3W4QA

Crystal structure of pena beta-lactamase from burkholderia multivorans at ph4.2
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
258
structure length
258
Chain Sequence
ASFAALERAAGGRLGVCAIDTATGRRALHRADERFPFCSTFKAMLGAAVLAQSVAHPGLLQQRVTYGRSDLVNYSPVTERHVDTGMTVAELCAATIQYSDNTAANELMKRIGGPAAVTAYARSIGDDTFRLDRWETELNTALPGDLRDTTTPAAMAANLRVLVLGDALPPAQRAQLIEWLRGNKVGDKRIRAGVPTGWRVGDKTGTGDYGTTNDVGVLWPPSRAPIVLAVYYTQTRADAKAKDDVIAAATRIASATLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase
publication title Insights into beta-lactamases from Burkholderia species, two phylogenetically related yet distinct resistance determinants
pubmed doi rcsb
source organism Burkholderia multivorans
total genus 94
structure length 258
sequence length 258
chains with identical sequence B, C
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2013-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3w4qA00
1H5XA 1ES2A 1DJCA 2XH9A 4X55A 5HAIA 4EWFA 3M2KA 3BFGA 1ZG4A 4JKTA 4WMCD 4DXCA 4S2OA 4EUZA 5CGSA 2EX6A 4QY6A 3IXDA 1KGFA 1YLZA 3N8RA 4GDNA 1MXOA 5TR7A 3GTCA 3MBZA 5HX9A 3Q7ZA 2GDNA 1JVJA 4ZJ2A 3ITBA 3N8SA 1L0GA 1ONGA 1BT5A 1K25A 2ZJ9A 4GD6A 1I5QA 1YLTA 3NY4A 4Q8IA 3O86A 5GLAA 2HDRA 2Z2MB 4BD0A 4DDYA 4O7DA 5AQ9A 5CXWA 1JTDA 4KZ5A 4OOLA 5F1GA 4FSFA 1PWDA 4UA7A 1L0EA 2Y2OA 3CG5A 4P85A 2WKHA 2X02A 1G6AA 4CPKA 2R9WA 4OPRA 4X56A 3N7WA 4WYYA 5EVID 4MBFA 4PM6A 4R3JA 2Y2GA 3FKWA 4RX2A 3SS4A 4EBNA 4LCLA 4HESA 3VP0A 1Y54A 2Y2MA 1M40A 1NJ4A 3C4PA 3V39A 3VFFA 5CEDA 1I2SA 4PM8A 4DE0A 2JE5A 2PU4A 2EFUA 1E3UD 3HLFA 5TGFA 4X68A 3UDFA 4BENA 2WKIA 4WZ4A 1IEMA 2V1ZA 1GHMA 2X71A 4GOGA 2Y55A 4JF6A 4LV1A 2WZXA 3GQZA 5CGWA 3AGEA 4EBLA 4HBTA 5EVIB 1SDEA 3BLSA 3LY4A 1GHPA 4KG2A 5KMWA 4OQGA 2OSUA 2WADA 3HBRA 1MWSA 2WKEA 3M6HA 5F82A 3ZFZA 1ESIA 3ZG5A 3MZDA 1W5DA 4OPZA 1XA7A 2XD1A 5TFQA 4OPQA 3C7VA 3UN7A 1K38A 4JXVA 5FA7A 1Q2QA 3QHYA 3IWOA 1MWUA 1XX2A 1E4DA 1ESUA 2XFTA 3CZDA 2Z2LB 1K6RA 1EWZA 5A93A 3B3XA 4MLLA 2IWBA 1Q2PA 4FD8A 5G18A 2WK0A 2PBYA 3GRJA 1K4FA 2Y2NA 4XUZA 1W8YA 5EVIC 4OQ0A 5HW3A 3BECA 2A3UA 4GB7A 3W4OA 2IWCA 3ZG8B 4DDSA 1YMXA 2OLVA 4KQQA 4P87A 3VMAA 1BLHA 4KZ6A 3M6BA 4ZTKA 2BG1A 1CEGA 3BFEA 4OPYA 4QHCA 1KDSA 4KZ8A 4ZBEA 5CECA 1ERMA 3ZVWA 3FZCA 4KZ7A 4R23A 2XFSA 4E3OA 1PI5A 1KGGA 2V2FF 4IEDA 4E3MA 1C3BA 4WMCA 3S22A 1MKIA 3TSGA 4DE3A 4S2LA 3OPPA 2FFYA 5E2EA 1S6RA 1FCOA 2ZC5B 5EE8A 1MWTA 1PW1A 3E2KA 3WRTA 2HPBA 4DF6A 4QJGA 3RXXA 3HUOA 3MKFA 3O88A 1ONHA 3Q07A 4BJPA 4WM9A 4MBHA 5FI7A 2XK1A 4GN2A 1RP5A 1IYSA 4E3IA 