3H7WB

Crystal structure of the high affinity heterodimer of hif2 alpha and arnt c-terminal pas domains with the artificial ligand ths017
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
110
structure length
110
Chain Sequence
CQPTRFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Endothelial PAS domain-containing protein 1
publication title Principles of ligand binding within a completely buried cavity in HIF2alpha PAS-B
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2009-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF14598 PAS_11 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3h7wB01
3LIEA 4BBTA 3LIAA 1OTAA 5EFWA 4GCZA 4HP4A 2VV6A 5HD5A 4MN6A 4GHIA 4L9FA 5F68A 5J3WA 5TBMA 3IBRA 4XT2A 1GSVA 3F1OA 3H82B 2JHEA 4R6LA 3LICA 2JN7A 3BY8A 2GJ3A 3E4PA 3F1PA 5HWWA 3LIDA 1WA9A 4HIAA 3UB6A 1T1BA 2ZBBA 3ULFA 2INWA 3K3DA 4I38A 2QJ5A 4BBVA 2PYRA 2WKRA 2L4RA 1OTIA 2WKPA 4EESA 5KIZA 3A0SA 1XJ4A 3IS2A 1D06A 2OWJA 4YWZA 5A8BA 4JGOA 3A0RA 3D72A 3HJKA 1UWPX 1OTEA 2OOLA 4HOIA 3UMDA 1OTBA 1D7EA 4EQ1A 5HSQA 3LI8A 1XJ6A 4F3LB 3FC7A 3A0VA 2BASA 4I5SA 2YKHA 1LT0A 1T1CA 2EA9A 5AVEA 4GHIB 2P7JA 2VV8A 2PDRA 5TBMB 1LL8A 3PHYA 4R38A 2A24A 2PHYA 1N9LA 2ZOIA 1S4RA 4EETB 1F98A 3E4QA 1DP6A 4KUOA 4HY8A 4JGRA 4BBUA 3K3CA 3F1PB 1OT9A 4RQ9A 3E4OA 3UB7A 1Y28A 3VE3A 1ODVA 3UB8A 4HI4A 2VLGA 4EW7A 2PYPA 2V1BA 2L0WA 2R78A 4DJ2A 4GS9B 4LLOB 1T19A 4I3IA 3CLOA 5F6AA 4NXEA 1EW0A 1UWNX 3LUQA 3NOUC 4L9EA 3G6OA 3FG8A 4PKYA 1V9ZA 3OLOA 3VE4A 4HJ6A 1DP9A 4HH2A 1BYWA 3HJIA 2WKQA 2VV7A 1DRMA 5DJUA 1TS0A 4WL9A 2QJ7A 5HWTA 4E04A 3UE6A 1S4SA 4I39A 4DJ3A 4MN5A 2PD8A 4WUJA 1OJGA 3UMEA 2HV1A 1P0ZA 3F1NB 5I5LA 1LSWA 3B33A 1VB6A 5HWVA 5DKKA 1T18A 3VOLA 1NWZA 3MFXA 1P97A 4HP9A 1XJ3A 1F9IA 3C2WA 4HNBA 5F5YA 2V0WA 4B9OA 2V1AA 5HZHA 2K7SA 4EEUA 4NXFA 2Z6CA 4H6JA 2J80A 4XT2B 4HJ4A 3CWFA 3H7WA 3F1OB 2V9AA 4EXOA 5J7EA 2PR5A 2W27A 4EERA 1XFQA 4LRXC 3T50A 3ZQ5A 5HD3A 4K08A 2V0UA 4M4XA 4HQAA 4F3LA 3ICYA 1S1YA 3H9WA 1OT6A 4R3AA 5HDSA 3BWLA 3IS2B 3NOPC 1S66L 3SW1A 1S1ZA 3KX0X 4KQDA 1S67L 1X0OA 4LRZE 2QHKA 1T1AA 4NXGA 2QKPA 5HDDA 4HH3A 4HHDA 5DJTA 3RH8B 4I3JA 3RTYA 3MJQA 3EEHA 1N9OA 3NHQA 3NOTC 4JGQA 2D01A 3CAXA 3GDIA 2M1CA 4I3AA 4L9GA 3GECA 1G28A 1XFNA 4EEPA 1TS8A 1KOUA 2Z6DA 4GS9A 1LSXA 4H6JB 3H82A 3H7WB 1UGUA 4NXBA 2A24B 5DKLA 2B02A 3NJAA 4LRYC 3BY9A 3MXQA 5HDCA 2D02A 2PD7A 1GSWA 3MR0A 4R70A 2L1MA 2QWSA 5IU1A 3C8CA 3EWKA 3MQQA 2VEAA 3LIFA 3LYXA 5J4EA 3UB9A 1OTDA 2I9VA 1TS7A 3MQOA 3LI9A 2OWHA 4GW9A 1XJ2A 1V9YA 1N9NA 4LPZA 5AVFA 3PYPA 3F1NA 4WN5A 1JNUA 4WLAA 2KDKA 3P7NA 4PKYG 1MZUA 4JGPA 2CMNA 5IS1A 5G4ZA 2H28A 2PR6A 2YKFA 4HJ3A 2KX6A 3LIBA 1OJ5A 1DP8A 1TS6A 4KUKA 1LSVA 5G4YA 1GSXA 2W0NA 4WF0A 2ZOHA 5F69A
chains in the Genus database with same CATH superfamily
3ZYTA 1CEGA 3LIAA 1OTAA 3SH7A 1NZOA 1K4FA 3T12B 3T4TA 1BLSA 4L9FA 4L0LA 5DF9A 3WS1A 3N8LA 1N9BA 3Q7VA 1FSWA 5FQ9A 3IXDA 4KZ6A 4R6LA 1J9MA 1K56A 1Y4OA 1FSYA 3JPUA 3BY8A 3LR0A 4LENA 4DXBA 4KG2A 3VOZA 2ZM2A 4K91A 3LIDA 1T1BA 2O99A 2R9XA 1BLCA 1JWZA 1SKFA 3SS4A 4BBVA 4LV3A 2A2LA 2WKPA 3S4XA 4OOLA 1IELA 3IX3A 3A0SA 3IS2A 3E0YA 4OPYA 3IX8A 5A8BA 1GA9A 4JGOA 4NEED 3ITBA 4EUVA 2VGLM 1GCEA 3T4SA 5FQMA 2J9PA 3UMDA 5CXWA 2EXBA 4EQ1A 3A3FA 3S1YA 4JXWA 2YKHA 4ETZA 1P9WA 2W1TA 3M6HA 3LEQA 4BENA 4KZ5A 3MKEA 1T1CA 4AFIA 1LI9A 1PZPA 4NKPA 4IUKA 4PPRA 2P7JA 2PDRA 3O3VA 4ZJ3A 2VGKA 4EBLA 4E3KA 2B95A 3BM6A 1K25A 4WYYA 4GDNA 1XGJA 2OAP1 4EETB 2V8FA 5EVIA 4BBUA 3G34A 5DTKA 1OT9A 1YLWA 4RQ9A 3DTEA 3UB7A 3OZHA 1SZVA 4HI4A 1HLUP 1C3BA 1IKIA 5DTSA 4DJ2A 1H5XA 1H3QA 2EWWA 3Q1FA 4GD6A 3LR3A 4WMCA 4X69A 4I3IA 2LB5A 5F6AA 4NXEA 5L8MA 3T1SA 1EROA 3OOVA 1CK3A 1MPLA 3GSGA 4PKYA 1V9ZA 2Y2LA 5FEFA 1VETB 1YSPA 3B47A 3MKFA 1ALQA 2Y2PA 2O9CA 2G7UA 4KENB 4X1LA 4E6WA 2XD5A 2PAVP 3PR6A 3S22A 1DRMA 3HLDA 4GKUA 2O9BA 3A3EA 2WAFA 3ZHHA 3Q82A 2QJ7A 5HWTA 1F5MA 2W1TB 1I2WA 4JPMA 1IYSA 1SKOB 3PAEA 3BFGA 3D9YA 3QHYA 2NUPC 3UMEA 3A3JA 1CEFA 2HV1A 2VGJA 3QP6A 1MY8A 1NLZA 1VB6A 5GHXA 2HPBA 5DKKA 2WYXA 1NZUA 2VJWA 3C7VA 3HL9A 3VOLA 4JXVA 3EOIA 5EVIB 4HP9A 2W3DA 2GDNA 2J3WA 1ERQA 1F9IA 2Q9NA 3GQZA 3LR4A 5F5YA 4B9OA 4OP8A 4Y2FA 4WBGA 1XGIA 3TOIA 4F94A 2H10A 3FV7A 2JC7A 3QP1A 2W3FA 2JKGA 1YMSA 2H5SA 3F1OB 2V9AA 1BLHA 1ZTUA 2JKTM 4O7DA 5CGXA 3IF5A 2Y91A 4ZJ1A 2W1RA 4LRXC 1VHMA 4FH4A 1K55A 3PBQA 3ZFZA 5FSRA 5HD3A 4K08A 4M4XA 1ES2A 1JWPA 2WUQA 1VQQA 1H8ZA 1L0DA 2Y2GA 1K6RA 5HDSA 3P09A 3BWLA 5GL9A 4K0WA 4JLFA 4KQDA 1YLTA 4DDYA 2ZQAA 1X0OA 4WZ4A 3IBJA 3TG9A 3V39A 4LGWA 3C5AA 5DJTA 3LY4A 3VP4A 2M7UA 3BRMA 2O9AA 3QNBA 1KVMA 1NRJA 1N9OA 4MNRA 4JGQA 4P87A 3TW8A 5L07A 4GLQA 3VP2A 1NLYA 1NXYA 3LGOA 5EM0A 5CTNA 2M1CA 3M2KA 2IWBA 3EEAA 1ES4A 1L2SA 4P6ZS 4FCFA 4GN2A 1ZG4A 5HAPA 3ZGAB 1G28A 2PT7A 3I7JA 3NDEA 5BOHA 1M6KA 3BQAA 3RXXA 4YNRA 3NIAA 2WKEA 5HDCA 1TEMA 2PD7A 2P74A 1GSWA 2QWSA 1QMEA 5IU1A 3EWKA 2K31A 3KSGA 1VEUB 1FR6A 3LIFA 5J4EA 3UB9A 5D3OA 2I9VA 4E3MA 1TS7A 3MQOA 3LI9A 5KMWA 1E4DA 1LLBA 3ZDJA 1RGZA 4K0XA 3V3RA 4LPZA 1ESIA 4KQQA 1RCJA 5EOEA 4WN5A 4PKYG 1MZUA 3MQ0A 4CLCC 3JVUA 1DJCA 