3H7WB

Crystal structure of the high affinity heterodimer of hif2 alpha and arnt c-terminal pas domains with the artificial ligand ths017
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
110
structure length
110
Chain Sequence
CQPTRFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Endothelial PAS domain-containing protein 1
publication title Principles of ligand binding within a completely buried cavity in HIF2alpha PAS-B
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 32
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2009-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF14598 PAS_11 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3h7wB01
1OTIA 3LIFA 3FG8A 2D02A 5I5LA 2OWHA 2L1MA 3LIEA 2V1AA 4LLOB 3MXQA 1T1BA 1N9NA 2INWA 4I38A 1S4RA 4L9EA 4L9GA 2QKPA 1MZUA 2PD7A 4I3JA 3FC7A 4F3LA 1D7EA 3LYXA 4EXOA 2A24B 5G4ZA 4B9OA 4LRYC 2PD8A 2V0UA 1LL8A 2EA9A 1LSWA 1BYWA 5J7EA 5AVFA 3H82A 4EERA 4DJ2A 1OTAA 3RH8B 1P0ZA 3UE6A 4K08A 5HWVA 2V1BA 3P7NA 1UWNX 2HV1A 4KQDA 5HDDA 2P7JA 3EEHA 4DJ3A 2QJ5A 4GCZA 2K7SA 3K3CA 3UB7A 1TS7A 3PYPA 3NJAA 4KUOA 1NWZA 2I9VA 4BBVA 4HIAA 4EW7A 5HSQA 5KIZA 1S67L 2YKHA 3BY9A 2PR5A 4WN5A 3H9WA 2Z6DA 4HNBA 1DP9A 2PYPA 5J3WA 4JGOA 3CLOA 3IS2A 1LSVA 5F68A 5G4YA 4NXFA 1OT6A 3GECA 3F1OB 1X0OA 2ZOIA 4GW9A 1XJ4A 4HJ6A 4HQAA 2KX6A 5DKLA 3NOUC 5TBMA 4XT2A 3UB6A 4WUJA 2PHYA 3CWFA 2PYRA 1N9OA 3EWKA 3F1PA 3H7WA 3KX0X 2WKRA 3RTYA 1S66L 5F69A 4H6JA 4HI4A 3LUQA 3ULFA 3SW1A 2V0WA 4NXGA 1XFNA 1G28A 4LRXC 4I3AA 2B02A 2ZBBA 1OTBA 2BASA 1VB6A 2J80A 4HP4A 5A8BA 4I5SA 2L4RA 1OJGA 4EQ1A 5HWTA 2A24A 4R70A 4EESA 3NHQA 3UMEA 4HH3A 4HY8A 1XJ6A 4L9FA 1WA9A 3CAXA 1OT9A 1TS0A 3LIAA 1UWPX 3F1NB 4HHDA 4LRZE 1DP8A 1V9ZA 1T19A 4BBTA 5DJTA 1T1CA 3HJKA 4JGPA 4EEPA 3LI8A 3T50A 3LICA 1F98A 3K3DA 3ZQ5A 3A0SA 5F5YA 4GS9A 2QHKA 5J4EA 1OTEA 2OWJA 2CMNA 3VE3A 3G6OA 2VV7A 4R3AA 2VV8A 2YKFA 4GHIB 4EETB 3E4OA 3NOPC 1T1AA 1XJ3A 4R6LA 2VLGA 2VEAA 3D72A 2JN7A 1TS8A 1S1YA 4HJ3A 5HZHA 5DJUA 1XFQA 4KUKA 3F1OA 1D06A 1LT0A 2W0NA 3MJQA 3NOTC 4WLAA 2GJ3A 5HD5A 3GDIA 3C8CA 4F3LB 3LI9A 3A0RA 1S4SA 3BWLA 3MFXA 2PDRA 2JHEA 1UGUA 2ZOHA 5HD3A 2L0WA 4JGQA 3HJIA 3H82B 5HDCA 1GSXA 3MQOA 1ODVA 2H28A 4LPZA 1GSVA 1LSXA 1N9LA 1XJ2A 1JNUA 1Y28A 1EW0A 4HP9A 4HJ4A 5F6AA 4I3IA 4PKYG 5IU1A 1DRMA 3C2WA 3IBRA 4PKYA 4JGRA 3VE4A 3VOLA 2M1CA 3LIDA 4RQ9A 2QJ7A 3A0VA 2V9AA 2R78A 4M4XA 1DP6A 4WL9A 2QWSA 1P97A 2Z6CA 3IS2B 3LIBA 3PHYA 4GS9B 5IS1A 2D01A 5HDSA 3ICYA 3MR0A 1OTDA 1V9YA 4NXEA 4MN6A 5DKKA 2VV6A 1OJ5A 3UB8A 3B33A 3UB9A 2WKQA 3F1NA 5TBMB 4EEUA 5HWWA 1T18A 4XT2B 3E4QA 1KOUA 4HOIA 4BBUA 4YWZA 4I39A 5EFWA 1TS6A 4WF0A 5AVEA 3F1PB 1GSWA 3H7WB 2WKPA 1F9IA 4R38A 2PR6A 2W27A 3UMDA 2KDKA 1S1ZA 4H6JB 4NXBA 2OOLA 4MN5A 3OLOA 4HH2A 4E04A 3E4PA 3MQQA 3BY8A 4GHIA
chains in the Genus database with same CATH superfamily
3FWLA 1JVJA 3PAGA 2DCFA 1PWGA 1DJCA 1KE0A 1TEMA 3LIEA 4MDZA 2XQZA 1T1BA 2INWA 4KZ7A 1S0WA 1PWDA 2JCHA 3PBQA 2LB9A 5EVEA 4UHUA 3VSKA 2G2WA 1LI0A 1N4OA 3B3XA 4LCMA 2QKPA 1BTLA 3VMAA 1MZUA 2PD7A 1K6SA 4OOYA 3NECA 5HW3A 1E3UD 4EXOA 3T4TA 5G4ZA 4B9OA 3OPPA 1P9RA 2V0UA 2K31A 3WRTA 2EX2A 3C4PA 1MY8A 4Z9QA 1KVMA 1BYWA 5KSHA 3CPTA 3E98A 3UPNA 4P6BA 2XGNA 4EERA 4S2NA 1P0ZA 3G4PA 5HWVA 5DVAA 3C7UA 1M40A 1XP4A 3HUMA 4OLDA 4X1LA 3T4JA 4JLFA 1CI8A 1FCOA 4BWIA 4EUVA 3TG9A 5AQAA 1PI4A 1NZOA 1LHYA 5HAQA 2P74A 3EEAA 4FH4A 5CTNA 4KUOA 4YFMA 3LGOA 3O88A 3MQ0A 1NRJA 4JKTA 5CGSA 2JE5A 4X68A 3T12B 3CMZA 5FI6A 1W63Q 3CLOA 3SS5A 1LSVA 5F68A 1LLBA 3Q7ZA 1FR1A 4Y15A 4NXFA 3BJNA 3P09A 3GECA 4PM5A 1RGZA 4E3MA 1BT5A 3G30A 1YKDA 2G2UA 5L8MA 3BFEA 3EOIA 1X0OA 3DTKA 4OPZA 2ZQCA 1GHIA 2Y2IA 1O07A 2VGLM 3CI6A 3NOUC 3ZG0A 4NG2A 2ZLYA 2ZC6B 4WUJA 2PHYA 3CWFA 4KG5A 1SDEA 2PU4A 5F1FA 5HAPA 3GSGA 2JBFA 4KQRA 2WAEA 1AWIA 3FYZA 5FQQA 4UA6A 4EV4A 1NJ4A 3AGEA 4CLCA 4XUXA 1G6OA 2ZQ7A 2OLUA 3SW1A 3KSGA 1YPRA 1YLWA 1XFNA 2ZM2A 4MNRA 4I3AA 2EX8A 2HP9A 2BASA 1VB6A 2WYXA 3OZHA 3IBJA 3HVFA 1MWSA 1NYYA 3K2NA 4L0LA 4PHTA 5G18A 4G3VA 3SOIA 5CEBA 2Q9NA 3OC2A 2XR0A 1MXOA 4CJNA 4X53A 3DTIA 4OPRA 1KE4A 3CJMA 1XPBA 3UE3A 1UWPX 4QB8A 3U4LP 4X69A 4BBTA 4OP8A 1YLYA 3HJKA 3IX8A 1YLPA 2UV0E 3IT9A 3ZVWA 3ZNYA 1GHPA 2W3EA 4BL2A 1K56A 4Y0TA 5CX7A 1L2SA 4Y5FA 1BLHA 4S2IA 4DMZA 3E4OA 5EVIC 1IYPA 1ES3A 4BL3A 1TVFA 2O0YA 5EOOA 3G34A 2CC1A 1G68A 4QPRA 3V3SA 4HJ3A 5FATA 3DWZA 1XFQA 1JTGA 4FUWA 1QMEA 5FQIA 1D06A 3MJQA 2W0NA 3W2ZA 4ZBEA 3KYEA 4WLAA 2GJ3A 2A2LA 4II7A 4WYYA 3Q81A 2Y8HA 2VX8A 3OOVA 3A0RA 1S4SA 3LR3A 2PDRA 4KZ6A 5EECA 1ESUA 2W3HA 2ZOHA 3QNCA 3VP4A 4PPRA 4HBUA 2ZMVA 5GLBA 1EWZA 5GLAA 1FIKA 2ZQAA 4PMAA 4BQMA 1ODVA 5EVID 1NRFA 4LPZA 4UA7A 3T1SA 2M7VA 1N9LA 1TDGA 2Y2KA 3G32A 3NDGA 1JNUA 3S7QA 1EW0A 3HLGA 2HDUA 4HJ4A 2IWBA 4G3KA 2Y55A 5IU1A 2EFXA 4GN2A 5EOEA 5GHXA 2E8IA 5IHVA 4EBPA 4PKYA 3VE4A 4JF5A 1KGGA 3L7HA 3S7PA 3LIDA 3HL9A 3PBOA 3OPRA 4QY5A 2DMWA 2WUQA 3IH9A 2R78A 1XA1A 4MCWA 2NUPC 1STZA 1SCWA 2O9CA 4Y0OA 4GS9B 2V2FF 5IS1A 4GDBA 2WKHA 2Y59A 1ERQA 3ICYA 1OTDA 5IT5A 3TJZC 3SH8A 2ZC4B 4FH2A 1OJ5A 2AVXA 1W8YA 4KENB 3B33A 3UB9A 5CGWA 4EEUA 