4C3QA

Neutron structure of a perdeuterated toho-1 r274n r276n double mutant beta-lactamase in complex with a fully deuterated boronic acid (bzb) at 100k
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
261
structure length
261
Chain Sequence
NSVQQQLEALEKSSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTMTLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTEPTLNTAIPGDPRDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGSGDYGTTNDIAVIWPENHAPLVLVTYFTQPEQKAENRNDILAAAAKIVTHGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-LACTAMASE TOHO-1
publication title Cryogenic Neutron Protein Crystallography: Routine Methods and Potential Benefits
doi rcsb
source organism Escherichia coli
total genus 88
structure length 261
sequence length 261
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2013-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4c3qA00
3GV9A 5GLAA 1NZUA 5FASA 1E4DA 1W7FA 5DVAA 4E3OA 1EWZA 1GHIA 4FCFA 1BTLA 3QNCA 4KENB 1KVLA 4EBPA 3NBLA 1C3BA 4QY6A 4Y0OA 3A3FA 3RXWA 4OPRA 3VFHA 1PIOA 5JYPA 1K57C 1SHVA 1RP5A 4KZ4A 5HARA 3NIAA 4KZ8A 4LV1A 3C5AA 5CHJA 5GLCA 1H5XA 1KGGA 5FI7A 4QB8A 3VSKA 3DWKA 5M1AA 4KG2A 4S2PA 3WRZA 4MBHA 2XR0A 1FCOA 3I7JA 5G18A 2IWBA 3SS4A 3WRTA 4ID4A 3VSLA 3G34A 5CGWA 2V1ZA 1J9MA 3FWLA 1SDEA 3GQZA 5DTKA 1BULA 3AGDA 2H0TA 4X68A 2QMIA 1QMFA 4XUXA 5FQ9A 4Y7PA 3G2ZA 1FOFA 5HAIA 1PW1A 3HUMA 3A3IA 3HLWA 5CEDA 1NY0A 2XFSA 4FH2A 1FQGA 2ZMAA 4B4XA 3FKWA 4KZAA 1QMEA 4IVKA 4RX3A 4M3KA 2XD1A 3V39A 2ZQ8A 3IF6A 1ES4A 1LL9A 1SCWA 5EUAA 4H8RA 4OOYA 1K38A 1DY6A 3HUOA 5CECA 5J8XA 5GL9A 3IWOA 3W4PA 1IYQA 3ITAA 3Q07A 1K54A 2GDNA 4WBGA 2IWCA 1IEMA 1CEFA 3WS0A 4QD4A 1W79A 3OPLA 2WAEA 4S2NA 1ALQA 1BUEA 4KG5A 1K6RA 4E3LA 1K55C 1L2SA 3IF6B 1LL5A 2XQZA 4R3BA 3G30A 5DTTA 3PBSA 3HLGA 2ZQDA 4FSFA 4DE0A 4EV4A 3VFFA 3WS4A 1XA1A 5CEBA 4OVDA 1FR6A 3BFGA 1PYYA 4P85A 3MBZA 1AXBA 2XLNA 3PBQA 4S2KA 3E2LA 1MWRA 3UDXA 4EBLA 3UDFA 3IT9A 4FH4A 3TSGA 1SKFA 5CGSA 4R3JA 4BLMA 2G2WA 4GKUA 4OPYA 1ZG6A 4WZ4A 5FA7A 3MZFA 3NC8A 5F1FA 4XXRA 2A3UA 3ZNYA 2Y91A 3DWZA 3NI9A 3BYDA 1VQQA 4PM9A 5CTMA 1KGFA 5FQMA 4K91A 5FQQA 5A93A 1O7EA 1Q2QA 2ZQ9A 4PMAA 4EBNA 4EQIA 1XKZA 5HAQA 1YMSA 2RCXA 4R4SA 1K56D 2E8IA 1YLPA 4PM6A 3UPNA 4IBXA 3N4IA 1TVFA 2G2UA 3UE0A 4X53A 5KSCA 1WE4A 2XH9A 2WKIA 3OCLA 1IYPA 4LCMA 4JKTA 1IKGA 4HEFA 3BFDA 4X6TA 1MXOA 1YLTA 1W8YA 4RX2A 4LENA 1TDLA 3G4PA 3S1YA 5GLDA 2JBFA 4MBKA 2OSUA 2I72A 2QPNA 3V3SA 1FR1A 5KZHA 5E43A 1JVJA 2Y2HA 1BT5A 5DF9A 1EI5A 5HFOA 1H8ZA 1PWGA 1YQSA 3ITBA 5E2EA 5GHYA 3UNWA 2WZZA 1K57A 2X02A 3UPOA 1KE4A 3BFCA 1JWPA 1NJ4A 4WMCD 1NYYA 3BFEA 3VMAA 2H10A 3LEZA 1K4FA 4IEDA 5EE8A 4ZJ1A 4JPMA 3VP1A 3NDGA 3S4XA 4JF4A 3WS1A 1Z6FA 4LV0A 3PBOA 4OQ0A 5CXWA 2CC1A 3MZDA 1GHMA 4QU3A 1JWZA 2HDQA 3P98A 1G6AA 3BLMA 4OKPA 5E2HA 1KDWA 2EXBA 1ESIA 4RA7A 3UN7A 3M2KA 4B88A 5AQAA 2HP5A 4MBFA 4GB7A 1ONHA 2EFXA 1O07A 4XUZA 2ZQAA 3IH9A 5FQIA 2P9VB 1IKIA 1XGJA 2ZC5B 4KZ7A 5A90A 5EECA 1I2WA 5HL1A 2J7VA 4DE1A 1L0FA 1FSWA 3PBTA 1ERQA 4DXBA 3ZNTA 4S2MA 3CMZA 2IWDA 2Y2NA 1CK3A 5KSHA 3VP0A 3RJUA 2R9XA 4MNRA 3HVFA 1K55A 2C6WB 1XPBA 3BLSA 1L0GA 4OH0A 1NZOA 2Y2IA 4KZ9A 3N6IA 3ZG8B 2H0YA 4PM8A 4U0TA 2V2FF 3TOIA 4DE3A 5EVID 1EROA 1GCEA 5FAPA 1MWUA 3G2YA 1NXYA 2C5WB 1E3UA 5L2FA 4N9KA 1HZOA 2Y2KA 2Z2MB 3BEBA 1WYCA 3UE3A 3HBRA 4Y0UA 3OPHA 3SS5A 1N9BA 3A3EA 2WKHA 4B4ZA 5U47A 4RVAA 1K4EA 3HLBA 3M6BA 3SH7A 1KE3A 2Y2GA 3CJMA 4OLGA 1YLYA 2Y55A 2P74A 4LV3A 2WGWB 2Y2QA 3ZG5A 5KMWA 4MLLA 5CHUA 4KZ6A 1XX2A 1YMXA 1XGIA 3V5MA 1TEMA 3D4FA 5I94A 1S6RA 3WS2A 1PI4A 3QNBA 4U3TA 4BJPA 4D2OA 1ES3A 3MXRA 1MWTA 5EVIC 2ZJ9A 5GHZA 1JWVA 1CI9A 2WZXA 3C4OA 1TDGA 1KE0A 4JBFA 4OQGA 5F1GA 5HX9A 4ZJ2A 4DXCA 5DF8A 2EXAA 3OZHA 3IWIA 4KQQA 4P0MA 4RYEA 3IWQA 4OONA 4X56A 1H8YA 5DTSA 5FI2A 3G35A 4KZ5A 3ZDJA 4HBUA 3IHAA 4YFMA 1FCMA 1XA7A 2ZD8A 1PWCA 1YLZA 3GTCA 4WELA 3HUNA 1MBLA 4E6XA 3AGFA 4E6WA 1LI0A 1K6SA 1JTGA 4DE2A 1SDNA 4KG6A 3B3XA 4OOMA 2Z2LB 2HP9A 3OPPA 5AQBA 1LI9A 2ZM8A 3MKEA 3LY3A 4GOGA 5HW3A 5M18A 4JXSA 3G31A 1IYOA 4Z9QA 4BD1A 3A3JA 3ZVTA 4OLDA 4DF6A 3O3VA 3BFFA 1ES2A 3CG5A 4NK3A 3PTEA 1S0WA 2DCFA 4O7DA 1N4OA 5CTNA 3HLDA 5AQ7A 1KDSA 3ISGA 5HAPA 4DDSA 1DJCA 4GN2A 1PW8A 1W5DA 3ZFZA 3N8SA 3NCKA 2HDSA 4UA6A 3PAGA 4PPRA 5CHMA 4BQMA 1HVBA 2WGVA 2Y2PA 2JCHA 2A49A 2VGKA 4QJGA 2X01A 4WM9A 2XGNA 4LV2A 4OP5A 1YLWA 4BL2A 4KZBA 3NY4A 4WZ5C 5DF7A 2V20A 2ZM0A 3M6HA 4ZTKA 1MKIA 4A5RA 1GHPA 4PM5A 1RGZA 4C75A 3W4OA 3V50A 4BD0A 1BLCA 5JYOA 2ZQ7A 3O86A 5EOOA 4WMCA 2OLVA 2PU2A 3WWXA 5TR7A 3N8RA 4ZDXA 1BLSA 1GA9A 3CZDA 1WYBA 3HLFA 1Y54A 2WKEA 3Q82A 3GSGA 4N1XA 1MPLA 4OPZA 2P9VA 3GVBA 4GD6A 1LLBA 3ZVWA 4KZ3A 3UY6A 3IXDA 4QY5A 5FATA 1RGYA 5BOHA 1PZOA 3PAEA 5EOEA 3LY4A 1ESUA 3MKFA 4P6BA 3C7VA 3QHYA 3JYIA 4UHUA 3SOIA 3ZGAB 3AGEA 4N9LA 5F83A 4E3NA 4E3JA 1ZG4A 3HL9A 2OLUA 1CI8A 4GNUA 3UO9A 3LCEA 4ZBEA 1NYMA 5CRFA 3FYZA 4QHCA 2JC7A 5CGXA 3ZG7B 4OQIA 2J9OA 3Q7VA 5FI6A 1Q2PA 2ZC7A 4C6YA 2HP6A 2ZM2A 4JF6A 1MY8A 2ZLYA 3VOZA 4CJNA 1XXMA 2ZC3B 2BG1A 2ZC6B 3VOYA 1IELA 3ZG9B 4GZBA 2WUQA 4K0XA 4P87A 2XFTA 4UAAA 2XF3A 2Y2JA 5TFQA 4UA7A 3SH9A 1U60A 4OPQA 3P09A 2ZC4B 3FKVA 3OC2A 2WK0A 3Q7VB 4JLFA 3IXHA 4DRTA 4S2OA 2WGWA 1BZAA 3PBRA 1FCNA 5FAOA 1E25A 2Y2MA 3WS5A 4R4RA 5FQJA 5EVIA 4JXGA 2BLSA 4ZJ3A 5TGFA 3SS3A 4U0XA 2JE5A 4WEKA 5A92A 1L0EA 1ZKJA 4EWFA 3OPRA 4X55A 4JF5A 3IF5A 5M19A 1OMEA 1ERMA 4JXVA 4GDBA 2HDUA 3V3RA 2WGIA 5CERA 5E2GA 3VP4A 1ONGA 3VP3A 2H5SA 3LO7A 2XD5A 2DRWA 3EQUA 3SH8A 3BRMA 1I2SA 3UPPA 1YM1A 5GLBA 4BL3A 3MFDA 1E3UD 5EVIB 1W8QA 2Y2LA 4YINA 1YT4A 5GHXA 2Q9NA 2PBYA 1ZC2A 2DNSA 1DJBA 4DKIA 5FDHA 4Q8IA 1YLJA 4R1GA 4GDNA 1KGEA 2RL3A 3S22A 2WADA 2Y4AA 3N8LA 2XEPA 4R23A 2WAFA 4EUZA 3M2JA 3BECA 5FSRA 3GMWA 3UE1A 2PU4A 1FSYA 1PZPA 4PM7A 4OQHA 2EFUA 4CPKA 1VM1A 1HD8A 4FD8A 4C3QA 3RXXA 3IF6C 2VGJA 1CEGA 3Q1FA 3IH8A 4LCLA 3IQAA 4BENA 5F82A 1MWSA 4S2JA 1K54C 3C7UA 1IYSA 4NETA 4S2NC 1XP4A 1PI5A 3DTMA 2X71A 1K56A 4HBTA 1NRFA 2Y59A 4WZ5A 3EQVA 1JTDA 5E2FA 4DDYA 1ES5A 2Q9MA 3NDEA 1BSGA 2B5RA 3GRJA 3O88A 4IVIA 4K0WA 4KQRA 4GD8A 1PWDA 1I5QA 1L0DA 4N92A 2EX2A 1GA0A 3O87A 4OOLA 3OCNA 1G68A 1DJAA 3ZHHA 1BLPA 4F94A 5EPHA 4L0LA 4R0QA 4E3IA 3IXBA 1M40A 3FV7A 3HLCA 3FZCA 3E2KA 3W8KA 5AQ9A 2XDMA 2QZ6A 3GR2A 2OV5A 5D3OA 1M6KA 1LHYA 2XK1A 3MZEA 4E3MA 3A3DA 4JXWA 4N1HA 3BM6A 5IHVA 2J8YA 3N7WA 3TG9A 3HLEA 2J9PA 4HESA 3ZG0A 4ZAMA 4MEZA 2HPBA 3C4PA 3Q7ZA 3HREA 3DW0A 2FFFB 4OP8A 3G32A 1HTZA 4IBRA 2WYXA 4UA9A 2EX8A 4S2IA 1KVMA 3IHBA 4KQOA 2Y2OA 3ZCZA 3IXGA 1K25A 1RCJA 2EX9A 3PBNA 2UWXA 3VP2A 4E3KA 4Y0TA 4S2LA 2EX6A 3Q81A 4WYYA 5FQKA 3UDIA 2R9WA 3MXSA 4X69A 5EVLA 5A91A 2FFYA 2HDRA 4WEJA 5FAQA 3W4QA 1BLHA 2ZQCA
chains in the Genus database with same CATH superfamily
