4C3QA

Neutron structure of a perdeuterated toho-1 r274n r276n double mutant beta-lactamase in complex with a fully deuterated boronic acid (bzb) at 100k
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
261
structure length
261
Chain Sequence
NSVQQQLEALEKSSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTMTLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTEPTLNTAIPGDPRDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGSGDYGTTNDIAVIWPENHAPLVLVTYFTQPEQKAENRNDILAAAAKIVTHGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE TOHO-1
publication title Cryogenic Neutron Protein Crystallography: Routine Methods and Potential Benefits
doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 88
structure length 261
sequence length 261
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2013-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4c3qA00
4OQ0A 3UNWA 3IF5A 2EXBA 2HP9A 3JYIA 3N4IA 3DWZA 1SKFA 2E8IA 3IXHA 1YT4A 5KMWA 4HBTA 3AGEA 1BUEA 3PAEA 5DVAA 2CC1A 1K56D 4U0TA 3ZCZA 1IKIA 4D2OA 2QMIA 3IHAA 4NK3A 4PMAA 3BRMA 4JXWA 3BLMA 3IF6C 3Q7ZA 2EX8A 2HDSA 3ZNTA 2A49A 3Q07A 4JPMA 5E2GA 1G68A 5A93A 1N9BA 2XD1A 2Y2HA 1XPBA 5E2EA 2WUQA 4DDSA 2PU4A 2OLVA 4KG6A 5FASA 4B88A 3G30A 4OPRA 1QMFA 1W5DA 5KSCA 3C7UA 4R0QA 1E3UD 3S1YA 1RGZA 4LV2A 5HX9A 3ZNYA 3OCNA 1FCOA 4R3JA 1BLHA 2XQZA 5CRFA 1KGEA 4N92A 1I5QA 2HP5A 4S2IA 1GCEA 4EBLA 3Q7VB 3N8LA 1XKZA 2XR0A 4UAAA 3ZHHA 4QY6A 1I2WA 4N9LA 3FV7A 4F94A 4KQOA 4OQGA 2ZJ9A 3GV9A 1PW8A 4WZ5A 4MBHA 4Y0UA 2WK0A 3IWIA 1KGGA 1U60A 5JYPA 4X69A 1XA1A 2HP6A 2HDRA 1RGYA 5A92A 1O07A 4S2LA 2C5WB 4WMCD 4LV3A 4E6WA 1AXBA 3G34A 3GR2A 4JLFA 1I2SA 1L2SA 2XEPA 4GD6A 4JXGA 4C6YA 4OLDA 4QU3A 3IF6B 5HW3A 1MPLA 2DCFA 1NZUA 4ZTKA 3PBOA 3WS0A 1K55C 1ES4A 1HTZA 3EQVA 4LV0A 4WELA 1GHMA 4KZ6A 5CGSA 1PWCA 5KSHA 4E3LA 1K25A 2X02A 1K54C 1K38A 1L0DA 4BL2A 1SHVA 3NIAA 3PTEA 5EVLA 5GHZA 2DNSA 1GA0A 2XFSA 4KZAA 4WBGA 2ZC7A 3EQUA 1N4OA 1NXYA 3A3FA 3WS5A 2DRWA 4Y7PA 3M2KA 2Y4AA 4KZ3A 4OPZA 3C5AA 1KDWA 1L0EA 4LV1A 5GHYA 1PI4A 4OLGA 2ZD8A 3ZG8B 3BFDA 4ZJ2A 3UE1A 4EBNA 1Z6FA 2V1ZA 1K4FA 4K0XA 5FDHA 3RJUA 3QNBA 3B3XA 1Q2QA 2H5SA 1DJBA 1LL9A 1FCMA 1KE3A 2EX6A 4K0WA 1ZG6A 2EX2A 4GDNA 4L0LA 4S2KA 1W8QA 5G18A 3N8RA 4GD8A 5FAPA 2Q9MA 2Q9NA 4UA6A 4WEJA 5FAOA 2G2WA 1IELA 1MKIA 1NZOA 3IWQA 2ZQ7A 4PM8A 4DDYA 2ZQ8A 4OH0A 4KG5A 4P6BA 3LY4A 5F83A 3ZVTA 5F1FA 1DJCA 3OZHA 1IYSA 5FA7A 2Z2MB 1YLYA 5FQJA 2WKEA 2Y2OA 3Q82A 4NETA 1CEGA 3VP1A 2JE5A 3ZG0A 3CMZA 1BSGA 3TOIA 5DTSA 2EXAA 5EECA 1LL5A 1S6RA 3LCEA 5F82A 1JWVA 2ZC5B 3NBLA 5FQIA 3IXGA 3OPLA 5GLAA 3W4OA 3GVBA 4P87A 2IWCA 5FI6A 3VP4A 4U0XA 4YINA 2P9VB 1MWUA 5EVID 1YMXA 4JF6A 2XH9A 2ZC4B 3VP0A 3NI9A 3TG9A 5FQKA 4H8RA 1NYYA 3S4XA 3OCLA 3C4PA 2Y2NA 1OMEA 3BFEA 3G35A 3Q7VA 1S0WA 1LLBA 4X53A 1BLCA 3RXWA 4RX3A 2XLNA 3LO7A 4P0MA 4BD0A 1PYYA 3UPNA 1YLWA 5HARA 5GLBA 4PM5A 3FZCA 1MXOA 1FR1A 1MWSA 4FH4A 3MFDA 2WAFA 1IYPA 4UA9A 4MEZA 3MXRA 4P85A 2H0TA 3Q81A 5E2FA 4GKUA 4C3QA 5M18A 3VFFA 3QHYA 5CGXA 4HEFA 3HL9A 2Y2MA 4GZBA 3FKVA 1FOFA 3IH9A 2JBFA 4R1GA 1Q2PA 2FFYA 1IYOA 3HLBA 3IF6A 3NC8A 2ZM0A 4KENB 4S2NC 3WWXA 1XP4A 5CEBA 1HZOA 3A3EA 4KZBA 3IT9A 4OPYA 1XGJA 5L2FA 2Y2PA 4KZ7A 4N9KA 1ES2A 4KG2A 3OPRA 4OVDA 5CECA 1NY0A 3BECA 3P98A 1YM1A 2Y2LA 1ESUA 5M1AA 4R4RA 3W8KA 4OPQA 3DW0A 1ONGA 3MZEA 1PW1A 5FQQA 5EVIB 1NJ4A 4X6TA 5HAIA 4BL3A 3SS5A 3WS1A 4BD1A 3IQAA 1G6AA 3UDFA 5FAQA 3G32A 2ZQDA 1YQSA 4C75A 1FSWA 4EV4A 5IHVA 4JF5A 2WZXA 4OOLA 5CHMA 4MBKA 2ZQAA 3GMWA 4JKTA 3QNCA 1E25A 4IBRA 1JTDA 4OKPA 3W4PA 1YLJA 1EROA 5TFQA 4HBUA 4JXSA 5CTNA 5FQMA 3ITBA 4LCLA 1MWRA 4PM9A 3V39A 1MY8A 1PWGA 1SDNA 3C7VA 3SS4A 3V3SA 3HBRA 3WS2A 1K55A 3FKWA 3HUNA 4S2OA 3NY4A 1ONHA 2XK1A 5AQ9A 4BLMA 4UA7A 1JWZA 3OPHA 4QD4A 1K54A 4IVIA 1CK3A 3V50A 4EUZA 2Y59A 3ZG5A 2C6WB 2OSUA 3UN7A 3MZDA 3UY6A 3WRZA 4GN2A 4GDBA 3V5MA 4E6XA 5A90A 3BEBA 3OPPA 4XXRA 3OC2A 2Y91A 2ZC3B 2ZMAA 5HFOA 3HUOA 4DKIA 5GLCA 5AQ7A 3ZFZA 1KE4A 5CEDA 4ZJ3A 3GSGA 3ZVWA 4QHCA 1GHIA 2ZQ9A 5DTKA 4CPKA 1L0GA 2WGWB 1BZAA 4X55A 1M40A 3HUMA 1K57C 5CHUA 1QMEA 2X71A 5FSRA 4MNRA 1PIOA 5DF8A 1SCWA 3DTMA 1XA7A 2EFXA 5DTTA 2RL3A 4EQIA 4MLLA 4XUZA 3IH8A 3M6HA 5GLDA 3VFHA 2Y2JA 3G2YA 4E3OA 1RCJA 2G2UA 4N1HA 3DWKA 1FQGA 3BFGA 4FSFA 3S22A 2OLUA 5CXWA 1H5XA 2Y2QA 4DRTA 4OOYA 1MWTA 2IWBA 2BG1A 4BJPA 4Q8IA 4E3JA 1LI0A 1PWDA 4KZ5A 1ERMA 1DJAA 2XF3A 2JC7A 4O7DA 1KVLA 3RXXA 3IXBA 4ZJ1A 4DF6A 4QB8A 4E3IA 3UDIA 1FSYA 4DE3A 3D4FA 2HPBA 3BFCA 1ZC2A 2R9WA 2JCHA 1C3BA 3SH7A 2XGNA 3IWOA 3O88A 1WE4A 3UPPA 5EVIC 4OP8A 1GHPA 1W8YA 2FFFB 3UE0A 4PM6A 2Z2LB 4ZAMA 1BTLA 1JWPA 2VGJA 1CEFA 3ZDJA 4QJGA 1M6KA 4BENA 3I7JA 4WYYA 3BM6A 1HD8A 5FQ9A 4DXCA 3PBNA 5I94A 2WKHA 3LY3A 2Y2IA 3IHBA 3HLCA 3O86A 4OQIA 4R23A 3WS4A 5EOOA 1WYBA 2A3UA 1PI5A 1NRFA 1FCNA 2OV5A 5CERA 5TGFA 3UPOA 4FCFA 1IEMA 2EFUA 2GDNA 5M19A 3HVFA 3BFFA 4LCMA 4M3KA 2UWXA 1VQQA 3UO9A 1BT5A 1CI9A 1DY6A 3MZFA 1IYQA 2H10A 5FI2A 3BYDA 2R9XA 4E3MA 1ERQA 3N7WA 3PBTA 1TEMA 2WKIA 4OP5A 4EWFA 1K56A 4WM9A 1BULA 1KVMA 3ISGA 1J9MA 4B4XA 4PPRA 2Y2GA 3IXDA 4DE1A 1TDGA 4S2JA 1O7EA 2Y55A 2V20A 2H0YA 3PBQA 1PZPA 2I72A 2V2FF 4WEKA 3N8SA 1ES3A 3NDGA 4KQQA 3UE3A 1JTGA 1KGFA 4RX2A 4S2NA 1YLZA 2RCXA 5CHJA 4KQRA 3VP3A 2QZ6A 4EBPA 2ZM8A 3A3DA 1E3UA 4CJNA 3G2ZA 5E43A 3G31A 4WZ5C 3Q1FA 1JVJA 3N6IA 4KZ9A 4YFMA 1SDEA 5GL9A 2J9OA 3CJMA 3MBZA 3VSLA 4OONA 4DE0A 1H8ZA 3FWLA 2PBYA 4X68A 5DF9A 4R4SA 1FR6A 3AGDA 1MBLA 4ZDXA 5AQAA 4Y0OA 1E4DA 3VOYA 3ZGAB 3CZDA 1NYMA 5CTMA 1ES5A 3GRJA 4E3KA 3GQZA 4WMCA 1W7FA 5JYOA 4IBXA 2WGWA 3HLFA 1ALQA 4RA7A 1KDSA 5HAPA 1BLSA 2WGIA 3V3RA 4IVKA 5TR7A 1CI8A 3SS3A 4OQHA 2WAEA 2HDQA 3M2JA 5E2HA 1L0FA 1W79A 2XD5A 2EX9A 4HESA 4FD8A 2ZC6B 1YLPA 4GOGA 3AGFA 5EPHA 3PBRA 3MXSA 1KE0A 2PU2A 3PBSA 1K6RA 4A5RA 4S2PA 1K4EA 3ITAA 4ZBEA 3SH9A 2VGKA 4X56A 1Y54A 3P09A 3C4OA 1LHYA 4KZ4A 1RP5A 3NCKA 2P74A 4Y0TA 5HAQA 2ZM2A 3CG5A 3MKFA 2BLSA 3O3VA 5CGWA 5FATA 1ZKJA 2P9VA 3A3IA 2IWDA 1GA9A 3VSKA 4S2MA 4R3BA 5HL1A 2J9PA 4B4ZA 1EWZA 5EUAA 3A3JA 3UDXA 4JXVA 4DE2A 5D3OA 5EOEA 3M6BA 1ESIA 1H8YA 1IKGA 1XGIA 2Y2KA 3G4PA 3WRTA 2WYXA 4E3NA 5J8XA 4IEDA 4Z9QA 2WADA 3SH8A 1BLPA 3BLSA 2WGVA 5A91A 4U3TA 2XDMA 4JF4A 2XFTA 2ZQCA 3VOZA 1XX2A 3E2KA 2ZLYA 1K57A 4DXBA 2HDUA 5FI7A 3ZG9B 4QY5A 3HLDA 4MBFA 5BOHA 1XXMA 4GNUA 4KZ8A 1HVBA 5EE8A 4ID4A 1ZG4A 1LI9A 3E2LA 1YLTA 5GHXA 5KZHA 3HREA 1TVFA 3HLGA 3O87A 4WZ4A 1TDLA 3LEZA 2X01A 4GB7A 3HLWA 3PAGA 3SOIA 2J8YA 4UHUA 5F1GA 4FH2A 3W4QA 1VM1A 5DF7A 3ZG7B 1YMSA 3NDEA 3HLEA 5AQBA 4BQMA 4K91A 4RVAA 3VMAA 2WZZA 1EI5A 1K6SA 4RYEA 4LENA 5EVIA 3VP2A 1PZOA 2B5RA 4N1XA 2J7VA 3FYZA 4PM7A 4JBFA 4OOMA 2QPNA 5U47A 4XUXA 3MKEA 3GTCA 3TSGA 1WYCA
chains in the Genus database with same CATH superfamily