3NY4A 1T18A 2C6WB 3E4QA 3ZCZA 2J3TC 1D1JA 3ZG7B 3BW6A 2XDMA 1G6AA 4KZ8A 3PXPA 3TSGA 2B95A 4OPYA 1F9IA 3MSHA 2IA2A 2V20A 2W27A 1ERMA 3CUEA 1NXYA 2GZAA 3A3EA 3LIFA 1IKIA 3FG8A 3P01A 5GL9A 5I5LA 2OWHA 1LL5A 2V1AA 5E2GA 1ZKJA 2ZC7A 4IBRA 5HL1A 3Q82A 4I38A 3R7WB 5DFXA 4HESA 3Q7VB 4L9EA 4L9GA 1TD5A 4OKPA 2Y79A 3BECA 3QHYA 4GB7A 1WE4A 1ALQA 4IHQA 1G5UA 2ZJ9A 3FKVA 3C30A 3LYXA 5DTSA 1VHMA 3BYDA 4LRYC 2J3TD 1RP5A 3N8LA 2VK3A 1LL8A 3ZG9B 4ZJ1A 4R1GA 3TW8A 1DJBA 1QMFA 5J7EA 5AVFA 2Y2JA 5CHMA 4DJ2A 3ISGA 3RH8B 2Y2MA 2IWDA 4K08A 2JKRM 1UWNX 4OVDA 2HV1A 2WKEA 4IUHA 2XK1A 2O9BA 3MXRA 1YAXA 5HDDA 2P7JA 3W8KA 4CPKA 3EEHA 2QJ5A 4KQOA 3T1XA 2Q0OA 1RGYA 1BSGA 1TS7A 3PYPA 3HBRA 2I9VA 4HIAA 1YT4A 4DXCA 3MMHA 3LR4A 1CK3A 5KIZA 4Z1WA 2PR5A 4WN5A 3E0YA 3WS5A 2XRNA 1IKGA 1DP9A 3PBRA 4A5RA 5L09A 4NEED 4F94A 3IWOA 3GR2A 4S2PA 2WGWB 1EROA 5CHUA 3BQ8A 4CLCE 3QP2A 4GW9A 4JXVA 4OLGA 4JF4A 3V67A 5AQ9A 2QZ6A 3T4LA 1IOUA 2PYRA 1N9OA 4R3JA 3HLDA 2VKSA 3EWKA 2Z2MB 2P9VB 3IHBA 2VZWA 1BULA 4GZBA 3IXDA 4O8GA 5FEFA 4DE2A 3B47A 5AQBA 3Q07A 3T4KA 5TJJA 4NXGA 1G28A 3IQAA 4DXBA 2A49A 4WZ5A 4X6TA 3DBAA 3NBLA 4DN0A 1WYBA 3D4FA 2J80A 3R7WA 4QJGA 1PRQA 4FOFA 3Q7VA 4QY6A 5FA7A 1ACFA 2L4RA 2QMIA 4GOGA 1FCNA 3LY3A 1OJGA 3W4PA 1YLTA 4QD4A 1LL9A 3G35A 2EWVA 5JYPA 4QWOA 2H5SA 2H10A 4WELA 3G2ZA 3NHQA 1S6RA 3UMEA 3VOZA 4Y17A 4N92A 4Y2FA 3IXBA 4HY8A 1K25A 2R9XA 1FOFA 3M6BA 5E2FA 4KZ9A 1CEGA 3SS4A 1OT9A 2XROA 1E3UA 3F1NB 4HHDA 1KVLA 1BLSA 4D60A 4LRZE 1T19A 3HUOA 3FZCA 4Y0UA 2UWXA 3KYZA 3PTEA 4EEPA 4P6ZS 3T50A 1O7EA 3ZHHA 3JPUA 3VP3A 3EQUA 5KMWA 1K4FA 3A0SA 5F5YA 5J4EA 1ZTUA 4LFUA 1VETB 3B42A 3G6OA 4KG2A 4R3AA 3BQAA 4KG6A 4LENA 4Q0JA 2FFYA 3C4OA 2YKFA 4GHIB 4DDSA 2EX9A 3MKFA 2XD5A 4FCFA 3NOPC 4YINA 2QYBA 4OQIA 1ONGA 1XJ3A 5HX9A 4O0PA 3D3OA 5L2FA 2GX5A 1W79A 4UQIS 5HZHA 4RVAA 5DJUA 3UE0A 4EBNA 2RL3A 2Y2PA 3UN7A 1XKZA 1WYCA 1LT0A 3NOTC 2WGWA 3N4IA 4F3LB 5GHZA 2X01A 3LI9A 1H8YA 3FPVA 4N1XA 4BLMA 4EBLA 5FAQA 4DF6A 5LBRA 2ZQDA 3MFXA 4WMCD 5HPFA 4RX3A 3KYQA 4E6XA 1YLJA 5HARA 3N6IA 3UDXA 2XEPA 4U0XA 3H82B 2P9VA 4N9LA 2EX6A 2XH9A 2ZM0A 2H28A 2ZQ8A 4GLQA 1GSVA 5EVLA 2Y91A 1XJ2A 3RFBA 3KSIA 2LB5A 1U60A 1MWUA 2ZL1B 4I3IA 4GDNA 4QU3A 2Y2NA 3O86A 1K38A 3A3IA 3NIAA 2Y2GA 1IELA 5EVIB 1YQSA 3VOLA 3JVUA 1PW1A 3GRJA 3NCKA 1YM1A 3G31A 3DAVA 5CERA 2WADA 4WL9A 4IUKA 3IS2B 5MC7A 3LEQA 2W1RA 2DRWA 4X56A 1EI5A 5HL6A 1NYMA 3MR0A 1Z6FA 4NXEA 5L07A 4MN6A 4KZ5A 4WBGA 2PU2A 2GNXA 4FD8A 2PRFA 1YSQA 2VV6A 2EXBA 3U2AA 2Y2HA 5A91A 3F1NA 5TBMB 5HWWA 4XT2B 2XFSA 4XXRA 3P98A 4HOIA 2BLSA 1ES4A 1TDLA 3JVVA 1H3QA 4I39A 3S7NA 3UY6A 3LCEA 4GJ4A 2H0YA 2V8CA 1YMXA 4PM7A 5EV0A 3MBZA 2EFUA 1VETA 2VGLS 1H8MA 3BLMA 4ID4A 2XD1A 4H6JB 4NXBA 3SS3A 2X71A 3MQQA 3UB5P 4GHIA 1XX2A 3N8SA 2RCXA 2XA7M 3ZYTA 3TE8A 3WS2A 2L1MA 3WS1A 3BLSA 1S4RA 1LI9A 4UA9A 4ZTKA 3OPHA 2O9AA 4PM6A 4MBHA 1K55C 1MC0A 3AGFA 3FC7A 4F3LA 1FILA 4KZ3A 1D7EA 2WZXA 3MZFA 4Y7PA 2PD8A 3V3RA 2EA9A 4E3IA 2J7VA 2XF3A 2I72A 4S2KA 5FQ9A 1FSYA 1LSWA 3A3FA 3CZDA 3H82A 2K2NA 3UE6A 2XLNA 2V1BA 3P7NA 2OAP1 1K54C 3IWIA 3VP0A 2C5WB 4B88A 2VJWA 5HFOA 5FEGA 3MFDA 5M18A 5TGFA 1GA9A 4ESPA 3N8RA 2ZL1A 3IH8A 3K3CA 3UB7A 2B5RA 2JKFA 1NWZA 4BBVA 1DY6A 5HSQA 4RYEA 5EVIA 2O99A 1FR6A 3MXSA 3H9WA 3O3VA 2KLIA 2WGIA 1AXBA 2PYPA 1FQGA 5FL3A 3IS2A 1VM1A 5G4YA 2JKGA 4IBXA 4WZ4A 4K91A 1OT6A 3F1OB 3PBNA 3BFGA 1HVBA 2VGJA 2FFFB 5FAPA 3IF6C 2W3FA 3V5MA 1Y4OA 3O87A 1K0KA 4GNUA 1FCMA 5L10A 3FKWA 1XXMA 2KX6A 1SKOB 5TBMA 4FSFA 4XT2A 4X55A 4X1MA 4LCLA 3MZEA 3UB6A 4G3WA 2Y4AA 3E2LA 2Y2LA 2V1ZA 1K57C 3LFVA 3OCNA 3BEBA 5E2EA 3LEZA 2Q9MA 1ONHA 1BZAA 4BD1A 2X02A 3DTEA 2JKRI 3IXGA 5GHYA 2WKRA 5CEDA 1OMEA 3RTYA 1S66L 5F69A 4H6JA 2J9OA 2ZD8A 1YLZA 4HI4A 4R4SA 2HZ5A 3LUQA 3ULFA 3BFFA 5TFQA 4Y3IA 2V0WA 5DF8A 2B02A 3QP6A 3OCLA 4M3KA 1OTBA 3M2KA 4U0TA 1MWRA 5C5KA 3G2YA 3S1YA 4IJGA 1K54A 1H0MA 4S2JA 5A8BA 4I5SA 3UNWA 4EQ1A 3D9YA 5HWTA 1F2KA 3SH9A 2DNSA 2HDQA 5M19A 1XGJA 4R70A 4EESA 4PAUA 1YSPA 1IFQA 1K4EA 1PFLA 1ZG4A 1GCEA 5DTKA 1XJ6A 4OQHA 3QP4A 4IVKA 4NKPA 2ZC3B 2M7UA 4KQQA 2ZMAA 1TS0A 3LIAA 5EUAA 3UPPA 4S2NC 4R23A 3KO6A 1DP8A 3MF0A 3IF5A 1NY0A 3MZDA 3BFDA 5DJTA 2P04A 3WS4A 2NUTC 1T1CA 1BLPA 4JGPA 3LI8A 4PM9A 3LICA 2MJ6A 4JBFA 5U47A 2W1TB 3RXXA 4B4ZA 3K3DA 3ZQ5A 3R4KA 3BFCA 2GDNA 4GS9A 2QHKA 2OWJA 3VE3A 3C5AA 5GLDA 2E8JA 2VV8A 2HF6A 4C6YA 3IX3A 2ACGA 1ZG6A 1IYSA 2Y2QA 3QP1A 4R6LA 2R9WA 2VEAA 4EU0A 4C3QA 2JN7A 3E2KA 3IX4A 1CF0A 4LGWA 4KUKA 3F1OA 2Y2OA 3EGDC 3DTMA 1F5MA 5HD5A 3TOIA 4Y13A 3UDFA 3GV9A 3BWLA 1SKOA 4H8RA 4OP5A 1UGUA 5FQMA 1KE3A 1MKIA 4JGQA 5FQJA 4N1HA 3HJIA 2W3DA 5DF9A 5HDCA 3VOYA 1I2WA 2WKIA 1PI5A 1GSXA 4CQHA 5A92A 1W5DA 3N7WA 1LSXA 5AJGA 4ME4A 4LV3A 2WK0A 4CLCC 4HP9A 5F6AA 4RX2A 1PWCA 1DRMA 2PT7A 4IVIA 3C2WA 1VEUB 4MBFA 4HEFA 3MKEA 1Q2QA 2PBDP 4JGRA 5EE8A 1FSWA 5F1GA 4N9KA 2M1CA 3ZVTA 2QJ7A 3FV7A 3VV4A 1H8ZA 3A0VA 4K0XA 3HLFA 2V9AA 4M4XA 4UAAA 1L3LA 2EWWA 1P97A 3FPWA 4Q0IA 3PHYA 3QP5A 1PNEA 1JWPA 3SH7A 4P85A 3HLBA 3ZDJA 1M6KA 1IEMA 5HDSA 3UDIA 3CITA 3OPLA 1W63M 4P0MA 5DKKA 1ZC2A 3GMWA 2WKQA 3LO7A 1Q2PA 2G7UA 4NETA 