5J4E A;  3G4P A;  1L0E A;  1DP8 A;  2W3D A;  1H8M A;  3GDI A;  1K0K A;  1L2S A;  5CGW A;  1ESI A;  1RP5 A;  3AGD A;  1S1Y A;  3C7U A;  5CEB A;  1BTL A;  1FR1 A;  1SKO A;  4F3L B;  2ZJ9 A;  2D01 A;  1E3U A;  5F82 A;  3BFF A;  1V9Y A;  2O0Y A;  1G6O A;  5M1A A;  3UB8 A;  2ZMA A;  4E3L A;  3Q7V B;  2VGL M;  4DE1 A;  1P9W A;  1P0Z A;  3DWK A;  4O8G A;  1LI0 A;  2VEA A;  2K31 A;  2PU4 A;  3DTI A;  4GOG A;  3PHY A;  1OTE A;  3HRE A;  1VM1 A;  3MXQ A;  4HI4 A;  3NY4 A;  1OJG A;  4R4R A;  4DDY A;  3T1R A;  4CPK A;  2V0W A;  3MQ0 A;  2ZC3 B;  4S2I A;  1FCN A;  4X55 A;  5CER A;  3UPO A;  1WE4 A;  5FAT A;  3VE4 A;  3M6H A;  4ZJ2 A;  3F1N B;  3IXD A;  2WAD A;  2DRW A;  3BY8 A;  4LRZ E;  2IA2 A;  4BD1 A;  1NLZ A;  5FDS A;  3BQA A;  2A24 B;  4KZ6 A;  5DKK A;  4GB7 A;  3V3R A;  4AFI A;  2Q9N A;  2V1Z A;  3MR0 A;  3ZFZ A;  3LIE A;  3MZE A;  3ZCZ A;  1K4F A;  3HJI A;  1DY6 A;  2O9B A;  1I2W A;  1K57 A;  1LSX A;  4PKY A;  5TJJ A;  4I3A A;  3LGO A;  4E04 A;  4XUZ A;  3ISG A;  1CK3 A;  4Y0U A;  1PI5 A;  2HV1 A;  5TBM A;  3BFD A;  2Y79 A;  3T50 A;  4EEU A;  2KDK A;  3CPT B;  3S7Q A;  5CTN A;  1XJ2 A;  4WMC A;  3ZG8 B;  3NI9 A;  2OAQ 1;  5CXW A;  4HBT A;  4WBG A;  1FSW A;  3IF6 A;  1Y4O A;  4IED A;  3UO9 A;  3B42 A;  5IHV A;  2W1R A;  3N4I A;  3BYD A;  3NHQ A;  4KG5 A;  4LCM A;  3ZG5 A;  4QHC A;  3FPW A;  3HLW A;  1BUE A;  1ES3 A;  2Y2J A;  4N1X A;  2UV0 E;  3QP8 A;  1PWD A;  1NRF A;  3UE3 A;  3CG5 A;  3TSG A;  3WS0 A;  3LI9 A;  2V9A A;  1K55 A;  4OPY A;  1LLB A;  4WEL A;  4KEN B;  4ID4 A;  4P6Z S;  3TW8 A;  1YMS A;  2VGJ A;  3DWZ A;  3S7N A;  3ZYT A;  2J9P A;  2KOI A;  3DTE A;  5F1F A;  2Y4A A;  3BRM A;  3EQU A;  3BW6 A;  1TS7 A;  4LCL A;  2JKR M;  1NWZ A;  3MMH A;  2WKE A;  3EGX C;  5F5Y A;  2WGV A;  3IBJ A;  4S2J A;  4CLC C;  2PT7 A;  4GS9 B;  3HJK A;  3FV7 A;  2WGW A;  3B47 A;  2WK0 A;  1K56 D;  2K2N A;  4GHI A;  1IYQ A;  3O86 A;  3QNC A;  3W4O A;  1ONG A;  4ETX A;  5EVI A;  5JYO A;  1D1J A;  1JWV A;  1SCW A;  3P01 A;  5HL1 A;  5FI2 A;  2XR0 A;  1AXB A;  2HZ5 A;  4GDN A;  2PU2 A;  2YKF A;  4I3I A;  4K0W A;  2PBD P;  4R1G A;  4OP5 A;  4I5S A;  1JVJ A;  4ZAM A;  2EX6 A;  5FEG A;  4H6J B;  