1Y54A 2H0YA 2EX6A 3VP3A 1FR1A 2YKFA 4HJ3A 3LIBA 2GX5A 2R9WA 5FQQA 1TS6A 4GOGA 1GHPA 4KUKA 2W0NA 4D2OA 4BMWA 1GA0A 3QP8A 3EQUA 5EFWA 4GCZA 5FI2A 5CGWA 1WE4A 4HP4A 4EQIA 2VV6A 4Y7PA 5HD5A 4MN6A 5FQKA 4FD8A 5CHMA 4NETA 1A0KA 4XT2A 3T1XA 4ZDXA 4Q0IA 4CLCD 3AGDA 2JN7A 1CJFA 2X01A 1N4OA 2VA0A 4PAUA 3HCYA 3W4PA 5CEBA 4E3JA 4HIAA 3U4LP 2ZBBA 2INWA 2ZC5B 1MKMA 3K3DA 4DMZA 2PYRA 1OTIA 5FQIA 5GLAA 4EESA 4PM6A 5KIZA 4DKIA 2LB9A 3IHAA 1ONHA 1CF0A 2OWJA 5M19A 4YWZA 3LY3A 1MKIA 1IYOA 4ZTKA 1ZC2A 4B4XA 4MBHA 2Y2QA 2FFYA 2JKRM 3EGXC 2EFXA 4O0PA 3A0VA 4JXSA 5AQBA 4OONA 1LT0A 4OP5A 2J8YA 5FI6A 3DAVA 4DDSA 1Q2QA 1FCOA 3AGFA 3PBOA 5HL1A 1JWVA 1LL5A 4KG6A 4P6BA 5FDSA 1FILA 3PHYA 1DJAA 2A24A 2PHYA 4OH0A 2G2UA 2JCHA 4UEYA 3S7QA 3N6IA 2W3EA 1DP6A 2WKIA 1JVJA 4HY8A 1BZAA 2V1ZA 3K3CA 2OAQ1 1STZA 1MWTA 3CPTA 2IWCA 1ODVA 3VE3A 3UB8A 3UDIA 3NULA 3NCKA 2VLGA 4XUXA 1KE4A 2PYPA 4RVAA 2HP5A 2ZQ8A 2ZD8A 1WYCA 4GZBA 1K38A 3GMWA 4GS9B 4RX3A 3QNCA 2Y2IA 3Q81A 3MZEA 4MCWA 2Z2LB 2DCFA 4DN0A 3DWZA 3WS0A 1UWNX 2RL3A 5A93A 3NOUC 3DWKA 1DJBA 2PU4A 5EVLA 1PI5A 2HDQA 5EE8A 3VE4A 2ZLYA 1DP9A 2EWVA 3DTKA 2Y2NA 3HJIA 1SDNA 1EWZA 3ZG9B 4QY5A 4X56A 2Y2OA 2HZ5A 1TS0A 3W4QA 1D1JA 4WL9A 5HFOA 3KSIA 3ZVWA 3UE6A 2J7VA 3ZG8B 4JXGA 4DJ3A 3CMZA 3MXRA 5EVEA 4YOFA 4MN5A 3HBRA 5DF7A 3IF6C 1NYYA 3F1NB 3IX4A 3P98A 5I5LA 3V50A 3IH9A 1LSWA 5A91A 5L10A 1MC0A 5HWVA 2FFFB 3VSKA 3MFXA 3N8RA 3OCNA 1XJ3A 2WZZA 4OLGA 2ZC3B 1I5QA 3C2WA 2UV0E 4KQOA 3FPVA 4HNBA 1YQSA 1K4EA 4BD0A 2V1AA 4OQIA 5HL6A 1PI4A 3G31A 2W3HA 1PWCA 4EEUA 5FAPA 4H6JA 3FKVA 4ZRRA 5GHYA 3Q7VB 3DW0A 3DTMA 1PIOA 5J7EA 4BL2A 2PR5A 4EWFA 3D4FA 4EERA 4P6ZM 4KQRA 1XFQA 4DE2A 1YMXA 2Y2HA 2X71A 3HLWA 3T4KA 3JVVA 3T50A 2WZXA 5E2HA 5CERA 2V0UA 2XQZA 4HQAA 4F3LA 3TRCA 5FAQA 3VP0A 3WS5A 1H8YA 1SCWA 2J9OA 1OT6A 4R3AA 3BFDA 4CLCA 3OPLA 3TSGA 3SS3A 2XFTA 1KGFA 3IS2B 3NOPC 1KGGA 3SW1A 1S1ZA 4O01A 4KZ7A 3JYIA 3HUMA 4B4ZA 2IWDA 3HUNA 4DF6A 3LR5A 3C38A 1NYMA 1IYPA 2V2FF 5AQAA 2EX9A 5EV0A 2XDMA 1YT4A 2H0TA 1MWRA 2QMIA 4FUWA 3GDIA 4OQGA 1K0KA 5DTTA 5TFQA 4I3AA 2MJ6A 4PM5A 3Q07A 3KSHA 3T4OA 4L9GA 2PU2A 1W5DA 1TS8A 1KOUA 5GLCA 3S7OA 1LSXA 4H6JB 2FZ0A 4QD4A 3BFEA 1XXMA 2EX2A 4WEKA 5GLBA 5DKLA 4Y0TA 2WGWA 1BT5A 1LHYA 3BQ8A 4E3LA 4B88A 3WRTA 4S2NC 3BYDA 4R70A 1MWUA 3MQQA 3QP4A 3Q7ZA 4G3WA 1S0WA 3ZG5A 4PM8A 4MDZA 3E2KA 3C4OA 1Z6FA 3IWIA 2GZAA 4S2PA 1YLYA 1N9NA 4CLCB 2A49A 5HAQA 3DTIA 1K57A 3EQVA 3ZG7B 1MXOA 5A90A 3PBRA 2KLIA 4X6TA 1PRQA 4ARZA 2V20A 1TD5A 4WLAA 2KDKA 3P7NA 1ZKJA 3KYZA 4JGPA 4E3NA 2WADA 5MC7A 5IS1A 2ZJ9A 1YLPA 1W8QA 2PR6A 4IHQA 3BFCA 4M3KA 1OJ5A 1DP8A 1G68A 4WELA 2Q9MA 3NC8A 5G4YA 1GSXA 3ZCZA 5EUAA 3CJMA 2HDSA 2EFUA 4ID4A 5F69A 3LIEA 5F83A 4DE3A 1KE0A 4EUZA 4GHIA 4II7A 5J3WA 5TBMA 3MS6A 3IBRA 2ZC6B 3KO6A 4KG5A 2Y79A 4ZAMA 3UPNA 2JHEA 1FIKA 3TJZC 4CLCE 3LICA 5FASA 3PBNA 3MSHA 3KYEA 3UDFA 2WGWB 2Q0OA 3V5MA 1KVLA 3F1PA 4UAAA 3G30A 2XLNA 2QPNA 1WA9A 3UB6A 4UA9A 3G35A 1L0EA 1YM1A 4IEDA 2VKSA 4HBUA 2WKRA 3SZTA 5CRFA 5F1FA 3M2JA 3CI6A 3IXHA 3R7WA 5JYOA 1YLZA 5KSCA 4OOMA 1W63Q 3MZDA 3A0RA 2OV5A 3S7NA 4QB8A 1EI5A 3GV9A 2OOLA 4RA7A 2WK0A 3NDGA 3E98A 3N8SA 1HZOA 3P01A 5L09A 1D7EA 1VM1A 4BQMA 4X25A 1XJ6A 5CHJA 2JKFA 2C6WB 1Z09A 3FC7A 5K5BA 3IF6A 1K6SA 1W7FA 2BASA 4KZ8A 4I5SA 4MEZA 2WAEA 2EXAA 2ZMFA 3LO7A 4U3TA 1XKZA 1IKGA 2ZC4B 5HARA 2EA9A 3HLEA 2Y2KA 3E2LA 1G6AA 4GHIB 3VFFA 2VV8A 5TBMB 3KYQA 3IQAA 2ZM8A 2DMWA 1LL8A 4P85A 3W8KA 2ZOIA 3UB5P 5L2FA 1S4RA 5E2GA 4DXCA 4NK3A 3E4QA 4BLMA 2QYBA 3OPPA 4YINA 5EOOA 3F1PB 5LBRA 4N9KA 1TDGA 2BLSA 2VK3A 3E4OA 1Y28A 1E3UD 5KZHA 4UA6A 2K2NA 2V1BA 2BTFP 2R78A 5F82A 4NG2A 4R1GA 4KZAA 4LLOB 1T19A 3O5YA 4S2KA 3CLOA 4BD1A 1PW8A 3O88A 3LUQA 4QJGA 1TVFA 4G3KA 2GNXA 3FG8A 5FQJA 3OLOA 4Z9QA 4Y0UA 1G6OA 1H8MA 2VV7A 2P9VA 4IVKA 5DJUA 4Q8IA 5TGFA 3IF6B 4QY6A 5A92A 3CZDA 1L3LA 2B18A 5E2FA 4E04A 3SOIA 1BUEA 5DF8A 4I39A 1E25A 4N9LA 3MXSA 3MF0A 4WUJA 4OQHA 4JF5A 1HD8A 1M40A 5IT5A 4KZ4A 2HDUA 4GDBA 3S7PA 3HLFA 1K57C 1YSQA 1ZHHB 4P0MA 2HP6A 5DFYA 3BJNA 2B5RA 2HJ9C 2XGNA 3SH9A 4WEJA 3BECA 4S2MA 4BWIA 1RGYA 3IT9A 1ONGA 5FAOA 4UHUA 2X02A 1XP4A 2V0WA 3R4KA 2W3GA 2OLVA 1YAXA 5HZHA 4RYEA 3U2AA 5FATA 3C4PA 3IHBA 5CHUA 3BW6A 2ZC7A 4XT2B 4S2NA 3T1RA 3CWFA 3PBTA 4QWOA 4EV4A 4EXOA 3CHWP 3ZG0A 2JKTI 4R3BA 4GNUA 2I72A 3WWXA 2JBFA 3W2ZA 2W27A 3RJUA 3N7WA 3GRJA 3L9KA 5CEDA 1S6RA 5FA7A 3ZQ5A 2XD1A 2ZL1A 1PW1A 1OPXA 4EBNA 4U0TA 1KE3A 4IJGA 4LCLA 3ICYA 4BL3A 2P9VB 3CUEC 3H9WA 5C5KA 1ZG6A 5HPIA 4FSFA 1SDEA 1F2KA 5U47A 3FWLA 5FL3A 3UPPA 1K54C 1BULA 1S67L 4LRZE 2QHKA 1T1AA 3CG5A 5HDDA 1PZOA 1YLJA 5E2EA 1YPRA 4I3JA 4JF6A 3RTYA 4KZ3A 2HF6A 3NOTC 3GR2A 4MN7A 3GTCA 1GHMA 3BLMA 2IA2A 4D60A 5GLDA 1W8YA 3CAXA 4ME4A 3T4JA 3GECA 2G2WA 4EEPA 3C7UA 3H82A 3UPOA 1L0GA 4NXBA 1MBLA 4HEFA 3B42A 2A24B 1I2SA 4ZJ2A 4MLLA 3VOYA 3D3OA 1PFLA 1KDWA 1KGEA 2ZM0A 4LRYC 1KDSA 5CGSA 4QU3A 2XFSA 3MXQA 1AWIA 2D02A 2XH9A 3N4IA 1HTZA 1YKDA 2L1MA 1VETA 4WZ5A 3ZNYA 3CPTB 4BJPA 3C8CA 3UNWA 2E8IA 2XK1A 2ZL1B 2VEAA 3ZNTA 3SH8A 1OTDA 3A3IA 4Q0HA 3NI9A 3MBZA 4ETXA 3DBAA 1ES3A 1ES5A 2OWHA 2Y8HA 1JTGA 2DRWA 