4YINA 1K56D 2ZMAA 3A3IA 1TEMA 4WEJA 4C3QA 3AGDA 2QZ6A 5E2GA 3UE3A 5FI6A 2FFFB 3IH8A 4FCFA 2Y59A 1H8ZA 1LI9A 2XR0A 4D2OA 1QMEA 3IF5A 1O07A 3V5MA 1E25A 1O7EA 1QMFA 1VQQA 5CEBA 5E2FA 4MEZA 3VP3A 1CK3A 1YM1A 5KSHA 1IKIA 1BLPA 1BUEA 3O87A 1NXYA 3HUNA 1GA0A 1KE4A 3LY3A 4RX3A 5EECA 1W8QA 2A49A 5EVIA 4LCMA 2C6WB 1IYQA 1IELA 2XEPA 4E3KA 1KE0A 1GCEA 4N9KA 4HBUA 5F83A 3WWXA 3LEZA 4KZ4A 3HLCA 3ZCZA 4DRTA 3W4PA 4DXBA 4X69A 1E3UA 1XPBA 2HDUA 5E2HA 4JPMA 1MPLA 4YFMA 2Y91A 4BL2A 3NDGA 4R4RA 2E8IA 3N6IA 3IT9A 4PMAA 1JWPA 3NI9A 3IXBA 1CEFA 1I2WA 4E6XA 3DW0A 2EX9A 2H5SA 3NC8A 3GR2A 4DE1A 4LV2A 1ZKJA 5FQ9A 2JCHA 3SS5A 4Z9QA 3EQUA 3IHAA 3E2LA 4WEKA 3UDIA 1YLJA 4S2NA 3VP4A 3UPPA 1ALQA 5M19A 4KQRA 4U3TA 3IQAA 1PI4A 4P0MA 4Y7PA 5HL1A 4OKPA 3WRZA 3ZNTA 5FATA 3WS5A 4BD1A 4LV3A 3MZFA 2HP6A 4ZDXA 3PTEA 1YLYA 3CJMA 3UE1A 1ES3A 1ES4A 4M3KA 5AQAA 3ZG7B 3IXHA 4JLFA 3IWIA 4NK3A 1LI0A 1Z6FA 1MBLA 4OP5A 1S0WA 3ZNYA 3PBTA 2H0YA 4GZBA 1ERQA 1RCJA 3PBNA 2Y2IA 5I94A 5FAQA 1K55C 1YLPA 2CC1A 2J9OA 3HREA 2Y2KA 3PBQA 3PAEA 3G34A 3IXGA 3LCEA 5DVAA 1YT4A 4DE2A 2XGNA 1KVMA 3OPLA 2XQZA 4KZBA 5GHYA 2DCFA 3MFDA 4X6TA 1IYPA 4OQIA 4QD4A 4XUXA 3SS3A 1WYCA 1TDGA 4S2KA 5DF8A 3ISGA 2ZQ8A 2Q9NA 4KZAA 3SOIA 5EOEA 2Y2LA 5DF7A 5GLCA 2ZM0A 1HVBA 3PBRA 5CERA 2WYXA 3M2JA 3WS2A 5DTTA 5HAQA 3NCKA 3C7UA 3ZG9B 2QPNA 1W79A 4RA7A 4BLMA 4LENA 1K54A 5BOHA 1L0FA 2WAEA 5KSCA 3N4IA 1FSYA 5CHUA 4JXGA 2J8YA 1NZOA 1XKZA 3LO7A 1XA1A 5J8XA 3FV7A 3HL9A 2ZC6B 3NBLA 3HUMA 1NY0A 1TVFA 3ITAA 4UAAA 4GD8A 3Q1FA 3N8LA 3VOZA 1K56A 2ZM8A 4K0WA 2HDSA 5L2FA 5EPHA 1XGIA 1LL5A 4A5RA 5EUAA 4B4ZA 3FYZA 5FQIA 4UA6A 1K6SA 3BRMA 1TDLA 5D3OA 4NETA 4QU3A 5A92A 1YMSA 2X01A 4PM9A 5FQJA 3GMWA 3V3SA 1N4OA 4KZ3A 3RJUA 4FH2A 5FAOA 4F94A 2WZZA 2H10A 3HLBA 4C6YA 1G68A 5GL9A 2ZC7A 3PBOA 3HLEA 1K55A 4JF4A 3A3DA 1XXMA 3C4OA 4MNRA 5GLDA 3VFHA 1RGZA 1K57A 2WGWB 4S2NC 5U47A 1EI5A 2UWXA 4C75A 2QMIA 1JWZA 2ZQ9A 3GV9A 3PBSA 5EOOA 3C5AA 4EBPA 5FQKA 1ES5A 1PZOA 2P74A 3G2ZA 4OP8A 3S1YA 4KQOA 3V3RA 2JBFA 4MBKA 4E6WA 5FASA 1DY6A 1KE3A 1CI9A 3UPNA 2WGIA 5CGXA 1NYMA 4Y0OA 1L0DA 3A3FA 4IBXA 1AXBA 3P09A 4R1GA 3RXWA 1KDWA 1DJAA 2I72A 2P9VB 1IKGA 2DNSA 2Y4AA 3ZHHA 3O3VA 4L0LA 4S2PA 5IHVA 1ZG6A 3JYIA 1CI8A 5FQMA 3BM6A 2OV5A 5HAPA 3Q7VB 4WZ5A 4OLGA 3HLGA 4JXSA 3TOIA 2HDQA 1WE4A 3HVFA 4ZJ3A 4GKUA 2ZD8A 5CRFA 3A3JA 1BTLA 3DWZA 4HEFA 1FQGA 4P6BA 5EVLA 2ZC4B 3MXSA 2JC7A 3ZGAB 4ID4A 3TG9A 2R9XA 4KENB 4B88A 4WBGA 1YLWA 1EROA 3QNBA 4OOYA 4S2MA 4Y0UA 5CHJA 5M1AA 1K54C 4GNUA 1NYYA 4N1HA 4KG6A 4ZAMA 4WELA 1XGJA 