2BLS A;  3G31 A;  3FWL A;  3IWI A;  5CHJ A;  2R9X A;  2Y2L A;  3NC8 A;  2PYP A;  3OPL A;  5L09 A;  4FOF A;  4MDZ A;  3JPU A;  5G18 A;  2A2L A;  4UEY A;  3NOT C;  1GHM A;  1VET A;  1QMF A;  1YLY A;  1IKG A;  4LV0 A;  3KYZ A;  2IWC A;  4Y13 A;  5HAP A;  5CHU A;  3FKW A;  1LL8 A;  1K4E A;  2XF3 A;  1PW8 A;  5EEC A;  2M1C A;  5F68 A;  1N9B A;  4EXO A;  1IOU A;  3VP0 A;  1HD8 A;  5CED A;  5E2G A;  5HL6 A;  5DF7 A;  3B33 A;  3IXB A;  2W0N A;  2PBY A;  4KQO A;  3WS4 A;  4FUW A;  4P6Z M;  2XEP A;  4P87 A;  2E8I A;  2EX9 A;  4QY6 A;  3VSK A;  2VJW A;  3A3D A;  1ES2 A;  1VQQ A;  4X1M A;  3IS2 A;  2J80 A;  3QP6 A;  4M3K A;  5M19 A;  4JF4 A;  3HUM A;  1LT0 A;  1H0M A;  3HLD A;  3GEC A;  4D2O A;  5EVI C;  2LB9 A;  1IKI A;  1L0D A;  4PPR A;  2WAF A;  3N7W A;  1XXM A;  4FTX A;  3LUQ A;  4I39 A;  3HL9 A;  2W3H A;  1IEM A;  4PM8 A;  3OBF A;  5C5K A;  3BY9 A;  4CLC D;  4A5R A;  4HJ3 A;  2GZA A;  1UWP X;  3HUN A;  4OPR A;  4BD0 A;  2CMN A;  3C4O A;  1OJ5 A;  3CWF A;  4G3K A;  5CGS A;  4DMZ A;  3UPN A;  4RYE A;  3NOP C;  3PBT A;  2UWX A;  5TGF A;  4YFM A;  3UB5 P;  5HWT A;  3G34 A;  5KMW A;  1MY8 A;  4D60 A;  2Y91 A;  4M4X A;  4KG6 A;  4KZA A;  4QB8 A;  1MC0 A;  1XA7 A;  2ZC5 B;  1W8Y A;  2B18 A;  5AQ9 A;  1L0G A;  3SH8 A;  2Z2L B;  4I3J A;  3H82 B;  5I5L A;  2XD5 A;  4EV4 A;  4IVK A;  4PAU A;  3U4L P;  3BWL A;  1LHY A;  1EI5 A;  2VKS A;  4GD6 A;  4ZJ3 A;  1XJ6 A;  4C75 A;  3QHY A;  1F9I A;  4KZ9 A;  2VK3 A;  3LFV A;  4R0Q A;  1K6R A;  4BL3 A;  3S7P A;  4ETZ A;  4OPZ A;  5FQK A;  5HDC A;  2HDQ A;  1SKF A;  1PW1 A;  2QWS A;  3C2W A;  1SHV A;  4F94 A;  1JWZ A;  4JGO A;  1TEM A;  4R3B A;  4DXB A;  1U60 A;  1ERO A;  3OCN A;  4NET A;  4WYY A;  4DF6 A;  2XSS A;  1HTZ A;  3F1P B;  3ZGA B;  3KX0 X;  1XKZ A;  3EGD C;  3UY6 A;  2PAV P;  5E2H A;  3IWO A;  3GSG A;  3KYE A;  3TRC A;  2WKH A;  4PHT A;  1IEL A;  3MF0 A;  4WZ4 A;  1J3W A;  4B4X A;  3IX4 A;  2GNX A;  3G2Y A;  4IUH A;  3KSH A;  1DP9 A;  3VSL A;  1JTG A;  5DF8 A;  3CZD A;  4G3W A;  3C5A A;  3MKF A;  4JKT A;  1GCE A;  1OTB A;  1UWN X;  2ACG A;  4LPZ A;  4LV1 A;  1K56 A;  3EWK A;  3HLC A;  3RJU A;  2HP6 A;  5KIZ A;  1PIO A;  2QJ5 A;  2PYR A;  2EWV