4HIAA

Crystal structure of rhodobacter sphaeroides lov protein
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
176
structure length
176
Chain Sequence
MDQKQFEKIRAVFDRSGVALTLVDMSLPEQPVVLANPPFLRMTGYTEGQILGFNCRFLQRGDENAQARADIRDALKLGRELQVVLRNYRANDEPFDNLLFLHPVGGRPDAPDYFLGSQFELGRSGNSEEAAAAGHAGALTGELARIGTVAARLEMDSRRHLAQAAAALVRAWERRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords LOV protein
publication title Light-induced subunit dissociation by a light-oxygen-voltage domain photoreceptor from Rhodobacter sphaeroides.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
total genus 59
structure length 176
sequence length 176
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4hiaA00
1XJ4A 4B9OA 4GHIA 3LIFA 1T1AA 1S1ZA 3MFXA 4I39A 4JGOA 4L9GA 3GDIA 3MXQA 1DP8A 2OOLA 1WA9A 3G6OA 1Y28A 4HY8A 3BY9A 3ICYA 3MQQA 1D7EA 4PKYG 2GJ3A 4I3AA 1OTIA 4GCZA 2VV8A 4EEUA 1UGUA 4F3LA 3P7NA 5KIZA 3NOTC 2QKPA 3ZQ5A 4HIAA 5IS1A 4JGPA 4KUOA 1OT6A 3C8CA 4JGQA 5J7EA 4HNBA 3ULFA 4WUJA 4LRYC 3UB8A 4F3LB 2J80A 1S66L 3BY8A 3D72A 4DJ3A 3LI9A 4YWZA 3MR0A 2INWA 3CWFA 4LRZE 1LSWA 1N9LA 1OJGA 1GSVA 3T50A 4EQ1A 2Z6CA 2D02A 3MQOA 2PYRA 3KX0X 2W0NA 4EERA 2V0UA 4EXOA 2Z6DA 3UB7A 1V9YA 1BYWA 3H7WA 1XJ3A 1UWNX 2BASA 2A24A 3F1PB 4BBTA 4KUKA 5J4EA 2WKQA 5HWWA 4HQAA 1TS7A 3HJIA 2VV6A 5HZHA 1JNUA 4HI4A 4LRXC 2PD8A 4HOIA 5A8BA 4HP9A 4JGRA 1P0ZA 4MN6A 2A24B 5DKKA 4HJ6A 4XT2B 4I3JA 2PR5A 5HD5A 5AVFA 2L1MA 1TS0A 3UE6A 2P7JA 5DJUA 4EESA 2L0WA 5DJTA 3UMDA 4LPZA 4LLOB 3A0VA 2JHEA 3K3CA 2V1AA 4NXEA 3H82A 1F9IA 3C2WA 1XFNA 4BBUA 3FG8A 3UB9A 1XJ2A 4GW9A 4EEPA 4BBVA 2V0WA 3NOPC 2CMNA 1OTEA 2WKRA 3E4OA 1S1YA 5J3WA 1XJ6A 4HJ3A 3H82B 5F69A 4NXBA 3MJQA 1TS6A 4K08A 4WL9A 4NXFA 4EW7A 3F1NA 3LICA 1S4RA 4L9EA 1DP9A 1T1CA 2M1CA 2ZOHA 4NXGA 1T1BA 1T18A 5HDSA 3FC7A 3F1OA 3F1PA 3NJAA 3B33A 3PYPA 3CLOA 3F1NB 4HH2A 3IS2B 1MZUA 5TBMB 5HDDA 5G4YA 3E4QA 1KOUA 5G4ZA 3RH8B 3F1OB 1F98A 3EEHA 3LYXA 3GECA 2EA9A 4XT2A 2R78A 4R38A 2PD7A 1ODVA 3K3DA 4DJ2A 2PR6A 1DRMA 1VB6A 2ZBBA 3UB6A 2L4RA 3LIBA 2PHYA 2V1BA 4GS9B 5HSQA 5F5YA 3HJKA 1EW0A 2QJ7A 4EETB 5HWVA 1N9NA 3OLOA 1G28A 1D06A 4M4XA 1UWPX 3E4PA 3IBRA 2VLGA 5HWTA 2QJ5A 1OJ5A 3LIDA 3VOLA 3UMEA 4H6JA 2OWJA 1DP6A 4E04A 2PDRA 4WF0A 1S67L 1P97A 1N9OA 1LSXA 3EWKA 5AVEA 4I5SA 1LL8A 4I38A 1NWZA 3LI8A 4GHIB 1LT0A 5EFWA 2VEAA 4H6JB 3NOUC 5I5LA 2JN7A 1OTBA 4HHDA 1XFQA 2YKFA 3VE4A 1OTDA 3VE3A 3NHQA 1GSWA 4PKYA 3IS2A 5IU1A 1OT9A 3CAXA 5TBMA 2V9AA 4I3IA 2KX6A 2OWHA 4KQDA 5F68A 1OTAA 2VV7A 3LIAA 2ZOIA 2H28A 3A0SA 1GSXA 2HV1A 2WKPA 2W27A 2QWSA 2K7SA 2B02A 2YKHA 4R3AA 4GS9A 1T19A 2QHKA 5HD3A 3LIEA 4R70A 4L9FA 3LUQA 5DKLA 2I9VA 4RQ9A 2PYPA 4WN5A 4WLAA 1X0OA 4R6LA 3PHYA 2D01A 4HJ4A 1V9ZA 3RTYA 2KDKA 4HP4A 1LSVA 5HDCA 5F6AA 3SW1A 3A0RA 3H9WA 1S4SA 4HH3A 3BWLA 1TS8A 3H7WB 4MN5A
chains in the Genus database with same CATH superfamily
5HPIA 3LGOA 2A3UA 4KQRA 1XJ4A 4B9OA 5DF8A 1L0DA 5DTSA 1NRFA 4N92A 1YT4A 4CQHA 4I39A 4ESPA 4MDZA 5HAPA 4PMAA 3MXQA 3D3OA 1BLCA 3HBRA 4S2PA 3BY9A 3IF6A 4QY6A 2JKTM 1IFQA 4KZAA 2XK1A 2GJ3A 4ZRRA 1OTIA 3TOIA 4FUWA 5D3OA 1FOFA 3UE3A 4QJGA 4F3LA 1PFLA 2PRFA 3P7NA 5KIZA 4R23A 5DTKA 4DXCA 4CLCB 2QKPA 3N8RA 4X56A 3UDFA 3TW8A 1YQSA 3LEZA 4JGPA 4JXSA 1OT6A 1ESIA 3C8CA 4LGWA 3T4QA 3CJMA 4MNRA 4B4XA 4E3KA 3GVBA 4JLFA 2WZXA 1BLSA 4KZBA 4IBXA 1LI0A 2VKSA 4PM8A 2JC7A 1ZTUA 2XRNA 4EQIA 3IX4A 3KX0X 5L10A 4EERA 3MMHA 3MZFA 3QP2A 4P6ZS 1VQQA 3MKEA 4R1GA 3ZYTA 4JF6A 4NEED 1AXBA 4N9KA 5FDHA 2Q9NA 1SZVA 2B95A 1PW1A 4CPKA 1DJCA 3IBJA 4WEJA 3PBNA 4E3OA 2P9VB 2PBDP 2QMIA 4LRXC 3WS2A 3SS4A 3W4OA 1S6RA 5HL6A 1P0ZA 5FI2A 3IT9A 1IEMA 3WRTA 4HJ6A 3T12B 4B88A 4XT2B 4KZ8A 4S2OA 1VETB 1TS0A 4UQIM 2UV0E 5DJUA 2VGJA 2QZ6A 1XPBA 2M7VA 5EOOA 2JHEA 2RCXA 2V1AA 4MLLA 3C2WA 4BBUA 1FCNA 4XUXA 3UB9A 5IHVA 1LL5A 1SDNA 1KVLA 4PM7A 3T4JA 3TSGA 2Y2GA 1N4OA 5CERA 4FOFA 3MZEA 3SS3A 4KQQA 4KQOA 2PU4A 5CECA 3FKVA 1M6KA 3QP8A 1BLPA 4E6XA 4G3VA 2H0TA 3S7NA 3LICA 1DP9A 1RGYA 1CQAA 1MKMA 2M1CA 1XKZA 4CLCE 2JKGA 3P98A 4NXGA 4FH4A 1WYBA 4PM5A 3F1PA 3ZNTA 2V20A 4MN7A 5TFQA 3IXBA 2K31A 2XF3A 3CLOA 2R9XA 5HDDA 1DJAA 1E25A 1K55A 5HAIA 5FL3A 1CI8A 2ZJ9A 4KZ5A 5G4ZA 1FILA 3GECA 4OH0A 3GSGA 4BWIA 4GNUA 4X55A 1L0GA 3VP1A 3P09A 1ERMA 3AGEA 1DRMA 1GHMA 3FZCA 4QD4A 5CHJA 1K57A 2PHYA 1IYOA 4L0LA 5MC7A 4OQHA 1GHPA 2ZMAA 4S2JA 3G2YA 4M4XA 2HDSA 4X1MA 1W79A 1K54A 4G3WA 3NIAA 4Y0UA 3BLSA 3N6IA 3Q81A 2P74A 1YAXA 2QJ5A 1KDSA 3UDIA 2IA2A 4R4SA 2X71A 3W2ZA 3UPOA 3OCNA 2OWJA 3BRMA 3VOYA 2ZM0A 1N9OA 4GN2A 2J8YA 1KGFA 4U3TA 2WAFA 1NXYA 3CUEA 4YOFA 1NWZA 4BD1A 4H8RA 4BENA 4LV0A 1JTDA 2J3TC 4ZBEA 2JN7A 3RFBA 1XFQA 1Y4OA 4QU3A 5EVIA 4C75A 4BD0A 4HBTA 3E98A 3IF6B 1ZG6A 5TBMA 2DCFA 4Z9QA 4IEDA 5CXWA 4MBFA 2FFYA 3KSGA 2KX6A 2VGKA 4JF4A 4Y15A 2OWHA 4KQDA 2WZZA 3BW6A 2VV7A 5DF9A 2H28A 1Z09A 5M19A 3PR6A 4D2OA 4Y0OA 3EEAA 5GL9A 3E0YA 2QWSA 3Q1FA 2K7SA 4Y2FA 4GD6A 2B02A 3C4PA 1T19A 1STZA 1VEUA 3S7PA 1H5XA 4S2MA 2P08A 3LUQA 2I9VA 5FATA 4MCWA 5GHYA 4RQ9A 2PYPA 3JVUA 1MWTA 1PZOA 3M6BA 3M2KA 3ZFZA 3NDGA 1X0OA 4ARZA 1LL9A 3W8KA 1V9ZA 2KDKA 4HP4A 