2EX2A 2XLNA 1M6KA 4S2JA 3UE0A 2EX8A 4K91A 4OVDA 2ZQCA 3GSGA 5FQQA 3HLWA 1YQSA 2HP9A 3QNCA 3G31A 4EV4A 1SCWA 3NIAA 4QB8A 4OH0A 3G4PA 2EXBA 3BLMA 3ZVTA 4N92A 1SKFA 4E3LA 5FDHA 4QY5A 4B4XA 3Q82A 1WYBA 4X53A 4FH4A 4N9LA 1N9BA 4DKIA 3MKEA 3G32A 3UY6A 3WS0A 4IBRA 5CTNA 2RL3A 1NZUA 2Q9MA 1K57C 1BLCA 1LL9A 2WGWA 3AGFA 1PW8A 3FKVA 2IWDA 2C5WB 4K0XA 3ZG0A 1VM1A 1FSWA 1ZC2A 4JBFA 1PZPA 3DWKA 4S2IA 2VGKA 5DF9A 3OC2A 3V50A 3SH7A 1NRFA 2H0TA 2ZC3B 4UHUA 3NDEA 1U60A 3I7JA 4KG5A 1PWGA 2WUQA 5CHMA 1PWCA 1FR6A 4PPRA 2G2UA 4PM5A 3MZEA 3GVBA 5A91A 3UPOA 5HFOA 2P9VA 4OQHA 4U0TA 5A90A 3DTMA 2J7VA 3SH9A 2HP5A 3D4FA 4IVKA 3IF6B 5AQ7A 3MXRA 1OMEA 5FI2A 3Q7VA 4WZ5C 5DTSA 4BQMA 3VSKA 4JF5A 3UNWA 4RVAA 1JTGA 4UA9A 5E43A 1BULA 4OOMA 4PM7A 5KZHA 3W4QA 1GA9A 3HLDA 2J9PA 1IYOA 1FR1A 1KVLA 2ZQAA 2OLUA 5FAPA 3VP2A 1SHVA 3VP1A 2ZQDA 2G2WA 2WAFA 3IF6C 1HD8A 1MWRA 3IH9A 3UO9A 5GHXA 4Y0TA 1JWVA 3BFFA 2RCXA 1FCMA 1PYYA 4OLDA 4ZJ1A 2ZLYA 4R4SA 5JYPA 3PAGA 3A3EA 1H8YA 5JYOA 3G35A 1PIOA 2WGVA 1RGYA 4IVIA 2Y2PA 4N1XA 4RYEA 3OCNA 1BSGA 5M18A 2Y2JA 5CTMA 5FSRA 3SH8A 3IHBA 2V20A 3G2YA 1BLSA 3P98A 4R0QA 4CJNA 2VGJA 1W7FA 5AQBA 1KGEA 4R3BA 3S4XA 3UDXA 2Y2QA 3W8KA 1L2SA 2BLSA 3OCLA 2DRWA 3BFDA 4EQIA 3ZDJA 1LHYA 3CMZA 3BFCA 4E3JA 3FWLA 1FOFA 1GHIA 5F1FA 3OPHA 1FCNA 2ZQ7A 2EXAA 5GLBA 3OZHA 2XD5A 3VSLA 4BL3A 1SDNA 3Q81A 1LLBA 4E3NA 4JXWA 1K4EA 5GHZA 2B5RA 4LV0A 1DJBA 3BYDA 1XP4A 4U0XA 3IWQA 4GDBA 2XF3A 1MY8A 3OPRA 2PU2A 3WS1A 3VOYA 4XXRA 4H8RA 3WS4A 4OONA 2EFXA 1BZAA 3G30A 1J9MA 3BEBA 2XDMA 4KZ9A 2ZM2A 1HZOA 3IF6A 3EQVA 1HTZA 5DTKA 2Y2HA 5HARA
chains in the Genus database with same CATH superfamily
3LUQA 4X55A 5HAIA 4ME4A 4JKTA 4WMCD 5CGSA 4PHTA 5HWVA 5TR7A 2JN7A 2GDNA 3B42A 1CJFA 1L0GA 1I5QA 1K0KA 1YLTA 1OTDA 2HDRA 4UQIM 4DDYA 5AQ9A 2VV7A 1JTDA 5F1GA 4FSFA 1L0EA 4Z1WA 5G4ZA 1KOUA 4CLCA 4MBFA 1N9LA 3SS4A 4EBNA 3VFFA 1I2SA 4PM8A 4DE0A 5TGFA 4X68A 4MN5A 4GOGA 1OJ5A 3GQZA 5HDSA 2JKRI 3AGEA 3E4QA 4HBTA 1SDEA 3BLSA 3LY4A 3KYQA 2NUTC 1XA7A 2XD1A 5TFQA 1G6OA 1BYWA 1Q2QA 3QHYA 4BBUA 1MWUA 1XX2A 1ESUA 3CZDA 2Z6CA 4F3LA 4FD8A 4LRZE 4XUZA 2Y2NA 1W8YA 4OQ0A 5L09A 3ZG8B 2OLVA 4P87A 4HY8A 4KQQA 3VMAA 2VGLM 3T4TA 4MN6A 3S7QA 2MJ6A 3K3DA 2W27A 4ZBEA 4R23A 4EETB 1PI5A 4IEDA 1WA9A 4WMCA 4S2LA 4QJGA 2J3TC 3HUOA 4DMZA 3K2NA 4GN2A 4C3QA 1TEMA 4WEJA 2JKFA 2PBDP 2O9CA 5FI6A 2FFFB 2Y59A 1H8ZA 3NOUC 1QMEA 3IF5A 1O07A 4O8GA 1O7EA 1VQQA 5CEBA 1YM1A 5KSHA 1IKIA 1BLPA 3IX8A 3O87A 4RX3A 4MN7A 2A49A 4JGOA 4LCMA 2C6WB 3FG8A 3WWXA 4DXBA 3LR5A 5E2HA 2V8FA 1EW0A 