1W7FA 3BQ8A 4FCFA 1KVLA 3NBLA 2J3TC 4QY6A 4Y0OA 4CQHA 4PAUA 3NIAA 3KSIA 4LV1A 1GSWA 3EWKA 5GLCA 1H5XA 1S67L 3DWKA 3I7JA 2IWBA 3SS4A 3VSLA 2V1ZA 5DTKA 1T19A 1BULA 2QWSA 2PR5A 1QMFA 3DTKA 3G2ZA 3A3IA 1NY0A 4D60A 2ZMAA 4KZAA 1QMEA 4IVKA 4LRZE 3V39A 4HH2A 1BYWA 4ZRRA 2BTFP 3IF6A 1ES4A 5EUAA 5CECA 4H6JA 2IWCA 4RQ9A 1W79A 2WAEA 1ALQA 1BUEA 4KG5A 1K6RA 4E3LA 5DTTA 1MZUA 1OTIA 1XA1A 1OPXA 5HL6A 3PBQA 3UDXA 4FH4A 2O0YA 2V1AA 2G2WA 4GKUA 3F1PB 3NC8A 3T1SA 2A3UA 3LGOA 5A93A 1VQQA 5FQMA 4HIAA 1O7EA 4EBNA 4LFUA 4F3LB 4CLCB 4PM6A 4IBXA 3OOVA 4X53A 2WKIA 3T4JA 4LCMA 1YLTA 4RX2A 4GCZA 3H82A 1N9NA 2QPNA 2I72A 3V3SA 5KZHA 3P01A 1EI5A 3O5YA 5E2EA 3UNWA 2WZZA 1K57A 3UPOA 4WMCD 4ME4A 3BFEA 4IEDA 3C2WA 3NDGA 3WS1A 3PBOA 4OQ0A 1XJ4A 5CXWA 3VE4A 3P98A 5DKKA 1OTAA 4WN5A 4OKPA 4RA7A 3UN7A 5MC7A 4B9OA 4B88A 4GB7A 4ETXA 1ONHA 4MN5A 2Y79A 3IH9A 2ZC5B 3E0YA 4BBTA 5K5BA 5EECA 3LUQA 4DE1A 5G4YA 3T1RA 3PBTA 4HP9A 5TBMB 4DXBA 2ZMFA 2Y2NA 1K55A 2C6WB 3BLSA 4OH0A 3QP4A 4PM8A 4X25A 4PKYA 2V2FF 3LR4A 3TOIA 1T18A 1E3UA 1HZOA 1WYCA 3UE3A 3OPHA 3H7WA 3T4KA 2Y2GA 1UGUA 3CJMA 1MKMA 4DMZA 1K0KA 3WS2A 3IX8A 3BY9A 5EVIC 2ZJ9A 2MJ6A 3CPTB 1CI9A 2W3EA 1CQAA 2WZXA 3C4OA 3KSGA 5HX9A 4DXCA 4KQQA 4P0MA 4X56A 3GTCA 4WELA 4MCWA 3HUNA 3AGFA 2IA2A 1MC0A 3BWLA 2P08A 1SDNA 3MS6A 3KYZA 3OPPA 2O9CA 1LI9A 2ZM8A 3MKEA 4JXSA 3G31A 4EERA 3ZVTA 2JKGA 1SKOA 1DP9A 3O3VA 1ES2A 3IS2A 2DMWA 2W1TA 4GW9A 3CG5A 4O7DA 5AQ7A 1KDSA 3EOIA 1GSXA 1DJCA 1DRMA 1W5DA 2PT7A 3NCKA 2HDSA 4PPRA 1N9LA 1HVBA 4KQDA 2WGVA 2VGKA 1H8MA 2X01A 4GHIA 2V20A 4A5RA 1GHPA 3F1OA 3NOTC 3E4QA 4Y17A 5JYOA 2G7UA 2OLVA 5TR7A 4ZDXA 1GA9A 3CZDA 3HLFA 3BY8A 1TS0A 2V8FA 3LIDA 4OPZA 3PHYA 5HD3A 4KZ3A 5FATA 5EOEA 1ESUA 3JYIA 3CAXA 3ZGAB 3AGEA 3UMEA 4N9LA 5F83A 4E3NA 3HL9A 1CI8A 1NYMA 5CRFA 3VE3A 2W27A 4EESA 2ZC7A 2HP6A 1MY8A 3B47A 2HGVA 4Y3IA 4AFIA 4UAAA 5TFQA 3NOPC 3OBFA 1U60A 2ZC4B 2VV7A 4DRTA 2Y2MA 1ODVA 3SS3A 3OPRA 5M19A 1OMEA 1ERMA 2WKQA 5CERA 5E2GA 3VP4A 1ONGA 3LO7A 3UE6A 3SH8A 2QHKA 3UPPA 1YM1A 3K3DA 4BL3A 1AWIA 3MFDA 4YINA 5C5KA 2PBYA 1SZVA 5FDHA 4Q8IA 1YLJA 4R1GA 3FPVA 3S22A 2WADA 3R7WB 4R23A 2WAFA 1FSYA 2H28A 4G3KA 1HD8A 5HWWA 3KX0X 2VGJA 1CEGA 3IH8A 4HI4A 4IHQA 2X71A 4BBUA 4WZ5A 5AVEA 1JTDA 1ZHHB 4JGPA 1L0DA 1XFNA 3LYXA 3ZHHA 1BLPA 4XT2A 3IXBA 3FV7A 3BW6A 2XDMA 2Y8HA 1LHYA 2XK1A 2QJ7A 2M7VA 2D02A 3EGXC 3HLEA 4ZAMA 2PAVP 3Q7ZA 3HREA 2OOLA 3CITA 3B42A 4IBRA 3UB8A 2EX8A 4KQOA 3ZCZA 1RCJA 4Y0TA 4WYYA 2R9WA 4X69A 3CWFA 4EWFA 4WEJA 3LR5A 2ZQCA 3GV9A 5GLAA 5FASA 5DVAA 4IUKA 4E3OA 1EWZA 1BTLA 1C3BA 2W3GA 4HNBA 3A3FA 3RXWA 2W3HA 4DJ2A 1YSPA 4O01A 1FILA 2VKSA 1NRJA 5FI7A 3VSKA 1OTEA 3WRZA 3T4LA 5DFYA 3WRTA 4ID4A 2JKTM 3G34A 5CGWA 4UEYA 1SDEA 3GQZA 3AGDA 4X68A 5FQ9A 2QMIA 4XUXA 4ARZA 4Y7PA 4KUOA 5HAIA 5CEDA 2XFSA 1FQGA 4B4XA 1D1JA 1P9RA 2JKTI 2XD1A 2ZQ8A 3F1NB 3QP5A 1D7EA 3K2NA 5J8XA 2I9VA 3HUOA 4R38A 5GL9A 5CX7A 3ITAA 5F69A 3D72A 1CEFA 3OPLA 1L3LA 4S2NA 2V0UA 3HLGA 2J80A 4LGWA 2VX8A 3H7WB 4P85A 3MBZA 3MFXA 2XLNA 3E2LA 1MWRA 4BLMA 2VGLS 3BJNA 3ZNYA 3BYDA 1KGFA 1YSQA 4HQAA 1Q2QA 4EQIA 1V9ZA 1XKZA 1YMSA 2XSSA 1K56D 2E8IA 4E04A 3B33A 3UE0A 5KSCA 3OCLA 3LFVA 5LBRA 4X6TA 1W8YA 1TDLA 3S1YA 3CUEC 2J3WA 1FR1A 4I39A 2ZL1A 4NKPA 5DF9A 1PWGA 4FUWA 4HOIA 3VOLA 4HY8A 5GHYA 2W1TB 3DAVA 4R70A 5IU1A 1JWPA 3QP2A 1NYYA 1NLZA 3LEZA 4ZJ1A 3D9YA 1XJ3A 4JF4A 3S4XA 4LV0A 5I5LA 2CC1A 3MZDA 1P97A 4QU3A 1F98A 4Y2FA 2PR6A 2HDQA 1G6AA 2GX5A 1F2KA 2A24A 3OLOA 2VGLM 4MBFA 5FQIA 1I2WA 5HL1A 2PD8A 4YWZA 4EXOA 4S2MA 2IWDA 5KSHA 3FC7A 1VETA 1L0GA 2JHEA 1NZOA 3N6IA 1T1CA 3CHWP 4DE3A 5HZHA 1GCEA 1MWUA 3BEBA 2ACGA 1X0OA 2OAQ1 3SS5A 2WKHA 4B4ZA 3HLBA 3M6BA 4OLGA 3MQOA 4LV3A 4JGRA 1VEUB 1YMXA 1TEMA 1S6RA 5DJTA 3QNBA 4BWIA 3LR0A 3V67A 5GHZA 4FTXA 3EEHA 2O9BA 3FPWA 2EXAA 3IWIA 4RYEA 3T1XA 4B93A 5DTSA 5FI2A 4KZ5A 4HBUA 3IHAA 1XA7A 2ZD8A 3MR0A 1P0ZA 1OJGA 2HV1A 4DE2A 4I5SA 5HDDA 4KG6A 3HJKA 3LY3A 5HW3A 4NXEA 2FH5A 3T50A 4OLDA 3BFFA 4NK3A 2DCFA 5CTNA 3HLDA 1PW8A 4EQ1A 4UA6A 5CHMA 3RFBA 2Y2PA 2A49A 4QJGA 1FIKA 4WM9A 4OP5A 3U2AA 1YLWA 3NHQA 2ZMVA 5DF7A 1HLUP 4ZTKA 1NWZA 5AJGA 3C38A 2ZQ7A 2BASA 1ZTUA 2PU2A 5EFWA 3WWXA 2Q0OA 4XT2B 3TW8A 4EU0A 3Q82A 4EUVA 4N1XA 3GVBA 3ZVWA 4QY5A 3VV4A 5J3WA 2R78A 4DJ3A 3SOIA 3T4QA 4Y15A 2OLUA 3LCEA 4QHCA 4OQIA 3E4PA 3GECA 2ZLYA 4CJNA 2ZC3B 1IELA 4P87A 4EW7A 4OPQA 2WK0A 3Q7VB 4S2OA 1JNUA 1BZAA 3PBRA 2K31A 5FAOA 1E25A 2KLIA 5EVIA 2BLSA 4ZJ3A 3IF5A 3HJIA 4Q0JA 3VP3A 2HJ9C 2PYPA 3KYQA 1LSWA 2YKHA 3BRMA 5HWVA 5GLBA 1W8QA 2Y2LA 5GHXA 2Q9NA 1ZC2A 2DNSA 4DKIA 2W3DA 1KGEA 2Y4AA 4EUZA 2V0WA 3GMWA 2PU4A 1PZPA 4OQHA 2EFUA 3RXXA 2PBDP 4IUHA 4LCLA 1MWSA 1K54C 3KSFA 1IYSA 3C30A 1J3WA 3DTMA 4GJ4A 1K56A 4M4XA 4WUJA 2Q9MA 5TJJA 1PRQA 3LIEA 1S4SA 4GD8A 2EX2A 4OOLA 3OCNA 1G68A 1DJAA 4HJ6A 3W8KA 3GR2A 2OV5A 1M6KA 3A3DA 4JXWA 3BM6A 4YOFA 3N7WA 1Y28A 4HESA 2J3TD 2FFFB 4OP8A 4I3JA 4UA9A 3IHBA 1K25A 3MMHA 2EX6A 5FQKA 3UDIA 5EVLA 5A91A 4L9FA 5FAQA 1BLHA 1NZUA 1E4DA 3LIBA 1YKDA 2QKPA 4EBPA 3VFHA 1XJ2A 1PIOA 5A8BA 1RP5A 3HCYA 2KX6A 3SZTA 2O99A 3C5AA 5CHJA 1KGGA 4QB8A 1FCOA 5G18A 1YPRA 3H9WA 2A24B 1FOFA 1PW1A 3HUMA 3HLWA 4O0PA 1T1BA 4FH2A 3FKWA 4M3KA 1F5MA 2INWA 1LL9A 1SCWA 4H8RA 1DY6A 3IWOA 3E98A 1A0KA 3WS0A 1TS7A 3LI8A 2ZOIA 3MQQA 1L2SA 3IF6B 1LL5A 2XQZA 4R3BA 1PFLA 4H6JB 4EV4A 2V9AA 3VFFA 3S7OA 5CEBA 3UB6A 1FR6A 3DTEA 3BFGA 1PYYA 1AXBA 3CLOA 3MQ0A 3UDFA 3IT9A 3TSGA 4K08A 3RH8B 4F3LA 2OWJA 4OPYA 4X1LA 3MZFA 2Y91A 5CTMA 5FQQA 3EEAA 3T12B 4PMAA 4EETB 3IBJA 3L7HA 5HWTA 4R4SA 3LIAA 2G2UA 3QP6A 4CLCC 1IYPA 2QYBA 4HJ4A 1IKGA 4HEFA 3BFDA 1OTBA 1MXOA 4LENA 3G4PA 4MBKA 4PKYG 2OSUA 2Z6CA 1JVJA 2Y2HA 4HH3A 1H8ZA 1YQSA 4WLAA 1OT6A 3H82B 3VMAA 2H10A 5EE8A 4JPMA 3GDIA 3VP1A 1Z6FA 5F6AA 1GHMA 3KSHA 1KDWA 5TBMA 3M2KA 2HP5A 2OWHA 2PYRA 3T1QB 2EFXA 2ZQAA 1XGJA 1UWNX 5HSQA 1FSWA 1ERQA 3ZNTA 3CMZA 2Y2IA 4KZ9A 2H0YA 5HPIA 2O9AA 3UB5P 5EVID 4GS9A 5FAPA 1NXYA 5L2FA 4N9KA 2Y2KA 4Y0UA 2UV0E 4G3WA 1N9BA 2JKFA 3A3EA 5U47A 4RVAA 1K4EA 3CPTA 4HP4A 3SH7A 1KE3A 1YLYA 2P74A 5CHUA 4KZ6A 5AVFA 3V5MA 3D4FA 1PI4A 4U3TA 4BJPA 4D2OA 3MXRA 1MWTA 4R6LA 1NLYA 3OZHA 1OJ5A 3KYEA 4KUKA 4OONA 1H8YA 3G35A 4YFMA 1FCMA 1PWCA 1YLZA 3RTYA 3UB9A 3CUEA 4E6WA 1LI0A 3UMDA 3B3XA 2Z2LB 1GSVA 5AQBA 2W1RA 4QPRA 4GOGA 1IYOA 4Z9QA 4BD1A 3A3JA 4DF6A 3C8CA 1S0WA 1N4OA 2KOIA 3A0RA 2VA0A 3ISGA 5HAPA 4DDSA 1S1ZA 3ICYA 2B02A 3PAGA 4BQMA 2OAP1 2JCHA 1SKOB 3IS2B 2XGNA 1S66L 4LV2A 4BL2A 3KO6A 3S7NA 1VHMA 2ZM0A 3M6HA 1MKIA 4JGOA 4PM5A 1CJFA 3IX4A 3V50A 1BLCA 5EOOA 3N8RA 2XA7S 3IX3A 1WYBA 4GHIB 2L1MA 3R4KA 3GSGA 2EWVA 5L09A 2P9VA 4IJGA 4GD6A 1LLBA 3F1OB 4BMWA 3UY6A 1Z09A 1RGYA 1PZOA 3LY4A 4NG2A 3LIFA 3MKFA 4P6BA 3C7VA 3QHYA 2B95A 2HJEA 1EW0A 1ZG4A 4ZBEA 3FYZA 5CGXA 2JC7A 3ZG7B 4FOFA 2J9OA 5FI6A 2P7JA 3FG8A 5HD5A 3VOZA 4I3AA 2BG1A 2ZC6B 4GZBA 4K0XA 2GJ3A 3U4LP 3L9KA 2HZ5A 4UA7A 3SH9A 3P09A 3FKVA 3OC2A 4JLFA 1OT9A 3IXHA 2WGWA 3WS5A 4R4RA 5FQJA 4WF0A 5TGFA 4U0XA 4WEKA 1ZKJA 4JF5A 4LRXC 2WGIA 2GZAA 3V3RA 3R7WA 1DP6A 2VJWA 4X1MA 4Q0HA 4MMNA 2XA7M 4LLOB 2V8CA 5L07A 4GDNA 