3IF5A 2HP9A 5KMWA 1NLYA 3AGEA 1BUEA 3PAEA 4JGRA 3BLMA 2A49A 1UWPX 1OJGA 1S4SA 3G30A 1QMFA 3C7UA 3D3OA 4YWZA 3MS6A 3OCNA 5CRFA 1KGEA 4N92A 1I5QA 2HP5A 1GCEA 3Q7VB 2INWA 3ZHHA 4QY6A 4N9LA 4F94A 1T1CA 2PAVP 3QP8A 1NWZA 2OAP1 4KUOA 4EW7A 2WK0A 1KGGA 1U60A 5JYPA 5A92A 2HP6A 2HDRA 5MC7A 1PFLA 4S2LA 3G34A 4JLFA 1L2SA 4GD6A 2V8FA 2WKQA 4GS9B 5HW3A 1NZUA 4ZTKA 4BWIA 1K55C 3SW1A 1HTZA 1GHMA 4KZ6A 5CGSA 4PKYG 2OOLA 4E3LA 1K38A 4BL2A 3NIAA 5GHZA 2DNSA 2PR6A 2ZBBA 4EEUA 3LICA 3EQUA 4JGPA 4EQ1A 3A3FA 3WS5A 2YKFA 2Y4AA 4KZ3A 2R78A 5DKKA 4EBNA 1TS6A 3TRCA 3EEAA 4HIAA 1K4FA 2H5SA 1KE3A 2EX6A 4K0WA 4S2KA 4LFUA 5J4EA 2PT7A 4UA6A 4WEJA 5FAOA 1MKIA 2ZQ7A 3H9WA 4KG5A 3LY4A 1YLYA 2A24B 4NETA 1CEGA 1DP9A 2GJ3A 5DTSA 2ZMVA 5EECA 3MMHA 3LCEA 2J80A 3LR5A 3MQOA 3GVBA 5DJTA 5HD5A 3R7WB 5DFYA 2ZL1A 5FEGA 1IOUA 3NI9A 3TG9A 2D02A 3G35A 4RX3A 5IU1A 4P0MA 5HARA 4PM5A 3H82B 4XT2A 5FDSA 1IYPA 4BBVA 1YSQA 4C3QA 4GKUA 1S1ZA 4O01A 2GX5A 3S7NA 3FKVA 1FOFA 3H7WA 3IX3A 5CEBA 3IT9A 1XGJA 4N9KA 4KG2A 4OVDA 1YM1A 2VEAA 1ONGA 3P7NA 2OWJA 5EVIB 1NJ4A 4X6TA 1OJ5A 4NXBA 4BD1A 4E04A 2PYRA 4HJ6A 5FAQA 3G32A 4UQIM 2ZQDA 2NUTC 1STZA 1YQSA 4LRZE 1H8MA 2B18A 5F69A 2B02A 3OOVA 4OKPA 1EROA 3NHQA 4GLQA 4HBUA 4JXSA 4PM9A 3SS4A 3C7VA 3HBRA 2Q0OA 1K55A 4CLCD 1ONHA 2XK1A 4UA7A 2OAQ1 4IVIA 1CK3A 3V50A 2VGLS 2Y59A 3ZG5A 4CLCC 3UN7A 3WRZA 3V5MA 1L3LA 3OPPA 2Y91A 2ZC3B 3GSGA 4HQAA 4QHCA 2WGWB 1BZAA 1M40A 3KYEA 4R38A 2JKTI 4BMWA 3B47A 4OOYA 2BG1A 4E3JA 2JC7A 2XF3A 4QB8A 4DE3A 5DFXA 3BFCA 1WE4A 1LL8A 3UPPA 1N9LA 2XRNA 1GHPA 4ZAMA 1LT0A 5FQ9A 4DXCA 2WKHA 3WS4A 2Y2IA 1G28A 3HLCA 2W3FA 2GZAA 3UPOA 4M3KA 1OPXA 1IYQA 3IBRA 3BYDA 3HCYA 3U4LP 4B4XA 2BASA 2Y2GA 1MKMA 3T4TA 2VGLM 4S2JA 2H0YA 2O99A 1OTAA 4D60A 2V2FF 3C2WA 4NEED 3UE3A 1JTGA 4LLOB 2V1BA 5G4YA 3VE3A 3TW8A 3A3DA 4IJGA 2JKRM 3HJKA 5F5YA 1SDEA 4Y17A 4DE0A 4X68A 1CQAA 1H0MA 1XJ3A 3AGDA 3S7OA 5AQAA 3ZGAB 5HPFA 1NYMA 5CTMA 4E3KA 3A0SA 5HWVA 1KDSA 1SKOB 1BLSA 2P08A 4KUKA 4HP9A 2Y79A 4EERA 5L09A 3AGFA 5AVFA 2VGKA 1LHYA 4Y0TA 5HAQA 3E98A 3O3VA 4CLCA 2B95A 2P9VA 2V1AA 2QYBA 4MN5A 5IT5A 1YPRA 3A3JA 5EOEA 3M6BA 4IEDA 2ZOHA 3BLSA 5A91A 2XDMA 2Z6CA 3VOZA 1XX2A 1JNUA 3E0YA 3QP2A 5AVEA 2VV8A 3UE6A 1S66L 1K6SA 2W1TA 4F3LA 3KSGA 4PM7A 4OOMA 2V0WA 4YOFA 3MKEA 2J3TD 1DP6A 2HGVA 4R3AA 3TSGA 2E8JA 3N4IA 2E8IA 1GSXA 5L07A 2J3TC 4HBTA 5DVAA 2KDKA 4NK3A 4JXWA 4O8GA 4AFIA 5E2GA 1G68A 2L0WA 5A93A 2XD1A 2WUQA 2M7VA 2OLVA 4KG6A 5FASA 3BY8A 2W3EA 5KSCA 4R0QA 1E3UD 3S1YA 4LV2A 5HX9A 1FCOA 4R3JA 2XQZA 2O0YA 4EBLA 1XKZA 3CUEC 4KQOA 4FTXA 3T4LA 4HJ4A 1PW8A 4MBHA 3EEHA 3IWIA 1BYWA 1O07A 2C5WB 4WMCD 1AXBA 2O9AA 3PHYA 5J3WA 4JXGA 4Q0IA 3T4OA 5IS1A 1VETB 4ESPA 1L0DA 1GA0A 2XFSA 4JGQA 4KZAA 4WBGA 2JHEA 4OPZA 3C5AA 5GHYA 1PI4A 2NUPC 1MZUA 3ZG8B 3LIEA 1VHMA 2QHKA 4G3WA 3KO6A 3QNBA 1Q2QA 3DAVA 1W8QA 5G18A 2PDRA 3N8RA 4GD8A 5FAPA 1IELA 5K5BA 4DDYA 4P6BA 5F1FA 1DJCA 1IYSA 5FL3A 2JN7A 2Y2OA 2LB5A 3ZG0A 3ZQ5A 1YKDA 3TOIA 2VV6A 1S6RA 5FQIA 5GLAA 3NOTC 1Y4OA 3VP4A 1VEUB 2O9CA 4YINA 5EVID 1YMXA 3VP0A 2Y2NA 3BFEA 4EESA 3MXQA 3Q7VA 1LLBA 1OT6A 3UPNA 1YLWA 2XSSA 1MXOA 4I3IA 3F1OA 1TD5A 3F1NA 2PD7A 3MXRA 4P85A 2H0TA 3Q81A 4GZBA 2JBFA 3SZTA 3T4SA 1UWNX 1TS0A 3QP5A 3A3EA 4KZBA 1F2KA 5L2FA 2Y2PA 1ES2A 3CWFA 5EV0A 2P7JA 2L1MA 5CECA 2MJ6A 4R4RA 4JGOA 4OPQA 3U2AA 4MN7A 3WS1A 3CUEA 5EFWA 3IQAA 4DJ2A 4C75A 1FSWA 3PYPA 4OOLA 2UV0E 1E25A 1G6OA 4IBRA 4G3VA 5FQMA 2VKSA 1MWRA 1MY8A 4BLMA 1JWZA 4QD4A 3NECA 4EUZA 3TJZC 3FPVA 2OSUA 4B9OA 4E6XA 2ZMAA 4QPRA 4HH3A 5GLCA 5HWTA 2ZQ9A 4WN5A 4UQIS 3RFBA 3HUMA 1F98A 2X71A 1PIOA 3DTMA 1XA7A 1T18A 4MLLA 5GLDA 2JKRI 3T1SA 4N1HA 3CPTA 1FQGA 3BFGA 2D01A 1H5XA 2Y2QA 2IWBA 1LI0A 4DF6A 4ARZA 1ZC2A 3SH7A 3IWOA 1W8YA 1TS7A 4LRXC 1M6KA 4BENA 3I7JA 4WYYA 4EEPA 1W63Q 2HZ5A 2BTFP 4WF0A 2A2LA 5I94A 5AJGA 3O86A 3D9YA 2PHYA 2A3UA 1D1JA 5CERA 2QJ7A 4LCMA 3UO9A 1VQQA 1CI9A 2ACGA 5FI2A 2H10A 1TEMA 1OTBA 4WM9A 1KVMA 4PPRA 3LR0A 4I39A 3G6OA 5DKLA 2Y55A 1S1YA 1XFQA 2I72A 1ZHHB 1ES3A 1KGFA 4KQRA 3VP3A 4EBPA 2ZM8A 3ICYA 4I3AA 2ZL1B 3DTEA 3Q1FA 4KZ9A 4YFMA 5GL9A 2J9OA 3CJMA 3QP1A 4OONA 5DF9A 4ZDXA 4GW9A 1E4DA 1T1BA 3CZDA 1FILA 1ES5A 1K0KA 4NXGA 4XT2B 3GQZA 1W7FA 5JYOA 2WGWA 3HLFA 4RA7A 4M4XA 1A0KA 1TF1A 4IVKA 3LR4A 4OQHA 2WAEA 2HDQA 1L0FA 1W79A 1DRMA 4FD8A 2ZC6B 1YLPA 3MXSA 3H7WB 3IS2A 5TJJA 2Y8HA 3W2ZA 2ZMFA 3ITAA 4ZBEA 1TS8A 1Y54A 1FIKA 1RP5A 3NCKA 2P74A 2ZM2A 5FATA 3NULA 1G5UA 4HOIA 4R3BA 3KSIA 3EGXC 1ESIA 4E3NA 2WYXA 3QP4A 4Z9QA 2WADA 3SH8A 3K3DA 1BLPA 2WGVA 4JF4A 3PXPA 3E2KA 4RQ9A 2HDUA 5FI7A 3HLDA 4MBFA 3A0VA 4KZ8A 2VV7A 5EE8A 4ID4A 4NG2A 4ZRRA 1YLTA 5GHXA 3HREA 1TVFA 3HLGA 3O87A 1TDLA 4II7A 2X01A 3PAGA 3W4QA 3LEQA 1VM1A 3MQQA 3HLEA 4BQMA 2PR5A 3VMAA 3VP2A 4R70A 1PZOA 3KYZA 2W3HA 1N9OA 3FYZA 2K31A 1S4RA 2DMWA 1WYCA 4OQ0A 5I5LA 2EXBA 1SKFA 3IXHA 1YT4A 3MF0A 4U0TA 1K56D 3ZCZA 1IKIA 2QMIA 3IHAA 4PMAA 3ZNTA 2HV1A 4Y13A 3Q07A 4JPMA 1N9BA 2Y2HA 2W27A 1XPBA 5E2EA 4FOFA 2PU4A 2HJ9C 3MJQA 4B88A 3EGDC 3E4OA 1X0OA 2V9AA 3BY9A 4S2IA 3N8LA 1I2WA 5L8MA 3BJNA 3HJIA 4OQGA 2ZJ9A 3GV9A 4Y0UA 1RGYA 4CLCE 1I2SA 2XEPA 3GDIA 4C6YA 4EU0A 4QU3A 3IF6B 1MPLA 2DCFA 1ES4A 4LV0A 4WELA 5EVEA 5KSHA 4P6ZS 3IBJA 1ODVA 1SHVA 5EVLA 3BQAA 1Z09A 3T1QB 1N4OA 1NXYA 2DRWA 3JVVA 1L0EA 4LV1A 4EUVA 2ZD8A 2WKRA 3RJUA 3IX8A 1DJBA 1F9IA 1LL9A 1FCMA 3E4PA 2EX2A 3F1PA 5HPIA 4EXOA 4R6LA 3FC7A 4I3JA 2KOIA 2Q9MA 2Q9NA 2G2WA 3IX4A 3GECA 3OZHA 1T19A 1V9ZA 2Z2MB 1IFQA 5FQJA 3Q82A 3T50A 3CMZA 2LB9A 4H6JA 2EXAA 1LL5A 1JWVA 3NBLA 3OPLA 3W4OA 4P87A 2V8CA 5FI6A 4U0XA 2P9VB 4JF6A 2XH9A 3LR3A 2ZC4B 4H8RA 1NYYA 3C4PA 1OMEA 1S0WA 1BLCA 2HF6A 2W1RA 3RXWA 5J7EA 3LO7A 4BD0A 3FZCA 2Z6DA 1FR1A 1F5MA 1XJ2A 4FH4A 3MFDA 4L9FA 4Q0JA 4P6ZM 5M18A 3VFFA 3QHYA 5CGXA 3KX0X 3T1XA 3HL9A 3IH9A 1Q2PA 2FFYA 1IYOA 2K7SA 4YNRA 4KENB 3WWXA 1HZOA 4OPYA 4KZ7A 1NY0A 1PRQA 1ESUA 2Y2LA 5M1AA 2PD8A 3W8KA 2FZ0A 3DW0A 3T12B 3MZEA 1PW1A 5FQQA 4BL3A 2W1TB 3SS5A 4F3LB 3P01A 5A8BA 3KSHA 4EV4A 4X25A 2WZXA 5CHMA 2ZQAA 4B93A 3RTYA 1YLJA 4X1MA 3ITBA 1GSVA 3V39A 3UB7A 1PNEA 1PWGA 3BWLA 1SDNA 3WS2A 1P97A 1OTEA 3HUNA 4S2OA 3NY4A 5AQ9A 4LGWA 1HLUP 3OPHA 2C6WB 2PYPA 3UY6A 3CAXA 4GHIA 4GN2A 4GDBA 3K2NA 5LBRA 3OC2A 2XA7M 5HFOA 3HUOA 1VEUA 5TBMB 4ZJ3A 3ZVWA 1GHIA 4X1LA 2J3WA 5DTKA 1DP8A 4CPKA 4X55A 1P0ZA 3A0RA 2CMNA 1K57C 4HI4A 4MNRA 5F68A 5DF8A 1SCWA 3OLOA 5DTTA 2RL3A 4EQIA 3VFHA 2Y2JA 3G2YA 4E3OA 1RCJA 2G2UA 5EM1A 1LSXA 2EWWA 4Z1WA 3T4QA 4DRTA 4Q8IA 4BJPA 4Q0HA 4Y2FA 4KZ5A 1CJFA 4I5SA 1DJAA 3RXXA 3IXBA 4ZJ1A 2WKPA 3UDIA 1FSYA 3LIDA 2HPBA 2QJ5A 2XGNA 3O88A 5EVIC 2L4RA 3EOIA 2Z2LB 3ZDJA 1JWPA 2VGJA 1CEFA 4QJGA 4DN0A 2IA2A 3V67A 3PBNA 3IHBA 3MR0A 4OQIA 1WYBA 1PI5A 1NRFA 3JPUA 2OV5A 4DJ3A 5TGFA 4FCFA 2EFUA 3FG8A 3HVFA 3C8CA 2UWXA 1BT5A 3MZFA 4GS9A 2R9XA 4EWFA 3N7WA 3PBTA 2WKIA 3ISGA 3IXDA 4DE1A 1TDGA 3B33A 3PBQA 1PZPA 4KQQA 4RX2A 2RCXA 4Y15A 5CHJA 3RH8B 2QZ6A 2V0UA 1E3UA 3B42A 2M1CA 3G2ZA 3G31A 4WZ5C 1T1AA 5C5KA 4IUKA 4HJ3A 1H8ZA 4R4SA 1FR6A 2O9BA 4Y0OA 3VOYA 1EW0A 3GRJA 4WMCA 3F1OB 1ALQA 3F1NB 2WGIA 3V3RA 1CI8A 4QWOA 