3PBSA 2PBYA 4BBUA 3S7OA 3GTCA 1L0FA 5JYOA 4MLLA 4CLCD 3LY4A 2HDSA 4LV1A 4WF0A 4GD6A 2W1TA 3F1PB 3H7WB 4AFIA 3AGDA 3UPOA 3JYIA 4GD8A 5M1AA 3T4QA 2ZM8A 3EQVA 3A3JA 3WWXA 1PZOA 2KDKA 2OOLA 3OLOA 4HH2A 3E4PA 3BY8A 1JTDA 4R0QA 1OTIA 3CG5A 3PBTA 1SDNA 2KOIA 2D02A 1MBLA 4LLOB 3MXQA 1N9NA 2HJ9C 5EPHA 4ETXA 2J9PA 3S22A 4ARZB 3RXWA 4FTXA 5DFYA 4I3JA 1E25A 2H0TA 1L0DA 4BD0A 2A24B 2EXAA 3HLCA 4R4RA 1VQQA 4UEYA 1A0KA 4LV2A 3ZG8B 3Q1FA 2J3WA 3SZTA 1CEFA 4YNRA 5FAOA 5GLCA 1OTAA 1CI9A 1K56D 3BRMA 1XGIA 5F82A 4WMCA 1NZUA 1IYOA 4KQDA 3IHAA 4DRTA 4E3LA 4WEJA 4DJ3A 4GCZA 4JXWA 2K7SA 2OLVA 2OSUA 4DDYA 4OQ0A 3RJUA 1PIOA 2A3UA 3PR6A 3PAEA 1VEUA 3NJAA 5FDSA 2XSSA 5DF7A 4EW7A 1DJAA 1S67L 2JC7A 1PZPA 2YKHA 3BY9A 1BUEA 3C38A 4MN7A 5FI2A 5CHJA 2Z6DA 3NULA 2WZZA 4HNBA 4MBKA 5J3WA 3UE1A 4KZBA 4JGOA 4OPQA 3WS0A 5K5BA 3QP8A 1K6RA 4XUZA 2PAVP 1J3WA 2XFTA 1E4DA 5AQ7A 2HP5A 2HGVA 2ZOIA 1XJ4A 5CTMA 4HJ6A 4DKIA 1HD8A 4HQAA 2ZMFA 1SZVA 4D2OA 3EGXC 4BENA 5CECA 4GKUA 4R3BA 5DKLA 4KZAA 3S4XA 4K0WA 3TRCA 4E3JA 2P08A 4OQGA 5KSCA 3BM6A 2HPBA 3F1PA 4PM8A 3H7WA 5HPIA 3IXHA 1W7FA 3KX0X 4ZRRA 5A90A 2IWCA 3CUEC 4ZJ2A 1RCJA 4NK3A 3HCYA 3HREA 3ITBA 1SHVA 3W4QA 3CHWP 1KGEA 4HBTA 3HUNA 4DE1A 4LRXC 2ZBBA 4X25A 4WEKA 3OBFA 4BJPA 3NI9A 5HAIA 4HP4A 3HLEA 5FDHA 4JXSA 4E6WA 4ARZA 1GA0A 1PYYA 4OH0A 5A93A 1NLYA 5D3OA 4B4XA 1GHMA 3I7JA 2A24A 3IF6B 3HLWA 1Y54A 1H5XA 5E2HA 4HH3A 3ZFZA 5E43A 4L9FA 1WA9A 2ZC5B 3CAXA 1C3BA 5FSRA 5EM1A 1V9ZA 2ZQ9A 4QHCA 2FH5A 1Z09A 1F98A 5BOHA 1IYQA 1CJFA 1OTEA 5CGXA 2CMNA 2VV7A 3M6HA 3M2JA 4O01A 4DE3A 4EETB 1NLZA 5TR7A 4DE0A 4MEZA 2V8FA 3ITAA 4Q8IA 4S2MA 4RA7A 1T1AA 3T4SA 2B18A 2VLGA 1I5QA 4JXGA 1W8QA 3D72A 4EWFA 1TS8A 1S1YA 1XA7A 3V50A 3WRZA 3VFHA 4ETZA 4KZ4A 1ES5A 1ESIA 1K55A 4LV0A 1J9MA 1P9WA 3GDIA 3KSHA 3C7VA 2XA7S 3C8CA 1HTZA 3L9KA 4E3KA 3W4OA 1MKMA 3A3DA 3T1RA 2OAQ1 4WM9A 4U3TA 3VSLA 2JHEA 3ZNTA 5KZHA 4P87A 3T1QB 5HD3A 2L0WA 3CPTB 1HZOA 3GQZA 2FZ0A 4OOLA 4YOFA 4E3OA 3MQOA 4B93A 4ZJ3A 1Y28A 4C75A 5DTTA 3LR0A 4PKYG 1KGFA 4IEDA 2VGKA 1HLUP 1YMSA 3DWKA 2Z2LB 2VA0A 2QPNA 1SKFA 3IBRA 4WZ5C 4O7DA 1PW8A 3VP1A 4RQ9A 2JKTI 3NC8A 4MMNA 4EQIA 1DP6A 2QWSA 2Z6CA 3DW0A 4JF6A 1N9BA 3LIBA 3IWQA 2D01A 3NDEA 5FASA 1ES2A 2HJEA 3VP2A 3KSFA 1MWTA 2BTFP 1KDWA 1TF1A 5FQKA 3IF6A 4P6ZM 1ZHHB 1L0EA 3LR5A 1JWZA 4S2LA 1BLCA 1V9YA 5CRFA 1L0GA 4E3NA 3MS6A 2J8YA 1CQAA 3T4OA 4OOMA 4BMWA 3UO9A 4JPMA 3UB8A 3VFFA 2JKTM 3QNBA 5EM0A 4OONA 1KOUA 5F83A 3ZGAB 2BG1A 1I2SA 1K57A 4YWZA 5J8XA 4ZAMA 5EFWA 1OPXA 1TS6A 2HDRA 5AVEA 1GSWA 3GVBA 3V39A 2WKPA 3ZG5A 1MPLA 4S2OA 1JWVA 4ZDXA 5CXWA 4R38A 4EUZA 2HP6A 4UQIM 2PR6A 3UMDA 3O5YA 5I94A 1S1ZA 1KDSA 4Q0HA 2OV5A 4MN5A 4CLCB 5FI7A 4E04A 2W3GA 2WGVA 2WAFA
chains in the Genus database with same CATH topology
1OTIA 3LIFA 2XA7M 3PBTA 3FG8A 2KOIA 3P01A 2D02A 5I5LA 2OWHA 3TE8A 3ZYTA 2L1MA 3LIEA 4MDZA 2V1AA 4LLOB 3MXQA 1T1BA 1N9NA 2INWA 3R7WB 2HJ9C 4I38A 4ETXA 3PBQA 1S4RA 5DFXA 2LB9A 4L9EA 2O9AA 4L9GA 1TD5A 4ARZB 2QKPA 5DFYA 2Y79A 1MC0A 1MZUA 2PD7A 4I3JA 3FC7A 4F3LA 4IHQA 1D7EA 3C30A 3LYXA 3T4TA 2A24B 4EXOA 5G4ZA 1VHMA 4B9OA 4LRYC 2J3TD 2PD8A 1P9RA 2V0UA 2K31A 4UEYA 1LL8A 2EA9A 3TW8A 2J3WA 4YNRA 1LSWA 1BYWA 5KSHA 5J7EA 5AVFA 3E98A 3H82A 4EERA 4DJ2A 1OTAA 3RH8B 2K2NA 1P0ZA 3UE6A 4K08A 5HWVA 2JKRM 2V1BA 3P7NA 2OAP1 1UWNX 3T4JA 2HV1A 4IUHA 2O9BA 4BWIA 4KQDA 4EUVA 2VJWA 1YAXA 4WEJA 5HDDA 2P7JA 3EEHA 4DJ3A 2QJ5A 4KQOA 4GCZA 2K7SA 3K3CA 3UB7A 1TS7A 3PR6A 3PYPA 3EEAA 3NJAA 2XSSA 4KUOA 1NWZA 2I9VA 4BBVA 4HIAA 4EW7A 3MMHA 3LR4A 5HSQA 5KIZA 1S67L 2YKHA 3BY9A 4Z1WA 2O99A 3C38A 2PR5A 4MN7A 3MQ0A 1NRJA 4WN5A 3H9WA 2KLIA 2Z6DA 3E0YA 2XRNA 4HNBA 1DP9A 2PYPA 3PBRA 5J3WA 1W63Q 4NEED 4JGOA 3CLOA 5FL3A 3IS2A 1LSVA 5F68A 5K5BA 5G4YA 4NXFA 3BJNA 1OT6A 3GECA 3F1OB 3PBNA 1YKDA 2HGVA 2W3FA 3BQ8A 5L8MA 4CLCE 3EOIA 1X0OA 2ZOIA 4GW9A 1XJ4A 4HJ6A 4HQAA 2ZMFA 3EGXC 2VGLM 3V67A 2KX6A 3CI6A 5DKLA 3NOUC 5TBMA 4FSFA 4XT2A 3T4LA 3UB6A 4G3WA 4WUJA 2PHYA 3CWFA 3TRCA 1IOUA 2PYRA 2P08A 1N9OA 3LFVA 3OCNA 2VKSA 3EWKA 3F1PA 3H7WA 5HPIA 2VZWA 3KX0X 2JKRI 4ZRRA 4O8GA 2WKRA 3RTYA 1S66L 3CUEC 5F69A 4H6JA 4CLCA 3B47A 4HI4A 3LUQA 1G6OA 3ULFA 3HCYA 3T4KA 3SW1A 3KSGA 5TJJA 4Y3IA 2V0WA 4NXGA 1XFNA 1G28A 4LRXC 4I3AA 2B02A 3OCLA 2ZBBA 1OTBA 4WEKA 3DBAA 2BASA 1VB6A 3OBFA 4BJPA 5C5KA 4DN0A 2J80A 3R7WA 4IJGA 4FOFA 4HP4A 3IBJA 5A8BA 4I5SA 2L4RA 4L0LA 3K2NA 4ARZA 4PHTA 1OJGA 4EQ1A 5HWTA 4G3VA 1NLYA 2EWVA 2A24A 4R70A 4WELA 4EESA 3NHQA 3UMEA 4PAUA 1YSPA 3OC2A 1IFQA 4Y2FA 4HH3A 4HY8A 1XJ6A 4L9FA 4NKPA 1WA9A 2M7UA 3CAXA 1OT9A 2XROA 1TS0A 3LIAA 3UE3A 1UWPX 3F1NB 4HHDA 4LRZE 3KO6A 1DP8A 3MF0A 1V9ZA 1T19A 4BBTA 5DJTA 2P04A 2NUTC 1T1CA 3KYZA 3HJKA 4JGPA 4P6ZS 4EEPA 3LI8A 3T50A 3LICA 2FH5A 2MJ6A 3EQUA 2W1TB 1F98A 3K3DA 3ZQ5A 3R4KA 3A0SA 5F5YA 4GS9A 2QHKA 5J4EA 1OTEA 1ZTUA 2W3EA 2OWJA 2CMNA 5CX7A 3VE3A 3B42A 3G6OA 2VV7A 4Y5FA 4R3AA 3BQAA 4Q0JA 4O01A 2VV8A 2HF6A 2YKFA 4GHIB 4DMZA 4EETB 1NLZA 3E4OA 3NOPC 2QYBA 1T1AA 1XJ3A 4R6LA 3T4SA 4O0PA 3D3OA 2B18A 2O0YA 2VLGA 2VEAA 4EU0A 3D72A 2JN7A 1TS8A 1S1YA 2GX5A 4QPRA 4HJ3A 4UQIS 4ETZA 5HZHA 5DJUA 