A;  1S67 L;  1BYW A;  4B88 A;  1ESU A;  4Z1W A;  3WS2 A;  5HW3 A;  3VE3 A;  3C4P A;  5DJU A;  2Q9M A;  1S4R A;  3KYQ A;  3BEC A;  2EWW A;  5DTS A;  1VHM A;  3PBS A;  1GA0 A;  2Y2I A;  2XLN A;  1W79 A;  3ZG7 B;  1BLH A;  4N92 A;  2ZQC A;  1PNE A;  4OPQ A;  2XH9 A;  2HPB A;  2QYB A;  1PWG A;  4E3I A;  4BJP A;  3HLE A;  4ZDX A;  1XP4 A;  4UA9 A;  5DKL A;  3W4P A;  3GRJ A;  5FI6 A;  3QP5 A;  3LR4 A;  2NUP C;  3W8K A;  3I7J A;  1W5D A;  2JE5 A;  1FIK A;  3DTM A;  3TOI A;  5FQJ A;  2XD1 A;  1CI9 A;  2XFT A;  1GSW A;  4JF5 A;  3EQV A;  4JXS A;  4XT2 A;  2HP5 A;  4S2N C;  3T4J A;  3C7V A;  4JXV A;  3UMD A;  2H10 A;  4GJ4 A;  3VP4 A;  4CQH A;  2ZM8 A;  2P74 A;  3JVU A;  5TBM B;  2Y8H A;  2HDU A;  2ZQ7 A;  2P08 A;  4BQM A;  3VFF A;  5GLA A;  3BJN A;  4GKU A;  1H8Z A;  3E4O A;  4FD8 A;  1GHP A;  5A93 A;  4WEJ A;  1PWC A;  4EBP A;  5M18 A;  2Z2M B;  4NXE A;  3F1O A;  1W8Q A;  5D3O A;  2C6W B;  4ARZ B;  4Y5F A;  4RVA A;  1N9O A;  4EBL A;  3A3I A;  2P9V A;  2H0Y A;  4HP9 A;  3H9W A;  1F98 A;  3PAE A;  3MBZ A;  3IXG A;  4G3V A;  4NEE D;  5GLC A;  3CMZ A;  3A0R A;  1ZTU A;  4R38 A;  2W3F A;  4GZB A;  4WLA A;  5EE8 A;  4CLC A;  5F6A A;  4B9O A;  4P0M A;  2PRF A;  2O9A A;  5EV0 A;  3UDF A;  1I2S A;  1H8Y A;  3B3X A;  3AGE A;  3C30 A;  4NXB A;  2RL3 A;  3JYI A;  4O7D A;  1ES5 A;  4H8R A;  1KE0 A;  3UN7 A;  3ITB A;  4OLD A;  5E2F A;  3ITA A;  1YAX A;  5HPF A;  3T4O A;  1PI4 A;  4KUK A;  3Q7V A;  4MN5 A;  4E3O A;  1MWS A;  5GLD A;  2ZL1 A;  4NXG A;  5FSR A;  1NXY A;  4JXG A;  1PFL A;  2ZC4 B;  3Q82 A;  3SS5 A;  3FG8 A;  5EVL A;  2M7U A;  4L0L A;  2QPN A;  4MMN A;  2WKP A;  3PBQ A;  4BWI A;  3HUO A;  4HJ6 A;  2XQZ A;  1BSG A;  1OTD A;  4K91 A;  3R7W A;  4YIN A;  2GJ3 A;  2O99 A;  1VEU B;  3BLM A;  2JC7 A;  3L7H A;  3T4T A;  5FAQ A;  3G35 A;  1HVB A;  5HWV A;  2V2F F;  5DJT A;  4DKI A;  2V8C A;  3IF5 A;  3UME A;  4S2L A;  4JBF A;  4PM5 A;  1PRQ A;  3V67 A;  3CAX A;  3M2K A;  2OSU A;  2WYX A;  4Z9Q A;  3UE1 A;  5HZH A;  4QY5 A;  2A24 A;  1S4S A;  1KE4 A;  4LV2 A;  3ZVW A;  2V8F A;  1XFQ A;  2ZMF A;  4CLC E;  2YKH A;  3T4Q A;  2R78 A;  2G2W A;  4LFU A;  4MN7 A;  4ZJ1 A;  1F2K A;  3P7N A;  3GQZ A;  4GCZ A;  2EFX A;  1O07 A;  1CQA A;  5L2F A;  2FFF B;  5A8B A;  4JGQ A;  2Y2O A;  4BMW A;  3LR5 A;  1S6R A;  3LR0 A;  4HES A;  4LGW A;  4S2K A;  1MWT A;  4JXW A;  1Y54 A;  3E0Y A;  3V50 A;  3KSF A;  1J9M A;  4JLF A;  5E2E A;  3CJM A;  1YSQ A;  1ODV A;  4MBH A;  5DFX A;  3KSG A;  1UGU A;  2KX6 A;  4L9E A;  1YQS A;  2PD8 A;  1DJB A;  4GLQ A;  2XGN A;  5EOO A;  1NJ4 A;  4OON A;  5IU1 A;  4Y17 A;  3MKE A;  3D9Y A;  3IS2 B;  1TS6 A;  3FZC A;  3PBR A;  3IBR A;  1KE3 A;  4HHD A;  2K7S A;  2WKI A;  3E4P A;  1YLJ A;  3LO7 A;  1MBL A;  2ZC7 A;  1L0F A;  1RGZ A;  1MPL A;  4E3N A;  4LLO B;  5JYP A;  5HDD A;  2J9O A;  1BT5 A;  2PR5 A;  4S2M A;  1W63 Q;  2GX5 A;  3BFG A;  3O88 A;  4GS9 A;  3MXS A;  4HQA A;  2G7U A;  3WRT A;  2BG1 A;  4II7 A;  4K08 A;  4MN6 A;  4UA7 A;  3MZF A;  2DCF A;  4MBF A;  2BTF P;  3V5M A;  1WYB A;  2E8J A;  1OME A;  2QMI A;  4IBR A;  1M40 A;  5DTK A;  2EXB A;  5GHX A;  3G6O A;  4KQQ A;  3RXW A;  1CEF A;  1XGJ A;  3C38 A;  4WF0 A;  5FAO A;  3VP3 A;  4H6J A;  3E98 A;  3BFC A;  2QKP A;  2W3E A;  2JHE A;  3PBO A;  2CC1 A;  3DAV A;  3A3F A;  1FOF A;  2ZBB A;  3RXX A;  5FQQ A;  3SS3 A;  4C3Q A;  1YPR A;  3SW1 A;  4DJ2 A;  3EEA A;  1LL5 A;  1TS8 A;  3IQA A;  4O0P A;  4N9K A;  4R3J A;  1XJ3 A;  4R70 A;  1GA9 A;  1DRM A;  2J8Y A;  4BL2 A;  2Y55 A;  3OOV A;  5J3W A;  2JKT M;  2X71 A;  3NCK A;  3TG9 A;  4B4Z A;  3SS4 A;  4RA7 A;  1E4D A;  5FAP A;  2OWH A;  3VOY A;  3GTC A;  4UQI S;  2RCX A;  1XFN A;  5FQI A;  2ZQD A;  2M7V A;  2OOL A;  4EWF A;  3O87 A;  5FQM A;  1BZA A;  4BLM A;  5AJG A;  4Q0I A;  2WZX A;  5F83 A;  3NUL A;  3G32 A;  1E25 A;  3GVB A;  4ZTK A;  4EBN A;  1F5M A;  4XXR A;  4DE3 A;  1ZKJ A;  4MNR A;  2VLG A;  4OKP A;  3IX3 A;  4LV3 A;  1KVL A;  3DTK A;  3OCL A;  2V1B A;  1LI9 A;  1EWZ A;  4EER A;  5J7E A;  5AQ7 A;  1S0W A;  4PM6 A;  3VFH A;  2V0U A;  3K3C A;  1OT9 A;  2J3W A;  5GLB A;  2HP9 A;  3FC7 A;  1DJA A;  1NZU A;  5HPI A;  5EUA A;  4KZB A;  1OT6 A;  1KOU A;  4IVI A;  4IJG A;  1K6S A;  1IFQ A;  3FYZ A;  4X53 A;  3OPR A;  4KZ3 A;  5F69 A;  1BUL A;  2JCH A;  4WUJ A;  4ESP A;  2OWJ A;  5FL3 A;  2I9V A;  2HDS A;  3HCY A;  2HGV A;  2Z6D A;  1RGY A;  3IH8 A;  