2E8IA 1JWPA 1I2WA 2ZOIA 3NC8A 1YKDA 1ZKJA 1A0KA 2ZL1A 4NEED 1ALQA 1PI4A 5HL1A 3WRZA 3ZNTA 3NHQA 4LV3A 3MZFA 2HP6A 4DJ2A 3CJMA 3IXHA 4HH2A 4JLFA 4NKPA 3PBTA 2H0YA 4GZBA 1ERQA 2Y8HA 3QP1A 3PBNA 2Y2IA 3A0VA 5I94A 1K55C 1YLPA 2CC1A 2J9OA 3G34A 3LCEA 4O0PA 5DVAA 2XQZA 4KZBA 5GHYA 4NXGA 4S2KA 3H7WA 3SOIA 2W1RA 2PD7A 5CERA 3VE3A 3WS2A 5HAQA 3NCKA 3TW8A 5HSQA 1L0FA 2WAEA 2P04A 1TS8A 5CHUA 3LO7A 1XKZA 5FEGA 3FV7A 3HL9A 1NY0A 1TVFA 3CUEC 3ITAA 2ZM8A 4K0WA 2HDSA 1P9RA 5EUAA 3E4PA 3C8CA 5FQJA 3GMWA 3ICYA 4FH2A 1G68A 3MJQA 1D7EA 1CF0A 3PXPA 1EI5A 4EW7A 1JWZA 2ZQ9A 1Z09A 3S1YA 4E6WA 4XT2A 2P08A 2WGIA 5CGXA 1L0DA 4IBXA 4R1GA 3RXWA 2DNSA 1CI8A 5HAPA 2OV5A 3B47A 3HVFA 4HEFA 3MXSA 3PR6A 3TG9A 3D3OA 4KENB 3LR3A 3QNBA 5CHJA 1NYYA 2EX2A 2EX8A 4K91A 4ARZA 4LRYC 1T1CA 3EWKA 3G31A 4KUKA 3S7NA 5LBRA 2EXBA 4N92A 1SKFA 3QP6A 1WYBA 4HI4A 3MKEA 1K57C 2Q9MA 1ZC2A 3OBFA 5HL6A 3RFBA 1P0ZA 3T4LA 3BY9A 2I9VA 4UHUA 3NDEA 2WUQA 4H6JA 4PM5A 3GVBA 5HWWA 4RQ9A 4OQHA 1S1ZA 4U0TA 1VETA 2J7VA 3SH9A 1S66L 3Q7VA 2D02A 3T1QB 1F98A 4HHDA 4LLOB 1DRMA 3LGOA 2VV6A 5FAPA 1DP6A 1SHVA 2ZQDA 5FEFA 2G2WA 4G3WA 3MQ0A 1JWVA 2RCXA 4ZJ1A 4R4SA 3PAGA 3BQAA 5AVEA 4N1XA 3OCNA 4EQ1A 3IHBA 4JGPA 4NXBA 4CLCB 3T50A 5EVEA 3CI6A 3U2AA 3DTIA 1FCNA 2ZQ7A 2EXAA 4BL3A 3F1NA 3Q81A 3BY8A 3LI8A 3BYDA 3OPRA 5A8BA 3LI9A 2W3EA 3B33A 2XDMA 4KZ9A 4F3LB 3ZQ5A 3EQVA 2PRFA 3BRMA 5HARA 1T1AA 1DJCA 4EWFA 4DXCA 2B95A 3BFGA 4S2OA 2QJ7A 3N8RA 3MBZA 5DJTA 5EM0A 1N9NA 4ZJ2A 3N8SA 3UB7A 1ONGA 1K25A 1S1YA 4GD6A 1NRJA 2INWA 4Q0IA 4O7DA 1UWPX 2J80A 3H82A 1T19A 1ODVA 5L07A 4R3JA 2Z6DA 4LRXC 1Y54A 1LSXA 2JE5A 2EFUA 4BENA 4WZ4A 2V1ZA 1GHMA 3CITA 4JF6A 4LV1A 2WZXA 4Y3IA 4EBLA 3KSFA 3LIDA 5KMWA 3HBRA 2WKEA 5TBMA 2R78A 3C7VA 3T4SA 5FA7A 2D01A 4CLCD 1J3WA 2XFTA 5A93A 2IWBA 3GRJA 1K4FA 2V0WA 2ZL1B 2A3UA 2IWCA 2KLIA 4FTXA 1CEGA 3BFEA 1JNUA 4MDZA 1KDSA 4KZ8A 3UMDA 1W63M 4K08A 4II7A 2V0UA 4E3OA 1FILA 2V2FF 2XRNA 4E3MA 3S22A 1FCOA 5EE8A 1MWTA 1PW1A 3E2KA 3LICA 3A0SA 3WRTA 4NXFA 3F1PA 3P7NA 4FOFA 3T4KA 4BBVA 4BJPA 1RP5A 3H7WB 4LGWA 3A3IA 2ZMAA 4YINA 1MZUA 3AGDA 3VE4A 4BBTA 1TD5A 4R3AA 4HP4A 1QMFA 1N9OA 4MEZA 3VP3A 1V9YA 1CK3A 4GJ4A 1S67L 1NXYA 4R38A 5EECA 3KSIA 1IYQA 4E3KA 1KE0A 4M4XA 5F5YA 4HBUA 3LEZA 4DRTA 1XPBA 4HNBA 4BL2A 3NDGA 4R4RA 3N6IA 3IT9A 4PMAA 4E6XA 3DW0A 2H5SA 2XA7S 3TE8A 2B18A 2JCHA 4FUWA 3UDIA 4S2NA 3VP4A 4GHIA 4OKPA 3WS5A 2WKRA 4ZDXA 1ES3A 4XT2B 3JPUA 1S0WA 2OWJA 2JKTM 3HREA 3PAEA 2XGNA 1KVMA 1G28A 1IYPA 2HF6A 3ISGA 2VX8A 4D60A 5DF7A 5GLCA 3PBRA 3MR0A 3C7UA 1XJ2A 