1XFQA 4KUKA 3F1OA 1D06A 1LT0A 2W0NA 3EGDC 3MJQA 3NOTC 3W2ZA 4WLAA 1F5MA 2A2LA 2GJ3A 4II7A 5HD5A 1P9WA 3GDIA 3KSHA 2XA7S 3C8CA 4F3LB 2Y8HA 2VX8A 3LI9A 3FPVA 3OOVA 1MKMA 3A0RA 2OAQ1 1S4SA 3BWLA 5LBRA 3LR3A 3MFXA 2PDRA 2JHEA 1UGUA 2W3HA 2ZOHA 5HPFA 3KYQA 5HD3A 2L0WA 4JGQA 3HJIA 2W3DA 2ZMVA 3H82B 2FZ0A 5DF9A 4OOLA 5HDCA 4YOFA 1GSXA 4CQHA 3MQOA 1ODVA 2H28A 4LPZA 4GLQA 2M7VA 1GSVA 1LSXA 4B93A 1N9LA 1XJ2A 3KSIA 2LB5A 4ME4A 5AJGA 3RFBA 1JNUA 1Y28A 4CLCC 3S7QA 1EW0A 4HP9A 4HJ4A 5F6AA 4I3IA 3LR0A 4PKYG 4G3KA 5IU1A 1DRMA 2PT7A 3C2WA 2VA0A 3IBRA 4PKYA 4JGRA 3VE4A 3S7PA 3VOLA 2M1CA 3LIDA 3JVUA 4RQ9A 2QJ7A 3VV4A 2JKTI 3PBOA 3A0VA 2DMWA 2V9AA 4MMNA 2R78A 4M4XA 1DP6A 2EWWA 4MCWA 4WL9A 2QWSA 1P97A 2Z6CA 2NUPC 1STZA 3FPWA 4IUKA 4Q0IA 3IS2B 3LIBA 3PHYA 2O9CA 5MC7A 2W1RA 4GS9B 5IS1A 2D01A 2HJEA 3KSFA 5HL6A 1TF1A 5HDSA 1ZHHB 3CITA 4P6ZM 3ICYA 3MR0A 3LR5A 1OTDA 1W63M 1V9YA 5IT5A 4NXEA 4MN6A 3TJZC 2GNXA 5DKKA 4OOMA 3T4OA 1YSQA 4BMWA 2VV6A 1OJ5A 3U2AA 3UB8A 2JKTM 3B33A 3UB9A 2WKQA 3F1NA 5TBMB 4EEUA 5HWWA 1T18A 4XT2B 2G7UA 3E4QA 1KOUA 2J3TC 3PBSA 4HOIA 4BBUA 3S7OA 4CLCD 3BW6A 3JVVA 4YWZA 1H3QA 4I39A 3S7NA 5EFWA 1OPXA 1TS6A 4WF0A 5AVEA 2W1TA 3F1PB 3PXPA 1GSWA 3H7WB 4AFIA 2WKPA 4GJ4A 1F9IA 3T4QA 3EQVA 4R38A 2IA2A 2VGLS 4UQIM 1H8MA 2PR6A 2W27A 3UMDA 3CUEA 3O5YA 2KDKA 1S1ZA 4H6JB 4NXBA 4Q0HA 2OOLA 4MN5A 4CLCB 3OLOA 4HH2A 4E04A 2W3GA 3E4PA 3BY8A 3MQQA 4GHIA 2GZAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OTI A;  3LIF A;  3FG8 A;  2D02 A;  5I5L A;  2OWH A;  2L1M A;  3LIE A;  2V1A A;  4LLO B;  3MXQ A;  1T1B A;  1N9N A;  2INW A;  4I38 A;  1S4R A;  4L9E A;  4L9G A;  2QKP A;  1MZU A;  2PD7 A;  4I3J A;  3FC7 A;  4F3L A;  1D7E A;  3LYX A;  4EXO A;  2A24 B;  5G4Z A;  4B9O A;  4LRY C;  2PD8 A;  2V0U A;  1LL8 A;  2EA9 A;  1LSW A;  1BYW A;  5J7E A;  5AVF A;  3H82 A;  4EER A;  4DJ2 A;  1OTA A;  3RH8 B;  1P0Z A;  3UE6 A;  4K08 A;  5HWV A;  2V1B A;  3P7N A;  1UWN X;  2HV1 A;  4KQD A;  5HDD A;  2P7J A;  3EEH A;  4DJ3 A;  2QJ5 A;  4GCZ A;  2K7S A;  3K3C A;  3UB7 A;  1TS7 A;  3PYP A;  3NJA A;  4KUO A;  1NWZ A;  2I9V A;  4BBV A;  4HIA A;  4EW7 A;  5HSQ A;  5KIZ A;  1S67 L;  2YKH A;  3BY9 A;  2PR5 A;  4WN5 A;  3H9W A;  2Z6D A;  4HNB A;  1DP9 A;  2PYP A;  5J3W A;  4JGO A;  3CLO A;  3IS2 A;  1LSV A;  5F68 A;  5G4Y A;  4NXF A;  1OT6 A;  3GEC A;  3F1O B;  1X0O A;  2ZOI A;  4GW9 A;  1XJ4 A;  4HJ6 A;  4HQA A;  2KX6 A;  5DKL A;  3NOU C;  5TBM A;  4XT2 A;  3UB6 A;  4WUJ A;  2PHY A;  3CWF A;  2PYR A;  1N9O A;  3EWK A;  3F1P A;  3H7W A;  3KX0 X;  2WKR A;  3RTY A;  1S66 L;  5F69 A;  4H6J A;  4HI4 A;  3LUQ A;  3ULF A;  3SW1 A;  2V0W A;  4NXG A;  1XFN A;  1G28 A;  4LRX C;  4I3A A;  2B02 A;  2ZBB A;  1OTB A;  2BAS A;  1VB6 A;  2J80 A;  4HP4 A;  5A8B A;  4I5S A;  2L4R A;  1OJG A;  4EQ1 A;  5HWT A;  2A24 A;  4R70 A;  4EES A;  3NHQ A;  3UME A;  4HH3 A;  4HY8 A;  1XJ6 A;  4L9F A;  1WA9 A;  3CAX A;  1OT9 A;  1TS0 A;  3LIA A;  1UWP X;  3F1N B;  4HHD A;  4LRZ E;  1DP8 A;  1V9Z A;  1T19 A;  4BBT A;  5DJT A;  1T1C A;  3HJK A;  4JGP A;  4EEP A;  3LI8 A;  3T50 A;  3LIC A;  1F98 A;  3K3D A;  3ZQ5 A;  3A0S A;  5F5Y A;  4GS9 A;  2QHK A;  5J4E A;  1OTE A;  2OWJ A;  2CMN A;  3VE3 A;  3G6O A;  2VV7 A;  4R3A A;  2VV8 A;  2YKF A;  4GHI B;  4EET B;  3E4O A;  3NOP C;  1T1A A;  1XJ3 A;  4R6L A;  2VLG A;  2VEA A;  3D72 A;  2JN7 A;  1TS8 A;  1S1Y A;  4HJ3 A;  5HZH A;  5DJU A;  1XFQ A;  4KUK A;  3F1O A;  1D06 A;  1LT0 A;  2W0N A;  3MJQ A;  3NOT C;  4WLA A;  2GJ3 A;  5HD5 A;  3GDI A;  3C8C A;  4F3L B;  3LI9 A;  3A0R A;  1S4S A;  3BWL A;  3MFX A;  2PDR A;  2JHE A;  1UGU A;  2ZOH A;  5HD3 A;  2L0W A;  4JGQ A;  3HJI A;  3H82 B;  5HDC A;  1GSX A;  3MQO A;  1ODV A;  2H28 A;  4LPZ A;  1GSV A;  1LSX A;  1N9L A;  1XJ2 A;  1JNU A;  1Y28 A;  1EW0 A;  4HP9 A;  4HJ4 A;  5F6A A;  4I3I A;  4PKY G;  5IU1 A;  1DRM A;  3C2W A;  3IBR A;  4PKY A;  4JGR A;  3VE4 A;  3VOL A;  2M1C A;  3LID A;  4RQ9 A;  2QJ7 A;  3A0V A;  2V9A A;  2R78 A;  4M4X A;  1DP6 A;  4WL9 A;  2QWS A;  1P97 A;  2Z6C A;  3IS2 B;  3LIB A;  3PHY A;  4GS9 B;  5IS1 A;  2D01 A;  5HDS A;  3ICY A;  3MR0 A;  1OTD A;  1V9Y A;  4NXE A;  4MN6 A;  5DKK A;  2VV6 A;  1OJ5 A;  3UB8 A;  3B33 A;  3UB9 A;  2WKQ A;  3F1N A;  5TBM B;  4EEU A;  5HWW A;  1T18 A;  4XT2 B;  3E4Q A;  1KOU A;  4HOI A;  4BBU A;  4YWZ A;  4I39 A;  5EFW A;  1TS6 A;  4WF0 A;  5AVE A;  3F1P B;  1GSW A;  3H7W B;  2WKP A;  1F9I A;  4R38 A;  2PR6 A;  2W27 A;  3UMD A;  2KDK A;  1S1Z A;  4H6J B;  4NXB A;  2OOL A;  4MN5 A;  3OLO A;  4HH2 A;  4E04 A;  3E4P A;  3MQQ A;  3BY8 A;  4GHI A; 
#chains in the Genus database with same CATH topology