3SZTA 2XLNA 5HDCA 3QP5A 1OMEA 5F6AA 1K55C 2ZC4B 3SW1A 3C4OA 3CHWP 3MXSA 4HH3A 3VP4A 1W63Q 2Y2OA 4ZJ1A 3UPNA 5FI6A 4X6TA 4EBNA 4MN5A 1H8MA 2EX9A 3GR2A 1L0EA 4FTXA 3ZGAB 3HL9A 3IXHA 2Y2QA 4X68A 2A49A 4Y5FA 2Z2MB 3FKWA 1ZHHB 3Q82A 1T1AA 4S2IA 1XA1A 4JGOA 4L9GA 4AFIA 2XFTA 3CITA 1DP8A 2OOLA 1GA9A 3G6OA 4R3BA 1Y28A 4HY8A 3HLCA 1MC0A 5IT5A 1K54C 3HLBA 2Y2PA 2GX5A 4FCFA 4PKYG 3WRZA 1XX2A 4GCZA 4OPYA 2RL3A 2VV8A 4RVAA 2Y2MA 1PNEA 4E3IA 4X69A 5FSRA 3NOTC 1O07A 1FIKA 5KSCA 4XXRA 4DE3A 5IS1A 3HVFA 3ZG8B 1G5UA 2LB9A 3KYZA 3TE8A 4E3NA 2W3DA 3UB8A 3GRJA 2EFXA 4G3KA 3T4KA 1YLWA 5CHUA 3AGDA 3LI9A 3DTKA 5TGFA 5K5BA 3LCEA 5FAQA 3GV9A 1N9LA 3G31A 5LBRA 4LV2A 5EVIC 2VJWA 2J3WA 4EQ1A 2XDMA 3WS1A 2W3HA 2WKHA 3LR4A 3C30A 2W0NA 4EBLA 3UO9A 3A3DA 2V0UA 4OONA 1K56D 4DE0A 2PU2A 2Z6DA 3PAEA 2WGWA 3LEQA 1BYWA 1K4FA 1TEMA 1YLYA 5CEDA 2HP6A 1F5MA 5AQAA 4UA7A 1KDWA 1BT5A 2B5RA 3F1PB 5FQJA 2XEPA 4BBTA 4KUKA 1SKOA 2WKQA 2O9AA 3E2LA 5BOHA 1QMFA 2WYXA 3O87A 1TS7A 5DTTA 1PW8A 3QP6A 4WZ4A 2VV6A 5HZHA 3HLDA 4HOIA 2HDRA 5A8BA 4HP9A 4JGRA 2H10A 3QP1A 2A24B 2VK3A 2ZC7A 2PR5A 2O9CA 2L1MA 2WGIA 1RCJA 1MWUA 2IWCA 4QWOA 5DJTA 2ZM2A 5F83A 3BQ8A 3A0VA 2VA0A 3K3CA 4NXEA 3NI9A 1HVBA 4E6WA 4KG6A 1PI5A 1XJ2A 2Y59A 4GW9A 2MJ6A 3KYQA 5F1GA 3TG9A 3G35A 1K0KA 1S1YA 5FQQA 3GQZA 2ZQ9A 3H82B 5F69A 3IHBA 3ZNYA 2ZMFA 3MJQA 1TS6A 4PAUA 4S2NA 1ACFA 1FSWA 4Q0HA 2GDNA 1H8YA 3IX8A 1CJFA 1S4RA 1PRQA 1T1CA 2EWWA 2XD1A 2ZQ8A 2LB5A 3KO6A 1PWCA 3RJUA 3OZHA 5CTNA 3FC7A 1ZC2A 3V3SA 3C5AA 5EVIB 3F1NB 1ALQA 3HLEA 5EE8A 1KVMA 5TBMB 4OPRA 3T1XA 3ISGA 4JKTA 5G4YA 4UA9A 1H0MA 2NUPC 3F1OB 1F98A 4PPRA 1JTGA 3HLFA 3EEHA 4O01A 4O0PA 2EA9A 2R78A 4OPZA 2Y2NA 3ZVWA 5A93A 3VSKA 4DJ2A 5E2EA 2PR6A 3PTEA 2ZBBA 2ZD8A 2L4RA 3UN7A 4PM6A 5FQ9A 3LIBA 2V1BA 5HSQA 5F5YA 3HJKA 1CEGA 4EETB 4N1HA 5HWVA 5CRFA 5FAOA 2X02A 1YMSA 1VHMA 1E3UD 2EX8A 4ETZA 2ZL1B 3E4PA 1W8YA 1L2SA 3BFCA 4ARZB 4IUHA 4N1XA 3RXWA 5DVAA 1S0WA 4WZ5C 1NRJA 2EX2A 4B4ZA 4ETXA 3FPVA 4OQGA 4X25A 3EOIA 4PHTA 4KZ6A 4DF6A 1NZUA 5AQ7A 5AVEA 1LL8A 2JKRI 5A91A 1LT0A 1C3BA 5EFWA 3QNBA 1J3WA 3PAGA 3LR0A 1IYPA 4D60A 1ZKJA 4H6JB 3L9KA 4F94A 5L09A 5GLDA 2YKFA 2XROA 3VE4A 3S22A 1OTDA 3BYDA 4FSFA 3DTEA 1GSWA 4PKYA 5KMWA 3IS2A 2FZ0A 5IU1A 3ZHHA 1OPXA 5E2GA 2V9AA 5A90A 3FYZA 1SKFA 2WAEA 1MY8A 3CG5A 1OTAA 3IH8A 3M6HA 4WEKA 1K4EA 2G2UA 3A0SA 3N8LA 3WWXA 1XGJA 1KE0A 4S2NC 1GSXA 3SH7A 5G18A 4NG2A 5C5KA 3GTCA 4GS9A 1EWZA 1F2KA 2QHKA 1ONHA 4KZ4A 3LIEA 5DKLA 2JKTI 1IOUA 4NKPA 2HJEA 4WN5A 1DJBA 5E2HA 4WLAA 4HBUA 2HZ5A 4MMNA 2J9OA 2A2LA 1CEFA 2D01A 4R3JA 5DFXA 1LSVA 3B3XA 3L7HA 3QHYA 2Y8HA 2W3FA 2HF6A 3BWLA 2EWVA 2WGWB 3NC8A 2W3EA 4LCMA 3T4OA 3BM6A 1W63M 1ERQA 1IYQA 4JXGA 4GHIA 3DWZA 5M1AA 1SKOB 1PYYA 2XGNA 2I72A 3LIFA 1IKIA 2X01A 3SS5A 1RP5A 3MFXA 1WYCA 3OCLA 4ID4A 1ES3A 1P9WA 3A3EA 1YLZA 4DKIA 1HTZA 3MQQA 5FEFA 1BLHA 1D7EA 1K38A 4GJ4A 1W7FA 1MWRA 2O99A 2ZQ7A 4EEUA 1UGUA 2ZM8A 1K6SA 5GLAA 4IVIA 3ZQ5A 3HLWA 2Y55A 3V39A 5FA7A 2GZAA 1H3QA 4JGQA 5J7EA 4HNBA 3FV7A 4GKUA 4WUJA 1NY0A 4JBFA 2EXAA 2JBFA 4F3LB 3HUNA 3IWOA 3BY8A 4DJ3A 3O3VA 1FR6A 3C7UA 3ZVTA 2INWA 3CWFA 5I94A 4LRZE 5CGSA 1LSWA 1TD5A 1I2SA 3O86A 2ZC3B 3S4XA 4CLCD 4JXVA 1XXMA 4DE1A 3PXPA 3T50A 2Z6CA 5CTMA 2WK0A 1BTLA 2D02A 3MQOA 4BJPA 1G6OA 4Q0IA 4QB8A 4EXOA 4X1LA 4WMCD 1XP4A 3HUMA 2DNSA 2W1TA 2XA7S 3IXGA 3UB7A 2JCHA 4K0XA 2H5SA 1V9YA 4E3JA 3H7WA 3VP2A 1J9MA 2O0YA 5E43A 4C3QA 1BULA 1XJ3A 1Q2QA 2BASA 2J7VA 5J4EA 2ZLYA 3DWKA 5HWWA 1YPRA 4HQAA 3UE1A 1I2WA 3PBQA 1VETA 3T1RA 1ES4A 2OV5A 1P9RA 2OLUA 3S1YA 1G68A 2PD8A 3IWQA 3MFDA 4MN6A 1H8ZA 5DKKA 1MKIA 3VP0A 3C38A 1E4DA 4I3JA 4MEZA 5HD5A 2Q9MA 1MXOA 3BFGA 2P7JA 1NLZA 3UNWA 5A92A 2Y2KA 3UMDA 2VGLS 5DFYA 4LLOB 1JVJA 4BL2A 1XGIA 3HCYA 4BLMA 2ACGA 3JYIA 1XFNA 1W5DA 1K56A 1Z6FA 2V0WA 2Z2LB 3MXRA 2CMNA 4O7DA 2EXBA 3VOZA 4OPQA 2WKRA 4GB7A 1YSQA 5J3WA 4HJ3A 4HEFA 1YM1A 2G7UA 4K0WA 4DN0A 4K08A 1Q2PA 3BLMA 4KZ7A 4CLCC 3T1SA 3SH9A 4ZAMA 3NECA 4IJGA 1IELA 1YLPA 2WADA 3A3FA 3NCKA 5FQKA 3LY4A 3PBOA 4FD8A 4MBHA 2XD5A 2WKEA 1T18A 5HDSA 1AWIA 1PIOA 3C7VA 3NJAA 4C6YA 5GHZA 4UA6A 3B33A 3PYPA 4ZDXA 4KZ3A 4WBGA 4HH2A 3IS2B 4N9LA 5HFOA 3BJNA 5FDSA 4BQMA 5EM1A 4OKPA 4P0MA 3V50A 1A0KA 1CF0A 2CC1A 3RH8B 5AJGA 2ZQDA 1HZOA 2JKRM 1JWVA 4R38A 2NUTC 1ODVA 4YINA 4WZ5A 4JPMA 4S2LA 4Y0TA 2C6WB 2XH9A 2Y79A 4GS9B 4JF5A 4O8GA 4P6BA 1EW0A 4JXWA 3K2NA 1CK3A 3E2KA 1GHIA 4GDBA 4P6ZM 2Y2IA 5EOEA 2EFUA 3OBFA 1KGGA 1D06A 1G28A 4Y17A 5KZHA 1NZOA 4KG5A 4DDSA 3IBRA 3TJZC 2QYBA 5J8XA 4IVKA 2OAP1 3OPLA 5HWTA 1OJ5A 1TDLA 2BG1A 4B93A 2M7UA 4K91A 2WUQA 3UB5P 5HPFA 4UEYA 5JYOA 1G6AA 1K25A 2HJ9C 4EUVA 3I7JA 2WGVA 3G34A 3U4LP 2PDRA 3DTMA 1S67L 1P97A 1LSXA 3G30A 2K2NA 4I5SA 2OLVA 5M18A 1IKGA 4GHIB 4WYYA 2VEAA 3EQUA 1YSPA 1M40A 4Z1WA 3MBZA 3T4SA 3WS5A 2V8CA 4M3KA 4XUZA 5FAPA 3UE0A 1OTBA 4HHDA 4DMZA 3VE3A 3EQVA 3NHQA 1YKDA 4OOLA 3CAXA 4P87A 4Q0JA 5EPHA 4II7A 4NK3A 3GMWA 2Y91A 1E3UA 1MWSA 2ZQCA 3MF0A 2PAVP 3R7WA 3V5MA 3MS6A 3CMZA 4EU0A 2HP9A 5CEBA 1HD8A 1BZAA 3N8SA 4DRTA 3O5YA 4UHUA 4OOYA 3NDEA 3ZG0A 1ONGA 1TF1A 4LENA 4HESA 5HD3A 1KE4A 3IX3A 4L9FA 3LFVA 