4NXGA

Crystal structure of ilov-i486z(2lt) at ph 9.0
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
103
structure length
102
Chain Sequence
KNFVITDPRLPDNPIIFASDGFLELTEYSREEILGRNARFLQGPETDQATVQKIRDAIRDQRETTVQLINYTKSGKKFWNLLHLQPVRDQKGELQYFGVQLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Flavoprotein, fluorescent protein
molecule keywords Phototropin-2
publication title Significant Expansion of Fluorescent Protein Sensing Ability through the Genetic Incorporation of Superior Photo-Induced Electron-Transfer Quenchers
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 32
structure length 102
sequence length 103
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4nxgA00
1ODVA 3F1NB 4F3LB 1LSXA 4JGRA 4MN6A 2PR5A 4HJ3A 1DP8A 4I3IA 1F98A 3IS2B 3G6OA 3HJKA 4EQ1A 1WA9A 3RTYA 4HI4A 2V9AA 4DJ2A 5IS1A 5KIZA 1OTDA 2QJ5A 2P7JA 3F1OA 3PYPA 4EEPA 3F1PB 3UE6A 4NXFA 4NXGA 2JHEA 4LRZE 1S1ZA 4I5SA 2EA9A 2A24A 1OJ5A 4HQAA 5HWWA 2B02A 5HDDA 1XJ6A 5HSQA 3BWLA 3PHYA 5F68A 3SW1A 1N9OA 2QKPA 3FC7A 3H7WB 4HIAA 4GS9A 1P97A 3C8CA 2H28A 2PD8A 3F1NA 1UWPX 2OWJA 3NOTC 4R38A 4F3LA 2OOLA 2I9VA 1OJGA 2ZOHA 2QJ7A 3FG8A 1LSWA 2PDRA 3T50A 3D72A 5G4ZA 3IS2A 4K08A 2JN7A 1OTEA 4R6LA 2KX6A 3UB8A 3LI8A 3NHQA 5DJTA 2W27A 2L1MA 4WN5A 3LICA 2K7SA 1VB6A 3ZQ5A 3LIBA 2HV1A 4I3AA 3F1PA 3LIDA 1Y28A 5TBMB 1N9LA 3MQQA 4I38A 2VV7A 1DP6A 3H9WA 3MFXA 2INWA 1D06A 3CLOA 4JGOA 4HOIA 1GSXA 2QHKA 5G4YA 1LT0A 1V9YA 2VEAA 1LL8A 4WL9A 2VV6A 4BBUA 4KUOA 1D7EA 3H7WA 1OT6A 3E4PA 4EXOA 4LRXC 5J3WA 1S66L 5HD3A 1NWZA 3K3DA 5AVFA 4MN5A 1T1AA 5AVEA 5A8BA 3LIAA 5J4EA 4PKYA 3LYXA 2OWHA 1GSWA 4EEUA 5DKKA 1S67L 4BBVA 2GJ3A 1JNUA 2D01A 2ZOIA 4H6JB 1XFNA 5I5LA 1UGUA 4LPZA 5DJUA 3H82B 1GSVA 1KOUA 2PR6A 3UB6A 3MJQA 2PD7A 3VE4A 2PYPA 5F6AA 2J80A 1T1CA 5TBMA 4HP4A 1XJ3A 5HD5A 4JGPA 4DJ3A 3NOUC 4L9FA 3UB7A 1T19A 4R70A 2V0UA 1F9IA 3ICYA 3P7NA 2PHYA 4HJ6A 4HH2A 4HNBA 3KX0X 4EW7A 2VV8A 4I39A 4YWZA 1TS7A 3NJAA 4JGQA 1OT9A 3MR0A 4B9OA 2QWSA 2Z6CA 1OTIA 3A0VA 3A0SA 5HWTA 5J7EA 3C2WA 4I3JA 1TS6A 4KQDA 2R78A 4EERA 4EESA 1OTBA 1G28A 3OLOA 4NXBA 5F69A 1UWNX 4H6JA 1V9ZA 2L4RA 2Z6DA 3LIFA 4PKYG 2VLGA 3H82A 5EFWA 2V1BA 3EWKA 5IU1A 4L9EA 4WLAA 3MQOA 5DKLA 2PYRA 4XT2B 5F5YA 4LLOB 1TS0A 3GECA 5HWVA 4HJ4A 3BY8A 1X0OA 3IBRA 4GHIB 2M1CA 2WKQA 2YKHA 1XFQA 4WF0A 2V1AA 2V0WA 3MXQA 4M4XA 4NXEA 1T18A 2WKRA 3K3CA 1S4RA 3B33A 3NOPC 1DRMA 4R3AA 5HDSA 1XJ4A 4GCZA 2W0NA 4RQ9A 4L9GA 2ZBBA 2KDKA 3CWFA 2YKFA 3VE3A 4LRYC 1T1BA 2D02A 1EW0A 4E04A 1MZUA 3GDIA 4XT2A 3HJIA 3EEHA 5HDCA 1P0ZA 1XJ2A 1LSVA 3F1OB 3UB9A 4HHDA 4EETB 3UMDA 4HY8A 4BBTA 3LI9A 4GHIA 4WUJA 1S4SA 3UMEA 2A24B 3A0RA 5HZHA 1TS8A 2BASA 4HH3A 1DP9A 1S1YA 2WKPA 1OTAA 2CMNA 3VOLA 2L0WA 4GW9A 4KUKA 3LUQA 4HP9A 3CAXA 3LIEA 1BYWA 3E4OA 4GS9B 3RH8B 3E4QA 1N9NA 3BY9A 3ULFA
chains in the Genus database with same CATH superfamily
4S2PA 5BOHA 1BLPA 4D60A 3IXDA 2ZMAA 2E8JA 4WZ5C 3JVVA 3UDFA 1F2KA 2PR5A 3W2ZA 3Q7VB 1NY0A 3P01A 4K91A 1DP8A 2ZM8A 3IS2B 5FDSA 2M7UA 3HJKA 2XD5A 3RTYA 4HI4A 2A49A 1KGFA 2NUTC 2P7JA 1CJFA 2XQZA 1LLBA 1ACFA 4N9LA 1FSYA 4WMCD 5GHXA 1S6RA 2P04A 4GD6A 4OH0A 3EEAA 2LB9A 1PNEA 4B4XA 3N7WA 5EVLA 2XK1A 1KE4A 2K31A 1ZTUA 1QMEA 2Y4AA 1PIOA 3O86A 2B02A 3BWLA 5F68A 3SS3A 3SW1A 4HBTA 5KMWA 2EFUA 2ZC3B 4OOMA 2GX5A 4DRTA 2MJ6A 4HIAA 3ZG7B 1L2SA 3C8CA 2P9VA 2PD8A 4K0XA 4Y7PA 3NOTC 2JKTM 1WE4A 3EQUA 2Y2QA 4DXCA 3HL9A 2ZOHA 2QJ7A 3TRCA 5KSHA 4WM9A 2JN7A 2VZWA 5E43A 3CHWP 4KZ3A 1JWZA 2O9CA 4WYYA 3EOIA 3LI8A 2W27A 2L1MA 3LICA 2QZ6A 1VB6A 3W4PA 3ZQ5A 4YOFA 1XA1A 3BYDA 4MMNA 3N8RA 2QPNA 1K6SA 1JTGA 2Y55A 1K55A 1EROA 3EQVA 5FASA 1K54C 2VV7A 2W3EA 2PBDP 1DP6A 2EX8A 2H10A 1YLTA 5HFOA 4Q0JA 2XSSA 4Y2FA 1GSXA 4Y5FA 3V5MA 5M1AA 1G6AA 3T12B 1P9RA 1LT0A 3RFBA 2GZAA 4FSFA 3BLSA 3W8KA 4KUOA 1D7EA 3WWXA 3N8LA 3IH8A 1OT6A 1BULA 1Y54A 1K56D 3ZCZA 2ZLYA 5HD3A 2HDRA 1MKIA 1KVMA 1QMFA 4MN5A 3C30A 2ZC4B 4WZ5A 4LCMA 1TD5A 4PMAA 2V8CA 1RGZA 2H0YA 5DKKA 5CEBA 4BBVA 1FR6A 4EUZA 3RXWA 3NC8A 2D01A 3T4LA 2ZOIA 4ETXA 5I5LA 3D4FA 4LPZA 4Y15A 3HLBA 3VP1A 3IQAA 3MJQA 2PD7A 4DDSA 5IHVA 5TJJA 5EVIC 5TBMA 1KVLA 2FZ0A 4HP4A 1ESUA 3IF6C 3PBTA 2EWVA 1ES4A 3G4PA 2H5SA 3MBZA 1FQGA 2EWWA 1J3WA 4R70A 2V0UA 4OVDA 4IHQA 4Y13A 4X68A 4U0XA 4DKIA 3B3XA 1E3UA 1M40A 3EGDC 2HPBA 4HJ6A 2VV8A 1OT9A 2XFSA 3MR0A 1ONHA 4S2NC 5M19A 2WK0A 2EFXA 3E2KA 3QP4A 2B18A 3SZTA 2UWXA 3BQ8A 2BTFP 3SOIA 2ZM2A 2R78A 1S0WA 3LEZA 4EESA 4LENA 3Q82A 4Q8IA 1G28A 3RXXA 4NXBA 2W1TA 2ACGA 1UWNX 4H6JA 4N92A 1BLSA 3HLDA 2O0YA 1K4FA 2XGNA 4PKYG 4EV4A 5CTMA 2ZC5B 3DAVA 3G2ZA 4CLCD 1XGIA 4WLAA 3E98A 2ZJ9A 5HX9A 3VFFA 3R7WB 1PI5A 1C3BA 3GECA 2JKRM 4MDZA 3HLCA 2P08A 3UE1A 3TW8A 3LY3A 3HLFA 3BY8A 1X0OA 2V1ZA 5HPIA 4RA7A 3T4SA 1BTLA 4OLDA 3KSGA 4R1GA 1KDSA 3G34A 2V0WA 1Z09A 3NECA 3MXQA 4JF4A 1S4RA 1VQQA 3OCLA 1CF0A 3QP2A 1JVJA 3NOPC 4BL3A 5J8XA 3LR5A 5HDSA 3BECA 2QYBA 3UDXA 5FI2A 4L9GA 2W3HA 2X02A 2WKIA 2JKTI 2ZMFA 2ZBBA 2KDKA 4MNRA 5FAOA 3V3RA 1L3LA 1H8ZA 3Q81A 1LI9A 1W79A 3RJUA 2HP6A 3TOIA 3VE3A 1T1BA 4CQHA 3PBNA 1U60A 3ZFZA 3ITAA 2Y79A 4PM6A 5TR7A 1TF1A 3GDIA 3DTEA 2FH5A 5EVIA 4XUZA 4XT2A 3BFEA 3HJIA 3QP6A 2WYXA 5L8MA 3SS5A 5CGWA 2ZQ8A 3BFGA 5DTTA 3IF6A 4Z9QA 1XJ2A 4KZ5A 3E0YA 3M6HA 4HHDA 4JLFA 3UNWA 4DE1A 3MS6A 5FA7A 3UDIA 3MQ0A 4GHIA 2EX9A 2ZD8A 2QMIA 4P6ZM 2PU2A 1IYPA 4EUVA 3S22A 1IELA 3A0RA 5IT5A 3C7UA 3MZFA 4N1HA 4HH3A 4FTXA 3VOYA 2W1RA 4GKUA 4ZBEA 3ZG0A 3VOLA 2XROA 4E3KA 4KUKA 1XX2A 1H0MA 4FH2A 3LUQA 3CAXA 3IX3A 4QPRA 4UA6A 1KGGA 4B93A 1YAXA 3T4KA 1A0KA 1N9NA 4OQ0A 5F1GA 3BY9A 2ZC6B 2P9VB 4DE2A 2KOIA 5E2FA 4JGRA 1YLJA 3ZVWA 3T1RA 1PFLA 4HJ3A 3TSGA 4MEZA 4LCLA 4EQ1A 3KSFA 1FCNA 3LR0A 4RVAA 5CECA 3JPUA 3NDGA 4DJ2A 3LEQA 4BENA 3VP2A 2QJ5A 3CUEA 4E3OA 5CX7A 2J3TC 1VEUA 3FKVA 5L10A 4BJPA 3WS2A 3GV9A 5F1FA 3CI6A 5DVAA 1SDEA 1H5XA 1OPXA 3NY4A 4HQAA 4IUHA 5HWWA 2VGLS 3IXBA 4IVKA 2IWDA 3FC7A 4BQMA 4EQIA 5JYPA 4GS9A 2JBFA 1JWVA 4RX2A 3F1NA 1K38A 2OWJA 1PYYA 3KSIA 3VP3A 4WEJA 2XFTA 4GD8A 4Y0OA 4C6YA 4A5RA 3V67A 2DCFA 2Y2KA 3PBOA 2O9BA 4G3KA 3ISGA 1PZOA 1OTEA 5EM1A 4R6LA 5FSRA 4OKPA 3UB8A 4K0WA 3FV7A 3NHQA 4ETZA 4Y0UA 4WN5A 4E6WA 4Y17A 5AQ9A 4GN2A 1CEGA 2ZM0A 1MY8A 1ERMA 3F1PA 3AGEA 1G68A 3IHAA 3LIDA 4M3KA 1ZKJA 5TBMB 2ZMVA 3PBQA 3MQQA 1W8YA 1AWIA 5A92A 3SH7A 3H9WA 1RCJA 4MBHA 2JKRI 1LL9A 3MFXA 1D06A 5KZHA 1TVFA 3VSLA 1XKZA 4JXVA 4P0MA 2QHKA 3BLMA 5G4YA 5FEFA 5L07A 4OPRA 4Z1WA 1YLWA 4WL9A 2VV6A 1YSQA 4CLCC 4ZTKA 4X1LA 3BM6A 3BQAA 4KZ7A 5J3WA 5AJGA 1NWZA 3T1QB 1T1AA 2Y2OA 4H8RA 5HPFA 2ZQCA 5J4EA 4IBXA 4PKYA 4KQRA 3ZYTA 1S67L 2Y2LA 2W1TB 4Q0IA 2GJ3A 4DMZA 5MC7A 4H6JB 3NDEA 4FUWA 3ZGAB 5DJUA 2VX8A 3VV4A 4YINA 1KOUA 3NI9A 2PR6A 3UB6A 3GMWA 1O07A 3VE4A 2PYPA 2J3WA 2DMWA 2W3FA 2Y59A 1ES5A 3FZCA 4LFUA 1XJ3A 4BL2A 4OLGA 1FIKA 4DJ3A 5EOEA 4L9FA 3DTIA 2IWBA 4BD1A 3JYIA 1W8QA 3PXPA 5HAPA 1ONGA 4BMWA 1KE0A 1SKFA 2EXBA 2ZQAA 3O3VA 1TS7A 3NJAA 5DFYA 2ZQ7A 4MN7A 4R0QA 5DFXA 4B9OA 5FQIA 5M18A 2GNXA 2Z6CA 3L7HA 4E3MA 1OTIA 3VOZA 3A0VA 3A0SA 5HWTA 2XF3A 5CRFA 1TS6A 3N8SA 4DXBA 3KO6A 4OOYA 5K5BA 2L4RA 3DWKA 1XPBA 3EWKA 4IJGA 2WADA 3MQOA 4CPKA 5EVIB 4XT2B 4N9KA 4X6TA 5CHJA 4PAUA 5GHZA 2WAEA 3IF6B 5F5YA 1GA0A 2OLUA 3DTMA 1ZG4A 4OP5A 2G7UA 5CGXA 4GZBA 4N1XA 2J9PA 2XEPA 1BT5A 3E2LA 2VGJA 3DBAA 4GHIB 2K2NA 2WKQA 4UEYA 2YKHA 1XFQA 2EX6A 4WF0A 4GDNA 3NCKA 2GDNA 4NXEA 2V20A 3IXHA 1I2SA 3B33A 1K57C 3A3IA 1SZVA 5GLAA 4Y3IA 3IBJA 5HL1A 4RQ9A 4OP8A 4ZJ1A 1VM1A 3T4JA 3CWFA 2VJWA 2RCXA 1G6OA 4NETA 3UY6A 4LRYC 5EUAA 2OAQ1 1EW0A 3CG5A 3MSHA 4FD8A 2XR0A 4E04A 1MWUA 3MF0A 1ALQA 2Y2IA 4BLMA 2IA2A 3EEHA 1YT4A 3UO9A 5A91A 4L0LA 1VHMA 3BFFA 1YLYA 4P85A 4AFIA 1VEUB 4UA9A 1HVBA 2ZQ9A 4JF6A 3M2JA 1F5MA 3CPTA 3S7PA 3M6BA 3HUMA 4YFMA 2BASA 2XH9A 2XRNA 1I5QA 5FQMA 3V39A 1E25A 1DP9A 4YNRA 2WKPA 2L0WA 4GW9A 1HD8A 4X69A 4HP9A 3S4XA 3E4OA 5LBRA 1GHPA 4GS9B 5DTSA 5L09A 4DE3A 1K54A 5CTNA 1ODVA 3TG9A 3F1NB 5JYOA 3N4IA 4C3QA 1LSXA 1IYOA 2WUQA 2ZL1A 1MPLA 5AQBA 4I3IA 1F98A 2VA0A 3G6OA 3FPVA 4OPYA 4KZ4A 1CI9A 1WA9A 1RGYA 1XGJA 1YLPA 3MKFA 3P98A 4RYEA 3UPNA 3S7NA 1OTDA 3F1OA 3PYPA 3F1PB 3UE6A 4NXGA 2JKGA 1WYBA 1SKOA 1ESIA 1IOUA 3ZG5A 3G32A 2Y8HA 4S2KA 3MFDA 2O9AA 5U47A 5F83A 2XD1A 4GDBA 3BFCA 4I5SA 3U4LP 1E3UD 3N6IA 5FAQA 5CHMA 1MKMA 1W63Q 4ZJ3A 5HSQA 3PHYA 5KSCA 2XA7S 1N9OA 1K57A 2WAFA 5D3OA 1FR1A 1TEMA 2QKPA 4R3BA 4FCFA 2X01A 3EGXC 1P97A 3G31A 1W63M 1JTDA 1YSPA 3VSKA 1SCWA 2H28A 5TFQA 2V2FF 4R38A 4II7A 4F3LA 2W3DA 3Q7ZA 3QNBA 1OJGA 2PDRA 4LGWA 3SH9A 4RX3A 3MXRA 4O7DA 4DF6A 4PHTA 4UAAA 4Y0TA 4G3WA 3MKEA 3FKWA 5DJTA 2K7SA 1L0DA 2J7VA 1IFQA 2HV1A 4JKTA 3BJNA 5FAPA 2BLSA 5CERA 4S2NA 3IWQA 1TDLA 2RL3A 1Y28A 1NYMA 5FDHA 2R9WA 2WKEA 1DJCA 2INWA 2XLNA 4ZAMA 3WRTA 3CLOA 4JGOA 1DY6A 4HOIA 4IBRA 1Y4OA 3T1XA 2PAVP 3VMAA 4ZDXA 3VP0A 2VK3A 3QP8A 1ES3A 1MWTA 3QHYA 2VEAA 5E2EA 1MXOA 5A93A 4WZ4A 4UA7A 1CEFA 4WEKA 3ZHHA 4R3JA 3WS1A 4OQIA 3H7WA 3ZG8B 1YMXA 3D3OA 4KQQA 3E4PA 4EXOA 3CITA 1GCEA 5E2HA 1HZOA 4NKPA 3LYXA 1GSWA 1PW1A 4ARZB 2P74A 2ZQDA 3MZDA 1XFNA 1KGEA 5FI7A 4JXWA 4X56A 4O8GA 1L0GA 5GLBA 5EVID 1NYYA 3IX8A 4JBFA 4ZJ2A 1IEMA 4S2IA 2WKHA 3ITBA 2EXAA 3SS4A 1PWCA 5HD5A 4KQOA 2B95A 2V8FA 1DJAA 3NOUC 2HJ9C 4WMCA 1ZG6A 4KZ8A 3UB7A 2C5WB 4S2JA 1F9IA 4E3LA 3IWIA 1LL5A 3GR2A 1FOFA 4HH2A 4HNBA 4EW7A 2Y91A 4X25A 4YWZA 1BUEA 2O99A 2Y2MA 4JGQA 4QWOA 5GLCA 2IWCA 5HAQA 2Y2PA 2QWSA 1CI8A 1LHYA 3ZDJA 3C4PA 5J7EA 4I3JA 2JE5A 1H8YA 3QNCA 4KQDA 2Z2LB 5I94A 3OPHA 2A2LA 4UQIS 4PM8A 3OLOA 4OONA 1H8MA 3ZNTA 1V9ZA 3LIFA 5FEGA 3H82A 2W3GA 2A3UA 5EFWA 1MC0A 3BEBA 4KG5A 2JCHA 1EWZA 2PU4A 4QB8A 2HDQA 5IU1A 3UE3A 4IEDA 1NZUA 2AVXA 1G5UA 4DDYA 3PBRA 2PYRA 4QHCA 1L0EA 1ERQA 3T4OA 4KENB 1FCOA 3B42A 3BFDA 5FL3A 1BLCA 3DW0A 5EPHA 1TS0A 4OOLA 2OAP1 4FOFA 3R4KA 4HJ4A 3CMZA 3T4TA 3HCYA 2M1CA 4LV2A 3OC2A 2V1AA 1XXMA 3FYZA 3CPTB 4M4XA 1T18A 1VETB 2KLIA 3FPWA 4HEFA 3SH8A 1GHMA 1KDWA 5DF9A 4BD0A 2J9OA 2CC1A 1K56A 5DF7A 3L9KA 1DRMA 4R3AA 4F94A 2WGWA 1XJ4A 4GCZA 4NG2A 4WBGA 3OPRA 1EI5A 4GJ4A 4R23A 3KYEA 4X53A 2YKFA 1HTZA 4JF5A 3CJMA 2I72A 2D02A 3IT9A 2ZL1B 3LR3A 4DN0A 2VGLM 1TDGA 2UV0E 1Q2QA 2Y2JA 3LCEA 3OCNA 1N4OA 5GHYA 5GL9A 2OV5A 5HDCA 4PM5A 3WRZA 1P0ZA 1LSVA 1KE3A 3W4QA 3F1OB 3JVUA 1PZPA 4EETB 1ZC2A 1SKOB 