4NXGA

Crystal structure of ilov-i486z(2lt) at ph 9.0
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
103
structure length
102
Chain Sequence
KNFVITDPRLPDNPIIFASDGFLELTEYSREEILGRNARFLQGPETDQATVQKIRDAIRDQRETTVQLINYTKSGKKFWNLLHLQPVRDQKGELQYFGVQLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Phototropin-2
publication title Significant Expansion of Fluorescent Protein Sensing Ability through the Genetic Incorporation of Superior Photo-Induced Electron-Transfer Quenchers
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Flavoprotein, fluorescent protein
total genus 32
structure length 102
sequence length 103
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4nxgA00
5AVFA 5J4EA 3LUQA 4KUOA 4LRXC 3NOUC 4XT2A 5HDDA 3BY9A 2WKQA 4HJ6A 1T19A 3LYXA 3F1NB 2K7SA 4HI4A 3LIEA 5HWVA 5DJUA 4XT2B 2Z6CA 3UB8A 4EEUA 5HWWA 3LI8A 3NHQA 4HQAA 4HIAA 1XJ2A 3UB9A 1S1YA 1OJ5A 4I5SA 1DRMA 3OLOA 5F68A 3C8CA 2L1MA 4LPZA 2EA9A 3PYPA 5HD5A 4BBUA 3UE6A 3GECA 1F9IA 1N9LA 2YKFA 3T50A 4F3LA 4L9GA 2J80A 3P7NA 1OJGA 1TS6A 2WKPA 4DJ3A 5G4ZA 1BYWA 4I3AA 4HHDA 4R6LA 4L9EA 1G28A 1LSXA 2V1BA 2PYPA 4HH3A 3H7WA 4K08A 1GSVA 3E4QA 4NXEA 1D7EA 1T18A 3MFXA 5F5YA 4HY8A 5A8BA 3VE3A 2ZOIA 2QJ7A 1XFQA 4EESA 3F1OB 3FG8A 4MN5A 1NWZA 1Y28A 2I9VA 2VV6A 3ZQ5A 3EEHA 1V9ZA 2JN7A 3LIBA 2W27A 4H6JA 3IS2A 1LL8A 4LLOB 4I3IA 3A0RA 4H6JB 5F6AA 3IS2B 4GS9A 3CWFA 3VE4A 2M1CA 4JGPA 3CAXA 2A24B 4HH2A 4GHIB 2BASA 4BBVA 3MQQA 3K3CA 3F1NA 4GS9B 2R78A 2VV8A 1GSXA 3C2WA 5TBMB 4M4XA 1TS7A 1S4SA 2KX6A 1XJ3A 4HP4A 5DKKA 4DJ2A 2P7JA 4EETB 4LRZE 3HJIA 3RH8B 5HDSA 1KOUA 2WKRA 4HOIA 1OTBA 3FC7A 4GCZA 3PHYA 3SW1A 4EQ1A 1T1BA 4L9FA 2VLGA 4KUKA 4EEPA 2INWA 2HV1A 1X0OA 2V1AA 5AVEA 4EERA 3UB6A 4YWZA 4LRYC 4E04A 5F69A 1TS0A 2PR6A 4I3JA 4JGRA 2L0WA 3MQOA 4PKYA 1S4RA 3RTYA 1N9OA 1UWPX 2V0WA 1N9NA 1OTDA 3NOPC 2OWHA 3F1OA 5HDCA 3EWKA 1EW0A 5J3WA 3LI9A 1OT6A 4R38A 1P0ZA 3UMDA 2VV7A 2W0NA 5J7EA 1VB6A 4WLAA 1DP8A 3A0VA 1T1CA 3KX0X 1LT0A 5DJTA 4EXOA 1OTIA 4RQ9A 3BY8A 4JGQA 2A24A 1DP9A 4GHIA 1WA9A 2KDKA 2QWSA 1UGUA 4WL9A 3HJKA 1D06A 4WUJA 1F98A 5TBMA 1ODVA 4JGOA 2Z6DA 2CMNA 4WN5A 2QHKA 4KQDA 3LIDA 3NOTC 1T1AA 3E4OA 2V0UA 4WF0A 2VEAA 4NXFA 2PHYA 5HZHA 2PDRA 1S1ZA 1OTEA 2YKHA 1TS8A 4I39A 1V9YA 3IBRA 2H28A 1OTAA 4PKYG 2OWJA 3LICA 5DKLA 2QJ5A 1S66L 1LSVA 2B02A 3LIAA 3LIFA 4HNBA 1JNUA 3D72A 3H9WA 2QKPA 3G6OA 2PD8A 1MZUA 4B9OA 2JHEA 3MR0A 3UMEA 3K3DA 1XJ4A 1GSWA 2D02A 1LSWA 1OT9A 4GW9A 3A0SA 3ICYA 2PR5A 4HJ4A 3B33A 4HJ3A 3NJAA 4BBTA 5G4YA 1UWNX 3ULFA 1XJ6A 4F3LB 4HP9A 5IS1A 4EW7A 3UB7A 4NXBA 3CLOA 4R70A 1XFNA 2OOLA 2PD7A 2ZOHA 4R3AA 3MJQA 2ZBBA 2L4RA 3H7WB 5HD3A 5KIZA 5HSQA 2V9AA 4MN6A 3VOLA 5I5LA 3F1PA 3BWLA 4I38A 4NXGA 2PYRA 3GDIA 3H82A 1DP6A 3F1PB 1P97A 2D01A 3E4PA 5EFWA 2GJ3A 5HWTA 1S67L 5IU1A 3MXQA 3H82B
chains in the Genus database with same CATH superfamily
1EROA 1FR1A 3MZDA 5J4EA 4M3KA 5U47A 3PBRA 3HLFA 4KUOA 5A91A 1VHMA 4ZBEA 3IQAA 3T4LA 4PM7A 3UE3A 3LR5A 2WKQA 4P0MA 1DJCA 1JTGA 4HJ6A 1T19A 4FSFA 3F1NB 3LIEA 1FR6A 1PYYA 5HWVA 5DJUA 3HVFA 4QY5A 4EEUA 1K57C 1E3UA 4EBPA 1TDLA 4HIAA 1BZAA 4MN7A 1OJ5A 1L0GA 4I5SA 1DRMA 4N9KA 3RXWA 1VQQA 4LPZA 3PR6A 4KG2A 5HD5A 3P09A 4WELA 4E3KA 4FUWA 2JKRM 2YKFA 2WGWA 4Q0HA 3C38A 4DJ3A 4CLCD 3SH7A 1MBLA 2O9BA 2NUPC 2V1BA 4L0LA 3VP2A 3OCNA 5F1GA 1GSVA 3LEQA 3IXHA 3NULA 3BM6A 5FQKA 3ZG9B 1YMSA 3ZG8B 1XX2A 1D7EA 2ZQ9A 1T18A 3N8SA 2Y2JA 2QZ6A 1FCOA 2W3DA 4DE2A 3EQVA 1Q2PA 1WE4A 1LHYA 5A8BA 3JVUA 3UDIA 2ZOIA 4X53A 3MBZA 3P98A 3W4PA 2Q0OA 4R1GA 2JKTM 1Y28A 5J8XA 2G2WA 4OP5A 3C4OA 2W27A 4JKTA 5JYOA 3T1SA 4MMNA 2FH5A 4H6JA 3NDGA 3KO6A 4R0QA 1GA0A 1LL8A 4OQHA 2X02A 2X01A 3IWIA 1ESUA 3IS2B 4XXRA 1GHPA 4JF5A 4HH2A 4GHIB 4GDBA 1DY6A 4EBNA 3C7UA 4KZ6A 4FH2A 2P04A 1K4FA 1ONHA 4LGWA 2HP5A 3LCEA 5G18A 2ACGA 5TBMB 4E3LA 5HAPA 4NKPA 3OPPA 5EECA 5DFXA 3N4IA 2WAEA 4NETA 2Y91A 4EETB 3WRTA 1LL5A 4LRZE 2LB5A 4MBHA 5EOOA 3BLSA 3IF6A 5FSRA 3TG9A 4RX2A 4PM8A 1IFQA 4P6ZM 1MWTA 4X6TA 5HARA 1T1BA 1SKOA 5L09A 3WS5A 2V1AA 5AVEA 4YWZA 2EWWA 1KGFA 2WK0A 2PRFA 4I3JA 4ETXA 4QU3A 5CHMA 5L2FA 1SCWA 4BJPA 4PKYA 5IHVA 4X55A 2DMWA 3RTYA 4E6XA 4QD4A 1N9NA 1HLUP 4QB8A 3KSHA 1RP5A 1PWDA 3F1OA 3GV9A 4X25A 3EWKA 1Y4OA 4G3VA 2LB9A 1P0ZA 1K4EA 2H5SA 4XUZA 3HLEA 1CF0A 4LCMA 1U60A 2AVXA 1ZG6A 1PZPA 5GL9A 4IBRA 4WZ5C 3UPOA 1CQAA 3O3VA 5DJTA 4E3OA 4Z9QA 4EWFA 4Y0UA 3W8KA 4DDSA 2A24A 3D3OA 3OZHA 1L0DA 1VM1A 1PW1A 2HDQA 3HLWA 5TGFA 3HUNA 1F98A 1ODVA 5EVIC 2QHKA 1IKIA 4KQDA 1O7EA 4KZAA 2W3EA 3G31A 2C5WB 2WKEA 3CMZA 4HBTA 3TW8A 1M40A 2PHYA 5HZHA 5CHUA 1AWIA 2V8CA 1TS8A 4I39A 3BQ8A 2H28A 3QP6A 3ZGAB 4PKYG 4OKPA 1FIKA 4OH0A 4WMCA 3B47A 5M1AA 4QY6A 4S2PA 3S7PA 4OPZA 3LIFA 1WYBA 3V50A 2ZC3B 3IXDA 2RCXA 4R23A 1YLZA 1PIOA 2OLVA 1G68A 4GLQA 5K5BA 4OQGA 3NI9A 2Y2LA 1VETA 4LENA 4R4SA 5DVAA 4GW9A 4EUVA 3T4QA 1WYCA 3SH9A 1H8YA 2GDNA 3ICYA 2A49A 3MSHA 4HJ4A 4HJ3A 4CLCB 1ZTUA 3PXPA 3E2KA 4G3WA 4E3MA 5CRFA 5IT5A 3M2JA 2Y2KA 2J3WA 3FZCA 1G5UA 2ZQAA 4FTXA 2WKIA 3CI6A 4JBFA 1XFNA 2PBDP 2ZOHA 3ITBA 2B5RA 3KSIA 1L3LA 1W63M 3OPLA 1SZVA 3ZNTA 4CJNA 5KIZA 2Q9NA 