5M1AA 5M18A 1PWDA 1V9YA 4MBFA 4Y15A 1FCMA 1SKOA 1JTDA 1Q2PA 5AVFA 2VZWA 3PYPA 2RCXA 1JNUA 1E3UA 4UQIS 3OCLA 2Y55A 5G4ZA 4FTXA 5TR7A 2H28A 3V67A 2XA7S 4S2IA 5DFXA 4FOFA 2FH5A 3WS4A 3IWQA 1GHIA 3VFHA 4XUZA 1LSVA 4N92A 3UY6A 2J3TC 5KSHA 3TE8A 2ZOHA 1BLPA 5GHZA 3RXWA 4BBTA 2Y2JA 4N1HA 5F68A 1BSGA 2E8JA 1CI9A 3G2YA 3BLSA 4X68A 1GSVA 3PTEA 3F1OA 1QMFA 3H82B 4C6YA 4MMNA 5HW3A 3FPWA 3SS5A 2Y4AA 4OOYA 4DE1A 2GJ3A 3E4PA 3MZFA 3T4QA 5FEGA 5HWWA 2J3TD 1O07A 3LCEA 3ULFA 4I38A 5CECA 2QJ5A 4CQHA 1HVBA 4EBPA 4OKPA 3BEBA 5AJGA 2L4RA 1CI8A 3C30A 4OVDA 1XPBA 1LL9A 1XJ4A 5AQ7A 4IBRA 1D06A 4PMAA 5I94A 3UDXA 2WGVA 1ERMA 2XROA 3UN7A 4MBKA 3D72A 3HJKA 1UWPX 1OTEA 1NRFA 4HOIA 3V3SA 3OBFA 3T4LA 2ACGA 2HGVA 1OTBA 3FZCA 5HSQA 2JKRI 1SHVA 3LI8A 4F3LB 3UO9A 1L0FA 2JE5A 3ITAA 3PAGA 4PM7A 3PBSA 3WS2A 2XF3A 2PRFA 5AVEA 3VMAA 3UE3A 1TF1A 5J8XA 2XSSA 3UE0A 1FQGA 4RX2A 4R38A 2O0YA 1N9LA 2VX8A 2EX8A 3NY4A 3VSLA 1F98A 4LV1A 4JKTA 4E3IA 4KUOA 4JGRA 4JBFA 2ZMVA 3HUOA 4R23A 5E43A 1IOUA 1VEUA 4R4SA 2VGLS 2ZQDA 2XEPA 4EW7A 1PNEA 2L0WA 4Z1WA 4C3QA 4LFUA 3G32A 1BTLA 3QP2A 4S2LA 2XR0A 3A3DA 1CQAA 2Y59A 4H8RA 2A3UA 1ESUA 2Y2MA 1EW0A 3IWOA 1OMEA 3MFDA 4Y5FA 4FH2A 3CUEA 4G3VA 4L9EA 3G6OA 2XRNA 1W63M 1NJ4A 4HJ6A 4HH2A 1K54A 1BYWA 2WKQA 1K56D 3OPRA 4GD8A 1LI0A 4GB7A 4KZ9A 5F1GA 4WZ5C 4HBTA 3IH8A 1S4SA 4JF4A 3HREA 4HESA 4YFMA 3WRZA 2PD8A 1OJGA 3OPHA 1P0ZA 4ARZB 4OPRA 3B33A 3NBLA 1P9RA 1TDLA 1T18A 2KOIA 1PYYA 3QP5A 4LCMA 1NWZA 2ZMAA 3MMHA 1P97A 4R0QA 4Q0JA 4CPKA 3EGDC 3ZVTA 4ZBEA 2HDRA 5JYPA 4EU0A 3NECA 4ESPA 3G4PA 4N1XA 1XA7A 4IBXA 1FCNA 5EVIC 5EM1A 2K7SA 4NXFA 2WGIA 2Z6CA 2J80A 5DVAA 4HJ4A 4WM9A 2UWXA 3H7WA 4GJ4A 2ZQ9A 5CTMA 4B93A 1XX2A 4OPZA 1IYQA 3K2NA 1WYBA 2P04A 4R4RA 2WKHA 5IHVA 4LV2A 3W4OA 5HPFA 3T1QB 5TJJA 4Y0OA 3ISGA 2BG1A 3PXPA 3LEZA 4S2JA 1S1YA 3M6BA 1FOFA 1XA1A 2AVXA 5EVID 2HJEA 4E6XA 4O8GA 1AXBA 4DRTA 2QZ6A 1RP5A 4C75A 4LV0A 3R7WB 3VV4A 4OQ0A 1S66L 1IFQA 5FI7A 3KX0X 4NXGA 2C5WB 2QKPA 1ACFA 4HH3A 5G18A 1O7EA 4PHTA 4HHDA 3B3XA 3RH8B 4Y17A 4OPQA 3LFVA 4WMCD 3HLCA 3O86A 3MJQA 3EEHA 4DE0A 3NHQA 4Y3IA 3IXGA 2D01A 2DNSA 1IEMA 1J3WA 4Y13A 2CC1A 1W79A 3RFBA 2PBDP 4UA7A 4UQIM 3O87A 4E3OA 5AQ9A 2OLUA 3GVBA 4QHCA 4PM9A 1PWGA 2XA7M 1XFNA 3IXBA 2Z6DA 4GS9A 2HP9A 2Z2MB 3FYZA 3H7WB 1UGUA 2B02A 3AGEA 3HLBA 3NJAA 4X53A 3BY9A 1H0MA 2ZQCA 4KZBA 2P08A 2V8CA 3MR0A 3HVFA 5HAIA 4R3JA 4A5RA 4U0XA 5CX7A 3LYXA 3UE1A 5EECA 3G2ZA 1K55C 4GW9A 4S2OA 4CJNA 1XJ2A 1G5UA 3BFFA 1MWSA 3KSFA 2PBYA 5FDHA 4QPRA 4X1MA 3OC2A 2NUTC 4IVIA 3F1NA 3FKWA 5HX9A 3VP1A 2M7VA 2CMNA 1U60A 2OSUA 1DY6A 3HLGA 4IUHA 2KX6A 5EPHA 3L7HA 4XXRA 2ZQ7A 4OLDA 3CITA 1NY0A 4WF0A 4X55A
chains in the Genus database with same CATH topology
4BMWA 3LIEA 3ZYTA 4BBTA 3LIAA 1OTAA 3EQUA 5EFWA 4GCZA 4HP4A 3T4TA 2VV6A 5HD5A 4MN6A 4GHIA 4L9FA 4L0LA 4II7A 5F68A 5DF9A 5J3WA 5TBMA 3IBRA 4XT2A 3KO6A 1GSVA 4Q0IA 2Y79A 3F1OA 3H82B 2JHEA 4R6LA 4MMNA 3TJZC 4CLCE 3LICA 4CLCD 2JN7A 3PBNA 3BY8A 3FPWA 3LR0A 2VA0A 4PAUA 2GJ3A 3E4PA 3F1PA 3T4QA 3HCYA 5HWWA 3LIDA 1WA9A 4HIAA 3UB6A 1T1BA 2J3TD 2O99A 2ZBBA 3ULFA 2INWA 1MKMA 3K3DA 4I38A 4DMZA 2QJ5A 4CQHA 4BBVA 2PYRA 2VKSA 2WKRA 5AJGA 2A2LA 1OTIA 2L4RA 2WKPA 3CI6A 4EESA 5KIZA 3C30A 2LB9A 4OOLA 3R7WA 3A0SA 1XJ4A 3IS2A 1D06A 2OWJA 3E0YA 4YWZA 4OOMA 5A8BA 1W63Q 4JGOA 2XROA 3A0RA 4NEED 4EUVA 2VGLM 3S7NA 3T4SA 3D72A 3HJKA 1UWPX 1OTEA 2OOLA 4HOIA 3UMDA 3OBFA 3T4LA 2HGVA 1OTBA 3E98A 3P01A 1D7EA 4EQ1A 5HSQA 2JKRI 2JKRM 3EGXC 3LI8A 1XJ6A 4F3LB 4O0PA 3FC7A 5K5BA 3A0VA 2BASA 4I5SA 2YKHA 4ETZA 1P9WA 1LT0A 2W1TA 2ZMFA 3PBSA 1T1CA 4AFIA 2EA9A 5AVEA 4NKPA 3PBOA 3UE3A 4GHIB 4IUKA 2P7JA 1TF1A 2VV8A 2PDRA 5TBMB 3KYQA 2DMWA 2XSSA 1LL8A 3PHYA 4R38A 2O0YA 2A24A 2PHYA 1N9LA 2ZOIA 1S4RA 2OAP1 4UEYA 2VX8A 4EETB 3S7QA 1F98A 3E4QA 2W3EA 1DP6A 4KUOA 4HY8A 2QYBA 4JGRA 4BBUA 3K3CA 2ZMVA 2OAQ1 3F1PB 1STZA 5LBRA 1OT9A 4RQ9A 1IOUA 3E4OA 3UB7A 1Y28A 1ODVA 3VE3A 3UB8A 4HI4A 2VLGA 2VGLS 2K2NA 4EW7A 2PYPA 2V1BA 2L0WA 4Z1WA 2R78A 4DJ2A 1H3QA 2EWWA 4GS9B 3LR3A 4MCWA 4LLOB 1T19A 4I3IA 3O5YA 3CLOA 2LB5A 5F6AA 4DN0A 4NXEA 5L8MA 1EW0A 1UWNX 3OOVA 4Y5FA 3LUQA 3NOUC 3CUEA 4G3VA 4L9EA 4G3KA 3G6OA 2GNXA 3FG8A 2XRNA 4PKYA 1V9ZA 1W63M 3OLOA 1YSPA 3B47A 3VE4A 1G6OA 1H8MA 4HJ6A 1DP9A 2EWVA 4HH2A 1BYWA 2G7UA 2O9CA 3HJIA 2WKQA 3PR6A 2VV7A 1DRMA 5DJUA 2O9BA 1TS0A 4WL9A 2B18A 2QJ7A 5HWTA 1F5MA 2W1TB 3KSIA 4E04A 3UE6A 1S4SA 4I39A 4DJ3A 2NUPC 4YOFA 4MN5A 2PD8A 3MF0A 1OJGA 4WUJA 3UMEA 2HV1A 1P0ZA 3F1NB 5I5LA 4ARZB 1LSWA 3B33A 1NLZA 1VB6A 5IT5A 1MC0A 1P9RA 5HWVA 5DKKA 1T18A 2KOIA 2VJWA 3S7PA 1YSQA 3VOLA 1NWZA 1ZHHB 3MFXA 3EOIA 3MMHA 1P97A 3OCNA 4Q0JA 5DFYA 3BJNA 4HP9A 2W3DA 3EGDC 1XJ3A 2J3WA 2HJ9C 1F9IA 3LR4A 4WEJA 4BWIA 4EU0A 3C2WA 4KQOA 3FPVA 4HNBA 5F5YA 2V0WA 4B9OA 3R4KA 4Y2FA 2W3GA 2V1AA 1YAXA 5HL6A 5HZHA 3U2AA 2W3HA 3BW6A 2K7SA 4EEUA 4NXFA 2Z6CA 4H6JA 2J80A 4ZRRA 4XT2B 4HJ4A 3CWFA 3H7WA 4GJ4A 2W3FA 3PBTA 4B93A 3F1OB 2V9AA 4EXOA 2JKTI 5J7EA 1ZTUA 2PR5A 2JKTM 3W2ZA 2W27A 3K2NA 2P04A 4EERA 4P6ZM 2W1RA 1XFQA 4LRXC 1VHMA 3PBQA 5HPFA 5TJJA 3T4KA 3JVVA 3T50A 3ZQ5A 5HD3A 