4RA7A 4BLMA 4LENA 1K54A 5KSCA 3N4IA 1FSYA 5J8XA 1NZOA 1XA1A 1NLYA 4ARZB 3QP2A 3N8LA 3D9YA 3LIAA 4I3AA 5D3OA 2X01A 1N4OA 4KZ3A 3RJUA 3OLOA 3HLBA 3U4LP 3CAXA 1Y28A 1S4SA 2QWSA 2ZC7A 1XXMA 5EM1A 5U47A 3GV9A 3CWFA 5EOOA 4EEPA 2JKGA 5FQKA 2P74A 4R6LA 3V3RA 4MBKA 1DY6A 1KE3A 3F1OA 1CI9A 1NYMA 4H6JB 3P09A 2I72A 1DJAA 1IKGA 1VETB 2W1TA 1ZG6A 3JYIA 5FQMA 3Q7VB 4OLGA 3TOIA 2W0NA 2HDQA 2Q0OA 4ZJ3A 1LSVA 2ZD8A 4GKUA 2P7JA 2M7VA 1OPXA 5EVLA 1FQGA 3ZGAB 4ID4A 1W63Q 1EROA 3MQQA 4N1HA 4KG6A 4B93A 2OAP1 2ZQCA 1YQSA 2L4RA 3ZVTA 4QY5A 4B4XA 5DJUA 3S7OA 1NZUA 1VM1A 3F1NB 5EV0A 3DWKA 3H9WA 3OC2A 3V50A 1U60A 4QPRA 4KG5A 2OOLA 3UE6A 1TS7A 1SKOA 5A90A 3BJNA 3DTMA 5HD5A 3D4FA 3HJIA 4WZ5C 1OT9A 4RVAA 1JTGA 1GA9A 1IYOA 1FR1A 5MC7A 2VGLS 4GS9A 3NULA 1HD8A 5GHXA 3KSHA 4Y0TA 3BFFA 4IUKA 2ZLYA 5JYPA 3G35A 1PIOA 1RGYA 4IVIA 3H82B 2Y2PA 3T1RA 3TRCA 3G2YA 4R0QA 4CJNA 3IX4A 2VGJA 1W7FA 2A24A 3LYXA 5AQBA 2Y2QA 3C30A 3W8KA 3OCLA 3MXQA 2DRWA 4EQIA 1LHYA 3FWLA 1NLZA 2XD5A 3VSLA 1AWIA 4E3NA 5GHZA 4I3IA 1DJBA 1XP4A 4U0XA 4GDBA 5TBMB 2PR6A 2PU2A 4XXRA 3WS4A 5HPFA 5G4YA 4I3JA 2EFXA 3JVUA 2A2LA 1BZAA 3BEBA 5J3WA 2O9BA 1XFQA 4IUHA 5DTKA 4I5SA 1H5XA 4JGQA 4EUZA 1F2KA 4DJ3A 4QY6A 3IXDA 1YLZA 4GDNA 1MXOA 2G7UA 3DTEA 3Q7ZA 1JVJA 1STZA 3ITBA 3MQOA 4LPZA 3KX0X 3LFVA 1BT5A 3DBAA 2ZJ9A 4Q8IA 3O86A 3LIEA 5GLAA 4BD0A 3FPVA 4ETXA 1PWDA 4HJ4A 4UA7A 3CG5A 4P85A 2X02A 1G6AA 4CPKA 2R9WA 3F1PB 4EXOA 2O0YA 4WYYA 5EVID 3A0RA 2Y2GA 3FKWA 4LCLA 1OT6A 4HIAA 2PU4A 1E3UD 2QHKA 2WKIA 2X71A 5CGWA 2ZMFA 2YKHA 4KG2A 1GHPA 2WADA 5I5LA 2VZWA 3M6HA 3ZFZA 1ESIA 3ZG5A 3UB5P 4OPZA 3UB8A 4OPQA 3UN7A 4JXVA 4YNRA 3IWOA 4PKYG 3EEHA 2Z2LB 1GSVA 3B3XA 4MLLA 1Q2PA 5G18A 2WK0A 3OOVA 5J4EA 4BMWA 1X0OA 2KX6A 2HZ5A 3T1SA 3BECA 3W4OA 2V1AA 4GHIB 1YMXA 2V8CA 1TS6A 4ZTKA 2FH5A 2BG1A 4OPYA 3LR0A 2XROA 1ERMA 3ZVWA 4KZ7A 2W3DA 1KGGA 1C3BA 3UB9A 1MKIA 3TSGA 3OPPA 2K31A 4WF0A 1UWNX 2ZC5B 4HJ3A 4EU0A 2HPBA 3FC7A 2BASA 3Q07A 5FI7A 2QYBA 4BWIA 4CLCC 2XK1A 4E3IA 1IYSA 1K56D 2QZ6A 4EERA 3IH8A 2GNXA 1DP8A 1LI9A 3IBRA 3QP8A 4I39A 1OJGA 3V5MA 3UMEA 3CPTA 5E2FA 3D72A 1BUEA 3LY3A 1KE4A 1W8QA 5EVIA 3CUEA 4QWOA 1GCEA 2UV0E 1H3QA 5F83A 3HLCA 3ZCZA 1E3UA 2HDUA 1MPLA 2Y91A 1P97A 3NI9A 4P6ZS 5FDSA 5FQ9A 3SS5A 5J7EA 4Z9QA 3EQUA 3E2LA 1YLJA 2K2NA 4GLQA 4U3TA 4P0MA 3HJKA 4Y7PA 3PHYA 1YLYA 3UE1A 5AQAA 4M3KA 5HWTA 3IWIA 1LI0A 1Z6FA 3F1OB 4OP5A 2LB9A 1RCJA 1T1BA 3E98A 5FAQA 2Y2KA 1XFNA 3PBQA 4DE2A 1YT4A 2W1TB 3OPLA 3MFDA 4OQIA 4XUXA 3SS3A 4G3VA 1WYCA 5DF8A 2ZQ8A 2Q9NA 5C5KA 4HQAA 1HVBA 2PT7A 3EGXC 