 3FWL A;  1JVJ A;  3PAG A;  2DCF A;  1PWG A;  1DJC A;  1KE0 A;  1TEM A;  3LIE A;  4MDZ A;  2XQZ A;  1T1B A;  2INW A;  4KZ7 A;  1S0W A;  1PWD A;  2JCH A;  3PBQ A;  2LB9 A;  5EVE A;  4UHU A;  3VSK A;  2G2W A;  1LI0 A;  1N4O A;  3B3X A;  4LCM A;  2QKP A;  1BTL A;  3VMA A;  1MZU A;  2PD7 A;  1K6S A;  4OOY A;  3NEC A;  5HW3 A;  1E3U D;  4EXO A;  3T4T A;  5G4Z A;  4B9O A;  3OPP A;  1P9R A;  2V0U A;  2K31 A;  3WRT A;  2EX2 A;  3C4P A;  1MY8 A;  4Z9Q A;  1KVM A;  1BYW A;  5KSH A;  3CPT A;  3E98 A;  3UPN A;  4P6B A;  2XGN A;  4EER A;  4S2N A;  1P0Z A;  3G4P A;  5HWV A;  5DVA A;  3C7U A;  1M40 A;  1XP4 A;  3HUM A;  4OLD A;  4X1L A;  3T4J A;  4JLF A;  1CI8 A;  1FCO A;  4BWI A;  4EUV A;  3TG9 A;  5AQA A;  1PI4 A;  1NZO A;  1LHY A;  5HAQ A;  2P74 A;  3EEA A;  4FH4 A;  5CTN A;  4KUO A;  4YFM A;  3LGO A;  3O88 A;  3MQ0 A;  1NRJ A;  4JKT A;  5CGS A;  2JE5 A;  4X68 A;  3T12 B;  3CMZ A;  5FI6 A;  1W63 Q;  3CLO A;  3SS5 A;  1LSV A;  5F68 A;  1LLB A;  3Q7Z A;  1FR1 A;  4Y15 A;  4NXF A;  3BJN A;  3P09 A;  3GEC A;  4PM5 A;  1RGZ A;  4E3M A;  1BT5 A;  3G30 A;  1YKD A;  2G2U A;  5L8M A;  3BFE A;  3EOI A;  1X0O A;  3DTK A;  4OPZ A;  2ZQC A;  1GHI A;  2Y2I A;  1O07 A;  2VGL M;  3CI6 A;  3NOU C;  3ZG0 A;  4NG2 A;  2ZLY A;  2ZC6 B;  4WUJ A;  2PHY A;  3CWF A;  4KG5 A;  1SDE A;  2PU4 A;  5F1F A;  5HAP A;  3GSG A;  2JBF A;  4KQR A;  2WAE A;  1AWI A;  3FYZ A;  5FQQ A;  4UA6 A;  4EV4 A;  1NJ4 A;  3AGE A;  4CLC A;  4XUX A;  1G6O A;  2ZQ7 A;  2OLU A;  3SW1 A;  3KSG A;  1YPR A;  1YLW A;  1XFN A;  2ZM2 A;  4MNR A;  4I3A A;  2EX8 A;  2HP9 A;  2BAS A;  1VB6 A;  2WYX A;  3OZH A;  3IBJ A;  3HVF A;  1MWS A;  1NYY A;  3K2N A;  4L0L A;  4PHT A;  5G18 A;  4G3V A;  3SOI A;  5CEB A;  2Q9N A;  3OC2 A;  2XR0 A;  1MXO A;  4CJN A;  4X53 A;  3DTI A;  4OPR A;  1KE4 A;  3CJM A;  1XPB A;  3UE3 A;  1UWP X;  4QB8 A;  3U4L P;  4X69 A;  4BBT A;  4OP8 A;  1YLY A;  3HJK A;  3IX8 A;  1YLP A;  2UV0 E;  3IT9 A;  3ZVW A;  3ZNY A;  1GHP A;  2W3E A;  4BL2 A;  1K56 A;  4Y0T A;  5CX7 A;  1L2S A;  4Y5F A;  1BLH A;  4S2I A;  4DMZ A;  3E4O A;  5EVI C;  1IYP A;  1ES3 A;  4BL3 A;  1TVF A;  2O0Y A;  5EOO A;  3G34 A;  2CC1 A;  1G68 A;  4QPR A;  3V3S A;  4HJ3 A;  5FAT A;  3DWZ A;  1XFQ A;  1JTG A;  4FUW A;  1QME A;  5FQI A;  1D06 A;  3MJQ A;  2W0N A;  3W2Z A;  4ZBE A;  3KYE A;  4WLA A;  2GJ3 A;  2A2L A;  4II7 A;  4WYY A;  3Q81 A;  2Y8H A;  2VX8 A;  3OOV A;  3A0R A;  1S4S A;  3LR3 A;  2PDR A;  4KZ6 A;  5EEC A;  1ESU A;  2W3H A;  2ZOH A;  3QNC A;  3VP4 A;  4PPR A;  4HBU A;  2ZMV A;  5GLB A;  1EWZ A;  5GLA A;  1FIK A;  2ZQA A;  4PMA A;  4BQM A;  1ODV A;  5EVI D;  1NRF A;  4LPZ A;  4UA7 A;  3T1S A;  2M7V A;  1N9L A;  1TDG A;  2Y2K A;  3G32 A;  3NDG A;  1JNU A;  3S7Q A;  1EW0 A;  3HLG A;  2HDU A;  4HJ4 A;  2IWB A;  4G3K A;  2Y55 A;  5IU1 A;  2EFX A;  4GN2 A;  5EOE A;  5GHX A;  2E8I A;  5IHV A;  4EBP A;  4PKY A;  3VE4 A;  4JF5 A;  1KGG A;  3L7H A;  3S7P A;  3LID A;  3HL9 A;  3PBO A;  3OPR A;  4QY5 A;  2DMW A;  2WUQ A;  3IH9 A;  2R78 A;  1XA1 A;  4MCW A;  2NUP C;  1STZ A;  1SCW A;  2O9C A;  4Y0O A;  4GS9 B;  2V2F F;  5IS1 A;  4GDB A;  2WKH A;  2Y59 A;  1ERQ A;  3ICY A;  1OTD A;  5IT5 A;  3TJZ C;  3SH8 A;  2ZC4 B;  4FH2 A;  1OJ5 A;  2AVX A;  1W8Y A;  4KEN B;  3B33 A;  3UB9 A;  5CGW A;  4EEU A;  3NY4 A;  1T18 A;  2C6W B;  3E4Q A;  3ZCZ A;  2J3T C;  1D1J A;  3ZG7 B;  3BW6 A;  2XDM A;  1G6A A;  4KZ8 A;  3PXP A;  3TSG A;  2B95 A;  4OPY A;  1F9I A;  3MSH A;  2IA2 A;  2V20 A;  2W27 A;  1ERM A;  3CUE A;  1NXY A;  2GZA A;  3A3E A;  3LIF A;  1IKI A;  3FG8 A;  3P01 A;  5GL9 A;  5I5L A;  2OWH A;  1LL5 A;  2V1A A;  5E2G A;  1ZKJ A;  2ZC7 A;  4IBR A;  5HL1 A;  3Q82 A;  4I38 A;  3R7W B;  5DFX A;  4HES A;  3Q7V B;  4L9E A;  4L9G A;  1TD5 A;  4OKP A;  2Y79 A;  3BEC A;  3QHY A;  4GB7 A;  1WE4 A;  1ALQ A;  4IHQ A;  1G5U A;  2ZJ9 A;  3FKV A;  3C30 A;  3LYX A;  5DTS A;  1VHM A;  3BYD A;  4LRY C;  2J3T D;  1RP5 A;  3N8L A;  2VK3 A;  1LL8 A;  3ZG9 B;  4ZJ1 A;  4R1G A;  3TW8 A;  1DJB A;  1QMF A;  5J7E A;  5AVF A;  2Y2J A;  5CHM A;  4DJ2 A;  3ISG A;  3RH8 B;  2Y2M A;  2IWD A;  4K08 A;  2JKR M;  1UWN X;  4OVD A;  2HV1 A;  2WKE A;  4IUH A;  2XK1 A;  2O9B A;  3MXR A;  1YAX A;  5HDD A;  2P7J A;  3W8K A;  4CPK A;  3EEH A;  2QJ5 A;  4KQO A;  3T1X A;  2Q0O A;  1RGY A;  1BSG A;  1TS7 A;  3PYP A;  3HBR A;  2I9V A;  4HIA A;  1YT4 A;  4DXC A;  3MMH A;  3LR4 A;  1CK3 A;  5KIZ A;  4Z1W A;  2PR5 A;  4WN5 A;  3E0Y A;  3WS5 A;  2XRN A;  1IKG A;  1DP9 A;  3PBR A;  4A5R A;  5L09 A;  4NEE D;  4F94 A;  3IWO A;  3GR2 A;  4S2P A;  2WGW B;  1ERO A;  5CHU A;  3BQ8 A;  4CLC E;  3QP2 A;  4GW9 A;  4JXV A;  4OLG A;  4JF4 A;  3V67 A;  5AQ9 A;  2QZ6 A;  3T4L A;  1IOU A;  2PYR A;  1N9O A;  4R3J A;  3HLD A;  2VKS A;  3EWK A;  2Z2M B;  2P9V B;  3IHB A;  2VZW A;  1BUL A;  4GZB A;  3IXD A;  4O8G A;  5FEF A;  4DE2 A;  3B47 A;  5AQB A;  3Q07 A;  3T4K A;  5TJJ A;  4NXG A;  1G28 A;  3IQA A;  4DXB A;  2A49 A;  4WZ5 A;  4X6T A;  3DBA A;  3NBL A;  4DN0 A;  1WYB A;  3D4F A;  2J80 A;  3R7W A;  4QJG A;  1PRQ A;  4FOF A;  3Q7V A;  4QY6 A;  5FA7 A;  1ACF A;  2L4R A;  2QMI A;  4GOG A;  1FCN A;  3LY3 A;  1OJG A;  3W4P A;  1YLT A;  4QD4 A;  1LL9 A;  3G35 A;  2EWV A;  5JYP A;  4QWO A;  2H5S A;  2H10 A;  4WEL A;  3G2Z A;  3NHQ A;  1S6R A;  3UME A;  3VOZ A;  4Y17 A;  4N92 A;  4Y2F A;  3IXB A;  4HY8 A;  1K25 A;  2R9X A;  1FOF A;  3M6B A;  5E2F A;  4KZ9 A;  1CEG A;  3SS4 A;  1OT9 A;  