3PXPA 4K08A 1OPXA 2V0UA 4M4XA 4HQAA 4F3LA 3TRCA 4IJGA 3ICYA 1S1YA 3CUEC 3H9WA 5C5KA 1OT6A 2HJEA 4R3AA 4O8GA 5HPIA 4FSFA 3R7WB 4CLCA 5HDSA 3VV4A 3BWLA 5FL3A 3IS2B 3NOPC 1S66L 1IFQA 3SW1A 1S1ZA 3KX0X 4KQDA 1S67L 1X0OA 4LRZE 2QHKA 4O01A 1T1AA 4NXGA 2QKPA 5HDDA 3IBJA 4HH3A 4PHTA 4HHDA 5DJTA 3RH8B 2M7UA 2O9AA 3LFVA 1NRJA 3LR5A 4I3JA 3RTYA 3MJQA 3C38A 3EEHA 1N9OA 2HF6A 3NHQA 3NOTC 4MN7A 4Y3IA 4JGQA 2D01A 3TW8A 4GLQA 2IA2A 3CAXA 1NLYA 3GDIA 3RFBA 2M1CA 4UQIM 3EEAA 4ME4A 4I3AA 2MJ6A 3T4JA 4P6ZS 3KSHA 3T4OA 4L9GA 3GECA 1G28A 2XA7M 1XFNA 2PT7A 4EEPA 1TS8A 1KOUA 2Z6DA 4GS9A 3S7OA 1LSXA 4H6JB 2FZ0A 3H82A 3H7WB 1UGUA 4NXBA 4WEKA 3B42A 2A24B 5DKLA 2B02A 3BQAA 3D3OA 4YNRA 3NJAA 4LRYC 3BQ8A 3BY9A 3MXQA 5HDCA 2D02A 2P08A 2PD7A 1GSWA 3MR0A 4R70A 1YKDA 2L1MA 2QWSA 5IU1A 4BJPA 3C8CA 3EWKA 2K31A 3KSGA 3MQQA 4G3WA 2VEAA 3LIFA 5CX7A 3LYXA 5J4EA 4MDZA 3UB9A 1OTDA 2I9VA 4Q0HA 4ETXA 3DBAA 1TS7A 3MQOA 3LI9A 2OWHA 2Y8HA 4GW9A 2GZAA 1XJ2A 1V9YA 1N9NA 4CLCB 3KSFA 4QPRA 4LPZA 5AVFA 2VZWA 3EQVA 3OC2A 2NUTC 3PYPA 3PBRA 2KLIA 3F1NA 4WN5A 1JNUA 4ARZA 1TD5A 4WLAA 2KDKA 3P7NA 3KYZA 4PKYG 2M7VA 4UQIS 3OCLA 1MZUA 3MQ0A 4JGPA 4CLCC 2CMNA 3JVUA 5MC7A 5IS1A 5G4ZA 4IUHA 2H28A 3V67A 2PR6A 2YKFA 4HJ3A 4IHQA 2KX6A 3LIBA 2XA7S 5DFXA 1OJ5A 4FOFA 2FH5A 2GX5A 1DP8A 1TS6A 4KUKA 3CITA 4WELA 1LSVA 5G4YA 1GSXA 2J3TC 2W0NA 5KSHA 4WF0A 3TE8A 2ZOHA 5F69A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LIE A;  4BBT A;  3LIA A;  1OTA A;  5EFW A;  4GCZ A;  4HP4 A;  2VV6 A;  5HD5 A;  4MN6 A;  4GHI A;  4L9F A;  5F68 A;  5J3W A;  5TBM A;  3IBR A;  4XT2 A;  1GSV A;  3F1O A;  3H82 B;  2JHE A;  4R6L A;  3LIC A;  2JN7 A;  3BY8 A;  2GJ3 A;  3E4P A;  3F1P A;  5HWW A;  3LID A;  1WA9 A;  4HIA A;  3UB6 A;  1T1B A;  2ZBB A;  3ULF A;  2INW A;  3K3D A;  4I38 A;  2QJ5 A;  4BBV A;  2PYR A;  2WKR A;  2L4R A;  1OTI A;  2WKP A;  4EES A;  5KIZ A;  3A0S A;  1XJ4 A;  3IS2 A;  1D06 A;  2OWJ A;  4YWZ A;  5A8B A;  4JGO A;  3A0R A;  3D72 A;  3HJK A;  1UWP X;  1OTE A;  2OOL A;  4HOI A;  3UMD A;  1OTB A;  1D7E A;  4EQ1 A;  5HSQ A;  3LI8 A;  1XJ6 A;  4F3L B;  3FC7 A;  3A0V A;  2BAS A;  4I5S A;  2YKH A;  1LT0 A;  1T1C A;  2EA9 A;  5AVE A;  4GHI B;  2P7J A;  2VV8 A;  2PDR A;  5TBM B;  1LL8 A;  3PHY A;  4R38 A;  2A24 A;  2PHY A;  1N9L A;  2ZOI A;  1S4R A;  4EET B;  1F98 A;  3E4Q A;  1DP6 A;  4KUO A;  4HY8 A;  4JGR A;  4BBU A;  3K3C A;  3F1P B;  1OT9 A;  4RQ9 A;  3E4O A;  3UB7 A;  1Y28 A;  3VE3 A;  1ODV A;  3UB8 A;  4HI4 A;  2VLG A;  4EW7 A;  2PYP A;  2V1B A;  2L0W A;  2R78 A;  4DJ2 A;  4GS9 B;  4LLO B;  1T19 A;  4I3I A;  3CLO A;  5F6A A;  4NXE A;  1EW0 A;  1UWN X;  3LUQ A;  3NOU C;  4L9E A;  3G6O A;  3FG8 A;  4PKY A;  1V9Z A;  3OLO A;  3VE4 A;  4HJ6 A;  1DP9 A;  4HH2 A;  1BYW A;  3HJI A;  2WKQ A;  2VV7 A;  1DRM A;  5DJU A;  1TS0 A;  4WL9 A;  2QJ7 A;  5HWT A;  4E04 A;  3UE6 A;  1S4S A;  4I39 A;  4DJ3 A;  4MN5 A;  2PD8 A;  4WUJ A;  1OJG A;  3UME A;  2HV1 A;  1P0Z A;  3F1N B;  5I5L A;  1LSW A;  3B33 A;  1VB6 A;  5HWV A;  5DKK A;  1T18 A;  3VOL A;  1NWZ A;  3MFX A;  1P97 A;  4HP9 A;  1XJ3 A;  1F9I A;  3C2W A;  4HNB A;  5F5Y A;  2V0W A;  4B9O A;  2V1A A;  5HZH A;  2K7S A;  4EEU A;  4NXF A;  2Z6C A;  4H6J A;  2J80 A;  4XT2 B;  4HJ4 A;  3CWF A;  3H7W A;  3F1O B;  2V9A A;  4EXO A;  5J7E A;  2PR5 A;  2W27 A;  4EER A;  1XFQ A;  4LRX C;  3T50 A;  3ZQ5 A;  5HD3 A;  4K08 A;  2V0U A;  4M4X A;  4HQA A;  4F3L A;  3ICY A;  1S1Y A;  3H9W A;  1OT6 A;  4R3A A;  5HDS A;  3BWL A;  3IS2 B;  3NOP C;  1S66 L;  3SW1 A;  1S1Z A;  3KX0 X;  4KQD A;  1S67 L;  1X0O A;  4LRZ E;  2QHK A;  1T1A A;  4NXG A;  2QKP A;  5HDD A;  4HH3 A;  4HHD A;  5DJT A;  3RH8 B;  4I3J A;  3RTY A;  3MJQ A;  3EEH A;  1N9O A;  3NHQ A;  3NOT C;  4JGQ A;  2D01 A;  3CAX A;  3GDI A;  2M1C A;  4I3A A;  4L9G A;  3GEC A;  1G28 A;  1XFN A;  4EEP A;  1TS8 A;  1KOU A;  2Z6D A;  4GS9 A;  1LSX A;  4H6J B;  3H82 A;  3H7W B;  1UGU A;  4NXB A;  2A24 B;  5DKL A;  2B02 A;  3NJA A;  4LRY C;  3BY9 A;  3MXQ A;  5HDC A;  2D02 A;  2PD7 A;  1GSW A;  3MR0 A;  4R70 A;  2L1M A;  2QWS A;  5IU1 A;  3C8C A;  3EWK A;  3MQQ A;  2VEA A;  3LIF A;  3LYX A;  5J4E A;  3UB9 A;  1OTD A;  2I9V A;  1TS7 A;  3MQO A;  3LI9 A;  2OWH A;  4GW9 A;  1XJ2 A;  1V9Y A;  1N9N A;  4LPZ A;  5AVF A;  3PYP A;  3F1N A;  4WN5 A;  1JNU A;  4WLA A;  2KDK A;  3P7N A;  4PKY G;  1MZU A;  4JGP A;  2CMN A;  5IS1 A;  5G4Z A;  2H28 A;  2PR6 A;  2YKF A;  4HJ3 A;  2KX6 A;  3LIB A;  1OJ5 A;  1DP8 A;  1TS6 A;  4KUK A;  1LSV A;  5G4Y A;  1GSX A;  2W0N A;  4WF0 A;  2ZOH A;  5F69 A; 
#chains in the Genus database with same CATH topology