1PZPA 4QPRA 1FSYA 4CJNA 4GZBA 3VFFA 4LV1A 2OAQ1 3PHYA 4HJ4A 1VEUB 2KOIA 3D9YA 1NYYA 3VMAA 3UDXA 3U2AA 5GLCA 3IH9A 2W1TB 3MQ0A 4EWFA 2XSSA 4ZJ2A 2E8IA 1TS8A 3H7WB 4BL3A 5HW3A 4OP5A 4IUKA 3ZDJA 5HAQA 2PBYA 2W3GA 2HGVA 1EI5A 3DTIA 5HL1A 5CHMA 1S1ZA 2BLSA 1FQGA 3GDIA 3LY3A 2Y2JA 5E2FA 2V1ZA 1GA0A 1WA9A 1PWGA 5AQ9A 4R0QA 5L07A 3ICYA 2XQZA 3OPPA 1U60A 4GDNA 1SDEA 4I3AA 3Q07A 3P01A 3TRCA 3JVVA 3M2JA 2FFFB 2Y2LA 5HARA 2B18A 2EX6A 1NYMA 3WS4A 4HIAA 4MBKA 3Q7VA 4KUOA 5FASA 4DDYA 3A3IA 2H0YA 3EGDC 4GLQA 3AGFA 3IF6C 4NETA 3ULFA 4LRYC 3ZG7B 2DMWA 2J80A 3JPUA 1JWZA 1KE3A 1S66L 4RYEA 3CPTA 3D72A 1FR1A 5CGXA 3Q7ZA 4YWZA 3W4PA 1K6RA 1RGZA 3KSFA 2J3TD 3MR0A 3NULA 2BTFP 4QY5A 1OJGA 4EBPA 2HDQA 1GSVA 3W4QA 2JE5A 1LI9A 5GLBA 2PYRA 1GCEA 1LHYA 1HLUP 1LLBA 2HPBA 1NLYA 1TDGA 3KSIA 2Y4AA 4YNRA 2IWDA 1SCWA 2ZC5B 5U47A 1QMEA 4UQIS 3MKFA 4KENB 2E8JA 3A3JA 1UWNX 1O7EA 2A24A 3FWLA 3VSLA 3ZG9B 1YMXA 1IYSA 1PWDA 2Q0OA 1N9BA 4E3MA 3V67A 5F1FA 3HJIA 1WE4A 3HLGA 3IQAA 1JNUA 4HI4A 2KLIA 2J9PA 5EM0A 5FQIA 1MPLA 1JWPA 2XA7M 3LO7A 1ESUA 1D1JA 3DW0A 3PBSA 5AVFA 3BFDA 3EGXC 3UE6A 4EESA 2PT7A 1NJ4A 2L0WA 4LPZA 4IHQA 3KYEA 3IWIA 5HX9A 2DRWA 2IWBA 3T1QB 4CLCA 3SH8A 5EECA 3H82A 3T4TA 1F9IA 4OP8A 3FG8A 4EEPA 3ZCZA 4BBVA 3D4FA 4WMCA 4Y7PA 1TVFA 2VX8A 2ZMVA 3NOPC 3DAVA 2XFSA 3CI6A 1OTEA 4R4RA 3E4OA 2C5WB 2W1RA 3HUOA 3PBRA 1XJ6A 3BFFA 3BEBA 3NY4A 4NXBA 3N7WA 5F82A 2FH5A 1MBLA 3S7OA 4WL9A 2VGLM 4NXFA 4RX2A 3OPHA 1L0FA 5EVEA 4EW7A 4QHCA 3F1NA 4L9EA 5JYPA 4U0TA 1ZG4A 4IBRA 2ZOHA 1YLJA 1T1BA 3G2ZA 5FQMA 4S2KA 1ES5A 3F1OA 3WS0A 3UY6A 3LR5A 4OVDA 1ES2A 1KGEA 3OC2A 4DE2A 1MZUA 5DF7A 5EUAA 3BFEA 2P9VA 4LV3A 2UWXA 3T4LA 2HP5A 4OLDA 3E4QA 3S7QA 1KOUA 1FCOA 4GOGA 3MZDA 3LYXA 1EROA 3R7WB 4XT2A 5GHXA 4BMWA 2PD7A 2ZL1A 3K3DA 5CGWA 5FI7A 3IF5A 1VB6A 5EVID 3UB6A 3SOIA 4Y13A 3IHAA 3OOVA 5FEGA 2QJ7A 3B42A 3HREA 4KG2A 2G2WA 5EV0A 1N9NA 3OLOA 4RA7A 1SHVA 4OLGA 1UWPX 2GNXA 5CX7A 4UAAA 2V2FF 2VLGA 2V8FA 3B47A 3LIDA 3VOLA 3UMEA 5AQBA 1K57C 3ITBA 4H6JA 4WM9A 4P85A 3BECA 3O88A 1DP6A 4E04A 4WF0A 3CZDA 3EWKA 2JKFA 3G32A 5L2FA 4I38A 3LI8A 3VFHA 1YLTA 3MSHA 5EVLA 2VZWA 3OPRA 3RXXA 1BSGA 3R4KA 3NOUC 1FCMA 4YFMA 5I5LA 4WELA 4KZ9A 1VM1A 2R9WA 3N4IA 1OT9A 5L8MA 1DY6A 3QNCA 3KSHA 4OOMA 4I3IA 3CUEC 2HDUA 2WKIA 5F68A 2OSUA 3VV4A 3LIAA 2ZOIA 4FH2A 1CI9A 4U0XA 4ZTKA 2AVXA 2Y2HA 2HV1A 2WKPA 4OQIA 1PI4A 2W27A 3IXDA 3Q7VB 4OQ0A 4Y3IA 3FPWA 2YKHA 4R3AA 4X53A 3VP3A 1Y54A 3QP4A 3G4PA 4R70A 4E3LA 3PBTA 2XR0A 3CPTB 3DBAA 1BUEA 4LFUA 2O9BA 1I5QA 4R6LA 2ZQAA 4DXBA 3ITAA 4Q8IA 5TR7A 3BQAA 1L3LA 3RTYA 2QPNA 4GD8A 1XA7A 4RX3A 4LCLA 4ME4A 3A0RA 3H9WA 3V3RA 5KSHA 1S4SA 3LR3A 2P04A 1W8QA 2ZC6B 4A5RA 3NBLA 3ZG5A 4EUZA 5TJJA 4PM9A 3UPPA 4ZJ3A 4EV4A
chains in the Genus database with same CATH topology
5HPIA 1W63M 1XJ4A 4IUKA 4B9OA 4GHIA 2W3GA 4CQHA 4Y5FA 2HGVA 3LIFA 1ZHHB 1T1AA 1S1ZA 3MFXA 4I39A 4MDZA 4JGOA 4L9GA 3GDIA 3OCLA 4AFIA 3MXQA 1P9WA 3CITA 1DP8A 2OOLA 1WA9A 3D3OA 3G6OA 1Y28A 4HY8A 1MC0A 3BY9A 3ICYA 5IT5A 3MQQA 2GX5A 2JKTM 1IFQA 1D7EA 4PKYG 2GJ3A 4ZRRA 4I3AA 1OTIA 4GJ4A 3P01A 3TRCA 3JVVA 4GCZA 2VV8A 2O99A 4EEUA 1UGUA 2B18A 3UE3A 4F3LA 3P7NA 5KIZA 3NOTC 4CLCB 2QKPA 3ZQ5A 4HIAA 3TW8A 5IS1A 4JGPA 4KUOA 2GZAA 1H3QA 1OT6A 2LB9A 3C8CA 4JGQA 3EGDC 3KYZA 4GLQA 4HNBA 3TE8A 5J7EA 3ULFA 2W3DA 4WUJA 3T4QA 4LRYC 3UB8A 2DMWA 4F3LB 2J80A 4G3KA 1S66L 3T4KA 3BY8A 3D72A 4DJ3A 3LI9A 4YWZA 5K5BA 3KSFA 2J3TD 3MR0A 2INWA 3CWFA 4LRZE 1LSWA 1TD5A 1N9LA 2VKSA 1OJGA 5LBRA 1GSVA 4CLCD 3PXPA 1ZTUA 2VJWA 2J3WA 3T50A 4EQ1A 2XRNA 2Z6CA 2D02A 3MQOA 4BJPA 1G6OA 2PYRA 2W3HA 3KX0X 3LR4A 4Q0IA 3C30A 2W0NA 1NLYA 4EERA 3MMHA 2V0UA 4EXOA 4P6ZS 2Z6DA 2W1TA 2XA7S 3KSIA 3UB7A 4YNRA 1V9YA 1BYWA 3H7WA 2O0YA 3ZYTA 1F5MA 4NEED 4UQIS 1XJ3A 1UWNX 2BASA 2A24A 3F1PB 4BBTA 4KUKA 5J4EA 2WKQA 2O9AA 3IBJA 5HWWA 4HQAA 4WEJA 3PBNA 1TS7A 3PBQA 3V67A 3HJIA 2VV6A 5HZHA 1JNUA 1P9RA 4HI4A 4LRXC 2KLIA 2PD8A 4HOIA 5A8BA 4HP9A 4JGRA 5HL6A 1P0ZA 4MN6A 2A24B 5DKKA 4HJ6A 2XA7M 3C38A 4XT2B 4I3JA 2PR5A 5HD5A 2O9CA 3PBSA 5AVFA 2L1MA 1TS0A 3EGXC 4UQIM 3UE6A 2P7JA 1NLZA 5DJUA 4EESA 2PT7A 2M7VA 2L0WA 5DJTA 3UMDA 3BQ8A 2VGLS 4IHQA 4LPZA 5DFYA 4LLOB 3A0VA 2JHEA 2VA0A 3K3CA 2V1AA 4NXEA 4CLCA 3HCYA 3H82A 3T4TA 1F9IA 3C2WA 1XFNA 4BBUA 3FG8A 3UB9A 1XJ2A 4GW9A 4EEPA 2MJ6A 4BBVA 2V0WA 2VX8A 2ZMVA 3NOPC 2CMNA 3CI6A 3KYQA 1OTEA 3T4JA 2WKRA 3E4OA 1YSQA 2W1RA 3PBRA 1S1YA 5J3WA 1XJ6A 4HJ3A 4FOFA 3H82B 5F69A 4NXBA 2ZMFA 3MJQA 2G7UA 4DN0A 1TS6A 4PAUA 4KQOA 2FH5A 4K08A 3S7OA 4WL9A 4CLCC 2VGLM 4NXFA 4G3VA 4IJGA 4Q0HA 4EW7A 3F1NA 3LICA 1S4RA 4L9EA 3S7NA 1DP9A 3PBOA 1T1CA 2EWWA 1MKMA 2M1CA 4CLCE 2LB5A 2ZOHA 3KO6A 4NXGA 1T1BA 1T18A 5HDSA 3FC7A 3F1OA 3F1PA 3LR5A 3NJAA 3B33A 3PYPA 4MN7A 3OC2A 2K31A 3CLOA 3F1NB 4HH2A 3IS2B 1MZUA 5TBMB 5HDDA 3BJNA 5FL3A 3T4LA 5G4YA 3E4QA 2NUPC 3S7QA 1KOUA 5G4ZA 3RH8B 3F1OB 1F98A 5AJGA 3EEHA 4O01A 3LYXA 3GECA 4O0PA 2EA9A 3R7WB 4XT2A 2R78A 4BWIA 2JKRM 4BMWA 4R38A 2PD7A 2NUTC 1ODVA 3K3DA 4DJ2A 2PR6A 1DRMA 1VB6A 2ZBBA 3UB6A 2L4RA 3LIBA 4L0LA 2PHYA 2V1BA 2Y79A 4GS9B 4O8GA 3OOVA 5HSQA 5F5YA 3HJKA 1EW0A 2QJ7A 