4P87A 3TE8A 2Y2GA 4BBTA 4CLCE 4JXSA 4WUJA 3HREA 1S4SA 5TGFA 4ARZA 3I7JA 1W5DA 1P9WA 4UHUA 4XXRA 2PRFA 4S2OA 5HZHA 3IXGA 4S2MA 4ESPA 5EE8A 1OTAA 2CMNA 1PWDA 4PM7A 1IYSA 2Z2MB 5FQ9A 5AQAA 3HUOA 1NZOA 4GOGA 1BYWA 5F82A 5CEDA 2OSUA 2WZZA 3E4QA 4UQIM 1TS8A 2OOLA 5DF8A 3FWLA 3S7OA 4KZ9A 4F3LB 3IF5A 4EBPA 3P09A 1IKIA 4G3VA 4OQGA 3V3SA 2PT7A 2JC7A 4MN6A 3GSGA 2OLVA 2XDMA 1Q2PA 1STZA 2Q9MA 3B47A 5CXWA 1MWRA 1W7FA 1XP4A 2V9AA 3LY4A 4CLCA 1CQAA 2J3TD 5IS1A 5KIZA 2WZXA 4EEPA 4NXFA 3G2YA 3TJZC 2VKSA 2JHEA 2FFFB 4D2OA 3V50A 1YPRA 4LRZE 1PRQA 1S1ZA 2M7VA 2DRWA 4QU3A 2EA9A 2A24A 1OJ5A 3O88A 4X55A 3HBRA 3NIAA 3MXSA 3VFHA 5HDDA 3GRJA 1XJ6A 4MLLA 1YM1A 3QP1A 4NEED 3H7WB 3S7QA 1FSWA 4WELA 1J9MA 2ZC7A 3O87A 1UWPX 2I9VA 4Q0HA 4LV1A 3ZVTA 1O7EA 3KYZA 3FG8A 1LSWA 3Q7VA 4KZ6A 4B4ZA 4R4SA 3WS4A 4PPRA 3D72A 3T50A 2HGVA 3IWOA 5G4ZA 3IS2A 4K08A 4P6ZS 5AQ7A 4ME4A 2KX6A 1ES2A 5FQQA 2X71A 2PBYA 1VETA 3LIBA 4EBNA 3A3FA 4B88A 3HVFA 4I3AA 1ZHHB 4EBLA 3G35A 5A90A 5EM0A 1N9LA 2R9XA 4I38A 3HLEA 1K0KA 2Y2HA 2LB5A 4OPZA 1GA9A 1BSGA 1K4EA 3GVBA 3HLWA 2C6WB 2EX2A 3CZDA 2B5RA 4DE0A 1YLZA 1V9YA 4X1MA 1LL8A 4BBUA 1SHVA 1D1JA 4HESA 1YMSA 3BW6A 4E3NA 1PI4A 5EECA 3CUEC 4LRXC 3UB5P 1S66L 3AGDA 3K3DA 5AVFA 3T1SA 2HF6A 5AVEA 2WGIA 5A8BA 3LIAA 4QD4A 3Q1FA 2OWHA 5DTKA 2WGVA 3S1YA 4EEUA 1K25A 4R4RA 5HL6A 1JNUA 1NLYA 4E3JA 5EV0A 5G18A 4OQHA 4KG6A 3LR4A 1UGUA 3H82B 1GSVA 4ZRRA 3U2AA 5HW3A 3KYQA 3D9YA 3C4OA 1JWPA 1RP5A 2FFYA 4OPQA 5F6AA 2J80A 1M6KA 1T1CA 2G2UA 4E3IA 2G2WA 2VGKA 4JGPA 4P6BA 3GTCA 5FI6A 4O0PA 1T19A 1BZAA 3QP5A 5FQKA 3HLGA 3ICYA 3Q07A 3P7NA 2PHYA 1E4DA 1IKGA 3G30A 3KX0X 3PBSA 3OOVA 4I39A 1K6RA 4GB7A 4C75A 3GQZA 5L2FA 1N9BA 1MBLA 1NLZA 3PAEA 5EOOA 2DNSA 2Y2NA 4LV0A 3C2WA 3UPOA 3IHBA 5HAIA 2Q9NA 3A3JA 1XA7A 2WGWB 4QJGA 4IUKA 3WS0A 1L0FA 4EERA 1DJBA 1OTBA 2BG1A 5F69A 1Z6FA 2Z6DA 1LI0A 4JXGA 2HP9A 2VLGA 3NBLA 3T4QA 2V1BA 1PWGA 4EWFA 3LFVA 4L9EA 5FQJA 3IX4A 5DKLA 3UPPA 1CK3A 2HJEA 4HBUA 3UE0A 2J8YA 2HDSA 4U0TA 4LLOB 3DWZA 3OPPA 4O01A 4S2LA 5HWVA 3VP4A 3O5YA 3PR6A 3IBRA 3PAGA 2NUPC 4PM9A 5CGSA 1NRJA 3WS5A 4U3TA 3C7VA 3DTKA 1FILA 1GHIA 1PW8A 2WKRA 3M2KA 1BLHA 3MMHA 3PTEA 3K3CA 3LGOA 4QY6A 3MZEA 3UN7A 3ZNYA 3ZG9B 4IVIA 3HUNA 3AGFA 1YQSA 4MBKA 5E2GA 3OBFA 2H0TA 2W0NA 2HZ5A 2Q0OA 3NULA 3A3DA 4KZAA 3C38A 1YKDA 4ID4A 5C5KA 2XA7M 1MZUA 3BRMA 5GLDA 3OZHA 5HARA 3KSHA 1H3QA 4XUXA 4KG2A 4FH4A 4NK3A 2JKFA 4E6XA 2HDUA 4CLCB 1OMEA 3R7WA 4GLQA 4CJNA 3UB9A 5EVEA 4MCWA 2E8IA 3UMDA 1K55C 4EU0A 1HLUP 3LO7A 4QY5A 4HY8A 2HP5A 3LI9A 4KZBA 1AXBA 3C5AA 1IYQA 3UMEA 2A24B 1NXYA 4JPMA 3IH9A 3W4OA 5CHUA 4BWIA 1I2WA 5FATA 3OPLA 1S1YA 1NRFA 3K2NA 4MBFA 1WYCA 1MWSA 3LIEA 4LV3A 3RH8B 3A3EA 4GNUA 1NJ4A 1FCMA 1SDNA 3ULFA
chains in the Genus database with same CATH topology
1ODVA 3F1NB 2KOIA 3S7OA 4F3LB 4G3VA 1LSXA 2PT7A 3JVVA 4JGRA 4MN6A 2PR5A 3W2ZA 3P01A 4HJ3A 1DP8A 4I3IA 1F98A 2VA0A 3IS2B 3G6OA 3FPVA 1STZA 3HJKA 2M7UA 4EQ1A 1WA9A 3KSFA 3RTYA 3B47A 3LR0A 4HI4A 2V9AA 4CLCA 2J3TD 2NUTC 4DJ2A 5IS1A 3S7NA 5KIZA 1OTDA 2QJ5A 3CUEA 2P7JA 3F1OA 5CX7A 3PYPA 4EEPA 3F1PB 3UE6A 2J3TC 4NXFA 4NXGA 3TJZC 2VKSA 1IOUA 2Y8HA 2JHEA 4BJPA 2O9AA 4LRZE 2P04A 1S1ZA 2M7VA 3EEAA 2LB9A 4I5SA 2EA9A 2A24A 3CI6A 2K31A 1OJ5A 1OPXA 1ZTUA 4HQAA 4IUHA 2B02A 5HWWA 1MKMA 1W63Q 5HDDA 1XJ6A 5HSQA 3BWLA 3PHYA 5F68A 2XA7S 2VGLS 3SW1A 1N9OA 4OOMA 2GX5A 2QKPA 3FC7A 4NEED 2MJ6A 3EGXC 3H7WB 4HIAA 4GS9A 1P97A 1W63M 3S7QA 1YSPA 3C8CA 4WELA 2H28A 2PD8A 3F1NA 1UWPX 2OWJA 3NOTC 4R38A 2JKTM 4II7A 3KSIA 4F3LA 2I9VA 3EQUA 4WEJA 4Q0HA 2W3DA 1OJGA 2ZOHA 3KYZA 2QJ7A 3FG8A 1LSWA 2PDRA 3V67A 3T50A 3D72A 3TRCA 5KSHA 2HGVA 5G4ZA 3PBOA 2O9BA 3IS2A 4G3KA 4K08A 2JN7A 1OTEA 2VZWA 4PHTA 4R6LA 4P6ZS 4ME4A 2KX6A 4G3WA 2O9CA 3UB8A 3EOIA 3LI8A 3NHQA 4ETZA 5DJTA 2W27A 2L1MA 4WN5A 3LICA 2K7SA 1VB6A 3ZQ5A 1IFQA 4YOFA 3LIBA 2HV1A 3BJNA 4I3AA 1ZHHB 3F1PA 4MMNA 3LIDA 1Y28A 5TBMB 2ZMVA 1N9LA 3PBQA 3MQQA 3EQVA 4I38A 2VV7A 2W3EA 1DP6A 2LB5A 3H9WA 2JKRI 3MFXA 2INWA 1D06A 3CLOA 4JGOA 4Q0JA 4HOIA 2XSSA 4Y2FA 1GSXA 4Y5FA 2QHKA 5G4YA 1P9RA 1LT0A 4Z1WA 1V9YA 2GZAA 2VEAA 1LL8A 4FSFA 2VV6A 4WL9A 3RFBA 4BBUA 1YSQA 4KUOA 1D7EA 4WEKA 3BW6A 4CLCC 3H7WA 1OT6A 3D3OA 3E4PA 4EXOA 3CUEC 3BQAA 4LRXC 3CITA 5J3WA 5AJGA 1S66L 5HD3A 1NWZA 3K3DA 5AVFA 2HF6A 4MN5A 1T1AA 3C30A 5AVEA 5A8BA 4NKPA 5HPFA 3LIAA 5J4EA 1TD5A 4PKYA 3LYXA 2OWHA 1GSWA 3ZYTA 4EEUA 5DKKA 1S67L 4ARZB 4BBVA 5HL6A 2W1TB 4Q0IA 2GJ3A 1JNUA 1NLYA 2D01A 3T4LA 2ZOIA 4DMZA 4ETXA 5MC7A 4H6JB 1XFNA 5I5LA 3LR4A 1UGUA 4O8GA 4LPZA 5DJUA 2VX8A 3VV4A 3H82B 1GSVA 1KOUA 4ZRRA 3U2AA 2PR6A 3UB6A 3KYQA 3MJQA 2PD7A 3VE4A 2PYPA 5F6AA 2J3WA 2J80A 2DMWA 1T1CA 2W3FA 5TBMA 5TJJA 2FZ0A 4HP4A 3ULFA 1XJ3A 3PBTA 4JGPA 5HD5A 2EWVA 4DJ3A 4KQOA 3NOUC 2HJ9C 4L9FA 4O0PA 2EWWA 3UB7A 1T19A 4R70A 2V0UA 1F9IA 4IHQA 3ICYA 3PXPA 3P7NA 2PHYA 4BMWA 3EGDC 4HJ6A 4HH2A 4HNBA 3KX0X 4EW7A 2VV8A 3PBSA 3OOVA 4I39A 4YWZA 1TS7A 2O99A 3NJAA 4JGQA 1OT9A 5DFYA 3MR0A 4MN7A 5DFXA 4B9OA 2QWSA 2GNXA 2Z6CA 1NLZA 1OTIA 3A0VA 2B18A 3A0SA 3BQ8A 5HWTA 5J7EA 3C2WA 4I3JA 1TS6A 4KQDA 2R78A 3KO6A 4IUKA 4EERA 4EESA 1OTBA 