 3ZYT A;  1CEG A;  3LIA A;  1OTA A;  3SH7 A;  1NZO A;  1K4F A;  3T12 B;  3T4T A;  1BLS A;  4L9F A;  4L0L A;  5DF9 A;  3WS1 A;  3N8L A;  1N9B A;  3Q7V A;  1FSW A;  5FQ9 A;  3IXD A;  4KZ6 A;  4R6L A;  1J9M A;  1K56 A;  1Y4O A;  1FSY A;  3JPU A;  3BY8 A;  3LR0 A;  4LEN A;  4DXB A;  4KG2 A;  3VOZ A;  2ZM2 A;  4K91 A;  3LID A;  1T1B A;  2O99 A;  2R9X A;  1BLC A;  1JWZ A;  1SKF A;  3SS4 A;  4BBV A;  4LV3 A;  2A2L A;  2WKP A;  3S4X A;  4OOL A;  1IEL A;  3IX3 A;  3A0S A;  3IS2 A;  3E0Y A;  4OPY A;  3IX8 A;  5A8B A;  1GA9 A;  4JGO A;  4NEE D;  3ITB A;  4EUV A;  2VGL M;  1GCE A;  3T4S A;  5FQM A;  2J9P A;  3UMD A;  5CXW A;  2EXB A;  4EQ1 A;  3A3F A;  3S1Y A;  4JXW A;  2YKH A;  4ETZ A;  1P9W A;  2W1T A;  3M6H A;  3LEQ A;  4BEN A;  4KZ5 A;  3MKE A;  1T1C A;  4AFI A;  1LI9 A;  1PZP A;  4NKP A;  4IUK A;  4PPR A;  2P7J A;  2PDR A;  3O3V A;  4ZJ3 A;  2VGK A;  4EBL A;  4E3K A;  2B95 A;  3BM6 A;  1K25 A;  4WYY A;  4GDN A;  1XGJ A;  2OAP 1;  4EET B;  2V8F A;  5EVI A;  4BBU A;  3G34 A;  5DTK A;  1OT9 A;  1YLW A;  4RQ9 A;  3DTE A;  3UB7 A;  3OZH A;  1SZV A;  4HI4 A;  1HLU P;  1C3B A;  1IKI A;  5DTS A;  4DJ2 A;  1H5X A;  1H3Q A;  2EWW A;  3Q1F A;  4GD6 A;  3LR3 A;  4WMC A;  4X69 A;  4I3I A;  2LB5 A;  5F6A A;  4NXE A;  5L8M A;  3T1S A;  1ERO A;  3OOV A;  1CK3 A;  1MPL A;  3GSG A;  4PKY A;  1V9Z A;  2Y2L A;  5FEF A;  1VET B;  1YSP A;  3B47 A;  3MKF A;  1ALQ A;  2Y2P A;  2O9C A;  2G7U A;  4KEN B;  4X1L A;  4E6W A;  2XD5 A;  2PAV P;  3PR6 A;  3S22 A;  1DRM A;  3HLD A;  4GKU A;  2O9B A;  3A3E A;  2WAF A;  3ZHH A;  3Q82 A;  2QJ7 A;  5HWT A;  1F5M A;  2W1T B;  1I2W A;  4JPM A;  1IYS A;  1SKO B;  3PAE A;  3BFG A;  3D9Y A;  3QHY A;  2NUP C;  3UME A;  3A3J A;  1CEF A;  2HV1 A;  2VGJ A;  3QP6 A;  1MY8 A;  1NLZ A;  1VB6 A;  5GHX A;  2HPB A;  5DKK A;  2WYX A;  1NZU A;  2VJW A;  3C7V A;  3HL9 A;  3VOL A;  4JXV A;  3EOI A;  5EVI B;  4HP9 A;  2W3D A;  2GDN A;  2J3W A;  1ERQ A;  1F9I A;  2Q9N A;  3GQZ A;  3LR4 A;  5F5Y A;  4B9O A;  4OP8 A;  4Y2F A;  4WBG A;  1XGI A;  3TOI A;  4F94 A;  2H10 A;  3FV7 A;  2JC7 A;  3QP1 A;  2W3F A;  2JKG A;  1YMS A;  2H5S A;  3F1O B;  2V9A A;  1BLH A;  1ZTU A;  2JKT M;  4O7D A;  5CGX A;  3IF5 A;  2Y91 A;  4ZJ1 A;  2W1R A;  4LRX C;  1VHM A;  4FH4 A;  1K55 A;  3PBQ A;  3ZFZ A;  5FSR A;  5HD3 A;  4K08 A;  4M4X A;  1ES2 A;  1JWP A;  2WUQ A;  1VQQ A;  1H8Z A;  1L0D A;  2Y2G A;  1K6R A;  5HDS A;  3P09 A;  3BWL A;  5GL9 A;  4K0W A;  4JLF A;  4KQD A;  1YLT A;  4DDY A;  2ZQA A;  1X0O A;  4WZ4 A;  3IBJ A;  3TG9 A;  3V39 A;  4LGW A;  3C5A A;  5DJT A;  3LY4 A;  3VP4 A;  2M7U A;  3BRM A;  2O9A A;  3QNB A;  1KVM A;  1NRJ A;  1N9O A;  4MNR A;  4JGQ A;  4P87 A;  3TW8 A;  5L07 A;  4GLQ A;  3VP2 A;  1NLY A;  1NXY A;  3LGO A;  5EM0 A;  5CTN A;  2M1C A;  3M2K A;  2IWB A;  3EEA A;  1ES4 A;  1L2S A;  4P6Z S;  4FCF A;  4GN2 A;  1ZG4 A;  5HAP A;  3ZGA B;  1G28 A;  2PT7 A;  3I7J A;  3NDE A;  5BOH A;  1M6K A;  3BQA A;  3RXX A;  4YNR A;  3NIA A;  2WKE A;  5HDC A;  1TEM A;  2PD7 A;  2P74 A;  1GSW A;  2QWS A;  1QME A;  5IU1 A;  3EWK A;  2K31 A;  3KSG A;  1VEU B;  1FR6 A;  3LIF A;  5J4E A;  3UB9 A;  5D3O A;  2I9V A;  4E3M A;  1TS7 A;  3MQO A;  3LI9 A;  5KMW A;  1E4D A;  1LLB A;  3ZDJ A;  1RGZ A;  4K0X A;  3V3R A;  4LPZ A;  1ESI A;  4KQQ A;  1RCJ A;  5EOE A;  4WN5 A;  4PKY G;  1MZU A;  3MQ0 A;  4CLC C;  3JVU A;  1DJC A;  1Y54 A;  2H0Y A;  2EX6 A;  3VP3 A;  1FR1 A;  2YKF A;  4HJ3 A;  3LIB A;  2GX5 A;  2R9W A;  5FQQ A;  1TS6 A;  4GOG A;  1GHP A;  4KUK A;  2W0N A;  4D2O A;  4BMW A;  1GA0 A;  3QP8 A;  3EQU A;  5EFW A;  4GCZ A;  5FI2 A;  5CGW A;  1WE4 A;  4HP4 A;  4EQI A;  2VV6 A;  4Y7P A;  5HD5 A;  4MN6 A;  5FQK A;  4FD8 A;  5CHM A;  4NET A;  1A0K A;  4XT2 A;  3T1X A;  4ZDX A;  4Q0I A;  4CLC D;  3AGD A;  2JN7 A;  1CJF A;  2X01 A;  1N4O A;  2VA0 A;  4PAU A;  3HCY A;  3W4P A;  5CEB A;  4E3J A;  4HIA A;  3U4L P;  2ZBB A;  2INW A;  2ZC5 B;  1MKM A;  3K3D A;  4DMZ A;  2PYR A;  1OTI A;  5FQI A;  5GLA A;  4EES A;  4PM6 A;  5KIZ A;  4DKI A;  2LB9 A;  3IHA A;  1ONH A;  1CF0 A;  2OWJ A;  5M19 A;  4YWZ A;  3LY3 A;  1MKI A;  1IYO A;  4ZTK A;  1ZC2 A;  4B4X A;  4MBH A;  2Y2Q A;  2FFY A;  2JKR M;  3EGX C;  2EFX A;  4O0P A;  3A0V A;  4JXS A;  5AQB A;  4OON A;  1LT0 A;  4OP5 A;  2J8Y A;  5FI6 A;  3DAV A;  4DDS A;  1Q2Q A;  1FCO A;  3AGF A;  3PBO A;  5HL1 A;  1JWV A;  1LL5 A;  4KG6 A;  4P6B A;  5FDS A;  1FIL A;  3PHY A;  1DJA A;  2A24 A;  2PHY A;  4OH0 A;  2G2U A;  2JCH A;  4UEY A;  3S7Q A;  3N6I A;  2W3E A;  1DP6 A;  2WKI A;  1JVJ A;  4HY8 A;  1BZA A;  2V1Z A;  3K3C A;  2OAQ 1;  1STZ A;  1MWT A;  3CPT A;  2IWC A;  1ODV A;  3VE3 A;  3UB8 A;  3UDI A;  3NUL A;  3NCK A;  2VLG A;  4XUX A;  1KE4 A;  2PYP A;  4RVA A;  2HP5 A;  2ZQ8 A;  2ZD8 A;  1WYC A;  4GZB A;  1K38 A;  3GMW A;  4GS9 B;  4RX3 A;  3QNC A;  2Y2I A;  3Q81 A;  3MZE A;  4MCW A;  2Z2L B;  2DCF A;  4DN0 A;  3DWZ A;  3WS0 A;  1UWN X;  2RL3 A;  5A93 A;  3NOU C;  3DWK A;  1DJB A;  2PU4 A;  5EVL A;  1PI5 A;  2HDQ A;  5EE8 A;  3VE4 A;  2ZLY A;  1DP9 A;  2EWV A;  3DTK A;  2Y2N A;  3HJI A;  1SDN A;  1EWZ A;  3ZG9 B;  4QY5 A;  4X56 A;  2Y2O A;  2HZ5 A;  1TS0 A;  3W4Q A;  1D1J A;  4WL9 A;  5HFO A;  3KSI A;  3ZVW A;  3UE6 A;  2J7V A;  3ZG8 B;  4JXG A;  4DJ3 A;  3CMZ A;  3MXR A;  5EVE A;  4YOF A;  4MN5 A;  3HBR A;  5DF7 A;  3IF6 C;  1NYY A;  3F1N B;  3IX4 A;  3P98 A;  5I5L A;  3V50 A;  3IH9 A;  1LSW A;  5A91 A;  5L10 A;  1MC0 A;  5HWV A;  2FFF B;  3VSK A;  3MFX