4NXGA

Crystal structure of ilov-i486z(2lt) at ph 9.0
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
103
structure length
102
Chain Sequence
KNFVITDPRLPDNPIIFASDGFLELTEYSREEILGRNARFLQGPETDQATVQKIRDAIRDQRETTVQLINYTKSGKKFWNLLHLQPVRDQKGELQYFGVQLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Phototropin-2
publication title Significant Expansion of Fluorescent Protein Sensing Ability through the Genetic Incorporation of Superior Photo-Induced Electron-Transfer Quenchers
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Flavoprotein, fluorescent protein
total genus 32
structure length 102
sequence length 103
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4nxgA00
5IU1A 3A0RA 3H82A 2Z6CA 2JN7A 2H28A 2CMNA 3KX0X 2A24B 2K7SA 3LIEA 3C8CA 1OT9A 2ZOIA 1T1BA 3ULFA 4WN5A 3NJAA 1LSVA 4F3LA 3NHQA 3H9WA 3VOLA 1UWPX 3E4PA 1DP6A 2PR5A 1XJ4A 4EETB 1F98A 4I39A 4JGOA 2L4RA 4RQ9A 1OTIA 5F5YA 1LT0A 1TS7A 4LRXC 1OJ5A 3F1OB 1NWZA 2PHYA 4HOIA 4R6LA 4I5SA 4LPZA 2J80A 3A0VA 4HJ4A 2OWHA 1P97A 2A24A 4GHIA 2PD7A 4HH2A 4EW7A 2KX6A 5A8BA 5F6AA 1LL8A 1UWNX 2GJ3A 1JNUA 4HQAA 1TS6A 1DP9A 3LIDA 4HJ3A 3CAXA 4BBUA 4L9GA 5I5LA 4I3JA 2QJ5A 1EW0A 1GSVA 2QJ7A 2VV7A 1VB6A 4EESA 5TBMA 3UB6A 3E4QA 5J3WA 1BYWA 3D72A 5HWWA 2OOLA 3LIBA 2PR6A 2B02A 4H6JA 3C2WA 1OT6A 2V9AA 4KUOA 5EFWA 3LUQA 4GW9A 4HNBA 4EEPA 2PD8A 2VEAA 5DJUA 3LYXA 3PYPA 2WKQA 2W27A 2V0WA 2KDKA 3NOTC 4EQ1A 3UB7A 1XFNA 4HP9A 4BBVA 3VE4A 1S4SA 4GHIB 1T19A 3F1PB 3LI8A 1N9NA 1OJGA 1XJ3A 2INWA 2WKRA 1DRMA 3BWLA 5HSQA 2YKHA 2W0NA 4I38A 5F68A 1TS0A 2D01A 2L1MA 4R70A 4L9FA 3OLOA 5DJTA 2M1CA 2VLGA 4DJ3A 3K3DA 2I9VA 5F69A 5HDSA 3MR0A 4HJ6A 5TBMB 3NOPC 4HH3A 4XT2A 3MQQA 3NOUC 4L9EA 4EEUA 2JHEA 4NXEA 3RTYA 1WA9A 1S66L 3EWKA 3F1PA 4H6JB 3BY9A 1KOUA 4HHDA 5AVFA 4DJ2A 3UB8A 3LICA 1D7EA 1OTAA 4JGPA 3H7WA 3MJQA 1V9YA 4PKYG 1XJ2A 4HY8A 1F9IA 5G4YA 3UMDA 3EEHA 4WL9A 2WKPA 4NXGA 4PKYA 3T50A 3UE6A 5KIZA 3B33A 3G6OA 5J7EA 4LLOB 3PHYA 2PDRA 1X0OA 4GS9B 4WUJA 2Z6DA 2BASA 1P0ZA 2ZOHA 3K3CA 3F1NB 4NXFA 4HIAA 3E4OA 4XT2B 4WF0A 1Y28A 4JGQA 3UB9A 3HJKA 3HJIA 5HWTA 3MFXA 3RH8B 1S1ZA 3GDIA 4B9OA 2VV8A 4HP4A 2QKPA 3LIAA 4MN5A 1S4RA 4R38A 3ICYA 1S67L 3FC7A 4HI4A 3CLOA 1S1YA 2ZBBA 2OWJA 5DKLA 4E04A 3LI9A 4GS9A 3BY8A 3H7WB 4I3IA 3A0SA 5HDDA 1N9LA 1N9OA 4WLAA 4KQDA 5DKKA 3F1NA 2V1BA 1OTBA 3SW1A 1T18A 2V0UA 2P7JA 1MZUA 4MN6A 1G28A 2PYRA 3VE3A 5HDCA 2V1AA 5HWVA 3GECA 5J4EA 1GSXA 3MXQA 1D06A 1V9ZA 1XJ6A 1DP8A 1TS8A 2YKFA 5HD3A 1T1CA 3IS2B 1XFQA 4YWZA 4M4XA 2QHKA 3ZQ5A 4GCZA 1GSWA 3H82B 2L0WA 1ODVA 2QWSA 4JGRA 3CWFA 4EERA 3FG8A 1OTEA 1LSWA 5HD5A 5AVEA 3F1OA 4F3LB 3LIFA 2HV1A 3IBRA 3UMEA 2R78A 2VV6A 3MQOA 4NXBA 2PYPA 4BBTA 1LSXA 1OTDA 4R3AA 4K08A 4LRZE 4EXOA 5IS1A 4LRYC 5HZHA 1UGUA 4I3AA 2D02A 5G4ZA 4KUKA 3IS2A 3P7NA 1T1AA 2EA9A
chains in the Genus database with same CATH superfamily
5IU1A 3A0RA 5M18A 1TVFA 2Z6CA 3G30A 5IHVA 2Y2HA 5EOOA 2C6WB 1OT9A 3NECA 3ULFA 5HL6A 1VETB 3E4PA 1ONGA 1DP6A 3ITAA 3ZG7B 2VGJA 1IELA 1FQGA 3HVFA 1RCJA 4P87A 2Y2JA 2JE5A 5HAQA 1PWDA 3PBQA 5J8XA 2OSUA 2FZ0A 4YINA 1TS7A 4OP5A 3OC2A 1OJ5A 3UPNA 1NWZA 4R3BA 1ES4A 5TGFA 4N1HA 5HARA 2X71A 3QP5A 5FQJA 3MF0A 4E3OA 4Y17A 4ZTKA 3UE0A 4KQRA 4LCMA 5F82A 1L0FA 2Y55A 2QZ6A 4HH2A 2VK3A 1QMFA 4KZ7A 5FI2A 3M6HA 2J3WA 2V20A 3IXDA 5F6AA 4JXWA 5CXWA 2WAEA 5MC7A 5EM0A 3W4PA 1JNUA 4GD6A 5FDSA 4OKPA 1K4FA 4KZAA 1CK3A 5L8MA 1MBLA 3M6BA 4I3JA 2QJ5A 1GSVA 3DW0A 1W5DA 1PI5A 3OPLA 2ACGA 1YMSA 4EESA 3CPTB 2UWXA 3E4QA 2WKHA 1TEMA 5J3WA 3QNBA 3D72A 3S7NA 4R0QA 5AQBA 5HWWA 5CERA 1STZA 3C30A 1E25A 3G34A 4DE3A 4O0PA 2V9AA 2Y2NA 4KUOA 3B42A 3GV9A 3SZTA 5E43A 2VEAA 3M2KA 3SH8A 5HFOA 4MDZA 2ZC7A 3KO6A 4Y0TA 2WZXA 3NOTC 1FCOA 2Y2MA 1S4SA 3IHAA 1T19A 3LI8A 4IVIA 4BQMA 3IX8A 3G31A 2INWA 2WKRA 1DRMA 3BWLA 5HSQA 2YKHA 2WADA 1YMXA 3EGXC 2HF6A 1ZG6A 1TS0A 1YKDA 2ZQDA 3PBOA 1M6KA 1SZVA 3EEAA 2Y2KA 1TDLA 2HPBA 3KYZA 1ACFA 2I9VA 4OLDA 4X6TA 2ZQ9A 3D9YA 5E2HA 4HH3A 4UA9A 4WZ5C 4XT2A 3UB5P 4IBXA 1AWIA 3NOUC 4L9EA 1BLHA 3LR0A 3RTYA 3BFCA 2W3FA 1S66L 2ZL1A 3E98A 2B18A 3BY9A 5CRFA 2W3EA 3OCLA 4NK3A 1KOUA 3C7VA 1JTGA 3OOVA 3ZNTA 5AVFA 2XFSA 1K54A 3UB8A 2HP6A 1Z09A 2KOIA 4OPQA 1WYCA 2J7VA 3BM6A 3MJQA 1XJ2A 5EOEA 2JKTM 4R1GA 1ZHHB 4Y3IA 2XH9A 4WL9A 4PKYA 2JCHA 5CGSA 4ARZA 3UE6A 3VSLA 4N9KA 2WUQA 4P0MA 1WE4A 1PWCA 3BRMA 3PAGA 4E6WA 3B33A 5J7EA 5KSCA 1CQAA 3PR6A 3ZFZA 3O88A 1L0EA 1NRJA 5FATA 5KSHA 1X0OA 3BW6A 5GHZA 3MQ0A 5DF7A 2Y2OA 4WUJA 4GDNA 1K6SA 2Z6DA 4S2MA 5FQKA 3F1NB 4KZ4A 4NXFA 4XT2B 4JBFA 3CUEA 3UB9A 1H8MA 1MWSA 5HPIA 4OOYA 2ZL1B 3DBAA 2ZJ9A 4U3TA 1O7EA 1S1ZA 4B9OA 3UDFA 4IUHA 3T4JA 1YT4A 2G2UA 3OPHA 2Y79A 3FC7A 4BD0A 4N1XA 2WZZA 1MKMA 3L7HA 5U47A 2A3UA 4KQDA 4BWIA 5TR7A 5F83A 5AQ9A 3N6IA 2M7VA 3MFDA 3S4XA 3S7QA 5A92A 1YM1A 3A3IA 1T18A 4MMNA 1MZUA 2V2FF 1L0GA 2Y2GA 4JF5A 3W2ZA 5HDCA 4WBGA 3BECA 5EV0A 3IF6A 5L07A 4S2OA 1H8ZA 3RXWA 4B93A 4IEDA 4E3NA 3E2LA 3MKFA 2PBYA 2XK1A 4CLCE 1NLZA 2V1ZA 3T12B 2BG1A 4DF6A 1W8QA 1CI8A 3IWOA 2FFYA 5DF8A 2VKSA 1W7FA 1K54C 3KSHA 3VOYA 3G35A 3R7WA 1ZG4A 2QYBA 3H82B 4BJPA 3FKVA 3BEBA 