3SS3A 3M2JA 3LIBA 3KYQA 5EPHA 3CLOA 2A24A 3PBRA 2PU2A 3PBSA 3CHWP 2HJEA 4S2PA 5F6AA 3SH9A 4X56A 3CG5A 1W63M 1P9RA 5CGWA 1ZKJA 3A3IA 2FH5A 2IWDA 3BW6A 3R7WA 1GA9A 4ME4A 2J9PA 3E4QA 1EWZA 4JXVA 4DE2A 1D06A 1WA9A 1XGIA 3UB9A 3G4PA 5J8XA 1Y28A 1LSVA 3H82A 1UGUA 2VZWA 2XFTA 2ZQCA 2ZLYA 1K57A 4DXBA 3MFXA 3CITA 1XXMA 3KSFA 3DTIA 1ZG4A 5KZHA 3C30A 4GB7A 3DTKA 3HLWA 4LRYC 4FH2A 5DF7A 4PAUA 4K91A 2WZZA 4G3KA 5EVIA 4RYEA 4LENA 1GSWA 3CI6A 2J7VA 4N1XA 4JBFA 4MN6A 2QPNA 3L7HA 3GTCA 4FUWA 3UNWA 3JYIA 3DWZA 5CX7A 1OTDA 2CC1A 5KIZA 4D2OA 3BRMA 4HNBA 3IF6C 3CPTB 2EX8A 2HDSA 3Q7ZA 4DDSA 4OPRA 1W5DA 4IUHA 4ARZB 1RGZA 3ZNYA 1BLHA 3MSHA 1SZVA 2XR0A 4UAAA 4BBUA 4HP4A 3FV7A 3NOUC 2GNXA 4WZ5A 4X69A 1XA1A 5HDCA 1NLZA 4LV3A 3ZYTA 4E6WA 3GR2A 2M7UA 2VLGA 4GCZA 4OLDA 4WLAA 2OWHA 3PBOA 3WS0A 3EQVA 1PWCA 3TE8A 1AWIA 1K25A 2X02A 1K54C 3VV4A 3PTEA 2W3GA 3S7QA 4ETXA 3LIAA 4GJ4A 2ZC7A 1KOUA 1YSPA 4Y7PA 2EWVA 3T4KA 3M2KA 1KDWA 4OLGA 3BFDA 4ZJ2A 3UE1A 5G4ZA 1Z6FA 2YKHA 2V1ZA 4K0XA 5FDHA 3B3XA 4ETZA 1ZG6A 4GDNA 4L0LA 4IHQA 2VJWA 2KX6A 3IWQA 1NZOA 4PM8A 2ZQ8A 4OH0A 3LIFA 3T1RA 5F83A 3ZVTA 5FA7A 2WKEA 1XJ6A 3IS2B 3VP1A 2JE5A 1BSGA 5HZHA 2JKFA 5F82A 2ZC5B 1S67L 1V9YA 3IXGA 1LSWA 2IWCA 4WUJA 1MWUA 3LUQA 1D7EA 4HY8A 5FQKA 3S4XA 3OCLA 4X53A 1CF0A 2XLNA 1OT9A 1PYYA 3DBAA 5GLBA 1MWSA 1SKOA 2WAFA 4UA9A 4MEZA 4K08A 5E2FA 3LYXA 4HEFA 2Y2MA 4R1GA 3HLBA 3IF6A 3NC8A 2ZM0A 4HHDA 4S2NC 1XP4A 4PKYA 3QP6A 3OPRA 1VB6A 3BECA 3P98A 2VA0A 5HAIA 2K2NA 4DMZA 4WL9A 3UDFA 1G6AA 1H3QA 1XJ4A 5IHVA 4JF5A 4MBKA 3GMWA 2ZOIA 4JKTA 3QNCA 1JTDA 3W4PA 3UB5P 5TFQA 4HH2A 3LGOA 5CTNA 3UMEA 4LCLA 3UB8A 3V3SA 4I38A 3FKWA 2XROA 1K54A 5EM0A 2W0NA 3MZDA 2VX8A 5A90A 3BEBA 1YAXA 4XXRA 4DKIA 3ZFZA 5AQ7A 4NXFA 1KE4A 5CEDA 3ULFA 5HD3A 4CQHA 1L0GA 5CHUA 1QMEA 5FSRA 3T4JA 3VOLA 1ZTUA 2EFXA 3K3CA 4XUZA 3IH8A 3M6HA 3DWKA 3S22A 4FSFA 2OLUA 5CXWA 5DJUA 1ACFA 1MWTA 4Y5FA 1PWDA 1ERMA 4O7DA 2P04A 1KVLA 3LI9A 4CLCB 4E3IA 2QWSA 3UMDA 4MCWA 3D4FA 3D72A 4MMNA 2R9WA 2JCHA 4EETB 1C3BA 4OP8A 2FFFB 2XA7S 3UE0A 4PM6A 1BTLA 5HWWA 1XFNA 3BM6A 3VE4A 1HD8A 3L9KA 3LY3A 4R23A 1N9NA 5EOOA 2G7UA 1FCNA 3F1PB 1IEMA 2GDNA 5M19A 3BFFA 1DY6A 3S7PA 3NOPC 4UEYA 4E3MA 1ERQA 4OP5A 1K56A 1BULA 3OBFA 1J9MA 1VETA 3EWKA 1O7EA 2V20A 2KLIA 4WEKA 4NKPA 3N8SA 3NDGA 2QKPA 4S2NA 4H6JB 3C38A 1YLZA 4L9GA 2JKTM 4CJNA 4NXEA 5E43A 1JVJA 3N6IA 2PBDP 3JVUA 3MBZA 3VSLA 2I9VA 3FWLA 5HDDA 2PBYA 5HSQA 3LFVA 4O0PA 5TBMA 5HDSA 1MBLA 5L10A 4IBXA 5HAPA 5TR7A 1P9WA 3MQ0A 5E2HA 2XD5A 2EX9A 3UB6A 4HESA 4BBTA 4GOGA 1KE0A 1K6RA 4A5RA 2W3DA 1K4EA 3P09A 3C4OA 4KZ4A 4MDZA 3PR6A 3MKFA 2BLSA 2EA9A 3VSKA 4S2MA 4KQDA 4B4ZA 5EUAA 1J3WA 3UDXA 5D3OA 3WRTA 1H8YA 1IKGA 2Y2KA 3BQ8A 4U3TA 5HL6A 3O5YA 3FPWA 3LI8A 2JKGA 1MC0A 3ZG9B 4QY5A 5BOHA 4GNUA 1HVBA 1NRJA 1LI9A 3E2LA 3NJAA 5FEFA 2VK3A 4WZ4A 4PHTA 4Y3IA 3LEZA 3SOIA 2J8YA 4UHUA 4GHIB 5F1GA 3ZG7B 1YMSA 3NDEA 5AQBA 2H28A 2AVXA 4RVAA 1EI5A 2PRFA 3R4KA 2B5RA 4L9EA 4LPZA 1OTIA 5U47A 4XUXA 5HL1A
chains in the Genus database with same CATH topology
4OQ0A 3UNWA 3IF5A 2EXBA 2HP9A 3JYIA 3N4IA 3DWZA 1SKFA 2E8IA 3IXHA 1YT4A 5KMWA 4HBTA 3AGEA 1BUEA 3PAEA 5DVAA 2CC1A 1K56D 4U0TA 3ZCZA 1IKIA 4D2OA 2QMIA 3IHAA 4NK3A 4PMAA 3BRMA 4JXWA 3BLMA 3IF6C 3Q7ZA 2EX8A 2HDSA 3ZNTA 2A49A 3Q07A 4JPMA 5E2GA 1G68A 5A93A 1N9BA 2XD1A 2Y2HA 1XPBA 5E2EA 2WUQA 4DDSA 2PU4A 2OLVA 4KG6A 5FASA 4B88A 3G30A 4OPRA 1QMFA 1W5DA 5KSCA 3C7UA 4R0QA 1E3UD 3S1YA 1RGZA 4LV2A 5HX9A 3ZNYA 3OCNA 1FCOA 4R3JA 1BLHA 2XQZA 5CRFA 1KGEA 4N92A 1I5QA 2HP5A 4S2IA 1GCEA 4EBLA 3Q7VB 3N8LA 1XKZA 2XR0A 4UAAA 3ZHHA 4QY6A 1I2WA 4N9LA 3FV7A 4F94A 4KQOA 4OQGA 2ZJ9A 3GV9A 1PW8A 4WZ5A 4MBHA 4Y0UA 2WK0A 3IWIA 1KGGA 1U60A 5JYPA 4X69A 1XA1A 2HP6A 2HDRA 1RGYA 5A92A 1O07A 4S2LA 2C5WB 4WMCD 4LV3A 4E6WA 1AXBA 3G34A 3GR2A 4JLFA 1I2SA 1L2SA 2XEPA 4GD6A 4JXGA 4C6YA 4OLDA 4QU3A 3IF6B 5HW3A 1MPLA 2DCFA 1NZUA 4ZTKA 3PBOA 3WS0A 1K55C 1ES4A 1HTZA 3EQVA 4LV0A 4WELA 1GHMA 4KZ6A 5CGSA 1PWCA 5KSHA 4E3LA 1K25A 2X02A 1K54C 1K38A 1L0DA 4BL2A 1SHVA 3NIAA 3PTEA 5EVLA 5GHZA 2DNSA 1GA0A 2XFSA 4KZAA 4WBGA 2ZC7A 3EQUA 1N4OA 1NXYA 3A3FA 3WS5A 2DRWA 4Y7PA 3M2KA 2Y4AA 4KZ3A 4OPZA 3C5AA 1KDWA 1L0EA 4LV1A 5GHYA 1PI4A 4OLGA 2ZD8A 3ZG8B 3BFDA 4ZJ2A 3UE1A 4EBNA 1Z6FA 2V1ZA 1K4FA 4K0XA 5FDHA 3RJUA 3QNBA 3B3XA 1Q2QA 2H5SA 1DJBA 1LL9A 1FCMA 1KE3A 2EX6A 4K0WA 1ZG6A 2EX2A 4GDNA 4L0LA 4S2KA 1W8QA 5G18A 3N8RA 4GD8A 5FAPA 2Q9MA 2Q9NA 4UA6A 4WEJA 5FAOA 2G2WA 1IELA 1MKIA 1NZOA 3IWQA 2ZQ7A 4PM8A 4DDYA 2ZQ8A 4OH0A 4KG5A 4P6BA 3LY4A 5F83A 3ZVTA 5F1FA 1DJCA 3OZHA 1IYSA 5FA7A 2Z2MB 1YLYA 5FQJA 2WKEA 2Y2OA 3Q82A 4NETA 1CEGA 3VP1A 2JE5A 3ZG0A 3CMZA 1BSGA 3TOIA 5DTSA 2EXAA 5EECA 1LL5A 1S6RA 3LCEA 5F82A 1JWVA 2ZC5B 3NBLA 5FQIA 3IXGA 3OPLA 5GLAA 3W4OA 3GVBA 4P87A 2IWCA 5FI6A 3VP4A 4U0XA 4YINA 2P9VB 1MWUA 5EVID 1YMXA 4JF6A 2XH9A 2ZC4B 3VP0A 3NI9A 3TG9A 5FQKA 4H8RA 1NYYA 3S4XA 3OCLA 3C4PA 2Y2NA 1OMEA 3BFEA 3G35A 3Q7VA 1S0WA 1LLBA 4X53A 1BLCA 3RXWA 4RX3A 2XLNA 3LO7A 4P0MA 4BD0A 1PYYA 3UPNA 1YLWA 5HARA 5GLBA 4PM5A 3FZCA 1MXOA 1FR1A 1MWSA 4FH4A 3MFDA 2WAFA 1IYPA 4UA9A 4MEZA 3MXRA 4P85A 2H0TA 3Q81A 5E2FA 4GKUA 4C3QA 5M18A 3VFFA 3QHYA 5CGXA 4HEFA 3HL9A 2Y2MA 4GZBA 3FKVA 1FOFA 3IH9A 2JBFA 4R1GA 1Q2PA 2FFYA 1IYOA 3HLBA 3IF6A 3NC8A 2ZM0A 4KENB 4S2NC 3WWXA 1XP4A 5CEBA 1HZOA 3A3EA 4KZBA 3IT9A 4OPYA 1XGJA 5L2FA 2Y2PA 4KZ7A 4N9KA 1ES2A 4KG2A 3OPRA 4OVDA 5CECA 1NY0A 3BECA 3P98A 1YM1A 2Y2LA 1ESUA 5M1AA 4R4RA 3W8KA 4OPQA 3DW0A 1ONGA 3MZEA 1PW1A 5FQQA 5EVIB 1NJ4A 4X6TA 5HAIA 4BL3A 3SS5A 3WS1A 4BD1A 3IQAA 1G6AA 3UDFA 5FAQA 3G32A 2ZQDA 1YQSA 4C75A 1FSWA 4EV4A 5IHVA 4JF5A 2WZXA 4OOLA 5CHMA 4MBKA 2ZQAA 3GMWA 4JKTA 3QNCA 1E25A 4IBRA 1JTDA 4OKPA 3W4PA 1YLJA 1EROA 5TFQA 4HBUA 4JXSA 5CTNA 5FQMA 3ITBA 4LCLA 1MWRA 4PM9A 3V39A 1MY8A 1PWGA 1SDNA 3C7VA 3SS4A 3V3SA 3HBRA 3WS2A 1K55A 3FKWA 3HUNA 4S2OA 3NY4A 1ONHA 2XK1A 5AQ9A 4BLMA 4UA7A 1JWZA 3OPHA 4QD4A 1K54A 4IVIA 1CK3A 3V50A 4EUZA 2Y59A 3ZG5A 2C6WB 2OSUA 3UN7A 3MZDA 3UY6A 3WRZA 4GN2A 4GDBA 3V5MA 4E6XA 5A90A 3BEBA 3OPPA 4XXRA 3OC2A 2Y91A 2ZC3B 2ZMAA 5HFOA 3HUOA 4DKIA 5GLCA 5AQ7A 3ZFZA 1KE4A 5CEDA 4ZJ3A 3GSGA 3ZVWA 4QHCA 1GHIA 2ZQ9A 5DTKA 4CPKA 1L0GA 2WGWB 1BZAA 4X55A 1M40A 3HUMA 1K57C 5CHUA 1QMEA 2X71A 5FSRA 4MNRA 1PIOA 5DF8A 1SCWA 3DTMA 1XA7A 2EFXA 5DTTA 2RL3A 4EQIA 4MLLA 4XUZA 3IH8A 3M6HA 5GLDA 3VFHA 2Y2JA 3G2YA 4E3OA 1RCJA 2G2UA 4N1HA 3DWKA 1FQGA 3BFGA 4FSFA 3S22A 2OLUA 5CXWA 1H5XA 2Y2QA 4DRTA 4OOYA 1MWTA 2IWBA 2BG1A 4BJPA 4Q8IA 4E3JA 1LI0A 1PWDA 4KZ5A 1ERMA 1DJAA 2XF3A 2JC7A 4O7DA 1KVLA 3RXXA 3IXBA 4ZJ1A 4DF6A 4QB8A 4E3IA 3UDIA 1FSYA 4DE3A 3D4FA 2HPBA 3BFCA 1ZC2A 2R9WA 2JCHA 1C3BA 3SH7A 2XGNA 3IWOA 3O88A 1WE4A 3UPPA 5EVIC 4OP8A 1GHPA 1W8YA 2FFFB 3UE0A 4PM6A 2Z2LB 4ZAMA 1BTLA 1JWPA 2VGJA 1CEFA 3ZDJA 4QJGA 1M6KA 4BENA 3I7JA 4WYYA 3BM6A 1HD8A 5FQ9A 4DXCA 3PBNA 5I94A 2WKHA 3LY3A 2Y2IA 3IHBA 3HLCA 3O86A 4OQIA 4R23A 3WS4A 