2XRO A;  1E3U A;  3F1N B;  4HHD A;  1KVL A;  1BLS A;  4D60 A;  4LRZ E;  1T19 A;  3HUO A;  3FZC A;  4Y0U A;  2UWX A;  3KYZ A;  3PTE A;  4EEP A;  4P6Z S;  3T50 A;  1O7E A;  3ZHH A;  3JPU A;  3VP3 A;  3EQU A;  5KMW A;  1K4F A;  3A0S A;  5F5Y A;  5J4E A;  1ZTU A;  4LFU A;  1VET B;  3B42 A;  3G6O A;  4KG2 A;  4R3A A;  3BQA A;  4KG6 A;  4LEN A;  4Q0J A;  2FFY A;  3C4O A;  2YKF A;  4GHI B;  4DDS A;  2EX9 A;  3MKF A;  2XD5 A;  4FCF A;  3NOP C;  4YIN A;  2QYB A;  4OQI A;  1ONG A;  1XJ3 A;  5HX9 A;  4O0P A;  3D3O A;  5L2F A;  2GX5 A;  1W79 A;  4UQI S;  5HZH A;  4RVA A;  5DJU A;  3UE0 A;  4EBN A;  2RL3 A;  2Y2P A;  3UN7 A;  1XKZ A;  1WYC A;  1LT0 A;  3NOT C;  2WGW A;  3N4I A;  4F3L B;  5GHZ A;  2X01 A;  3LI9 A;  1H8Y A;  3FPV A;  4N1X A;  4BLM A;  4EBL A;  5FAQ A;  4DF6 A;  5LBR A;  2ZQD A;  3MFX A;  4WMC D;  5HPF A;  4RX3 A;  3KYQ A;  4E6X A;  1YLJ A;  5HAR A;  3N6I A;  3UDX A;  2XEP A;  4U0X A;  3H82 B;  2P9V A;  4N9L A;  2EX6 A;  2XH9 A;  2ZM0 A;  2H28 A;  2ZQ8 A;  4GLQ A;  1GSV A;  5EVL A;  2Y91 A;  1XJ2 A;  3RFB A;  3KSI A;  2LB5 A;  1U60 A;  1MWU A;  2ZL1 B;  4I3I A;  4GDN A;  4QU3 A;  2Y2N A;  3O86 A;  1K38 A;  3A3I A;  3NIA A;  2Y2G A;  1IEL A;  5EVI B;  1YQS A;  3VOL A;  3JVU A;  1PW1 A;  3GRJ A;  3NCK A;  1YM1 A;  3G31 A;  3DAV A;  5CER A;  2WAD A;  4WL9 A;  4IUK A;  3IS2 B;  5MC7 A;  3LEQ A;  2W1R A;  2DRW A;  4X56 A;  1EI5 A;  5HL6 A;  1NYM A;  3MR0 A;  1Z6F A;  4NXE A;  5L07 A;  4MN6 A;  4KZ5 A;  4WBG A;  2PU2 A;  2GNX A;  4FD8 A;  2PRF A;  1YSQ A;  2VV6 A;  2EXB A;  3U2A A;  2Y2H A;  5A91 A;  3F1N A;  5TBM B;  5HWW A;  4XT2 B;  2XFS A;  4XXR A;  3P98 A;  4HOI A;  2BLS A;  1ES4 A;  1TDL A;  3JVV A;  1H3Q A;  4I39 A;  3S7N A;  3UY6 A;  3LCE A;  4GJ4 A;  2H0Y A;  2V8C A;  1YMX A;  4PM7 A;  5EV0 A;  3MBZ A;  2EFU A;  1VET A;  2VGL S;  1H8M A;  3BLM A;  4ID4 A;  2XD1 A;  4H6J B;  4NXB A;  3SS3 A;  2X71 A;  3MQQ A;  3UB5 P;  4GHI A;  1XX2 A;  3N8S A;  2RCX A;  2XA7 M;  3ZYT A;  3TE8 A;  3WS2 A;  2L1M A;  3WS1 A;  3BLS A;  1S4R A;  1LI9 A;  4UA9 A;  4ZTK A;  3OPH A;  2O9A A;  4PM6 A;  4MBH A;  1K55 C;  1MC0 A;  3AGF A;  3FC7 A;  4F3L A;  1FIL A;  4KZ3 A;  1D7E A;  2WZX A;  3MZF A;  4Y7P A;  2PD8 A;  3V3R A;  2EA9 A;  4E3I A;  2J7V A;  2XF3 A;  2I72 A;  4S2K A;  5FQ9 A;  1FSY A;  1LSW A;  3A3F A;  3CZD A;  3H82 A;  2K2N A;  3UE6 A;  2XLN A;  2V1B A;  3P7N A;  2OAP 1;  1K54 C;  3IWI A;  3VP0 A;  2C5W B;  4B88 A;  2VJW A;  5HFO A;  5FEG A;  3MFD A;  5M18 A;  5TGF A;  1GA9 A;  4ESP A;  3N8R A;  2ZL1 A;  3IH8 A;  3K3C A;  3UB7 A;  2B5R A;  2JKF A;  1NWZ A;  4BBV A;  1DY6 A;  5HSQ A;  4RYE A;  5EVI A;  2O99 A;  1FR6 A;  3MXS A;  3H9W A;  3O3V A;  2KLI A;  2WGI A;  1AXB A;  2PYP A;  1FQG A;  5FL3 A;  3IS2 A;  1VM1 A;  5G4Y A;  2JKG A;  4IBX A;  4WZ4 A;  4K91 A;  1OT6 A;  3F1O B;  3PBN A;  3BFG A;  1HVB A;  2VGJ A;  2FFF B;  5FAP A;  3IF6 C;  2W3F A;  3V5M A;  1Y4O A;  3O87 A;  1K0K A;  4GNU A;  1FCM A;  5L10 A;  3FKW A;  1XXM A;  2KX6 A;  1SKO B;  5TBM A;  4FSF A;  4XT2 A;  4X55 A;  4X1M A;  4LCL A;  3MZE A;  3UB6 A;  4G3W A;  2Y4A A;  3E2L A;  2Y2L A;  2V1Z A;  1K57 C;  3LFV A;  3OCN A;  3BEB A;  5E2E A;  3LEZ A;  2Q9M A;  1ONH A;  1BZA A;  4BD1 A;  2X02 A;  3DTE A;  2JKR I;  3IXG A;  5GHY A;  2WKR A;  5CED A;  1OME A;  3RTY A;  1S66 L;  5F69 A;  4H6J A;  2J9O A;  2ZD8 A;  1YLZ A;  4HI4 A;  4R4S A;  2HZ5 A;  3LUQ A;  3ULF A;  3BFF A;  5TFQ A;  4Y3I A;  2V0W A;  5DF8 A;  2B02 A;  3QP6 A;  3OCL A;  4M3K A;  1OTB A;  3M2K A;  4U0T A;  1MWR A;  5C5K A;  3G2Y A;  3S1Y A;  4IJG A;  1K54 A;  1H0M A;  4S2J A;  5A8B A;  4I5S A;  3UNW A;  4EQ1 A;  3D9Y A;  5HWT A;  1F2K A;  3SH9 A;  2DNS A;  2HDQ A;  5M19 A;  1XGJ A;  4R70 A;  4EES A;  4PAU A;  1YSP A;  1IFQ A;  1K4E A;  1PFL A;  1ZG4 A;  1GCE A;  5DTK A;  1XJ6 A;  4OQH A;  3QP4 A;  4IVK A;  4NKP A;  2ZC3 B;  2M7U A;  4KQQ A;  2ZMA A;  1TS0 A;  3LIA A;  5EUA A;  3UPP A;  4S2N C;  4R23 A;  3KO6 A;  1DP8 A;  3MF0 A;  3IF5 A;  1NY0 A;  3MZD A;  3BFD A;  5DJT A;  2P04 A;  3WS4 A;  2NUT C;  1T1C A;  1BLP A;  4JGP A;  3LI8 A;  4PM9 A;  3LIC A;  2MJ6 A;  4JBF A;  5U47 A;  2W1T B;  3RXX A;  4B4Z A;  3K3D A;  3ZQ5 A;  3R4K A;  3BFC A;  2GDN A;  4GS9 A;  2QHK A;  2OWJ A;  3VE3 A;  3C5A A;  5GLD A;  2E8J A;  2VV8 A;  2HF6 A;  4C6Y A;  3IX3 A;  2ACG A;  1ZG6 A;  1IYS A;  2Y2Q A;  3QP1 A;  4R6L A;  2R9W A;  2VEA A;  4EU0 A;  4C3Q A;  2JN7 A;  3E2K A;  3IX4 A;  1CF0 A;  4LGW A;  4KUK A;  3F1O A;  2Y2O A;  3EGD C;  3DTM A;  1F5M A;  5HD5 A;  3TOI A;  4Y13 A;  3UDF A;  3GV9 A;  3BWL A;  1SKO A;  4H8R A;  4OP5 A;  1UGU A;  5FQM A;  1KE3 A;  1MKI A;  4JGQ A;  5FQJ A;  4N1H A;  3HJI A;  2W3D A;  5DF9 A;  5HDC A;  3VOY A;  1I2W A;  2WKI A;  1PI5 A;  1GSX A;  4CQH A;  5A92 A;  1W5D A;  3N7W A;  1LSX A;  5AJG A;  4ME4 A;  4LV3 A;  2WK0 A;  4CLC C;  4HP9 A;  5F6A A;  4RX2 A;  1PWC A;  1DRM A;  2PT7 A;  4IVI A;  3C2W A;  1VEU B;  4MBF A;  4HEF A;  3MKE A;  1Q2Q A;  2PBD P;  4JGR A;  5EE8 A;  1FSW A;  5F1G A;  4N9K A;  2M1C A;  3ZVT