4Y2FA 3AGEA 3ITAA 4MN6A 3VOLA 5I5LA 4C3QA 2PYRA 3GDIA 3MKEA 3C5AA 4Y0OA 3OBFA 1N9BA 4QJGA 3KYQA 2O0YA 1P97A 5A92A 4DXCA 3R7WB 1BT5A 2V2FF 2JKRI 3DBAA 2GJ3A 5TFQA 5HWTA 4MLLA 5IU1A 4ME4A 4OPYA 1VEUA 5GHZA 1BLPA 1SHVA 2WZXA 1OMEA 2R9WA 1BTLA 3DTKA 4JXGA 5FQJA 5FQMA 5FDHA 5JYPA 3HBRA 4Y3IA 3DTIA 1CK3A 1MY8A 3V39A 2OAP1 1IYSA 1IYQA 3NHQA 3VOYA 1GA9A 1MKIA 5CEBA 4HQAA 5M18A 2JKTI 3WS2A 1XJ2A 3UB9A 1BLSA 1IYOA 4LV1A 4ZDXA 4CLCC 1MPLA 3PBNA 5FQIA 3D4FA 3BFGA 5DTTA 2HJEA 2FFYA 4O8GA 2ZM0A 1N9LA 2ZJ9A 1K6RA 4F3LA 1H8ZA 3CG5A 5L10A 3Q1FA 3SS4A 4EBLA 2J80A 3P7NA 1OJGA 2A3UA 4E3IA 2R9XA 4I3AA 1G28A 1YKDA 1LSXA 3Q82A 4S2LA 4K08A 4S2KA 3Q81A 4BMWA 4GN2A 3E4QA 4IJGA 4N9LA 3LY4A 3UDFA 1CI8A 4LCLA 4KENB 2EXAA 2MJ6A 1ES2A 4OPRA 4EU0A 3VE3A 4EESA 4MN5A 2EX9A 1IKGA 2XEPA 2XK1A 5DTSA 2VV6A 3UO9A 1M6KA 2BG1A 1K25A 2JN7A 3LIBA 1S0WA 4Y17A 4DE3A 1YLTA 3IS2A 4WZ5A 3L9KA 1KE0A 2HZ5A 3HLCA 4IUHA 2PBYA 4JF6A 4FD8A 1YAXA 4QPRA 1E25A 3V67A 5CX7A 1XA1A 3A0RA 5F6AA 3VE4A 2H0YA 2P74A 1ZKJA 5EVLA 4X68A 5CHJA 1IOUA 3MQQA 2Y55A 3K3CA 1ACFA 5EVIA 2JE5A 2R78A 4JPMA 2XD1A 3BW6A 4OPQA 3C2WA 1W63Q 3DTMA 3C4PA 4M4XA 5AQ9A 1TS7A 2Y8HA 4UEYA 3IX4A 1LI0A 1S6RA 3G30A 1KGGA 3WRZA 5D3OA 2ZLYA 5FAPA 1N4OA 3LY3A 4OOYA 1KOUA 1DJAA 4DMZA 5F83A 4DN0A 4HOIA 3NDEA 3IHAA 3FC7A 4S2OA 1AXBA 2VLGA 4KUKA 1FSWA 3C7VA 2HV1A 3TSGA 4GNUA 5F69A 4R4RA 5CXWA 5FQQA 2PR6A 2ZMAA 1NYMA 3MQOA 3R4KA 4CLCE 1GHMA 2HP6A 1JWPA 1NRFA 4IVKA 1UWPX 2V0WA 1OTDA 2XF3A 1HTZA 3O87A 1Z6FA 4KG6A 5I94A 2E8IA 4BL3A 2EFXA 2Y79A 2DCFA 5J3WA 1JTDA 3A3FA 3LI9A 3T4JA 1NXYA 1NY0A 4R38A 3ZFZA 4BQMA 3EOIA 3AGFA 2W0NA 3Q7VB 3T12B 3UN7A 1H3QA 3A0VA 5EV0A 1PNEA 4KZ4A 3PTEA 5LBRA 4RQ9A 4JGQA 1XA7A 1W79A 2QWSA 4UA6A 1G6AA 3MFDA 4WL9A 1TDGA 4B93A 5F1FA 1D06A 2Q9MA 3M6HA 3T1QB 5FL3A 2XFTA 2Z6DA 4Y7PA 3KSGA 2EWVA 2G2UA 3LIDA 3NOTC 1T1AA 2ZM2A 4P6BA 2VKSA 3CPTB 4II7A 2UWXA 3HLDA 3KYEA 3NBLA 3FV7A 2W1TB 1J9MA 1ESIA 1BLCA 3IBRA 3GSGA 1NLYA 2B18A 2OWJA 2O9AA 2QJ5A 3QP1A 3NIAA 3RFBA 3VP1A 3D72A 3S22A 2QKPA 3BYDA 1EWZA 3KYZA 1JWZA 4G3KA 1RCJA 3UPPA 4Y13A 3LR3A 1F5MA 3G2YA 4ID4A 1PZOA 3LEZA 3C30A 5CTMA 4EQIA 4WM9A 4MCWA 3QP5A 1ERMA 4KQQA 5E2FA 1ES4A 4CLCA 1JVJA 4R3BA 2Y2PA 2WUQA 4AFIA 1LSWA 1OT9A 5F82A 3L7HA 5MC7A 3A0SA 4H8RA 4RYEA 3MZFA 1MWSA 3SS5A 1NJ4A 4KZBA 3NJAA 5G4YA 1O07A 5AQAA 3V3SA 4QWOA 4BD1A 4LV2A 1UWNX 2PAVP 4OOMA 1PWGA 4KZ5A 4HP9A 3PAEA 5IS1A 1NLZA 4IVIA 4PM9A 4ZJ1A 1K54A 4U0XA 5GHXA 2GNXA 1HVBA 3B3XA 4PPRA 4B4ZA 2VA0A 2XR0A 1TVFA 2X71A 2V20A 4DXBA 3R7WA 4I38A 4GD8A 3M2KA 3MZEA 4OP8A 4KQOA 2EX8A 1HD8A 3RJUA 2ZD8A 2OSUA 2Y4AA 3F1PB 3UPNA 1L0EA 3PBTA 2HJ9C 3UDXA 3QNCA 5GLAA 3H82B 4MNRA 3VSLA 4XUXA 5AVFA 4JXWA 3LUQA 2JCHA 3GQZA 4E6WA 3NCKA 4LRXC 3VV4A 2WZZA 1F2KA 3IBJA 4WBGA 5HAIA 5HDDA 4ZAMA 3CHWP 3IT9A 3BY9A 1QMEA 1I5QA 3S1YA 2K7SA 4HI4A 2WAFA 1CEGA 2XA7S 5HPIA 2XFSA 4XT2B 2QPNA 2Z2LB 3ZG5A 3MQ0A 3B42A 2ZQ8A 1S1YA 4Y15A 1YLWA 3E0YA 1NYYA 3LR0A 3QNBA 5FI6A 1E4DA 3OLOA 1ZHHB 3QHYA 3ZCZA 5F68A 3C8CA 3IF6B 2OAQ1 2EA9A 3PYPA 1ES5A 4BBUA 3GMWA 3UE6A 3GECA 3S7NA 1F9IA 3OPHA 5FDSA 5FI7A 3T50A 4L9GA 3CITA 5HW3A 2RL3A 2WKPA 1SKOB 3FWLA 2VGJA 1BYWA 4R6LA 1XKZA 3HUMA 1L2SA 2QYBA 2WKHA 2E8JA 4HH3A 3H7WA 3SOIA 2XROA 2FZ0A 4ETZA 4MBFA 3BFCA 3QP8A 1ZG4A 1GCEA 4PHTA 2XD5A 3MFXA 3ZYTA 2WYXA 1YSPA 3HL9A 5EM1A 2HDSA 5HAQA 5F5YA 4HY8A 3ZVWA 3IX8A 5FAOA 4LV3A 1XFQA 2O99A 5E2HA 3F1OB 3FG8A 1NWZA 2I9VA 3ZHHA 1V9ZA 1P9WA 1XGJA 2P9VB 3TRCA 1LLBA 4HESA 5E2GA 4BL2A 4IUKA 4PM6A 4ARZB 4I3IA 3E2LA 4B4XA 2IWCA 2O9CA 1XGIA 1YLJA 3CWFA 2M1CA 1BUEA 4JGPA 3CAXA 2A24B 4BBVA 2WADA 3QP2A 3ZNYA 3BRMA 2J3TD 5FAQA 1KVMA 3PBQA 5KMWA 2VX8A 3F1NA 4KZ9A 2K2NA 1XP4A 4GS9B 3U4LP 2VV8A 3TE8A 5EM0A 3OC2A 3Q07A 4Q0JA 1S4SA 2KX6A 3M6BA 3RXXA 3NC8A 3WWXA 4KQRA 4Y5FA 3CZDA 3HUOA 4HP4A 1CEFA 2ZQDA 5HX9A 2ZC6B 1C3BA 3HJIA 2P08A 5M19A 5HDSA 2J9PA 1I2WA 4FH4A 4OLDA 2JBFA 1W5DA 5DF8A 5FATA 1LI9A 2HPBA 1KE4A 1YLYA 2V8FA 3PHYA 1QMFA 3V5MA 1YM1A 4R3JA 1E3UD 4EEPA 2INWA 1X0OA 5DFYA 3UB6A 1OPXA 2ZQCA 2JC7A 4CPKA 4E04A 1PI5A 4DF6A 1YT4A 2L0WA 3FPWA 3FYZA 2VJWA 1K56D 3S7OA 2M7UA 1MKMA 5DF9A 4NK3A 1N9OA 4OLGA 1K54C 3JYIA 3NOPC 2OWHA 3SZTA 5HDCA 1EW0A 4WYYA 3Q7VA 4UA7A 3DW0A 2XQZA 2BLSA 4PM5A 1OT6A 1H8MA 3IWQA 1PRQA 2VV7A 4N1XA 3P01A 4S2IA 4N1HA 4WLAA 3VP4A 2PU4A 1DP8A 4BLMA 3T1XA 1T1CA 3KX0X 3VSKA 1LT0A 3S4XA 2K31A 3HREA 5KSHA 4GHIA 1WA9A 3T1RA 1MWUA 3G2ZA 2KDKA 2ZMFA 1UGUA 3PBOA 4X56A 2DRWA 2Y2MA 1YPRA 2I72A 3QP4A 3S7QA 3HJKA 4ZTKA 1FQGA 2DNSA 3OPRA 4WUJA 2CC1A 5TBMA 3CPTA 2CMNA 4WN5A 3G35A 2J9OA 4S2NA 4S2JA 1JWVA 2W1TA 3OCLA 2V0UA 4P6ZS 1KVLA 2VEAA 3DAVA 2Y59A 4GD6A 4NXFA 3IHBA 2PDRA 1S1ZA 4UQIS 1OTEA 4NEED 3TJZC 3GTCA 5CGSA 2YKHA 1NZOA 1Z09A 4Q8IA 3LICA 5DKLA 4ZJ3A 4OONA 4BENA 2Y2IA 1VEUB 4YNRA 2B02A 3LIAA 2H0TA 4HNBA 1JNUA 1K55C 1K0KA 3H9WA 3G6OA 5C5KA 1I2SA 3GRJA 4CQHA 5DF7A 2ZL1B 5L8MA 1MZUA 3NECA 3LO7A 2JHEA 3U2AA 3K3DA 1GSWA 1YQSA 1XXMA 5EE8A 3EGDC 4WZ4A 3EGXC 2ZC4B 4S2MA 5E2EA 1K56A 2Y2OA 4PMAA 2NUTC 2PR5A 2VK3A 3B33A 2Y2GA 3EEAA 1W8YA 4BBTA 4ZRRA 4KZ3A 4BD0A 5L07A 3IF5A 1XJ6A 4F3LB 3SH8A 5AQBA 