5EOOA 1WYBA 2A3UA 1PI5A 1NRFA 1FCNA 2OV5A 5CERA 5TGFA 3UPOA 4FCFA 1IEMA 2EFUA 2GDNA 5M19A 3HVFA 3BFFA 4LCMA 4M3KA 2UWXA 1VQQA 3UO9A 1BT5A 1CI9A 1DY6A 3MZFA 1IYQA 2H10A 5FI2A 3BYDA 2R9XA 4E3MA 1ERQA 3N7WA 3PBTA 1TEMA 2WKIA 4OP5A 4EWFA 1K56A 4WM9A 1BULA 1KVMA 3ISGA 1J9MA 4B4XA 4PPRA 2Y2GA 3IXDA 4DE1A 1TDGA 4S2JA 1O7EA 2Y55A 2V20A 2H0YA 3PBQA 1PZPA 2I72A 2V2FF 4WEKA 3N8SA 1ES3A 3NDGA 4KQQA 3UE3A 1JTGA 1KGFA 4RX2A 4S2NA 1YLZA 2RCXA 5CHJA 4KQRA 3VP3A 2QZ6A 4EBPA 2ZM8A 3A3DA 1E3UA 4CJNA 3G2ZA 5E43A 3G31A 4WZ5C 3Q1FA 1JVJA 3N6IA 4KZ9A 4YFMA 1SDEA 5GL9A 2J9OA 3CJMA 3MBZA 3VSLA 4OONA 4DE0A 1H8ZA 3FWLA 2PBYA 4X68A 5DF9A 4R4SA 1FR6A 3AGDA 1MBLA 4ZDXA 5AQAA 4Y0OA 1E4DA 3VOYA 3ZGAB 3CZDA 1NYMA 5CTMA 1ES5A 3GRJA 4E3KA 3GQZA 4WMCA 1W7FA 5JYOA 4IBXA 2WGWA 3HLFA 1ALQA 4RA7A 1KDSA 5HAPA 1BLSA 2WGIA 3V3RA 4IVKA 5TR7A 1CI8A 3SS3A 4OQHA 2WAEA 2HDQA 3M2JA 5E2HA 1L0FA 1W79A 2XD5A 2EX9A 4HESA 4FD8A 2ZC6B 1YLPA 4GOGA 3AGFA 5EPHA 3PBRA 3MXSA 1KE0A 2PU2A 3PBSA 1K6RA 4A5RA 4S2PA 1K4EA 3ITAA 4ZBEA 3SH9A 2VGKA 4X56A 1Y54A 3P09A 3C4OA 1LHYA 4KZ4A 1RP5A 3NCKA 2P74A 4Y0TA 5HAQA 2ZM2A 3CG5A 3MKFA 2BLSA 3O3VA 5CGWA 5FATA 1ZKJA 2P9VA 3A3IA 2IWDA 1GA9A 3VSKA 4S2MA 4R3BA 5HL1A 2J9PA 4B4ZA 1EWZA 5EUAA 3A3JA 3UDXA 4JXVA 4DE2A 5D3OA 5EOEA 3M6BA 1ESIA 1H8YA 1IKGA 1XGIA 2Y2KA 3G4PA 3WRTA 2WYXA 4E3NA 5J8XA 4IEDA 4Z9QA 2WADA 3SH8A 1BLPA 3BLSA 2WGVA 5A91A 4U3TA 2XDMA 4JF4A 2XFTA 2ZQCA 3VOZA 1XX2A 3E2KA 2ZLYA 1K57A 4DXBA 2HDUA 5FI7A 3ZG9B 4QY5A 3HLDA 4MBFA 5BOHA 1XXMA 4GNUA 4KZ8A 1HVBA 5EE8A 4ID4A 1ZG4A 1LI9A 3E2LA 1YLTA 5GHXA 5KZHA 3HREA 1TVFA 3HLGA 3O87A 4WZ4A 1TDLA 3LEZA 2X01A 4GB7A 3HLWA 3PAGA 3SOIA 2J8YA 4UHUA 5F1GA 4FH2A 3W4QA 1VM1A 5DF7A 3ZG7B 1YMSA 3NDEA 3HLEA 5AQBA 4BQMA 4K91A 4RVAA 3VMAA 2WZZA 1EI5A 1K6SA 4RYEA 4LENA 5EVIA 3VP2A 1PZOA 2B5RA 4N1XA 2J7VA 3FYZA 4PM7A 4JBFA 4OOMA 2QPNA 5U47A 4XUXA 3MKEA 3GTCA 3TSGA 1WYCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OQ0 A;  3UNW A;  3IF5 A;  2EXB A;  2HP9 A;  3JYI A;  3N4I A;  3DWZ A;  1SKF A;  2E8I A;  3IXH A;  1YT4 A;  5KMW A;  4HBT A;  3AGE A;  1BUE A;  3PAE A;  5DVA A;  2CC1 A;  1K56 D;  4U0T A;  3ZCZ A;  1IKI A;  4D2O A;  2QMI A;  3IHA A;  4NK3 A;  4PMA A;  3BRM A;  4JXW A;  3BLM A;  3IF6 C;  3Q7Z A;  2EX8 A;  2HDS A;  3ZNT A;  2A49 A;  3Q07 A;  4JPM A;  5E2G A;  1G68 A;  5A93 A;  1N9B A;  2XD1 A;  2Y2H A;  1XPB A;  5E2E A;  2WUQ A;  4DDS A;  2PU4 A;  2OLV A;  4KG6 A;  5FAS A;  4B88 A;  3G30 A;  4OPR A;  1QMF A;  1W5D A;  5KSC A;  3C7U A;  4R0Q A;  1E3U D;  3S1Y A;  1RGZ A;  4LV2 A;  5HX9 A;  3ZNY A;  3OCN A;  1FCO A;  4R3J A;  1BLH A;  2XQZ A;  5CRF A;  1KGE A;  4N92 A;  1I5Q A;  2HP5 A;  4S2I A;  1GCE A;  4EBL A;  3Q7V B;  3N8L A;  1XKZ A;  2XR0 A;  4UAA A;  3ZHH A;  4QY6 A;  1I2W A;  4N9L A;  3FV7 A;  4F94 A;  4KQO A;  4OQG A;  2ZJ9 A;  3GV9 A;  1PW8 A;  4WZ5 A;  4MBH A;  4Y0U A;  2WK0 A;  3IWI A;  1KGG A;  1U60 A;  5JYP A;  4X69 A;  1XA1 A;  2HP6 A;  2HDR A;  1RGY A;  5A92 A;  1O07 A;  4S2L A;  2C5W B;  4WMC D;  4LV3 A;  4E6W A;  1AXB A;  3G34 A;  3GR2 A;  4JLF A;  1I2S A;  1L2S A;  2XEP A;  4GD6 A;  4JXG A;  4C6Y A;  4OLD A;  4QU3 A;  3IF6 B;  5HW3 A;  1MPL A;  2DCF A;  1NZU A;  4ZTK A;  3PBO A;  3WS0 A;  1K55 C;  1ES4 A;  1HTZ A;  3EQV A;  4LV0 A;  4WEL A;  1GHM A;  4KZ6 A;  5CGS A;  1PWC A;  5KSH A;  4E3L A;  1K25 A;  2X02 A;  1K54 C;  1K38 A;  1L0D A;  4BL2 A;  1SHV A;  3NIA A;  3PTE A;  5EVL A;  5GHZ A;  2DNS A;  1GA0 A;  2XFS A;  4KZA A;  4WBG A;  2ZC7 A;  3EQU A;  1N4O A;  1NXY A;  3A3F A;  3WS5 A;  2DRW A;  4Y7P A;  3M2K A;  2Y4A A;  4KZ3 A;  4OPZ A;  3C5A A;  1KDW A;  1L0E A;  4LV1 A;  5GHY A;  1PI4 A;  4OLG A;  2ZD8 A;  3ZG8 B;  3BFD A;  4ZJ2 A;  3UE1 A;  4EBN A;  1Z6F A;  2V1Z A;  1K4F A;  4K0X A;  5FDH A;  3RJU A;  3QNB A;  3B3X A;  1Q2Q A;  2H5S A;  1DJB A;  1LL9 A;  1FCM A;  1KE3 A;  2EX6 A;  4K0W A;  1ZG6 A;  2EX2 A;  4GDN A;  4L0L A;  4S2K A;  1W8Q A;  5G18 A;  3N8R A;  4GD8 A;  5FAP A;  2Q9M A;  2Q9N A;  4UA6 A;  4WEJ A;  5FAO A;  2G2W A;  1IEL A;  1MKI A;  1NZO A;  3IWQ A;  2ZQ7 A;  4PM8 A;  4DDY A;  2ZQ8 A;  4OH0 A;  4KG5 A;  4P6B A;  3LY4 A;  5F83 A;  3ZVT A;  5F1F A;  1DJC A;  3OZH A;  1IYS A;  5FA7 A;  2Z2M B;  1YLY A;  5FQJ A;  2WKE A;  2Y2O A;  3Q82 A;  4NET A;  1CEG A;  3VP1 A;  2JE5 A;  3ZG0 A;  3CMZ A;  1BSG A;  3TOI A;  5DTS A;  2EXA A;  5EEC A;  1LL5 A;  1S6R A;  3LCE A;  5F82 A;  1JWV A;  2ZC5 B;  3NBL A;  5FQI A;  3IXG A;  3OPL A;  5GLA A;  3W4O A;  3GVB A;  4P87 A;  2IWC A;  5FI6 A;  3VP4 A;  4U0X A;  4YIN A;  2P9V B;  1MWU A;  5EVI D;  1YMX A;  4JF6 A;  2XH9 A;  2ZC4 B;  3VP0 A;  3NI9 A;  3TG9 A;  5FQK A;  4H8R A;  1NYY A;  3S4X A;  3OCL A;  3C4P A;  2Y2N A;  1OME A;  3BFE A;  3G35 A;  3Q7V A;  1S0W A;  1LLB A;  4X53 A;  1BLC A;  3RXW A;  4RX3 A;  2XLN A;  3LO7 A;  4P0M A;  4BD0 A;  1PYY A;  3UPN A;  1YLW A;  5HAR A;  5GLB A;  4PM5 A;  3FZC A;  1MXO A;  1FR1 A;  1MWS A;  4FH4 A;  3MFD A;  2WAF A;  1IYP A;  4UA9 A;  4MEZ A;  3MXR A;  4P85 A;  2H0T A;  3Q81 A;  5E2F A;  4GKU A;  4C3Q A;  5M18 A;  3VFF A;  3QHY A;  5CGX A;  4HEF A;  3HL9 A;  2Y2M A;  4GZB A;  3FKV A;  1FOF A;  3IH9 A;  2JBF A;  4R1G A;  1Q2P A;  2FFY A;  1IYO A;  3HLB A;  3IF6 A;  3NC8 A;  2ZM0 A;  4KEN B;  4S2N C;  3WWX A;  1XP4 A;  5CEB A;  1HZO A;  3A3E A;  4KZB A;  3IT9 A;  4OPY A;  1XGJ A;  5L2F A;  2Y2P A;  4KZ7 A;  4N9K A;  1ES2 A;  4KG2 A;  3OPR A;  4OVD A;  5CEC A;  1NY0 A;  3BEC A;  3P98 A;  1YM1 A;  2Y2L A;  1ESU A;  5M1A A;  4R4R A;  3W8K A;  4OPQ A;  3DW0 A;  1ONG A;  3MZE A;  1PW1 A;  5FQQ A;  5EVI B;  1NJ4 A;  4X6T A;  5HAI A;  4BL3 A;  3SS5 A;  3WS1 A;  4BD1 A;  3IQA A;  1G6A A;  3UDF A;  5FAQ A;  3G32 A;  2ZQD A;  1YQS A;  4C75 A;  1FSW A;  4EV4 A;  5IHV A;  4JF5 A;  2WZX A;  4OOL A;  5CHM A;  4MBK A;  2ZQA A;  3GMW A;  4JKT A;  3QNC A;  1E25 A;  4IBR A;  1JTD A;  4OKP A;  3W4P A;  1YLJ A;  1ERO A;  5TFQ A;  4HBU A;  4JXS A;  5CTN A;  5FQM A;  3ITB A;  4LCL A;  1MWR A;  4PM9 A;  3V39 A;  1MY8 A;  1PWG A;  1SDN A;  3C7V A;  3SS4 A;  3V3S A;  3HBR A;  3WS2 A;  1K55 A;  3FKW A;  3HUN A;  4S2O A;  3NY4 A;  1ONH A;  2XK1 A;  5AQ9 A;  4BLM A;  4UA7 A;  1JWZ A;  3OPH A;  4QD4 A;  1K54 A;  4IVI A;  1CK3 A;  3V50 A;  4EUZ A;  2Y59 A;  3ZG5 A;  2C6W B;  2OSU A;  3UN7 A;  3MZD A;  3UY6 A;  3WRZ A;  4GN2 A;  4GDB A;  3V5M A;  4E6X A;  5A90 A;  3BEB A;  3OPP A;  4XXR A;  3OC2 A;  2Y91 A;  2ZC3 B;  2ZMA A;  5HFO A;  3HUO A;  4DKI A;  5GLC A;  5AQ7 A;  3ZFZ A;  1KE4 A;  5CED A;  4ZJ3 A;  3GSG A;  3ZVW A;  4QHC A;  1GHI A;  2ZQ9 A;  5DTK A;  4CPK A;  1L0G A;  2WGW B;  1BZA A;  4X55 A;  1M40 A;  3HUM A;  1K57 C;  5CHU A;  1QME A;  2X71 A;  5FSR A;  4MNR A;  1PIO A;  5DF8 A;  1SCW A;  3DTM A;  1XA7 A;  2EFX A;  5DTT A;  2RL3 A;  4EQI A;  4MLL A;  4XUZ A;  3IH8 A;  3M6H A;  5GLD A;  3VFH