3M2JA 5DTTA 1OTBA 1W79A 3R7WB 2FZ0A 3EEAA 3T4JA 2J8YA 1ZHHB 2HV1A 3HUMA 5K5BA 4UAAA 3Q1FA 3VOZA 1K56A 5EPHA 4A5RA 2QJ5A 5FQIA 4UA6A 1K6SA 1TDLA 5A92A 1YMSA 4PM9A 3L7HA 2GX5A 4MCWA 5FAOA 3MFXA 2WZZA 2H10A 4F94A 5GL9A 4JF4A 3A3DA 1T18A 3C4OA 5GLDA 3VFHA 1K57A 2UWXA 4C75A 2QMIA 2L0WA 3PBSA 4EBPA 2QKPA 4GCZA 3G2ZA 4OP8A 4KQOA 2JBFA 2PD8A 1UGUA 3UPNA 3QP4A 4Y0OA 5KIZA 1SKOB 3T4OA 2PYPA 2Y4AA 3O3VA 4L0LA 4S2PA 4PAUA 3LIBA 3BM6A 1WE4A 3A3JA 3BQ8A 4Y17A 3DWZA 2R9XA 4B88A 3KYZA 4OOYA 4S2MA 4Y0UA 5M1AA 4GNUA 4GS9B 2YKFA 4X25A 4WELA 1TF1A 1M6KA 3UE0A 3NECA 2EWVA 3GSGA 3QNCA 2M1CA 3NIAA 2A24B 2PR5A 3LIFA 2VA0A 4FH4A 3DAVA 4Q0HA 1N9BA 4DKIA 3UY6A 4IBRA 5AJGA 5CTNA 3NJAA 3AGFA 4L9GA 2WGWA 3FKVA 2C5WB 3RTYA 3ZG0A 3KSGA 5DF9A 2PDRA 1L3LA 1NRFA 2H0TA 2WKPA 2ZC3B 5CHMA 4PPRA 5A91A 3UPOA 4R70A 2P9VA 3NOTC 4Y2FA 4EUVA 1OMEA 5FI2A 5DTSA 4JGRA 4BQMA 3VSKA 3UNWA 2O9AA 3ZYTA 3FPWA 4HJ6A 2HJEA 4WL9A 5E43A 1BULA 4OOMA 4PM7A 5FL3A 5KZHA 1DP9A 3HLDA 3PYPA 1KVLA 2M7UA 3VP2A 2WAFA 1MWRA 3UO9A 1PYYA 5EFWA 4WN5A 5JYOA 4X1MA 2Y2JA 5FSRA 1VHMA 2V20A 3P98A 1KGEA 2ZOHA 2L1MA 3UDXA 2BLSA 3BFDA 3ZDJA 3BFCA 3UB6A 1FOFA 4Y5FA 1GHIA 3IS2A 4Y15A 4O01A 5F1FA 5GLBA 3OZHA 4GW9A 1SDNA 1LLBA 2B5RA 3T12B 3O5YA 3IWQA 1OTIA 3IX3A 2CMNA 5IT5A 1LSWA 3W2ZA 1ZTUA 4EEUA 3KO6A 4OONA 3R7WA 1VEUA 1J9MA 2ZM2A 3IF6A 1HTZA 5HDCA 2KDKA 1ES2A 2XH9A 4CLCE 3M2KA 1ZG4A 4CQHA 4ESPA 2EX6A 1KGFA 3DTKA 4UQIS 2Y79A 1OTEA 3GTCA 5HX9A 3NY4A 4Q0JA 1XJ3A 2Z2MB 2W3HA 3CHWP 5CXWA 4KZ5A 4OOLA 2OWHA 2Y2OA 2KOIA 2WKHA 4OPRA 4X56A 3N7WA 1GSXA 4ZRRA 3SZTA 4PM6A 4RX2A 5DKLA 3V67A 4HESA 3VP0A 1D1JA 2Y2MA 1M40A 1NJ4A 3C4PA 3V39A 5CEDA 2WKQA 3UDFA 3HLFA 5HD3A 5HPIA 1IEMA 2O99A 4G3KA 3CPTB 4I38A 2Y55A 3IBJA 5EVIB 4OQGA 2OSUA 1MWSA 1MKMA 2JKRM 5F82A 3MZDA 1W5DA 2J3TD 1K38A 1PFLA 3R4KA 1E4DA 1K6RA 1EWZA 3SW1A 3BWLA 2H28A 5F69A 2PBYA 1F5MA 3T4QA 2PAVP 2E8JA 5EVIC 1YSPA 5HW3A 4GB7A 4DDSA 3GDIA 1D06A 3P01A 1BLHA 4KZ6A 3M6BA 4QHCA 2PYRA 5CECA 3FZCA 2XFSA 1LT0A 4E04A 2K7SA 4DE3A 2FFYA 4IJGA 1S6RA 3C2WA 5E2EA 4DF6A 3RXXA 3MKFA 3O88A 1ONHA 4L9FA 4WM9A 4MBHA 1S4RA 4AFIA 1PNEA 5E2GA 1CQAA 3UE3A 4FCFA 4IHQA 3VV4A 2XR0A 4D2OA 3VOLA 1E25A 1XJ4A 3HUNA 1GA0A 1IFQA 5F68A 1IELA 2XEPA 4N9KA 3QP5A 4KZ4A 3W4PA 4X69A 4JPMA 5HDDA 2VK3A 4YFMA 3HCYA 5DKKA 4X1LA 3IXBA 1CEFA 2EX9A 4NXEA 2XSSA 3GR2A 4DE1A 4LV2A 1TS0A 4WEKA 3IHAA 3UPPA 3LR4A 5M19A 4KQRA 4YOFA 3IQAA 4P6ZM 4BD1A 5FATA 2VV8A 4YWZA 3PTEA 3ZG7B 1ES4A 4NK3A 3G6OA 1MBLA 1H0MA 3ZNYA 3K3CA 1YAXA 1NWZA 3IXGA 5AVFA 1GSWA 3LEQA 2DCFA 