2XH9A 4EW7A 1IYPA 3UB7A 4NXBA 3CLOA 3LGOA 4R70A 1BSGA 4MBKA 1ONGA 2OOLA 2PD7A 3MJQA 3VFHA 1IELA 4Z1WA 2ZBBA 4FOFA 3WS1A 5HD3A 3BFFA 2V9AA 5FASA 4GDNA 1STZA 2WGIA 4OVDA 2W3GA 3G4PA 1K38A 3F1PA 3MS6A 4P87A 4HBUA 1RGYA 3DWZA 3K2NA 4E3JA 4X1LA 4NXGA 3SS3A 4YOFA 3D9YA 3FKVA 2QMIA 3LFVA 3H82A 1DP6A 4UA9A 2HDUA 5A93A 1P9RA 2BTFP 5FI2A 1IEMA 3MXQA 5AQ7A 3WS4A 5EPHA 2Z2MB 1FCMA 1D1JA 5CGWA 4GZBA 1YLPA 1A0KA 2W3HA 3G32A 2V1ZA 2WGVA 4D60A 3NOUC 4XT2A 3UNWA 5EUAA 3MMHA 4DE1A 4P85A 3LYXA 5EVIB 2VGLS 3VOZA 2HDRA 4WMCD 2Z6CA 3UB8A 3E98A 5HWWA 4K0XA 3LI8A 1PI4A 3ZG7B 5TR7A 4Q0IA 2GX5A 4C6YA 1PWCA 4YINA 3HLGA 2EXBA 3A3JA 2KLIA 5TJJA 2L1MA 3V3RA 4UQIM 4KZ7A 5FEGA 3IWOA 2VZWA 2J7VA 3IXBA 1NRJA 2Y2HA 3CUEA 3ZDJA 4B88A 1ERQA 4GOGA 3N6IA 1TS6A 1Q2QA 5G4ZA 4O01A 4FCFA 4HHDA 4L9EA 1SDNA 2A2LA 2WGWB 2PYPA 4LFUA 3CJMA 4NXEA 3BFEA 2IWDA 3OOVA 5GLBA 1H5XA 5CERA 2PT7A 1TEMA 3DWKA 2P9VA 2QJ7A 5HL6A 2JKFA 5DTKA 4KG5A 3UE0A 1HZOA 5A90A 3ZQ5A 1TF1A 4RVAA 4ARZA 3EEHA 3KSFA 5FEFA 5BOHA 1BLHA 4ESPA 1GHIA 4S2NC 5EVEA 2J3TC 4LLOB 4U0TA 2Y2NA 3W4OA 3UY6A 1FOFA 1FCNA 1K6SA 3AGDA 3MXSA 1KE3A 4H6JB 4GS9A 5FQ9A 2BASA 3IH9A 3BJNA 2PU2A 2UV0E 1TD5A 3IH8A 3ZVTA 1L0FA 4O7DA 5EOEA 3N7WA 4QHCA 1GSXA 2ZM8A 4LV0A 1CI9A 4IEDA 3PAGA 1XPBA 2B95A 1XJ3A 5CECA 4E3NA 5DKKA 2ZMVA 3MXRA 4DJ2A 2P7JA 1MXOA 3RH8B 3LR4A 4MDZA 4U3TA 2WKRA 5FA7A 1J3WA 1OTBA 4DRTA 4GCZA 3SW1A 4EQ1A 1H0MA 4L9FA 4JLFA 3PBSA 1K55A 4NG2A 5KZHA 3MKFA 4EERA 2C6WB 4LRYC 4HEFA 2ZC5B 1K57A 4UHUA 1TS0A 3N8RA 3MF0A 3T4SA 4O0PA 5E43A 4JGRA 1W7FA 2OLUA 2VGLM 3Q7ZA 1S4RA 2OV5A 4A5RA 2KOIA 1DJBA 2IA2A 4IBXA 3G34A 1KDWA 3WS0A 2M7VA 3HLBA 5GHYA 3W4QA 2HGVA 1ZC2A 3UMDA 3I7JA 4K0WA 5HFOA 4D2OA 5J7EA 1VB6A 3ZG0A 4YFMA 4RX3A 4KZ8A 4EXOA 1OTIA 3BY8A 3UB5P 3A3EA 1DP9A 1PFLA 2XGNA 3FPVA 2IWBA 2GZAA 3BECA 3JPUA 4DE0A 3NY4A 4ZJ2A 3IXGA 4DDYA 5KSCA 3TOIA 3IX3A 4JGOA 4WEJA 2HP9A 2JKGA 4X1MA 4EV4A 3E4OA 3O88A 2EX6A 4WF0A 4X69A 3VP0A 5CEDA 1EI5A 3T4TA 3FKWA 2VGKA 1NZUA 4EUZA 5EVID 1V9YA 1PW8A 1OTAA 3IF6C 3EQUA 1W8QA 4IHQA 2ZL1A 1S66L 1LSVA 2HF6A 4RA7A 2W3FA 4GJ4A 1ALQA 2PD8A 4DKIA 4WEKA 3CUEC 1LL9A 1FILA 1SDEA 3ISGA 3GVBA 2ZQ7A 3BQAA 4B9OA 3VMAA 5GLDA 1FSYA 3MR0A 3UMEA 3UE1A 1XJ4A 4N92A 1RGZA 5HPFA 2D02A 3W2ZA 4OOLA 2XA7M 3O86A 2W1RA 3DTEA 4PAUA 3N8LA 2XDMA 1MWRA 4UAAA 3BEBA 2EX2A 1VETB 2XRNA 3A3IA 5CGXA 4Y0TA 2EFUA 1SKFA 4OQ0A 5CTNA 1Y54A 3ULFA 3O5YA 2H10A 1MC0A 1KGEA 4JF4A 2G7UA 3T4OA 4OQIA 5AJGA 1KDSA 4R3AA 4F94A 1CJFA 2Y2QA 3GR2A 5HL1A 4C75A 2L4RA 3H7WB 5HSQA 4GB7A 3VP3A 4BWIA 2FFFB 3VFFA 2ZC7A 3BLMA 3A3DA 3BWLA 4JXVA 2XLNA 1YSQA 4JXSA 3HCYA 1BULA 4K91A 2D01A 3E4PA 3BFDA 5EFWA 1G6OA 3T4KA 4GKUA 5GLCA 2XSSA 1S67L 4MEZA 3JVVA 1ES3A 2J8YA 1YMXA
chains in the Genus database with same CATH topology
5AVFA 5J4EA 3LUQA 3PBRA 2W3HA 4KUOA 4LRXC 3VV4A 1VHMA 3NOUC 4XT2A 3IBJA 3T4LA 5HDDA 3UE3A 3LR5A 3BY9A 3MMHA 2WKQA 4HJ6A 1T19A 3LYXA 4FSFA 3F1NB 2K7SA 4HI4A 4Y3IA 3LIEA 2VGLS 5HWVA 2XA7S 5HPIA 5DJUA 4XT2B 2Z6CA 2OAP1 3UB8A 4EEUA 3E98A 5HWWA 3LI8A 3NHQA 4HQAA 2JKTI 3MQ0A 3B42A 4Q0IA 2GX5A 4HIAA 1XJ2A 3UB9A 4MN7A 1S1YA 1OJ5A 4CLCC 3PBNA 3E0YA 4I5SA 3LR0A 1DRMA 2KLIA 3OLOA 1ZHHB 5F68A 3C8CA 2L1MA 4LPZA 3PR6A 5TJJA 4UQIM 2OAQ1 2EA9A 3PYPA 2VZWA 2HJEA 5HD5A 4BBUA 3UE6A 3GECA 4WELA 3S7NA 4O8GA 1F9IA 1N9LA 2JKRM 1NRJA 2YKFA 3T50A 3CUEA 4Q0HA 4F3LA 4L9GA 3C38A 3CITA 2J80A 3P7NA 1OJGA 1TS6A 2WKPA 4DJ3A 4CLCD 5G4ZA 4O01A 1BYWA 4I3AA 4HHDA 4R6LA 4L9EA 1G28A 2O9BA 2A2LA 2QYBA 1YKDA 2NUPC 1LSXA 2V1BA 4L0LA 2PYPA 4HH3A 3H7WA 3OCNA 4K08A 1GSVA 4BMWA 2XROA 2FZ0A 3E4QA 4IJGA 4ETZA 4NXEA 3OOVA 1D7EA 1T18A 4PHTA 3MFXA 3ZYTA 2W3DA 1YSPA 3EQVA 2PT7A 5F5YA 2MJ6A 4HY8A 5A8BA 3JVUA 4EU0A 3VE3A 2ZOIA 2QJ7A 1XFQA 4EESA 2O99A 5HL6A 3F1OB 3FG8A 4MN5A 2JKTM 1NWZA 1Y28A 2I9VA 2VV6A 3ZQ5A 1TF1A 4ARZA 3EEHA 3KSFA 1V9ZA 1P9WA 2JN7A 3LIBA 2W27A 4MMNA 2FH5A 2J3TC 4H6JA 3TRCA 3IS2A 3KO6A 1LL8A 4LLOB 4IUKA 4IUHA 4ARZB 1YAXA 4I3IA 4QPRA 3V67A 2O9CA 5CX7A 3A0RA 4H6JB 5F6AA 3IS2B 4GS9A 3CWFA 3VE4A 2M1CA 4JGPA 3CAXA 2A24B 4HH2A 4GHIB 2BASA 4BBVA 3BJNA 1IOUA 2J3TD 2P04A 1TD5A 3MQQA 3K3CA 3PBQA 2VX8A 3F1NA 2K2NA 4GS9B 2R78A 2VV8A 3TE8A 3BW6A 3OC2A 1GSXA 3C2WA 1W63Q 5TBMB 4M4XA 1TS7A 4Q0JA 2Y8HA 4UEYA 1S4SA 2KX6A 4NKPA 5DFXA 1XJ3A 4Y5FA 4HP4A 5DKKA 2ZMVA 4DJ2A 2P7JA 4EETB 4LRZE 2LB5A 3HJIA 2P08A 3RH8B 3LR4A 4MDZA 5HDSA 1KOUA 2WKRA 4DMZA 4DN0A 4HOIA 1IFQA 1OTBA 4P6ZM 3FC7A 4GCZA 3PHYA 3SW1A 4EQ1A 1T1BA 4L9FA 3PBSA 2VLGA 4KUKA 4EEPA 2INWA 2HV1A 1X0OA 2V1AA 5DFYA 5AVEA 4EERA 3UB6A 1OPXA 4YWZA 2EWWA 4LRYC 4E04A 5F69A 1TS0A 2PR6A 3MF0A 4I3JA 3T4SA 4O0PA 4ETXA 4JGRA 2L0WA 3FPWA 3MQOA 2VJWA 3R4KA 4BJPA 4CLCE 4PKYA 3S7OA 2M7UA 2VGLM 1MKMA 5DF9A 1S4RA 2DMWA 3RTYA 1N9OA 1UWPX 2V0WA 1N9NA 1OTDA 3NOPC 2KOIA 2OWHA 3KSHA 2IA2A 3F1OA 5HDCA 3EWKA 1EW0A 2Y79A 5J3WA 2M7VA 3LI9A 4G3VA 3T4JA 2LB9A 1OT6A 4R38A 2HGVA 1P0ZA 1H8MA 3EOIA 3UMDA 2VV7A 3P01A 2W0NA 5J7EA 1VB6A 4WLAA 1H3QA 1DP8A 3A0VA 1T1CA 3KX0X 1LT0A 5DJTA 2K31A 5LBRA 4EXOA 1OTIA 4RQ9A 3BY8A 4JGQA 2A24A 5KSHA 1DP9A 4GHIA 1WA9A 2KDKA 2ZMFA 3FPVA 2GZAA 1UGUA 2QWSA 