A;  2Y2J A;  3G2Y A;  4E3O A;  1RCJ A;  2G2U A;  4N1H A;  3DWK A;  1FQG A;  3BFG A;  4FSF A;  3S22 A;  2OLU A;  5CXW A;  1H5X A;  2Y2Q A;  4DRT A;  4OOY A;  1MWT A;  2IWB A;  2BG1 A;  4BJP A;  4Q8I A;  4E3J A;  1LI0 A;  1PWD A;  4KZ5 A;  1ERM A;  1DJA A;  2XF3 A;  2JC7 A;  4O7D A;  1KVL A;  3RXX A;  3IXB A;  4ZJ1 A;  4DF6 A;  4QB8 A;  4E3I A;  3UDI A;  1FSY A;  4DE3 A;  3D4F A;  2HPB A;  3BFC A;  1ZC2 A;  2R9W A;  2JCH A;  1C3B A;  3SH7 A;  2XGN A;  3IWO A;  3O88 A;  1WE4 A;  3UPP A;  5EVI C;  4OP8 A;  1GHP A;  1W8Y A;  2FFF B;  3UE0 A;  4PM6 A;  2Z2L B;  4ZAM A;  1BTL A;  1JWP A;  2VGJ A;  1CEF A;  3ZDJ A;  4QJG A;  1M6K A;  4BEN A;  3I7J A;  4WYY A;  3BM6 A;  1HD8 A;  5FQ9 A;  4DXC A;  3PBN A;  5I94 A;  2WKH A;  3LY3 A;  2Y2I A;  3IHB A;  3HLC A;  3O86 A;  4OQI A;  4R23 A;  3WS4 A;  5EOO A;  1WYB A;  2A3U A;  1PI5 A;  1NRF A;  1FCN A;  2OV5 A;  5CER A;  5TGF A;  3UPO A;  4FCF A;  1IEM A;  2EFU A;  2GDN A;  5M19 A;  3HVF A;  3BFF A;  4LCM A;  4M3K A;  2UWX A;  1VQQ A;  3UO9 A;  1BT5 A;  1CI9 A;  1DY6 A;  3MZF A;  1IYQ A;  2H10 A;  5FI2 A;  3BYD A;  2R9X A;  4E3M A;  1ERQ A;  3N7W A;  3PBT A;  1TEM A;  2WKI A;  4OP5 A;  4EWF A;  1K56 A;  4WM9 A;  1BUL A;  1KVM A;  3ISG A;  1J9M A;  4B4X A;  4PPR A;  2Y2G A;  3IXD A;  4DE1 A;  1TDG A;  4S2J A;  1O7E A;  2Y55 A;  2V20 A;  2H0Y A;  3PBQ A;  1PZP A;  2I72 A;  2V2F F;  4WEK A;  3N8S A;  1ES3 A;  3NDG A;  4KQQ A;  3UE3 A;  1JTG A;  1KGF A;  4RX2 A;  4S2N A;  1YLZ A;  2RCX A;  5CHJ A;  4KQR A;  3VP3 A;  2QZ6 A;  4EBP A;  2ZM8 A;  3A3D A;  1E3U A;  4CJN A;  3G2Z A;  5E43 A;  3G31 A;  4WZ5 C;  3Q1F A;  1JVJ A;  3N6I A;  4KZ9 A;  4YFM A;  1SDE A;  5GL9 A;  2J9O A;  3CJM A;  3MBZ A;  3VSL A;  4OON A;  4DE0 A;  1H8Z A;  3FWL A;  2PBY A;  4X68 A;  5DF9 A;  4R4S A;  1FR6 A;  3AGD A;  1MBL A;  4ZDX A;  5AQA A;  4Y0O A;  1E4D A;  3VOY A;  3ZGA B;  3CZD A;  1NYM A;  5CTM A;  1ES5 A;  3GRJ A;  4E3K A;  3GQZ A;  4WMC A;  1W7F A;  5JYO A;  4IBX A;  2WGW A;  3HLF A;  1ALQ A;  4RA7 A;  1KDS A;  5HAP A;  1BLS A;  2WGI A;  3V3R A;  4IVK A;  5TR7 A;  1CI8 A;  3SS3 A;  4OQH A;  2WAE A;  2HDQ A;  3M2J A;  5E2H A;  1L0F A;  1W79 A;  2XD5 A;  2EX9 A;  4HES A;  4FD8 A;  2ZC6 B;  1YLP A;  4GOG A;  3AGF A;  5EPH A;  3PBR A;  3MXS A;  1KE0 A;  2PU2 A;  3PBS A;  1K6R A;  4A5R A;  4S2P A;  1K4E A;  3ITA A;  4ZBE A;  3SH9 A;  2VGK A;  4X56 A;  1Y54 A;  3P09 A;  3C4O A;  1LHY A;  4KZ4 A;  1RP5 A;  3NCK A;  2P74 A;  4Y0T A;  5HAQ A;  2ZM2 A;  3CG5 A;  3MKF A;  2BLS A;  3O3V A;  5CGW A;  5FAT A;  1ZKJ A;  2P9V A;  3A3I A;  2IWD A;  1GA9 A;  3VSK A;  4S2M A;  4R3B A;  5HL1 A;  2J9P A;  4B4Z A;  1EWZ A;  5EUA A;  3A3J A;  3UDX A;  4JXV A;  4DE2 A;  5D3O A;  5EOE A;  3M6B A;  1ESI A;  1H8Y A;  1IKG A;  1XGI A;  2Y2K A;  3G4P A;  3WRT A;  2WYX A;  4E3N A;  5J8X A;  4IED A;  4Z9Q A;  2WAD A;  3SH8 A;  1BLP A;  3BLS A;  2WGV A;  5A91 A;  4U3T A;  2XDM A;  4JF4 A;  2XFT A;  2ZQC A;  3VOZ A;  1XX2 A;  3E2K A;  2ZLY A;  1K57 A;  4DXB A;  2HDU A;  5FI7 A;  3ZG9 B;  4QY5 A;  3HLD A;  4MBF A;  5BOH A;  1XXM A;  4GNU A;  4KZ8 A;  1HVB A;  5EE8 A;  4ID4 A;  1ZG4 A;  1LI9 A;  3E2L A;  1YLT A;  5GHX A;  5KZH A;  3HRE A;  1TVF A;  3HLG A;  3O87 A;  4WZ4 A;  1TDL A;  3LEZ A;  2X01 A;  4GB7 A;  3HLW A;  3PAG A;  3SOI A;  2J8Y A;  4UHU A;  5F1G A;  4FH2 A;  3W4Q A;  1VM1 A;  5DF7 A;  3ZG7 B;  1YMS A;  3NDE A;  3HLE A;  5AQB A;  4BQM A;  4K91 A;  4RVA A;  3VMA A;  2WZZ A;  1EI5 A;  1K6S A;  4RYE A;  4LEN A;  5EVI A;  3VP2 A;  1PZO A;  2B5R A;  4N1X A;  2J7V A;  3FYZ A;  4PM7 A;  4JBF A;  4OOM A;  2QPN A;  5U47 A;  4XUX A;  3MKE A;  3GTC A;  3TSG A;  1WYC A; 
#chains in the Genus database with same CATH topology
 3IF5 A;  2HP9 A;  5KMW A;  1NLY A;  3AGE A;  1BUE A;  3PAE A;  4JGR A;  3BLM A;  2A49 A;  1UWP X;  1OJG A;  1S4S A;  3G30 A;  1QMF A;  3C7U A;  3D3O A;  4YWZ A;  3MS6 A;  3OCN A;  5CRF A;  1KGE A;  4N92 A;  1I5Q A;  2HP5 A;  1GCE A;  3Q7V B;  2INW A;  3ZHH A;  4QY6 A;  4N9L A;  4F94 A;  1T1C A;  2PAV P;  3QP8 A;  1NWZ A;  2OAP 1;  4KUO A;  4EW7 A;  2WK0 A;  1KGG A;  1U60 A;  5JYP A;  5A92 A;  2HP6 A;  2HDR A;  5MC7 A;  1PFL A;  4S2L A;  3G34 A;  4JLF A;  1L2S A;  4GD6 A;  2V8F A;  2WKQ A;  4GS9 B;  5HW3 A;  1NZU A;  4ZTK A;  4BWI A;  1K55 C;  3SW1 A;  1HTZ A;  1GHM A;  4KZ6 A;  5CGS A;  4PKY G;  2OOL A;  4E3L A;  1K38 A;  4BL2 A;  3NIA A;  5GHZ A;  2DNS A;  2PR6 A;  2ZBB A;  4EEU A;  3LIC A;  3EQU A;  4JGP A;  4EQ1 A;  3A3F A;  3WS5 A;  2YKF A;  2Y4A A;  4KZ3 A;  2R78 A;  5DKK A;  4EBN A;  1TS6 A;  3TRC A;  3EEA A;  4HIA A;  1K4F A;  2H5S A;  1KE3 A;  2EX6 A;  4K0W A;  4S2K A;  4LFU A;  5J4E A;  2PT7 A;  4UA6 A;  4WEJ A;  5FAO A;  1MKI A;  2ZQ7 A;  3H9W A;  4KG5 A;  3LY4 A;  1YLY A;  2A24 B;  4NET A;  1CEG A;  1DP9 A;  2GJ3 A;  5DTS A;  2ZMV A;  5EEC A;  3MMH A;  3LCE A;  2J80 A;  3LR5 A;  3MQO A;  3GVB A;  5DJT A;  5HD5 A;  3R7W B;  5DFY A;  2ZL1 A;  5FEG A;  1IOU A;  3NI9 A;  3TG9 A;  2D02 A;  3G35 A;  4RX3 A;  5IU1 A;  4P0M A;  5HAR A;  4PM5 A;  3H82 B;  4XT2 A;  5FDS A;  1IYP A;  4BBV A;  1YSQ A;  4C3Q A;  4GKU A;  1S1Z A;  4O01 A;  2GX5 A;  3S7N A;  3FKV A;  1FOF A;  3H7W A;  3IX3 A;  5CEB A;  3IT9 A;  1XGJ A;  4N9K A;  4KG2 A;  4OVD A;  1YM1 A;  2VEA A;  1ONG A;  3P7N A;  2OWJ A;  5EVI B;  1NJ4 A;  4X6T A;  1OJ5 A;  4NXB A;  4BD1 A;  4E04 A;  2PYR A;  4HJ6 A;  5FAQ A;  3G32 A;  4UQI M;  2ZQD A;  2NUT C;  1STZ A;  1YQS A;  4LRZ E;  1H8M A;  2B18 A;  5F69 A;  2B02 A;  3OOV A;  4OKP A;  1ERO A;  3NHQ A;  4GLQ A;  4HBU A;  4JXS A;  4PM9 A;  3SS4 A;  3C7V A;  3HBR A;  2Q0O A;  1K55 A;  4CLC D;  1ONH A;  2XK1 A;  4UA7 A;  2OAQ 1;  4IVI A;  1CK3 A;  3V50 A;  2VGL S;  2Y59 A;  3ZG5 A;  4CLC C;  3UN7 A;  3WRZ A;  3V5M A;  1L3L A;  3OPP A;  2Y91 A;  2ZC3 B;  3GSG A;  4HQA A;  4QHC A;  2WGW B;  1BZA A;  1M40 A;  3KYE A;  4R38 A;  2JKT I;  4BMW A;  3B47 A;  4OOY A;  2BG1 A;  4E3J A;  2JC7 A;  2XF3 A;  4QB8 A;  4DE3 A;  5DFX A;  3BFC A;  1WE4 A;  1LL8 A;  3UPP A;  1N9L A;  2XRN A;  1GHP A;  4ZAM A;  1LT0 A;  5FQ9 A;  4DXC A;  2WKH A;  3WS4 A;  2Y2I A;  1G28 A;  3HLC A;  2W3F A;  2GZA A;  3UPO A;  4M3K A;  1OPX A;  1IYQ A;  3IBR A;  3BYD A;  3HCY A;  3U4L P;  4B4X A;  2BAS A;  2Y2G A;  1MKM A;  3T4T A;  2VGL M;  4S2J A;  2H0Y A;  2O99 A;  1OTA A;  4D60 A;  2V2F F;  3C2W A;  4NEE D;  3UE3 A;  1JTG A;  4LLO B;  2V1B A;  5G4Y A;  3VE3 A;  3TW8 A;  3A3D A;  4IJG A;  2JKR M;  3HJK A;  5F5Y A;  1SDE A;  4Y17 A;  4DE0 A;  4X68 A;  1CQA A;  1H0M A;  1XJ3 A;  3AGD A;  3S7O A;  5AQA A;  3ZGA B;  5HPF A;  1NYM A;  5CTM A;  4E3K A;  3A0S A;  5HWV A;  1KDS A;  1SKO B;  1BLS A;  2P08 A;  4KUK A;  4HP9 A;  2Y79 A;  4EER A;  5L09 A;  3AGF A;  5AVF A;  2VGK A;  1LHY A;  4Y0T A;  5HAQ A;  3E98 A;  3O3V A;  4CLC A;  2B95 A;  2P9V A;  