5DFXA 4X6TA 4QD4A 1TDGA 4KZAA 3EGDC 5EOEA 4EESA 2Y2LA 2ZM0A 2WYXA 3ZG9B 1G5UA 2QPNA 3MF0A 4JXGA 3NBLA 2ZC6B 3KYEA 4GD8A 5L2FA 1XGIA 1LL5A 4B4ZA 3FYZA 4L9EA 1YPRA 5BOHA 4NETA 4QU3A 2W3FA 1OTAA 3V3SA 4HH3A 3ULFA 1MC0A 2NUPC 4C6YA 1XJ6A 2J3WA 3PBOA 3HLEA 2DMWA 1K55A 4PKYA 4MNRA 1RGZA 5L8MA 4S2NC 2WGWB 5L10A 2V9AA 1ACFA 3JVVA 4Y13A 3GECA 3C5AA 1ES5A 1PZOA 4KUOA 1IOUA 5FASA 4HP9A 3E4OA 3A3FA 1AXBA 3S7PA 2HGVA 1KDWA 2P9VB 1VB6A 3ZHHA 5IHVA 1P9WA 2VJWA 4WZ5A 3HLGA 2ZBBA 4JXSA 5CRFA 1BTLA 3C38A 4LFUA 1PRQA 4P6BA 5CX7A 4B9OA 2ZC4B 2JC7A 2ZMVA 2W3GA 2VEAA 4WBGA 1YLWA 3E0YA 2B02A 1K54C 4ZAMA 1XGJA 2XLNA 2VKSA 5DFYA 3T1XA 2HJ9C 4S2JA 1V9ZA 4OVDA 5HZHA 5FQQA 3HLWA 2HP9A 4EV4A 1SCWA 4QB8A 4OH0A 3G4PA 3BLMA 2XA7M 4E3LA 5FDHA 2JKTI 4UEYA 5IU1A 3Q82A 4X53A 4MMNA 1Y4OA 4N9LA 3G32A 4NG2A 3WS0A 1SZVA 3IS2B 2RL3A 1LL9A 1BLCA 1PW8A 2IWDA 1HLUP 4K0XA 3TJZC 1FSWA 4JBFA 1PZPA 4S2IA 2VGKA 4DN0A 4ETZA 3SH7A 5F6AA 4KQDA 3I7JA 1PWGA 1PWCA 1FR6A 3CLOA 2G2UA 3MZEA 5HFOA 1H8MA 2GJ3A 1VEUB 2HP5A 3L9KA 3IF6B 4IVKA 5AQ7A 3MS6A 3MXRA 2IA2A 4JF5A 3MMHA 5IS1A 2GZAA 4UA9A 5TJJA 3BW6A 2EWWA 2LB5A 3W4QA 2J9PA 2ZQAA 2OLUA 3VP1A 1FIKA 3IF6C 3IH9A 2ACGA 1FCMA 4OLDA 3A3EA 1H8YA 2WGVA 1LL8A 4RYEA 1BSGA 5M18A 2BTFP 5CTMA 3SH8A 1BLSA 3NOPC 2EA9A 4R3BA 3S4XA 2OAQ1 1L2SA 1YSQA 3CMZA 3MSHA 4E3JA 2PHYA 1F9IA 3OPHA 3EOIA 3RH8B 4JXWA 1K4EA 4LV0A 4WLAA 2VLGA 2XF3A 1MY8A 2AVXA 3WS1A 3VOYA 4H8RA 2V1BA 2JHEA 3G30A 4WUJA 1HZOA 4HOIA 2Y2HA
chains in the Genus database with same CATH topology
1H5XA 1ES2A 1DJCA 2XH9A 4X55A 5HAIA 4EWFA 3M2KA 3BFGA 1ZG4A 4JKTA 4WMCD 4DXCA 4S2OA 4EUZA 5CGSA 2EX6A 4QY6A 3IXDA 1KGFA 1YLZA 3N8RA 4GDNA 1MXOA 5TR7A 3GTCA 3MBZA 5HX9A 3Q7ZA 2GDNA 1JVJA 4ZJ2A 3ITBA 3N8SA 1L0GA 1ONGA 1BT5A 1K25A 2ZJ9A 4GD6A 1I5QA 1YLTA 3NY4A 4Q8IA 3O86A 5GLAA 2HDRA 2Z2MB 4BD0A 4DDYA 4O7DA 5AQ9A 5CXWA 1JTDA 4KZ5A 4OOLA 5F1GA 4FSFA 1PWDA 4UA7A 1L0EA 2Y2OA 3CG5A 4P85A 2WKHA 2X02A 1G6AA 4CPKA 2R9WA 4OPRA 4X56A 3N7WA 4WYYA 5EVID 4MBFA 4PM6A 4R3JA 2Y2GA 3FKWA 4RX2A 3SS4A 4EBNA 4LCLA 4HESA 3VP0A 1Y54A 2Y2MA 1M40A 1NJ4A 3C4PA 3V39A 3VFFA 5CEDA 1I2SA 4PM8A 4DE0A 2JE5A 2PU4A 2EFUA 1E3UD 3HLFA 5TGFA 4X68A 3UDFA 4BENA 2WKIA 4WZ4A 1IEMA 2V1ZA 1GHMA 2X71A 4GOGA 2Y55A 4JF6A 4LV1A 2WZXA 3GQZA 5CGWA 3AGEA 4EBLA 4HBTA 5EVIB 1SDEA 3BLSA 3LY4A 1GHPA 4KG2A 5KMWA 4OQGA 2OSUA 2WADA 3HBRA 1MWSA 2WKEA 3M6HA 5F82A 3ZFZA 1ESIA 3ZG5A 3MZDA 1W5DA 4OPZA 1XA7A 2XD1A 5TFQA 4OPQA 3C7VA 3UN7A 1K38A 4JXVA 5FA7A 1Q2QA 3QHYA 3IWOA 1MWUA 1XX2A 1E4DA 1ESUA 2XFTA 3CZDA 2Z2LB 