3D3OA 3PBOA 4WL9A 3S7QA 3HJKA 4B93A 1D06A 4WUJA 1F98A 5TBMA 1ODVA 5FL3A 4JGOA 2Z6DA 4WEJA 2CMNA 4WN5A 2QHKA 3KSGA 4KQDA 2EWVA 3LIDA 3NOTC 1T1AA 2W3EA 3E4OA 2W1TA 3OCLA 2VKSA 2V0UA 4P6ZS 4WF0A 2VEAA 3TW8A 4NXFA 2PHYA 5HZHA 4II7A 2PDRA 1S1ZA 4UQIS 3T4TA 1OTEA 4NEED 3TJZC 2YKHA 2W1TB 1TS8A 4I39A 1V9YA 3BQ8A 3IBRA 2H28A 1OTAA 4PKYG 1NLYA 2B18A 2OWJA 3EQUA 2O9AA 3LICA 5DKLA 3B47A 4IHQA 2QJ5A 3S7PA 1S66L 4YNRA 1LSVA 2B02A 3RFBA 3LIAA 3LIFA 4HNBA 1JNUA 3D72A 2HF6A 3H9WA 2QKPA 3G6OA 5C5KA 2W3FA 4GJ4A 2PD8A 4CQHA 4WEKA 3KYZA 3CUEC 5L8MA 4G3KA 1MZUA 3BQAA 4B9OA 3LR3A 1F5MA 4GLQA 2JHEA 3MR0A 3UMEA 3U2AA 3C30A 5K5BA 3K3DA 1XJ4A 1GSWA 4MCWA 3EGDC 4CLCA 3EGXC 5HPFA 2D02A 3W2ZA 4OOLA 2XA7M 2W1RA 4AFIA 1LSWA 1OT9A 4PAUA 4GW9A 4EUVA 3T4QA 5MC7A 3A0SA 2NUTC 3ICYA 2PR5A 4HJ4A 3B33A 3EEAA 4HJ3A 4CLCB 2XRNA 3NJAA 4BBTA 1ZTUA 3PXPA 4G3WA 5G4YA 4ZRRA 5IT5A 1UWNX 4OOMA 3ULFA 1XJ6A 4F3LB 4HP9A 3O5YA 5IS1A 2J3WA 1NLZA 4EW7A 1MC0A 3UB7A 4NXBA 3CI6A 3CLOA 4R70A 2G7UA 1XFNA 3T4OA 2OOLA 2PD7A 2ZOHA 5AJGA 4R3AA 3MJQA 3KSIA 4Z1WA 2ZBBA 1W63M 2GNXA 4FOFA 2L4RA 3H7WB 5HD3A 5KIZA 5HSQA 2V9AA 4BWIA 1STZA 2VA0A 4Y2FA 2W3GA 4MN6A 3VOLA 5I5LA 3F1PA 3BWLA 3K2NA 3R7WA 4I38A 4NXGA 2PYRA 3GDIA 4KQOA 4YOFA 1YSQA 3HCYA 3OBFA 3LFVA 3H82A 1DP6A 3F1PB 3KYQA 2O0YA 1P97A 2D01A 3E4PA 3R7WB 3PBTA 2HJ9C 5EFWA 1G6OA 3T4KA 2JKRI 1P9RA 3DBAA 2GJ3A 2XSSA 5HWTA 1S67L 3JVVA 3MXQA 5IU1A 3H82B 4ME4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AVF A;  5J4E A;  3LUQ A;  4KUO A;  4LRX C;  3NOU C;  4XT2 A;  5HDD A;  3BY9 A;  2WKQ A;  4HJ6 A;  1T19 A;  3LYX A;  3F1N B;  2K7S A;  4HI4 A;  3LIE A;  5HWV A;  5DJU A;  4XT2 B;  2Z6C A;  3UB8 A;  4EEU A;  5HWW A;  3LI8 A;  3NHQ A;  4HQA A;  4HIA A;  1XJ2 A;  3UB9 A;  1S1Y A;  1OJ5 A;  4I5S A;  1DRM A;  3OLO A;  5F68 A;  3C8C A;  2L1M A;  4LPZ A;  2EA9 A;  3PYP A;  5HD5 A;  4BBU A;  3UE6 A;  3GEC A;  1F9I A;  1N9L A;  2YKF A;  3T50 A;  4F3L A;  4L9G A;  2J80 A;  3P7N A;  1OJG A;  1TS6 A;  2WKP A;  4DJ3 A;  5G4Z A;  1BYW A;  4I3A A;  4HHD A;  4R6L A;  4L9E A;  1G28 A;  1LSX A;  2V1B A;  2PYP A;  4HH3 A;  3H7W A;  4K08 A;  1GSV A;  3E4Q A;  4NXE A;  1D7E A;  1T18 A;  3MFX A;  5F5Y A;  4HY8 A;  5A8B A;  3VE3 A;  2ZOI A;  2QJ7 A;  1XFQ A;  4EES A;  3F1O B;  3FG8 A;  4MN5 A;  1NWZ A;  1Y28 A;  2I9V A;  2VV6 A;  3ZQ5 A;  3EEH A;  1V9Z A;  2JN7 A;  3LIB A;  2W27 A;  4H6J A;  3IS2 A;  1LL8 A;  4LLO B;  4I3I A;  3A0R A;  4H6J B;  5F6A A;  3IS2 B;  4GS9 A;  3CWF A;  3VE4 A;  2M1C A;  4JGP A;  3CAX A;  2A24 B;  4HH2 A;  4GHI B;  2BAS A;  4BBV A;  3MQQ A;  3K3C A;  3F1N A;  4GS9 B;  2R78 A;  2VV8 A;  1GSX A;  3C2W A;  5TBM B;  4M4X A;  1TS7 A;  1S4S A;  2KX6 A;  1XJ3 A;  4HP4 A;  5DKK A;  4DJ2 A;  2P7J A;  4EET B;  4LRZ E;  3HJI A;  3RH8 B;  5HDS A;  1KOU A;  2WKR A;  4HOI A;  1OTB A;  3FC7 A;  4GCZ A;  3PHY A;  3SW1 A;  4EQ1 A;  1T1B A;  4L9F A;  2VLG A;  4KUK A;  4EEP A;  2INW A;  2HV1 A;  1X0O A;  2V1A A;  5AVE A;  4EER A;  3UB6 A;  4YWZ A;  4LRY C;  4E04 A;  5F69 A;  1TS0 A;  2PR6 A;  4I3J A;  4JGR A;  2L0W A;  3MQO A;  4PKY A;  1S4R A;  3RTY A;  1N9O A;  1UWP X;  2V0W A;  1N9N A;  1OTD A;  3NOP C;  2OWH A;  3F1O A;  5HDC A;  3EWK A;  1EW0 A;  5J3W A;  3LI9 A;  1OT6 A;  4R38 A;  1P0Z A;  3UMD A;  2VV7 A;  2W0N A;  5J7E A;  1VB6 A;  4WLA A;  1DP8 A;  3A0V A;  1T1C A;  3KX0 X;  1LT0 A;  5DJT A;  4EXO A;  1OTI A;  4RQ9 A;  3BY8 A;  4JGQ A;  2A24 A;  1DP9 A;  4GHI A;  1WA9 A;  2KDK A;  2QWS A;  1UGU A;  4WL9 A;  3HJK A;  1D06 A;  4WUJ A;  1F98 A;  5TBM A;  1ODV A;  4JGO A;  2Z6D A;  2CMN A;  4WN5 A;  2QHK A;  4KQD A;  3LID A;  3NOT C;  1T1A A;  3E4O A;  2V0U A;  4WF0 A;  2VEA A;  4NXF A;  2PHY A;  5HZH A;  2PDR A;  1S1Z A;  1OTE A;  2YKH A;  1TS8 A;  4I39 A;  1V9Y A;  3IBR A;  2H28 A;  1OTA A;  4PKY G;  2OWJ A;  3LIC A;  5DKL A;  2QJ5 A;  1S66 L;  1LSV A;  2B02 A;  3LIA A;  3LIF A;  4HNB A;  1JNU A;  3D72 A;  3H9W A;  2QKP A;  3G6O A;  2PD8 A;  1MZU A;  4B9O A;  2JHE A;  3MR0 A;  3UME A;  3K3D A;  1XJ4 A;  1GSW A;  2D02 A;  1LSW A;  1OT9 A;  4GW9 A;  3A0S A;  3ICY A;  2PR5 A;  4HJ4 A;  3B33 A;  4HJ3 A;  3NJA A;  4BBT A;  5G4Y A;  1UWN X;  3ULF A;  1XJ6 A;  4F3L B;  4HP9 A;  5IS1 A;  4EW7 A;  3UB7 A;  4NXB A;  3CLO A;  4R70 A;  1XFN A;  2OOL A;  2PD7 A;  2ZOH A;  4R3A A;  3MJQ A;  2ZBB A;  2L4R A;  3H7W B;  5HD3 A;  5KIZ A;  5HSQ A;  2V9A A;  4MN6 A;  3VOL A;  5I5L A;  3F1P A;  3BWL A;  4I38 A;  4NXG A;  2PYR A;  3GDI A;  3H82 A;  1DP6 A;  3F1P B;  1P97 A;  2D01 A;  3E4P A;  5EFW A;  2GJ3 A;  5HWT A;  1S67 L;  5IU1 A;  3MXQ A;  3H82 B; 
#chains in the Genus database with same CATH topology