2A2LA 4UQIS 1G28A 3OLOA 2W1TA 4NXBA 5F69A 1UWNX 5K5BA 1H8MA 4H6JA 2O0YA 1V9ZA 2L4RA 2Z6DA 3LIFA 4PKYG 2VLGA 3H82A 2W3GA 3T4QA 5EFWA 1MC0A 2V1BA 3EWKA 3LFVA 4IJGA 3UE3A 5IU1A 4CLCD 4L9EA 4WLAA 3MQOA 3E98A 3PBRA 5DKLA 2PYRA 2HJEA 4XT2B 4PAUA 3T4OA 3B42A 5FL3A 5F5YA 3R7WB 4LLOB 1TS0A 4O01A 2G7UA 4OOLA 3GECA 2JKRM 2OAP1 4MDZA 5HWVA 2P08A 3TW8A 4FOFA 3R4KA 4HJ4A 3BY8A 3O5YA 3PR6A 1X0OA 3IBRA 5HPIA 2NUPC 3T4SA 3KSGA 3T4TA 3DBAA 4GHIB 1NRJA 2K2NA 3HCYA 2M1CA 2WKQA 4UEYA 2YKHA 1XFQA 3OC2A 4WF0A 2V1AA 2V0WA 3MXQA 4M4XA 4NXEA 1T18A 2KLIA 2WKRA 3FPWA 3MMHA 3K3CA 5DF9A 1S4RA 3B33A 3OCLA 3OBFA 4Y3IA 3NOPC 1DRMA 3LR5A 4R3AA 3IBJA 5HDSA 1XJ4A 4GCZA 2W0NA 4RQ9A 2QYBA 4L9GA 2W3HA 2JKTI 2ZMFA 4GJ4A 2ZBBA 2KDKA 3T4JA 3CWFA 2YKFA 2VJWA 1G6OA 3VE3A 3C38A 4LRYC 1YKDA 1T1BA 2D02A 4CQHA 2OAQ1 1EW0A 3PBNA 5C5KA 3LR3A 4DN0A 2XA7M 2VGLM 4E04A 1MZUA 2Y79A 3MF0A 1TF1A 3GDIA 3KSHA 2FH5A 1H3QA 2IA2A 4XT2A 3OCNA 3HJIA 5L8MA 3EEHA 4CLCB 5HDCA 3R7WA 1P0ZA 1XJ2A 1LSVA 4GLQA 4L0LA 3E0YA 3F1OB 3UB9A 3JVUA 1VHMA 4HHDA 4EETB 4MCWA 3UMDA 4AFIA 4EU0A 3TE8A 4HY8A 4BBTA 3LI9A 4CLCE 3MQ0A 4GHIA 4WUJA 1S4SA 4P6ZM 3UMEA 4ARZA 1P9WA 1F5MA 2A24B 4EUVA 3S7PA 3A0RA 4BWIA 5IT5A 5HZHA 1TS8A 2BASA 2XRNA 4HH3A 1DP9A 4YNRA 1S1YA 2W1RA 2WKPA 1OTAA 2CMNA 3K2NA 2XROA 3VOLA 2L0WA 4GW9A 4KUKA 3LUQA 4HP9A 3CAXA 3LIEA 4QPRA 1BYWA 3E4OA 5LBRA 1YAXA 4B93A 3T4KA 4GS9B 3RH8B 3E4QA 1N9NA 4UQIM 3BY9A 2OOLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ODV A;  3F1N B;  4F3L B;  1LSX A;  4JGR A;  4MN6 A;  2PR5 A;  4HJ3 A;  1DP8 A;  4I3I A;  1F98 A;  3IS2 B;  3G6O A;  3HJK A;  4EQ1 A;  1WA9 A;  3RTY A;  4HI4 A;  2V9A A;  4DJ2 A;  5IS1 A;  5KIZ A;  1OTD A;  2QJ5 A;  2P7J A;  3F1O A;  3PYP A;  4EEP A;  3F1P B;  3UE6 A;  4NXF A;  4NXG A;  2JHE A;  4LRZ E;  1S1Z A;  4I5S A;  2EA9 A;  2A24 A;  1OJ5 A;  4HQA A;  5HWW A;  2B02 A;  5HDD A;  1XJ6 A;  5HSQ A;  3BWL A;  3PHY A;  5F68 A;  3SW1 A;  1N9O A;  2QKP A;  3FC7 A;  3H7W B;  4HIA A;  4GS9 A;  1P97 A;  3C8C A;  2H28 A;  2PD8 A;  3F1N A;  1UWP X;  2OWJ A;  3NOT C;  4R38 A;  4F3L A;  2OOL A;  2I9V A;  1OJG A;  2ZOH A;  2QJ7 A;  3FG8 A;  1LSW A;  2PDR A;  3T50 A;  3D72 A;  5G4Z A;  3IS2 A;  4K08 A;  2JN7 A;  1OTE A;  4R6L A;  2KX6 A;  3UB8 A;  3LI8 A;  3NHQ A;  5DJT A;  2W27 A;  2L1M A;  4WN5 A;  3LIC A;  2K7S A;  1VB6 A;  3ZQ5 A;  3LIB A;  2HV1 A;  4I3A A;  3F1P A;  3LID A;  1Y28 A;  5TBM B;  1N9L A;  3MQQ A;  4I38 A;  2VV7 A;  1DP6 A;  3H9W A;  3MFX A;  2INW A;  1D06 A;  3CLO A;  4JGO A;  4HOI A;  1GSX A;  2QHK A;  5G4Y A;  1LT0 A;  1V9Y A;  2VEA A;  1LL8 A;  4WL9 A;  2VV6 A;  4BBU A;  4KUO A;  1D7E A;  3H7W A;  1OT6 A;  3E4P A;  4EXO A;  4LRX C;  5J3W A;  1S66 L;  5HD3 A;  1NWZ A;  3K3D A;  5AVF A;  4MN5 A;  1T1A A;  5AVE A;  5A8B A;  3LIA A;  5J4E A;  4PKY A;  3LYX A;  2OWH A;  1GSW A;  4EEU A;  5DKK A;  1S67 L;  4BBV A;  2GJ3 A;  1JNU A;  2D01 A;  2ZOI A;  4H6J B;  1XFN A;  5I5L A;  1UGU A;  4LPZ A;  5DJU A;  3H82 B;  1GSV A;  1KOU A;  2PR6 A;  3UB6 A;  3MJQ A;  2PD7 A;  3VE4 A;  2PYP A;  5F6A A;  2J80 A;  1T1C A;  5TBM A;  4HP4 A;  1XJ3 A;  5HD5 A;  4JGP A;  4DJ3 A;  3NOU C;  4L9F A;  3UB7 A;  1T19 A;  4R70 A;  2V0U A;  1F9I A;  3ICY A;  3P7N A;  2PHY A;  4HJ6 A;  4HH2 A;  4HNB A;  3KX0 X;  4EW7 A;  2VV8 A;  4I39 A;  4YWZ A;  1TS7 A;  3NJA A;  4JGQ A;  1OT9 A;  3MR0 A;  4B9O A;  2QWS A;  2Z6C A;  1OTI A;  3A0V A;  3A0S A;  5HWT A;  5J7E A;  3C2W A;  4I3J A;  1TS6 A;  4KQD A;  2R78 A;  4EER A;  4EES A;  1OTB A;  1G28 A;  3OLO A;  4NXB A;  5F69 A;  1UWN X;  4H6J A;  1V9Z A;  2L4R A;  2Z6D A;  3LIF A;  4PKY G;  2VLG A;  3H82 A;  5EFW A;  2V1B A;  3EWK A;  5IU1 A;  4L9E A;  4WLA A;  3MQO A;  5DKL A;  2PYR A;  4XT2 B;  5F5Y A;  4LLO B;  1TS0 A;  3GEC A;  5HWV A;  4HJ4 A;  3BY8 A;  1X0O A;  3IBR A;  4GHI B;  2M1C A;  2WKQ A;  2YKH A;  1XFQ A;  4WF0 A;  2V1A A;  2V0W A;  3MXQ A;  4M4X A;  4NXE A;  1T18 A;  2WKR A;  3K3C A;  1S4R A;  3B33 A;  3NOP C;  1DRM A;  4R3A A;  5HDS A;  1XJ4 A;  4GCZ A;  2W0N A;  4RQ9 A;  4L9G A;  2ZBB A;  2KDK A;  3CWF A;  2YKF A;  3VE3 A;  4LRY C;  1T1B A;  2D02 A;  1EW0 A;  4E04 A;  1MZU A;  3GDI A;  4XT2 A;  3HJI A;  3EEH A;  5HDC A;  1P0Z A;  1XJ2 A;  1LSV A;  3F1O B;  3UB9 A;  4HHD A;  4EET B;  3UMD A;  4HY8 A;  4BBT A;  3LI9 A;  4GHI A;  4WUJ A;  1S4S A;  3UME A;  2A24 B;  3A0R A;  5HZH A;  1TS8 A;  2BAS A;  4HH3 A;  1DP9 A;  1S1Y A;  2WKP A;  1OTA A;  2CMN A;  3VOL A;  2L0W A;  4GW9 A;  4KUK A;  3LUQ A;  4HP9 A;  3CAX A;  3LIE A;  1BYW A;  3E4O A;  4GS9 B;  3RH8 B;  3E4Q A;  1N9N A;  3BY9 A;  3ULF A; 
#chains in the Genus database with same CATH topology