1YM1 A;  5A92 A;  5E43 A;  2ZM2 A;  3T1X A;  3LIB A;  2WKR A;  4YNR A;  4HJ4 A;  2VX8 A;  3GR2 A;  2ZMV A;  2JKG A;  1ZG6 A;  4HOI A;  5DVA A;  1N4O A;  1MKM A;  1N9N A;  3NDE A;  1MWU A;  2Y2P A;  2HJE A;  3MZD A;  3ZQ5 A;  5TR7 A;  5HSQ A;  4WL9 A;  2HDR A;  1CJF A;  1GHI A;  2XA7 S;  3IHA A;  3PTE A;  4WEK A;  4S2N A;  2PR6 A;  3UPP A;  1W7F A;  1L3L A;  4R3A A;  5KZH A;  1ES4 A;  3QP4 A;  1YMX A;  1K25 A;  3E4Q A;  4X6T A;  3BEB A;  1TF1 A;  2W3G A;  2R9W A;  3ZVT A;  5AQB A;  4GD8 A;  3IH9 A;  3BQ8 A;  1ALQ A;  5HX9 A;  4WZ5 C;  1KDS A;  2B5R A;  2QJ7 A;  3OPH A;  5LBR A;  1DJC A;  3OPP A;  4UQI M;  4Y2F A;  1SKO B;  4IHQ A;  2A3U A;  1W63 M;  5G4Y A;  2XRO A;  1YSP A;  1XX2 A;  3KO6 A;  2I72 A;  2J7V A;  3RFB A;  4FSF A;  2O9C A;  3HBR A;  3K2N A;  5AVF A;  1O7E A;  4MEZ A;  3UNW A;  5FAS A;  5AVE A;  2X02 A;  2PHY A;  3SZT A;  2JKT I;  3LID A;  2B02 A;  3LI8 A;  1FIL A;  5DTT A;  3SH7 A;  3VOZ A;  3EOI A;  1YLP A;  3LY4 A;  5GL9 A;  1IYS A;  3LIA A;  1D06 A;  2FZ0 A;  3C8C A;  4QD4 A;  3MFD A;  2GDN A;  1Q2P A;  1G68 A;  4MBK A;  2DNS A;  1S66 L;  2P9V B;  1K54 A;  5IS1 A;  1TDG A;  3SH9 A;  3TE8 A;  2ZOH A;  4QU3 A;  3QP2 A;  3CUE C;  4E3K A;  1YLT A;  4KQD A;  3CHW P;  1KDW A;  1ZG4 A;  2Y59 A;  2VV8 A;  3W2Z A;  4HH2 A;  3T4S A;  3H7W A;  4CLC B;  4OOM A;  4GDB A;  2ZQ9 A;  3L9K A;  5CEC A;  1ACF A;  4HIA A;  4Q0J A;  1PYY A;  1AWI A;  1G5U A;  4JGR A;  4UAA A;  5CRF A;  3Q07 A;  5EOE A;  2ZLY A;  4WM9 A;  3ULF A;  3RTY A;  1S1Z A;  1JNU A;  4Y0T A;  3V39 A;  1A0K A;  5F1G A;  2VA0 A;  3BFE A;  1ZHH B;  3VP2 A;  3LY3 A;  5EVE A;  3NEC A;  3IT9 A;  3HLB A;  2ZL1 B;  1FSY A;  3T1S A;  2H0T A;  4IBX A;  5HAI A;  5A91 A;  2XK1 A;  5U47 A;  2XA7 M;  3IF6 B;  2ZQ8 A;  2C5W B;  3E2L A;  3NIA A;  1QME A;  1WA9 A;  2W1T A;  4S2O A;  3JVV A;  4GNU A;  3MQQ A;  2XDM A;  4DDS A;  2JN7 A;  3R7W B;  3ZDJ A;  5HWW A;  4KUO A;  3WS5 A;  3QP1 A;  4Y7P A;  1CF0 A;  4EQI A;  2ZD8 A;  1LL9 A;  2BAS A;  3PXP A;  2EX2 A;  3HLG A;  3ZNY A;  3P09 A;  1SZV A;  1PZO A;  2OV5 A;  4F3L A;  2Q0O A;  4FH4 A;  5HAR A;  1NYY A;  1NYM A;  2FFY A;  3KSI A;  3K3D A;  4E3M A;  4Q0H A;  5EM1 A;  