 1ERO A;  1FR1 A;  3MZD A;  5J4E A;  4M3K A;  5U47 A;  3PBR A;  3HLF A;  4KUO A;  5A91 A;  1VHM A;  4ZBE A;  3IQA A;  3T4L A;  4PM7 A;  3UE3 A;  3LR5 A;  2WKQ A;  4P0M A;  1DJC A;  1JTG A;  4HJ6 A;  1T19 A;  4FSF A;  3F1N B;  3LIE A;  1FR6 A;  1PYY A;  5HWV A;  5DJU A;  3HVF A;  4QY5 A;  4EEU A;  1K57 C;  1E3U A;  4EBP A;  1TDL A;  4HIA A;  1BZA A;  4MN7 A;  1OJ5 A;  1L0G A;  4I5S A;  1DRM A;  4N9K A;  3RXW A;  1VQQ A;  4LPZ A;  3PR6 A;  4KG2 A;  5HD5 A;  3P09 A;  4WEL A;  4E3K A;  4FUW A;  2JKR M;  2YKF A;  2WGW A;  4Q0H A;  3C38 A;  4DJ3 A;  4CLC D;  3SH7 A;  1MBL A;  2O9B A;  2NUP C;  2V1B A;  4L0L A;  3VP2 A;  3OCN A;  5F1G A;  1GSV A;  3LEQ A;  3IXH A;  3NUL A;  3BM6 A;  5FQK A;  3ZG9 B;  1YMS A;  3ZG8 B;  1XX2 A;  1D7E A;  2ZQ9 A;  1T18 A;  3N8S A;  2Y2J A;  2QZ6 A;  1FCO A;  2W3D A;  4DE2 A;  3EQV A;  1Q2P A;  1WE4 A;  1LHY A;  5A8B A;  3JVU A;  3UDI A;  2ZOI A;  4X53 A;  3MBZ A;  3P98 A;  3W4P A;  2Q0O A;  4R1G A;  2JKT M;  1Y28 A;  5J8X A;  2G2W A;  4OP5 A;  3C4O A;  2W27 A;  4JKT A;  5JYO A;  3T1S A;  4MMN A;  2FH5 A;  4H6J A;  3NDG A;  3KO6 A;  4R0Q A;  1GA0 A;  1LL8 A;  4OQH A;  2X02 A;  2X01 A;  3IWI A;  1ESU A;  3IS2 B;  4XXR A;  1GHP A;  4JF5 A;  4HH2 A;  4GHI B;  4GDB A;  1DY6 A;  4EBN A;  3C7U A;  4KZ6 A;  4FH2 A;  2P04 A;  1K4F A;  1ONH A;  4LGW A;  2HP5 A;  3LCE A;  5G18 A;  2ACG A;  5TBM B;  4E3L A;  5HAP A;  4NKP A;  3OPP A;  5EEC A;  5DFX A;  3N4I A;  2WAE A;  4NET A;  2Y91 A;  4EET B;  3WRT A;  1LL5 A;  4LRZ E;  2LB5 A;  4MBH A;  5EOO A;  3BLS A;  3IF6 A;  5FSR A;  3TG9 A;  4RX2 A;  4PM8 A;  1IFQ A;  4P6Z M;  1MWT A;  4X6T A;  5HAR A;  1T1B A;  1SKO A;  5L09 A;  3WS5 A;  2V1A A;  5AVE A;  4YWZ A;  2EWW A;  1KGF A;  2WK0 A;  2PRF A;  4I3J A;  4ETX A;  4QU3 A;  5CHM A;  5L2F A;  1SCW A;  4BJP A;  4PKY A;  5IHV A;  4X55 A;  2DMW A;  3RTY A;  4E6X A;  4QD4 A;  1N9N A;  1HLU P;  4QB8 A;  3KSH A;  1RP5 A;  1PWD A;  3F1O A;  3GV9 A;  4X25 A;  3EWK A;  1Y4O A;  4G3V A;  2LB9 A;  1P0Z A;  1K4E A;  2H5S A;  4XUZ A;  3HLE A;  1CF0 A;  4LCM A;  1U60 A;  2AVX A;  1ZG6 A;  1PZP A;  5GL9 A;  4IBR A;  4WZ5 C;  3UPO A;  1CQA A;  3O3V A;  5DJT A;  4E3O A;  4Z9Q A;  4EWF A;  4Y0U A;  3W8K A;  4DDS A;  2A24 A;  3D3O A;  3OZH A;  1L0D A;  1VM1 A;  1PW1 A;  2HDQ A;  3HLW A;  5TGF A;  3HUN A;  1F98 A;  1ODV A;  5EVI C;  2QHK A;  1IKI A;  4KQD A;  1O7E A;  4KZA A;  2W3E A;  3G31 A;  2C5W B;  2WKE A;  3CMZ A;  4HBT A;  3TW8 A;  1M40 A;  2PHY A;  5HZH A;  5CHU A;  1AWI A;  2V8C A;  1TS8 A;  4I39 A;  3BQ8 A;  2H28 A;  3QP6 A;  3ZGA B;  4PKY G;  4OKP A;  1FIK A;  4OH0 A;  4WMC A;  3B47 A;  5M1A A;  4QY6 A;  4S2P A;  3S7P A;  4OPZ A;  3LIF A;  1WYB A;  3V50 A;  2ZC3 B;  3IXD A;  2RCX A;  4R23 A;  1YLZ A;  1PIO A;  2OLV A;  1G68 A;  4GLQ A;  5K5B A;  4OQG A;  3NI9 A;  2Y2L A;  1VET A;  4LEN A;  4R4S A;  5DVA A;  4GW9 A;  4EUV A;  3T4Q A;  1WYC A;  3SH9 A;  1H8Y A;  2GDN A;  3ICY A;  2A49 A;  3MSH A;  4HJ4 A;  4HJ3 A;  4CLC B;  1ZTU A;  3PXP A;  3E2K A;  4G3W A;  4E3M A;  5CRF A;  5IT5 A;  3M2J A;  2Y2K A;  2J3W A;  3FZC A;  1G5U A;  2ZQA A;  4FTX A;  2WKI A;  3CI6 A;  4JBF A;  1XFN A;  2PBD P;  2ZOH A;  3ITB A;  2B5R A;  3KSI A;  1L3L A;  1W63 M;  3OPL A;  1SZV A;  3ZNT A;  4CJN A;  5KIZ A;  2Q9N A;  4Y2F A;  3AGE A;  3ITA A;  4MN6 A;  3VOL A;  5I5L A;  4C3Q A;  2PYR A;  3GDI A;  3MKE A;  3C5A A;  4Y0O A;  3OBF A;  1N9B A;  4QJG A;  3KYQ A;  2O0Y A;  1P97 A;  5A92 A;  4DXC A;  3R7W B;  1BT5 A;  2V2F F;  2JKR I;  3DBA A;  2GJ3 A;  5TFQ A;  5HWT A;  4MLL A;  5IU1 A;  4ME4 A;  4OPY A;  1VEU A;  5GHZ A;  1BLP A;  1SHV A;  2WZX A;  1OME A;  2R9W A;  1BTL A;  3DTK A;  4JXG A;  5FQJ A;  5FQM A;  5FDH A;  5JYP A;  3HBR A;  4Y3I A;  3DTI A;  1CK3 A;  1MY8 A;  3V39 A;  2OAP 1;  1IYS A;  1IYQ A;  3NHQ A;  3VOY A;  1GA9 A;  1MKI A;  5CEB A;  4HQA A;  5M18 A;  2JKT I;  3WS2 A;  1XJ2 A;  3UB9 A;  1BLS A;  1IYO A;  4LV1 A;  4ZDX A;  4CLC C;  1MPL A;  3PBN A;  5FQI A;  3D4F A;  3BFG A;  5DTT A;  2HJE A;  2FFY A;  4O8G A;  2ZM0 A;  1N9L A;  2ZJ9 A;  1K6R A;  4F3L A;  1H8Z A;  3CG5 A;  5L10 A;  3Q1F A;  3SS4 A;  4EBL A;  2J80 A;  3P7N A;  1OJG A;  2A3U A;  4E3I A;  2R9X A;  4I3A A;  1G28 A;  1YKD A;  1LSX A;  3Q82 A;  4S2L A;  4K08 A;  4S2K A;  3Q81 A;  4BMW A;  4GN2 A;  3E4Q A;  4IJG A;  4N9L A;  3LY4 A;  3UDF A;  1CI8 A;  4LCL A;  4KEN B;  2EXA A;  2MJ6 A;  1ES2 A;  4OPR A;  4EU0 A;  3VE3 A;  4EES A;  4MN5 A;  2EX9 A;  1IKG A;  2XEP A;  2XK1 A;  5DTS A;  2VV6 A;  3UO9 A;  1M6K A;  2BG1 A;  1K25 A;  2JN7 A;  3LIB A;  1S0W A;  4Y17 A;  4DE3 A;  1YLT A;  3IS2 A;  4WZ5 A;  3L9K A;  1KE0 A;  2HZ5 A;  3HLC A;  4IUH A;  2PBY A;  4JF6 A;  4FD8 A;  1YAX A;  4QPR A;  1E25 A;  3V67 A;  5CX7 A;  1XA1 A;  3A0R A;  5F6A A;  3VE4 A;  2H0Y A;  2P74 A;  1ZKJ A;  5EVL A;  4X68 A;  5CHJ A;  1IOU A;  3MQQ A;  2Y55 A;  3K3C A;  1ACF A;  5EVI A;  2JE5 A;  2R78 A;  4JPM A;  2XD1 A;  3BW6 A;  4OPQ A;  3C2W A;  1W63 Q;  3DTM A;  3C4P A;  4M4X A;  5AQ9 A;  1TS7 A;  2Y8H A;  4UEY A;  3IX4 A;  1LI0 A;  1S6R A;  3G30 A;  1KGG A;  3WRZ A;  5D3O A;  2ZLY A;  5FAP A;  1N4O A;  3LY3 A;  4OOY A;  1KOU A;  1DJA A;  4DMZ A;  5F83 A;  4DN0 A;  4HOI A;  3NDE A;  3IHA A;  3FC7 A;  4S2O A;  1AXB A;  2VLG A;  4KUK A;  1FSW A;  3C7V A;  2HV1 A;  3TSG A;  4GNU A;  5F69 A;  4R4R A;  5CXW A;  5FQQ A;  2PR6 A;  2ZMA A;  1NYM A;  3MQO A;  3R4K A;  4CLC E;  1GHM A;  2HP6 A;  1JWP A;  1NRF