 4S2P A;  5BOH A;  1BLP A;  4D60 A;  3IXD A;  2ZMA A;  2E8J A;  4WZ5 C;  3JVV A;  3UDF A;  1F2K A;  2PR5 A;  3W2Z A;  3Q7V B;  1NY0 A;  3P01 A;  4K91 A;  1DP8 A;  2ZM8 A;  3IS2 B;  5FDS A;  2M7U A;  3HJK A;  2XD5 A;  3RTY A;  4HI4 A;  2A49 A;  1KGF A;  2NUT C;  2P7J A;  1CJF A;  2XQZ A;  1LLB A;  1ACF A;  4N9L A;  1FSY A;  4WMC D;  5GHX A;  1S6R A;  2P04 A;  4GD6 A;  4OH0 A;  3EEA A;  2LB9 A;  1PNE A;  4B4X A;  3N7W A;  5EVL A;  2XK1 A;  1KE4 A;  2K31 A;  1ZTU A;  1QME A;  2Y4A A;  1PIO A;  3O86 A;  2B02 A;  3BWL A;  5F68 A;  3SS3 A;  3SW1 A;  4HBT A;  5KMW A;  2EFU A;  2ZC3 B;  4OOM A;  2GX5 A;  4DRT A;  2MJ6 A;  4HIA A;  3ZG7 B;  1L2S A;  3C8C A;  2P9V A;  2PD8 A;  4K0X A;  4Y7P A;  3NOT C;  2JKT M;  1WE4 A;  3EQU A;  2Y2Q A;  4DXC A;  3HL9 A;  2ZOH A;  2QJ7 A;  3TRC A;  5KSH A;  4WM9 A;  2JN7 A;  2VZW A;  5E43 A;  3CHW P;  4KZ3 A;  1JWZ A;  2O9C A;  4WYY A;  3EOI A;  3LI8 A;  2W27 A;  2L1M A;  3LIC A;  2QZ6 A;  1VB6 A;  3W4P A;  3ZQ5 A;  4YOF A;  1XA1 A;  3BYD A;  4MMN A;  3N8R A;  2QPN A;  1K6S A;  1JTG A;  2Y55 A;  1K55 A;  1ERO A;  3EQV A;  5FAS A;  1K54 C;  2VV7 A;  2W3E A;  2PBD P;  1DP6 A;  2EX8 A;  2H10 A;  1YLT A;  5HFO A;  4Q0J A;  2XSS A;  4Y2F A;  1GSX A;  4Y5F A;  3V5M A;  5M1A A;  1G6A A;  3T12 B;  1P9R A;  1LT0 A;  3RFB A;  2GZA A;  4FSF A;  3BLS A;  3W8K A;  4KUO A;  1D7E A;  3WWX A;  3N8L A;  3IH8 A;  1OT6 A;  1BUL A;  1Y54 A;  1K56 D;  3ZCZ A;  2ZLY A;  5HD3 A;  2HDR A;  1MKI A;  1KVM A;  1QMF A;  4MN5 A;  3C30 A;  2ZC4 B;  4WZ5 A;  4LCM A;  1TD5 A;  4PMA A;  2V8C A;  1RGZ A;  2H0Y A;  5DKK A;  5CEB A;  4BBV A;  1FR6 A;  4EUZ A;  3RXW A;  3NC8 A;  2D01 A;  3T4L A;  2ZOI A;  4ETX A;  5I5L A;  3D4F A;  4LPZ A;  4Y15 A;  3HLB A;  3VP1 A;  3IQA A;  3MJQ A;  2PD7 A;  4DDS A;  5IHV A;  5TJJ A;  5EVI C;  5TBM A;  1KVL A;  2FZ0 A;  4HP4 A;  1ESU A;  3IF6 C;  3PBT A;  2EWV A;  1ES4 A;  3G4P A;  2H5S A;  3MBZ A;  1FQG A;  2EWW A;  1J3W A;  4R70 A;  2V0U A;  4OVD A;  4IHQ A;  4Y13 A;  4X68 A;  4U0X A;  4DKI A;  3B3X A;  1E3U A;  1M40 A;  3EGD C;  2HPB A;  4HJ6 A;  2VV8 A;  1OT9 A;  2XFS A;  3MR0 A;  1ONH A;  4S2N C;  5M19 A;  2WK0 A;  2EFX A;  3E2K A;  3QP4 A;  2B18 A;  3SZT A;  2UWX A;  3BQ8 A;  2BTF P;  3SOI A;  2ZM2 A;  2R78 A;  1S0W A;  3LEZ A;  4EES A;  4LEN A;  3Q82 A;  4Q8I A;  1G28 A;  3RXX A;  4NXB A;  2W1T A;  2ACG A;  1UWN X;  4H6J A;  4N92 A;  1BLS A;  3HLD A;  2O0Y A;  1K4F A;  2XGN A;  4PKY G;  4EV4 A;  5CTM A;  2ZC5 B;  3DAV A;  3G2Z A;  4CLC D;  1XGI A;  4WLA A;  3E98 A;  2ZJ9 A;  5HX9 A;  3VFF A;  3R7W B;  1PI5 A;  1C3B A;  3GEC A;  2JKR M;  4MDZ A;  3HLC A;  2P08 A;  3UE1 A;  3TW8 A;  3LY3 A;  3HLF A;  3BY8 A;  1X0O A;  2V1Z A;  5HPI A;  4RA7 A;  3T4S A;  1BTL A;  4OLD A;  3KSG A;  4R1G A;  1KDS A;  3G34 A;  2V0W A;  1Z09 A;  3NEC A;  3MXQ A;  4JF4 A;  1S4R A;  1VQQ A;  3OCL A;  1CF0 A;  3QP2 A;  1JVJ A;  3NOP C;  4BL3 A;  5J8X A;  3LR5 A;  5HDS A;  3BEC A;  2QYB A;  3UDX A;  5FI2 A;  4L9G A;  2W3H A;  2X02 A;  2WKI A;  2JKT I;  2ZMF A;  2ZBB A;  2KDK A;  4MNR A;  5FAO A;  3V3R A;  1L3L A;  1H8Z A;  3Q81 A;  1LI9 A;  1W79 A;  3RJU A;  2HP6 A;  3TOI A;  3VE3 A;  1T1B A;  4CQH A;  3PBN A;  1U60 A;  3ZFZ A;  3ITA A;  2Y79 A;  4PM6 A;  5TR7 A;  1TF1 A;  3GDI A;  3DTE A;  2FH5 A;  5EVI A;  4XUZ A;  4XT2 A;  3BFE A;  3HJI A;  3QP6 A;  2WYX A;  5L8M A;  3SS5 A;  5CGW A;  2ZQ8 A;  3BFG A;  5DTT A;  3IF6 A;  4Z9Q A;  1XJ2 A;  4KZ5 A;  3E0Y A;  3M6H A;  4HHD A;  4JLF A;  3UNW A;  4DE1 A;  3MS6 A;  5FA7 A;  3UDI A;  3MQ0 A;  4GHI A;  2EX9 A;  2ZD8 A;  2QMI A;  4P6Z M;  2PU2 A;  1IYP A;  4EUV A;  3S22 A;  1IEL A;  3A0R A;  5IT5 A;  3C7U A;  3MZF A;  4N1H A;  4HH3 A;  4FTX A;  3VOY A;  2W1R A;  4GKU A;  4ZBE A;  3ZG0 A;  3VOL A;  2XRO A;  4E3K A;  4KUK A;  1XX2 A;  1H0M A;  4FH2 A;  3LUQ A;  3CAX A;  3IX3 A;  4QPR A;  4UA6 A;  1KGG A;  4B93 A;  1YAX A;  3T4K A;  1A0K A;  1N9N A;  4OQ0 A;  5F1G A;  3BY9 A;  2ZC6 B;  2P9V B;  4DE2 A;  2KOI A;  5E2F A;  4JGR A;  1YLJ A;  3ZVW A;  3T1R A;  1PFL A;  4HJ3 A;  3TSG A;  4MEZ A;  4LCL A;  4EQ1 A;  3KSF A;  1FCN A;  3LR0 A;  4RVA A;  5CEC A;  3JPU A;  3NDG A;  4DJ2 A;  3LEQ A;  4BEN A;  3VP2 A;  2QJ5 A;  3CUE A;  4E3O A;  5CX7 A;  2J3T C;  1VEU A;  3FKV A;  5L10 A;  4BJP A;  3WS2 A;  3GV9 A;  5F1F A;  3CI6 A;  5DVA A;  1SDE A;  1H5X A;  1OPX A;  3NY4 A;  4HQA A;  4IUH A;  5HWW A;  2VGL S;  3IXB A;  4IVK A;  2IWD A;  3FC7 A;  4BQM A;  4EQI A;  5JYP A;  4GS9 A;  2JBF A;  1JWV A;  4RX2 A;  3F1N A;  1K38 A;  2OWJ A;  1PYY A;  3KSI A;  3VP3 A;  4WEJ A;  2XFT A;  4GD8 A;  4Y0O A;  4C6Y A;  4A5R A;  3V67 A;  2DCF A;  2Y2K A;  3PBO A;  2O9B A;  4G3K A;  3ISG A;  1PZO A;  1OTE A;  5EM1 A;  4R6L A;  5FSR A;  4OKP A;  3UB8 A;  4K0W A;  3FV7 A;  3NHQ A;  4ETZ A;  4Y0U A;  4WN5 A;  4E6W A;  4Y17 A;  5AQ9 A;  4GN2 A;  1CEG A;  2ZM0 A;  1MY8 A;  1ERM A;  3F1P A;  3AGE A;  1G68 A;  3IHA A;  3LID A;  4M3K A;  1ZKJ A;  5TBM B;  2ZMV A;  3PBQ A;  3MQQ A;  1W8Y A;  1AWI A;  5A92 A;  3SH7 A;  3H9W A;  1RCJ A;  4MBH A;  2JKR I;  1LL9 A;  3MFX A;  1D06 A;  5KZH A;  1TVF A;  3VSL A;  1XKZ A;  4JXV A;  4P0M A;  2QHK A;  3BLM A;  5G4Y A;  5FEF A;  5L07 A;  4OPR A;  4Z1W A;  1YLW A;  4WL9 A;  2VV6 A;  1YSQ A;  4CLC C;  4ZTK A;  4X1L A;  3BM6 A;  3BQA A;  4KZ7 A;  5J3W A;  5AJG A;  1NWZ A;  3T1Q B;  1T1A A;  2Y2O A;  4H8R A;  5HPF A;  2ZQC A;  5J4E A;  4IBX A;  4PKY A;  4KQR A;  3ZYT A;  1S67 