3LFVA 3CWFA 1K55A 1OTEA 1DY6A 2PT7A 3T4KA 2DCFA 3QP1A 1ZTUA 4X1MA 3BJNA 4CLCA 3DAVA 2Y8HA 2NUPC 3IBRA 2R78A 2VV6A 3O5YA 2PYPA 3BLSA 1IFQA 4BBTA 4R3AA 4FSFA 3HCYA 2CC1A 1XA1A 4D60A 5CEDA 3MBZA 3T4OA 3N8LA 4OPZA 1T1AA 4KZ6A 4FH4A 2I72A 3IF6B 4BL2A 5D3OA 3VSKA 2CMNA 1ONHA 3KX0X 3CUEC 2A24B 2K7SA 4XUXA 2ZOIA 3VP0A 2ZLYA 1XKZA 4F3LA 3NHQA 3FZCA 4A5RA 3H9WA 5HL1A 5CTNA 4LV3A 2JKFA 4K0XA 5K5BA 1MWTA 4QY5A 2VZWA 1XJ4A 4R23A 2O9CA 3R7WB 3LR4A 1NZOA 1E4DA 2L4RA 4OPRA 4M3KA 2B95A 4MBHA 2JBFA 3FV7A 4RQ9A 4P6BA 5F1FA 1MY8A 5F5YA 2XFTA 4PMAA 3GR2A 3P98A 4CLCB 2VJWA 3QP6A 2P9VA 4I5SA 3VP4A 4LPZA 1KVMA 4HESA 4DDYA 1PW8A 2J80A 5BOHA 1E3UA 5DVAA 4B4ZA 1XXMA 2PD7A 4EW7A 2C5WB 1D1JA 1VETA 5A8BA 4E3LA 3QHYA 1UWNX 4Z1WA 1LL9A 4HQAA 3NC8A 2JKTI 5EVIC 1PIOA 3PAEA 4BBUA 3TSGA 3VP1A 4B4XA 1KDSA 2EXBA 3TOIA 3NDGA 3EGDC 2VV7A 2ZQ7A 3NI9A 3FWLA 3BQ8A 3E0YA 2W3HA 3B3XA 3C4OA 5G18A 4C3QA 2K2NA 2OOLA 5DFYA 3QP2A 4HEFA 4DE2A 1K55C 5FEGA 1JWPA 5EM1A 3IX4A 5EFWA 4GW9A 4HNBA 3HLDA 5DJUA 4R3JA 3PYPA 1GHPA 2WKQA 2H5SA 4ZAMA 1PNEA 2DNSA 1ERQA 5CEBA 2ZM0A 3VE4A 4S2JA 3F1PB 1OJGA 3UDXA 4EQIA 1RGYA 4WEKA 2ZQ8A 4GZBA 3CPTA 2Y2LA 4WYYA 4EWFA 3N8SA 2PBDP 2W0NA 4I38A 4IJGA 1LI9A 2AVXA 3N7WA 4OQHA 3NDEA 4N9LA 1FCMA 4S2PA 4QWOA 3DWZA 2M1CA 2VLGA 4DJ3A 5AQ7A 1P9WA 3Q7VB 5DFXA 2G7UA 1HZOA 4HJ6A 5EVEA 1IEMA 3NOPC 1K56A 2WKIA 1PYYA 2JHEA 4UA7A 4LCLA 2ZMAA 5DTKA 2OV5A 1IYOA 4QD4A 3V3RA 4JXVA 3D3OA 3HLBA 4P6ZS 4JXSA 3HLWA 3KSIA 4P85A 2LB9A 4MNRA 3M2JA 3LICA 5DF9A 3SS5A 3VP2A 4LV2A 1D7EA 3W8KA 4EV4A 5TFQA 3GRJA 5FASA 4GKUA 4KQOA 2EX2A 1NXYA 3NCKA 3Q1FA 3ZG0A 4PKYG 4MLLA 1F9IA 3UMDA 4YOFA 3Q82A 1H5XA 1W63M 1FIKA 4ME4A 2XRNA 3HBRA 1RGZA 3VV4A 3G6OA 3QNCA 5E2FA 3ZVTA 3V67A 2W3DA 2XLNA 5IT5A 4GS9B 4O7DA 3ZDJA 5AQAA 3W4QA 1FR1A 3PBRA 3O86A 2BASA 3S1YA 3CZDA 3K3CA 4OONA 4BENA 4WMCA 4HIAA 1KGEA 1YSQA 4O8GA 1PWGA 5A91A 4WF0A 5HWTA 4JLFA 5CGWA 3BFFA 3RH8B 2O9BA 1FSWA 3GDIA 2V8FA 2VV8A 1DJAA 5A90A 4NETA 3LIAA 3VOZA 4LV1A 4PM9A 1S4RA 2PAVP 5DTSA 4XXRA 3ICYA 1VHMA 3UE3A 1K57A 3JPUA 4P6ZM 1YLJA 3WRZA 2OWJA 2H0YA 3T4TA 4E04A 4Y13A 4KG6A 3BY8A 3A0SA 2PU2A 1N9LA 4UA6A 1FCNA 1MWUA 3F1NA 1ERMA 3WS5A 4GDBA 4HBUA 5CHJA 3SW1A 3VMAA 2GX5A 4S2IA 2XF3A 2V0UA 4OLGA 4BLMA 3VE3A 4X1LA 3EOIA 1DJCA 3OPRA 2ZMVA 2Y4AA 1FILA 1SDEA 2R9XA 3MZEA 1IKIA 1DP8A 2LB5A 1SKFA 1TS8A 2YKFA 1L0DA 3IH8A 1ZKJA 4S2NA 4ZJ2A 1SDNA 2J9PA 3IS2B 2JKRM 2XA7S 3JVUA 4M4XA 2QHKA 3ZQ5A 3FPVA 1ODVA 1YPRA 1L2SA 4OOMA 4JGRA 3IXHA 3W4OA 2HV1A 3FYZA 3UMEA 4G3WA 4JXGA 3GTCA 3EQUA 4LFUA 1XX2A 1BLPA 2FFFB 1XA7A 3MZDA 4K08A 3UO9A 4KZ8A 5GL9A 4LRZE 4EXOA 3MSHA 3PBTA 4OVDA 4KZ5A 4WZ4A 3ZCZA 4QB8A 4DDSA 1KDWA 4CQHA 5G4ZA 4KUKA 3DTIA 1I2SA 1ZC2A 3P7NA 3BYDA 1IYSA 1N4OA 3IQAA 3H82A 3KYQA 2J8YA 4PM5A 3LR5A 3VFFA 5FI6A 2PRFA 3LIEA 3C8CA 5CECA 1NYMA 4C6YA 3NJAA 1LSVA 5FQIA 1NLYA 4DMZA 1PW1A 1UWPX 2Q0OA 1HTZA 2PR5A 3LR3A 3TJZC 4EETB 1G6OA 1S6RA 1W8YA 4I39A 4JGOA 1HVBA 4RA7A 3BLMA 3I7JA 5L10A 1G6AA 3WS4A 2XA7M 4LRXC 3IXBA 3LO7A 3NULA 2PHYA 4R6LA 3P01A 4YNRA 3ZG8B 4HJ4A 3T4SA 2QMIA 2ZMFA 2A24A 2VA0A 3QP4A 4GOGA 3UPPA 3A3FA 2A49A 4Z9QA 3B47A 4MBFA 1A0KA 3PBSA 2GJ3A 4KZ9A 1XPBA 2Y91A 3ZYTA 4ZJ1A 4HJ3A 1ES2A 3CAXA 3OPPA 1KVLA 4L9GA 1HLUP 3MKEA 1ESIA 2E8JA 4NKPA 2B5RA 3BFDA 5FAOA 4B88A 5L2FA 5TBMA 3UB6A 4U0XA 3S7OA 3TE8A 3IF5A 3LIBA 3LCEA 3IHBA 1MWRA 3CJMA 4H6JA 3C2WA 3DWKA 3BFEA 4II7A 1OT6A 4Y7PA 4CPKA 3D4FA 3LUQA 1N9BA 5F1GA 4DN0A 2H0TA 3LYXA 3HLGA 2IWDA 2W27A 1LI0A 2V0WA 3UB7A 2XGNA 4HP9A 1ES3A 4NG2A 3O3VA 4IHQA 4OPYA 2E8IA 2A2LA 2ZM2A 3V39A 2IWCA 3MXSA 4D2OA 3P09A 3SS4A 4XUZA 4YFMA 1PRQA 5F68A 2D01A 1MXOA 4MN7A 4R70A 4GN2A 4L9FA 1C3BA 1G68A 1K4EA 4H8RA 1U60A 1OPXA 5GHYA 3K3DA 2WYXA 3AGFA 5F69A 5HDSA 1JWVA 3MR0A 4GLQA 2QPNA 2ZC5B 4JPMA 5TBMB 3HUMA 1AXBA 3G2ZA 1MPLA 5FSRA 4OP8A 4EBLA 1I5QA 4PM6A 1WA9A 3EWKA 3F1PA 5HX9A 3DTMA 4H6JB 2OAP1 1HD8A 1Z6FA 3MMHA 3OBFA 1CEGA 4NEED 4PHTA 1TD5A 5I94A 5HAPA 3L9KA 3IF6C 2HDUA 3CG5A 1CEFA 1H0MA 3DTKA 4L0LA 4Y0UA 2JKRI 2DRWA 3U2AA 1OTAA 1BTLA 2EX6A 3O87A 5AJGA 2Z2MB 3Q7VA 5FA7A 2Y2IA 4FOFA 5G4YA 3EEHA 4FH2A 2XEPA 1NY0A 5E2GA 4ETXA 4Q8IA 5KIZA 4QY6A 3NIAA 3N4IA 3OCNA 4RYEA 5CTMA 2PDRA 3Q81A 1VM1A 2XD1A 4CLCC 3CMZA 2EFXA 3FPWA 5EPHA 4JF6A 2EX9A 1TDGA 1VQQA 1P0ZA 2ZOHA 4KQQA 1S0WA 4S2LA 2BLSA 2WK0A 4X56A 2WGWA 1Y28A 1YSPA 4JGQA 3HJKA 3HJIA 5FQMA 3MFXA 4Y5FA 5JYPA 2Q9NA 4HP4A 3IX3A 4Q0HA 4MN5A 3HUOA 1P9RA 3CI6A 4R38A 3ZG9B 1S67L 3IH9A 4Y0OA 3E2KA 5FAQA 3ZVWA 2Q9MA 1MKIA 2UV0E 3MS6A 3CLOA 4HI4A 3RJUA 1S1YA 2ZBBA 5DKLA 1NJ4A 3JVVA 4GS9A 1IYPA 1N9OA 3SH9A 1FSYA 5DKKA 4WZ5A 3K2NA 2V1BA 4ZDXA 4GB7A 4G3VA 2WAFA 4PPRA 1CJFA 1TF1A 1OTBA 4Y15A 4X55A 3GQZA 5GLCA 1BUEA 2P7JA 4GJ4A 4MN6A 1H8YA 1G28A 3HUNA 2PYRA 2OAQ1 4WM9A 3IWQA 4OQ0A 2O9AA 4PAUA 5HWVA 3GECA 3SOIA 1D06A 1VEUB 1NZUA 5M1AA 2WGWB 3PBNA 5HW3A 5EVID 1O07A 2J3TC 4MEZA 4FUWA 1T1CA 1GHMA 2X01A 2R9WA 4YWZA 5FAPA 3HLCA 4CJNA 2O0YA 4RX2A 4GNUA 3R4KA 4KG5A 1GA0A 4X53A 4EERA 2ZC4B 2ZQAA 5HD5A 5AVEA 1CI9A 3F1OA 5FQ9A 3UY6A 1K6RA 4JF4A 5TJJA 4QJGA 3C5AA 1Y4OA 3MQOA 4KG2A 2P04A 4CLCD 4OQIA 2GNXA 1H3QA 