A;  4IVK A;  1UWP X;  2V0W A;  1OTD A;  2XF3 A;  1HTZ A;  3O87 A;  1Z6F A;  4KG6 A;  5I94 A;  2E8I A;  4BL3 A;  2EFX A;  2Y79 A;  2DCF A;  5J3W A;  1JTD A;  3A3F A;  3LI9 A;  3T4J A;  1NXY A;  1NY0 A;  4R38 A;  3ZFZ A;  4BQM A;  3EOI A;  3AGF A;  2W0N A;  3Q7V B;  3T12 B;  3UN7 A;  1H3Q A;  3A0V A;  5EV0 A;  1PNE A;  4KZ4 A;  3PTE A;  5LBR A;  4RQ9 A;  4JGQ A;  1XA7 A;  1W79 A;  2QWS A;  4UA6 A;  1G6A A;  3MFD A;  4WL9 A;  1TDG A;  4B93 A;  5F1F A;  1D06 A;  2Q9M A;  3M6H A;  3T1Q B;  5FL3 A;  2XFT A;  2Z6D A;  4Y7P A;  3KSG A;  2EWV A;  2G2U A;  3LID A;  3NOT C;  1T1A A;  2ZM2 A;  4P6B A;  2VKS A;  3CPT B;  4II7 A;  2UWX A;  3HLD A;  3KYE A;  3NBL A;  3FV7 A;  2W1T B;  1J9M A;  1ESI A;  1BLC A;  3IBR A;  3GSG A;  1NLY A;  2B18 A;  2OWJ A;  2O9A A;  2QJ5 A;  3QP1 A;  3NIA A;  3RFB A;  3VP1 A;  3D72 A;  3S22 A;  2QKP A;  3BYD A;  1EWZ A;  3KYZ A;  1JWZ A;  4G3K A;  1RCJ A;  3UPP A;  4Y13 A;  3LR3 A;  1F5M A;  3G2Y A;  4ID4 A;  1PZO A;  3LEZ A;  3C30 A;  5CTM A;  4EQI A;  4WM9 A;  4MCW A;  3QP5 A;  1ERM A;  4KQQ A;  5E2F A;  1ES4 A;  4CLC A;  1JVJ A;  4R3B A;  2Y2P A;  2WUQ A;  4AFI A;  1LSW A;  1OT9 A;  5F82 A;  3L7H A;  5MC7 A;  3A0S A;  4H8R A;  4RYE A;  3MZF A;  1MWS A;  3SS5 A;  1NJ4 A;  4KZB A;  3NJA A;  5G4Y A;  1O07 A;  5AQA A;  3V3S A;  4QWO A;  4BD1 A;  4LV2 A;  1UWN X;  2PAV P;  4OOM A;  1PWG A;  4KZ5 A;  4HP9 A;  3PAE A;  5IS1 A;  1NLZ A;  4IVI A;  4PM9 A;  4ZJ1 A;  1K54 A;  4U0X A;  5GHX A;  2GNX A;  1HVB A;  3B3X A;  4PPR A;  4B4Z A;  2VA0 A;  2XR0 A;  1TVF A;  2X71 A;  2V20 A;  4DXB A;  3R7W A;  4I38 A;  4GD8 A;  3M2K A;  3MZE A;  4OP8 A;  4KQO A;  2EX8 A;  1HD8 A;  3RJU A;  2ZD8 A;  2OSU A;  2Y4A A;  3F1P B;  3UPN A;  1L0E A;  3PBT A;  2HJ9 C;  3UDX A;  3QNC A;  5GLA A;  3H82 B;  4MNR A;  3VSL A;  4XUX A;  5AVF A;  4JXW A;  3LUQ A;  2JCH A;  3GQZ A;  4E6W A;  3NCK A;  4LRX C;  3VV4 A;  2WZZ A;  1F2K A;  3IBJ A;  4WBG A;  5HAI A;  5HDD A;  4ZAM A;  3CHW P;  3IT9 A;  3BY9 A;  1QME A;  1I5Q A;  3S1Y A;  2K7S A;  4HI4 A;  2WAF A;  1CEG A;  2XA7 S;  5HPI A;  2XFS A;  4XT2 B;  2QPN A;  2Z2L B;  3ZG5 A;  3MQ0 A;  3B42 A;  2ZQ8 A;  1S1Y A;  4Y15 A;  1YLW A;  3E0Y A;  1NYY A;  3LR0 A;  3QNB A;  5FI6 A;  1E4D A;  3OLO A;  1ZHH B;  3QHY A;  3ZCZ A;  5F68 A;  3C8C A;  3IF6 B;  2OAQ 1;  2EA9 A;  3PYP A;  1ES5 A;  4BBU A;  3GMW A;  3UE6 A;  3GEC A;  3S7N A;  1F9I A;  3OPH A;  5FDS A;  5FI7 A;  3T50 A;  4L9G A;  3CIT A;  5HW3 A;  2RL3 A;  2WKP A;  1SKO B;  3FWL A;  2VGJ A;  1BYW A;  4R6L A;  1XKZ A;  3HUM A;  1L2S A;  2QYB A;  2WKH A;  2E8J A;  4HH3 A;  3H7W A;  3SOI A;  2XRO A;  2FZ0 A;  4ETZ A;  4MBF A;  3BFC A;  3QP8 A;  1ZG4 A;  1GCE A;  4PHT A;  2XD5 A;  3MFX A;  3ZYT A;  2WYX A;  1YSP A;  3HL9 A;  5EM1 A;  2HDS A;  5HAQ A;  5F5Y A;  4HY8 A;  3ZVW A;  3IX8 A;  5FAO A;  4LV3 A;  1XFQ A;  2O99 A;  5E2H A;  3F1O B;  3FG8 A;  1NWZ A;  2I9V A;  3ZHH A;  1V9Z A;  1P9W A;  1XGJ A;  2P9V B;  3TRC A;  1LLB A;  4HES A;  5E2G A;  4BL2 A;  4IUK A;  4PM6 A;  4ARZ B;  4I3I A;  3E2L A;  4B4X A;  2IWC A;  2O9C A;  1XGI A;  1YLJ A;  3CWF A;  2M1C A;  1BUE A;  4JGP A;  3CAX A;  2A24 B;  4BBV A;  2WAD A;  3QP2 A;  3ZNY A;  3BRM A;  2J3T D;  5FAQ A;  1KVM A;  3PBQ A;  5KMW A;  2VX8 A;  3F1N A;  4KZ9 A;  2K2N A;  1XP4 A;  4GS9 B;  3U4L P;  2VV8 A;  3TE8 A;  5EM0 A;  3OC2 A;  3Q07 A;  4Q0J A;  1S4S A;  2KX6 A;  3M6B A;  3RXX A;  3NC8 A;  3WWX A;  4KQR A;  4Y5F A;  3CZD A;  3HUO A;  4HP4 A;  1CEF A;  2ZQD A;  5HX9 A;  2ZC6 B;  1C3B A;  3HJI A;  2P08 A;  5M19 A;  5HDS A;  2J9P A;  1I2W A;  4FH4 A;  4OLD A;  2JBF A;  1W5D A;  5DF8 A;  5FAT A;  1LI9 A;  2HPB A;  1KE4 A;  1YLY A;  2V8F A;  3PHY A;  1QMF A;  3V5M A;  1YM1 A;  4R3J A;  1E3U D;  4EEP A;  2INW A;  1X0O A;  5DFY A;  3UB6 A;  1OPX A;  2ZQC A;  2JC7 A;  4CPK A;  4E04 A;  1PI5 A;  4DF6 A;  1YT4 A;  2L0W A;  3FPW A;  3FYZ A;  2VJW A;  1K56 D;  3S7O A;  2M7U A;  1MKM A;  5DF9 A;  4NK3 A;  1N9O A;  4OLG A;  1K54 C;  3JYI A;  3NOP C;  2OWH A;  3SZT A;  5HDC A;  1EW0 A;  4WYY A;  3Q7V A;  4UA7 A;  3DW0 A;  2XQZ A;  2BLS A;  4PM5 A;  1OT6 A;  1H8M A;  3IWQ A;  1PRQ A;  2VV7 A;  4N1X A;  3P01 A;  4S2I A;  4N1H A;  4WLA A;  3VP4 A;  2PU4 A;  1DP8 A;  4BLM A;  3T1X A;  1T1C A;  3KX0 X;  3VSK A;  1LT0 A;  3S4X A;  2K31 A;  3HRE A;  5KSH A;  4GHI A;  1WA9 A;  3T1R A;  1MWU A;  3G2Z A;  2KDK A;  2ZMF A;  1UGU A;  3PBO A;  4X56 A;  2DRW A;  2Y2M A;  1YPR A;  2I72 A;  3QP4 A;  3S7Q A;  3HJK A;  4ZTK A;  1FQG A;  2DNS A;  3OPR A;  4WUJ A;  2CC1 A;  5TBM A;  3CPT A;  2CMN A;  4WN5 A;  3G35 A;  2J9O A;  4S2N A;  4S2J A;  1JWV A;  2W1T A;  3OCL A;  2V0U A;  4P6Z S;  1KVL A;  2VEA A;  3DAV A;  2Y59 A;  4GD6 A;  4NXF A;  3IHB A;  2PDR A;  1S1Z A;  4UQI S;  1OTE A;  4NEE D;  3TJZ C;  3GTC A;  5CGS A;  2YKH A;  1NZO A;  1Z09 A;  4Q8I A;  3LIC A;  5DKL A;  4ZJ3 A;  4OON A;  4BEN A;  2Y2I A;  1VEU B;  4YNR A;  2B02 A;  3LIA A;  2H0T A;  4HNB A;  1JNU A;  1K55 C;  1K0K A;  3H9W A;  3G6O A;  5C5K A;  1I2S A;  3GRJ A;  4CQH A;  5DF7 