2RL3A 5FL3A 3LEQA 4HJ3A 4DN0A 4NXBA 5EM0A 2EWWA 2XROA 3IF6C 4MN7A 3P7NA 3Q1FA 3IQAA 4BENA 2NUTC 2D01A 2HF6A 5F82A 2VLGA 4LPZA 3C7UA 4NETA 1W63Q 4CLCD 3ULFA 4Q0IA 3NOUC 4HBTA 1NRFA 2Y59A 4DDYA 1ES5A 4G3VA 2XRNA 1STZA 2B5RA 2JKRM 3GRJA 4KQRA 2JN7A 4CLCE 1I5QA 3NJAA 1LSVA 4Z1WA 3FZCA 1ACFA 2JKRI 1S1YA 4R3AA 3JVUA 3S7QA 3PYPA 5IHVA 2J8YA 3TG9A 3ZG0A 4MEZA 1TS8A 3C4PA 2M1CA 3DW0A 1HTZA 2E8JA 2WYXA 2PD7A 5F68A 1KVMA 3S7PA 3VP2A 1TS6A 2FFYA 1YAXA 1LSXA 4EEPA 1GHIA 4NEED 4KENB 3QNCA 1F9IA 4QWOA 1P9WA 4OPRA 5JYPA 4O8GA 1K57C 1SHVA 4KZ4A 1TF1A 5HARA 4KZ8A 3MF0A 3JPUA 2VV8A 5L10A 5M1AA 4KG2A 2PRFA 4S2PA 4MBHA 2XR0A 4P6ZS 1VB6A 3MJQA 2CMNA 1J9MA 3FWLA 3DTIA 3F1NA 2H0TA 3LR3A 3IBRA 5KIZA 2L4RA 4HHDA 4RX3A 3EGDC 2V1BA 5J4EA 4ARZB 4OOYA 1K38A 3W4PA 1IYQA 3Q07A 1K54A 2GDNA 4WBGA 1IEMA 4QD4A 1UWPX 1V9YA 1K55C 1XJ6A 4GS9B 3G30A 3PBSA 2ZQDA 4FSFA 2M7UA 3MXQA 4BBVA 4DE0A 2KDKA 4GLQA 5L8MA 3WS4A 4OVDA 4I3IA 4S2KA 3CI6A 4EBLA 1SKFA 5CGSA 4R3JA 5IS1A 1ZG6A 4WZ4A 5FA7A 3D3OA 3G6OA 5F1FA 4XXRA 3DWZA 1S4RA 3NI9A 4PM9A 4K91A 2ZQ9A 3A0VA 4P6ZM 5HAQA 2RCXA 1YLPA 3UPNA 3N4IA 1TVFA 2VZWA 1WE4A 2XH9A 3TJZC 4JKTA 2K2NA 3W2ZA 5GLDA 2JBFA 1OTDA 3NECA 5E43A 1BT5A 4LRYC 5HFOA 3ITBA 3ZQ5A 4II7A 3QP8A 5DJUA 2EA9A 2X02A 1KE4A 3BFCA 1NJ4A 1K4FA 2ZL1B 4UQIS 1PNEA 3DBAA 5IT5A 2ZBBA 5EVEA 1JWZA 3BLMA 5E2HA 2EXBA 3TE8A 1ESIA 2LB5A 5AQAA 1TD5A 1O07A 4XUZA 1WA9A 2P9VB 4PHTA 4NXFA 1IKIA 4KZ7A 5A90A 2J7VA 1L0FA 5EV0A 5G4ZA 2AVXA 1CK3A 3VP0A 3RJUA 2R9XA 4MNRA 3HVFA 1XPBA 2VEAA 3ZG8B 1N9OA 4U0TA 3E4OA 1EROA 3G2YA 1VEUA 2C5WB 3T4OA 3SW1A 2Z2MB 3HBRA 2B18A 1VETB 3TRCA 2L0WA 5DKLA 4EEUA 3ZYTA 2Y55A 2WGWB 2Y2QA 3ZG5A 5KMWA 4MLLA 1XX2A 1XGIA 5I94A 3F1PA 3UB7A 1ES3A 3T4TA 1JWVA 2NUPC 5FEGA 4UQIM 4JBFA 5F1GA 1TDGA 1KE0A 4OQGA 4ZJ2A 5DF8A 2P04A 4CLCA 3IWQA 2PDRA 3ZDJA 2WKRA 2LB9A 1MBLA 4E6XA 2VK3A 1K6SA 1JTGA 4MDZA 4OOMA 2HP9A 1XFQA 1LT0A 3PXPA 5M18A 5FEFA 3PTEA 2FZ0A 4YNRA 4GN2A 3ZFZA 3N8SA 4KZBA 3NY4A 4WZ5C 1T1AA 2W0NA 1RGZA 4C75A 3W4OA 4BD0A 3O86A 4WMCA 4ESPA 5HDCA 1BLSA 5EM1A 1Y54A 2WKEA 2K7SA 1MPLA 4MN6A 5HPFA 1CF0A 3QP1A 1G6OA 3IXDA 5BOHA 5F5YA 3PAEA 2YKFA 4UHUA 2A2LA 3MSHA 4E3JA 3A0SA 4GNUA 3UO9A 3Q7VA 1Q2PA 4C6YA 2ZM2A 4JF6A 2ZOHA 1D06A 1XXMA 3VOYA 3ZG9B 4NXGA 1H3QA 2WUQA 2XFTA 2XF3A 2Y2JA 1H0MA 1FCNA 3K3CA 4Y13A 4L9GA 4WL9A 4JXGA 4L9EA 2JE5A 5A92A 1L0EA 4X55A 4JXVA 4GDBA 2HDUA 2H5SA 2XD5A 2DRWA 3EQUA 3JVVA 1I2SA 3NULA 1KOUA 2QJ5A 1E3UD 5EVIB 1IOUA 2W3FA 1YT4A 1DJBA 3LI9A 3N8LA 4JGQA 2XEPA 3BQAA 3M2JA 3BECA 5FSRA 2Z6DA 3UE1A 5DFXA 1W63M 4PM7A 5FDSA 4CPKA 1VM1A 4FD8A 4C3QA 1IFQA 3LICA 4S2JA 4ETZA 4S2NC 1XP4A 3PR6A 1PI5A 3EQVA 4I38A 5E2FA 1DP8A 3NDEA 1BSGA 1G28A 3O88A 4IVIA 4K0WA 1PWDA 4N92A 1GA0A 3O87A 2VV6A 4F94A 5EPHA 2WKPA 4L0LA 4R0QA 4E3IA 1M40A 2GNXA 3HLCA 3E2KA 5AQ9A 2QZ6A 5D3OA 1Y4OA 3T4SA 3MZEA 4E3MA 1LL8A 4N1HA 2PHYA 2J9PA 2HPBA 1G5UA 3G32A 4S2IA 2Y2OA 5HDSA 3IXGA 2EX9A 3PBNA 2UWXA 4E3KA 5J7EA 4S2LA 3Q81A 3MXSA 2HDRA 3W4QA 4Y5FA
chains in the Genus database with same CATH topology
3GV9A 5GLAA 1NZUA 5FASA 1E4DA 1W7FA 5DVAA 4E3OA 1EWZA 1GHIA 4FCFA 1BTLA 3QNCA 4KENB 1KVLA 4EBPA 3NBLA 1C3BA 4QY6A 4Y0OA 3A3FA 3RXWA 4OPRA 3VFHA 1PIOA 5JYPA 1K57C 1SHVA 1RP5A 4KZ4A 5HARA 3NIAA 4KZ8A 4LV1A 3C5AA 5CHJA 5GLCA 1H5XA 1KGGA 5FI7A 4QB8A 3VSKA 3DWKA 5M1AA 4KG2A 4S2PA 3WRZA 4MBHA 2XR0A 1FCOA 3I7JA 5G18A 2IWBA 3SS4A 3WRTA 4ID4A 3VSLA 3G34A 5CGWA 2V1ZA 1J9MA 3FWLA 1SDEA 3GQZA 5DTKA 1BULA 3AGDA 2H0TA 4X68A 2QMIA 1QMFA 4XUXA 5FQ9A 4Y7PA 3G2ZA 1FOFA 5HAIA 1PW1A 3HUMA 3A3IA 3HLWA 5CEDA 1NY0A 2XFSA 4FH2A 1FQGA 2ZMAA 4B4XA 3FKWA 4KZAA 1QMEA 4IVKA 4RX3A 4M3KA 2XD1A 3V39A 2ZQ8A 3IF6A 1ES4A 1LL9A 1SCWA 5EUAA 4H8RA 4OOYA 1K38A 1DY6A 3HUOA 5CECA 5J8XA 5GL9A 3IWOA 3W4PA 1IYQA 3ITAA 3Q07A 1K54A 2GDNA 4WBGA 2IWCA 1IEMA 1CEFA 3WS0A 4QD4A 1W79A 3OPLA 2WAEA 4S2NA 1ALQA 1BUEA 4KG5A 1K6RA 4E3LA 1K55C 1L2SA 3IF6B 1LL5A 2XQZA 4R3BA 3G30A 5DTTA 3PBSA 3HLGA 2ZQDA 4FSFA 4DE0A 4EV4A 3VFFA 3WS4A 1XA1A 5CEBA 4OVDA 1FR6A 3BFGA 1PYYA 4P85A 3MBZA 1AXBA 2XLNA 3PBQA 4S2KA 3E2LA 1MWRA 3UDXA 4EBLA 3UDFA 3IT9A 4FH4A 3TSGA 1SKFA 5CGSA 4R3JA 4BLMA 2G2WA 4GKUA 4OPYA 1ZG6A 4WZ4A 5FA7A 3MZFA 3NC8A 5F1FA 4XXRA 2A3UA 3ZNYA 2Y91A 3DWZA 3NI9A 3BYDA 1VQQA 4PM9A 5CTMA 1KGFA 5FQMA 4K91A 5FQQA 5A93A 1O7EA 1Q2QA 2ZQ9A 4PMAA 4EBNA 4EQIA 1XKZA 5HAQA 1YMSA 2RCXA 4R4SA 1K56D 2E8IA 1YLPA 4PM6A 3UPNA 4IBXA 3N4IA 1TVFA 2G2UA 3UE0A 4X53A 5KSCA 1WE4A 2XH9A 2WKIA 3OCLA 1IYPA 4LCMA 4JKTA 1IKGA 4HEFA 3BFDA 4X6TA 1MXOA 1YLTA 1W8YA 4RX2A 4LENA 1TDLA 3G4PA 3S1YA 5GLDA 2JBFA 4MBKA 2OSUA 2I72A 2QPNA 3V3SA 1FR1A 5KZHA 5E43A 1JVJA 2Y2HA 1BT5A 5DF9A 1EI5A 5HFOA 1H8ZA 1PWGA 1YQSA 3ITBA 5E2EA 5GHYA 3UNWA 2WZZA 1K57A 2X02A 3UPOA 1KE4A 3BFCA 1JWPA 1NJ4A 4WMCD 1NYYA 3BFEA 3VMAA 2H10A 3LEZA 1K4FA 4IEDA 5EE8A 4ZJ1A 4JPMA 3VP1A 3NDGA 3S4XA 4JF4A 3WS1A 1Z6FA 4LV0A 3PBOA 4OQ0A 5CXWA 2CC1A 3MZDA 1GHMA 4QU3A 1JWZA 2HDQA 3P98A 1G6AA 3BLMA 4OKPA 5E2HA 1KDWA 2EXBA 1ESIA 4RA7A 3UN7A 3M2KA 4B88A 5AQAA 2HP5A 4MBFA 4GB7A 1ONHA 2EFXA 1O07A 4XUZA 2ZQAA 3IH9A 5FQIA 2P9VB 1IKIA 1XGJA 2ZC5B 4KZ7A 5A90A 5EECA 1I2WA 5HL1A 2J7VA 4DE1A 1L0FA 1FSWA 3PBTA 1ERQA 4DXBA 3ZNTA 4S2MA 3CMZA 2IWDA 2Y2NA 1CK3A 5KSHA 3VP0A 3RJUA 2R9XA 4MNRA 3HVFA 1K55A 2C6WB 1XPBA 3BLSA 1L0GA 4OH0A 1NZOA 2Y2IA 4KZ9A 3N6IA 3ZG8B 2H0YA 4PM8A 4U0TA 2V2FF 3TOIA 4DE3A 5EVID 1EROA 1GCEA 5FAPA 1MWUA 3G2YA 1NXYA 2C5WB 1E3UA 5L2FA 4N9KA 1HZOA 2Y2KA 2Z2MB 3BEBA 1WYCA 3UE3A 3HBRA 4Y0UA 3OPHA 3SS5A 1N9BA 3A3EA 2WKHA 4B4ZA 5U47A 4RVAA 1K4EA 3HLBA 3M6BA 3SH7A 1KE3A 2Y2GA 3CJMA 4OLGA 1YLYA 2Y55A 2P74A 4LV3A 2WGWB 2Y2QA 3ZG5A 5KMWA 4MLLA 5CHUA 4KZ6A 1XX2A 1YMXA 1XGIA 3V5MA 1TEMA 3D4FA 5I94A 1S6RA 3WS2A 1PI4A 3QNBA 4U3TA 4BJPA 4D2OA 1ES3A 3MXRA 1MWTA 5EVIC 2ZJ9A 5GHZA 1JWVA 1CI9A 2WZXA 3C4OA 1TDGA 1KE0A 4JBFA 4OQGA 5F1GA 5HX9A 4ZJ2A 4DXCA 5DF8A 2EXAA 3OZHA 3IWIA 4KQQA 4P0MA 4RYEA 3IWQA 4OONA 4X56A 1H8YA 5DTSA 5FI2A 3G35A 4KZ5A 3ZDJA 4HBUA 3IHAA 4YFMA 1FCMA 1XA7A 2ZD8A 1PWCA 1YLZA 3GTCA 4WELA 3HUNA 1MBLA 4E6XA 3AGFA 4E6WA 1LI0A 1K6SA 1JTGA 4DE2A 1SDNA 4KG6A 3B3XA 4OOMA 2Z2LB 2HP9A 3OPPA 5AQBA 1LI9A 2ZM8A 3MKEA 3LY3A 4GOGA 5HW3A 5M18A 4JXSA 3G31A 1IYOA 4Z9QA 4BD1A 3A3JA 3ZVTA 4OLDA 4DF6A 3O3VA 3BFFA 1ES2A 3CG5A 4NK3A 3PTEA 1S0WA 2DCFA 4O7DA 1N4OA 5CTNA 3HLDA 5AQ7A 1KDSA 3ISGA 5HAPA 4DDSA 1DJCA 4GN2A 1PW8A 1W5DA 3ZFZA 3N8SA 3NCKA 2HDSA 4UA6A 3PAGA 4PPRA 5CHMA 4BQMA 1HVBA 2WGVA 2Y2PA 2JCHA 2A49A 2VGKA 4QJGA 2X01A 4WM9A 2XGNA 4LV2A 4OP5A 1YLWA 4BL2A 4KZBA 3NY4A 4WZ5C 5DF7A 2V20A 2ZM0A 3M6HA 4ZTKA 1MKIA 4A5RA 1GHPA 4PM5A 1RGZA 4C75A 3W4OA 3V50A 4BD0A 1BLCA 5JYOA 2ZQ7A 3O86A 5EOOA 4WMCA 2OLVA 2PU2A 3WWXA 5TR7A 3N8RA 4ZDXA 1BLSA 1GA9A 3CZDA 1WYBA 3HLFA 1Y54A 2WKEA 3Q82A 3GSGA 4N1XA 1MPLA 4OPZA 2P9VA 3GVBA 4GD6A 1LLBA 3ZVWA 4KZ3A 3UY6A 3IXDA 4QY5A 5FATA 1RGYA 5BOHA 1PZOA 3PAEA 5EOEA 3LY4A 1ESUA 3MKFA 4P6BA 3C7VA 