A;  3N8R A;  3OCN A;  1XJ3 A;  2WZZ A;  4OLG A;  2ZC3 B;  1I5Q A;  3C2W A;  2UV0 E;  4KQO A;  3FPV A;  4HNB A;  1YQS A;  1K4E A;  4BD0 A;  2V1A A;  4OQI A;  5HL6 A;  1PI4 A;  3G31 A;  2W3H A;  1PWC A;  4EEU A;  5FAP A;  4H6J A;  3FKV A;  4ZRR A;  5GHY A;  3Q7V B;  3DW0 A;  3DTM A;  1PIO A;  5J7E A;  4BL2 A;  2PR5 A;  4EWF A;  3D4F A;  4EER A;  4P6Z M;  4KQR A;  1XFQ A;  4DE2 A;  1YMX A;  2Y2H A;  2X71 A;  3HLW A;  3T4K A;  3JVV A;  3T50 A;  2WZX A;  5E2H A;  5CER A;  2V0U A;  2XQZ A;  4HQA A;  4F3L A;  3TRC A;  5FAQ A;  3VP0 A;  3WS5 A;  1H8Y A;  1SCW A;  2J9O A;  1OT6 A;  4R3A A;  3BFD A;  4CLC A;  3OPL A;  3TSG A;  3SS3 A;  2XFT A;  1KGF A;  3IS2 B;  3NOP C;  1KGG A;  3SW1 A;  1S1Z A;  4O01 A;  4KZ7 A;  3JYI A;  3HUM A;  4B4Z A;  2IWD A;  3HUN A;  4DF6 A;  3LR5 A;  3C38 A;  1NYM A;  1IYP A;  2V2F F;  5AQA A;  2EX9 A;  5EV0 A;  2XDM A;  1YT4 A;  2H0T A;  1MWR A;  2QMI A;  4FUW A;  3GDI A;  4OQG A;  1K0K A;  5DTT A;  5TFQ A;  4I3A A;  2MJ6 A;  4PM5 A;  3Q07 A;  3KSH A;  3T4O A;  4L9G A;  2PU2 A;  1W5D A;  1TS8 A;  1KOU A;  5GLC A;  3S7O A;  1LSX A;  4H6J B;  2FZ0 A;  4QD4 A;  3BFE A;  1XXM A;  2EX2 A;  4WEK A;  5GLB A;  5DKL A;  4Y0T A;  2WGW A;  1BT5 A;  1LHY A;  3BQ8 A;  4E3L A;  4B88 A;  3WRT A;  4S2N C;  3BYD A;  4R70 A;  1MWU A;  3MQQ A;  3QP4 A;  3Q7Z A;  4G3W A;  1S0W A;  3ZG5 A;  4PM8 A;  4MDZ A;  3E2K A;  3C4O A;  1Z6F A;  3IWI A;  2GZA A;  4S2P A;  1YLY A;  1N9N A;  4CLC B;  2A49 A;  5HAQ A;  3DTI A;  1K57 A;  3EQV A;  3ZG7 B;  1MXO A;  5A90 A;  3PBR A;  2KLI A;  4X6T A;  1PRQ A;  4ARZ A;  2V20 A;  1TD5 A;  4WLA A;  2KDK A;  3P7N A;  1ZKJ A;  3KYZ A;  4JGP A;  4E3N A;  2WAD A;  5MC7 A;  5IS1 A;  2ZJ9 A;  1YLP A;  1W8Q A;  2PR6 A;  4IHQ A;  3BFC A;  4M3K A;  1OJ5 A;  1DP8 A;  1G68 A;  4WEL A;  2Q9M A;  3NC8 A;  5G4Y A;  1GSX A;  3ZCZ A;  5EUA A;  3CJM A;  2HDS A;  2EFU A;  4ID4 A;  5F69 A;  3LIE A;  5F83 A;  4DE3 A;  1KE0 A;  4EUZ A;  4GHI A;  4II7 A;  5J3W A;  5TBM A;  3MS6 A;  3IBR A;  2ZC6 B;  3KO6 A;  4KG5 A;  2Y79 A;  4ZAM A;  3UPN A;  2JHE A;  1FIK A;  3TJZ C;  4CLC E;  3LIC A;  5FAS A;  3PBN A;  3MSH A;  3KYE A;  3UDF A;  2WGW B;  2Q0O A;  3V5M A;  1KVL A;  3F1P A;  4UAA A;  3G30 A;  2XLN A;  2QPN A;  1WA9 A;  3UB6 A;  4UA9 A;  3G35 A;  1L0E A;  1YM1 A;  4IED A;  2VKS A;  4HBU A;  2WKR A;  3SZT A;  5CRF A;  5F1F A;  3M2J A;  3CI6 A;  3IXH A;  3R7W A;  5JYO A;  1YLZ A;  5KSC A;  4OOM A;  1W63 Q;  3MZD A;  3A0R A;  2OV5 A;  3S7N A;  4QB8 A;  1EI5 A;  3GV9 A;  2OOL A;  4RA7 A;  2WK0 A;  3NDG A;  3E98 A;  3N8S A;  1HZO A;  3P01 A;  5L09 A;  1D7E A;  1VM1 A;  4BQM A;  4X25 A;  1XJ6 A;  5CHJ A;  2JKF A;  2C6W B;  1Z09 A;  3FC7 A;  5K5B A;  3IF6 A;  1K6S A;  1W7F A;  2BAS A;  4KZ8 A;  4I5S A;  4MEZ A;  2WAE A;  2EXA A;  2ZMF A;  3LO7 A;  4U3T A;  1XKZ A;  1IKG A;  2ZC4 B;  5HAR A;  2EA9 A;  3HLE A;  2Y2K A;  3E2L A;  1G6A A;  4GHI B;  3VFF A;  2VV8 A;  5TBM B;  3KYQ A;  3IQA A;  2ZM8 A;  2DMW A;  1LL8 A;  4P85 A;  3W8K A;  2ZOI A;  3UB5 P;  5L2F A;  1S4R A;  5E2G A;  4DXC A;  4NK3 A;  3E4Q A;  4BLM A;  2QYB A;  3OPP A;  4YIN A;  5EOO A;  3F1P B;  5LBR A;  4N9K A;  1TDG A;  2BLS A;  2VK3 A;  3E4O A;  1Y28 A;  1E3U D;  5KZH A;  4UA6 A;  2K2N A;  2V1B A;  2BTF P;  2R78 A;  5F82 A;  4NG2 A;  4R1G A;  4KZA A;  4LLO B;  1T19 A;  3O5Y A;  4S2K A;  3CLO A;  4BD1 A;  1PW8 A;  3O88 A;  3LUQ A;  4QJG A;  1TVF A;  4G3K A;  2GNX A;  3FG8 A;  5FQJ A;  3OLO A;  4Z9Q A;  4Y0U A;  1G6O A;  1H8M A;  2VV7 A;  2P9V A;  4IVK A;  5DJU A;  4Q8I A;  5TGF A;  3IF6 B;  4QY6 A;  5A92 A;  3CZD A;  1L3L A;  2B18 A;  5E2F A;  4E04 A;  3SOI A;  1BUE A;  5DF8 A;  4I39 A;  1E25 A;  4N9L A;  3MXS A;  3MF0 A;  4WUJ A;  4OQH A;  4JF5 A;  1HD8 A;  1M40 A;  5IT5 A;  4KZ4 A;  2HDU A;  4GDB A;  3S7P A;  3HLF A;  1K57 C;  1YSQ A;  1ZHH B;  4P0M A;  2HP6 A;  5DFY A;  3BJN A;  2B5R A;  2HJ9 C;  2XGN A;  3SH9 A;  4WEJ A;  3BEC A;  4S2M A;  4BWI A;  1RGY A;  3IT9 A;  1ONG A;  5FAO A;  4UHU A;  2X02 A;  1XP4 A;  2V0W A;  3R4K A;  2W3G A;  2OLV A;  1YAX A;  5HZH A;  4RYE A;  3U2A A;  5FAT A;  3C4P A;  3IHB A;  5CHU A;  3BW6 A;  2ZC7 A;  4XT2 B;  4S2N A;  3T1R A;  3CWF A;  3PBT A;  4QWO A;  4EV4 A;  4EXO A;  3CHW P;  3ZG0 A;  2JKT I;  4R3B A;  4GNU A;  2I72 A;  3WWX A;  2JBF A;  3W2Z A;  2W27 A;  3RJU A;  3N7W A;  3GRJ A;  3L9K A;  5CED A;  1S6R A;  5FA7 A;  3ZQ5 A;  2XD1 A;  2ZL1 A;  1PW1 A;  1OPX A;  4EBN A;  4U0T A;  1KE3 A;  4IJG A;  4LCL A;  3ICY A;  4BL3 A;  2P9V B;  3CUE C;  3H9W A;  5C5K A;  1ZG6 A;  5HPI A;  4FSF A;  1SDE A;  1F2K A;  5U47 A;  3FWL A;  5FL3 A;  3UPP A;  1K54 C;  1BUL A;  1S67 L;  4LRZ E;  2QHK A;  1T1A A;  3CG5 A;  5HDD A;  1PZO A;  1YLJ A;  5E2E A;  1YPR A;  4I3J A;  4JF6 A;  3RTY A;  4KZ3 A;  2HF6 A;  3NOT C;  3GR2 A;  4MN7 A;  3GTC A;  1GHM A;  3BLM A;  2IA2 A;  4D60 A;  5GLD A;  1W8Y A;  3CAX A;  4ME4 A;  3T4J A;  3GEC A;  2G2W A;  4EEP A;  3C7U A;  3H82 A;  3UPO A;  1L0G A;  4NXB A;  1MBL A;  4HEF A;  3B42 A;  2A24 B;  1I2S A;  4ZJ2 A;  