A;  2QJ7 A;  3FV7 A;  3VV4 A;  1H8Z A;  3A0V A;  4K0X A;  3HLF A;  2V9A A;  4M4X A;  4UAA A;  1L3L A;  2EWW A;  1P97 A;  3FPW A;  4Q0I A;  3PHY A;  3QP5 A;  1PNE A;  1JWP A;  3SH7 A;  4P85 A;  3HLB A;  3ZDJ A;  1M6K A;  1IEM A;  5HDS A;  3UDI A;  3CIT A;  3OPL A;  1W63 M;  4P0M A;  5DKK A;  1ZC2 A;  3GMW A;  2WKQ A;  3LO7 A;  1Q2P A;  2G7U A;  4NET A;  3PBS A;  2PBY A;  4BBU A;  3S7O A;  3GTC A;  1L0F A;  5JYO A;  4MLL A;  4CLC D;  3LY4 A;  2HDS A;  4LV1 A;  4WF0 A;  4GD6 A;  2W1T A;  3F1P B;  3H7W B;  4AFI A;  3AGD A;  3UPO A;  3JYI A;  4GD8 A;  5M1A A;  3T4Q A;  2ZM8 A;  3EQV A;  3A3J A;  3WWX A;  1PZO A;  2KDK A;  2OOL A;  3OLO A;  4HH2 A;  3E4P A;  3BY8 A;  1JTD A;  4R0Q A;  1OTI A;  3CG5 A;  3PBT A;  1SDN A;  2KOI A;  2D02 A;  1MBL A;  4LLO B;  3MXQ A;  1N9N A;  2HJ9 C;  5EPH A;  4ETX A;  2J9P A;  3S22 A;  4ARZ B;  3RXW A;  4FTX A;  5DFY A;  4I3J A;  1E25 A;  2H0T A;  1L0D A;  4BD0 A;  2A24 B;  2EXA A;  3HLC A;  4R4R A;  1VQQ A;  4UEY A;  1A0K A;  4LV2 A;  3ZG8 B;  3Q1F A;  2J3W A;  3SZT A;  1CEF A;  4YNR A;  5FAO A;  5GLC A;  1OTA A;  1CI9 A;  1K56 D;  3BRM A;  1XGI A;  5F82 A;  4WMC A;  1NZU A;  1IYO A;  4KQD A;  3IHA A;  4DRT A;  4E3L A;  4WEJ A;  4DJ3 A;  4GCZ A;  4JXW A;  2K7S A;  2OLV A;  2OSU A;  4DDY A;  4OQ0 A;  3RJU A;  1PIO A;  2A3U A;  3PR6 A;  3PAE A;  1VEU A;  3NJA A;  5FDS A;  2XSS A;  5DF7 A;  4EW7 A;  1DJA A;  1S67 L;  2JC7 A;  1PZP A;  2YKH A;  3BY9 A;  1BUE A;  3C38 A;  4MN7 A;  5FI2 A;  5CHJ A;  2Z6D A;  3NUL A;  2WZZ A;  4HNB A;  4MBK A;  5J3W A;  3UE1 A;  4KZB A;  4JGO A;  4OPQ A;  3WS0 A;  5K5B A;  3QP8 A;  1K6R A;  4XUZ A;  2PAV P;  1J3W A;  2XFT A;  1E4D A;  5AQ7 A;  2HP5 A;  2HGV A;  2ZOI A;  1XJ4 A;  5CTM A;  4HJ6 A;  4DKI A;  1HD8 A;  4HQA A;  2ZMF A;  1SZV A;  4D2O A;  3EGX C;  4BEN A;  5CEC A;  4GKU A;  4R3B A;  5DKL A;  4KZA A;  3S4X A;  4K0W A;  3TRC A;  4E3J A;  2P08 A;  4OQG A;  5KSC A;  3BM6 A;  2HPB A;  3F1P A;  4PM8 A;  3H7W A;  5HPI A;  3IXH A;  1W7F A;  3KX0 X;  4ZRR A;  5A90 A;  2IWC A;  3CUE C;  4ZJ2 A;  1RCJ A;  4NK3 A;  3HCY A;  3HRE A;  3ITB A;  1SHV A;  3W4Q A;  3CHW P;  1KGE A;  4HBT A;  3HUN A;  4DE1 A;  4LRX C;  2ZBB A;  4X25 A;  4WEK A;  3OBF A;  4BJP A;  3NI9 A;  5HAI A;  4HP4 A;  3HLE A;  5FDH A;  4JXS A;  4E6W A;  4ARZ A;  1GA0 A;  1PYY A;  4OH0 A;  5A93 A;  1NLY A;  5D3O A;  4B4X A;  1GHM A;  3I7J A;  2A24 A;  3IF6 B;  3HLW A;  1Y54 A;  1H5X A;  5E2H A;  4HH3 A;  3ZFZ A;  5E43 A;  4L9F A;  1WA9 A;  2ZC5 B;  3CAX A;  1C3B A;  5FSR A;  5EM1 A;  1V9Z A;  2ZQ9 A;  4QHC A;  2FH5 A;  1Z09 A;  1F98 A;  5BOH A;  1IYQ A;  1CJF A;  1OTE A;  5CGX A;  2CMN A;  2VV7 A;  3M6H A;  3M2J A;  4O01 A;  4DE3 A;  4EET B;  1NLZ A;  5TR7 A;  4DE0 A;  4MEZ A;  2V8F A;  3ITA A;  4Q8I A;  4S2M A;  4RA7 A;  1T1A A;  3T4S A;  2B18 A;  2VLG A;  1I5Q A;  4JXG A;  1W8Q A;  3D72 A;  4EWF A;  1TS8 A;  1S1Y A;  1XA7 A;  3V50 A;  3WRZ A;  3VFH A;  4ETZ A;  4KZ4 A;  1ES5 A;  1ESI A;  1K55 A;  4LV0 A;  1J9M A;  1P9W A;  3GDI A;  3KSH A;  3C7V A;  2XA7 S;  3C8C A;  1HTZ A;  3L9K A;  4E3K A;  3W4O A;  1MKM A;  3A3D A;  3T1R A;  2OAQ 1;  4WM9 A;  4U3T A;  3VSL A;  2JHE A;  3ZNT A;  5KZH A;  4P87 A;  3T1Q B;  5HD3 A;  2L0W A;  3CPT B;  1HZO A;  3GQZ A;  2FZ0 A;  4OOL A;  4YOF A;  4E3O A;  3MQO A;  4B93 A;  4ZJ3 A;  1Y28 A;  4C75 A;  5DTT A;  3LR0 A;  4PKY G;  1KGF A;  4IED A;  2VGK A;  1HLU P;  1YMS A;  3DWK A;  2Z2L B;  2VA0 A;  2QPN A;  1SKF A;  3IBR A;  4WZ5 C;  4O7D A;  1PW8 A;  3VP1 A;  4RQ9 A;  2JKT I;  3NC8 A;  4MMN A;  4EQI A;  1DP6 A;  2QWS A;  2Z6C A;  3DW0 A;  4JF6 A;  1N9B A;  3LIB A;  3IWQ A;  2D01 A;  3NDE A;  5FAS A;  1ES2 A;  2HJE A;  3VP2 A;  3KSF A;  1MWT A;  2BTF P;  1KDW A;  1TF1 A;  5FQK A;  3IF6 A;  4P6Z M;  1ZHH B;  1L0E A;  3LR5 A;  1JWZ A;  4S2L A;  1BLC A;  1V9Y A;  5CRF A;  1L0G A;  4E3N A;  3MS6 A;  2J8Y A;  1CQA A;  3T4O A;  4OOM A;  4BMW A;  3UO9 A;  4JPM A;  3UB8 A;  3VFF A;  2JKT M;  3QNB A;  5EM0 A;  4OON A;  1KOU A;  5F83 A;  3ZGA B;  2BG1 A;  1I2S A;  1K57 A;  4YWZ A;  5J8X A;  4ZAM A;  5EFW A;  1OPX A;  1TS6 A;  2HDR A;  5AVE A;  1GSW A;  3GVB A;  3V39 A;  2WKP A;  3ZG5 A;  1MPL A;  4S2O A;  1JWV A;  4ZDX A;  5CXW A;  4R38 A;  4EUZ A;  2HP6 A;  4UQI M;  2PR6 A;  3UMD A;  3O5Y A;  5I94 A;  1S1Z A;  1KDS A;  4Q0H A;  2OV5 A;  4MN5 A;  4CLC B;  5FI7 A;  4E04 A;  2W3G A;  2WGV A;  2WAF A; 
#chains in the Genus database with same CATH homology