3QHYA 3JYIA 4UHUA 3SOIA 3ZGAB 3AGEA 4N9LA 5F83A 4E3NA 4E3JA 1ZG4A 3HL9A 2OLUA 1CI8A 4GNUA 3UO9A 3LCEA 4ZBEA 1NYMA 5CRFA 3FYZA 4QHCA 2JC7A 5CGXA 3ZG7B 4OQIA 2J9OA 3Q7VA 5FI6A 1Q2PA 2ZC7A 4C6YA 2HP6A 2ZM2A 4JF6A 1MY8A 2ZLYA 3VOZA 4CJNA 1XXMA 2ZC3B 2BG1A 2ZC6B 3VOYA 1IELA 3ZG9B 4GZBA 2WUQA 4K0XA 4P87A 2XFTA 4UAAA 2XF3A 2Y2JA 5TFQA 4UA7A 3SH9A 1U60A 4OPQA 3P09A 2ZC4B 3FKVA 3OC2A 2WK0A 3Q7VB 4JLFA 3IXHA 4DRTA 4S2OA 2WGWA 1BZAA 3PBRA 1FCNA 5FAOA 1E25A 2Y2MA 3WS5A 4R4RA 5FQJA 5EVIA 4JXGA 2BLSA 4ZJ3A 5TGFA 3SS3A 4U0XA 2JE5A 4WEKA 5A92A 1L0EA 1ZKJA 4EWFA 3OPRA 4X55A 4JF5A 3IF5A 5M19A 1OMEA 1ERMA 4JXVA 4GDBA 2HDUA 3V3RA 2WGIA 5CERA 5E2GA 3VP4A 1ONGA 3VP3A 2H5SA 3LO7A 2XD5A 2DRWA 3EQUA 3SH8A 3BRMA 1I2SA 3UPPA 1YM1A 5GLBA 4BL3A 3MFDA 1E3UD 5EVIB 1W8QA 2Y2LA 4YINA 1YT4A 5GHXA 2Q9NA 2PBYA 1ZC2A 2DNSA 1DJBA 4DKIA 5FDHA 4Q8IA 1YLJA 4R1GA 4GDNA 1KGEA 2RL3A 3S22A 2WADA 2Y4AA 3N8LA 2XEPA 4R23A 2WAFA 4EUZA 3M2JA 3BECA 5FSRA 3GMWA 3UE1A 2PU4A 1FSYA 1PZPA 4PM7A 4OQHA 2EFUA 4CPKA 1VM1A 1HD8A 4FD8A 4C3QA 3RXXA 3IF6C 2VGJA 1CEGA 3Q1FA 3IH8A 4LCLA 3IQAA 4BENA 5F82A 1MWSA 4S2JA 1K54C 3C7UA 1IYSA 4NETA 4S2NC 1XP4A 1PI5A 3DTMA 2X71A 1K56A 4HBTA 1NRFA 2Y59A 4WZ5A 3EQVA 1JTDA 5E2FA 4DDYA 1ES5A 2Q9MA 3NDEA 1BSGA 2B5RA 3GRJA 3O88A 4IVIA 4K0WA 4KQRA 4GD8A 1PWDA 1I5QA 1L0DA 4N92A 2EX2A 1GA0A 3O87A 4OOLA 3OCNA 1G68A 1DJAA 3ZHHA 1BLPA 4F94A 5EPHA 4L0LA 4R0QA 4E3IA 3IXBA 1M40A 3FV7A 3HLCA 3FZCA 3E2KA 3W8KA 5AQ9A 2XDMA 2QZ6A 3GR2A 2OV5A 5D3OA 1M6KA 1LHYA 2XK1A 3MZEA 4E3MA 3A3DA 4JXWA 4N1HA 3BM6A 5IHVA 2J8YA 3N7WA 3TG9A 3HLEA 2J9PA 4HESA 3ZG0A 4ZAMA 4MEZA 2HPBA 3C4PA 3Q7ZA 3HREA 3DW0A 2FFFB 4OP8A 3G32A 1HTZA 4IBRA 2WYXA 4UA9A 2EX8A 4S2IA 1KVMA 3IHBA 4KQOA 2Y2OA 3ZCZA 3IXGA 1K25A 1RCJA 2EX9A 3PBNA 2UWXA 3VP2A 4E3KA 4Y0TA 4S2LA 2EX6A 3Q81A 4WYYA 5FQKA 3UDIA 2R9WA 3MXSA 4X69A 5EVLA 5A91A 2FFYA 2HDRA 4WEJA 5FAQA 3W4QA 1BLHA 2ZQCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GV9 A;  5GLA A;  1NZU A;  5FAS A;  1E4D A;  1W7F A;  5DVA A;  4E3O A;  1EWZ A;  1GHI A;  4FCF A;  1BTL A;  3QNC A;  4KEN B;  1KVL A;  4EBP A;  3NBL A;  1C3B A;  4QY6 A;  4Y0O A;  3A3F A;  3RXW A;  4OPR A;  3VFH A;  1PIO A;  5JYP A;  1K57 C;  1SHV A;  1RP5 A;  4KZ4 A;  5HAR A;  3NIA A;  4KZ8 A;  4LV1 A;  3C5A A;  5CHJ A;  5GLC A;  1H5X A;  1KGG A;  5FI7 A;  4QB8 A;  3VSK A;  3DWK A;  5M1A A;  4KG2 A;  4S2P A;  3WRZ A;  4MBH A;  2XR0 A;  1FCO A;  3I7J A;  5G18 A;  2IWB A;  3SS4 A;  3WRT A;  4ID4 A;  3VSL A;  3G34 A;  5CGW A;  2V1Z A;  1J9M A;  3FWL A;  1SDE A;  3GQZ A;  5DTK A;  1BUL A;  3AGD A;  2H0T A;  4X68 A;  2QMI A;  1QMF A;  4XUX A;  5FQ9 A;  4Y7P A;  3G2Z A;  1FOF A;  5HAI A;  1PW1 A;  3HUM A;  3A3I A;  3HLW A;  5CED A;  1NY0 A;  2XFS A;  4FH2 A;  1FQG A;  2ZMA A;  4B4X A;  3FKW A;  4KZA A;  1QME A;  4IVK A;  4RX3 A;  4M3K A;  2XD1 A;  3V39 A;  2ZQ8 A;  3IF6 A;  1ES4 A;  1LL9 A;  1SCW A;  5EUA A;  4H8R A;  4OOY A;  1K38 A;  1DY6 A;  3HUO A;  5CEC A;  5J8X A;  5GL9 A;  3IWO A;  3W4P A;  1IYQ A;  3ITA A;  3Q07 A;  1K54 A;  2GDN A;  4WBG A;  2IWC A;  1IEM A;  1CEF A;  3WS0 A;  4QD4 A;  1W79 A;  3OPL A;  2WAE A;  4S2N A;  1ALQ A;  1BUE A;  4KG5 A;  1K6R A;  4E3L A;  1K55 C;  1L2S A;  3IF6 B;  1LL5 A;  2XQZ A;  4R3B A;  3G30 A;  5DTT A;  3PBS A;  3HLG A;  2ZQD A;  4FSF A;  4DE0 A;  4EV4 A;  3VFF A;  3WS4 A;  1XA1 A;  5CEB A;  4OVD A;  1FR6 A;  3BFG A;  1PYY A;  4P85 A;  3MBZ A;  1AXB A;  2XLN A;  3PBQ A;  4S2K A;  3E2L A;  1MWR A;  3UDX A;  4EBL A;  3UDF A;  3IT9 A;  4FH4 A;  3TSG A;  1SKF A;  5CGS A;  4R3J A;  4BLM A;  2G2W A;  4GKU A;  4OPY A;  1ZG6 A;  4WZ4 A;  5FA7 A;  3MZF A;  3NC8 A;  5F1F A;  4XXR A;  2A3U A;  3ZNY A;  2Y91 A;  3DWZ A;  3NI9 A;  3BYD A;  1VQQ A;  4PM9 A;  5CTM A;  1KGF A;  5FQM A;  4K91 A;  5FQQ A;  5A93 A;  1O7E A;  1Q2Q A;  2ZQ9 A;  4PMA A;  4EBN A;  4EQI A;  1XKZ A;  5HAQ A;  1YMS A;  2RCX A;  4R4S A;  1K56 D;  2E8I A;  1YLP A;  4PM6 A;  3UPN A;  4IBX A;  3N4I A;  1TVF A;  2G2U A;  3UE0 A;  4X53 A;  5KSC A;  1WE4 A;  2XH9 A;  2WKI A;  3OCL A;  1IYP A;  4LCM A;  4JKT A;  1IKG A;  4HEF A;  3BFD A;  4X6T A;  1MXO A;  1YLT A;  1W8Y A;  4RX2 A;  4LEN A;  1TDL A;  3G4P A;  3S1Y A;  5GLD A;  2JBF A;  4MBK A;  2OSU A;  2I72 A;  2QPN A;  3V3S A;  1FR1 A;  5KZH A;  5E43 A;  1JVJ A;  2Y2H A;  1BT5 A;  5DF9 A;  1EI5 A;  5HFO A;  1H8Z A;  1PWG A;  1YQS A;  3ITB A;  5E2E A;  5GHY A;  3UNW A;  2WZZ A;  1K57 A;  2X02 A;  3UPO A;  1KE4 A;  3BFC A;  1JWP A;  1NJ4 A;  4WMC D;  1NYY A;  3BFE A;  3VMA A;  2H10 A;  3LEZ A;  1K4F A;  4IED A;  5EE8 A;  4ZJ1 A;  4JPM A;  3VP1 A;  3NDG A;  3S4X A;  4JF4 A;  3WS1 A;  1Z6F A;  4LV0 A;  3PBO A;  4OQ0 A;  5CXW A;  2CC1 A;  3MZD A;  1GHM A;  4QU3 A;  1JWZ A;  2HDQ A;  3P98 A;  1G6A A;  3BLM A;  4OKP A;  5E2H A;  1KDW A;  2EXB A;  1ESI A;  4RA7 A;  3UN7 A;  3M2K A;  4B88 A;  5AQA A;  2HP5 A;  4MBF A;  4GB7 A;  1ONH A;  2EFX A;  1O07 A;  4XUZ A;  2ZQA A;  3IH9 A;  5FQI A;  2P9V B;  1IKI A;  1XGJ A;  2ZC5 B;  4KZ7 A;  5A90 A;  5EEC A;  1I2W A;  5HL1 A;  2J7V A;  4DE1 A;  1L0F A;  1FSW A;  3PBT A;  1ERQ A;  4DXB A;  3ZNT A;  4S2M A;  3CMZ A;  2IWD A;  2Y2N A;  1CK3 A;  5KSH A;  3VP0 A;  3RJU A;  2R9X A;  4MNR A;  3HVF A;  1K55 A;  2C6W B;  1XPB A;  3BLS A;  1L0G A;  4OH0 A;  1NZO A;  2Y2I A;  4KZ9 A;  3N6I A;  3ZG8 B;  2H0Y A;  4PM8 A;  4U0T A;  2V2F F;  3TOI A;  4DE3 A;  5EVI D;  1ERO A;  1GCE A;  5FAP A;  1MWU A;  3G2Y A;  1NXY A;  2C5W B;  1E3U A;  5L2F A;  4N9K A;  1HZO A;  2Y2K A;  2Z2M B;  3BEB A;  1WYC A;  3UE3 A;  3HBR A;  4Y0U A;  3OPH A;  3SS5 A;  1N9B A;  3A3E A;  2WKH A;  4B4Z A;  5U47 A;  4RVA A;  1K4E A;  3HLB A;  3M6B A;  3SH7 A;  1KE3 A;  2Y2G A;  3CJM A;  4OLG A;  1YLY A;  2Y55 A;  2P74 A;  4LV3 A;  2WGW B;  2Y2Q A;  3ZG5 A;  5KMW A;  4MLL A;  5CHU A;  4KZ6 A;  1XX2 A;  1YMX A;  1XGI A;  3V5M A;  1TEM A;  3D4F A;  5I94 A;  1S6R A;  3WS2 A;  1PI4 A;  3QNB A;  4U3T A;  4BJP A;  4D2O A;  1ES3 A;  3MXR A;  1MWT A;  5EVI C;  2ZJ9 A;  5GHZ A;  1JWV A;  1CI9 A;  2WZX A;  3C4O A;  1TDG A;  1KE0 A;  4JBF A;  4OQG A;  5F1G A;  5HX9 A;  4ZJ2 A;  4DXC A;  5DF8 A;  2EXA A;  3OZH A;  3IWI A;  4KQQ A;  4P0M A;  4RYE A;  3IWQ A;  4OON A;  4X56 A;  1H8Y A;  5DTS A;  5FI2 A;  3G35 A;  4KZ5 A;  3ZDJ A;  4HBU A;  3IHA A;  4YFM A;  1FCM A;  1XA7 A;  2ZD8 A;  1PWC A;  1YLZ A;  3GTC A;  4WEL A;  3HUN A;  1MBL A;  4E6X A;  3AGF A;  4E6W A;  1LI0 A;  1K6S A;  1JTG A;  4DE2 A;  1SDN A;  4KG6 A;  3B3X A;  4OOM A;  2Z2L B;  2HP9 A;  3OPP A;  5AQB A;  1LI9 A;  2ZM8 A;  3MKE A;  3LY3 A;  4GOG A;  5HW3 A;  5M18 A;  4JXS A;  3G31 A;  1IYO A;  4Z9Q A;  4BD1 A;  3A3J A;  3ZVT A;  4OLD A;  4DF6 A;  3O3V A;  3BFF A;  1ES2 A;  3CG5 A;  4NK3 A;  3PTE A;  1S0W A;  2DCF A;  4O7D A;  1N4O A;  5CTN A;  3HLD A;  5AQ7 A;  1KDS A;  3ISG A;  5HAP A;  4DDS A;  1DJC