A;  2ZL1 B;  5L8M A;  1MZU A;  3NEC A;  3LO7 A;  2JHE A;  3U2A A;  3K3D A;  1GSW A;  1YQS A;  1XXM A;  5EE8 A;  3EGD C;  4WZ4 A;  3EGX C;  2ZC4 B;  4S2M A;  5E2E A;  1K56 A;  2Y2O A;  4PMA A;  2NUT C;  2PR5 A;  2VK3 A;  3B33 A;  2Y2G A;  3EEA A;  1W8Y A;  4BBT A;  4ZRR A;  4KZ3 A;  4BD0 A;  5L07 A;  3IF5 A;  1XJ6 A;  4F3L B;  3SH8 A;  5AQB A;  2XH9 A;  4EW7 A;  1IYP A;  3UB7 A;  4NXB A;  3CLO A;  3LGO A;  4R70 A;  1BSG A;  4MBK A;  1ONG A;  2OOL A;  2PD7 A;  3MJQ A;  3VFH A;  1IEL A;  4Z1W A;  2ZBB A;  4FOF A;  3WS1 A;  5HD3 A;  3BFF A;  2V9A A;  5FAS A;  4GDN A;  1STZ A;  2WGI A;  4OVD A;  2W3G A;  3G4P A;  1K38 A;  3F1P A;  3MS6 A;  4P87 A;  4HBU A;  1RGY A;  3DWZ A;  3K2N A;  4E3J A;  4X1L A;  4NXG A;  3SS3 A;  4YOF A;  3D9Y A;  3FKV A;  2QMI A;  3LFV A;  3H82 A;  1DP6 A;  4UA9 A;  2HDU A;  5A93 A;  1P9R A;  2BTF P;  5FI2 A;  1IEM A;  3MXQ A;  5AQ7 A;  3WS4 A;  5EPH A;  2Z2M B;  1FCM A;  1D1J A;  5CGW A;  4GZB A;  1YLP A;  1A0K A;  2W3H A;  3G32 A;  2V1Z A;  2WGV A;  4D60 A;  3NOU C;  4XT2 A;  3UNW A;  5EUA A;  3MMH A;  4DE1 A;  4P85 A;  3LYX A;  5EVI B;  2VGL S;  3VOZ A;  2HDR A;  4WMC D;  2Z6C A;  3UB8 A;  3E98 A;  5HWW A;  4K0X A;  3LI8 A;  1PI4 A;  3ZG7 B;  5TR7 A;  4Q0I A;  2GX5 A;  4C6Y A;  1PWC A;  4YIN A;  3HLG A;  2EXB A;  3A3J A;  2KLI A;  5TJJ A;  2L1M A;  3V3R A;  4UQI M;  4KZ7 A;  5FEG A;  3IWO A;  2VZW A;  2J7V A;  3IXB A;  1NRJ A;  2Y2H A;  3CUE A;  3ZDJ A;  4B88 A;  1ERQ A;  4GOG A;  3N6I A;  1TS6 A;  1Q2Q A;  5G4Z A;  4O01 A;  4FCF A;  4HHD A;  4L9E A;  1SDN A;  2A2L A;  2WGW B;  2PYP A;  4LFU A;  3CJM A;  4NXE A;  3BFE A;  2IWD A;  3OOV A;  5GLB A;  1H5X A;  5CER A;  2PT7 A;  1TEM A;  3DWK A;  2P9V A;  2QJ7 A;  5HL6 A;  2JKF A;  5DTK A;  4KG5 A;  3UE0 A;  1HZO A;  5A90 A;  3ZQ5 A;  1TF1 A;  4RVA A;  4ARZ A;  3EEH A;  3KSF A;  5FEF A;  5BOH A;  1BLH A;  4ESP A;  1GHI A;  4S2N C;  5EVE A;  2J3T C;  4LLO B;  4U0T A;  2Y2N A;  3W4O A;  3UY6 A;  1FOF A;  1FCN A;  1K6S A;  3AGD A;  3MXS A;  1KE3 A;  4H6J B;  4GS9 A;  5FQ9 A;  2BAS A;  3IH9 A;  3BJN A;  2PU2 A;  2UV0 E;  1TD5 A;  3IH8 A;  3ZVT A;  1L0F A;  4O7D A;  5EOE A;  3N7W A;  4QHC A;  1GSX A;  2ZM8 A;  4LV0 A;  1CI9 A;  4IED A;  3PAG A;  1XPB A;  2B95 A;  1XJ3 A;  5CEC A;  4E3N A;  5DKK A;  2ZMV A;  3MXR A;  4DJ2 A;  2P7J A;  1MXO A;  3RH8 B;  3LR4 A;  4MDZ A;  4U3T A;  2WKR A;  5FA7 A;  1J3W A;  1OTB A;  4DRT A;  4GCZ A;  3SW1 A;  4EQ1 A;  1H0M A;  4L9F A;  4JLF A;  3PBS A;  1K55 A;  4NG2 A;  5KZH A;  3MKF A;  4EER A;  2C6W B;  4LRY C;  4HEF A;  2ZC5 B;  1K57 A;  4UHU A;  1TS0 A;  3N8R A;  3MF0 A;  3T4S A;  4O0P A;  5E43 A;  4JGR A;  1W7F A;  2OLU A;  2VGL M;  3Q7Z A;  1S4R A;  2OV5 A;  4A5R A;  2KOI A;  1DJB A;  2IA2 A;  4IBX A;  3G34 A;  1KDW A;  3WS0 A;  2M7V A;  3HLB A;  5GHY A;  3W4Q A;  2HGV A;  1ZC2 A;  3UMD A;  3I7J A;  4K0W A;  5HFO A;  4D2O A;  5J7E A;  1VB6 A;  3ZG0 A;  4YFM A;  4RX3 A;  4KZ8 A;  4EXO A;  1OTI A;  3BY8 A;  3UB5 P;  3A3E A;  1DP9 A;  1PFL A;  2XGN A;  3FPV A;  2IWB A;  2GZA A;  3BEC A;  3JPU A;  4DE0 A;  3NY4 A;  4ZJ2 A;  3IXG A;  4DDY A;  5KSC A;  3TOI A;  3IX3 A;  4JGO A;  4WEJ A;  2HP9 A;  2JKG A;  4X1M A;  4EV4 A;  3E4O A;  3O88 A;  2EX6 A;  4WF0 A;  4X69 A;  3VP0 A;  5CED A;  1EI5 A;  3T4T A;  3FKW A;  2VGK A;  1NZU A;  4EUZ A;  5EVI D;  1V9Y A;  1PW8 A;  1OTA A;  3IF6 C;  3EQU A;  1W8Q A;  4IHQ A;  2ZL1 A;  1S66 L;  1LSV A;  2HF6 A;  4RA7 A;  2W3F A;  4GJ4 A;  1ALQ A;  2PD8 A;  4DKI A;  4WEK A;  3CUE C;  1LL9 A;  1FIL A;  1SDE A;  3ISG A;  3GVB A;  2ZQ7 A;  3BQA A;  4B9O A;  3VMA A;  5GLD A;  1FSY A;  3MR0 A;  3UME A;  3UE1 A;  1XJ4 A;  4N92 A;  1RGZ A;  5HPF A;  2D02 A;  3W2Z A;  4OOL A;  2XA7 M;  3O86 A;  2W1R A;  3DTE A;  4PAU A;  3N8L A;  2XDM A;  1MWR A;  4UAA A;  3BEB A;  2EX2 A;  1VET B;  2XRN A;  3A3I A;  5CGX A;  4Y0T A;  2EFU A;  1SKF A;  4OQ0 A;  5CTN A;  1Y54 A;  3ULF A;  3O5Y A;  2H10 A;  1MC0 A;  1KGE A;  4JF4 A;  2G7U A;  3T4O A;  4OQI A;  5AJG A;  1KDS A;  4R3A A;  4F94 A;  1CJF A;  2Y2Q A;  3GR2 A;  5HL1 A;  4C75 A;  2L4R A;  3H7W B;  5HSQ A;  4GB7 A;  3VP3 A;  4BWI A;  2FFF B;  3VFF A;  2ZC7 A;  3BLM A;  3A3D A;  3BWL A;  4JXV A;  2XLN A;  1YSQ A;  4JXS A;  3HCY A;  1BUL A;  4K91 A;  2D01 A;  3E4P A;  3BFD A;  5EFW A;  1G6O A;  3T4K A;  4GKU A;  5GLC A;  2XSS A;  1S67 L;  4MEZ A;  3JVV A;  1ES3 A;  2J8Y A;  1YMX A; 
#chains in the Genus database with same CATH homology