4EW7 A;  2OLU A;  3MSH A;  3N6I A;  1K54 C;  1G6A A;  3BM6 A;  5HD3 A;  1ERQ A;  2FH5 A;  4X68 A;  3PYP A;  4CJN A;  1Z09 A;  3G2Z A;  2AVX A;  1NY0 A;  1FQG A;  4JF6 A;  4Y0O A;  5FI7 A;  4QWO A;  1XPB A;  4DN0 A;  1T19 A;  2WGW B;  2W27 A;  1JWP A;  3A3J A;  1FCO A;  2IWB A;  1KVM A;  4U0T A;  1GSV A;  3UDI A;  3CIT A;  5KSC A;  4GHI B;  1JTD A;  1K38 A;  4ARZ A;  4RX2 A;  2EXA A;  1YLZ A;  5EVI B;  1LSW A;  5FDH A;  4C6Y A;  4YWZ A;  2WAE A;  4IUK A;  3UB9 A;  3F1N A;  4RX3 A;  3MXR A;  3G30 A;  3NBL A;  1NRJ A;  2OAP 1;  4NG2 A;  1TD5 A;  5EPH A;  1T1C A;  3ZG9 B;  2EFU A;  3ICY A;  5EM0 A;  2JKF A;  3DBA A;  4BBV A;  4UHU A;  1KGG A;  3HLF A;  2X01 A;  3N8L A;  4KZ4 A;  1XJ4 A;  1G28 A;  3CPT A;  3LR3 A;  5CGX A;  4HP4 A;  1VET B;  5CX7 A;  3LCE A;  3PR6 A;  1STZ A;  2Y2M A;  2G2U A;  1KGE A;  1TDL A;  2INW A;  3MFX A;  1HZO A;  2PDR A;  3T1Q B;  4NKP A;  1V9Z A; 
#chains in the Genus database with same CATH homology
 2V1A A;  3EWK A;  3VE4 A;  3NOU C;  2OWH A;  4UQI S;  5KIZ A;  1XFN A;  2QJ5 A;  3F1N B;  2PYR A;  2EWV A;  2OOL A;  2M7V A;  2EA9 A;  1S67 L;  1BYW A;  3BY8 A;  4LRZ E;  2IA2 A;  5AJG A;  4Q0I A;  1NLZ A;  4Z1W A;  3VE3 A;  3BQA A;  2A24 B;  5DKK A;  4AFI A;  3MR0 A;  3LIE A;  5DJU A;  4L9F A;  4YOF A;  3HJI A;  2O9B A;  1S4R A;  1LSX A;  1F5M A;  3KYQ A;  2EWW A;  4PKY A;  1VHM A;  3PBS A;  5TJJ A;  4I3A A;  4E04 A;  2DMW A;  2VLG A;  5TBM A;  2HV1 A;  1NLY A;  2MJ6 A;  2Y79 A;  2LB5 A;  3T50 A;  4EEU A;  3OCL A;  2KDK A;  2V1B A;  3CLO A;  3S7Q A;  2QYB A;  2D02 A;  4EER A;  5J7E A;  3S7O A;  1XJ2 A;  4BJP A;  3CI6 A;  2V0U A;  3K3C A;  1OT9 A;  2OAQ 1;  5DKL A;  2J3W A;  3FC7 A;  4BBU A;  2J3T C;  5HPI A;  1OT6 A;  1KOU A;  4R6L A;  4IJG A;  3B42 A;  1IFQ A;  1N9L A;  3LR4 A;  2NUP C;  2W1R A;  5F69 A;  4WUJ A;  3NHQ A;  2VZW A;  3FPW A;  2OWJ A;  5FL3 A;  2I9V A;  3HCY A;  2HGV A;  2Z6D A;  3OLO A;  3UE3 A;  3LI9 A;  2V9A A;  2ZOI A;  4OOL A;  3LIB A;  1GSW A;  2WKR A;  4WEL A;  3EQV A;  4P6Z S;  4XT2 A;  4YNR A;  4HJ4 A;  3TW8 A;  2VX8 A;  4EES A;  2ZMV A;  3T4J A;  4WN5 A;  3TJZ C;  4HOI A;  2NUT C;  3S7N A;  5HD5 A;  3ZYT A;  4LRX C;  2L0W A;  