2V1A A;  2QYB A;  4MN5 A;  5IT5 A;  1YPR A;  3A3J A;  5EOE A;  3M6B A;  4IED A;  2ZOH A;  3BLS A;  5A91 A;  2XDM A;  2Z6C A;  3VOZ A;  1XX2 A;  1JNU A;  3E0Y A;  3QP2 A;  5AVE A;  2VV8 A;  3UE6 A;  1S66 L;  1K6S A;  2W1T A;  4F3L A;  3KSG A;  4PM7 A;  4OOM A;  2V0W A;  4YOF A;  3MKE A;  2J3T D;  1DP6 A;  2HGV A;  4R3A A;  3TSG A;  2E8J A;  3N4I A;  2E8I A;  1GSX A;  5L07 A;  2J3T C;  4HBT A;  5DVA A;  2KDK A;  4NK3 A;  4JXW A;  4O8G A;  4AFI A;  5E2G A;  1G68 A;  2L0W A;  5A93 A;  2XD1 A;  2WUQ A;  2M7V A;  2OLV A;  4KG6 A;  5FAS A;  3BY8 A;  2W3E A;  5KSC A;  4R0Q A;  1E3U D;  3S1Y A;  4LV2 A;  5HX9 A;  1FCO A;  4R3J A;  2XQZ A;  2O0Y A;  4EBL A;  1XKZ A;  3CUE C;  4KQO A;  4FTX A;  3T4L A;  4HJ4 A;  1PW8 A;  4MBH A;  3EEH A;  3IWI A;  1BYW A;  1O07 A;  2C5W B;  4WMC D;  1AXB A;  2O9A A;  3PHY A;  5J3W A;  4JXG A;  4Q0I A;  3T4O A;  5IS1 A;  1VET B;  4ESP A;  1L0D A;  1GA0 A;  2XFS A;  4JGQ A;  4KZA A;  4WBG A;  2JHE A;  4OPZ A;  3C5A A;  5GHY A;  1PI4 A;  2NUP C;  1MZU A;  3ZG8 B;  3LIE A;  1VHM A;  2QHK A;  4G3W A;  3KO6 A;  3QNB A;  1Q2Q A;  3DAV A;  1W8Q A;  5G18 A;  2PDR A;  3N8R A;  4GD8 A;  5FAP A;  1IEL A;  5K5B A;  4DDY A;  4P6B A;  5F1F A;  1DJC A;  1IYS A;  5FL3 A;  2JN7 A;  2Y2O A;  2LB5 A;  3ZG0 A;  3ZQ5 A;  1YKD A;  3TOI A;  2VV6 A;  1S6R A;  5FQI A;  5GLA A;  3NOT C;  1Y4O A;  3VP4 A;  1VEU B;  2O9C A;  4YIN A;  5EVI D;  1YMX A;  3VP0 A;  2Y2N A;  3BFE A;  4EES A;  3MXQ A;  3Q7V A;  1LLB A;  1OT6 A;  3UPN A;  1YLW A;  2XSS A;  1MXO A;  4I3I A;  3F1O A;  1TD5 A;  3F1N A;  2PD7 A;  3MXR A;  4P85 A;  2H0T A;  3Q81 A;  4GZB A;  2JBF A;  3SZT A;  3T4S A;  1UWN X;  1TS0 A;  3QP5 A;  3A3E A;  4KZB A;  1F2K A;  5L2F A;  2Y2P A;  1ES2 A;  3CWF A;  5EV0 A;  2P7J A;  2L1M A;  5CEC A;  2MJ6 A;  4R4R A;  4JGO A;  4OPQ A;  3U2A A;  4MN7 A;  3WS1 A;  3CUE A;  5EFW A;  3IQA A;  4DJ2 A;  4C75 A;  1FSW A;  3PYP A;  4OOL A;  2UV0 E;  1E25 A;  1G6O A;  4IBR A;  4G3V A;  5FQM A;  2VKS A;  1MWR A;  1MY8 A;  4BLM A;  1JWZ A;  4QD4 A;  3NEC A;  4EUZ A;  3TJZ C;  3FPV A;  2OSU A;  4B9O A;  4E6X A;  2ZMA A;  4QPR A;  4HH3 A;  5GLC A;  5HWT A;  2ZQ9 A;  4WN5 A;  4UQI S;  3RFB A;  3HUM A;  1F98 A;  2X71 A;  1PIO A;  3DTM A;  1XA7 A;  1T18 A;  4MLL A;  5GLD A;  2JKR I;  3T1S A;  4N1H A;  3CPT A;  1FQG A;  3BFG A;  2D01 A;  1H5X A;  2Y2Q A;  2IWB A;  1LI0 A;  4DF6 A;  4ARZ A;  1ZC2 A;  3SH7 A;  3IWO A;  1W8Y A;  1TS7 A;  4LRX C;  1M6K A;  4BEN A;  3I7J A;  4WYY A;  4EEP A;  1W63 Q;  2HZ5 A;  2BTF P;  4WF0 A;  2A2L A;  5I94 A;  5AJG A;  3O86 A;  3D9Y A;  2PHY A;  2A3U A;  1D1J A;  5CER A;  2QJ7 A;  4LCM A;  3UO9 A;  1VQQ A;  1CI9 A;  2ACG A;  5FI2 A;  2H10 A;  1TEM A;  1OTB A;  4WM9 A;  1KVM A;  4PPR A;  3LR0 A;  4I39 A;  3G6O A;  5DKL A;  2Y55 A;  1S1Y A;  1XFQ A;  2I72 A;  1ZHH B;  1ES3 A;  1KGF A;  4KQR A;  3VP3 A;  4EBP A;  2ZM8 A;  3ICY A;  4I3A A;  2ZL1 B;  3DTE A;  3Q1F A;  4KZ9 A;  4YFM A;  5GL9 A;  2J9O A;  3CJM A;  3QP1 A;  4OON A;  5DF9 A;  4ZDX A;  4GW9 A;  1E4D A;  1T1B A;  3CZD A;  1FIL A;  1ES5 A;  1K0K A;  4NXG A;  4XT2 B;  3GQZ A;  1W7F A;  5JYO A;  2WGW A;  3HLF A;  4RA7 A;  4M4X A;  1A0K A;  1TF1 A;  4IVK A;  3LR4 A;  4OQH A;  2WAE A;  2HDQ A;  1L0F A;  1W79 A;  1DRM A;  4FD8 A;  2ZC6 B;  1YLP A;  3MXS A;  3H7W B;  3IS2 A;  5TJJ A;  2Y8H A;  3W2Z A;  2ZMF A;  3ITA A;  4ZBE A;  1TS8 A;  1Y54 A;  1FIK A;  1RP5 A;  3NCK A;  2P74 A;  2ZM2 A;  5FAT A;  3NUL A;  1G5U A;  4HOI A;  4R3B A;  3KSI A;  3EGX C;  1ESI A;  4E3N A;  2WYX A;  3QP4 A;  4Z9Q A;  2WAD A;  3SH8 A;  3K3D A;  1BLP A;  2WGV A;  4JF4 A;  3PXP A;  3E2K A;  4RQ9 A;  2HDU A;  5FI7 A;  3HLD A;  4MBF A;  3A0V A;  4KZ8 A;  2VV7 A;  5EE8 A;  4ID4 A;  4NG2 A;  4ZRR A;  1YLT A;  5GHX A;  3HRE A;  1TVF A;  3HLG A;  3O87 A;  1TDL A;  4II7 A;  2X01 A;  3PAG A;  3W4Q A;  3LEQ A;  1VM1 A;  3MQQ A;  3HLE A;  4BQM A;  2PR5 A;  3VMA A;  3VP2 A;  4R70 A;  1PZO A;  3KYZ A;  2W3H A;  1N9O A;  3FYZ A;  2K31 A;  1S4R A;  2DMW A;  1WYC A;  4OQ0 A;  5I5L A;  2EXB A;  1SKF A;  3IXH A;  1YT4 A;  3MF0 A;  4U0T A;  1K56 D;  3ZCZ A;  1IKI A;  2QMI A;  3IHA A;  4PMA A;  3ZNT A;  2HV1 A;  4Y13 A;  3Q07 A;  4JPM A;  1N9B A;  2Y2H A;  2W27 A;  1XPB A;  5E2E A;  4FOF A;  2PU4 A;  2HJ9 C;  3MJQ A;  4B88 A;  3EGD C;  3E4O A;  1X0O A;  2V9A A;  3BY9 A;  4S2I A;  3N8L A;  1I2W A;  5L8M A;  3BJN A;  3HJI A;  4OQG A;  2ZJ9 A;  3GV9 A;  4Y0U A;  1RGY A;  4CLC E;  1I2S A;  2XEP A;  3GDI A;  4C6Y A;  4EU0 A;  4QU3 A;  3IF6 B;  1MPL A;  2DCF A;  1ES4 A;  4LV0 A;  4WEL A;  5EVE A;  5KSH A;  4P6Z S;  3IBJ A;  1ODV A;  1SHV A;  5EVL A;  3BQA A;  1Z09 A;  3T1Q B;  1N4O A;  1NXY A;  2DRW A;  3JVV A;  1L0E A;  4LV1 A;  4EUV A;  2ZD8 A;  2WKR A;  3RJU A;  3IX8 A;  1DJB A;  1F9I A;  1LL9 A;  1FCM A;  3E4P A;  2EX2 A;  3F1P A;  5HPI A;  4EXO A;  4R6L A;  3FC7 A;  4I3J A;  2KOI A;  2Q9M A;  2Q9N A;  2G2W A;  3IX4 A;  3GEC A;  3OZH A;  1T19 A;  1V9Z A;  2Z2M B;  1IFQ A;  5FQJ A;  3Q82 A;  3T50 A;  3CMZ A;  2LB9 A;  4H6J A;  2EXA A;  1LL5 A;  1JWV A;  3NBL A;  3OPL A;  3W4O A;  4P87 A;  2V8C A;  5FI6 A;  4U0X A;  2P9V B;  4JF6 A;  2XH9 A;  3LR3 A;  2ZC4 B;  4H8R A;  1NYY A;  3C4P A;  1OME A;  1S0W A;  1BLC A;  2HF6 A;  2W1R A;  3RXW A;  5J7E A;  3LO7 A;  4BD0 A;  3FZC A;  2Z6D A;  1FR1 A;  1F5M A;  1XJ2 A;  4FH4 A;  3MFD A;  4L9F A;  4Q0J A;  4P6Z M;  5M18 A;  3VFF A;  3QHY A;  5CGX A;  3KX0 X;  3T1X A;  3HL9 A;  3IH9 A;  1Q2P A;  2FFY A;  1IYO A;  2K7S A;  4YNR A;  4KEN B;  3WWX A;  1HZO A;  4OPY A;  4KZ7 A;  1NY0 A;  1PRQ A;  1ESU A;  2Y2L A;  5M1A A;  2PD8 A;  3W8K A;  2FZ0 A;  3DW0 A;  3T12 B;  3MZE A;  1PW1 A;  5FQQ A;  4BL3 A;  2W1T B;  3SS5 A;  4F3L B;  3P01 A;  5A8B A;  3KSH A;  4EV4 A;  4X25 A;  2WZX A;  5CHM A;  2ZQA A;  4B93 A;  3RTY A;  1YLJ A;  4X1M A;  3ITB A;  1GSV A;  3V39 A;  3UB7 A;  1PNE A;  1PWG A;  3BWL A;  1SDN A;  3WS2 A;  1P97 A;  1OTE A;  3HUN A;  4S2O A;  3NY4 A;  5AQ9 A;  4LGW A;  1HLU P;  3OPH A;  2C6W B;  2PYP A;  3UY6 A;  3CAX A;  4GHI A;  4GN2 A;  4GDB A;  3K2N A;  5LBR A;  3OC2 A;  2XA7 M;  5HFO A;  3HUO A;  1VEU A;  5TBM B;  4ZJ3 A;  3ZVW A;  1GHI A;  4X1L A;  2J3W A;  5DTK A;  1DP8 A;  4CPK A;  4X55 A;  1P0Z A;  3A0R A;  2CMN A;  1K57 C;  4HI4 A;  4MNR A;  5F68 A;  5DF8 A;  1SCW A;  3OLO A;  5DTT A;  2RL3 A;  4EQI A;  3VFH A;  2Y2J A;  3G2Y A;  4E3O A;  1RCJ A;  2G2U A;  5EM1 A;  1LSX A;  2EWW A;  4Z1W A;  3T4Q A;  4DRT A;  4Q8I A;  4BJP A;  4Q0H A;  4Y2F A;  4KZ5 A;  1CJF A;  4I5S A;  1DJA A;  3RXX A;  3IXB A;  4ZJ1 A;  2WKP A;  3UDI A;  1FSY A;  3LID A;  2HPB A;  2QJ5 A;  2XGN A;  3O88 A;  5EVI C;  2L4R A;  3EOI A;  2Z2L B;  3ZDJ A;  1JWP A;  2VGJ A;  1CEF A;  4QJG A;  4DN0 A;  2IA2 A;  3V67 A;  3PBN A;  3IHB A;  3MR0 A;  4OQI A;  1WYB A;  1PI5 A;  1NRF A;  3JPU