L;  2Y2L A;  2W1T B;  4Q0I A;  2GJ3 A;  4DMZ A;  5MC7 A;  4H6J B;  3NDE A;  4FUW A;  3ZGA B;  5DJU A;  2VX8 A;  3VV4 A;  4YIN A;  1KOU A;  3NI9 A;  2PR6 A;  3UB6 A;  3GMW A;  1O07 A;  3VE4 A;  2PYP A;  2J3W A;  2DMW A;  2W3F A;  2Y59 A;  1ES5 A;  3FZC A;  4LFU A;  1XJ3 A;  4BL2 A;  4OLG A;  1FIK A;  4DJ3 A;  5EOE A;  4L9F A;  3DTI A;  2IWB A;  4BD1 A;  3JYI A;  1W8Q A;  3PXP A;  5HAP A;  1ONG A;  4BMW A;  1KE0 A;  1SKF A;  2EXB A;  2ZQA A;  3O3V A;  1TS7 A;  3NJA A;  5DFY A;  2ZQ7 A;  4MN7 A;  4R0Q A;  5DFX A;  4B9O A;  5FQI A;  5M18 A;  2GNX A;  2Z6C A;  3L7H A;  4E3M A;  1OTI A;  3VOZ A;  3A0V A;  3A0S A;  5HWT A;  2XF3 A;  5CRF A;  1TS6 A;  3N8S A;  4DXB A;  3KO6 A;  4OOY A;  5K5B A;  2L4R A;  3DWK A;  1XPB A;  3EWK A;  4IJG A;  2WAD A;  3MQO A;  4CPK A;  5EVI B;  4XT2 B;  4N9K A;  4X6T A;  5CHJ A;  4PAU A;  5GHZ A;  2WAE A;  3IF6 B;  5F5Y A;  1GA0 A;  2OLU A;  3DTM A;  1ZG4 A;  4OP5 A;  2G7U A;  5CGX A;  4GZB A;  4N1X A;  2J9P A;  2XEP A;  1BT5 A;  3E2L A;  2VGJ A;  3DBA A;  4GHI B;  2K2N A;  2WKQ A;  4UEY A;  2YKH A;  1XFQ A;  2EX6 A;  4WF0 A;  4GDN A;  3NCK A;  2GDN A;  4NXE A;  2V20 A;  3IXH A;  1I2S A;  3B33 A;  1K57 C;  3A3I A;  1SZV A;  5GLA A;  4Y3I A;  3IBJ A;  5HL1 A;  4RQ9 A;  4OP8 A;  4ZJ1 A;  1VM1 A;  3T4J A;  3CWF A;  2VJW A;  2RCX A;  1G6O A;  4NET A;  3UY6 A;  4LRY C;  5EUA A;  2OAQ 1;  1EW0 A;  3CG5 A;  3MSH A;  4FD8 A;  2XR0 A;  4E04 A;  1MWU A;  3MF0 A;  1ALQ A;  2Y2I A;  4BLM A;  2IA2 A;  3EEH A;  1YT4 A;  3UO9 A;  5A91 A;  4L0L A;  1VHM A;  3BFF A;  1YLY A;  4P85 A;  4AFI A;  1VEU B;  4UA9 A;  1HVB A;  2ZQ9 A;  4JF6 A;  3M2J A;  1F5M A;  3CPT A;  3S7P A;  3M6B A;  3HUM A;  4YFM A;  2BAS A;  2XH9 A;  2XRN A;  1I5Q A;  5FQM A;  3V39 A;  1E25 A;  1DP9 A;  4YNR A;  2WKP A;  2L0W A;  4GW9 A;  1HD8 A;  4X69 A;  4HP9 A;  3S4X A;  3E4O A;  5LBR A;  1GHP A;  4GS9 B;  5DTS A;  5L09 A;  4DE3 A;  1K54 A;  5CTN A;  1ODV A;  3TG9 A;  3F1N B;  5JYO A;  3N4I A;  4C3Q A;  1LSX A;  1IYO A;  2WUQ A;  2ZL1 A;  1MPL A;  5AQB A;  4I3I A;  1F98 A;  2VA0 A;  3G6O A;  3FPV A;  4OPY A;  4KZ4 A;  1CI9 A;  1WA9 A;  1RGY A;  1XGJ A;  1YLP A;  3MKF A;  3P98 A;  4RYE A;  3UPN A;  3S7N A;  1OTD A;  3F1O A;  3PYP A;  3F1P B;  3UE6 A;  4NXG A;  2JKG A;  1WYB A;  1SKO A;  1ESI A;  1IOU A;  3ZG5 A;  3G32 A;  2Y8H A;  4S2K A;  3MFD A;  2O9A A;  5U47 A;  5F83 A;  2XD1 A;  4GDB A;  3BFC A;  4I5S A;  3U4L P;  1E3U D;  3N6I A;  5FAQ A;  5CHM A;  1MKM A;  1W63 Q;  4ZJ3 A;  5HSQ A;  3PHY A;  5KSC A;  2XA7 S;  1N9O A;  1K57 A;  2WAF A;  5D3O A;  1FR1 A;  1TEM A;  2QKP A;  4R3B A;  4FCF A;  2X01 A;  3EGX C;  1P97 A;  3G31 A;  1W63 M;  1JTD A;  1YSP A;  3VSK A;  1SCW A;  2H28 A;  5TFQ A;  2V2F F;  4R38 A;  4II7 A;  4F3L A;  2W3D A;  3Q7Z A;  3QNB A;  1OJG A;  2PDR A;  4LGW A;  3SH9 A;  4RX3 A;  3MXR A;  4O7D A;  4DF6 A;  4PHT A;  4UAA A;  4Y0T A;  4G3W A;  3MKE A;  3FKW A;  5DJT A;  2K7S A;  1L0D A;  2J7V A;  1IFQ A;  2HV1 A;  4JKT A;  3BJN A;  5FAP A;  2BLS A;  5CER A;  4S2N A;  3IWQ A;  1TDL A;  2RL3 A;  1Y28 A;  1NYM A;  5FDH A;  2R9W A;  2WKE A;  1DJC A;  2INW A;  2XLN A;  4ZAM A;  3WRT A;  3CLO A;  4JGO A;  1DY6 A;  4HOI A;  4IBR A;  1Y4O A;  3T1X A;  2PAV P;  3VMA A;  4ZDX A;  3VP0 A;  2VK3 A;  3QP8 A;  1ES3 A;  1MWT A;  3QHY A;  2VEA A;  5E2E A;  1MXO A;  5A93 A;  4WZ4 A;  4UA7 A;  1CEF A;  4WEK A;  3ZHH A;  4R3J A;  3WS1 A;  4OQI A;  3H7W A;  3ZG8 B;  1YMX A;  3D3O A;  4KQQ A;  3E4P A;  4EXO A;  3CIT A;  1GCE A;  5E2H A;  1HZO A;  4NKP A;  3LYX A;  1GSW A;  1PW1 A;  4ARZ B;  2P74 A;  2ZQD A;  3MZD A;  1XFN A;  1KGE A;  5FI7 A;  4JXW A;  4X56 A;  4O8G A;  1L0G A;  5GLB A;  5EVI D;  1NYY A;  3IX8 A;  4JBF A;  4ZJ2 A;  1IEM A;  4S2I A;  2WKH A;  3ITB A;  2EXA A;  3SS4 A;  1PWC A;  5HD5 A;  4KQO A;  2B95 A;  2V8F A;  1DJA A;  3NOU C;  2HJ9 C;  4WMC A;  1ZG6 A;  4KZ8 A;  3UB7 A;  2C5W B;  4S2J A;  1F9I A;  4E3L A;  3IWI A;  1LL5 A;  3GR2 A;  1FOF A;  4HH2 A;  4HNB A;  4EW7 A;  2Y91 A;  4X25 A;  4YWZ A;  1BUE A;  2O99 A;  2Y2M A;  4JGQ A;  4QWO A;  5GLC A;  2IWC A;  5HAQ A;  2Y2P A;  2QWS A;  1CI8 A;  1LHY A;  3ZDJ A;  3C4P A;  5J7E A;  4I3J A;  2JE5 A;  1H8Y A;  3QNC A;  4KQD A;  2Z2L B;  5I94 A;  3OPH A;  2A2L A;  4UQI S;  4PM8 A;  3OLO A;  4OON A;  1H8M A;  3ZNT A;  1V9Z A;  3LIF A;  5FEG A;  3H82 A;  2W3G A;  2A3U A;  5EFW A;  1MC0 A;  3BEB A;  4KG5 A;  2JCH A;  1EWZ A;  2PU4 A;  4QB8 A;  2HDQ A;  5IU1 A;  3UE3 A;  4IED A;  1NZU A;  2AVX A;  1G5U A;  4DDY A;  3PBR A;  2PYR A;  4QHC A;  1L0E A;  1ERQ A;  3T4O A;  4KEN B;  1FCO A;  3B42 A;  3BFD A;  5FL3 A;  1BLC A;  3DW0 A;  5EPH A;  1TS0 A;  4OOL A;  2OAP 1;  4FOF A;  3R4K A;  4HJ4 A;  3CMZ A;  3T4T A;  3HCY A;  2M1C A;  4LV2 A;  3OC2 A;  2V1A A;  1XXM A;  3FYZ A;  3CPT B;  4M4X A;  1T18 A;  1VET B;  2KLI A;  3FPW A;  4HEF A;  3SH8 A;  1GHM A;  1KDW A;  5DF9 A;  4BD0 A;  2J9O A;  2CC1 A;  1K56 A;  5DF7 A;  3L9K A;  1DRM A;  4R3A A;  4F94 A;  2WGW A;  1XJ4 A;  4GCZ A;  4NG2 A;  4WBG A;  3OPR A;  1EI5 A;  