1MKM A;  3UMD A;  1N9N A;  1T18 A;  4GJ4 A;  4CQH A;  2KOI A;  3T4L A;  2HJE A;  3JVU A;  5TBM B;  3ZQ5 A;  4EEP A;  3LYX A;  4Y3I A;  5HSQ A;  4WL9 A;  2Y8H A;  3OC2 A;  5K5B A;  3EQU A;  3MJQ A;  2P08 A;  2XA7 S;  3BW6 A;  4I38 A;  1TS7 A;  3BJN A;  4WEK A;  3E4O A;  2JKR M;  1NWZ A;  4WEJ A;  5EFW A;  2PR6 A;  3MMH A;  4PKY G;  4LRY C;  4R3A A;  3EGX C;  5F5Y A;  4EET B;  4NXE A;  3F1O A;  4MCW A;  4ARZ B;  3IBJ A;  4Y5F A;  4CLC C;  1N9O A;  3E4Q A;  2PT7 A;  4GS9 B;  4HP9 A;  2VV7 A;  1TF1 A;  3HJK A;  2W3G A;  3H9W A;  4NXF A;  5DFY A;  4EU0 A;  3B47 A;  1F98 A;  3BQ8 A;  4G3V A;  4NEE D;  1LSV A;  2K2N A;  4GHI A;  1VB6 A;  3A0R A;  1ZTU A;  4R38 A;  2QJ7 A;  2W3F A;  3PBN A;  1MZU A;  5LBR A;  4WLA A;  4CLC A;  4ETX A;  5F6A A;  3A0S A;  5IT5 A;  4UQI M;  4Y2F A;  4B9O A;  3UE6 A;  2O9A A;  3P01 A;  4IHQ A;  1W63 M;  5G4Y A;  3T4K A;  2P7J A;  2YKF A;  4I3I A;  2XRO A;  2VV6 A;  1YSP A;  3C30 A;  4NXB A;  3MQO A;  3UB7 A;  3KO6 A;  4JGP A;  3RFB A;  4I5S A;  4FSF A;  2O9C A;  2JKR I;  4H6J B;  3K2N A;  4ME4 A;  5AVF A;  2L4R A;  4EQ1 A;  5AVE A;  1YAX A;  2PHY A;  3R4K A;  5HPF A;  3T4O A;  1P97 A;  2JKT I;  3LID A;  4KUK A;  4MN5 A;  2PYP A;  2B02 A;  3LI8 A;  1Y28 A;  4NXG A;  5KSH A;  4FOF A;  1T1B A;  3EOI A;  4MDZ A;  2A2L A;  4UEY A;  4B93 A;  3LIA A;  1D06 A;  3FG8 A;  2M7U A;  2FZ0 A;  3C8C A;  1YKD A;  3NOT C;  4L0L A;  4MMN A;  2WKP A;  2H28 A;  3PBQ A;  2Z6C A;  4BWI A;  4HJ6 A;  1S66 L;  1OTD A;  5IS1 A;  4QPR A;  3KYZ A;  3R7W A;  2O99 A;  2GJ3 A;  2ZOH A;  3TE8 A;  3CUE C;  4HNB A;  1EW0 A;  4KQD A;  1LL8 A;  3FPV A;  3T4T A;  5DF9 A;  2VV8 A;  3W2Z A;  4HH2 A;  3T4S A;  3H7W A;  2J3T D;  3NJA A;  4OOM A;  4CLC B;  2M1C A;  5F68 A;  5HWV A;  1TS0 A;  4HIA A;  4EXO A;  5DJT A;  2P04 A;  1IOU A;  4Q0J A;  3CUE A;  3UME A;  4JGR A;  5L8M A;  1H3Q A;  3D3O A;  3V67 A;  3CAX A;  5HL6 A;  3B33 A;  2W0N A;  4L9G A;  3ULF A;  5HZH A;  4HH3 A;  3RTY A;  2VGL S;  4KQO A;  1S1Z A;  1T1A A;  1JNU A;  2A24 A;  4P6Z M;  1S4S A;  3A0V A;  1DP6 A;  2VJW A;  1XFQ A;  2VA0 A;  2ZMF A;  1ZHH B;  3IS2 A;  2J80 A;  4CLC E;  2YKH A;  3T4Q A;  2R78 A;  2L1M A;  1P9R A;  1OTA