A;  2OV5 A;  4DJ3 A;  5TGF A;  4FCF A;  2EFU A;  3FG8 A;  3HVF A;  3C8C A;  2UWX A;  1BT5 A;  3MZF A;  4GS9 A;  2R9X A;  4EWF A;  3N7W A;  3PBT A;  2WKI A;  3ISG A;  3IXD A;  4DE1 A;  1TDG A;  3B33 A;  3PBQ A;  1PZP A;  4KQQ A;  4RX2 A;  2RCX A;  4Y15 A;  5CHJ A;  3RH8 B;  2QZ6 A;  2V0U A;  1E3U A;  3B42 A;  2M1C A;  3G2Z A;  3G31 A;  4WZ5 C;  1T1A A;  5C5K A;  4IUK A;  4HJ3 A;  1H8Z A;  4R4S A;  1FR6 A;  2O9B A;  4Y0O A;  3VOY A;  1EW0 A;  3GRJ A;  4WMC A;  3F1O B;  1ALQ A;  3F1N B;  2WGI A;  3V3R A;  1CI8 A;  4QWO A;  3SS3 A;  3M2J A;  3LIB A;  3KYQ A;  5EPH A;  3CLO A;  2A24 A;  3PBR A;  2PU2 A;  3PBS A;  3CHW P;  2HJE A;  4S2P A;  5F6A A;  3SH9 A;  4X56 A;  3CG5 A;  1W63 M;  1P9R A;  5CGW A;  1ZKJ A;  3A3I A;  2FH5 A;  2IWD A;  3BW6 A;  3R7W A;  1GA9 A;  4ME4 A;  2J9P A;  3E4Q A;  1EWZ A;  4JXV A;  4DE2 A;  1D06 A;  1WA9 A;  1XGI A;  3UB9 A;  3G4P A;  5J8X A;  1Y28 A;  1LSV A;  3H82 A;  1UGU A;  2VZW A;  2XFT A;  2ZQC A;  2ZLY A;  1K57 A;  4DXB A;  3MFX A;  3CIT A;  1XXM A;  3KSF A;  3DTI A;  1ZG4 A;  5KZH A;  3C30 A;  4GB7 A;  3DTK A;  3HLW A;  4LRY C;  4FH2 A;  5DF7 A;  4PAU A;  4K91 A;  2WZZ A;  4G3K A;  5EVI A;  4RYE A;  4LEN A;  1GSW A;  3CI6 A;  2J7V A;  4N1X A;  4JBF A;  4MN6 A;  2QPN A;  3L7H A;  3GTC A;  4FUW A;  3UNW A;  3JYI A;  3DWZ A;  5CX7 A;  1OTD A;  2CC1 A;  5KIZ A;  4D2O A;  3BRM A;  4HNB A;  3IF6 C;  3CPT B;  2EX8 A;  2HDS A;  3Q7Z A;  4DDS A;  4OPR A;  1W5D A;  4IUH A;  4ARZ B;  1RGZ A;  3ZNY A;  1BLH A;  3MSH A;  1SZV A;  2XR0 A;  4UAA A;  4BBU A;  4HP4 A;  3FV7 A;  3NOU C;  2GNX A;  4WZ5 A;  4X69 A;  1XA1 A;  5HDC A;  1NLZ A;  4LV3 A;  3ZYT A;  4E6W A;  3GR2 A;  2M7U A;  2VLG A;  4GCZ A;  4OLD A;  4WLA A;  2OWH A;  3PBO A;  3WS0 A;  3EQV A;  1PWC A;  3TE8 A;  1AWI A;  1K25 A;  2X02 A;  1K54 C;  3VV4 A;  3PTE A;  2W3G A;  3S7Q A;  4ETX A;  3LIA A;  4GJ4 A;  2ZC7 A;  1KOU A;  1YSP A;  4Y7P A;  2EWV A;  3T4K A;  3M2K A;  1KDW A;  4OLG A;  3BFD A;  4ZJ2 A;  3UE1 A;  5G4Z A;  1Z6F A;  2YKH A;  2V1Z A;  4K0X A;  5FDH A;  3B3X A;  4ETZ A;  1ZG6 A;  4GDN A;  4L0L A;  4IHQ A;  2VJW A;  2KX6 A;  3IWQ A;  1NZO A;  4PM8 A;  2ZQ8 A;  4OH0 A;  3LIF A;  3T1R A;  5F83 A;  3ZVT A;  5FA7 A;  2WKE A;  1XJ6 A;  3IS2 B;  3VP1 A;  2JE5 A;  1BSG A;  5HZH A;  2JKF A;  5F82 A;  2ZC5 B;  1S67 L;  1V9Y A;  3IXG A;  1LSW A;  2IWC A;  4WUJ A;  1MWU A;  3LUQ A;  1D7E A;  4HY8 A;  5FQK A;  3S4X A;  3OCL A;  4X53 A;  1CF0 A;  2XLN A;  1OT9 A;  1PYY A;  3DBA A;  5GLB A;  1MWS A;  1SKO A;  2WAF A;  4UA9 A;  4MEZ A;  4K08 A;  5E2F A;  3LYX A;  4HEF A;  2Y2M A;  4R1G A;  3HLB A;  3IF6 A;  3NC8 A;  2ZM0 A;  4HHD A;  4S2N C;  1XP4 A;  4PKY A;  3QP6 A;  3OPR A;  1VB6 A;  3BEC A;  3P98 A;  2VA0 A;  5HAI A;  2K2N A;  4DMZ A;  4WL9 A;  3UDF A;  1G6A A;  1H3Q A;  1XJ4 A;  5IHV A;  4JF5 A;  4MBK A;  3GMW A;  2ZOI A;  4JKT A;  3QNC A;  1JTD A;  3W4P A;  3UB5 P;  5TFQ A;  4HH2 A;  3LGO A;  5CTN A;  3UME A;  4LCL A;  3UB8 A;  3V3S A;  4I38 A;  3FKW A;  2XRO A;  1K54 A;  5EM0 A;  2W0N A;  3MZD A;  2VX8 A;  5A90 A;  3BEB A;  1YAX A;  4XXR A;  4DKI A;  3ZFZ A;  5AQ7 A;  4NXF A;  1KE4 A;  5CED A;  3ULF A;  5HD3 A;  4CQH A;  1L0G A;  5CHU A;  1QME A;  5FSR A;  3T4J A;  3VOL A;  1ZTU A;  2EFX A;  3K3C A;  4XUZ A;  3IH8 A;  3M6H A;  3DWK A;  3S22 A;  4FSF A;  2OLU A;  5CXW A;  5DJU A;  1ACF A;  1MWT A;  4Y5F A;  1PWD A;  1ERM A;  4O7D A;  2P04 A;  1KVL A;  3LI9 A;  4CLC B;  4E3I A;  2QWS A;  3UMD A;  4MCW A;  3D4F A;  3D72 A;  4MMN A;  2R9W A;  2JCH A;  4EET B;  1C3B A;  4OP8 A;  2FFF B;  2XA7 S;  3UE0 A;  4PM6 A;  1BTL A;  5HWW A;  1XFN A;  3BM6 A;  3VE4 A;  1HD8 A;  3L9K A;  3LY3 A;  4R23 A;  1N9N A;  5EOO A;  2G7U A;  1FCN A;  3F1P B;  1IEM A;  2GDN A;  5M19 A;  3BFF A;  1DY6 A;  3S7P A;  3NOP C;  4UEY A;  4E3M A;  1ERQ A;  4OP5 A;  1K56 A;  1BUL A;  3OBF A;  1J9M A;  1VET A;  3EWK A;  1O7E A;  2V20 A;  2KLI A;  4WEK A;  4NKP A;  3N8S A;  3NDG A;  2QKP A;  4S2N A;  4H6J B;  3C38 A;  1YLZ A;  4L9G A;  2JKT M;  4CJN A;  4NXE A;  5E43 A;  1JVJ A;  3N6I A;  2PBD P;  3JVU A;  3MBZ A;  3VSL A;  2I9V A;  3FWL A;  5HDD A;  2PBY A;  5HSQ A;  3LFV A;  4O0P A;  5TBM A;  5HDS A;  1MBL A;  5L10 A;  4IBX A;  5HAP A;  5TR7 A;  1P9W A;  3MQ0 A;  5E2H A;  2XD5 A;  2EX9 A;  3UB6 A;  4HES A;  4BBT A;  4GOG A;  1KE0 A;  1K6R A;  4A5R A;  2W3D A;  1K4E A;  3P09 A;  3C4O A;  4KZ4 A;  4MDZ A;  3PR6 A;  3MKF A;  2BLS A;  2EA9 A;  3VSK A;  4S2M A;  4KQD A;  4B4Z A;  5EUA A;  1J3W A;  3UDX A;  5D3O A;  3WRT A;  1H8Y A;  1IKG A;  2Y2K A;  3BQ8 A;  4U3T A;  5HL6 A;  3O5Y A;  3FPW A;  3LI8 A;  2JKG A;  1MC0 A;  3ZG9 B;  4QY5 A;  5BOH A;  4GNU A;  1HVB A;  1NRJ A;  1LI9 A;  3E2L A;  3NJA A;  5FEF A;  2VK3 A;  4WZ4 A;  4PHT A;  4Y3I A;  3LEZ A;  3SOI A;  2J8Y A;  4UHU A;  4GHI B;  5F1G A;  3ZG7 B;  1YMS A;  3NDE A;  5AQB A;  2H28 A;  2AVX A;  4RVA A;  1EI5 A;  2PRF A;  3R4K A;  2B5R A;  4L9E A;  4LPZ A;  1OTI A;  5U47 A;  4XUX A;  5HL1 A; 
#chains in the Genus database with same CATH homology
 4OQ0 A;  3UNW A;  3IF5 A;  2EXB A;  2HP9 A;  3JYI A;  3N4I A;  3DWZ A;  1SKF A;  2E8I A;  3IXH A;  1YT4 A;  5KMW A;  4HBT A;  3AGE A;  1BUE A;  3PAE A;  5DVA A;  2CC1 A;  1K56 D;  4U0T A;  3ZCZ A;  1IKI A;  4D2O A;  2QMI A;  3IHA A;  4NK3 A;  4PMA A;  3BRM A;  4JXW A;  3BLM A;  3IF6 C;  3Q7Z A;  2EX8 A;  2HDS A;  3ZNT A;  2A49 A;  3Q07 A;  4JPM A;  5E2G A;  1G68 A;  5A93 A;  1N9B A;  2XD1 A;  2Y2H A;  1XPB A;  5E2E A;  2WUQ A;  4DDS A;  2PU4 A;  2OLV A;  4KG6 A;  5FAS A;  4B88 A;  3G30 A;  4OPR A;  1QMF A;  1W5D A;  5KSC A;  3C7U A;  4R0Q A;  1E3U D;  3S1Y A;  1RGZ A;  4LV2 A;  5HX9 A;  3ZNY A;  3OCN A;  1FCO A;  4R3J A;  1BLH A;  2XQZ A;  5CRF A;  1KGE A;  4N92 A;  1I5Q A;  2HP5 A;  4S2I A;  1GCE A;  4EBL A;  3Q7V B;  3N8L A;  1XKZ A;  2XR0 A;  4UAA A;  3ZHH A;  4QY6 A;  1I2W A;  4N9L A;  3FV7 A;  4F94 A;  4KQO A;  4OQG A;  2ZJ9 A;  3GV9 A;  1PW8 A;  4WZ5 A;  4MBH A;  4Y0U A;  2WK0 A;  3IWI A;  1KGG A;  1U60 A;  5JYP A;  4X69 A;  1XA1 A;  2HP6 A;  2HDR A;  1RGY A;  5A92 A;  1O07 A;  4S2L A;  2C5W B;  4WMC D;  4LV3 A;  4E6W A;  1AXB A;  3G34 A;  3GR2 A;  4JLF A;  1I2S A;  1L2S A;  2XEP A;  4GD6 A;  4JXG A;  4C6Y A;  4OLD A;  4QU3 A;  3IF6 B;  5HW3 A;  1MPL A;  2DCF A;  1NZU A;  4ZTK A;  3PBO A;  3WS0 A;  1K55 C;  1ES4 A;  1HTZ A;  3EQV A;  4LV0 A;  4WEL A;  1GHM A;  4KZ6 A;  5CGS A;  1PWC A;  5KSH A;  4E3L A;  1K25 A;  2X02 A;  1K54 C;  1K38 A;  1L0D A;  4BL2 A;  1SHV A;  3NIA A;  3PTE A;  5EVL A;  5GHZ A;  2DNS A;  1GA0 A;  2XFS A;  4KZA A;  4WBG A;  2ZC7 A;  3EQU A;  1N4O A;  1NXY A;  3A3F A;  3WS5 A;  2DRW A;  4Y7P A;  3M2K A;  2Y4A A;  4KZ3 A;  4OPZ A;  3C5A A;  1KDW A;  1L0E A;  4LV1 A;  5GHY A;  1PI4 A;  4OLG A;  2ZD8 A;  3ZG8 B;  3BFD A;  4ZJ2 A;  3UE1 A;  4EBN A;  