1OTDA 5FDHA 2J9OA 3EQVA 2Y2PA 1BLCA 2Y2QA 4I3AA 2JKGA 2D02A 2X02A 1JVJA 3IS2A 2EA9A 3HLFA 4LV0A 3BFGA 4GD8A 5FQQA 2JN7A 4E6XA 2H28A 4EBPA 3IXGA 4DE1A 1W63Q 2WGIA 1T1BA 2MJ6A 4FCFA 4WN5A 4U0TA 3T4QA 4MCWA 2BTFP 3AGEA 1FR6A 3VOLA 3Q7ZA 2G2WA 4O01A 3T1QB 3T1XA 1F98A 2H10A 4ID4A 1GA9A 4Q0IA 5EE8A 3TG9A 2M7UA 4N92A 1LL5A 1OTIA 1NRFA 4EUVA 4UHUA 1BULA 1LT0A 4G3KA 1WYBA 3V3SA 3F1OB 5EUAA 1XGJA 4HOIA 3A0VA 3C38A 2OWHA 1P97A 3SS3A 1SCWA 4R4RA 4GHIA 5E2EA 5GLBA 2XSSA 1E3UD 3KYEA 2KX6A 1M40A 4FTXA 3A3DA 1LL8A 3OZHA 1PZPA 2ZC3B 3FKWA 1BLSA 4Q0JA 1ALQA 2J3TD 4QHCA 4OQGA 1TS6A 1DP9A 1K25A 3G32A 4RX3A 3LIDA 4LENA 4EU0A 4IVKA 5I5LA 4E3KA 1Y54A 1EW0A 2P74A 1K38A 2QJ7A 1IOUA 1BT5A 5HPFA 2WKEA 5LBRA 2KLIA 4PM7A 3LEZA 3WS0A 1VB6A 4DRTA 4BL3A 4LGWA 1OMEA 1BYWA 2XR0A 2HGVA 2PR6A 1SKOA 2B02A 4ESPA 2FH5A 4KZ3A 4EEPA 2HDSA 2PD8A 5CX7A 3T1RA 5HAIA 1YLYA 4PM8A 5CGXA 2PU4A 4IUKA 1RP5A 2HZ5A 3HLEA 2KDKA 2EX8A 4EQ1A 1W79A 1XFNA 2HJ9C 4MBKA 4BBVA 1PFLA 1F5MA 2RL3A 3KSGA 4GHIB 4E3IA 1N9NA 3Q07A 1YLTA 1XJ3A 2WGVA 3ZNYA 1XGIA 4EUZA 5FI7A 1J9MA 1IKGA 3VFHA 2XDMA 4QPRA 2L1MA 1G5UA 1K57C 4UQIS 2HJEA 3OLOA 1SHVA 5KMWA 3IT9A 5DJTA 4F94A 4OH0A 3LY4A 2K31A 3GSGA 3QP8A 2HDRA 3G4PA 3LY3A 4JKTA 3G2YA 2GZAA 2XROA 4ZRRA 3ITBA 3WS2A 3MQQA 3UNWA 5GLAA 4ARZB 5A93A 2ZD8A 4EEUA 4NXEA 5GLDA 3UDIA 1QMEA 4RVAA 1MC0A 4K0WA 1K56D 1SKOB 3MZFA 4K91A 3WS1A 1BZAA 1DJBA 1IYQA 4HHDA 4X25A 3HL9A 3AGDA 4DJ2A 2HDQA 4C75A 2W1TA 4IBRA 4ZBEA 4BD1A 5EVIA 2VGLS 3TW8A 4JGPA 5KZHA 4UAAA 3CHWP 3A3JA 1PZOA 4DXBA 3H7WA 1V9YA 1YLWA 4HY8A 4S2NC 3A3EA 3GVBA 2ZQCA 3IWIA 1ESUA 4QU3A 4NXGA 2WKPA 2XD5A 3NBLA 3LGOA 4KZBA 3T50A 3ZGAB 3MXRA 4DKIA 3GMWA 1LLBA 2P08A 4X69A 1LHYA 4LLOB 3T4LA 3PHYA 4S2KA 2EWWA 3UE1A 1BSGA 1NYYA 3DTEA 4UQIM 1F2KA 1KGFA 1JWZA 5FEFA 3IBJA 3V5MA 3UPOA 1EI5A 3E4OA 1JTDA 3ZG5A 4OOLA 2ZM8A 5EVLA 4WMCD 4E3MA 3VP3A 3LEQA 2VGKA 1KGGA 4UEYA 1EWZA 1EROA 3T1SA 1GHIA 2QKPA 2HP5A 5GHXA 2OLVA 3CITA 4E3JA 3TRCA 2XQZA 2W1TB 1PI4A 1YLPA 3N8RA 5EVIB 2O99A 3C4PA 5EECA 1I2WA 4FD8A 2OLUA 4KENB 4X68A 3LI9A 2RCXA 3HREA 2VGLM 3WWXA 3H7WB 4I3IA 5HDDA 4WLAA 2NUTC 4BMWA 1KE0A 5M19A 3RFBA 2VX8A 1Q2QA 5CHUA 2Y59A 3SH7A 3PXPA 4EBNA 1KE4A 4AFIA 3V50A 2V1AA 4HBTA 2EXAA 3BQAA 5J4EA 3PTEA 1GSXA 2W3GA 3MXQA 4R4SA 1V9ZA 2HP9A 2Z2LB 1XJ6A 1KE3A 3S22A 2ZC6B 3KSFA 4ZJ3A 1YLZA 2IA2A 3RXXA 5HD3A 3S7PA 2W1RA 2DMWA 1XP4A 1K0KA 1XFQA 3NY4A 3ISGA 1GCEA 3WRTA 4ETZA 4GCZA 1GSWA 1L3LA 5C5KA 2L0WA 1J3WA 2GDNA 5L09A 2QWSA 2V8CA 5JYOA 3FG8A 1LSWA 2JC7A 2IWBA 3ZHHA 3JYIA 1ES5A 4F3LB 1YQSA 3LIFA 4NXBA 1FOFA 5CHMA 3UN7A 1LSXA 4Y2FA 1VEUA 1YAXA 5FL3A 1Q2PA 5IS1A 4DE0A 2EFUA 4LRYC 5HZHA 5DTTA 3C7UA 4DXCA 1UGUA 1CF0A 4WELA 2EWVA 2P9VB 4WEJA 3U4LP
chains in the Genus database with same CATH topology
5IU1A 3A0RA 3H82A 2Z6CA 2JN7A 2H28A 3KYQA 2CMNA 3LR5A 3KX0X 3CUEC 2A24B 1W63Q 2K7SA 3LIEA 3C8CA 1OT9A 2ZOIA 1T1BA 2MJ6A 3ULFA 4WN5A 3T4QA 3NJAA 1LSVA 4MCWA 3NHQA 4F3LA 5HL6A 3H9WA 1NLYA 3VOLA 4DMZA 1UWPX 5K5BA 4O01A 3E4PA 1DP6A 2VZWA 2PR5A 3LR3A 1XJ4A 3TJZC 4EETB 1G6OA 2O9CA 1F98A 3R7WB 3LR4A 4I39A 4JGOA 4Q0IA 2L4RA 3PBQA 2M7UA 4RQ9A 1OTIA 2XA7M 2FZ0A 4EUVA 5F5YA 1LT0A 1TS7A 4G3KA 4LRXC 3OC2A 1OJ5A 3F1OB 1NWZA 4CLCB 2VJWA 2PHYA 4HOIA 3P01A 4R6LA 4I5SA 4LPZA 4YNRA 3MF0A 2J80A 3A0VA 4HJ4A 3T4SA 3C38A 2OWHA 1P97A 2ZMFA 2A24A 2VA0A 4GHIA 2PD7A 2XSSA 4HH2A 4EW7A 2KX6A 3B47A 2J3WA 5A8BA 5F6AA 1LL8A 5MC7A 3PBSA 1UWNX 2GJ3A 4Z1WA 1JNUA 4Q0JA 2J3TD 4HQAA 1TS6A 1DP9A 2JKTI 3ZYTA 3LIDA 4HJ3A 5L8MA 3CAXA 4BBUA 4EU0A 4L9GA 5I5LA 4I3JA 2QJ5A 1EW0A 1GSVA 2QJ7A 1IOUA 5HPFA 3EGDC 2VV7A 4NKPA 5LBRA 2KLIA 3BQ8A 1VB6A 3E0YA 4EESA 5TBMA 3UB6A 3E4QA 2W3HA 5J3WA 1BYWA 3D72A 3S7NA 3S7OA 2K2NA 5HWWA 3TE8A 2OOLA 5DFYA 1STZA 3LIBA 2HGVA 2PR6A 3C30A 2B02A 4H6JA 3C2WA 4II7A 2FH5A 1OT6A 4O0PA 2V9AA 4KUOA 5EFWA 3LUQA 4GW9A 4HNBA 4EEPA 2PD8A 3B42A 5CX7A 2VEAA 5DJUA 4DN0A 3LYXA 3PYPA 4MDZA 2WKQA 4IUKA 2W27A 3KO6A 2V0WA 2KDKA 3NOTC 4EQ1A 3UB7A 1XFNA 4HP9A 2HJ9C 4BBVA 3VE4A 1S4SA 1F5MA 3KSGA 4GHIB 4IHQA 1T19A 3F1PB 3LI8A 1N9NA 1OJGA 2A2LA 1XJ3A 2INWA 2WKRA 4WEKA 1DRMA 3BWLA 5HSQA 2YKHA 3EGXC 2HF6A 2W0NA 4I38A 4IJGA 4QPRA 5F68A 1TS0A 2D01A 2L1MA 1YKDA 4MN7A 3PBOA 4R70A 4UQIS 4L9FA 3EEAA 2HJEA 3OLOA 5DJTA 2M1CA 3KYZA 2VLGA 1OPXA 4DJ3A 2K31A 3K3DA 2I9VA 1P9WA 5F69A 5HDSA 3MR0A 4GLQA 5DFXA 2G7UA 2GZAA 2XROA 4HJ6A 4ZRRA 5TBMB 3NOPC 4HH3A 4XT2A 3MQQA 4ARZB 3NOUC 4L9EA 4EEUA 2JHEA 4NXEA 3LR0A 3RTYA 1WA9A 2W3FA 1S66L 3EWKA 3F1PA 1MC0A 4H6JB 2OAP1 3E98A 2B18A 3BY9A 3MMHA 3OBFA 2W3EA 3OCLA 1KOUA 3D3OA 3OOVA 4HHDA 4P6ZS 4NEED 3KSIA 4PHTA 5AVFA 4DJ2A 1TD5A 2LB9A 3UB8A 2W1TA 3LICA 5DF9A 1D7EA 2KOIA 2VGLS 4L0LA 3TW8A 2JKRI 3U2AA 1OTAA 4JGPA 4KQOA 3H7WA 3MJQA 1V9YA 4PKYG 5AJGA 1XJ2A 4HY8A 2JKTM 1F9IA 1ZHHB 4FOFA 4Y3IA 4YOFA 3EEHA 5G4YA 3UMDA 1W63M 4WL9A 2WKPA 4NXGA 4PKYA 4ME4A 3T50A 2XRNA 4ARZA 3UE6A 2P08A 4ETXA 5KIZA 3VV4A 3B33A 3OCNA 3G6OA 5J7EA 4LLOB 3PR6A 3T4LA 3PHYA 2PDRA 1NRJA 3V67A 5KSHA 1X0OA 2EWWA 3BW6A 3MQ0A 2W3DA 5IT5A 4CLCC 4GS9B 4UQIM 4WUJA 2Z6DA 3FPWA 3PBRA 2BASA 1P0ZA 2ZOHA 3IBJA 3K3CA 3F1NB 