A;  4GN2 A;  1PW8 A;  1W5D A;  3ZFZ A;  3N8S A;  3NCK A;  2HDS A;  4UA6 A;  3PAG A;  4PPR A;  5CHM A;  4BQM A;  1HVB A;  2WGV A;  2Y2P A;  2JCH A;  2A49 A;  2VGK A;  4QJG A;  2X01 A;  4WM9 A;  2XGN A;  4LV2 A;  4OP5 A;  1YLW A;  4BL2 A;  4KZB A;  3NY4 A;  4WZ5 C;  5DF7 A;  2V20 A;  2ZM0 A;  3M6H A;  4ZTK A;  1MKI A;  4A5R A;  1GHP A;  4PM5 A;  1RGZ A;  4C75 A;  3W4O A;  3V50 A;  4BD0 A;  1BLC A;  5JYO A;  2ZQ7 A;  3O86 A;  5EOO A;  4WMC A;  2OLV A;  2PU2 A;  3WWX A;  5TR7 A;  3N8R A;  4ZDX A;  1BLS A;  1GA9 A;  3CZD A;  1WYB A;  3HLF A;  1Y54 A;  2WKE A;  3Q82 A;  3GSG A;  4N1X A;  1MPL A;  4OPZ A;  2P9V A;  3GVB A;  4GD6 A;  1LLB A;  3ZVW A;  4KZ3 A;  3UY6 A;  3IXD A;  4QY5 A;  5FAT A;  1RGY A;  5BOH A;  1PZO A;  3PAE A;  5EOE A;  3LY4 A;  1ESU A;  3MKF A;  4P6B A;  3C7V A;  3QHY A;  3JYI A;  4UHU A;  3SOI A;  3ZGA B;  3AGE A;  4N9L A;  5F83 A;  4E3N A;  4E3J A;  1ZG4 A;  3HL9 A;  2OLU A;  1CI8 A;  4GNU A;  3UO9 A;  3LCE A;  4ZBE A;  1NYM A;  5CRF A;  3FYZ A;  4QHC A;  2JC7 A;  5CGX A;  3ZG7 B;  4OQI A;  2J9O A;  3Q7V A;  5FI6 A;  1Q2P A;  2ZC7 A;  4C6Y A;  2HP6 A;  2ZM2 A;  4JF6 A;  1MY8 A;  2ZLY A;  3VOZ A;  4CJN A;  1XXM A;  2ZC3 B;  2BG1 A;  2ZC6 B;  3VOY A;  1IEL A;  3ZG9 B;  4GZB A;  2WUQ A;  4K0X A;  4P87 A;  2XFT A;  4UAA A;  2XF3 A;  2Y2J A;  5TFQ A;  4UA7 A;  3SH9 A;  1U60 A;  4OPQ A;  3P09 A;  2ZC4 B;  3FKV A;  3OC2 A;  2WK0 A;  3Q7V B;  4JLF A;  3IXH A;  4DRT A;  4S2O A;  2WGW A;  1BZA A;  3PBR A;  1FCN A;  5FAO A;  1E25 A;  2Y2M A;  3WS5 A;  4R4R A;  5FQJ A;  5EVI A;  4JXG A;  2BLS A;  4ZJ3 A;  5TGF A;  3SS3 A;  4U0X A;  2JE5 A;  4WEK A;  5A92 A;  1L0E A;  1ZKJ A;  4EWF A;  3OPR A;  4X55 A;  4JF5 A;  3IF5 A;  5M19 A;  1OME A;  1ERM A;  4JXV A;  4GDB A;  2HDU A;  3V3R A;  2WGI A;  5CER A;  5E2G A;  3VP4 A;  1ONG A;  3VP3 A;  2H5S A;  3LO7 A;  2XD5 A;  2DRW A;  3EQU A;  3SH8 A;  3BRM A;  1I2S A;  3UPP A;  1YM1 A;  5GLB A;  4BL3 A;  3MFD A;  1E3U D;  5EVI B;  1W8Q A;  2Y2L A;  4YIN A;  1YT4 A;  5GHX A;  2Q9N A;  2PBY A;  1ZC2 A;  2DNS A;  1DJB A;  4DKI A;  5FDH A;  4Q8I A;  1YLJ A;  4R1G A;  4GDN A;  1KGE A;  2RL3 A;  3S22 A;  2WAD A;  2Y4A A;  3N8L A;  2XEP A;  4R23 A;  2WAF A;  4EUZ A;  3M2J A;  3BEC A;  5FSR A;  3GMW A;  3UE1 A;  2PU4 A;  1FSY A;  1PZP A;  4PM7 A;  4OQH A;  2EFU A;  4CPK A;  1VM1 A;  1HD8 A;  4FD8 A;  4C3Q A;  3RXX A;  3IF6 C;  2VGJ A;  1CEG A;  3Q1F A;  3IH8 A;  4LCL A;  3IQA A;  4BEN A;  5F82 A;  1MWS A;  4S2J A;  1K54 C;  3C7U A;  1IYS A;  4NET A;  4S2N C;  1XP4 A;  1PI5 A;  3DTM A;  2X71 A;  1K56 A;  4HBT A;  1NRF A;  2Y59 A;  4WZ5 A;  3EQV A;  1JTD A;  5E2F A;  4DDY A;  1ES5 A;  2Q9M A;  3NDE A;  1BSG A;  2B5R A;  3GRJ A;  3O88 A;  4IVI A;  4K0W A;  4KQR A;  4GD8 A;  1PWD A;  1I5Q A;  1L0D A;  4N92 A;  2EX2 A;  1GA0 A;  3O87 A;  4OOL A;  3OCN A;  1G68 A;  1DJA A;  3ZHH A;  1BLP A;  4F94 A;  5EPH A;  4L0L A;  4R0Q A;  4E3I A;  3IXB A;  1M40 A;  3FV7 A;  3HLC A;  3FZC A;  3E2K A;  3W8K A;  5AQ9 A;  2XDM A;  2QZ6 A;  3GR2 A;  2OV5 A;  5D3O A;  1M6K A;  1LHY A;  2XK1 A;  3MZE A;  4E3M A;  3A3D A;  4JXW A;  4N1H A;  3BM6 A;  5IHV A;  2J8Y A;  3N7W A;  3TG9 A;  3HLE A;  2J9P A;  4HES A;  3ZG0 A;  4ZAM A;  4MEZ A;  2HPB A;  3C4P A;  3Q7Z A;  3HRE A;  3DW0 A;  2FFF B;  4OP8 A;  3G32 A;  1HTZ A;  4IBR A;  2WYX A;  4UA9 A;  2EX8 A;  4S2I A;  1KVM A;  3IHB A;  4KQO A;  2Y2O A;  3ZCZ A;  3IXG A;  1K25 A;  1RCJ A;  2EX9 A;  3PBN A;  2UWX A;  3VP2 A;  4E3K A;  4Y0T A;  4S2L A;  2EX6 A;  3Q81 A;  4WYY A;  5FQK A;  3UDI A;  2R9W A;  3MXS A;  4X69 A;  5EVL A;  5A91 A;  2FFY A;  2HDR A;  4WEJ A;  5FAQ A;  3W4Q A;  1BLH A;  2ZQC A; 
#chains in the Genus database with same CATH topology
 1W7F A;  3BQ8 A;  4FCF A;  1KVL A;  3NBL A;  2J3T C;  4QY6 A;  4Y0O A;  4CQH A;  4PAU A;  3NIA A;  3KSI A;  4LV1 A;  1GSW A;  3EWK A;  5GLC A;  1H5X A;  1S67 L;  3DWK A;  3I7J A;  2IWB A;  3SS4 A;  3VSL A;  2V1Z A;  5DTK A;  1T19 A;  1BUL A;  2QWS A;  2PR5 A;  1QMF A;  3DTK A;  3G2Z A;  3A3I A;  1NY0 A;  4D60 A;  2ZMA A;  4KZA A;  1QME A;  4IVK A;  4LRZ E;  3V39 A;  4HH2 A;  1BYW A;  4ZRR A;  2BTF P;  3IF6 A;  1ES4 A;  5EUA A;  5CEC A;  4H6J A;  2IWC A;  4RQ9 A;  1W79 A;  2WAE A;  1ALQ A;  1BUE A;  4KG5 A;  1K6R A;  4E3L A;  5DTT A;  1MZU A;  1OTI A;  1XA1 A;  1OPX A;  5HL6 A;  3PBQ A;  3UDX A;  4FH4 A;  2O0Y A;  2V1A A;  2G2W A;  4GKU A;  3F1P B;  3NC8 A;  3T1S A;  2A3U A;  3LGO A;  5A93 A;  1VQQ A;  5FQM A;  4HIA A;  1O7E A;  4EBN A;  4LFU A;  4F3L B;  4CLC B;  4PM6 A;  4IBX A;  3OOV A;  4X53 A;  2WKI A;  3T4J A;  4LCM A;  1YLT A;  4RX2 A;  4GCZ A;  3H82 A;  1N9N A;  2QPN A;  2I72 A;  3V3S A;  5KZH A;  3P01 A;  1EI5 A;  3O5Y A;  5E2E A;  3UNW A;  2WZZ A;  1K57 A;  3UPO A;  4WMC D;  4ME4 A;  3BFE A;  4IED A;  3C2W A;  3NDG A;  3WS1 A;  3PBO A;  4OQ0 A;  1XJ4 A;  5CXW A;  3VE4 A;  3P98 A;  5DKK A;  1OTA A;  4WN5 A;  4OKP A;  4RA7 A;  3UN7 A;  5MC7 A;  4B9O A;  4B88 A;  4GB7 A;  4ETX A;  1ONH A;  4MN5 A;  2Y79 A;  3IH9 A;  2ZC5 B;  3E0Y A;  4BBT A;  5K5B A;  5EEC A;  3LUQ A;  4DE1 A;  5G4Y A;  3T1R A;  3PBT A;  4HP9 A;  5TBM B;  4DXB A;  2ZMF A;  2Y2N A;  1K55 A;  2C6W B;  3BLS A;  4OH0 A;  3QP4 A;  4PM8 A;  4X25 A;  4PKY A;  2V2F F;  3LR4 A;  3TOI A;  1T18 A;  1E3U A;  1HZO A;  1WYC A;  3UE3 A;  3OPH A;  3H7W A;  3T4K A;  2Y2G A;  1UGU A;  3CJM A;  1MKM A;  4DMZ A;  1K0K A;  3WS2 A;  3IX8 A;  3BY9 A;  5EVI C;  2ZJ9 A;  2MJ6 A;  3CPT B;  1CI9 A;  2W3E A;  1CQA A;  2WZX A;  3C4O A;  3KSG A;  5HX9 A;  4DXC A;  4KQQ A;  4P0M A;  4X56 A;  3GTC A;  4WEL A;  4MCW A;  3HUN A;  3AGF A;  2IA2 A;  1MC0 A;  3BWL A;  2P08 A;  1SDN A;  3MS6 A;  3KYZ A;  3OPP A;  2O9C A;  1LI9 A;  2ZM8 A;  3MKE A;  4JXS A;  3G31 A;  4EER A;  3ZVT A;  2JKG A;  1SKO A;  1DP9 A;  3O3V A;  1ES2 A;  3IS2 A;  2DMW A;  2W1T A;  4GW9 A;  3CG5 A;  4O7D A;  5AQ7 A;  1KDS A;  3EOI A;  1GSX A;  1DJC A;  1DRM A;  1W5D A;  2PT7 A;  3NCK A;  2HDS A;  4PPR A;  1N9L A;  1HVB A;  4KQD A;  2WGV A;  2VGK A;  1H8M A;  2X01 A;  4GHI A;  2V20 A;  4A5R A;  1GHP A;  3F1O A;  3NOT C;  3E4Q A;  4Y17 A;  5JYO A;  2G7U A;  2OLV A;  5TR7 A;  4ZDX A;  1GA9 A;  3CZD A;  3HLF A;  3BY8 A;  1TS0 A;  2V8F A;  3LID A;  4OPZ A;  3PHY A;  5HD3 A;  4KZ3 A;  5FAT A;  5EOE A;  1ESU A;  3JYI A;  3CAX A;  3ZGA B;  3AGE A;  3UME A;  4N9L A;  5F83 A;  4E3N A;  3HL9 A;  1CI8 A;  1NYM A;  5CRF A;  3VE3 A;  2W27 A;  4EES A;  2ZC7 A;  2HP6 A;  1MY8 A;  3B47 A;  2HGV A;  4Y3I A;  4AFI A;  4UAA A;  5TFQ A;  3NOP C;  3OBF A;  1U60 A;  2ZC4 B;  2VV7 A;  4DRT A;  2Y2M A;  1ODV A;  3SS3 A;  3OPR A;  5M19 A;  1OME A;  1ERM A;  2WKQ A;  5CER A;  5E2G A;  3VP4 A;  1ONG A;  3LO7 A;  3UE6 A;  3SH8 A;  2QHK A;  3UPP A;  1YM1 A;  3K3D A;  4BL3 A;  1AWI A;  3MFD A;  4YIN A;  5C5K A;  2PBY A;  1SZV A;  5FDH A;  4Q8I A;  1YLJ A;  4R1G A;  3FPV A;  3S22 A;  2WAD A;  3R7W B;  4R23 A;  2WAF A;  1FSY A;  2H28 A;  4G3K A;  1HD8 A;  5HWW A;  3KX0 X;  2VGJ A;  1CEG A;  3IH8 A;  4HI4 A;  4IHQ A;  2X71 A;  4BBU A;  4WZ5 A;  5AVE A;  1JTD A;  1ZHH B;  4JGP A;  1L0D A;  1XFN A;  3LYX A;  3ZHH A;  1BLP A;  4XT2 A;  3IXB A;  3FV7 A;  3BW6 A;  2XDM A;  2Y8H A;  1LHY A;  2XK1 A;  2QJ7 A;  2M7V A;  2D02 A;  3EGX C;  3HLE A;  4ZAM A;  2PAV P;  3Q7Z A;  3HRE A;  2OOL A;  3CIT A;  3B42 A;  4IBR A;  3UB8 A;  2EX8 A;  4KQO A;  3ZCZ A;  1RCJ A;  4Y0T A;  4WYY A;  2R9W A;  4X69 A;  3CWF A;  4EWF A;  4WEJ A;  3LR5 A;  2ZQC A;  3GV9 A;  5GLA A;  5FAS A;  5DVA A;  4IUK A;  4E3O A;  1EWZ A;  1BTL A;  1C3B A;  2W3G A;  4HNB A;  3A3F A;  3RXW A;  2W3H A;  4DJ2 A;  1YSP A;  4O01 A;  1FIL A;  2VKS A;  1NRJ A;  5FI7 A;  3VSK A;  1OTE A;  3WRZ A;  3T4L A;  5DFY A;  3WRT A;  4ID4 A;  2JKT M;  3G34 A;  5CGW A;  4UEY A;  1SDE A;  3GQZ A;  3AGD A;  4X68 A;  5FQ9 A;  2QMI A;  4XUX A;  4ARZ A;  4Y7P A;  4KUO A;  5HAI A;  5CED A;  2XFS A;  1FQG A;  4B4X A;  1D1J A;  1P9R A;  2JKT I;  2XD1 A;  2ZQ8 A;  3F1N B;  3QP5 A;  1D7E A;  3K2N A;  5J8X A;  2I9V A;  3HUO A;  4R38 A;  5GL9 A;  5CX7 A;  3ITA A;  5F69 A;  3D72 A;  1CEF A;  3OPL A;  1L3L A;  4S2N A;  2V0U A;  3HLG A;  2J80 A;  4LGW A;  2VX8 A;  3H7W B;  4P85 A;  3MBZ A;  3MFX A;  2XLN A;  3E2L A;  1MWR A;  4BLM A;  2VGL S;  3BJN A;  3ZNY A;  3BYD A;  1KGF A;  1YSQ A;  4HQA A;  1Q2Q A;  4EQI A;  1V9Z A;  1XKZ A;  1YMS A;  2XSS A;  1K56 D;  2E8I A;  4E04 A;  3B33 A;  3UE0 A;  5KSC A;  3OCL A;  3LFV A;  5LBR A;  4X6T A;  1W8Y A;  1TDL A;  3S1Y A;  3CUE C;  2J3W A;  1FR1 A;  4I39 A;  2ZL1 A;  4NKP A;  5DF9 A;  1PWG A;  4FUW A;  4HOI A;  3VOL A;  4HY8 A;  5GHY A;  2W1T B;  3DAV A;  4R70 A;  5IU1 A;  1JWP A;  3QP2 A;  1NYY A;  1NLZ A;  3LEZ A;  4ZJ1 A;  3D9Y A;  1XJ3 A;  4JF4 A;  3S4X A;  4LV0 A;  5I5L A;  2CC1 A;  3MZD A;  1P97 A;  4QU3 A;  1F98 A;  4Y2F A;  2PR6 A;  2HDQ A;  1G6A A;  2GX5 A;  1F2K A;  2A24 A;  3OLO A;  2VGL M;  4MBF A;  5FQI A;  1I2W A;  5HL1 A;  2PD8 A;  4YWZ A;  4EXO A;  4S2M A;  2IWD A;  5KSH A;  3FC7 A;  1VET A;  1L0G A;  2JHE A;  1NZO A;  3N6I A;  1T1C A;  3CHW P;  4DE3 A;  5HZH A;  1GCE A;  1MWU A;  3BEB A;  2ACG A;  1X0O A;  2OAQ 1;  3SS5 A;  2WKH A;  4B4Z A;  3HLB A;  3M6B A;  4OLG A;  3MQO A;  4LV3 A;  4JGR A;  1VEU B;  1YMX A;  1TEM A;  1S6R A;  5DJT A;  3QNB A;  4BWI A;  3LR0 A;  3V67 A;  5GHZ A;  4FTX A;  3EEH A;  2O9B A;  3FPW A;  2EXA A;  3IWI A;  4RYE A;  3T1X A;  4B93 A;  5DTS A;  5FI2 A;  4KZ5 A;  4HBU A;  3IHA A;  1XA7 A;  2ZD8 A;  3MR0 A;  1P0Z A;  1OJG A;  2HV1 A;  4DE2 A;  4I5S A;  5HDD A;  4KG6 A;  3HJK A;  3LY3 A;  5HW3 A;  4NXE A;  2FH5 A;  3T50 A;  4OLD A;  3BFF A;  4NK3 A;  2DCF A;  5CTN A;  3HLD A;  1PW8 A;  4EQ1 A;  4UA6 A;  5CHM A;  3RFB A;  2Y2P A;  2A49 A;  4QJG A;  1FIK A;  4WM9 A;  4OP5 A;  3U2A A;  1YLW A;  3NHQ A;  2ZMV A;  5DF7 A;  1HLU P;  4ZTK A;  1NWZ A;  5AJG A;  3C38 A;  2ZQ7 A;  2BAS A;  1ZTU A;  2PU2 A;  5EFW A;  3WWX A;  2Q0O A;  4XT2 B;  3TW8 A;  4EU0 A;  3Q82 A;  4EUV A;  4N1X A;  3GVB A;  3ZVW A;  4QY5 A;  3VV4 A;  5J3W A;  2R78 A;  4DJ3 A;  3SOI A;  3T4Q A;  4Y15 A;  2OLU A;  3LCE A;  4QHC A;  4OQI A;  3E4P A;  3GEC A;  2ZLY A;  4CJN A;  2ZC3 B;  1IEL A;  4P87 A;  4EW7 A;  4OPQ A;  2WK0 A;  3Q7V B;  4S2O A;  1JNU A;  1BZA A;  3PBR A;  2K31 A;  5FAO A;  1E25 A;  2KLI A;  5EVI A;  2BLS A;  4ZJ3 A;  3IF5 A;  3HJI A;  4Q0J A;  3VP3 A;  2HJ9 C;  2PYP A;  3KYQ A;  1LSW A;  2YKH A;  3BRM A;  5HWV A;  5GLB A;  1W8Q A;  2Y2L A;  5GHX A;  2Q9N A;  1ZC2 A;  2DNS A;  4DKI A;  2W3D A;  1KGE A;  2Y4A A;  4EUZ A;  2V0W A;  3GMW A;  2PU4 A;  1PZP A;  4OQH A;  2EFU A;  3RXX A;  2PBD P;  4IUH A;  4LCL A;  1MWS A;  1K54 C;  3KSF A;  1IYS A;  3C30 A;  1J3W A;  3DTM A;  4GJ4 A;  1K56 A;  4M4X A;  4WUJ A;  2Q9M A;  5TJJ A;  1PRQ A;  3LIE A;  1S4S A;  4GD8 A;  2EX2 A;  4OOL A;  3OCN A;  1G68 A;  1DJA A;  4HJ6 A;  3W8K A;  3GR2 A;  2OV5 A;  1M6K A;  3A3D A;  4JXW A;  3BM6 A;  4YOF A;  3N7W A;  1Y28 A;  4HES A;  2J3T D;  2FFF B;  4OP8 A;  4I3J A;  4UA9 A;  3IHB A;  1K25 A;  3MMH A;  2EX6 A;  5FQK A;  3UDI A;  5EVL A;  5A91 A;  4L9F A;  5FAQ A;  1BLH A;  1NZU A;  1E4D A;  3LIB A;  1YKD A;  2QKP A;  4EBP A;  3VFH A;  1XJ2 A;  1PIO A;  5A8B A;  1RP5 A;  3HCY A;  2KX6 A;  3SZT A;  2O99 A;  3C5A A;  5CHJ A;  1KGG A;  4QB8 A;  1FCO A;  5G18 A;  1YPR A;  3H9W A;  2A24 B;  1FOF A;  1PW1 A;  3HUM A;  3HLW A;  4O0P A;  1T1B A;  4FH2 A;  3FKW A;  4M3K A;  1F5M A;  2INW A;  1LL9 A;  1SCW A;  4H8R A;  1DY6 A;  3IWO A;  3E98 A;  1A0K A;  3WS0 A;  1TS7 A;  3LI8 A;  2ZOI A;  3MQQ A;  1L2S A;  3IF6 B;  1LL5 A;  2XQZ A;  4R3B A;  1PFL A;  4H6J B;  4EV4 A;  2V9A A;  3VFF A;  3S7O A;  5CEB A;  3UB6 A;  1FR6 A;  3DTE A;  3BFG A;  1PYY A;  1AXB A;  3CLO A;  3MQ0 A;  3UDF A;  3IT9 A;  3TSG A;  4K08 A;  3RH8 B;  4F3L A;  2OWJ A;  4OPY A;  4X1L A;  3MZF A;  2Y91 A;  5CTM A;  5FQQ A;  3EEA A;  3T12 B;  4PMA A;  4EET B;  3IBJ A;  3L7H A;  5HWT A;  4R4S A;  3LIA A;  2G2U A;  3QP6 A;  4CLC C;  1IYP A;  2QYB A;  4HJ4 A;  1IKG A;  4HEF A;  3BFD A;  1OTB A;  1MXO A;  4LEN A;  3G4P A;  4MBK A;  4PKY G;  2OSU A;  2Z6C A;  1JVJ A;  2Y2H A;  4HH3 A;  1H8Z A;  1YQS A;  4WLA A;  1OT6 A;  3H82 B;  3VMA A;  2H10 A;  5EE8 A;  4JPM A;  3GDI A;  3VP1 A;  1Z6F A;  5F6A A;  1GHM A;  3KSH A;  1KDW A;  5TBM A;  3M2K A;  2HP5 A;  2OWH A;  2PYR A;  3T1Q B;  2EFX A;  2ZQA A;  1XGJ A;  1UWN X;  5HSQ A;  1FSW A;  1ERQ A;  3ZNT A;  3CMZ A;  2Y2I A;  4KZ9 A;  2H0Y A;  5HPI A;  2O9A A;  3UB5 P;  5EVI D;  4GS9 A;  5FAP A;  1NXY A;  5L2F A;  4N9K A;  2Y2K A;  4Y0U A;  2UV0 E;  4G3W A;  1N9B A;  2JKF A;  3A3E A;  5U47 A;  4RVA A;  1K4E A;  3CPT A;  4HP4 A;  3SH7 A;  1KE3 A;  1YLY A;  2P74 A;  5CHU A;  4KZ6 A;  5AVF A;  3V5M A;  3D4F A;  1PI4 A;  4U3T A;  4BJP A;  4D2O A;  3MXR A;  1MWT A;  4R6L A;  1NLY A;  3OZH A;  1OJ5 A;  3KYE A;  4KUK A;  4OON A;  1H8Y A;  3G35 A;  4YFM A;  1FCM A;  1PWC A;  1YLZ A;  3RTY A;  3UB9 A;  3CUE A;  4E6W A;  1LI0 A;  3UMD A;  3B3X A;  2Z2L B;  1GSV A;  5AQB A;  2W1R A;  4QPR A;  4GOG A;  1IYO A;  4Z9Q A;  4BD1 A;  3A3J A;  4DF6 A;  3C8C A;  1S0W A;  1N4O A;  2KOI A;  3A0R A;  2VA0 A;  3ISG A;  5HAP A;  4DDS A;  1S1Z A;  3ICY A;  2B02 A;  3PAG A;  4BQM A;  2OAP 1;  2JCH A;  1SKO B;  3IS2 B;  2XGN A;  1S66 L;  4LV2 A;  4BL2 A;  3KO6 A;  3S7N A;  1VHM A;  2ZM0 A;  3M6H A;  1MKI A;  4JGO A;  4PM5 A;  1CJF A;  3IX4 A;  3V50 A;  1BLC A;  5EOO A;  3N8R A;  2XA7 S;  3IX3 A;  1WYB A;  4GHI B;  2L1M A;  3R4K A;  3GSG A;  2EWV A;  5L09 A;  2P9V A;  4IJG A;  4GD6 A;  1LLB A;  3F1O B;  4BMW A;  3UY6 A;  1Z09 A;  1RGY A;  1PZO A;  3LY4 A;  4NG2 A;  3LIF A;  3MKF A;  4P6B A;  3C7V A;  3QHY A;  2B95 