3K2NA 4EETB 3B42A 5HWVA 4P6ZM 1N9NA 5MC7A 3OBFA 3OLOA 1VHMA 1G28A 1D06A 4M4XA 4ETZA 1UWPX 2GNXA 3E4PA 5CX7A 3IBRA 3TJZC 4G3WA 2QYBA 2OAP1 2VLGA 4ARZB 4IUHA 3B47A 1YAXA 5HWTA 2QJ5A 1OJ5A 3LIDA 3VOLA 3UMEA 4B93A 1NRJA 2IA2A 2M7UA 4ETXA 3FPVA 5HPFA 4UEYA 3W2ZA 3EOIA 3OCNA 4PHTA 4H6JA 2OWJA 2HJ9C 4EUVA 1DP6A 4E04A 2PDRA 4WF0A 1S67L 1P97A 1N9OA 1LSXA 3EWKA 2K2NA 5AVEA 4I5SA 1LL8A 3CUEA 4I38A 1NWZA 3LI8A 4YOFA 2JKRI 4GHIB 1LT0A 5EFWA 2VEAA 3EQUA 1YSPA 4Z1WA 2VZWA 3LR0A 2J3TC 3T4SA 3R4KA 4H6JB 3NOUC 5I5LA 2JN7A 3RFBA 1OTBA 4HHDA 1XFQA 2YKFA 2XROA 4WELA 3VE4A 4DMZA 1OTDA 3VE3A 3EQVA 3NHQA 4FSFA 1GSWA 4PKYA 1YKDA 2FZ0A 3E98A 3IS2A 5IU1A 1OT9A 5L8MA 4OOLA 3CAXA 1OPXA 5TBMA 3KSHA 4Q0JA 4OOMA 2V9AA 4I3IA 3KSGA 4II7A 2KX6A 3CUEC 2OWHA 4KQDA 5F68A 3BW6A 1OTAA 2VV7A 3MF0A 5DF9A 3VV4A 3LIAA 3R7WA 2ZOIA 4WEKA 2H28A 3A0SA 4EU0A 3PR6A 1GSXA 2HV1A 2WKPA 3EEAA 2W27A 5C5KA 3O5YA 3E0YA 2QWSA 4Y3IA 3FPWA 2K7SA 4Y2FA 2B02A 2YKHA 4R3AA 4GS9A 1T19A 1STZA 1TF1A 2QHKA 3S7PA 5HD3A 3LIEA 4R70A 4L9FA 2P08A 3LUQA 3LFVA 5DKLA 3PBTA 2I9VA 4MCWA 2JKTI 4RQ9A 2PYPA 3DBAA 1IOUA 4NKPA 2HJEA 3JVUA 2O9BA 4QPRA 4WN5A 4WLAA 4MMNA 1X0OA 4R6LA 2OAQ1 4ARZA 2A2LA 3PHYA 2D01A 3BQAA 4HJ4A 1V9ZA 5DFXA 2KDKA 4HP4A 3RTYA 1LSVA 5HDCA 2KOIA 2Y8HA 5F6AA 2W3FA 4ME4A 3A0RA 3H9WA 3SW1A 5KSHA 1S4SA 2HF6A 4HH3A 3LR3A 3BWLA 2P04A 1W63Q 3U2AA 2W1TB 2EWVA 3MQ0A 5TJJA 2XSSA 2W3EA 1TS8A 3H7WB 4MN5A 1H8MA 3T4OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XJ4 A;  4B9O A;  4GHI A;  3LIF A;  1T1A A;  1S1Z A;  3MFX A;  4I39 A;  4JGO A;  4L9G A;  3GDI A;  3MXQ A;  1DP8 A;  2OOL A;  1WA9 A;  3G6O A;  1Y28 A;  4HY8 A;  3BY9 A;  3ICY A;  3MQQ A;  1D7E A;  4PKY G;  2GJ3 A;  4I3A A;  1OTI A;  4GCZ A;  2VV8 A;  4EEU A;  1UGU A;  4F3L A;  3P7N A;  5KIZ A;  3NOT C;  2QKP A;  3ZQ5 A;  4HIA A;  5IS1 A;  4JGP A;  4KUO A;  1OT6 A;  3C8C A;  4JGQ A;  5J7E A;  4HNB A;  3ULF A;  4WUJ A;  4LRY C;  3UB8 A;  4F3L B;  2J80 A;  1S66 L;  3BY8 A;  3D72 A;  4DJ3 A;  3LI9 A;  4YWZ A;  3MR0 A;  2INW A;  3CWF A;  4LRZ E;  1LSW A;  1N9L A;  1OJG A;  1GSV A;  3T50 A;  4EQ1 A;  2Z6C A;  2D02 A;  3MQO A;  2PYR A;  3KX0 X;  2W0N A;  4EER A;  2V0U A;  4EXO A;  2Z6D A;  3UB7 A;  1V9Y A;  1BYW A;  3H7W A;  1XJ3 A;  1UWN X;  2BAS A;  2A24 A;  3F1P B;  4BBT A;  4KUK A;  5J4E A;  2WKQ A;  5HWW A;  4HQA A;  1TS7 A;  3HJI A;  2VV6 A;  5HZH A;  1JNU A;  4HI4 A;  4LRX C;  2PD8 A;  4HOI A;  5A8B A;  4HP9 A;  4JGR A;  1P0Z A;  4MN6 A;  2A24 B;  5DKK A;  4HJ6 A;  4XT2 B;  4I3J A;  2PR5 A;  5HD5 A;  5AVF A;  2L1M A;  1TS0 A;  3UE6 A;  2P7J A;  5DJU A;  4EES A;  2L0W A;  5DJT A;  3UMD A;  4LPZ A;  4LLO B;  3A0V A;  2JHE A;  3K3C A;  2V1A A;  4NXE A;  3H82 A;  1F9I A;  3C2W A;  1XFN A;  4BBU A;  3FG8 A;  3UB9 A;  1XJ2 A;  4GW9 A;  4EEP A;  4BBV A;  2V0W A;  3NOP C;  2CMN A;  1OTE A;  2WKR A;  3E4O A;  1S1Y A;  5J3W A;  1XJ6 A;  4HJ3 A;  3H82 B;  5F69 A;  4NXB A;  3MJQ A;  1TS6 A;  4K08 A;  4WL9 A;  4NXF A;  4EW7 A;  3F1N A;  3LIC A;  1S4R A;  4L9E A;  1DP9 A;  1T1C A;  2M1C A;  2ZOH A;  4NXG A;  1T1B A;  1T18 A;  5HDS A;  3FC7 A;  3F1O A;  3F1P A;  3NJA A;  3B33 A;  3PYP A;  3CLO A;  3F1N B;  4HH2 A;  3IS2 B;  1MZU A;  5TBM B;  5HDD A;  5G4Y A;  3E4Q A;  1KOU A;  5G4Z A;  3RH8 B;  3F1O B;  1F98 A;  3EEH A;  3LYX A;  3GEC A;  2EA9 A;  4XT2 A;  2R78 A;  4R38 A;  2PD7 A;  1ODV A;  3K3D A;  4DJ2 A;  2PR6 A;  1DRM A;  1VB6 A;  2ZBB A;  3UB6 A;  2L4R A;  3LIB A;  2PHY A;  2V1B A;  4GS9 B;  5HSQ A;  5F5Y A;  3HJK A;  1EW0 A;  2QJ7 A;  4EET B;  5HWV A;  1N9N A;  3OLO A;  1G28 A;  1D06 A;  4M4X A;  1UWP X;  3E4P A;  3IBR A;  2VLG A;  5HWT A;  2QJ5 A;  1OJ5 A;  3LID A;  3VOL A;  3UME A;  4H6J A;  2OWJ A;  1DP6 A;  4E04 A;  2PDR A;  4WF0 A;  1S67 L;  1P97 A;  1N9O A;  1LSX A;  3EWK A;  5AVE A;  4I5S A;  1LL8 A;  4I38 A;  1NWZ A;  3LI8 A;  4GHI B;  1LT0 A;  5EFW A;  2VEA A;  4H6J B;  3NOU C;  5I5L A;  2JN7 A;  1OTB A;  4HHD A;  1XFQ A;  2YKF A;  3VE4 A;  1OTD A;  3VE3 A;  3NHQ A;  1GSW A;  4PKY A;  3IS2 A;  5IU1 A;  1OT9 A;  3CAX A;  5TBM A;  2V9A A;  4I3I A;  2KX6 A;  2OWH A;  4KQD A;  5F68 A;  1OTA A;  2VV7 A;  3LIA A;  2ZOI A;  2H28 A;  3A0S A;  1GSX A;  2HV1 A;  2WKP A;  2W27 A;  2QWS A;  2K7S A;  2B02 A;  2YKH A;  4R3A A;  4GS9 A;  1T19 A;  2QHK A;  5HD3 A;  3LIE A;  4R70 A;  4L9F A;  3LUQ A;  5DKL A;  2I9V A;  4RQ9 A;  2PYP A;  4WN5 A;  4WLA A;  1X0O A;  4R6L A;  3PHY A;  2D01 A;  4HJ4 A;  1V9Z A;  3RTY A;  2KDK A;  4HP4 A;  1LSV A;  5HDC A;  5F6A A;  3SW1 A;  3A0R A;  3H9W A;  1S4S A;  4HH3 A;  3BWL A;  1TS8 A;  3H7W B;  4MN5 A; 
#chains in the Genus database with same CATH topology