4NXFA 4HIAA 3E4OA 4XT2B 1YSQA 4O8GA 4OOLA 3CUEA 4WF0A 1Y28A 1YSPA 4JGQA 3HJKA 3UB9A 1H8MA 3HJIA 5HWTA 5HPIA 3MFXA 4Y5FA 3RH8B 3DBAA 2O9BA 1S1ZA 3GDIA 4B9OA 4UEYA 2VV8A 4HP4A 4IUHA 2QKPA 3LIAA 3CITA 4Q0HA 4MN5A 3TRCA 1S4RA 3T4JA 1P9RA 3CI6A 2W1TB 4R38A 2Y79A 3ICYA 1VHMA 3UE3A 1S67L 3FC7A 4P6ZM 2O99A 4HI4A 3CLOA 1S1YA 2ZBBA 2OWJA 1MKMA 5DKLA 3T4TA 4E04A 3LI9A 3JVVA 4GS9A 2VGLM 3BY8A 3H7WB 4I3IA 3A0SA 5HDDA 1N9LA 1N9OA 4WLAA 4KQDA 4BWIA 2NUTC 5DKKA 4BMWA 3F1NA 3K2NA 2V1BA 2M7VA 4G3VA 3RFBA 1TF1A 1OTBA 3S7QA 3SW1A 2VX8A 2GX5A 1T18A 3PXPA 4MMNA 2V0UA 2P7JA 1MZUA 4GJ4A 4MN6A 1G28A 2PYRA 3VE3A 3W2ZA 4AFIA 5HDCA 2OAQ1 3EOIA 2V1AA 2O9AA 4PAUA 5HWVA 2ZMVA 3GECA 3BQAA 5J4EA 1GSXA 2W3GA 3MXQA 1D06A 1V9ZA 1XJ6A 1DP8A 2LB5A 4B93A 1TS8A 2YKFA 4CLCE 3PBNA 1NLZA 3KSFA 2IA2A 5HD3A 2J3TC 3S7PA 2W1RA 1T1CA 2DMWA 2VKSA 3IS2B 1XFQA 4YWZA 2JKRM 2XA7S 3JVUA 3KSHA 4M4XA 2QHKA 3ZQ5A 4ETZA 3R7WA 4GCZA 3FPVA 1GSWA 2QYBA 3H82B 5C5KA 4BJPA 2L0WA 1ODVA 2O0YA 2QWSA 3LFVA 3R4KA 4OOMA 4JGRA 3CWFA 4EERA 3FG8A 1OTEA 1LSWA 5HD5A 2PT7A 5AVEA 3T4KA 3F1OA 1ZTUA 3BJNA 4CLCA 4F3LB 2Y8HA 2NUPC 5TJJA 3LIFA 2HV1A 3IBRA 3UMEA 2R78A 2VV6A 3MQOA 4G3WA 3O5YA 4NXBA 2PYPA 2P04A 4CLCD 3EQUA 1IFQA 2GNXA 1H3QA 4BBTA 1LSXA 4Y2FA 1YAXA 1OTDA 4R3AA 4FSFA 5FL3A 4K08A 3EQVA 3HCYA 4LRZE 4EXOA 5IS1A 3PBTA 4LRYC 3T4OA 5HZHA 1UGUA 4I3AA 4WELA 4CQHA 2D02A 5G4ZA 4KUKA 2EWVA 4WEJA 3IS2A 3P7NA 1T1AA 2EA9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IU1 A;  3A0R A;  3H82 A;  2Z6C A;  2JN7 A;  2H28 A;  2CMN A;  3KX0 X;  2A24 B;  2K7S A;  3LIE A;  3C8C A;  1OT9 A;  2ZOI A;  1T1B A;  3ULF A;  4WN5 A;  3NJA A;  1LSV A;  4F3L A;  3NHQ A;  3H9W A;  3VOL A;  1UWP X;  3E4P A;  1DP6 A;  2PR5 A;  1XJ4 A;  4EET B;  1F98 A;  4I39 A;  4JGO A;  2L4R A;  4RQ9 A;  1OTI A;  5F5Y A;  1LT0 A;  1TS7 A;  4LRX C;  1OJ5 A;  3F1O B;  1NWZ A;  2PHY A;  4HOI A;  4R6L A;  4I5S A;  4LPZ A;  2J80 A;  3A0V A;  4HJ4 A;  2OWH A;  1P97 A;  2A24 A;  4GHI A;  2PD7 A;  4HH2 A;  4EW7 A;  2KX6 A;  5A8B A;  5F6A A;  1LL8 A;  1UWN X;  2GJ3 A;  1JNU A;  4HQA A;  1TS6 A;  1DP9 A;  3LID A;  4HJ3 A;  3CAX A;  4BBU A;  4L9G A;  5I5L A;  4I3J A;  2QJ5 A;  1EW0 A;  1GSV A;  2QJ7 A;  2VV7 A;  1VB6 A;  4EES A;  5TBM A;  3UB6 A;  3E4Q A;  5J3W A;  1BYW A;  3D72 A;  5HWW A;  2OOL A;  3LIB A;  2PR6 A;  2B02 A;  4H6J A;  3C2W A;  1OT6 A;  2V9A A;  4KUO A;  5EFW A;  3LUQ A;  4GW9 A;  4HNB A;  4EEP A;  2PD8 A;  2VEA A;  5DJU A;  3LYX A;  3PYP A;  2WKQ A;  2W27 A;  2V0W A;  2KDK A;  3NOT C;  4EQ1 A;  3UB7 A;  1XFN A;  4HP9 A;  4BBV A;  3VE4 A;  1S4S A;  4GHI B;  1T19 A;  3F1P B;  3LI8 A;  1N9N A;  1OJG A;  1XJ3 A;  2INW A;  2WKR A;  1DRM A;  3BWL A;  5HSQ A;  2YKH A;  2W0N A;  4I38 A;  5F68 A;  1TS0 A;  2D01 A;  2L1M A;  4R70 A;  4L9F A;  3OLO A;  5DJT A;  2M1C A;  2VLG A;  4DJ3 A;  3K3D A;  2I9V A;  5F69 A;  5HDS A;  3MR0 A;  4HJ6 A;  5TBM B;  3NOP C;  4HH3 A;  4XT2 A;  3MQQ A;  3NOU C;  4L9E A;  4EEU A;  2JHE A;  4NXE A;  3RTY A;  1WA9 A;  1S66 L;  3EWK A;  3F1P A;  4H6J B;  3BY9 A;  1KOU A;  4HHD A;  5AVF A;  4DJ2 A;  3UB8 A;  3LIC A;  1D7E A;  1OTA A;  4JGP A;  3H7W A;  3MJQ A;  1V9Y A;  4PKY G;  1XJ2 A;  4HY8 A;  1F9I A;  5G4Y A;  3UMD A;  3EEH A;  4WL9 A;  2WKP A;  4NXG A;  4PKY A;  3T50 A;  3UE6 A;  5KIZ A;  3B33 A;  3G6O A;  5J7E A;  4LLO B;  3PHY A;  2PDR A;  1X0O A;  4GS9 B;  4WUJ A;  2Z6D A;  2BAS A;  1P0Z A;  2ZOH A;  3K3C A;  3F1N B;  4NXF A;  4HIA A;  3E4O A;  4XT2 B;  4WF0 A;  1Y28 A;  4JGQ A;  3UB9 A;  3HJK A;  3HJI A;  5HWT A;  3MFX A;  3RH8 B;  1S1Z A;  3GDI A;  4B9O A;  2VV8 A;  4HP4 A;  2QKP A;  3LIA A;  4MN5 A;  1S4R A;  4R38 A;  3ICY A;  1S67 L;  3FC7 A;  4HI4 A;  3CLO A;  1S1Y A;  2ZBB A;  2OWJ A;  5DKL A;  4E04 A;  3LI9 A;  4GS9 A;  3BY8 A;  3H7W B;  4I3I A;  3A0S A;  5HDD A;  1N9L A;  1N9O A;  4WLA A;  4KQD A;  5DKK A;  3F1N A;  2V1B A;  1OTB A;  3SW1 A;  1T18 A;  2V0U A;  2P7J A;  1MZU A;  4MN6 A;  1G28 A;  2PYR A;  3VE3 A;  5HDC A;  2V1A A;  5HWV A;  3GEC A;  5J4E A;  1GSX A;  3MXQ A;  1D06 A;  1V9Z A;  1XJ6 A;  1DP8 A;  1TS8 A;  2YKF A;  5HD3 A;  1T1C A;  3IS2 B;  1XFQ A;  4YWZ A;  4M4X A;  2QHK A;  3ZQ5 A;  4GCZ A;  1GSW A;  3H82 B;  2L0W A;  1ODV A;  2QWS A;  4JGR A;  3CWF A;  4EER A;  3FG8 A;  1OTE A;  1LSW A;  5HD5 A;  5AVE A;  3F1O A;  4F3L B;  3LIF A;  2HV1 A;  3IBR A;  3UME A;  2R78 A;  2VV6 A;  3MQO A;  4NXB A;  2PYP A;  4BBT A;  1LSX A;  1OTD A;  4R3A A;  4K08 A;  4LRZ E;  4EXO A;  5IS1 A;  4LRY C;  5HZH A;  1UGU A;  4I3A A;  2D02 A;  5G4Z A;  4KUK A;  3IS2 A;  3P7N A;  1T1A A;  2EA9 A; 
#chains in the Genus database with same CATH topology