1Z6F A;  2V1Z A;  1K4F A;  4K0X A;  5FDH A;  3RJU A;  3QNB A;  3B3X A;  1Q2Q A;  2H5S A;  1DJB A;  1LL9 A;  1FCM A;  1KE3 A;  2EX6 A;  4K0W A;  1ZG6 A;  2EX2 A;  4GDN A;  4L0L A;  4S2K A;  1W8Q A;  5G18 A;  3N8R A;  4GD8 A;  5FAP A;  2Q9M A;  2Q9N A;  4UA6 A;  4WEJ A;  5FAO A;  2G2W A;  1IEL A;  1MKI A;  1NZO A;  3IWQ A;  2ZQ7 A;  4PM8 A;  4DDY A;  2ZQ8 A;  4OH0 A;  4KG5 A;  4P6B A;  3LY4 A;  5F83 A;  3ZVT A;  5F1F A;  1DJC A;  3OZH A;  1IYS A;  5FA7 A;  2Z2M B;  1YLY A;  5FQJ A;  2WKE A;  2Y2O A;  3Q82 A;  4NET A;  1CEG A;  3VP1 A;  2JE5 A;  3ZG0 A;  3CMZ A;  1BSG A;  3TOI A;  5DTS A;  2EXA A;  5EEC A;  1LL5 A;  1S6R A;  3LCE A;  5F82 A;  1JWV A;  2ZC5 B;  3NBL A;  5FQI A;  3IXG A;  3OPL A;  5GLA A;  3W4O A;  3GVB A;  4P87 A;  2IWC A;  5FI6 A;  3VP4 A;  4U0X A;  4YIN A;  2P9V B;  1MWU A;  5EVI D;  1YMX A;  4JF6 A;  2XH9 A;  2ZC4 B;  3VP0 A;  3NI9 A;  3TG9 A;  5FQK A;  4H8R A;  1NYY A;  3S4X A;  3OCL A;  3C4P A;  2Y2N A;  1OME A;  3BFE A;  3G35 A;  3Q7V A;  1S0W A;  1LLB A;  4X53 A;  1BLC A;  3RXW A;  4RX3 A;  2XLN A;  3LO7 A;  4P0M A;  4BD0 A;  1PYY A;  3UPN A;  1YLW A;  5HAR A;  5GLB A;  4PM5 A;  3FZC A;  1MXO A;  1FR1 A;  1MWS A;  4FH4 A;  3MFD A;  2WAF A;  1IYP A;  4UA9 A;  4MEZ A;  3MXR A;  4P85 A;  2H0T A;  3Q81 A;  5E2F A;  4GKU A;  4C3Q A;  5M18 A;  3VFF A;  3QHY A;  5CGX A;  4HEF A;  3HL9 A;  2Y2M A;  4GZB A;  3FKV A;  1FOF A;  3IH9 A;  2JBF A;  4R1G A;  1Q2P A;  2FFY A;  1IYO A;  3HLB A;  3IF6 A;  3NC8 A;  2ZM0 A;  4KEN B;  4S2N C;  3WWX A;  1XP4 A;  5CEB A;  1HZO A;  3A3E A;  4KZB A;  3IT9 A;  4OPY A;  1XGJ A;  5L2F A;  2Y2P A;  4KZ7 A;  4N9K A;  1ES2 A;  4KG2 A;  3OPR A;  4OVD A;  5CEC A;  1NY0 A;  3BEC A;  3P98 A;  1YM1 A;  2Y2L A;  1ESU A;  5M1A A;  4R4R A;  3W8K A;  4OPQ A;  3DW0 A;  1ONG A;  3MZE A;  1PW1 A;  5FQQ A;  5EVI B;  1NJ4 A;  4X6T A;  5HAI A;  4BL3 A;  3SS5 A;  3WS1 A;  4BD1 A;  3IQA A;  1G6A A;  3UDF A;  5FAQ A;  3G32 A;  2ZQD A;  1YQS A;  4C75 A;  1FSW A;  4EV4 A;  5IHV A;  4JF5 A;  2WZX A;  4OOL A;  5CHM A;  4MBK A;  2ZQA A;  3GMW A;  4JKT A;  3QNC A;  1E25 A;  4IBR A;  1JTD A;  4OKP A;  3W4P A;  1YLJ A;  1ERO A;  5TFQ A;  4HBU A;  4JXS A;  5CTN A;  5FQM A;  3ITB A;  4LCL A;  1MWR A;  4PM9 A;  3V39 A;  1MY8 A;  1PWG A;  1SDN A;  3C7V A;  3SS4 A;  3V3S A;  3HBR A;  3WS2 A;  1K55 A;  3FKW A;  3HUN A;  4S2O A;  3NY4 A;  1ONH A;  2XK1 A;  5AQ9 A;  4BLM A;  4UA7 A;  1JWZ A;  3OPH A;  4QD4 A;  1K54 A;  4IVI A;  1CK3 A;  3V50 A;  4EUZ A;  2Y59 A;  3ZG5 A;  2C6W B;  2OSU A;  3UN7 A;  3MZD A;  3UY6 A;  3WRZ A;  4GN2 A;  4GDB A;  3V5M A;  4E6X A;  5A90 A;  3BEB A;  3OPP A;  4XXR A;  3OC2 A;  2Y91 A;  2ZC3 B;  2ZMA A;  5HFO A;  3HUO A;  4DKI A;  5GLC A;  5AQ7 A;  3ZFZ A;  1KE4 A;  5CED A;  4ZJ3 A;  3GSG A;  3ZVW A;  4QHC A;  1GHI A;  2ZQ9 A;  5DTK A;  4CPK A;  1L0G A;  2WGW B;  1BZA A;  4X55 A;  1M40 A;  3HUM A;  1K57 C;  5CHU A;  1QME A;  2X71 A;  5FSR A;  4MNR A;  1PIO A;  5DF8 A;  1SCW A;  3DTM A;  1XA7 A;  2EFX A;  5DTT A;  2RL3 A;  4EQI A;  4MLL A;  4XUZ A;  3IH8 A;  3M6H A;  5GLD A;  3VFH A;  2Y2J A;  3G2Y A;  4E3O A;  1RCJ A;  2G2U A;  4N1H A;  3DWK A;  1FQG A;  3BFG A;  4FSF A;  3S22 A;  2OLU A;  5CXW A;  1H5X A;  2Y2Q A;  4DRT A;  4OOY A;  1MWT A;  2IWB A;  2BG1 A;  4BJP A;  4Q8I A;  4E3J A;  1LI0 A;  1PWD A;  4KZ5 A;  1ERM A;  1DJA A;  2XF3 A;  2JC7 A;  4O7D A;  1KVL A;  3RXX A;  3IXB A;  4ZJ1 A;  4DF6 A;  4QB8 A;  4E3I A;  3UDI A;  1FSY A;  4DE3 A;  3D4F A;  2HPB A;  3BFC A;  1ZC2 A;  2R9W A;  2JCH A;  1C3B A;  3SH7 A;  2XGN A;  3IWO A;  3O88 A;  1WE4 A;  3UPP A;  5EVI C;  4OP8 A;  1GHP A;  1W8Y A;  2FFF B;  3UE0 A;  4PM6 A;  2Z2L B;  4ZAM A;  1BTL A;  1JWP A;  2VGJ A;  1CEF A;  3ZDJ A;  4QJG A;  1M6K A;  4BEN A;  3I7J A;  4WYY A;  3BM6 A;  1HD8 A;  5FQ9 A;  4DXC A;  3PBN A;  5I94 A;  2WKH A;  3LY3 A;  2Y2I A;  3IHB A;  3HLC A;  3O86 A;  4OQI A;  4R23 A;  3WS4 A;  5EOO A;  1WYB A;  2A3U A;  1PI5 A;  1NRF A;  1FCN A;  2OV5 A;  5CER A;  5TGF A;  3UPO A;  4FCF A;  1IEM A;  2EFU A;  2GDN A;  5M19 A;  3HVF A;  3BFF A;  4LCM A;  4M3K A;  2UWX A;  1VQQ A;  3UO9 A;  1BT5 A;  1CI9 A;  1DY6 A;  3MZF A;  1IYQ A;  2H10 A;  5FI2 A;  3BYD A;  2R9X A;  4E3M A;  1ERQ A;  3N7W A;  3PBT A;  1TEM A;  2WKI A;  4OP5 A;  4EWF A;  1K56 A;  4WM9 A;  1BUL A;  1KVM A;  3ISG A;  1J9M A;  4B4X A;  4PPR A;  2Y2G A;  3IXD A;  4DE1 A;  1TDG A;  4S2J A;  1O7E A;  2Y55 A;  2V20 A;  2H0Y A;  3PBQ A;  1PZP A;  2I72 A;  2V2F F;  4WEK A;  3N8S A;  1ES3 A;  3NDG A;  4KQQ A;  3UE3 A;  1JTG A;  1KGF A;  4RX2 A;  4S2N A;  1YLZ A;  2RCX A;  5CHJ A;  4KQR A;  3VP3 A;  2QZ6 A;  4EBP A;  2ZM8 A;  3A3D A;  1E3U A;  4CJN A;  3G2Z A;  5E43 A;  3G31 A;  4WZ5 C;  3Q1F A;  1JVJ A;  3N6I A;  4KZ9 A;  4YFM A;  1SDE A;  5GL9 A;  2J9O A;  3CJM A;  3MBZ A;  3VSL A;  4OON A;  4DE0 A;  1H8Z A;  3FWL A;  2PBY A;  4X68 A;  5DF9 A;  4R4S A;  1FR6 A;  3AGD A;  1MBL A;  4ZDX A;  5AQA A;  4Y0O A;  1E4D A;  3VOY A;  3ZGA B;  3CZD A;  1NYM A;  5CTM A;  1ES5 A;  3GRJ A;  4E3K A;  3GQZ A;  4WMC A;  1W7F A;  5JYO A;  4IBX A;  2WGW A;  3HLF A;  1ALQ A;  4RA7 A;  1KDS A;  5HAP A;  1BLS A;  2WGI A;  3V3R A;  4IVK A;  5TR7 A;  1CI8 A;  3SS3 A;  4OQH A;  2WAE A;  2HDQ A;  3M2J A;  5E2H A;  1L0F A;  1W79 A;  2XD5 A;  2EX9 A;  4HES A;  4FD8 A;  2ZC6 B;  1YLP A;  4GOG A;  3AGF A;  5EPH A;  3PBR A;  3MXS A;  1KE0 A;  2PU2 A;  3PBS A;  1K6R A;  4A5R A;  4S2P A;  1K4E A;  3ITA A;  4ZBE A;  3SH9 A;  2VGK A;  4X56 A;  1Y54 A;  3P09 A;  3C4O A;  1LHY A;  4KZ4 A;  1RP5 A;  3NCK A;  2P74 A;  4Y0T A;  5HAQ A;  2ZM2 A;  3CG5 A;  3MKF A;  2BLS A;  3O3V A;  5CGW A;  5FAT A;  1ZKJ A;  2P9V A;  3A3I A;  2IWD A;  1GA9 A;  3VSK A;  4S2M A;  4R3B A;  5HL1 A;  2J9P A;  4B4Z A;  1EWZ A;  5EUA A;  3A3J A;  3UDX A;  4JXV A;  4DE2 A;  5D3O A;  5EOE A;  3M6B A;  1ESI A;  1H8Y A;  1IKG A;  1XGI A;  2Y2K A;  3G4P A;  3WRT A;  2WYX A;  4E3N A;  5J8X A;  4IED A;  4Z9Q A;  2WAD A;  3SH8 A;  1BLP A;  3BLS A;  2WGV A;  5A91 A;  4U3T A;  2XDM A;  4JF4 A;  2XFT A;  2ZQC A;  3VOZ A;  1XX2 A;  3E2K A;  2ZLY A;  1K57 A;  4DXB A;  2HDU A;  5FI7 A;  3ZG9 B;  4QY5 A;  3HLD A;  4MBF A;  5BOH A;  1XXM A;  4GNU A;  4KZ8 A;  1HVB A;  5EE8 A;  4ID4 A;  1ZG4 A;  1LI9 A;  3E2L A;  1YLT A;  5GHX A;  5KZH A;  3HRE A;  1TVF A;  3HLG A;  3O87 A;  4WZ4 A;  1TDL A;  3LEZ A;  2X01 A;  4GB7 A;  3HLW A;  3PAG A;  3SOI A;  2J8Y A;  4UHU A;  5F1G A;  4FH2 A;  3W4Q A;  1VM1 A;  5DF7 A;  3ZG7 B;  1YMS A;  3NDE A;  3HLE A;  5AQB A;  4BQM A;  4K91 A;  4RVA A;  3VMA A;  2WZZ A;  1EI5 A;  1K6S A;  4RYE A;  4LEN A;  5EVI A;  3VP2 A;  1PZO A;  2B5R A;  4N1X A;  2J7V A;  3FYZ A;  4PM7 A;  4JBF A;  4OOM A;  2QPN A;  5U47 A;  4XUX A;  3MKE A;  3GTC A;  3TSG A;  1WYC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...