 5HPI A;  3LGO A;  2A3U A;  4KQR A;  1XJ4 A;  4B9O A;  5DF8 A;  1L0D A;  5DTS A;  1NRF A;  4N92 A;  1YT4 A;  4CQH A;  4I39 A;  4ESP A;  4MDZ A;  5HAP A;  4PMA A;  3MXQ A;  3D3O A;  1BLC A;  3HBR A;  4S2P A;  3BY9 A;  3IF6 A;  4QY6 A;  2JKT M;  1IFQ A;  4KZA A;  2XK1 A;  2GJ3 A;  4ZRR A;  1OTI A;  3TOI A;  4FUW A;  5D3O A;  1FOF A;  3UE3 A;  4QJG A;  4F3L A;  1PFL A;  2PRF A;  3P7N A;  5KIZ A;  4R23 A;  5DTK A;  4DXC A;  4CLC B;  2QKP A;  3N8R A;  4X56 A;  3UDF A;  3TW8 A;  1YQS A;  3LEZ A;  4JGP A;  4JXS A;  1OT6 A;  1ESI A;  3C8C A;  4LGW A;  3T4Q A;  3CJM A;  4MNR A;  4B4X A;  4E3K A;  3GVB A;  4JLF A;  2WZX A;  1BLS A;  4KZB A;  4IBX A;  1LI0 A;  2VKS A;  4PM8 A;  2JC7 A;  1ZTU A;  2XRN A;  4EQI A;  3IX4 A;  3KX0 X;  5L10 A;  4EER A;  3MMH A;  3MZF A;  3QP2 A;  4P6Z S;  1VQQ A;  3MKE A;  4R1G A;  3ZYT A;  4JF6 A;  4NEE D;  1AXB A;  4N9K A;  5FDH A;  2Q9N A;  1SZV A;  2B95 A;  1PW1 A;  4CPK A;  1DJC A;  3IBJ A;  4WEJ A;  3PBN A;  4E3O A;  2P9V B;  2PBD P;  2QMI A;  4LRX C;  3WS2 A;  3SS4 A;  3W4O A;  1S6R A;  5HL6 A;  1P0Z A;  5FI2 A;  3IT9 A;  1IEM A;  3WRT A;  4HJ6 A;  3T12 B;  4B88 A;  4XT2 B;  4KZ8 A;  4S2O A;  1VET B;  1TS0 A;  4UQI M;  2UV0 E;  5DJU A;  2VGJ A;  2QZ6 A;  1XPB A;  2M7V A;  5EOO A;  2JHE A;  2RCX A;  2V1A A;  4MLL A;  3C2W A;  4BBU A;  1FCN A;  4XUX A;  3UB9 A;  5IHV A;  1LL5 A;  1SDN A;  1KVL A;  4PM7 A;  3T4J A;  3TSG A;  2Y2G A;  1N4O A;  5CER A;  4FOF A;  3MZE A;  3SS3 A;  4KQQ A;  4KQO A;  2PU4 A;  5CEC A;  3FKV A;  1M6K A;  3QP8 A;  1BLP A;  4E6X A;  4G3V A;  2H0T A;  3S7N A;  3LIC A;  1DP9 A;  1RGY A;  1CQA A;  1MKM A;  2M1C A;  1XKZ A;  4CLC E;  2JKG A;  3P98 A;  4NXG A;  4FH4 A;  1WYB A;  4PM5 A;  3F1P A;  3ZNT A;  2V20 A;  4MN7 A;  5TFQ A;  3IXB A;  2K31 A;  2XF3 A;  3CLO A;  2R9X A;  5HDD A;  1DJA A;  1E25 A;  1K55 A;  5HAI A;  5FL3 A;  1CI8 A;  2ZJ9 A;  4KZ5 A;  5G4Z A;  1FIL A;  3GEC A;  4OH0 A;  3GSG A;  4BWI A;  4GNU A;  4X55 A;  1L0G A;  3VP1 A;  3P09 A;  1ERM A;  3AGE A;  1DRM A;  1GHM A;  3FZC A;  4QD4 A;  5CHJ A;  1K57 A;  2PHY A;  1IYO A;  4L0L A;  5MC7 A;  4OQH A;  1GHP A;  2ZMA A;  4S2J A;  3G2Y A;  4M4X A;  2HDS A;  4X1M A;  1W79 A;  1K54 A;  4G3W A;  3NIA A;  4Y0U A;  3BLS A;  3N6I A;  3Q81 A;  2P74 A;  1YAX A;  2QJ5 A;  1KDS A;  3UDI A;  2IA2 A;  4R4S A;  2X71 A;  3W2Z A;  3UPO A;  3OCN A;  2OWJ A;  3BRM A;  3VOY A;  2ZM0 A;  1N9O A;  4GN2 A;  2J8Y A;  1KGF A;  4U3T A;  2WAF A;  1NXY A;  3CUE A;  4YOF A;  1NWZ A;  4BD1 A;  4H8R A;  4BEN A;  4LV0 A;  1JTD A;  2J3T C;  4ZBE A;  2JN7 A;  3RFB A;  1XFQ A;  1Y4O A;  4QU3 A;  5EVI A;  4C75 A;  4BD0 A;  4HBT A;  3E98 A;  3IF6 B;  1ZG6 A;  5TBM A;  2DCF A;  4Z9Q A;  4IED A;  5CXW A;  4MBF A;  2FFY A;  3KSG A;  2KX6 A;  2VGK A;  4JF4 A;  4Y15 A;  2OWH A;  4KQD A;  2WZZ A;  3BW6 A;  2VV7 A;  5DF9 A;  2H28 A;  1Z09 A;  5M19 A;  3PR6 A;  4D2O A;  4Y0O A;  3EEA A;  5GL9 A;  3E0Y A;  2QWS A;  3Q1F A;  2K7S A;  4Y2F A;  4GD6 A;  2B02 A;  3C4P A;  1T19 A;  1STZ A;  1VEU A;  3S7P A;  1H5X A;  4S2M A;  2P08 A;  3LUQ A;  2I9V A;  5FAT A;  4MCW A;  5GHY A;  4RQ9 A;  2PYP A;  3JVU A;  1MWT A;  1PZO A;  3M6B A;  3M2K A;  3ZFZ A;  3NDG A;  1X0O A;  4ARZ A;  1LL9 A;  3W8K A;  1V9Z A;  2KDK A;  4HP4 A;  3SZT A;  2XLN A;  5HDC A;  3QP5 A;  1OME A;  5F6A A;  1K55 C;  2ZC4 B;  3SW1 A;  3C4O A;  3CHW P;  3MXS A;  4HH3 A;  3VP4 A;  1W63 Q;  2Y2O A;  4ZJ1 A;  3UPN A;  5FI6 A;  4X6T A;  4EBN A;  4MN5 A;  1H8M A;  2EX9 A;  3GR2 A;  1L0E A;  4FTX A;  3ZGA B;  3HL9 A;  3IXH A;  2Y2Q A;  4X68 A;  2A49 A;  4Y5F A;  2Z2M B;  3FKW A;  1ZHH B;  3Q82 A;  1T1A A;  4S2I A;  1XA1 A;  4JGO A;  4L9G A;  4AFI A;  2XFT A;  3CIT A;  1DP8 A;  2OOL A;  1GA9 A;  3G6O A;  4R3B A;  1Y28 A;  4HY8 A;  3HLC A;  1MC0 A;  5IT5 A;  1K54 C;  3HLB A;  2Y2P A;  2GX5 A;  4FCF A;  4PKY G;  3WRZ A;  1XX2 A;  4GCZ A;  4OPY A;  2RL3 A;  2VV8 A;  4RVA A;  2Y2M A;  1PNE A;  4E3I A;  4X69 A;  5FSR A;  3NOT C;  1O07 A;  1FIK A;  5KSC A;  4XXR A;  4DE3 A;  5IS1 A;  3HVF A;  3ZG8 B;  1G5U A;  2LB9 A;  3KYZ A;  3TE8 A;  4E3N A;  2W3D A;  3UB8 A;  3GRJ A;  2EFX A;  4G3K A;  3T4K A;  1YLW A;  5CHU A;  3AGD A;  3LI9 A;  3DTK A;  5TGF A;  5K5B A;  3LCE A;  5FAQ A;  3GV9 A;  1N9L A;  3G31 A;  5LBR A;  4LV2 A;  5EVI C;  2VJW A;  2J3W A;  4EQ1 A;  2XDM A;  3WS1 A;  2W3H A;  2WKH A;  3LR4 A;  3C30 A;  2W0N A;  4EBL A;  3UO9 A;  3A3D A;  2V0U A;  4OON A;  1K56 D;  4DE0 A;  2PU2 A;  2Z6D A;  3PAE A;  2WGW A;  3LEQ A;  1BYW A;  1K4F A;  1TEM A;  1YLY A;  5CED A;  2HP6 A;  1F5M A;  5AQA A;  4UA7 A;  1KDW A;  1BT5 A;  2B5R A;  3F1P B;  5FQJ A;  2XEP A;  4BBT A;  4KUK A;  1SKO A;  2WKQ A;  2O9A A;  3E2L A;  5BOH A;  1QMF A;  2WYX A;  3O87 A;  1TS7 A;  5DTT A;  1PW8 A;  3QP6 A;  4WZ4 A;  2VV6 A;  5HZH A;  3HLD A;  4HOI A;  2HDR A;  5A8B A;  4HP9 A;  4JGR A;  2H10 A;  3QP1 A;  2A24 B;  2VK3 A;  2ZC7 A;  2PR5 A;  2O9C A;  2L1M A;  2WGI A;  1RCJ A;  1MWU A;  2IWC A;  4QWO A;  5DJT A;  2ZM2 A;  5F83 A;  3BQ8 A;  3A0V A;  2VA0 A;  3K3C A;  4NXE A;  3NI9 A;  1HVB A;  4E6W A;  4KG6 A;  1PI5 A;  1XJ2 A;  2Y59 A;  4GW9 A;  2MJ6 A;  3KYQ A;  5F1G A;  3TG9 A;  3G35 A;  1K0K A;  1S1Y A;  5FQQ A;  3GQZ A;  2ZQ9 A;  3H82 B;  5F69 A;  3IHB A;  3ZNY A;  2ZMF A;  3MJQ A;  1TS6 A;  4PAU A;  4S2N A;  1ACF A;  1FSW A;  4Q0H A;  2GDN A;  1H8Y A;  3IX8 A;  1CJF A;  1S4R A;  1PRQ A;  1T1C A;  2EWW A;  2XD1 A;  2ZQ8 A;  2LB5 A;  