 5IU1 A;  3A0R A;  5M18 A;  1TVF A;  2Z6C A;  3G30 A;  5IHV A;  2Y2H A;  5EOO A;  2C6W B;  1OT9 A;  3NEC A;  3ULF A;  5HL6 A;  1VET B;  3E4P A;  1ONG A;  1DP6 A;  3ITA A;  3ZG7 B;  2VGJ A;  1IEL A;  1FQG A;  3HVF A;  1RCJ A;  4P87 A;  2Y2J A;  2JE5 A;  5HAQ A;  1PWD A;  3PBQ A;  5J8X A;  2OSU A;  2FZ0 A;  4YIN A;  1TS7 A;  4OP5 A;  3OC2 A;  1OJ5 A;  3UPN A;  1NWZ A;  4R3B A;  1ES4 A;  5TGF A;  4N1H A;  5HAR A;  2X71 A;  3QP5 A;  5FQJ A;  3MF0 A;  4E3O A;  4Y17 A;  4ZTK A;  3UE0 A;  4KQR A;  4LCM A;  5F82 A;  1L0F A;  2Y55 A;  2QZ6 A;  4HH2 A;  2VK3 A;  1QMF A;  4KZ7 A;  5FI2 A;  3M6H A;  2J3W A;  2V20 A;  3IXD A;  5F6A A;  4JXW A;  5CXW A;  2WAE A;  5MC7 A;  5EM0 A;  3W4P A;  1JNU A;  4GD6 A;  5FDS A;  4OKP A;  1K4F A;  4KZA A;  1CK3 A;  5L8M A;  1MBL A;  3M6B A;  4I3J A;  2QJ5 A;  1GSV A;  3DW0 A;  1W5D A;  1PI5 A;  3OPL A;  2ACG A;  1YMS A;  4EES A;  3CPT B;  2UWX A;  3E4Q A;  2WKH A;  1TEM A;  5J3W A;  3QNB A;  3D72 A;  3S7N A;  4R0Q A;  5AQB A;  5HWW A;  5CER A;  1STZ A;  3C30 A;  1E25 A;  3G34 A;  4DE3 A;  4O0P A;  2V9A A;  2Y2N A;  4KUO A;  3B42 A;  3GV9 A;  3SZT A;  5E43 A;  2VEA A;  3M2K A;  3SH8 A;  5HFO A;  4MDZ A;  2ZC7 A;  3KO6 A;  4Y0T A;  2WZX A;  3NOT C;  1FCO A;  2Y2M A;  1S4S A;  3IHA A;  1T19 A;  3LI8 A;  4IVI A;  4BQM A;  3IX8 A;  3G31 A;  2INW A;  2WKR A;  1DRM A;  3BWL A;  5HSQ A;  2YKH A;  2WAD A;  1YMX A;  3EGX C;  2HF6 A;  1ZG6 A;  1TS0 A;  1YKD A;  2ZQD A;  3PBO A;  1M6K A;  1SZV A;  3EEA A;  2Y2K A;  1TDL A;  2HPB A;  3KYZ A;  1ACF A;  2I9V A;  4OLD A;  4X6T A;  2ZQ9 A;  3D9Y A;  5E2H A;  4HH3 A;  4UA9 A;  4WZ5 C;  4XT2 A;  3UB5 P;  4IBX A;  1AWI A;  3NOU C;  4L9E A;  1BLH A;  3LR0 A;  3RTY A;  3BFC A;  2W3F A;  1S66 L;  2ZL1 A;  3E98 A;  2B18 A;  3BY9 A;  5CRF A;  2W3E A;  3OCL A;  4NK3 A;  1KOU A;  3C7V A;  1JTG A;  3OOV A;  3ZNT A;  5AVF A;  2XFS A;  1K54 A;  3UB8 A;  2HP6 A;  1Z09 A;  2KOI A;  4OPQ A;  1WYC A;  2J7V A;  3BM6 A;  3MJQ A;  1XJ2 A;  5EOE A;  2JKT M;  4R1G A;  1ZHH B;  4Y3I A;  2XH9 A;  4WL9 A;  4PKY A;  2JCH A;  5CGS A;  4ARZ A;  3UE6 A;  3VSL A;  4N9K A;  2WUQ A;  4P0M A;  1WE4 A;  1PWC A;  3BRM A;  3PAG A;  4E6W A;  3B33 A;  5J7E A;  5KSC A;  1CQA A;  3PR6 A;  3ZFZ A;  3O88 A;  1L0E A;  1NRJ A;  5FAT A;  5KSH A;  1X0O A;  3BW6 A;  5GHZ A;  3MQ0 A;  5DF7 A;  2Y2O A;  4WUJ A;  4GDN A;  1K6S A;  2Z6D A;  4S2M A;  5FQK A;  3F1N B;  4KZ4 A;  4NXF A;  4XT2 B;  4JBF A;  3CUE A;  3UB9 A;  1H8M A;  1MWS A;  5HPI A;  4OOY A;  2ZL1 B;  3DBA A;  2ZJ9 A;  4U3T A;  1O7E A;  1S1Z A;  4B9O A;  3UDF A;  4IUH A;  3T4J A;  1YT4 A;  2G2U A;  3OPH A;  2Y79 A;  3FC7 A;  4BD0 A;  4N1X A;  2WZZ A;  1MKM A;  3L7H A;  5U47 A;  2A3U A;  4KQD A;  4BWI A;  5TR7 A;  5F83 A;  5AQ9 A;  3N6I A;  2M7V A;  3MFD A;  3S4X A;  3S7Q A;  5A92 A;  1YM1 A;  3A3I A;  1T18 A;  4MMN A;  1MZU A;  2V2F F;  1L0G A;  2Y2G A;  4JF5 A;  3W2Z A;  5HDC A;  4WBG A;  3BEC A;  5EV0 A;  3IF6 A;  5L07 A;  4S2O A;  1H8Z A;  3RXW A;  4B93 A;  4IED A;  4E3N A;  3E2L A;  3MKF A;  2PBY A;  2XK1 A;  4CLC E;  1NLZ A;  2V1Z A;  3T12 B;  2BG1 A;  4DF6 A;  1W8Q A;  1CI8 A;  3IWO A;  2FFY A;  5DF8 A;  2VKS A;  1W7F A;  1K54 C;  3KSH A;  3VOY A;  3G35 A;  3R7W A;  1ZG4 A;  2QYB A;  3H82 B;  4BJP A;  3FKV A;  3BEB A;  3LFV A;  3CWF A;  1K55 A;  1OTE A;  1DY6 A;  2PT7 A;  3T4K A;  2DCF A;  3QP1 A;  1ZTU A;  4X1M A;  3BJN A;  4CLC A;  3DAV A;  2Y8H A;  2NUP C;  3IBR A;  2R78 A;  2VV6 A;  3O5Y A;  2PYP A;  3BLS A;  1IFQ A;  4BBT A;  4R3A A;  4FSF A;  3HCY A;  2CC1 A;  1XA1 A;  4D60 A;  5CED A;  3MBZ A;  3T4O A;  3N8L A;  4OPZ A;  1T1A A;  4KZ6 A;  4FH4 A;  2I72 A;  3IF6 B;  4BL2 A;  5D3O A;  3VSK A;  2CMN A;  1ONH A;  3KX0 X;  3CUE C;  2A24 B;  2K7S A;  4XUX A;  2ZOI A;  3VP0 A;  2ZLY A;  1XKZ A;  4F3L A;  3NHQ A;  3FZC A;  4A5R A;  3H9W A;  5HL1 A;  5CTN A;  4LV3 A;  2JKF A;  4K0X A;  5K5B A;  1MWT A;  4QY5 A;  2VZW A;  1XJ4 A;  4R23 A;  2O9C A;  3R7W B;  3LR4 A;  1NZO A;  1E4D A;  2L4R A;  4OPR A;  4M3K A;  2B95 A;  4MBH A;  2JBF A;  3FV7 A;  4RQ9 A;  4P6B A;  5F1F A;  1MY8 A;  5F5Y A;  2XFT A;  4PMA A;  3GR2 A;  3P98 A;  4CLC B;  2VJW A;  3QP6 A;  2P9V A;  4I5S A;  3VP4 A;  4LPZ A;  1KVM A;  4HES A;  4DDY A;  1PW8 A;  2J80 A;  5BOH A;  1E3U A;  5DVA A;  4B4Z A;  1XXM A;  2PD7 A;  4EW7 A;  2C5W B;  1D1J A;  1VET A;  5A8B A;  4E3L A;  3QHY A;  1UWN X;  4Z1W A;  1LL9 A;  4HQA A;  3NC8 A;  2JKT I;  5EVI C;  1PIO A;  3PAE A;  4BBU A;  3TSG A;  3VP1 A;  4B4X A;  1KDS A;  2EXB A;  3TOI A;  3NDG A;  3EGD C;  2VV7 A;  2ZQ7 A;  3NI9 A;  3FWL A;  3BQ8 A;  3E0Y A;  2W3H A;  3B3X A;  3C4O A;  5G18 A;  4C3Q A;  2K2N A;  2OOL A;  5DFY A;  3QP2 A;  4HEF A;  4DE2 A;  1K55 C;  5FEG A;  1JWP A;  5EM1 A;  3IX4 A;  5EFW A;  4GW9 A;  4HNB A;  3HLD A;  5DJU A;  4R3J A;  3PYP A;  1GHP A;  2WKQ A;  2H5S A;  4ZAM A;  1PNE A;  2DNS A;  1ERQ A;  5CEB A;  2ZM0 A;  3VE4 A;  4S2J A;  3F1P B;  1OJG A;  3UDX A;  4EQI A;  1RGY A;  4WEK A;  2ZQ8 A;  4GZB A;  3CPT A;  2Y2L A;  4WYY A;  4EWF A;  3N8S A;  2PBD P;  2W0N A;  4I38 A;  4IJG A;  1LI9 A;  2AVX A;  3N7W A;  4OQH A;  3NDE A;  4N9L A;  1FCM A;  4S2P A;  4QWO A;  3DWZ A;  2M1C A;  2VLG A;  4DJ3 A;  5AQ7 A;  1P9W A;  3Q7V B;  5DFX A;  2G7U A;  1HZO A;  4HJ6 A;  5EVE A;  1IEM A;  3NOP C;  1K56 A;  2WKI A;  1PYY A;  2JHE A;  4UA7 A;  4LCL A;  2ZMA A;  5DTK A;  2OV5 A;  1IYO A;  4QD4 A;  3V3R A;  4JXV A;  3D3O A;  3HLB A;  4P6Z