A;  2HJE A;  1EW0 A;  1ZG4 A;  4ZBE A;  3FYZ A;  5CGX A;  2JC7 A;  3ZG7 B;  4FOF A;  2J9O A;  5FI6 A;  2P7J A;  3FG8 A;  5HD5 A;  3VOZ A;  4I3A A;  2BG1 A;  2ZC6 B;  4GZB A;  4K0X A;  2GJ3 A;  3U4L P;  3L9K A;  2HZ5 A;  4UA7 A;  3SH9 A;  3P09 A;  3FKV A;  3OC2 A;  4JLF A;  1OT9 A;  3IXH A;  2WGW A;  3WS5 A;  4R4R A;  5FQJ A;  4WF0 A;  5TGF A;  4U0X A;  4WEK A;  1ZKJ A;  4JF5 A;  4LRX C;  2WGI A;  2GZA A;  3V3R A;  3R7W A;  1DP6 A;  2VJW A;  4X1M A;  4Q0H A;  4MMN A;  2XA7 M;  4LLO B;  2V8C A;  5L07 A;  4GDN A;  2RL3 A;  5FL3 A;  3LEQ A;  4HJ3 A;  4DN0 A;  4NXB A;  5EM0 A;  2EWW A;  2XRO A;  3IF6 C;  4MN7 A;  3P7N A;  3Q1F A;  3IQA A;  4BEN A;  2NUT C;  2D01 A;  2HF6 A;  5F82 A;  2VLG A;  4LPZ A;  3C7U A;  4NET A;  1W63 Q;  4CLC D;  3ULF A;  4Q0I A;  3NOU C;  4HBT A;  1NRF A;  2Y59 A;  4DDY A;  1ES5 A;  4G3V A;  2XRN A;  1STZ A;  2B5R A;  2JKR M;  3GRJ A;  4KQR A;  2JN7 A;  4CLC E;  1I5Q A;  3NJA A;  1LSV A;  4Z1W A;  3FZC A;  1ACF A;  2JKR I;  1S1Y A;  4R3A A;  3JVU A;  3S7Q A;  3PYP A;  5IHV A;  2J8Y A;  3TG9 A;  3ZG0 A;  4MEZ A;  1TS8 A;  3C4P A;  2M1C A;  3DW0 A;  1HTZ A;  2E8J A;  2WYX A;  2PD7 A;  5F68 A;  1KVM A;  3S7P A;  3VP2 A;  1TS6 A;  2FFY A;  1YAX A;  1LSX A;  4EEP A;  1GHI A;  4NEE D;  4KEN B;  3QNC A;  1F9I A;  4QWO A;  1P9W A;  4OPR A;  5JYP A;  4O8G A;  1K57 C;  1SHV A;  4KZ4 A;  1TF1 A;  5HAR A;  4KZ8 A;  3MF0 A;  3JPU A;  2VV8 A;  5L10 A;  5M1A A;  4KG2 A;  2PRF A;  4S2P A;  4MBH A;  2XR0 A;  4P6Z S;  1VB6 A;  3MJQ A;  2CMN A;  1J9M A;  3FWL A;  3DTI A;  3F1N A;  2H0T A;  3LR3 A;  3IBR A;  5KIZ A;  2L4R A;  4HHD A;  4RX3 A;  3EGD C;  2V1B A;  5J4E A;  4ARZ B;  4OOY A;  1K38 A;  3W4P A;  1IYQ A;  3Q07 A;  1K54 A;  2GDN A;  4WBG A;  1IEM A;  4QD4 A;  1UWP X;  1V9Y A;  1K55 C;  1XJ6 A;  4GS9 B;  3G30 A;  3PBS A;  2ZQD A;  4FSF A;  2M7U A;  3MXQ A;  4BBV A;  4DE0 A;  2KDK A;  4GLQ A;  5L8M A;  3WS4 A;  4OVD A;  4I3I A;  4S2K A;  3CI6 A;  4EBL A;  1SKF A;  5CGS A;  4R3J A;  5IS1 A;  1ZG6 A;  4WZ4 A;  5FA7 A;  3D3O A;  3G6O A;  5F1F A;  4XXR A;  3DWZ A;  1S4R A;  3NI9 A;  4PM9 A;  4K91 A;  2ZQ9 A;  3A0V A;  4P6Z M;  5HAQ A;  2RCX A;  1YLP A;  3UPN A;  3N4I A;  1TVF A;  2VZW A;  1WE4 A;  2XH9 A;  3TJZ C;  4JKT A;  2K2N A;  3W2Z A;  5GLD A;  2JBF A;  1OTD A;  3NEC A;  5E43 A;  1BT5 A;  4LRY C;  5HFO A;  3ITB A;  3ZQ5 A;  4II7 A;  3QP8 A;  5DJU A;  2EA9 A;  2X02 A;  1KE4 A;  3BFC A;  1NJ4 A;  1K4F A;  2ZL1 B;  4UQI S;  1PNE A;  3DBA A;  5IT5 A;  2ZBB A;  5EVE A;  1JWZ A;  3BLM A;  5E2H A;  2EXB A;  3TE8 A;  1ESI A;  2LB5 A;  5AQA A;  1TD5 A;  1O07 A;  4XUZ A;  1WA9 A;  2P9V B;  4PHT A;  4NXF A;  1IKI A;  4KZ7 A;  5A90 A;  2J7V A;  1L0F A;  5EV0 A;  5G4Z A;  2AVX A;  1CK3 A;  3VP0 A;  3RJU A;  2R9X A;  4MNR A;  3HVF A;  1XPB A;  2VEA A;  3ZG8 B;  1N9O A;  4U0T A;  3E4O A;  1ERO A;  3G2Y A;  1VEU A;  2C5W B;  3T4O A;  3SW1 A;  2Z2M B;  3HBR A;  2B18 A;  1VET B;  3TRC A;  2L0W A;  5DKL A;  4EEU A;  3ZYT A;  2Y55 A;  2WGW B;  2Y2Q A;  3ZG5 A;  5KMW A;  4MLL A;  1XX2 A;  1XGI A;  5I94 A;  3F1P A;  3UB7 A;  1ES3 A;  3T4T A;  1JWV A;  2NUP C;  5FEG A;  4UQI M;  4JBF A;  5F1G A;  1TDG A;  1KE0 A;  4OQG A;  4ZJ2 A;  5DF8 A;  2P04 A;  4CLC A;  3IWQ A;  2PDR A;  3ZDJ A;  2WKR A;  2LB9 A;  1MBL A;  4E6X A;  2VK3 A;  1K6S A;  1JTG A;  4MDZ A;  4OOM A;  2HP9 A;  1XFQ A;  1LT0 A;  3PXP A;  5M18 A;  5FEF A;  3PTE A;  2FZ0 A;  4YNR A;  4GN2 A;  3ZFZ A;  3N8S A;  4KZB A;  3NY4 A;  4WZ5 C;  1T1A A;  2W0N A;  1RGZ A;  4C75 A;  3W4O A;  4BD0 A;  3O86 A;  4WMC A;  4ESP A;  5HDC A;  1BLS A;  5EM1 A;  1Y54 A;  2WKE A;  2K7S A;  1MPL A;  4MN6 A;  5HPF A;  1CF0 A;  3QP1 A;  1G6O A;  3IXD A;  5BOH A;  5F5Y A;  3PAE A;  2YKF A;  4UHU A;  2A2L A;  3MSH A;  4E3J A;  3A0S A;  4GNU A;  3UO9 A;  3Q7V A;  1Q2P A;  4C6Y A;  2ZM2 A;  4JF6 A;  2ZOH A;  1D06 A;  1XXM A;  3VOY A;  3ZG9 B;  4NXG A;  1H3Q A;  2WUQ A;  2XFT A;  2XF3 A;  2Y2J A;  1H0M A;  1FCN A;  3K3C A;  4Y13 A;  4L9G A;  4WL9 A;  4JXG A;  4L9E A;  2JE5 A;  5A92 A;  1L0E A;  4X55 A;  4JXV A;  4GDB A;  2HDU A;  2H5S A;  2XD5 A;  2DRW A;  3EQU A;  3JVV A;  1I2S A;  3NUL A;  1KOU A;  2QJ5 A;  1E3U D;  5EVI B;  1IOU A;  2W3F A;  1YT4 A;  1DJB A;  3LI9 A;  3N8L A;  4JGQ A;  2XEP A;  3BQA A;  3M2J A;  3BEC A;  5FSR A;  2Z6D A;  3UE1 A;  5DFX A;  1W63 M;  4PM7 A;  5FDS A;  4CPK A;  1VM1 A;  4FD8 A;  4C3Q A;  1IFQ A;  3LIC A;  4S2J A;  4ETZ A;  4S2N C;  1XP4 A;  3PR6 A;  1PI5 A;  3EQV A;  4I38 A;  5E2F A;  1DP8 A;  3NDE A;  1BSG A;  1G28 A;  3O88 A;  4IVI A;  4K0W A;  1PWD A;  4N92 A;  1GA0 A;  3O87 A;  2VV6 A;  4F94 A;  5EPH A;  2WKP A;  4L0L A;  4R0Q A;  4E3I A;  1M40 A;  2GNX A;  3HLC A;  3E2K A;  5AQ9 A;  2QZ6 A;  5D3O A;  1Y4O A;  3T4S A;  3MZE A;  4E3M A;  1LL8 A;  4N1H A;  2PHY A;  2J9P A;  2HPB A;  1G5U A;  3G32 A;  4S2I A;  2Y2O A;  5HDS A;  3IXG A;  2EX9 A;  3PBN A;  2UWX A;  4E3K A;  5J7E A;  4S2L A;  3Q81 A;  3MXS A;  2HDR A;  3W4Q A;  4Y5F A; 
#chains in the Genus database with same CATH homology
 3GV9 A;  5GLA A;  1NZU A;  5FAS A;  1E4D A;  1W7F A;  5DVA A;  4E3O A;  1EWZ A;  1GHI A;  4FCF A;  1BTL A;  3QNC A;  4KEN B;  1KVL A;  4EBP A;  3NBL A;  1C3B A;  4QY6 A;  4Y0O A;  3A3F A;  3RXW A;  4OPR A;  3VFH A;  1PIO A;  5JYP A;  1K57 C;  1SHV A;  1RP5 A;  4KZ4 A;  5HAR A;  3NIA A;  4KZ8 A;  4LV1 A;  3C5A A;  5CHJ A;  5GLC A;  1H5X A;  1KGG A;  5FI7 A;  4QB8 A;  3VSK A;  3DWK A;  5M1A A;  4KG2 A;  4S2P A;  3WRZ A;  4MBH A;  2XR0 A;  1FCO A;  3I7J A;  5G18 A;  2IWB A;  3SS4 A;  3WRT A;  4ID4 A;  3VSL A;  3G34 A;  5CGW A;  2V1Z A;  1J9M A;  3FWL A;  1SDE A;  3GQZ A;  5DTK A;  1BUL A;  3AGD A;  2H0T A;  4X68 A;  2QMI A;  1QMF A;  4XUX A;  5FQ9 A;  4Y7P A;  3G2Z A;  1FOF A;  5HAI A;  1PW1 A;  3HUM A;  3A3I A;  3HLW A;  5CED A;  1NY0 A;  2XFS A;  4FH2 A;  1FQG A;  2ZMA A;  4B4X A;  3FKW A;  4KZA A;  1QME A;  4IVK A;  4RX3 A;  4M3K A;  2XD1 A;  3V39 A;  2ZQ8 A;  3IF6 A;  1ES4 A;  1LL9 A;  1SCW A;  5EUA A;  4H8R A;  4OOY A;  1K38 A;  1DY6 A;  3HUO A;  5CEC A;  5J8X A;  5GL9 A;  3IWO A;  3W4P A;  1IYQ A;  3ITA A;  3Q07 A;  1K54 A;  2GDN A;  4WBG A;  2IWC A;  1IEM A;  1CEF A;  3WS0 A;  4QD4 A;  1W79 A;  3OPL A;  2WAE A;  4S2N A;  1ALQ A;  1BUE A;  4KG5 A;  1K6R A;  4E3L A;  1K55 C;  1L2S A;  3IF6 B;  1LL5 A;  2XQZ A;  4R3B A;  3G30 A;  5DTT A;  3PBS A;  3HLG A;  2ZQD A;  4FSF A;  4DE0 A;  4EV4 A;  3VFF A;  3WS4 A;  1XA1 A;  5CEB A;  4OVD A;  1FR6 A;  3BFG A;  1PYY A;  4P85 A;  3MBZ A;  1AXB A;  2XLN A;  3PBQ A;  4S2K A;  3E2L A;  1MWR A;  3UDX A;  4EBL A;  3UDF A;  3IT9 A;  4FH4 A;  3TSG A;  1SKF A;  5CGS A;  4R3J A;  4BLM A;  2G2W A;  4GKU A;  4OPY A;  1ZG6 A;  4WZ4 A;  5FA7 A;  3MZF A;  3NC8 A;  5F1F A;  4XXR A;  2A3U A;  3ZNY A;  2Y91 A;  3DWZ A;  3NI9 A;  3BYD A;  1VQQ A;  