4MLL A;  3VOY A;  3D3O A;  1PFL A;  1KDW A;  1KGE A;  2ZM0 A;  4LRY C;  1KDS A;  5CGS A;  4QU3 A;  2XFS A;  3MXQ A;  1AWI A;  2D02 A;  2XH9 A;  3N4I A;  1HTZ A;  1YKD A;  2L1M A;  1VET A;  4WZ5 A;  3ZNY A;  3CPT B;  4BJP A;  3C8C A;  3UNW A;  2E8I A;  2XK1 A;  2ZL1 B;  2VEA A;  3ZNT A;  3SH8 A;  1OTD A;  3A3I A;  4Q0H A;  3NI9 A;  3MBZ A;  4ETX A;  3DBA A;  1ES3 A;  1ES5 A;  2OWH A;  2Y8H A;  1JTG A;  2DRW A;  5M1A A;  5M18 A;  1PWD A;  1V9Y A;  4MBF A;  4Y15 A;  1FCM A;  1SKO A;  1JTD A;  1Q2P A;  5AVF A;  2VZW A;  3PYP A;  2RCX A;  1JNU A;  1E3U A;  4UQI S;  3OCL A;  2Y55 A;  5G4Z A;  4FTX A;  5TR7 A;  2H28 A;  3V67 A;  2XA7 S;  4S2I A;  5DFX A;  4FOF A;  2FH5 A;  3WS4 A;  3IWQ A;  1GHI A;  3VFH A;  4XUZ A;  1LSV A;  4N92 A;  3UY6 A;  2J3T C;  5KSH A;  3TE8 A;  2ZOH A;  1BLP A;  5GHZ A;  3RXW A;  4BBT A;  2Y2J A;  4N1H A;  5F68 A;  1BSG A;  2E8J A;  1CI9 A;  3G2Y A;  3BLS A;  4X68 A;  1GSV A;  3PTE A;  3F1O A;  1QMF A;  3H82 B;  4C6Y A;  4MMN A;  5HW3 A;  3FPW A;  3SS5 A;  2Y4A A;  4OOY A;  4DE1 A;  2GJ3 A;  3E4P A;  3MZF A;  3T4Q A;  5FEG A;  5HWW A;  2J3T D;  1O07 A;  3LCE A;  3ULF A;  4I38 A;  5CEC A;  2QJ5 A;  4CQH A;  1HVB A;  4EBP A;  4OKP A;  3BEB A;  5AJG A;  2L4R A;  1CI8 A;  3C30 A;  4OVD A;  1XPB A;  1LL9 A;  1XJ4 A;  5AQ7 A;  4IBR A;  1D06 A;  4PMA A;  5I94 A;  3UDX A;  2WGV A;  1ERM A;  2XRO A;  3UN7 A;  4MBK A;  3D72 A;  3HJK A;  1UWP X;  1OTE A;  1NRF A;  4HOI A;  3V3S A;  3OBF A;  3T4L A;  2ACG A;  2HGV A;  1OTB A;  3FZC A;  5HSQ A;  2JKR I;  1SHV A;  3LI8 A;  4F3L B;  3UO9 A;  1L0F A;  2JE5 A;  3ITA A;  3PAG A;  4PM7 A;  3PBS A;  3WS2 A;  2XF3 A;  2PRF A;  5AVE A;  3VMA A;  3UE3 A;  1TF1 A;  5J8X A;  2XSS A;  3UE0 A;  1FQG A;  4RX2 A;  4R38 A;  2O0Y A;  1N9L A;  2VX8 A;  2EX8 A;  3NY4 A;  3VSL A;  1F98 A;  4LV1 A;  4JKT A;  4E3I A;  4KUO A;  4JGR A;  4JBF A;  2ZMV A;  3HUO A;  4R23 A;  5E43 A;  1IOU A;  1VEU A;  4R4S A;  2VGL S;  2ZQD A;  2XEP A;  4EW7 A;  1PNE A;  2L0W A;  4Z1W A;  4C3Q A;  4LFU A;  3G32 A;  1BTL A;  3QP2 A;  4S2L A;  2XR0 A;  3A3D A;  1CQA A;  2Y59 A;  4H8R A;  2A3U A;  1ESU A;  2Y2M A;  1EW0 A;  3IWO A;  1OME A;  3MFD A;  4Y5F A;  4FH2 A;  3CUE A;  4G3V A;  4L9E A;  3G6O A;  2XRN A;  1W63 M;  1NJ4 A;  4HJ6 A;  4HH2 A;  1K54 A;  1BYW A;  2WKQ A;  1K56 D;  3OPR A;  4GD8 A;  1LI0 A;  4GB7 A;  4KZ9 A;  5F1G A;  4WZ5 C;  4HBT A;  3IH8 A;  1S4S A;  4JF4 A;  3HRE A;  4HES A;  4YFM A;  3WRZ A;  2PD8 A;  1OJG A;  3OPH A;  1P0Z A;  4ARZ B;  4OPR A;  3B33 A;  3NBL A;  1P9R A;  1TDL A;  1T18 A;  2KOI A;  1PYY A;  3QP5 A;  4LCM A;  1NWZ A;  2ZMA A;  3MMH A;  1P97 A;  4R0Q A;  4Q0J A;  4CPK A;  3EGD C;  3ZVT A;  4ZBE A;  2HDR A;  5JYP A;  4EU0 A;  3NEC A;  4ESP A;  3G4P A;  4N1X A;  1XA7 A;  4IBX A;  1FCN A;  5EVI C;  5EM1 A;  2K7S A;  4NXF A;  2WGI A;  2Z6C A;  2J80 A;  5DVA A;  4HJ4 A;  4WM9 A;  2UWX A;  3H7W A;  4GJ4 A;  2ZQ9 A;  5CTM A;  4B93 A;  1XX2 A;  4OPZ A;  1IYQ A;  3K2N A;  1WYB A;  2P04 A;  4R4R A;  2WKH A;  5IHV A;  4LV2 A;  3W4O A;  5HPF A;  3T1Q B;  5TJJ A;  4Y0O A;  3ISG A;  2BG1 A;  3PXP A;  3LEZ A;  4S2J A;  1S1Y A;  3M6B A;  1FOF A;  1XA1 A;  2AVX A;  5EVI D;  2HJE A;  4E6X A;  4O8G A;  1AXB A;  4DRT A;  2QZ6 A;  1RP5 A;  4C75 A;  4LV0 A;  3R7W B;  3VV4 A;  4OQ0 A;  1S66 L;  1IFQ A;  5FI7 A;  3KX0 X;  4NXG A;  2C5W B;  2QKP A;  1ACF A;  4HH3 A;  5G18 A;  1O7E A;  4PHT A;  4HHD A;  3B3X A;  3RH8 B;  4Y17 A;  4OPQ A;  3LFV A;  4WMC D;  3HLC A;  3O86 A;  3MJQ A;  3EEH A;  4DE0 A;  3NHQ A;  4Y3I A;  3IXG A;  2D01 A;  2DNS A;  1IEM A;  1J3W A;  4Y13 A;  2CC1 A;  1W79 A;  3RFB A;  2PBD P;  4UA7 A;  4UQI M;  3O87 A;  4E3O A;  5AQ9 A;  2OLU A;  3GVB A;  4QHC A;  4PM9 A;  1PWG A;  2XA7 M;  1XFN A;  3IXB A;  2Z6D A;  4GS9 A;  2HP9 A;  2Z2M B;  3FYZ A;  3H7W B;  1UGU A;  2B02 A;  3AGE A;  3HLB A;  3NJA A;  4X53 A;  3BY9 A;  1H0M A;  2ZQC A;  4KZB A;  2P08 A;  2V8C A;  3MR0 A;  3HVF A;  5HAI A;  4R3J A;  4A5R A;  4U0X A;  5CX7 A;  3LYX A;  3UE1 A;  5EEC A;  3G2Z A;  1K55 C;  4GW9 A;  4S2O A;  4CJN A;  1XJ2 A;  1G5U A;  3BFF A;  1MWS A;  3KSF A;  2PBY A;  5FDH A;  4QPR A;  4X1M A;  3OC2 A;  2NUT C;  4IVI A;  3F1N A;  3FKW A;  5HX9 A;  3VP1 A;  2M7V A;  2CMN A;  1U60 A;  2OSU A;  1DY6 A;  3HLG A;  4IUH A;  2KX6 A;  5EPH A;  3L7H A;  4XXR A;  2ZQ7 A;  4OLD A;  3CIT A;  1NY0 A;  4WF0 A;  4X55 A; 
#chains in the Genus database with same CATH homology