 1OTI A;  3LIF A;  2XA7 M;  3PBT A;  3FG8 A;  2KOI A;  3P01 A;  2D02 A;  5I5L A;  2OWH A;  3TE8 A;  3ZYT A;  2L1M A;  3LIE A;  4MDZ A;  2V1A A;  4LLO B;  3MXQ A;  1T1B A;  1N9N A;  2INW A;  3R7W B;  2HJ9 C;  4I38 A;  4ETX A;  3PBQ A;  1S4R A;  5DFX A;  2LB9 A;  4L9E A;  2O9A A;  4L9G A;  1TD5 A;  4ARZ B;  2QKP A;  5DFY A;  2Y79 A;  1MC0 A;  1MZU A;  2PD7 A;  4I3J A;  3FC7 A;  4F3L A;  4IHQ A;  1D7E A;  3C30 A;  3LYX A;  3T4T A;  2A24 B;  4EXO A;  5G4Z A;  1VHM A;  4B9O A;  4LRY C;  2J3T D;  2PD8 A;  1P9R A;  2V0U A;  2K31 A;  4UEY A;  1LL8 A;  2EA9 A;  3TW8 A;  2J3W A;  4YNR A;  1LSW A;  1BYW A;  5KSH A;  5J7E A;  5AVF A;  3E98 A;  3H82 A;  4EER A;  4DJ2 A;  1OTA A;  3RH8 B;  2K2N A;  1P0Z A;  3UE6 A;  4K08 A;  5HWV A;  2JKR M;  2V1B A;  3P7N A;  2OAP 1;  1UWN X;  3T4J A;  2HV1 A;  4IUH A;  2O9B A;  4BWI A;  4KQD A;  4EUV A;  2VJW A;  1YAX A;  4WEJ A;  5HDD A;  2P7J A;  3EEH A;  4DJ3 A;  2QJ5 A;  4KQO A;  4GCZ A;  2K7S A;  3K3C A;  3UB7 A;  1TS7 A;  3PR6 A;  3PYP A;  3EEA A;  3NJA A;  2XSS A;  4KUO A;  1NWZ A;  2I9V A;  4BBV A;  4HIA A;  4EW7 A;  3MMH A;  3LR4 A;  5HSQ A;  5KIZ A;  1S67 L;  2YKH A;  3BY9 A;  4Z1W A;  2O99 A;  3C38 A;  2PR5 A;  4MN7 A;  3MQ0 A;  1NRJ A;  4WN5 A;  3H9W A;  2KLI A;  2Z6D A;  3E0Y A;  2XRN A;  4HNB A;  1DP9 A;  2PYP A;  3PBR A;  5J3W A;  1W63 Q;  4NEE D;  4JGO A;  3CLO A;  5FL3 A;  3IS2 A;  1LSV A;  5F68 A;  5K5B A;  5G4Y A;  4NXF A;  3BJN A;  1OT6 A;  3GEC A;  3F1O B;  3PBN A;  1YKD A;  2HGV A;  2W3F A;  3BQ8 A;  5L8M A;  4CLC E;  3EOI A;  1X0O A;  2ZOI A;  4GW9 A;  1XJ4 A;  4HJ6 A;  4HQA A;  2ZMF A;  3EGX C;  2VGL M;  3V67 A;  2KX6 A;  3CI6 A;  5DKL A;  3NOU C;  5TBM A;  4FSF A;  4XT2 A;  3T4L A;  3UB6 A;  4G3W A;  4WUJ A;  2PHY A;  3CWF A;  3TRC A;  1IOU A;  2PYR A;  2P08 A;  1N9O A;  3LFV A;  3OCN A;  2VKS A;  3EWK A;  3F1P A;  3H7W A;  5HPI A;  2VZW A;  3KX0 X;  2JKR I;  4ZRR A;  4O8G A;  2WKR A;  3RTY A;  1S66 L;  3CUE C;  5F69 A;  4H6J A;  4CLC A;  3B47 A;  4HI4 A;  3LUQ A;  1G6O A;  3ULF A;  3HCY A;  3T4K A;  3SW1 A;  3KSG A;  5TJJ A;  4Y3I A;  2V0W A;  4NXG A;  1XFN A;  1G28 A;  4LRX C;  4I3A A;  2B02 A;  3OCL A;  2ZBB A;  1OTB A;  4WEK A;  3DBA A;  2BAS A;  1VB6 A;  3OBF A;  4BJP A;  5C5K A;  4DN0 A;  2J80 A;  3R7W A;  4IJG A;  4FOF A;  4HP4 A;  3IBJ A;  5A8B A;  4I5S A;  2L4R A;  4L0L A;  3K2N A;  4ARZ A;  4PHT A;  1OJG A;  4EQ1 A;  5HWT A;  4G3V A;  1NLY A;  2EWV A;  2A24 A;  4R70 A;  4WEL A;  4EES A;  3NHQ A;  3UME A;  4PAU A;  1YSP A;  3OC2 A;  1IFQ A;  4Y2F A;  4HH3 A;  4HY8 A;  1XJ6 A;  4L9F A;  4NKP A;  1WA9 A;  2M7U A;  3CAX A;  1OT9 A;  2XRO A;  1TS0 A;  3LIA A;  3UE3 A;  1UWP X;  3F1N B;  4HHD A;  4LRZ E;  3KO6 A;  1DP8 A;  3MF0 A;  1V9Z A;  1T19 A;  4BBT A;  5DJT A;  2P04 A;  2NUT C;  1T1C A;  3KYZ A;  3HJK A;  4JGP A;  4P6Z S;  4EEP A;  3LI8 A;  3T50 A;  3LIC A;  2FH5 A;  2MJ6 A;  3EQU A;  2W1T B;  1F98 A;  3K3D A;  3ZQ5 A;  3R4K A;  3A0S A;  5F5Y A;  4GS9 A;  2QHK A;  5J4E A;  1OTE A;  1ZTU A;  2W3E A;  2OWJ A;  2CMN A;  5CX7 A;  3VE3 A;  3B42 A;  3G6O A;  2VV7 A;  4Y5F A;  4R3A A;  3BQA A;  4Q0J A;  4O01 A;  2VV8 A;  2HF6 A;  2YKF A;  4GHI B;  4DMZ A;  4EET B;  1NLZ A;  3E4O A;  3NOP C;  2QYB A;  1T1A A;  1XJ3 A;  4R6L A;  3T4S A;  4O0P A;  3D3O A;  2B18 A;  2O0Y A;  2VLG A;  2VEA A;  4EU0 A;  3D72 A;  2JN7 A;  1TS8 A;  1S1Y A;  2GX5 A;  4QPR A;  4HJ3 A;  4UQI S;  4ETZ A;  5HZH A;  5DJU A;  1XFQ A;  4KUK A;  3F1O A;  1D06 A;  1LT0 A;  2W0N A;  3EGD C;  3MJQ A;  3NOT C;  3W2Z A;  4WLA A;  1F5M A;  2A2L A;  2GJ3 A;  4II7 A;  5HD5 A;  1P9W A;  3GDI A;  3KSH A;  2XA7 S;  3C8C A;  4F3L B;  2Y8H A;  2VX8 A;  3LI9 A;  3FPV A;  3OOV A;  1MKM A;  3A0R A;  2OAQ 1;  1S4S A;  3BWL A;  5LBR A;  3LR3 A;  3MFX A;  2PDR A;  2JHE A;  1UGU A;  2W3H A;  2ZOH A;  5HPF A;  3KYQ A;  5HD3 A;  2L0W A;  4JGQ A;  3HJI A;  2W3D A;  2ZMV A;  3H82 B;  2FZ0 A;  5DF9 A;  4OOL A;  5HDC A;  4YOF A;  1GSX A;  4CQH A;  3MQO A;  1ODV A;  2H28 A;  4LPZ A;  4GLQ A;  2M7V A;  1GSV A;  1LSX A;  4B93 A;  1N9L A;  1XJ2 A;  3KSI A;  2LB5 A;  4ME4 A;  5AJG A;  3RFB A;  1JNU A;  1Y28 A;  4CLC C;  3S7Q A;  1EW0 A;  4HP9 A;  4HJ4 A;  5F6A A;  4I3I A;  3LR0 A;  4PKY G;  4G3K A;  5IU1 A;  1DRM A;  2PT7 A;  3C2W A;  2VA0 A;  3IBR A;  4PKY A;  4JGR A;  3VE4 A;  3S7P A;  3VOL A;  2M1C A;  3LID A;  3JVU A;  4RQ9 A;  2QJ7 A;  3VV4 A;  2JKT I;  3PBO A;  3A0V A;  2DMW A;  2V9A A;  4MMN A;  2R78 A;  4M4X A;  1DP6 A;  2EWW A;  4MCW A;  4WL9 A;  2QWS A;  1P97 A;  2Z6C A;  2NUP C;  1STZ A;  3FPW A;  4IUK A;  4Q0I A;  3IS2 B;  3LIB A;  3PHY A;  2O9C A;  5MC7 A;  2W1R A;  4GS9 B;  5IS1 A;  2D01 A;  2HJE A;  3KSF A;  5HL6 A;  1TF1 A;  5HDS A;  1ZHH B;  3CIT A;  4P6Z M;  3ICY A;  3MR0 A;  3LR5 A;  1OTD A;  1W63 M;  1V9Y A;  5IT5 A;  4NXE A;  4MN6 A;  3TJZ C;  2GNX A;  5DKK A;  4OOM A;  3T4O A;  1YSQ A;  4BMW A;  2VV6 A;  1OJ5 A;  3U2A A;  3UB8 A;  2JKT M;  3B33 A;  3UB9 A;  2WKQ A;  3F1N A;  5TBM B;  4EEU A;  5HWW A;  1T18 A;  4XT2 B;  2G7U A;  3E4Q A;  1KOU A;  2J3T C;  3PBS A;  4HOI A;  4BBU A;  3S7O A;  4CLC D;  3BW6 A;  3JVV A;  4YWZ A;  1H3Q A;  4I39 A;  3S7N A;  5EFW A;  1OPX A;  1TS6 A;  4WF0 A;  5AVE A;  2W1T A;  3F1P B;  3PXP A;  1GSW A;  3H7W B;  4AFI A;  2WKP A;  4GJ4 A;  1F9I A;  3T4Q A;  3EQV A;  4R38 A;  2IA2 A;  2VGL S;  4UQI M;  1H8M A;  2PR6 A;  2W27 A;  3UMD A;  3CUE A;  3O5Y A;  2KDK A;  1S1Z A;  4H6J B;  4NXB A;  4Q0H A;  2OOL A;  4MN5 A;  4CLC B;  3OLO A;  4HH2 A;  4E04 A;  2W3G A;  3E4P A;  3BY8 A;  3MQQ A;  4GHI A;  2GZA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...