S;  4JXS A;  3HLW A;  3KSI A;  4P85 A;  2LB9 A;  4MNR A;  3M2J A;  3LIC A;  5DF9 A;  3SS5 A;  3VP2 A;  4LV2 A;  1D7E A;  3W8K A;  4EV4 A;  5TFQ A;  3GRJ A;  5FAS A;  4GKU A;  4KQO A;  2EX2 A;  1NXY A;  3NCK A;  3Q1F A;  3ZG0 A;  4PKY G;  4MLL A;  1F9I A;  3UMD A;  4YOF A;  3Q82 A;  1H5X A;  1W63 M;  1FIK A;  4ME4 A;  2XRN A;  3HBR A;  1RGZ A;  3VV4 A;  3G6O A;  3QNC A;  5E2F A;  3ZVT A;  3V67 A;  2W3D A;  2XLN A;  5IT5 A;  4GS9 B;  4O7D A;  3ZDJ A;  5AQA A;  3W4Q A;  1FR1 A;  3PBR A;  3O86 A;  2BAS A;  3S1Y A;  3CZD A;  3K3C A;  4OON A;  4BEN A;  4WMC A;  4HIA A;  1KGE A;  1YSQ A;  4O8G A;  1PWG A;  5A91 A;  4WF0 A;  5HWT A;  4JLF A;  5CGW A;  3BFF A;  3RH8 B;  2O9B A;  1FSW A;  3GDI A;  2V8F A;  2VV8 A;  1DJA A;  5A90 A;  4NET A;  3LIA A;  3VOZ A;  4LV1 A;  4PM9 A;  1S4R A;  2PAV P;  5DTS A;  4XXR A;  3ICY A;  1VHM A;  3UE3 A;  1K57 A;  3JPU A;  4P6Z M;  1YLJ A;  3WRZ A;  2OWJ A;  2H0Y A;  3T4T A;  4E04 A;  4Y13 A;  4KG6 A;  3BY8 A;  3A0S A;  2PU2 A;  1N9L A;  4UA6 A;  1FCN A;  1MWU A;  3F1N A;  1ERM A;  3WS5 A;  4GDB A;  4HBU A;  5CHJ A;  3SW1 A;  3VMA A;  2GX5 A;  4S2I A;  2XF3 A;  2V0U A;  4OLG A;  4BLM A;  3VE3 A;  4X1L A;  3EOI A;  1DJC A;  3OPR A;  2ZMV A;  2Y4A A;  1FIL A;  1SDE A;  2R9X A;  3MZE A;  1IKI A;  1DP8 A;  2LB5 A;  1SKF A;  1TS8 A;  2YKF A;  1L0D A;  3IH8 A;  1ZKJ A;  4S2N A;  4ZJ2 A;  1SDN A;  2J9P A;  3IS2 B;  2JKR M;  2XA7 S;  3JVU A;  4M4X A;  2QHK A;  3ZQ5 A;  3FPV A;  1ODV A;  1YPR A;  1L2S A;  4OOM A;  4JGR A;  3IXH A;  3W4O A;  2HV1 A;  3FYZ A;  3UME A;  4G3W A;  4JXG A;  3GTC A;  3EQU A;  4LFU A;  1XX2 A;  1BLP A;  2FFF B;  1XA7 A;  3MZD A;  4K08 A;  3UO9 A;  4KZ8 A;  5GL9 A;  4LRZ E;  4EXO A;  3MSH A;  3PBT A;  4OVD A;  4KZ5 A;  4WZ4 A;  3ZCZ A;  4QB8 A;  4DDS A;  1KDW A;  4CQH A;  5G4Z A;  4KUK A;  3DTI A;  1I2S A;  1ZC2 A;  3P7N A;  3BYD A;  1IYS A;  1N4O A;  3IQA A;  3H82 A;  3KYQ A;  2J8Y A;  4PM5 A;  3LR5 A;  3VFF A;  5FI6 A;  2PRF A;  3LIE A;  3C8C A;  5CEC A;  1NYM A;  4C6Y A;  3NJA A;  1LSV A;  5FQI A;  1NLY A;  4DMZ A;  1PW1 A;  1UWP X;  2Q0O A;  1HTZ A;  2PR5 A;  3LR3 A;  3TJZ C;  4EET B;  1G6O A;  1S6R A;  1W8Y A;  4I39 A;  4JGO A;  1HVB A;  4RA7 A;  3BLM A;  3I7J A;  5L10 A;  1G6A A;  3WS4 A;  2XA7 M;  4LRX C;  3IXB A;  3LO7 A;  3NUL A;  2PHY A;  4R6L A;  3P01 A;  4YNR A;  3ZG8 B;  4HJ4 A;  3T4S A;  2QMI A;  2ZMF A;  2A24 A;  2VA0 A;  3QP4 A;  4GOG A;  3UPP A;  3A3F A;  2A49 A;  4Z9Q A;  3B47 A;  4MBF A;  1A0K A;  3PBS A;  2GJ3 A;  4KZ9 A;  1XPB A;  2Y91 A;  3ZYT A;  4ZJ1 A;  4HJ3 A;  1ES2 A;  3CAX A;  3OPP A;  1KVL A;  4L9G A;  1HLU P;  3MKE A;  1ESI A;  2E8J A;  4NKP A;  2B5R A;  3BFD A;  5FAO A;  4B88 A;  5L2F A;  5TBM A;  3UB6 A;  4U0X A;  3S7O A;  3TE8 A;  3IF5 A;  3LIB A;  3LCE A;  3IHB A;  1MWR A;  3CJM A;  4H6J A;  3C2W A;  3DWK A;  3BFE A;  4II7 A;  1OT6 A;  4Y7P A;  4CPK A;  3D4F A;  3LUQ A;  1N9B A;  5F1G A;  4DN0 A;  2H0T A;  3LYX A;  3HLG A;  2IWD A;  2W27 A;  1LI0 A;  2V0W A;  3UB7 A;  2XGN A;  4HP9 A;  1ES3 A;  4NG2 A;  3O3V A;  4IHQ A;  4OPY A;  2E8I A;  2A2L A;  2ZM2 A;  3V39 A;  2IWC A;  3MXS A;  4D2O A;  3P09 A;  3SS4 A;  4XUZ A;  4YFM A;  1PRQ A;  5F68 A;  2D01 A;  1MXO A;  4MN7 A;  4R70 A;  4GN2 A;  4L9F A;  1C3B A;  1G68 A;  1K4E A;  4H8R A;  1U60 A;  1OPX A;  5GHY A;  3K3D A;  2WYX A;  3AGF A;  5F69 A;  5HDS A;  1JWV A;  3MR0 A;  4GLQ A;  2QPN A;  2ZC5 B;  4JPM A;  5TBM B;  3HUM A;  1AXB A;  3G2Z A;  1MPL A;  5FSR A;  4OP8 A;  4EBL A;  1I5Q A;  4PM6 A;  1WA9 A;  3EWK A;  3F1P A;  5HX9 A;  3DTM A;  4H6J B;  2OAP 1;  1HD8 A;  1Z6F A;  3MMH A;  3OBF A;  1CEG A;  4NEE D;  4PHT A;  1TD5 A;  5I94 A;  5HAP A;  3L9K A;  3IF6 C;  2HDU A;  3CG5 A;  1CEF A;  1H0M A;  3DTK A;  4L0L A;  4Y0U A;  2JKR I;  2DRW A;  3U2A A;  1OTA A;  1BTL A;  2EX6 A;  3O87 A;  5AJG A;  2Z2M B;  3Q7V A;  5FA7 A;  2Y2I A;  4FOF A;  5G4Y A;  3EEH A;  4FH2 A;  2XEP A;  1NY0 A;  5E2G A;  4ETX A;  4Q8I A;  5KIZ A;  4QY6 A;  3NIA A;  3N4I A;  3OCN A;  4RYE A;  5CTM A;  2PDR A;  3Q81 A;  1VM1 A;  2XD1 A;  4CLC C;  3CMZ A;  2EFX A;  3FPW A;  5EPH A;  4JF6 A;  2EX9 A;  1TDG A;  1VQQ A;  1P0Z A;  2ZOH A;  4KQQ A;  1S0W A;  4S2L A;  2BLS A;  2WK0 A;  4X56 A;  2WGW A;  1Y28 A;  1YSP A;  4JGQ A;  3HJK A;  3HJI A;  5FQM A;  3MFX A;  4Y5F A;  5JYP A;  2Q9N A;  4HP4 A;  3IX3 A;  4Q0H A;  4MN5 A;  3HUO A;  1P9R A;  3CI6 A;  4R38 A;  3ZG9 B;  1S67 L;  3IH9 A;  4Y0O A;  3E2K A;  5FAQ A;  3ZVW A;  2Q9M A;  1MKI A;  2UV0 E;  3MS6 A;  3CLO A;  4HI4 A;  3RJU A;  1S1Y A;  2ZBB A;  5DKL A;  1NJ4 A;  3JVV A;  4GS9 A;  1IYP A;  1N9O A;  3SH9 A;  1FSY A;  5DKK A;  4WZ5 A;  3K2N A;  2V1B A;  4ZDX A;  4GB7 A;  4G3V A;  2WAF A;  4PPR A;  1CJF A;  1TF1 A;  1OTB A;  4Y15 A;  4X55 A;  3GQZ A;  5GLC A;  1BUE A;  2P7J A;  4GJ4 A;  4MN6 A;  1H8Y A;  1G28 A;  3HUN A;  2PYR A;  2OAQ 1;  4WM9 A;  3IWQ A;  4OQ0 A;  2O9A A;  4PAU A;  5HWV A;  3GEC A;  3SOI A;  1D06 A;  1VEU B;  1NZU A;  5M1A A;  2WGW B;  3PBN A;  5HW3 A;  5EVI D;  1O07 A;  2J3T C;  4MEZ A;  4FUW A;  1T1C A;  1GHM A;  2X01 A;  2R9W A;  4YWZ A;  5FAP A;  3HLC A;  4CJN A;  2O0Y A;  4RX2 A;  4GNU A;  3R4K A;  4KG5 A;  1GA0 A;  4X53 A;  4EER A;  2ZC4 B;  2ZQA A;  5HD5 A;  5AVE A;  1CI9 A;  3F1O A;  5FQ9 A;  3UY6 A;  1K6R A;  4JF4 A;  5TJJ A;  4QJG A;  3C5A A;  1Y4O A;  3MQO A;  4KG2 A;  2P04 A;  4CLC D;  4OQI A;  2GNX A;  1H3Q A;  1OTD A;  5FDH A;  2J9O A;  3EQV A;  2Y2P A;  1BLC A;  2Y2Q A;  4I3A A;  2JKG A;  2D02 A;  2X02 A;  1JVJ A;  3IS2 A;  2EA9 A;  3HLF A;  4LV0 A;  3BFG A;  4GD8 A;  5FQQ A;  2JN7 A;  4E6X A;  2H28 A;  4EBP A;  3IXG A;  4DE1 A;  1W63 Q;  2WGI A;  1T1B A;  2MJ6 A;  4FCF A;  4WN5 A;  4U0T A;  3T4Q A;  4MCW A;  2BTF P;  3AGE A;  1FR6 A;  3VOL A;  3Q7Z A;  2G2W A;  4O01 A;  3T1Q B;  3T1X A;  1F98 A;  2H10 A;  4ID4 A;  1GA9 A;  4Q0I A;  5EE8 A;  3TG9 A;  2M7U A;  4N92 A;  1LL5 A;  1OTI A;  1NRF A;  4EUV A;  4UHU A;  1BUL A;  1LT0 A;  4G3K A;  1WYB A;  3V3S A;  3F1O B;  5EUA A;  1XGJ A;  4HOI A;  3A0V A;  3C38 A;  2OWH A;  1P97 A;  3SS3 A;  1SCW A;  4R4R A;  4GHI A;  5E2E A;  5GLB A;  2XSS A;  1E3U D;  3KYE A;  2KX6 A;  1M40 A;  4FTX A;  3A3D A;  1LL8 A;  3OZH A;  1PZP A;  2ZC3 B;  3FKW A;  1BLS A;  4Q0J A;  1ALQ A;  2J3T D;  4QHC A;  4OQG A;  1TS6 A;  1DP9 A;  1K25 A;  3G32 A;  4RX3 A;  3LID A;  4LEN A;  4EU0 A;  4IVK A;  5I5L A;  4E3K A;  1Y54 A;  1EW0 A;  2P74 A;  1K38 A;  2QJ7 A;  1IOU A;  1BT5 A;  5HPF A;  2WKE A;  5LBR A;  2KLI A;  4PM7 A;  3LEZ A;  3WS0 A;  1VB6 A;  4DRT A;  4BL3 A;  4LGW A;  1OME A;  1BYW A;  2XR0 A;  2HGV A;  2PR6 A;  1SKO A;  2B02 A;  4ESP A;  2FH5 A;  4KZ3 A;  4EEP A;  2HDS A;  2PD8 A;  5CX7 A;  3T1R A;  5HAI A;  1YLY A;  4PM8 A;  5CGX A;  2PU4 A;  4IUK A;  1RP5 A;  2HZ5 A;  3HLE A;  2KDK A;  2EX8 A;  4EQ1 A;  1W79 A;  1XFN A;  2HJ9 C;  4MBK A;  4BBV A;  1PFL A;  1F5M A;  2RL3 A;  3KSG A;  4GHI B;  4E3I A;  1N9N A;  3Q07 A;  1YLT A;  1XJ3 A;  2WGV A;  3ZNY A;  1XGI A;  4EUZ A;  5FI7 A;  1J9M A;  1IKG A;  3VFH A;  2XDM A;  4QPR A;  2L1M A;  1G5U A;  1K57 C;  4UQI S;  2HJE A;  3OLO A;  1SHV A;  5KMW A;  3IT9 A;  5DJT A;  4F94 A;  4OH0 A;  3LY4 A;  2K31 A;  3GSG A;  3QP8 A;  2HDR A;  3G4P A;  3LY3 A;  4JKT A;  3G2Y A;  2GZA A;  2XRO A;  4ZRR A;  3ITB A;  3WS2 A;  3MQQ A;  3UNW A;  5GLA A;  4ARZ B;  5A93 A;  2ZD8 A;  4EEU A;  4NXE A;  5GLD A;  3UDI A;  1QME A;  4RVA A;  1MC0 A;  4K0W A;  1K56 D;  1SKO B;  3MZF A;  4K91 A;  3WS1 A;  1BZA A;  1DJB A;  1IYQ A;  4HHD A;  4X25 A;  3HL9 A;  3AGD A;  4DJ2 A;  2HDQ A;  4C75 A;  2W1T A;  4IBR A;  4ZBE A;  4BD1 A;  5EVI A;  2VGL S;  3TW8 A;  4JGP A;  5KZH A;  4UAA A;  3CHW P;  3A3J A;  1PZO A;  4DXB A;  3H7W A;  1V9Y A;  1YLW A;  4HY8 A;  4S2N C;  3A3E A;  3GVB A;  2ZQC A;  3IWI A;  1ESU A;  4QU3 A;  4NXG A;  2WKP A;  2XD5 A;  3NBL A;  3LGO A;  4KZB A;  3T50 A;  3ZGA B;  3MXR A;  4DKI A;  3GMW A;  1LLB A;  2P08 A;  4X69 A;  1LHY A;  4LLO B;  3T4L A;  3PHY A;  4S2K A;  2EWW A;  3UE1 A;  1BSG A;  1NYY A;  3DTE A;  4UQI M;  1F2K A;  1KGF A;  1JWZ A;  5FEF A;  3IBJ A;  3V5M A;  3UPO A;  1EI5 A;  3E4O A;  1JTD A;  3ZG5 A;  4OOL A;  2ZM8 A;  5EVL A;  4WMC D;  4E3M A;  3VP3 A;  3LEQ A;  2VGK A;  1KGG A;  4UEY A;  1EWZ A;  1ERO A;  3T1S A;  1GHI A;  2QKP A;  2HP5 A;  5GHX A;  2OLV A;  3CIT A;  4E3J A;  3TRC A;  2XQZ A;  2W1T B;  1PI4 A;  1YLP A;  3N8R A;  5EVI B;  2O99 A;  3C4P A;  5EEC A;  1I2W A;  4FD8 A;  2OLU A;  4KEN B;  4X68 A;  3LI9 A;  2RCX A;  3HRE A;  2VGL M;  3WWX A;  3H7W B;  4I3I A;  5HDD A;  4WLA A;  2NUT C;  4BMW A;  1KE0 A;  5M19 A;  3RFB A;  2VX8 A;  1Q2Q A;  5CHU A;  2Y59 A;  3SH7 A;  3PXP A;  4EBN A;  1KE4 A;  4AFI A;  3V50 A;  2V1A A;  4HBT A;  2EXA A;  3BQA A;  5J4E A;  3PTE A;  1GSX A;  2W3G A;  3MXQ A;  4R4S A;  1V9Z A;  2HP9 A;  2Z2L B;  1XJ6 A;  1KE3 A;  3S22 A;  2ZC6 B;  3KSF A;  4ZJ3 A;  1YLZ A;  2IA2 A;  3RXX A;  5HD3 A;  3S7P A;  2W1R A;  2DMW A;  1XP4 A;  1K0K A;  1XFQ A;  3NY4 A;  3ISG A;  1GCE A;  3WRT A;  4ETZ A;  4GCZ A;  1GSW A;  1L3L A;  5C5K A;  2L0W A;  1J3W A;  2GDN A;  5L09 A;  2QWS A;  2V8C A;  5JYO A;  3FG8 A;  1LSW A;  2JC7 A;  2IWB A;  3ZHH A;  3JYI A;  1ES5 A;  4F3L B;  1YQS A;  3LIF A;  4NXB A;  1FOF A;  5CHM A;  3UN7 A;  1LSX A;  4Y2F A;  1VEU A;  1YAX A;  5FL3 A;  1Q2P A;  5IS1 A;  4DE0 A;  2EFU A;  4LRY C;  5HZH A;  5DTT A;  3C7U A;  4DXC A;  1UGU A;  1CF0 A;  4WEL A;  2EWV A;  2P9V B;  4WEJ A;  3U4L P; 
#chains in the Genus database with same CATH homology