 5AVF A;  5J4E A;  3LUQ A;  3PBR A;  2W3H A;  4KUO A;  4LRX C;  3VV4 A;  1VHM A;  3NOU C;  4XT2 A;  3IBJ A;  3T4L A;  5HDD A;  3UE3 A;  3LR5 A;  3BY9 A;  3MMH A;  2WKQ A;  4HJ6 A;  1T19 A;  3LYX A;  4FSF A;  3F1N B;  2K7S A;  4HI4 A;  4Y3I A;  3LIE A;  2VGL S;  5HWV A;  2XA7 S;  5HPI A;  5DJU A;  4XT2 B;  2Z6C A;  2OAP 1;  3UB8 A;  4EEU A;  3E98 A;  5HWW A;  3LI8 A;  3NHQ A;  4HQA A;  2JKT I;  3MQ0 A;  3B42 A;  4Q0I A;  2GX5 A;  4HIA A;  1XJ2 A;  3UB9 A;  4MN7 A;  1S1Y A;  1OJ5 A;  4CLC C;  3PBN A;  3E0Y A;  4I5S A;  3LR0 A;  1DRM A;  2KLI A;  3OLO A;  1ZHH B;  5F68 A;  3C8C A;  2L1M A;  4LPZ A;  3PR6 A;  5TJJ A;  4UQI M;  2OAQ 1;  2EA9 A;  3PYP A;  2VZW A;  2HJE A;  5HD5 A;  4BBU A;  3UE6 A;  3GEC A;  4WEL A;  3S7N A;  4O8G A;  1F9I A;  1N9L A;  2JKR M;  1NRJ A;  2YKF A;  3T50 A;  3CUE A;  4Q0H A;  4F3L A;  4L9G A;  3C38 A;  3CIT A;  2J80 A;  3P7N A;  1OJG A;  1TS6 A;  2WKP A;  4DJ3 A;  4CLC D;  5G4Z A;  4O01 A;  1BYW A;  4I3A A;  4HHD A;  4R6L A;  4L9E A;  1G28 A;  2O9B A;  2A2L A;  2QYB A;  1YKD A;  2NUP C;  1LSX A;  2V1B A;  4L0L A;  2PYP A;  4HH3 A;  3H7W A;  3OCN A;  4K08 A;  1GSV A;  4BMW A;  2XRO A;  2FZ0 A;  3E4Q A;  4IJG A;  4ETZ A;  4NXE A;  3OOV A;  1D7E A;  1T18 A;  4PHT A;  3MFX A;  3ZYT A;  2W3D A;  1YSP A;  3EQV A;  2PT7 A;  5F5Y A;  2MJ6 A;  4HY8 A;  5A8B A;  3JVU A;  4EU0 A;  3VE3 A;  2ZOI A;  2QJ7 A;  1XFQ A;  4EES A;  2O99 A;  5HL6 A;  3F1O B;  3FG8 A;  4MN5 A;  2JKT M;  1NWZ A;  1Y28 A;  2I9V A;  2VV6 A;  3ZQ5 A;  1TF1 A;  4ARZ A;  3EEH A;  3KSF A;  1V9Z A;  1P9W A;  2JN7 A;  3LIB A;  2W27 A;  4MMN A;  2FH5 A;  2J3T C;  4H6J A;  3TRC A;  3IS2 A;  3KO6 A;  1LL8 A;  4LLO B;  4IUK A;  4IUH A;  4ARZ B;  1YAX A;  4I3I A;  4QPR A;  3V67 A;  2O9C A;  5CX7 A;  3A0R A;  4H6J B;  5F6A A;  3IS2 B;  4GS9 A;  3CWF A;  3VE4 A;  2M1C A;  4JGP A;  3CAX A;  2A24 B;  4HH2 A;  4GHI B;  2BAS A;  4BBV A;  3BJN A;  1IOU A;  2J3T D;  2P04 A;  1TD5 A;  3MQQ A;  3K3C A;  3PBQ A;  2VX8 A;  3F1N A;  2K2N A;  4GS9 B;  2R78 A;  2VV8 A;  3TE8 A;  3BW6 A;  3OC2 A;  1GSX A;  3C2W A;  1W63 Q;  5TBM B;  4M4X A;  1TS7 A;  4Q0J A;  2Y8H A;  4UEY A;  1S4S A;  2KX6 A;  4NKP A;  5DFX A;  1XJ3 A;  4Y5F A;  4HP4 A;  5DKK A;  2ZMV A;  4DJ2 A;  2P7J A;  4EET B;  4LRZ E;  2LB5 A;  3HJI A;  2P08 A;  3RH8 B;  3LR4 A;  4MDZ A;  5HDS A;  1KOU A;  2WKR A;  4DMZ A;  4DN0 A;  4HOI A;  1IFQ A;  1OTB A;  4P6Z M;  3FC7 A;  4GCZ A;  3PHY A;  3SW1 A;  4EQ1 A;  1T1B A;  4L9F A;  3PBS A;  2VLG A;  4KUK A;  4EEP A;  2INW A;  2HV1 A;  1X0O A;  2V1A A;  5DFY A;  5AVE A;  4EER A;  3UB6 A;  1OPX A;  4YWZ A;  2EWW A;  4LRY C;  4E04 A;  5F69 A;  1TS0 A;  2PR6 A;  3MF0 A;  4I3J A;  3T4S A;  4O0P A;  4ETX A;  4JGR A;  2L0W A;  3FPW A;  3MQO A;  2VJW A;  3R4K A;  4BJP A;  4CLC E;  4PKY A;  3S7O A;  2M7U A;  2VGL M;  1MKM A;  5DF9 A;  1S4R A;  2DMW A;  3RTY A;  1N9O A;  1UWP X;  2V0W A;  1N9N A;  1OTD A;  3NOP C;  2KOI A;  2OWH A;  3KSH A;  2IA2 A;  3F1O A;  5HDC A;  3EWK A;  1EW0 A;  2Y79 A;  5J3W A;  2M7V A;  3LI9 A;  4G3V A;  3T4J A;  2LB9 A;  1OT6 A;  4R38 A;  2HGV A;  1P0Z A;  1H8M A;  3EOI A;  3UMD A;  2VV7 A;  3P01 A;  2W0N A;  5J7E A;  1VB6 A;  4WLA A;  1H3Q A;  1DP8 A;  3A0V A;  1T1C A;  3KX0 X;  1LT0 A;  5DJT A;  2K31 A;  5LBR A;  4EXO A;  1OTI A;  4RQ9 A;  3BY8 A;  4JGQ A;  2A24 A;  5KSH A;  1DP9 A;  4GHI A;  1WA9 A;  2KDK A;  2ZMF A;  3FPV A;  2GZA A;  1UGU A;  2QWS A;  3D3O A;  3PBO A;  4WL9 A;  3S7Q A;  3HJK A;  4B93 A;  1D06 A;  4WUJ A;  1F98 A;  5TBM A;  1ODV A;  5FL3 A;  4JGO A;  2Z6D A;  4WEJ A;  2CMN A;  4WN5 A;  2QHK A;  3KSG A;  4KQD A;  2EWV A;  3LID A;  3NOT C;  1T1A A;  2W3E A;  3E4O A;  2W1T A;  3OCL A;  2VKS A;  2V0U A;  4P6Z S;  4WF0 A;  2VEA A;  3TW8 A;  4NXF A;  2PHY A;  5HZH A;  4II7 A;  2PDR A;  1S1Z A;  4UQI S;  3T4T A;  1OTE A;  4NEE D;  3TJZ C;  2YKH A;  2W1T B;  1TS8 A;  4I39 A;  1V9Y A;  3BQ8 A;  3IBR A;  2H28 A;  1OTA A;  4PKY G;  1NLY A;  2B18 A;  2OWJ A;  3EQU A;  2O9A A;  3LIC A;  5DKL A;  3B47 A;  4IHQ A;  2QJ5 A;  3S7P A;  1S66 L;  4YNR A;  1LSV A;  2B02 A;  3RFB A;  3LIA A;  3LIF A;  4HNB A;  1JNU A;  3D72 A;  2HF6 A;  3H9W A;  2QKP A;  3G6O A;  5C5K A;  2W3F A;  4GJ4 A;  2PD8 A;  4CQH A;  4WEK A;  3KYZ A;  3CUE C;  5L8M A;  4G3K A;  1MZU A;  3BQA A;  4B9O A;  3LR3 A;  1F5M A;  4GLQ A;  2JHE A;  3MR0 A;  3UME A;  3U2A A;  3C30 A;  5K5B A;  3K3D A;  1XJ4 A;  1GSW A;  4MCW A;  3EGD C;  4CLC A;  3EGX C;  5HPF A;  2D02 A;  3W2Z A;  4OOL A;  2XA7 M;  2W1R A;  4AFI A;  1LSW A;  1OT9 A;  4PAU A;  4GW9 A;  4EUV A;  3T4Q A;  5MC7 A;  3A0S A;  2NUT C;  3ICY A;  2PR5 A;  4HJ4 A;  3B33 A;  3EEA A;  4HJ3 A;  4CLC B;  2XRN A;  3NJA A;  4BBT A;  1ZTU A;  3PXP A;  4G3W A;  5G4Y A;  4ZRR A;  5IT5 A;  1UWN X;  4OOM A;  3ULF A;  1XJ6 A;  4F3L B;  4HP9 A;  3O5Y A;  5IS1 A;  2J3W A;  1NLZ A;  4EW7 A;  1MC0 A;  3UB7 A;  4NXB A;  3CI6 A;  3CLO A;  4R70 A;  2G7U A;  1XFN A;  3T4O A;  2OOL A;  2PD7 A;  2ZOH A;  5AJG A;  4R3A A;  3MJQ A;  3KSI A;  4Z1W A;  2ZBB A;  1W63 M;  2GNX A;  4FOF A;  2L4R A;  3H7W B;  5HD3 A;  5KIZ A;  5HSQ A;  2V9A A;  4BWI A;  1STZ A;  2VA0 A;  4Y2F A;  2W3G A;  4MN6 A;  3VOL A;  5I5L A;  3F1P A;  3BWL A;  3K2N A;  3R7W A;  4I38 A;  4NXG A;  2PYR A;  3GDI A;  4KQO A;  4YOF A;  1YSQ A;  3HCY A;  3OBF A;  3LFV A;  3H82 A;  1DP6 A;  3F1P B;  3KYQ A;  2O0Y A;  1P97 A;  2D01 A;  3E4P A;  3R7W B;  3PBT A;  2HJ9 C;  5EFW A;  1G6O A;  3T4K A;  2JKR I;  1P9R A;  3DBA A;  2GJ3 A;  2XSS A;  5HWT A;  1S67 L;  3JVV A;  3MXQ A;  5IU1 A;  3H82 B;  4ME4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...