4GJ4 A;  4R23 A;  3KYE A;  4X53 A;  2YKF A;  1HTZ A;  4JF5 A;  3CJM A;  2I72 A;  2D02 A;  3IT9 A;  2ZL1 B;  3LR3 A;  4DN0 A;  2VGL M;  1TDG A;  2UV0 E;  1Q2Q A;  2Y2J A;  3LCE A;  3OCN A;  1N4O A;  5GHY A;  5GL9 A;  2OV5 A;  5HDC A;  4PM5 A;  3WRZ A;  1P0Z A;  1LSV A;  1KE3 A;  3W4Q A;  3F1O B;  3JVU A;  1PZP A;  4EET B;  1ZC2 A;  1SKO B;  4P87 A;  3TE8 A;  2Y2G A;  4BBT A;  4CLC E;  4JXS A;  4WUJ A;  3HRE A;  1S4S A;  5TGF A;  4ARZ A;  3I7J A;  1W5D A;  1P9W A;  4UHU A;  4XXR A;  2PRF A;  4S2O A;  5HZH A;  3IXG A;  4S2M A;  4ESP A;  5EE8 A;  1OTA A;  2CMN A;  1PWD A;  4PM7 A;  1IYS A;  2Z2M B;  5FQ9 A;  5AQA A;  3HUO A;  1NZO A;  4GOG A;  1BYW A;  5F82 A;  5CED A;  2OSU A;  2WZZ A;  3E4Q A;  4UQI M;  1TS8 A;  2OOL A;  5DF8 A;  3FWL A;  3S7O A;  4KZ9 A;  4F3L B;  3IF5 A;  4EBP A;  3P09 A;  1IKI A;  4G3V A;  4OQG A;  3V3S A;  2PT7 A;  2JC7 A;  4MN6 A;  3GSG A;  2OLV A;  2XDM A;  1Q2P A;  1STZ A;  2Q9M A;  3B47 A;  5CXW A;  1MWR A;  1W7F A;  1XP4 A;  2V9A A;  3LY4 A;  4CLC A;  1CQA A;  2J3T D;  5IS1 A;  5KIZ A;  2WZX A;  4EEP A;  4NXF A;  3G2Y A;  3TJZ C;  2VKS A;  2JHE A;  2FFF B;  4D2O A;  3V50 A;  1YPR A;  4LRZ E;  1PRQ A;  1S1Z A;  2M7V A;  2DRW A;  4QU3 A;  2EA9 A;  2A24 A;  1OJ5 A;  3O88 A;  4X55 A;  3HBR A;  3NIA A;  3MXS A;  3VFH A;  5HDD A;  3GRJ A;  1XJ6 A;  4MLL A;  1YM1 A;  3QP1 A;  4NEE D;  3H7W B;  3S7Q A;  1FSW A;  4WEL A;  1J9M A;  2ZC7 A;  3O87 A;  1UWP X;  2I9V A;  4Q0H A;  4LV1 A;  3ZVT A;  1O7E A;  3KYZ A;  3FG8 A;  1LSW A;  3Q7V A;  4KZ6 A;  4B4Z A;  4R4S A;  3WS4 A;  4PPR A;  3D72 A;  3T50 A;  2HGV A;  3IWO A;  5G4Z A;  3IS2 A;  4K08 A;  4P6Z S;  5AQ7 A;  4ME4 A;  2KX6 A;  1ES2 A;  5FQQ A;  2X71 A;  2PBY A;  1VET A;  3LIB A;  4EBN A;  3A3F A;  4B88 A;  3HVF A;  4I3A A;  1ZHH B;  4EBL A;  3G35 A;  5A90 A;  5EM0 A;  1N9L A;  2R9X A;  4I38 A;  3HLE A;  1K0K A;  2Y2H A;  2LB5 A;  4OPZ A;  1GA9 A;  1BSG A;  1K4E A;  3GVB A;  3HLW A;  2C6W B;  2EX2 A;  3CZD A;  2B5R A;  4DE0 A;  1YLZ A;  1V9Y A;  4X1M A;  1LL8 A;  4BBU A;  1SHV A;  1D1J A;  4HES A;  1YMS A;  3BW6 A;  4E3N A;  1PI4 A;  5EEC A;  3CUE C;  4LRX C;  3UB5 P;  1S66 L;  3AGD A;  3K3D A;  5AVF A;  3T1S A;  2HF6 A;  5AVE A;  2WGI A;  5A8B A;  3LIA A;  4QD4 A;  3Q1F A;  2OWH A;  5DTK A;  2WGV A;  3S1Y A;  4EEU A;  1K25 A;  4R4R A;  5HL6 A;  1JNU A;  1NLY A;  4E3J A;  5EV0 A;  5G18 A;  4OQH A;  4KG6 A;  3LR4 A;  1UGU A;  3H82 B;  1GSV A;  4ZRR A;  3U2A A;  5HW3 A;  3KYQ A;  3D9Y A;  3C4O A;  1JWP A;  1RP5 A;  2FFY A;  4OPQ A;  5F6A A;  2J80 A;  1M6K A;  1T1C A;  2G2U A;  4E3I A;  2G2W A;  2VGK A;  4JGP A;  4P6B A;  3GTC A;  5FI6 A;  4O0P A;  1T19 A;  1BZA A;  3QP5 A;  5FQK A;  3HLG A;  3ICY A;  3Q07 A;  3P7N A;  2PHY A;  1E4D A;  1IKG A;  3G30 A;  3KX0 X;  3PBS A;  3OOV A;  4I39 A;  1K6R A;  4GB7 A;  4C75 A;  3GQZ A;  5L2F A;  1N9B A;  1MBL A;  1NLZ A;  3PAE A;  5EOO A;  2DNS A;  2Y2N A;  4LV0 A;  3C2W A;  3UPO A;  3IHB A;  5HAI A;  2Q9N A;  3A3J A;  1XA7 A;  2WGW B;  4QJG A;  4IUK A;  3WS0 A;  1L0F A;  4EER A;  1DJB A;  1OTB A;  2BG1 A;  5F69 A;  1Z6F A;  2Z6D A;  1LI0 A;  4JXG A;  2HP9 A;  2VLG A;  3NBL A;  3T4Q A;  2V1B A;  1PWG A;  4EWF A;  3LFV A;  4L9E A;  5FQJ A;  3IX4 A;  5DKL A;  3UPP A;  1CK3 A;  2HJE A;  4HBU A;  3UE0 A;  2J8Y A;  2HDS A;  4U0T A;  4LLO B;  3DWZ A;  3OPP A;  4O01 A;  4S2L A;  5HWV A;  3VP4 A;  3O5Y A;  3PR6 A;  3IBR A;  3PAG A;  2NUP C;  4PM9 A;  5CGS A;  1NRJ A;  3WS5 A;  4U3T A;  3C7V A;  3DTK A;  1FIL A;  1GHI A;  1PW8 A;  2WKR A;  3M2K A;  1BLH A;  3MMH A;  3PTE A;  3K3C A;  3LGO A;  4QY6 A;  3MZE A;  3UN7 A;  3ZNY A;  3ZG9 B;  4IVI A;  3HUN A;  3AGF A;  1YQS A;  4MBK A;  5E2G A;  3OBF A;  2H0T A;  2W0N A;  2HZ5 A;  2Q0O A;  3NUL A;  3A3D A;  4KZA A;  3C38 A;  1YKD A;  4ID4 A;  5C5K A;  2XA7 M;  1MZU A;  3BRM A;  5GLD A;  3OZH A;  5HAR A;  3KSH A;  1H3Q A;  4XUX A;  4KG2 A;  4FH4 A;  4NK3 A;  2JKF A;  4E6X A;  2HDU A;  4CLC B;  1OME A;  3R7W A;  4GLQ A;  4CJN A;  3UB9 A;  5EVE A;  4MCW A;  2E8I A;  3UMD A;  1K55 C;  4EU0 A;  1HLU P;  3LO7 A;  4QY5 A;  4HY8 A;  2HP5 A;  3LI9 A;  4KZB A;  1AXB A;  3C5A A;  1IYQ A;  3UME A;  2A24 B;  1NXY A;  4JPM A;  3IH9 A;  3W4O A;  5CHU A;  4BWI A;  1I2W A;  5FAT A;  3OPL A;  1S1Y A;  1NRF A;  3K2N A;  4MBF A;  1WYC A;  1MWS A;  3LIE A;  4LV3 A;  3RH8 B;  3A3E A;  4GNU A;  1NJ4 A;  1FCM A;  1SDN A;  3ULF A; 
#chains in the Genus database with same CATH homology