A;  2XA7 M;  1LT0 A;  2PD7 A;  4MN7 A;  3GEC A;  3U2A A;  3P7N A;  3H82 A;  1OPX A;  1WA9 A;  4GCZ A;  2LB9 A;  2W1T A;  3JVV A;  4GW9 A;  4O01 A;  5HDS A;  3MQQ A;  5A8B A;  4JGQ A;  4BMW A;  3LR5 A;  3LR0 A;  2JN7 A;  3R7W B;  4DJ3 A;  3LUQ A;  5HWW A;  4KUO A;  4I39 A;  2W3H A;  3E0Y A;  3OBF A;  5C5K A;  3VV4 A;  3BY9 A;  3LIC A;  4CLC D;  2BAS A;  3H7W B;  3PXP A;  4HJ3 A;  3KSF A;  4RQ9 A;  2GZA A;  1UWP X;  2QHK A;  2WKQ A;  2CMN A;  5G4Z A;  3UB6 A;  1OJ5 A;  1YSQ A;  1ODV A;  5DFX A;  3CWF A;  4G3K A;  4EUV A;  4DMZ A;  4XT2 B;  3KSG A;  1UGU A;  2KX6 A;  4L9E A;  4F3L A;  4ZRR A;  3NOP C;  2PD8 A;  3VOL A;  3PBT A;  4GLQ A;  1OTI A;  5IU1 A;  3EEH A;  5HWT A;  3KSI A;  3K3D A;  4M4X A;  4Q0H A;  4EW7 A;  3D72 A;  3F1P A;  3IS2 B;  1TS6 A;  3PBR A;  1MC0 A;  3IBR A;  1X0O A;  2KLI A;  5MC7 A;  5HD3 A;  4HHD A;  2FH5 A;  2K7S A;  1D7E A;  3PYP A;  2HJ9 C;  2B18 A;  3F1O B;  3E4P A;  4I3J A;  3O5Y A;  3H82 B;  5I5L A;  2HF6 A;  2W1T B;  4BBT A;  4DN0 A;  1T19 A;  4LLO B;  2W27 A;  5HDD A;  1GSV A;  4PAU A;  3CIT A;  2XRN A;  1GSX A;  4GHI B;  3RH8 B;  3BWL A;  2PR5 A;  3LIF A;  4ARZ A;  1W63 Q;  4HY8 A;  2VKS A;  2GX5 A;  5J4E A;  1XJ6 A;  4GS9 A;  4HQA A;  1DP8 A;  2G7U A;  2W3D A;  1H8M A;  3GDI A;  1LSW A;  1F9I A;  4II7 A;  4YWZ A;  4K08 A;  4MN6 A;  4IUK A;  3UB9 A;  3F1N A;  3LFV A;  3S7P A;  1S1Y A;  1NRJ A;  4ETZ A;  2OAP 1;  5HDC A;  4F3L B;  2QWS A;  2D01 A;  1TD5 A;  3C2W A;  1T1C A;  3G6O A;  1V9Y A;  3ICY A;  4JGO A;  2O0Y A;  1G6O A;  3UB8 A;  3DBA A;  4BBV A;  2VGL M;  4WF0 A;  3C38 A;  1P9W A;  3OCN A;  1P0Z A;  4H6J A;  3E98 A;  2XSS A;  3F1P B;  4O8G A;  2QKP A;  2W3E A;  2JHE A;  3KX0 X;  3PBO A;  2VEA A;  1XJ4 A;  1G28 A;  3EGD C;  3LR3 A;  2ZBB A;  3TRC A;  2K31 A;  4HP4 A;  5CX7 A;  4PHT A;  3PR6 A;  3MF0 A;  3PHY A;  1STZ A;  3SW1 A;  1OTE A;  4DJ2 A;  2GNX A;  3EEA A;  3MXQ A;  1TS8 A;  4HI4 A;  4IUH A;  4O0P A;  1OJG A;  4R70 A;  1XJ3 A;  3KSH A;  1DP9 A;  2V0W A;  1DRM A;  2INW A;  3MFX A;  3MQ0 A;  4G3W A;  3OOV A;  5J3W A;  2JKT M;  1OTB A;  1UWN X;  2PDR A;  4LPZ A;  4NKP A;  1V9Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...