3KO6 A;  1PWC A;  3RJU A;  3OZH A;  5CTN A;  3FC7 A;  1ZC2 A;  3V3S A;  3C5A A;  5EVI B;  3F1N B;  1ALQ A;  3HLE A;  5EE8 A;  1KVM A;  5TBM B;  4OPR A;  3T1X A;  3ISG A;  4JKT A;  5G4Y A;  4UA9 A;  1H0M A;  2NUP C;  3F1O B;  1F98 A;  4PPR A;  1JTG A;  3HLF A;  3EEH A;  4O01 A;  4O0P A;  2EA9 A;  2R78 A;  4OPZ A;  2Y2N A;  3ZVW A;  5A93 A;  3VSK A;  4DJ2 A;  5E2E A;  2PR6 A;  3PTE A;  2ZBB A;  2ZD8 A;  2L4R A;  3UN7 A;  4PM6 A;  5FQ9 A;  3LIB A;  2V1B A;  5HSQ A;  5F5Y A;  3HJK A;  1CEG A;  4EET B;  4N1H A;  5HWV A;  5CRF A;  5FAO A;  2X02 A;  1YMS A;  1VHM A;  1E3U D;  2EX8 A;  4ETZ A;  2ZL1 B;  3E4P A;  1W8Y A;  1L2S A;  3BFC A;  4ARZ B;  4IUH A;  4N1X A;  3RXW A;  5DVA A;  1S0W A;  4WZ5 C;  1NRJ A;  2EX2 A;  4B4Z A;  4ETX A;  3FPV A;  4OQG A;  4X25 A;  3EOI A;  4PHT A;  4KZ6 A;  4DF6 A;  1NZU A;  5AQ7 A;  5AVE A;  1LL8 A;  2JKR I;  5A91 A;  1LT0 A;  1C3B A;  5EFW A;  3QNB A;  1J3W A;  3PAG A;  3LR0 A;  1IYP A;  4D60 A;  1ZKJ A;  4H6J B;  3L9K A;  4F94 A;  5L09 A;  5GLD A;  2YKF A;  2XRO A;  3VE4 A;  3S22 A;  1OTD A;  3BYD A;  4FSF A;  3DTE A;  1GSW A;  4PKY A;  5KMW A;  3IS2 A;  2FZ0 A;  5IU1 A;  3ZHH A;  1OPX A;  5E2G A;  2V9A A;  5A90 A;  3FYZ A;  1SKF A;  2WAE A;  1MY8 A;  3CG5 A;  1OTA A;  3IH8 A;  3M6H A;  4WEK A;  1K4E A;  2G2U A;  3A0S A;  3N8L A;  3WWX A;  1XGJ A;  1KE0 A;  4S2N C;  1GSX A;  3SH7 A;  5G18 A;  4NG2 A;  5C5K A;  3GTC A;  4GS9 A;  1EWZ A;  1F2K A;  2QHK A;  1ONH A;  4KZ4 A;  3LIE A;  5DKL A;  2JKT I;  1IOU A;  4NKP A;  2HJE A;  4WN5 A;  1DJB A;  5E2H A;  4WLA A;  4HBU A;  2HZ5 A;  4MMN A;  2J9O A;  2A2L A;  1CEF A;  2D01 A;  4R3J A;  5DFX A;  1LSV A;  3B3X A;  3L7H A;  3QHY A;  2Y8H A;  2W3F A;  2HF6 A;  3BWL A;  2EWV A;  2WGW B;  3NC8 A;  2W3E A;  4LCM A;  3T4O A;  3BM6 A;  1W63 M;  1ERQ A;  1IYQ A;  4JXG A;  4GHI A;  3DWZ A;  5M1A A;  1SKO B;  1PYY A;  2XGN A;  2I72 A;  3LIF A;  1IKI A;  2X01 A;  3SS5 A;  1RP5 A;  3MFX A;  1WYC A;  3OCL A;  4ID4 A;  1ES3 A;  1P9W A;  3A3E A;  1YLZ A;  4DKI A;  1HTZ A;  3MQQ A;  5FEF A;  1BLH A;  1D7E A;  1K38 A;  4GJ4 A;  1W7F A;  1MWR A;  2O99 A;  2ZQ7 A;  4EEU A;  1UGU A;  2ZM8 A;  1K6S A;  5GLA A;  4IVI A;  3ZQ5 A;  3HLW A;  2Y55 A;  3V39 A;  5FA7 A;  2GZA A;  1H3Q A;  4JGQ A;  5J7E A;  4HNB A;  3FV7 A;  4GKU A;  4WUJ A;  1NY0 A;  4JBF A;  2EXA A;  2JBF A;  4F3L B;  3HUN A;  3IWO A;  3BY8 A;  4DJ3 A;  3O3V A;  1FR6 A;  3C7U A;  3ZVT A;  2INW A;  3CWF A;  5I94 A;  4LRZ E;  5CGS A;  1LSW A;  1TD5 A;  1I2S A;  3O86 A;  2ZC3 B;  3S4X A;  4CLC D;  4JXV A;  1XXM A;  4DE1 A;  3PXP A;  3T50 A;  2Z6C A;  5CTM A;  2WK0 A;  1BTL A;  2D02 A;  3MQO A;  4BJP A;  1G6O A;  4Q0I A;  4QB8 A;  4EXO A;  4X1L A;  4WMC D;  1XP4 A;  3HUM A;  2DNS A;  2W1T A;  2XA7 S;  3IXG A;  3UB7 A;  2JCH A;  4K0X A;  2H5S A;  1V9Y A;  4E3J A;  3H7W A;  3VP2 A;  1J9M A;  2O0Y A;  5E43 A;  4C3Q A;  1BUL A;  1XJ3 A;  1Q2Q A;  2BAS A;  2J7V A;  5J4E A;  2ZLY A;  3DWK A;  5HWW A;  1YPR A;  4HQA A;  3UE1 A;  1I2W A;  3PBQ A;  1VET A;  3T1R A;  1ES4 A;  2OV5 A;  1P9R A;  2OLU A;  3S1Y A;  1G68 A;  2PD8 A;  3IWQ A;  3MFD A;  4MN6 A;  1H8Z A;  5DKK A;  1MKI A;  3VP0 A;  3C38 A;  1E4D A;  4I3J A;  4MEZ A;  5HD5 A;  2Q9M A;  1MXO A;  3BFG A;  2P7J A;  1NLZ A;  3UNW A;  5A92 A;  2Y2K A;  3UMD A;  2VGL S;  5DFY A;  4LLO B;  1JVJ A;  4BL2 A;  1XGI A;  3HCY A;  4BLM A;  2ACG A;  3JYI A;  1XFN A;  1W5D A;  1K56 A;  1Z6F A;  2V0W A;  2Z2L B;  3MXR A;  2CMN A;  4O7D A;  2EXB A;  3VOZ A;  4OPQ A;  2WKR A;  4GB7 A;  1YSQ A;  5J3W A;  4HJ3 A;  4HEF A;  1YM1 A;  2G7U A;  4K0W A;  4DN0 A;  4K08 A;  1Q2P A;  3BLM A;  4KZ7 A;  4CLC C;  3T1S A;  3SH9 A;  4ZAM A;  3NEC A;  4IJG A;  1IEL A;  1YLP A;  2WAD A;  3A3F A;  3NCK A;  5FQK A;  3LY4 A;  3PBO A;  4FD8 A;  4MBH A;  2XD5 A;  2WKE A;  1T18 A;  5HDS A;  1AWI A;  1PIO A;  3C7V A;  3NJA A;  4C6Y A;  5GHZ A;  4UA6 A;  3B33 A;  3PYP A;  4ZDX A;  4KZ3 A;  4WBG A;  4HH2 A;  3IS2 B;  4N9L A;  5HFO A;  3BJN A;  5FDS A;  4BQM A;  5EM1 A;  4OKP A;  4P0M A;  3V50 A;  1A0K A;  1CF0 A;  2CC1 A;  3RH8 B;  5AJG A;  2ZQD A;  1HZO A;  2JKR M;  1JWV A;  4R38 A;  2NUT C;  1ODV A;  4YIN A;  4WZ5 A;  4JPM A;  4S2L A;  4Y0T A;  2C6W B;  2XH9 A;  2Y79 A;  4GS9 B;  4JF5 A;  4O8G A;  4P6B A;  1EW0 A;  4JXW A;  3K2N A;  1CK3 A;  3E2K A;  1GHI A;  4GDB A;  4P6Z M;  2Y2I A;  5EOE A;  2EFU A;  3OBF A;  1KGG A;  1D06 A;  1G28 A;  4Y17 A;  5KZH A;  1NZO A;  4KG5 A;  4DDS A;  3IBR A;  3TJZ C;  2QYB A;  5J8X A;  4IVK A;  2OAP 1;  3OPL A;  5HWT A;  1OJ5 A;  1TDL A;  2BG1 A;  4B93 A;  2M7U A;  4K91 A;  2WUQ A;  3UB5 P;  5HPF A;  4UEY A;  5JYO A;  1G6A A;  1K25 A;  2HJ9 C;  4EUV A;  3I7J A;  2WGV A;  3G34 A;  3U4L P;  2PDR A;  3DTM A;  1S67 L;  1P97 A;  1LSX A;  3G30 A;  2K2N A;  4I5S A;  2OLV A;  5M18 A;  1IKG A;  4GHI B;  4WYY A;  2VEA A;  3EQU A;  1YSP A;  1M40 A;  4Z1W A;  3MBZ A;  3T4S A;  3WS5 A;  2V8C A;  4M3K A;  4XUZ A;  5FAP A;  3UE0 A;  1OTB A;  4HHD A;  4DMZ A;  3VE3 A;  3EQV A;  3NHQ A;  1YKD A;  4OOL A;  3CAX A;  