 1ODV A;  3F1N B;  2KOI A;  3S7O A;  4F3L B;  4G3V A;  1LSX A;  2PT7 A;  3JVV A;  4JGR A;  4MN6 A;  2PR5 A;  3W2Z A;  3P01 A;  4HJ3 A;  1DP8 A;  4I3I A;  1F98 A;  2VA0 A;  3IS2 B;  3G6O A;  3FPV A;  1STZ A;  3HJK A;  2M7U A;  4EQ1 A;  1WA9 A;  3KSF A;  3RTY A;  3B47 A;  3LR0 A;  4HI4 A;  2V9A A;  4CLC A;  2J3T D;  2NUT C;  4DJ2 A;  5IS1 A;  3S7N A;  5KIZ A;  1OTD A;  2QJ5 A;  3CUE A;  2P7J A;  3F1O A;  5CX7 A;  3PYP A;  4EEP A;  3F1P B;  3UE6 A;  2J3T C;  4NXF A;  4NXG A;  3TJZ C;  2VKS A;  1IOU A;  2Y8H A;  2JHE A;  4BJP A;  2O9A A;  4LRZ E;  2P04 A;  1S1Z A;  2M7V A;  3EEA A;  2LB9 A;  4I5S A;  2EA9 A;  2A24 A;  3CI6 A;  2K31 A;  1OJ5 A;  1OPX A;  1ZTU A;  4HQA A;  4IUH A;  2B02 A;  5HWW A;  1MKM A;  1W63 Q;  5HDD A;  1XJ6 A;  5HSQ A;  3BWL A;  3PHY A;  5F68 A;  2XA7 S;  2VGL S;  3SW1 A;  1N9O A;  4OOM A;  2GX5 A;  2QKP A;  3FC7 A;  4NEE D;  2MJ6 A;  3EGX C;  3H7W B;  4HIA A;  4GS9 A;  1P97 A;  1W63 M;  3S7Q A;  1YSP A;  3C8C A;  4WEL A;  2H28 A;  2PD8 A;  3F1N A;  1UWP X;  2OWJ A;  3NOT C;  4R38 A;  2JKT M;  4II7 A;  3KSI A;  4F3L A;  2I9V A;  3EQU A;  4WEJ A;  4Q0H A;  2W3D A;  1OJG A;  2ZOH A;  3KYZ A;  2QJ7 A;  3FG8 A;  1LSW A;  2PDR A;  3V67 A;  3T50 A;  3D72 A;  3TRC A;  5KSH A;  2HGV A;  5G4Z A;  3PBO A;  2O9B A;  3IS2 A;  4G3K A;  4K08 A;  2JN7 A;  1OTE A;  2VZW A;  4PHT A;  4R6L A;  4P6Z S;  4ME4 A;  2KX6 A;  4G3W A;  2O9C A;  3UB8 A;  3EOI A;  3LI8 A;  3NHQ A;  4ETZ A;  5DJT A;  2W27 A;  2L1M A;  4WN5 A;  3LIC A;  2K7S A;  1VB6 A;  3ZQ5 A;  1IFQ A;  4YOF A;  3LIB A;  2HV1 A;  3BJN A;  4I3A A;  1ZHH B;  3F1P A;  4MMN A;  3LID A;  1Y28 A;  5TBM B;  2ZMV A;  1N9L A;  3PBQ A;  3MQQ A;  3EQV A;  4I38 A;  2VV7 A;  2W3E A;  1DP6 A;  2LB5 A;  3H9W A;  2JKR I;  3MFX A;  2INW A;  1D06 A;  3CLO A;  4JGO A;  4Q0J A;  4HOI A;  2XSS A;  4Y2F A;  1GSX A;  4Y5F A;  2QHK A;  5G4Y A;  1P9R A;  1LT0 A;  4Z1W A;  1V9Y A;  2GZA A;  2VEA A;  1LL8 A;  4FSF A;  2VV6 A;  4WL9 A;  3RFB A;  4BBU A;  1YSQ A;  4KUO A;  1D7E A;  4WEK A;  3BW6 A;  4CLC C;  3H7W A;  1OT6 A;  3D3O A;  3E4P A;  4EXO A;  3CUE C;  3BQA A;  4LRX C;  3CIT A;  5J3W A;  5AJG A;  1S66 L;  5HD3 A;  1NWZ A;  3K3D A;  5AVF A;  2HF6 A;  4MN5 A;  1T1A A;  3C30 A;  5AVE A;  5A8B A;  4NKP A;  5HPF A;  3LIA A;  5J4E A;  1TD5 A;  4PKY A;  3LYX A;  2OWH A;  1GSW A;  3ZYT A;  4EEU A;  5DKK A;  1S67 L;  4ARZ B;  4BBV A;  5HL6 A;  2W1T B;  4Q0I A;  2GJ3 A;  1JNU A;  1NLY A;  2D01 A;  3T4L A;  2ZOI A;  4DMZ A;  4ETX A;  5MC7 A;  4H6J B;  1XFN A;  5I5L A;  3LR4 A;  1UGU A;  4O8G A;  4LPZ A;  5DJU A;  2VX8 A;  3VV4 A;  3H82 B;  1GSV A;  1KOU A;  4ZRR A;  3U2A A;  2PR6 A;  3UB6 A;  3KYQ A;  3MJQ A;  2PD7 A;  3VE4 A;  2PYP A;  5F6A A;  2J3W A;  2J80 A;  2DMW A;  1T1C A;  2W3F A;  5TBM A;  5TJJ A;  2FZ0 A;  4HP4 A;  3ULF A;  1XJ3 A;  3PBT A;  4JGP A;  5HD5 A;  2EWV A;  4DJ3 A;  4KQO A;  3NOU C;  2HJ9 C;  4L9F A;  4O0P A;  2EWW A;  3UB7 A;  1T19 A;  4R70 A;  2V0U A;  1F9I A;  4IHQ A;  3ICY A;  3PXP A;  3P7N A;  2PHY A;  4BMW A;  3EGD C;  4HJ6 A;  4HH2 A;  4HNB A;  3KX0 X;  4EW7 A;  2VV8 A;  3PBS A;  3OOV A;  4I39 A;  4YWZ A;  1TS7 A;  2O99 A;  3NJA A;  4JGQ A;  1OT9 A;  5DFY A;  3MR0 A;  4MN7 A;  5DFX A;  4B9O A;  2QWS A;  2GNX A;  2Z6C A;  1NLZ A;  1OTI A;  3A0V A;  2B18 A;  3A0S A;  3BQ8 A;  5HWT A;  5J7E A;  3C2W A;  4I3J A;  1TS6 A;  4KQD A;  2R78 A;  3KO6 A;  4IUK A;  4EER A;  4EES A;  1OTB A;  2A2L A;  4UQI S;  1G28 A;  3OLO A;  2W1T A;  4NXB A;  5F69 A;  1UWN X;  5K5B A;  1H8M A;  4H6J A;  2O0Y A;  1V9Z A;  2L4R A;  2Z6D A;  3LIF A;  4PKY G;  2VLG A;  3H82 A;  2W3G A;  3T4Q A;  5EFW A;  1MC0 A;  2V1B A;  3EWK A;  3LFV A;  4IJG A;  3UE3 A;  5IU1 A;  4CLC D;  4L9E A;  4WLA A;  3MQO A;  3E98 A;  3PBR A;  5DKL A;  2PYR A;  2HJE A;  4XT2 B;  4PAU A;  3T4O A;  3B42 A;  5FL3 A;  5F5Y A;  3R7W B;  4LLO B;  1TS0 A;  4O01 A;  2G7U A;  4OOL A;  3GEC A;  2JKR M;  2OAP 1;  4MDZ A;  5HWV A;  2P08 A;  3TW8 A;  4FOF A;  3R4K A;  4HJ4 A;  3BY8 A;  3O5Y A;  3PR6 A;  1X0O A;  3IBR A;  5HPI A;  2NUP C;  3T4S A;  3KSG A;  3T4T A;  3DBA A;  4GHI B;  1NRJ A;  2K2N A;  3HCY A;  2M1C A;  2WKQ A;  4UEY A;  2YKH A;  1XFQ A;  3OC2 A;  4WF0 A;  2V1A A;  2V0W A;  3MXQ A;  4M4X A;  4NXE A;  1T18 A;  2KLI A;  2WKR A;  3FPW A;  3MMH A;  3K3C A;  5DF9 A;  1S4R A;  3B33 A;  3OCL A;  3OBF A;  4Y3I A;  3NOP C;  1DRM A;  3LR5 A;  4R3A A;  3IBJ A;  5HDS A;  1XJ4 A;  4GCZ A;  2W0N A;  4RQ9 A;  2QYB A;  4L9G A;  2W3H A;  2JKT I;  2ZMF A;  4GJ4 A;  2ZBB A;  2KDK A;  3T4J A;  3CWF A;  2YKF A;  2VJW A;  1G6O A;  3VE3 A;  3C38 A;  4LRY C;  1YKD A;  1T1B A;  2D02 A;  4CQH A;  2OAQ 1;  1EW0 A;  3PBN A;  5C5K A;  3LR3 A;  4DN0 A;  2XA7 M;  2VGL M;  4E04 A;  1MZU A;  2Y79 A;  3MF0 A;  1TF1 A;  3GDI A;  3KSH A;  2FH5 A;  1H3Q A;  2IA2 A;  4XT2 A;  3OCN A;  3HJI A;  5L8M A;  3EEH A;  4CLC B;  5HDC A;  3R7W A;  1P0Z A;  1XJ2 A;  1LSV A;  4GLQ A;  4L0L A;  3E0Y A;  3F1O B;  3UB9 A;  3JVU A;  1VHM A;  4HHD A;  4EET B;  4MCW A;  3UMD A;  4AFI A;  4EU0 A;  3TE8 A;  4HY8 A;  4BBT A;  3LI9 A;  4CLC E;  3MQ0 A;  4GHI A;  4WUJ A;  1S4S A;  4P6Z M;  3UME A;  4ARZ A;  1P9W A;  1F5M A;  2A24 B;  4EUV A;  3S7P A;  3A0R A;  4BWI A;  5IT5 A;  5HZH A;  1TS8 A;  2BAS A;  2XRN A;  4HH3 A;  1DP9 A;  4YNR A;  1S1Y A;  2W1R A;  2WKP A;  1OTA A;  2CMN A;  3K2N A;  2XRO A;  3VOL A;  2L0W A;  4GW9 A;  4KUK A;  3LUQ A;  4HP9 A;  3CAX A;  3LIE A;  4QPR A;  1BYW A;  3E4O A;  5LBR A;  1YAX A;  4B93 A;  3T4K A;  4GS9 B;  3RH8 B;  3E4Q A;  1N9N A;  4UQI M;  3BY9 A;  2OOL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...