4PM9 A;  5CTM A;  1KGF A;  5FQM A;  4K91 A;  5FQQ A;  5A93 A;  1O7E A;  1Q2Q A;  2ZQ9 A;  4PMA A;  4EBN A;  4EQI A;  1XKZ A;  5HAQ A;  1YMS A;  2RCX A;  4R4S A;  1K56 D;  2E8I A;  1YLP A;  4PM6 A;  3UPN A;  4IBX A;  3N4I A;  1TVF A;  2G2U A;  3UE0 A;  4X53 A;  5KSC A;  1WE4 A;  2XH9 A;  2WKI A;  3OCL A;  1IYP A;  4LCM A;  4JKT A;  1IKG A;  4HEF A;  3BFD A;  4X6T A;  1MXO A;  1YLT A;  1W8Y A;  4RX2 A;  4LEN A;  1TDL A;  3G4P A;  3S1Y A;  5GLD A;  2JBF A;  4MBK A;  2OSU A;  2I72 A;  2QPN A;  3V3S A;  1FR1 A;  5KZH A;  5E43 A;  1JVJ A;  2Y2H A;  1BT5 A;  5DF9 A;  1EI5 A;  5HFO A;  1H8Z A;  1PWG A;  1YQS A;  3ITB A;  5E2E A;  5GHY A;  3UNW A;  2WZZ A;  1K57 A;  2X02 A;  3UPO A;  1KE4 A;  3BFC A;  1JWP A;  1NJ4 A;  4WMC D;  1NYY A;  3BFE A;  3VMA A;  2H10 A;  3LEZ A;  1K4F A;  4IED A;  5EE8 A;  4ZJ1 A;  4JPM A;  3VP1 A;  3NDG A;  3S4X A;  4JF4 A;  3WS1 A;  1Z6F A;  4LV0 A;  3PBO A;  4OQ0 A;  5CXW A;  2CC1 A;  3MZD A;  1GHM A;  4QU3 A;  1JWZ A;  2HDQ A;  3P98 A;  1G6A A;  3BLM A;  4OKP A;  5E2H A;  1KDW A;  2EXB A;  1ESI A;  4RA7 A;  3UN7 A;  3M2K A;  4B88 A;  5AQA A;  2HP5 A;  4MBF A;  4GB7 A;  1ONH A;  2EFX A;  1O07 A;  4XUZ A;  2ZQA A;  3IH9 A;  5FQI A;  2P9V B;  1IKI A;  1XGJ A;  2ZC5 B;  4KZ7 A;  5A90 A;  5EEC A;  1I2W A;  5HL1 A;  2J7V A;  4DE1 A;  1L0F A;  1FSW A;  3PBT A;  1ERQ A;  4DXB A;  3ZNT A;  4S2M A;  3CMZ A;  2IWD A;  2Y2N A;  1CK3 A;  5KSH A;  3VP0 A;  3RJU A;  2R9X A;  4MNR A;  3HVF A;  1K55 A;  2C6W B;  1XPB A;  3BLS A;  1L0G A;  4OH0 A;  1NZO A;  2Y2I A;  4KZ9 A;  3N6I A;  3ZG8 B;  2H0Y A;  4PM8 A;  4U0T A;  2V2F F;  3TOI A;  4DE3 A;  5EVI D;  1ERO A;  1GCE A;  5FAP A;  1MWU A;  3G2Y A;  1NXY A;  2C5W B;  1E3U A;  5L2F A;  4N9K A;  1HZO A;  2Y2K A;  2Z2M B;  3BEB A;  1WYC A;  3UE3 A;  3HBR A;  4Y0U A;  3OPH A;  3SS5 A;  1N9B A;  3A3E A;  2WKH A;  4B4Z A;  5U47 A;  4RVA A;  1K4E A;  3HLB A;  3M6B A;  3SH7 A;  1KE3 A;  2Y2G A;  3CJM A;  4OLG A;  1YLY A;  2Y55 A;  2P74 A;  4LV3 A;  2WGW B;  2Y2Q A;  3ZG5 A;  5KMW A;  4MLL A;  5CHU A;  4KZ6 A;  1XX2 A;  1YMX A;  1XGI A;  3V5M A;  1TEM A;  3D4F A;  5I94 A;  1S6R A;  3WS2 A;  1PI4 A;  3QNB A;  4U3T A;  4BJP A;  4D2O A;  1ES3 A;  3MXR A;  1MWT A;  5EVI C;  2ZJ9 A;  5GHZ A;  1JWV A;  1CI9 A;  2WZX A;  3C4O A;  1TDG A;  1KE0 A;  4JBF A;  4OQG A;  5F1G A;  5HX9 A;  4ZJ2 A;  4DXC A;  5DF8 A;  2EXA A;  3OZH A;  3IWI A;  4KQQ A;  4P0M A;  4RYE A;  3IWQ A;  4OON A;  4X56 A;  1H8Y A;  5DTS A;  5FI2 A;  3G35 A;  4KZ5 A;  3ZDJ A;  4HBU A;  3IHA A;  4YFM A;  1FCM A;  1XA7 A;  2ZD8 A;  1PWC A;  1YLZ A;  3GTC A;  4WEL A;  3HUN A;  1MBL A;  4E6X A;  3AGF A;  4E6W A;  1LI0 A;  1K6S A;  1JTG A;  4DE2 A;  1SDN A;  4KG6 A;  3B3X A;  4OOM A;  2Z2L B;  2HP9 A;  3OPP A;  5AQB A;  1LI9 A;  2ZM8 A;  3MKE A;  3LY3 A;  4GOG A;  5HW3 A;  5M18 A;  4JXS A;  3G31 A;  1IYO A;  4Z9Q A;  4BD1 A;  3A3J A;  3ZVT A;  4OLD A;  4DF6 A;  3O3V A;  3BFF A;  1ES2 A;  3CG5 A;  4NK3 A;  3PTE A;  1S0W A;  2DCF A;  4O7D A;  1N4O A;  5CTN A;  3HLD A;  5AQ7 A;  1KDS A;  3ISG A;  5HAP A;  4DDS A;  1DJC A;  4GN2 A;  1PW8 A;  1W5D A;  3ZFZ A;  3N8S A;  3NCK A;  2HDS A;  4UA6 A;  3PAG A;  4PPR A;  5CHM A;  4BQM A;  1HVB A;  2WGV A;  2Y2P A;  2JCH A;  2A49 A;  2VGK A;  4QJG A;  2X01 A;  4WM9 A;  2XGN A;  4LV2 A;  4OP5 A;  1YLW A;  4BL2 A;  4KZB A;  3NY4 A;  4WZ5 C;  5DF7 A;  2V20 A;  2ZM0 A;  3M6H A;  4ZTK A;  1MKI A;  4A5R A;  1GHP A;  4PM5 A;  1RGZ A;  4C75 A;  3W4O A;  3V50 A;  4BD0 A;  1BLC A;  5JYO A;  2ZQ7 A;  3O86 A;  5EOO A;  4WMC A;  2OLV A;  2PU2 A;  3WWX A;  5TR7 A;  3N8R A;  4ZDX A;  1BLS A;  1GA9 A;  3CZD A;  1WYB A;  3HLF A;  1Y54 A;  2WKE A;  3Q82 A;  3GSG A;  4N1X A;  1MPL A;  4OPZ A;  2P9V A;  3GVB A;  4GD6 A;  1LLB A;  3ZVW A;  4KZ3 A;  3UY6 A;  3IXD A;  4QY5 A;  5FAT A;  1RGY A;  5BOH A;  1PZO A;  3PAE A;  5EOE A;  3LY4 A;  1ESU A;  3MKF A;  4P6B A;  3C7V A;  3QHY A;  3JYI A;  4UHU A;  3SOI A;  3ZGA B;  3AGE A;  4N9L A;  5F83 A;  4E3N A;  4E3J A;  1ZG4 A;  3HL9 A;  2OLU A;  1CI8 A;  4GNU A;  3UO9 A;  3LCE A;  4ZBE A;  1NYM A;  5CRF A;  3FYZ A;  4QHC A;  2JC7 A;  5CGX A;  3ZG7 B;  4OQI A;  2J9O A;  3Q7V A;  5FI6 A;  1Q2P A;  2ZC7 A;  4C6Y A;  2HP6 A;  2ZM2 A;  4JF6 A;  1MY8 A;  2ZLY A;  3VOZ A;  4CJN A;  1XXM A;  2ZC3 B;  2BG1 A;  2ZC6 B;  3VOY A;  1IEL A;  3ZG9 B;  4GZB A;  2WUQ A;  4K0X A;  4P87 A;  2XFT A;  4UAA A;  2XF3 A;  2Y2J A;  5TFQ A;  4UA7 A;  3SH9 A;  1U60 A;  4OPQ A;  3P09 A;  2ZC4 B;  3FKV A;  3OC2 A;  2WK0 A;  3Q7V B;  4JLF A;  3IXH A;  4DRT A;  4S2O A;  2WGW A;  1BZA A;  3PBR A;  1FCN A;  5FAO A;  1E25 A;  2Y2M A;  3WS5 A;  4R4R A;  5FQJ A;  5EVI A;  4JXG A;  2BLS A;  4ZJ3 A;  5TGF A;  3SS3 A;  4U0X A;  2JE5 A;  4WEK A;  5A92 A;  1L0E A;  1ZKJ A;  4EWF A;  3OPR A;  4X55 A;  4JF5 A;  3IF5 A;  5M19 A;  1OME A;  1ERM A;  4JXV A;  4GDB A;  2HDU A;  3V3R A;  2WGI A;  5CER A;  5E2G A;  3VP4 A;  1ONG A;  3VP3 A;  2H5S A;  3LO7 A;  2XD5 A;  2DRW A;  3EQU A;  3SH8 A;  3BRM A;  1I2S A;  3UPP A;  1YM1 A;  5GLB A;  4BL3 A;  3MFD A;  1E3U D;  5EVI B;  1W8Q A;  2Y2L A;  4YIN A;  1YT4 A;  5GHX A;  2Q9N A;  2PBY A;  1ZC2 A;  2DNS A;  1DJB A;  4DKI A;  5FDH A;  4Q8I A;  1YLJ A;  4R1G A;  4GDN A;  1KGE A;  2RL3 A;  3S22 A;  2WAD A;  2Y4A A;  3N8L A;  2XEP A;  4R23 A;  2WAF A;  4EUZ A;  3M2J A;  3BEC A;  5FSR A;  3GMW A;  3UE1 A;  2PU4 A;  1FSY A;  1PZP A;  4PM7 A;  4OQH A;  2EFU A;  4CPK A;  1VM1 A;  1HD8 A;  4FD8 A;  4C3Q A;  3RXX A;  3IF6 C;  2VGJ A;  1CEG A;  3Q1F A;  3IH8 A;  4LCL A;  3IQA A;  4BEN A;  5F82 A;  1MWS A;  4S2J A;  1K54 C;  3C7U A;  1IYS A;  4NET A;  4S2N C;  1XP4 A;  1PI5 A;  3DTM A;  2X71 A;  1K56 A;  4HBT A;  1NRF A;  2Y59 A;  4WZ5 A;  3EQV A;  1JTD A;  5E2F A;  4DDY A;  1ES5 A;  2Q9M A;  3NDE A;  1BSG A;  2B5R A;  3GRJ A;  3O88 A;  4IVI A;  4K0W A;  4KQR A;  4GD8 A;  1PWD A;  1I5Q A;  1L0D A;  4N92 A;  2EX2 A;  1GA0 A;  3O87 A;  4OOL A;  3OCN A;  1G68 A;  1DJA A;  3ZHH A;  1BLP A;  4F94 A;  5EPH A;  4L0L A;  4R0Q A;  4E3I A;  3IXB A;  1M40 A;  3FV7 A;  3HLC A;  3FZC A;  3E2K A;  3W8K A;  5AQ9 A;  2XDM A;  2QZ6 A;  3GR2 A;  2OV5 A;  5D3O A;  1M6K A;  1LHY A;  2XK1 A;  3MZE A;  4E3M A;  3A3D A;  4JXW A;  4N1H A;  3BM6 A;  5IHV A;  2J8Y A;  3N7W A;  3TG9 A;  3HLE A;  2J9P A;  4HES A;  3ZG0 A;  4ZAM A;  4MEZ A;  2HPB A;  3C4P A;  3Q7Z A;  3HRE A;  3DW0 A;  2FFF B;  4OP8 A;  3G32 A;  1HTZ A;  4IBR A;  2WYX A;  4UA9 A;  2EX8 A;  4S2I A;  1KVM A;  3IHB A;  4KQO A;  2Y2O A;  3ZCZ A;  3IXG A;  1K25 A;  1RCJ A;  2EX9 A;  3PBN A;  2UWX A;  3VP2 A;  4E3K A;  4Y0T A;  4S2L A;  2EX6 A;  3Q81 A;  4WYY A;  5FQK A;  3UDI A;  2R9W A;  3MXS A;  4X69 A;  5EVL A;  5A91 A;  2FFY A;  2HDR A;  4WEJ A;  5FAQ A;  3W4Q A;  1BLH A;  2ZQC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...