4P87 A;  4Q0J A;  5EPH A;  4II7 A;  4NK3 A;  3GMW A;  2Y91 A;  1E3U A;  1MWS A;  2ZQC A;  3MF0 A;  2PAV P;  3R7W A;  3V5M A;  3MS6 A;  3CMZ A;  4EU0 A;  2HP9 A;  5CEB A;  1HD8 A;  1BZA A;  3N8S A;  4DRT A;  3O5Y A;  4UHU A;  4OOY A;  3NDE A;  3ZG0 A;  1ONG A;  1TF1 A;  4LEN A;  4HES A;  5HD3 A;  1KE4 A;  3IX3 A;  4L9F A;  3LFV A;  1PZP A;  4QPR A;  1FSY A;  4CJN A;  4GZB A;  3VFF A;  4LV1 A;  2OAQ 1;  3PHY A;  4HJ4 A;  1VEU B;  2KOI A;  3D9Y A;  1NYY A;  3VMA A;  3UDX A;  3U2A A;  5GLC A;  3IH9 A;  2W1T B;  3MQ0 A;  4EWF A;  2XSS A;  4ZJ2 A;  2E8I A;  1TS8 A;  3H7W B;  4BL3 A;  5HW3 A;  4OP5 A;  4IUK A;  3ZDJ A;  5HAQ A;  2PBY A;  2W3G A;  2HGV A;  1EI5 A;  3DTI A;  5HL1 A;  5CHM A;  1S1Z A;  2BLS A;  1FQG A;  3GDI A;  3LY3 A;  2Y2J A;  5E2F A;  2V1Z A;  1GA0 A;  1WA9 A;  1PWG A;  5AQ9 A;  4R0Q A;  5L07 A;  3ICY A;  2XQZ A;  3OPP A;  1U60 A;  4GDN A;  1SDE A;  4I3A A;  3Q07 A;  3P01 A;  3TRC A;  3JVV A;  3M2J A;  2FFF B;  2Y2L A;  5HAR A;  2B18 A;  2EX6 A;  1NYM A;  3WS4 A;  4HIA A;  4MBK A;  3Q7V A;  4KUO A;  5FAS A;  4DDY A;  3A3I A;  2H0Y A;  3EGD C;  4GLQ A;  3AGF A;  3IF6 C;  4NET A;  3ULF A;  4LRY C;  3ZG7 B;  2DMW A;  2J80 A;  3JPU A;  1JWZ A;  1KE3 A;  1S66 L;  4RYE A;  3CPT A;  3D72 A;  1FR1 A;  5CGX A;  3Q7Z A;  4YWZ A;  3W4P A;  1K6R A;  1RGZ A;  3KSF A;  2J3T D;  3MR0 A;  3NUL A;  2BTF P;  4QY5 A;  1OJG A;  4EBP A;  2HDQ A;  1GSV A;  3W4Q A;  2JE5 A;  1LI9 A;  5GLB A;  2PYR A;  1GCE A;  1LHY A;  1HLU P;  1LLB A;  2HPB A;  1NLY A;  1TDG A;  3KSI A;  2Y4A A;  4YNR A;  2IWD A;  1SCW A;  2ZC5 B;  5U47 A;  1QME A;  4UQI S;  3MKF A;  4KEN B;  2E8J A;  3A3J A;  1UWN X;  1O7E A;  2A24 A;  3FWL A;  3VSL A;  3ZG9 B;  1YMX A;  1IYS A;  1PWD A;  2Q0O A;  1N9B A;  4E3M A;  3V67 A;  5F1F A;  3HJI A;  1WE4 A;  3HLG A;  3IQA A;  1JNU A;  4HI4 A;  2KLI A;  2J9P A;  5EM0 A;  5FQI A;  1MPL A;  1JWP A;  2XA7 M;  3LO7 A;  1ESU A;  1D1J A;  3DW0 A;  3PBS A;  5AVF A;  3BFD A;  3EGX C;  3UE6 A;  4EES A;  2PT7 A;  1NJ4 A;  2L0W A;  4LPZ A;  4IHQ A;  3KYE A;  3IWI A;  5HX9 A;  2DRW A;  2IWB A;  3T1Q B;  4CLC A;  3SH8 A;  5EEC A;  3H82 A;  3T4T A;  1F9I A;  4OP8 A;  3FG8 A;  4EEP A;  3ZCZ A;  4BBV A;  3D4F A;  4WMC A;  4Y7P A;  1TVF A;  2VX8 A;  2ZMV A;  3NOP C;  3DAV A;  2XFS A;  3CI6 A;  1OTE A;  4R4R A;  3E4O A;  2C5W B;  2W1R A;  3HUO A;  3PBR A;  1XJ6 A;  3BFF A;  3BEB A;  3NY4 A;  4NXB A;  3N7W A;  5F82 A;  2FH5 A;  1MBL A;  3S7O A;  4WL9 A;  2VGL M;  4NXF A;  4RX2 A;  3OPH A;  1L0F A;  5EVE A;  4EW7 A;  4QHC A;  3F1N A;  4L9E A;  5JYP A;  4U0T A;  1ZG4 A;  4IBR A;  2ZOH A;  1YLJ A;  1T1B A;  3G2Z A;  5FQM A;  4S2K A;  1ES5 A;  3F1O A;  3WS0 A;  3UY6 A;  3LR5 A;  4OVD A;  1ES2 A;  1KGE A;  3OC2 A;  4DE2 A;  1MZU A;  5DF7 A;  5EUA A;  3BFE A;  2P9V A;  4LV3 A;  2UWX A;  3T4L A;  2HP5 A;  4OLD A;  3E4Q A;  3S7Q A;  1KOU A;  1FCO A;  4GOG A;  3MZD A;  3LYX A;  1ERO A;  3R7W B;  4XT2 A;  5GHX A;  4BMW A;  2PD7 A;  2ZL1 A;  3K3D A;  5CGW A;  5FI7 A;  3IF5 A;  1VB6 A;  5EVI D;  3UB6 A;  3SOI A;  4Y13 A;  3IHA A;  3OOV A;  5FEG A;  2QJ7 A;  3B42 A;  3HRE A;  4KG2 A;  2G2W A;  5EV0 A;  1N9N A;  3OLO A;  4RA7 A;  1SHV A;  4OLG A;  1UWP X;  2GNX A;  5CX7 A;  4UAA A;  2V2F F;  2VLG A;  2V8F A;  3B47 A;  3LID A;  3VOL A;  3UME A;  5AQB A;  1K57 C;  3ITB A;  4H6J A;  4WM9 A;  4P85 A;  3BEC A;  3O88 A;  1DP6 A;  4E04 A;  4WF0 A;  3CZD A;  3EWK A;  2JKF A;  3G32 A;  5L2F A;  4I38 A;  3LI8 A;  3VFH A;  1YLT A;  3MSH A;  5EVL A;  2VZW A;  3OPR A;  3RXX A;  1BSG A;  3R4K A;  3NOU C;  1FCM A;  4YFM A;  5I5L A;  4WEL A;  4KZ9 A;  1VM1 A;  2R9W A;  3N4I A;  1OT9 A;  5L8M A;  1DY6 A;  3QNC A;  3KSH A;  4OOM A;  4I3I A;  3CUE C;  2HDU A;  2WKI A;  5F68 A;  2OSU A;  3VV4 A;  3LIA A;  2ZOI A;  4FH2 A;  1CI9 A;  4U0X A;  4ZTK A;  2AVX A;  2Y2H A;  2HV1 A;  2WKP A;  4OQI A;  1PI4 A;  2W27 A;  3IXD A;  3Q7V B;  4OQ0 A;  4Y3I A;  3FPW A;  2YKH A;  4R3A A;  4X53 A;  3VP3 A;  1Y54 A;  3QP4 A;  3G4P A;  4R70 A;  4E3L A;  3PBT A;  2XR0 A;  3CPT B;  3DBA A;  1BUE A;  4LFU A;  2O9B A;  1I5Q A;  4R6L A;  2ZQA A;  4DXB A;  3ITA A;  4Q8I A;  5TR7 A;  3BQA A;  1L3L A;  3RTY A;  2QPN A;  4GD8 A;  1XA7 A;  4RX3 A;  4LCL A;  4ME4 A;  3A0R A;  3H9W A;  3V3R A;  5KSH A;  1S4S A;  3LR3 A;  2P04 A;  1W8Q A;  2ZC6 B;  4A5R A;  3NBL A;  3ZG5 A;  4EUZ A;  5TJJ A;  4PM9 A;  3UPP A;  4ZJ3 A;  4EV4 A; 
#chains in the Genus database with same CATH homology