 4BMW A;  3LIE A;  3ZYT A;  4BBT A;  3LIA A;  1OTA A;  3EQU A;  5EFW A;  4GCZ A;  4HP4 A;  3T4T A;  2VV6 A;  5HD5 A;  4MN6 A;  4GHI A;  4L9F A;  4L0L A;  4II7 A;  5F68 A;  5DF9 A;  5J3W A;  5TBM A;  3IBR A;  4XT2 A;  3KO6 A;  1GSV A;  4Q0I A;  2Y79 A;  3F1O A;  3H82 B;  2JHE A;  4R6L A;  4MMN A;  3TJZ C;  4CLC E;  3LIC A;  4CLC D;  2JN7 A;  3PBN A;  3BY8 A;  3FPW A;  3LR0 A;  2VA0 A;  4PAU A;  2GJ3 A;  3E4P A;  3F1P A;  3T4Q A;  3HCY A;  5HWW A;  3LID A;  1WA9 A;  4HIA A;  3UB6 A;  1T1B A;  2J3T D;  2O99 A;  2ZBB A;  3ULF A;  2INW A;  1MKM A;  3K3D A;  4I38 A;  4DMZ A;  2QJ5 A;  4CQH A;  4BBV A;  2PYR A;  2VKS A;  2WKR A;  5AJG A;  2A2L A;  1OTI A;  2L4R A;  2WKP A;  3CI6 A;  4EES A;  5KIZ A;  3C30 A;  2LB9 A;  4OOL A;  3R7W A;  3A0S A;  1XJ4 A;  3IS2 A;  1D06 A;  2OWJ A;  3E0Y A;  4YWZ A;  4OOM A;  5A8B A;  1W63 Q;  4JGO A;  2XRO A;  3A0R A;  4NEE D;  4EUV A;  2VGL M;  3S7N A;  3T4S A;  3D72 A;  3HJK A;  1UWP X;  1OTE A;  2OOL A;  4HOI A;  3UMD A;  3OBF A;  3T4L A;  2HGV A;  1OTB A;  3E98 A;  3P01 A;  1D7E A;  4EQ1 A;  5HSQ A;  2JKR I;  2JKR M;  3EGX C;  3LI8 A;  1XJ6 A;  4F3L B;  4O0P A;  3FC7 A;  5K5B A;  3A0V A;  2BAS A;  4I5S A;  2YKH A;  4ETZ A;  1P9W A;  1LT0 A;  2W1T A;  2ZMF A;  3PBS A;  1T1C A;  4AFI A;  2EA9 A;  5AVE A;  4NKP A;  3PBO A;  3UE3 A;  4GHI B;  4IUK A;  2P7J A;  1TF1 A;  2VV8 A;  2PDR A;  5TBM B;  3KYQ A;  2DMW A;  2XSS A;  1LL8 A;  3PHY A;  4R38 A;  2O0Y A;  2A24 A;  2PHY A;  1N9L A;  2ZOI A;  1S4R A;  2OAP 1;  4UEY A;  2VX8 A;  4EET B;  3S7Q A;  1F98 A;  3E4Q A;  2W3E A;  1DP6 A;  4KUO A;  4HY8 A;  2QYB A;  4JGR A;  4BBU A;  3K3C A;  2ZMV A;  2OAQ 1;  3F1P B;  1STZ A;  5LBR A;  1OT9 A;  4RQ9 A;  1IOU A;  3E4O A;  3UB7 A;  1Y28 A;  1ODV A;  3VE3 A;  3UB8 A;  4HI4 A;  2VLG A;  2VGL S;  2K2N A;  4EW7 A;  2PYP A;  2V1B A;  2L0W A;  4Z1W A;  2R78 A;  4DJ2 A;  1H3Q A;  2EWW A;  4GS9 B;  3LR3 A;  4MCW A;  4LLO B;  1T19 A;  4I3I A;  3O5Y A;  3CLO A;  2LB5 A;  5F6A A;  4DN0 A;  4NXE A;  5L8M A;  1EW0 A;  1UWN X;  3OOV A;  4Y5F A;  3LUQ A;  3NOU C;  3CUE A;  4G3V A;  4L9E A;  4G3K A;  3G6O A;  2GNX A;  3FG8 A;  2XRN A;  4PKY A;  1V9Z A;  1W63 M;  3OLO A;  1YSP A;  3B47 A;  3VE4 A;  1G6O A;  1H8M A;  4HJ6 A;  1DP9 A;  2EWV A;  4HH2 A;  1BYW A;  2G7U A;  2O9C A;  3HJI A;  2WKQ A;  3PR6 A;  2VV7 A;  1DRM A;  5DJU A;  2O9B A;  1TS0 A;  4WL9 A;  2B18 A;  2QJ7 A;  5HWT A;  1F5M A;  2W1T B;  3KSI A;  4E04 A;  3UE6 A;  1S4S A;  4I39 A;  4DJ3 A;  2NUP C;  4YOF A;  4MN5 A;  2PD8 A;  3MF0 A;  1OJG A;  4WUJ A;  3UME A;  2HV1 A;  1P0Z A;  3F1N B;  5I5L A;  4ARZ B;  1LSW A;  3B33 A;  1NLZ A;  1VB6 A;  5IT5 A;  1MC0 A;  1P9R A;  5HWV A;  5DKK A;  1T18 A;  2KOI A;  2VJW A;  3S7P A;  1YSQ A;  3VOL A;  1NWZ A;  1ZHH B;  3MFX A;  3EOI A;  3MMH A;  1P97 A;  3OCN A;  4Q0J A;  5DFY A;  3BJN A;  4HP9 A;  2W3D A;  3EGD C;  1XJ3 A;  2J3W A;  2HJ9 C;  1F9I A;  3LR4 A;  4WEJ A;  4BWI A;  4EU0 A;  3C2W A;  4KQO A;  3FPV A;  4HNB A;  5F5Y A;  2V0W A;  4B9O A;  3R4K A;  4Y2F A;  2W3G A;  2V1A A;  1YAX A;  5HL6 A;  5HZH A;  3U2A A;  2W3H A;  3BW6 A;  2K7S A;  4EEU A;  4NXF A;  2Z6C A;  4H6J A;  2J80 A;  4ZRR A;  4XT2 B;  4HJ4 A;  3CWF A;  3H7W A;  4GJ4 A;  2W3F A;  3PBT A;  4B93 A;  3F1O B;  2V9A A;  4EXO A;  2JKT I;  5J7E A;  1ZTU A;  2PR5 A;  2JKT M;  3W2Z A;  2W27 A;  3K2N A;  2P04 A;  4EER A;  4P6Z M;  2W1R A;  1XFQ A;  4LRX C;  1VHM A;  3PBQ A;  5HPF A;  5TJJ A;  3T4K A;  3JVV A;  3T50 A;  3ZQ5 A;  5HD3 A;  3PXP A;  4K08 A;  1OPX A;  2V0U A;  4M4X A;  4HQA A;  4F3L A;  3TRC A;  4IJG A;  3ICY A;  1S1Y A;  3CUE C;  3H9W A;  5C5K A;  1OT6 A;  2HJE A;  4R3A A;  4O8G A;  5HPI A;  4FSF A;  3R7W B;  4CLC A;  5HDS A;  3VV4 A;  3BWL A;  5FL3 A;  3IS2 B;  3NOP C;  1S66 L;  1IFQ A;  3SW1 A;  1S1Z A;  3KX0 X;  4KQD A;  1S67 L;  1X0O A;  4LRZ E;  2QHK A;  4O01 A;  1T1A A;  4NXG A;  2QKP A;  5HDD A;  3IBJ A;  4HH3 A;  4PHT A;  4HHD A;  5DJT A;  3RH8 B;  2M7U A;  2O9A A;  3LFV A;  1NRJ A;  3LR5 A;  4I3J A;  3RTY A;  3MJQ A;  3C38 A;  3EEH A;  1N9O A;  2HF6 A;  3NHQ A;  3NOT C;  4MN7 A;  4Y3I A;  4JGQ A;  2D01 A;  3TW8 A;  4GLQ A;  2IA2 A;  3CAX A;  1NLY A;  3GDI A;  3RFB A;  2M1C A;  4UQI M;  3EEA A;  4ME4 A;  4I3A A;  2MJ6 A;  3T4J A;  4P6Z S;  3KSH A;  3T4O A;  4L9G A;  3GEC A;  1G28 A;  2XA7 M;  1XFN A;  2PT7 A;  4EEP A;  1TS8 A;  1KOU A;  2Z6D A;  4GS9 A;  3S7O A;  1LSX A;  4H6J B;  2FZ0 A;  3H82 A;  3H7W B;  1UGU A;  4NXB A;  4WEK A;  3B42 A;  2A24 B;  5DKL A;  2B02 A;  3BQA A;  3D3O A;  4YNR A;  3NJA A;  4LRY C;  3BQ8 A;  3BY9 A;  3MXQ A;  5HDC A;  2D02 A;  2P08 A;  2PD7 A;  1GSW A;  3MR0 A;  4R70 A;  1YKD A;  2L1M A;  2QWS A;  5IU1 A;  4BJP A;  3C8C A;  3EWK A;  2K31 A;  3KSG A;  3MQQ A;  4G3W A;  2VEA A;  3LIF A;  5CX7 A;  3LYX A;  5J4E A;  4MDZ A;  3UB9 A;  1OTD A;  2I9V A;  4Q0H A;  4ETX A;  3DBA A;  1TS7 A;  3MQO A;  3LI9 A;  2OWH A;  2Y8H A;  4GW9 A;  2GZA A;  1XJ2 A;  1V9Y A;  1N9N A;  4CLC B;  3KSF A;  4QPR A;  4LPZ A;  5AVF A;  2VZW A;  3EQV A;  3OC2 A;  2NUT C;  3PYP A;  3PBR A;  2KLI A;  3F1N A;  4WN5 A;  1JNU A;  4ARZ A;  1TD5 A;  4WLA A;  2KDK A;  3P7N A;  3KYZ A;  4PKY G;  2M7V A;  4UQI S;  3OCL A;  1MZU A;  3MQ0 A;  4JGP A;  4CLC C;  2CMN A;  3JVU A;  5MC7 A;  5IS1 A;  5G4Z A;  4IUH A;  2H28 A;  3V67 A;  2PR6 A;  2YKF A;  4HJ3 A;  4IHQ A;  2KX6 A;  3LIB A;  2XA7 S;  5DFX A;  1OJ5 A;  4FOF A;  2FH5 A;  2GX5 A;  1DP8 A;  1TS6 A;  4KUK A;  3CIT A;  4WEL A;  1LSV A;  5G4Y A;  1GSX A;  2J3T C;  2W0N A;  5KSH A;  4WF0 A;  3TE8 A;  2ZOH A;  5F69 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...