 5IU1 A;  3A0R A;  3H82 A;  2Z6C A;  2JN7 A;  2H28 A;  3KYQ A;  2CMN A;  3LR5 A;  3KX0 X;  3CUE C;  2A24 B;  1W63 Q;  2K7S A;  3LIE A;  3C8C A;  1OT9 A;  2ZOI A;  1T1B A;  2MJ6 A;  3ULF A;  4WN5 A;  3T4Q A;  3NJA A;  1LSV A;  4MCW A;  3NHQ A;  4F3L A;  5HL6 A;  3H9W A;  1NLY A;  3VOL A;  4DMZ A;  1UWP X;  5K5B A;  4O01 A;  3E4P A;  1DP6 A;  2VZW A;  2PR5 A;  3LR3 A;  1XJ4 A;  3TJZ C;  4EET B;  1G6O A;  2O9C A;  1F98 A;  3R7W B;  3LR4 A;  4I39 A;  4JGO A;  4Q0I A;  2L4R A;  3PBQ A;  2M7U A;  4RQ9 A;  1OTI A;  2XA7 M;  2FZ0 A;  4EUV A;  5F5Y A;  1LT0 A;  1TS7 A;  4G3K A;  4LRX C;  3OC2 A;  1OJ5 A;  3F1O B;  1NWZ A;  4CLC B;  2VJW A;  2PHY A;  4HOI A;  3P01 A;  4R6L A;  4I5S A;  4LPZ A;  4YNR A;  3MF0 A;  2J80 A;  3A0V A;  4HJ4 A;  3T4S A;  3C38 A;  2OWH A;  1P97 A;  2ZMF A;  2A24 A;  2VA0 A;  4GHI A;  2PD7 A;  2XSS A;  4HH2 A;  4EW7 A;  2KX6 A;  3B47 A;  2J3W A;  5A8B A;  5F6A A;  1LL8 A;  5MC7 A;  3PBS A;  1UWN X;  2GJ3 A;  4Z1W A;  1JNU A;  4Q0J A;  2J3T D;  4HQA A;  1TS6 A;  1DP9 A;  2JKT I;  3ZYT A;  3LID A;  4HJ3 A;  5L8M A;  3CAX A;  4BBU A;  4EU0 A;  4L9G A;  5I5L A;  4I3J A;  2QJ5 A;  1EW0 A;  1GSV A;  2QJ7 A;  1IOU A;  5HPF A;  3EGD C;  2VV7 A;  4NKP A;  5LBR A;  2KLI A;  3BQ8 A;  1VB6 A;  3E0Y A;  4EES A;  5TBM A;  3UB6 A;  3E4Q A;  2W3H A;  5J3W A;  1BYW A;  3D72 A;  3S7N A;  3S7O A;  2K2N A;  5HWW A;  3TE8 A;  2OOL A;  5DFY A;  1STZ A;  3LIB A;  2HGV A;  2PR6 A;  3C30 A;  2B02 A;  4H6J A;  3C2W A;  4II7 A;  2FH5 A;  1OT6 A;  4O0P A;  2V9A A;  4KUO A;  5EFW A;  3LUQ A;  4GW9 A;  4HNB A;  4EEP A;  2PD8 A;  3B42 A;  5CX7 A;  2VEA A;  5DJU A;  4DN0 A;  3LYX A;  3PYP A;  4MDZ A;  2WKQ A;  4IUK A;  2W27 A;  3KO6 A;  2V0W A;  2KDK A;  3NOT C;  4EQ1 A;  3UB7 A;  1XFN A;  4HP9 A;  2HJ9 C;  4BBV A;  3VE4 A;  1S4S A;  1F5M A;  3KSG A;  4GHI B;  4IHQ A;  1T19 A;  3F1P B;  3LI8 A;  1N9N A;  1OJG A;  2A2L A;  1XJ3 A;  2INW A;  2WKR A;  4WEK A;  1DRM A;  3BWL A;  5HSQ A;  2YKH A;  3EGX C;  2HF6 A;  2W0N A;  4I38 A;  4IJG A;  4QPR A;  5F68 A;  1TS0 A;  2D01 A;  2L1M A;  1YKD A;  4MN7 A;  3PBO A;  4R70 A;  4UQI S;  4L9F A;  3EEA A;  2HJE A;  3OLO A;  5DJT A;  2M1C A;  3KYZ A;  2VLG A;  1OPX A;  4DJ3 A;  2K31 A;  3K3D A;  2I9V A;  1P9W A;  5F69 A;  5HDS A;  3MR0 A;  4GLQ A;  5DFX A;  2G7U A;  2GZA A;  2XRO A;  4HJ6 A;  4ZRR A;  5TBM B;  3NOP C;  4HH3 A;  4XT2 A;  3MQQ A;  4ARZ B;  3NOU C;  4L9E A;  4EEU A;  2JHE A;  4NXE A;  3LR0 A;  3RTY A;  1WA9 A;  2W3F A;  1S66 L;  3EWK A;  3F1P A;  1MC0 A;  4H6J B;  2OAP 1;  3E98 A;  2B18 A;  3BY9 A;  3MMH A;  3OBF A;  2W3E A;  3OCL A;  1KOU A;  3D3O A;  3OOV A;  4HHD A;  4P6Z S;  4NEE D;  3KSI A;  4PHT A;  5AVF A;  4DJ2 A;  1TD5 A;  2LB9 A;  3UB8 A;  2W1T A;  3LIC A;  5DF9 A;  1D7E A;  2KOI A;  2VGL S;  4L0L A;  3TW8 A;  2JKR I;  3U2A A;  1OTA A;  4JGP A;  4KQO A;  3H7W A;  3MJQ A;  1V9Y A;  4PKY G;  5AJG A;  1XJ2 A;  4HY8 A;  2JKT M;  1F9I A;  1ZHH B;  4FOF A;  4Y3I A;  4YOF A;  3EEH A;  5G4Y A;  3UMD A;  1W63 M;  4WL9 A;  2WKP A;  4NXG A;  4PKY A;  4ME4 A;  3T50 A;  2XRN A;  4ARZ A;  3UE6 A;  2P08 A;  4ETX A;  5KIZ A;  3VV4 A;  3B33 A;  3OCN A;  3G6O A;  5J7E A;  4LLO B;  3PR6 A;  3T4L A;  3PHY A;  2PDR A;  1NRJ A;  3V67 A;  5KSH A;  1X0O A;  2EWW A;  3BW6 A;  3MQ0 A;  2W3D A;  5IT5 A;  4CLC C;  4GS9 B;  4UQI M;  4WUJ A;  2Z6D A;  3FPW A;  3PBR A;  2BAS A;  1P0Z A;  2ZOH A;  3IBJ A;  3K3C A;  3F1N B;  4NXF A;  4HIA A;  3E4O A;  4XT2 B;  1YSQ A;  4O8G A;  4OOL A;  3CUE A;  4WF0 A;  1Y28 A;  1YSP A;  4JGQ A;  3HJK A;  3UB9 A;  1H8M A;  3HJI A;  5HWT A;  5HPI A;  3MFX A;  4Y5F A;  3RH8 B;  3DBA A;  2O9B A;  1S1Z A;  3GDI A;  4B9O A;  4UEY A;  2VV8 A;  4HP4 A;  4IUH A;  2QKP A;  3LIA A;  3CIT A;  4Q0H A;  4MN5 A;  3TRC A;  1S4R A;  3T4J A;  1P9R A;  3CI6 A;  2W1T B;  4R38 A;  2Y79 A;  3ICY A;  1VHM A;  3UE3 A;  1S67 L;  3FC7 A;  4P6Z M;  2O99 A;  4HI4 A;  3CLO A;  1S1Y A;  2ZBB A;  2OWJ A;  1MKM A;  5DKL A;  3T4T A;  4E04 A;  3LI9 A;  3JVV A;  4GS9 A;  2VGL M;  3BY8 A;  3H7W B;  4I3I A;  3A0S A;  5HDD A;  1N9L A;  1N9O A;  4WLA A;  4KQD A;  4BWI A;  2NUT C;  5DKK A;  4BMW A;  3F1N A;  3K2N A;  2V1B A;  2M7V A;  4G3V A;  3RFB A;  1TF1 A;  1OTB A;  3S7Q A;  3SW1 A;  2VX8 A;  2GX5 A;  1T18 A;  3PXP A;  4MMN A;  2V0U A;  2P7J A;  1MZU A;  4GJ4 A;  4MN6 A;  1G28 A;  2PYR A;  3VE3 A;  3W2Z A;  4AFI A;  5HDC A;  2OAQ 1;  3EOI A;  2V1A A;  2O9A A;  4PAU A;  5HWV A;  2ZMV A;  3GEC A;  3BQA A;  5J4E A;  1GSX A;  2W3G A;  3MXQ A;  1D06 A;  1V9Z A;  1XJ6 A;  1DP8 A;  2LB5 A;  4B93 A;  1TS8 A;  2YKF A;  4CLC E;  3PBN A;  1NLZ A;  3KSF A;  2IA2 A;  5HD3 A;  2J3T C;  3S7P A;  2W1R A;  1T1C A;  2DMW A;  2VKS A;  3IS2 B;  1XFQ A;  4YWZ A;  2JKR M;  2XA7 S;  3JVU A;  3KSH A;  4M4X A;  2QHK A;  3ZQ5 A;  4ETZ A;  3R7W A;  4GCZ A;  3FPV A;  1GSW A;  2QYB A;  3H82 B;  5C5K A;  4BJP A;  2L0W A;  1ODV A;  2O0Y A;  2QWS A;  3LFV A;  3R4K A;  4OOM A;  4JGR A;  3CWF A;  4EER A;  3FG8 A;  1OTE A;  1LSW A;  5HD5 A;  2PT7 A;  5AVE A;  3T4K A;  3F1O A;  1ZTU A;  3BJN A;  4CLC A;  4F3L B;  2Y8H A;  2NUP C;  5TJJ A;  3LIF A;  2HV1 A;  3IBR A;  3UME A;  2R78 A;  2VV6 A;  3MQO A;  4G3W A;  3O5Y A;  4NXB A;  2PYP A;  2P04 A;  4CLC D;  3EQU A;  1IFQ A;  2GNX A;  1H3Q A;  4BBT A;  1LSX A;  4Y2F A;  1YAX A;  1OTD A;  4R3A A;  4FSF A;  5FL3 A;  4K08 A;  3EQV A;  3HCY A;  4LRZ E;  4EXO A;  5IS1 A;  3PBT A;  4LRY C;  3T4O A;  5HZH A;  1UGU A;  4I3A A;  4WEL A;  4CQH A;  2D02 A;  5G4Z A;  4KUK A;  2EWV A;  4WEJ A;  3IS2 A;  3P7N A;  1T1A A;  2EA9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...