 5HPI A;  1W63 M;  1XJ4 A;  4IUK A;  4B9O A;  4GHI A;  2W3G A;  4CQH A;  4Y5F A;  2HGV A;  3LIF A;  1ZHH B;  1T1A A;  1S1Z A;  3MFX A;  4I39 A;  4MDZ A;  4JGO A;  4L9G A;  3GDI A;  3OCL A;  4AFI A;  3MXQ A;  1P9W A;  3CIT A;  1DP8 A;  2OOL A;  1WA9 A;  3D3O A;  3G6O A;  1Y28 A;  4HY8 A;  1MC0 A;  3BY9 A;  3ICY A;  5IT5 A;  3MQQ A;  2GX5 A;  2JKT M;  1IFQ A;  1D7E A;  4PKY G;  2GJ3 A;  4ZRR A;  4I3A A;  1OTI A;  4GJ4 A;  3P01 A;  3TRC A;  3JVV A;  4GCZ A;  2VV8 A;  2O99 A;  4EEU A;  1UGU A;  2B18 A;  3UE3 A;  4F3L A;  3P7N A;  5KIZ A;  3NOT C;  4CLC B;  2QKP A;  3ZQ5 A;  4HIA A;  3TW8 A;  5IS1 A;  4JGP A;  4KUO A;  2GZA A;  1H3Q A;  1OT6 A;  2LB9 A;  3C8C A;  4JGQ A;  3EGD C;  3KYZ A;  4GLQ A;  4HNB A;  3TE8 A;  5J7E A;  3ULF A;  2W3D A;  4WUJ A;  3T4Q A;  4LRY C;  3UB8 A;  2DMW A;  4F3L B;  2J80 A;  4G3K A;  1S66 L;  3T4K A;  3BY8 A;  3D72 A;  4DJ3 A;  3LI9 A;  4YWZ A;  5K5B A;  3KSF A;  2J3T D;  3MR0 A;  2INW A;  3CWF A;  4LRZ E;  1LSW A;  1TD5 A;  1N9L A;  2VKS A;  1OJG A;  5LBR A;  1GSV A;  4CLC D;  3PXP A;  1ZTU A;  2VJW A;  2J3W A;  3T50 A;  4EQ1 A;  2XRN A;  2Z6C A;  2D02 A;  3MQO A;  4BJP A;  1G6O A;  2PYR A;  2W3H A;  3KX0 X;  3LR4 A;  4Q0I A;  3C30 A;  2W0N A;  1NLY A;  4EER A;  3MMH A;  2V0U A;  4EXO A;  4P6Z S;  2Z6D A;  2W1T A;  2XA7 S;  3KSI A;  3UB7 A;  4YNR A;  1V9Y A;  1BYW A;  3H7W A;  2O0Y A;  3ZYT A;  1F5M A;  4NEE D;  4UQI S;  1XJ3 A;  1UWN X;  2BAS A;  2A24 A;  3F1P B;  4BBT A;  4KUK A;  5J4E A;  2WKQ A;  2O9A A;  3IBJ A;  5HWW A;  4HQA A;  4WEJ A;  3PBN A;  1TS7 A;  3PBQ A;  3V67 A;  3HJI A;  2VV6 A;  5HZH A;  1JNU A;  1P9R A;  4HI4 A;  4LRX C;  2KLI A;  2PD8 A;  4HOI A;  5A8B A;  4HP9 A;  4JGR A;  5HL6 A;  1P0Z A;  4MN6 A;  2A24 B;  5DKK A;  4HJ6 A;  2XA7 M;  3C38 A;  4XT2 B;  4I3J A;  2PR5 A;  5HD5 A;  2O9C A;  3PBS A;  5AVF A;  2L1M A;  1TS0 A;  3EGX C;  4UQI M;  3UE6 A;  2P7J A;  1NLZ A;  5DJU A;  4EES A;  2PT7 A;  2M7V A;  2L0W A;  5DJT A;  3UMD A;  3BQ8 A;  2VGL S;  4IHQ A;  4LPZ A;  5DFY A;  4LLO B;  3A0V A;  2JHE A;  2VA0 A;  3K3C A;  2V1A A;  4NXE A;  4CLC A;  3HCY A;  3H82 A;  3T4T A;  1F9I A;  3C2W A;  1XFN A;  4BBU A;  3FG8 A;  3UB9 A;  1XJ2 A;  4GW9 A;  4EEP A;  2MJ6 A;  4BBV A;  2V0W A;  2VX8 A;  2ZMV A;  3NOP C;  2CMN A;  3CI6 A;  3KYQ A;  1OTE A;  3T4J A;  2WKR A;  3E4O A;  1YSQ A;  2W1R A;  3PBR A;  1S1Y A;  5J3W A;  1XJ6 A;  4HJ3 A;  4FOF A;  3H82 B;  5F69 A;  4NXB A;  2ZMF A;  3MJQ A;  2G7U A;  4DN0 A;  1TS6 A;  4PAU A;  4KQO A;  2FH5 A;  4K08 A;  3S7O A;  4WL9 A;  4CLC C;  2VGL M;  4NXF A;  4G3V A;  4IJG A;  4Q0H A;  4EW7 A;  3F1N A;  3LIC A;  1S4R A;  4L9E A;  3S7N A;  1DP9 A;  3PBO A;  1T1C A;  2EWW A;  1MKM A;  2M1C A;  4CLC E;  2LB5 A;  2ZOH A;  3KO6 A;  4NXG A;  1T1B A;  1T18 A;  5HDS A;  3FC7 A;  3F1O A;  3F1P A;  3LR5 A;  3NJA A;  3B33 A;  3PYP A;  4MN7 A;  3OC2 A;  2K31 A;  3CLO A;  3F1N B;  4HH2 A;  3IS2 B;  1MZU A;  5TBM B;  5HDD A;  3BJN A;  5FL3 A;  3T4L A;  5G4Y A;  3E4Q A;  2NUP C;  3S7Q A;  1KOU A;  5G4Z A;  3RH8 B;  3F1O B;  1F98 A;  5AJG A;  3EEH A;  4O01 A;  3LYX A;  3GEC A;  4O0P A;  2EA9 A;  3R7W B;  4XT2 A;  2R78 A;  4BWI A;  2JKR M;  4BMW A;  4R38 A;  2PD7 A;  2NUT C;  1ODV A;  3K3D A;  4DJ2 A;  2PR6 A;  1DRM A;  1VB6 A;  2ZBB A;  3UB6 A;  2L4R A;  3LIB A;  4L0L A;  2PHY A;  2V1B A;  2Y79 A;  4GS9 B;  4O8G A;  3OOV A;  5HSQ A;  5F5Y A;  3HJK A;  1EW0 A;  2QJ7 A;  3K2N A;  4EET B;  3B42 A;  5HWV A;  4P6Z M;  1N9N A;  5MC7 A;  3OBF A;  3OLO A;  1VHM A;  1G28 A;  1D06 A;  4M4X A;  4ETZ A;  1UWP X;  2GNX A;  3E4P A;  5CX7 A;  3IBR A;  3TJZ C;  4G3W A;  2QYB A;  2OAP 1;  2VLG A;  4ARZ B;  4IUH A;  3B47 A;  1YAX A;  5HWT A;  2QJ5 A;  1OJ5 A;  3LID A;  3VOL A;  3UME A;  4B93 A;  1NRJ A;  2IA2 A;  2M7U A;  4ETX A;  3FPV A;  5HPF A;  4UEY A;  3W2Z A;  3EOI A;  3OCN A;  4PHT A;  4H6J A;  2OWJ A;  2HJ9 C;  4EUV A;  1DP6 A;  4E04 A;  2PDR A;  4WF0 A;  1S67 L;  1P97 A;  1N9O A;  1LSX A;  3EWK A;  2K2N A;  5AVE A;  4I5S A;  1LL8 A;  3CUE A;  4I38 A;  1NWZ A;  3LI8 A;  4YOF A;  2JKR I;  4GHI B;  1LT0 A;  5EFW A;  2VEA A;  3EQU A;  1YSP A;  4Z1W A;  2VZW A;  3LR0 A;  2J3T C;  3T4S A;  3R4K A;  4H6J B;  3NOU C;  5I5L A;  2JN7 A;  3RFB A;  1OTB A;  4HHD A;  1XFQ A;  2YKF A;  2XRO A;  4WEL A;  3VE4 A;  4DMZ A;  1OTD A;  3VE3 A;  3EQV A;  3NHQ A;  4FSF A;  1GSW A;  4PKY A;  1YKD A;  2FZ0 A;  3E98 A;  3IS2 A;  5IU1 A;  1OT9 A;  5L8M A;  4OOL A;  3CAX A;  1OPX A;  5TBM A;  3KSH A;  4Q0J A;  4OOM A;  2V9A A;  4I3I A;  3KSG A;  4II7 A;  2KX6 A;  3CUE C;  2OWH A;  4KQD A;  5F68 A;  3BW6 A;  1OTA A;  2VV7 A;  3MF0 A;  5DF9 A;  3VV4 A;  3LIA A;  3R7W A;  2ZOI A;  4WEK A;  2H28 A;  3A0S A;  4EU0 A;  3PR6 A;  1GSX A;  2HV1 A;  2WKP A;  3EEA A;  2W27 A;  5C5K A;  3O5Y A;  3E0Y A;  2QWS A;  4Y3I A;  3FPW A;  2K7S A;  4Y2F A;  2B02 A;  2YKH A;  4R3A A;  4GS9 A;  1T19 A;  1STZ A;  1TF1 A;  2QHK A;  3S7P A;  5HD3 A;  3LIE A;  4R70 A;  4L9F A;  2P08 A;  3LUQ A;  3LFV A;  5DKL A;  3PBT A;  2I9V A;  4MCW A;  2JKT I;  4RQ9 A;  2PYP A;  3DBA A;  1IOU A;  4NKP A;  2HJE A;  3JVU A;  2O9B A;  4QPR A;  4WN5 A;  4WLA A;  4MMN A;  1X0O A;  4R6L A;  2OAQ 1;  4ARZ A;  2A2L A;  3PHY A;  2D01 A;  3BQA A;  4HJ4 A;  1V9Z A;  5DFX A;  2KDK A;  4HP4 A;  3RTY A;  1LSV A;  5HDC A;  2KOI A;  2Y8H A;  5F6A A;  2W3F A;  4ME4 A;  3A0R A;  3H9W A;  3SW1 A;  5KSH A;  1S4S A;  2HF6 A;  4HH3 A;  3LR3 A;  3BWL A;  2P04 A;  1W63 Q;  3U2A A;  2W1T B;  2EWV A;  3MQ0 A;  5TJJ A;  2XSS A;  2W3E A;  1TS8 A;  3H7W B;  4MN5 A;  1H8M A;  3T4O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...