1K6RA 1EWZA 5A93A 3B3XA 4MLLA 2IWBA 1Q2PA 4FD8A 5G18A 2WK0A 2PBYA 3GRJA 1K4FA 2Y2NA 4XUZA 1W8YA 5EVIC 4OQ0A 5HW3A 3BECA 2A3UA 4GB7A 3W4OA 2IWCA 3ZG8B 4DDSA 1YMXA 2OLVA 4KQQA 4P87A 3VMAA 1BLHA 4KZ6A 3M6BA 4ZTKA 2BG1A 1CEGA 3BFEA 4OPYA 4QHCA 1KDSA 4KZ8A 4ZBEA 5CECA 1ERMA 3ZVWA 3FZCA 4KZ7A 4R23A 2XFSA 4E3OA 1PI5A 1KGGA 2V2FF 4IEDA 4E3MA 1C3BA 4WMCA 3S22A 1MKIA 3TSGA 4DE3A 4S2LA 3OPPA 2FFYA 5E2EA 1S6RA 1FCOA 2ZC5B 5EE8A 1MWTA 1PW1A 3E2KA 3WRTA 2HPBA 4DF6A 4QJGA 3RXXA 3HUOA 3MKFA 3O88A 1ONHA 3Q07A 4BJPA 4WM9A 4MBHA 5FI7A 2XK1A 4GN2A 1RP5A 1IYSA 4E3IA 4YINA 1K56D 2ZMAA 3A3IA 1TEMA 4WEJA 4C3QA 3AGDA 2QZ6A 5E2GA 3UE3A 5FI6A 2FFFB 3IH8A 4FCFA 2Y59A 1H8ZA 1LI9A 2XR0A 4D2OA 1QMEA 3IF5A 1O07A 3V5MA 1E25A 1O7EA 1QMFA 1VQQA 5CEBA 5E2FA 4MEZA 3VP3A 1CK3A 1YM1A 5KSHA 1IKIA 1BLPA 1BUEA 3O87A 1NXYA 3HUNA 1GA0A 1KE4A 3LY3A 4RX3A 5EECA 1W8QA 2A49A 5EVIA 4LCMA 2C6WB 1IYQA 1IELA 2XEPA 4E3KA 1KE0A 1GCEA 4N9KA 4HBUA 5F83A 3WWXA 3LEZA 4KZ4A 3HLCA 3ZCZA 4DRTA 3W4PA 4DXBA 4X69A 1E3UA 1XPBA 2HDUA 5E2HA 4JPMA 1MPLA 4YFMA 2Y91A 4BL2A 3NDGA 4R4RA 2E8IA 3N6IA 3IT9A 4PMAA 1JWPA 3NI9A 3IXBA 1CEFA 1I2WA 4E6XA 3DW0A 2EX9A 2H5SA 3NC8A 3GR2A 4DE1A 4LV2A 1ZKJA 5FQ9A 2JCHA 3SS5A 4Z9QA 3EQUA 3IHAA 3E2LA 4WEKA 3UDIA 1YLJA 4S2NA 3VP4A 3UPPA 1ALQA 5M19A 4KQRA 4U3TA 3IQAA 1PI4A 4P0MA 4Y7PA 5HL1A 4OKPA 3WRZA 3ZNTA 5FATA 3WS5A 4BD1A 4LV3A 3MZFA 2HP6A 4ZDXA 3PTEA 1YLYA 3CJMA 3UE1A 1ES3A 1ES4A 4M3KA 5AQAA 3ZG7B 3IXHA 4JLFA 3IWIA 4NK3A 1LI0A 1Z6FA 1MBLA 4OP5A 1S0WA 3ZNYA 3PBTA 2H0YA 4GZBA 1ERQA 1RCJA 3PBNA 2Y2IA 5I94A 5FAQA 1K55C 1YLPA 2CC1A 2J9OA 3HREA 2Y2KA 3PBQA 3PAEA 3G34A 3IXGA 3LCEA 5DVAA 1YT4A 4DE2A 2XGNA 1KVMA 3OPLA 2XQZA 4KZBA 5GHYA 2DCFA 3MFDA 4X6TA 1IYPA 4OQIA 4QD4A 4XUXA 3SS3A 1WYCA 1TDGA 4S2KA 5DF8A 3ISGA 2ZQ8A 2Q9NA 4KZAA 3SOIA 5EOEA 2Y2LA 5DF7A 5GLCA 2ZM0A 1HVBA 3PBRA 5CERA 2WYXA 3M2JA 3WS2A 5DTTA 5HAQA 3NCKA 3C7UA 3ZG9B 2QPNA 1W79A 4RA7A 4BLMA 4LENA 1K54A 5BOHA 1L0FA 2WAEA 5KSCA 3N4IA 1FSYA 5CHUA 4JXGA 2J8YA 1NZOA 1XKZA 3LO7A 1XA1A 5J8XA 3FV7A 3HL9A 2ZC6B 3NBLA 3HUMA 1NY0A 1TVFA 3ITAA 4UAAA 4GD8A 3Q1FA 3N8LA 3VOZA 1K56A 2ZM8A 4K0WA 2HDSA 5L2FA 5EPHA 1XGIA 1LL5A 4A5RA 5EUAA 4B4ZA 3FYZA 5FQIA 4UA6A 1K6SA 3BRMA 1TDLA 5D3OA 4NETA 4QU3A 5A92A 1YMSA 2X01A 4PM9A 5FQJA 3GMWA 3V3SA 1N4OA 4KZ3A 3RJUA 4FH2A 5FAOA 4F94A 2WZZA 2H10A 3HLBA 4C6YA 1G68A 5GL9A 2ZC7A 3PBOA 3HLEA 1K55A 4JF4A 3A3DA 1XXMA 3C4OA 4MNRA 5GLDA 3VFHA 1RGZA 1K57A 2WGWB 4S2NC 5U47A 1EI5A 2UWXA 4C75A 2QMIA 1JWZA 2ZQ9A 3GV9A 3PBSA 5EOOA 3C5AA 4EBPA 5FQKA 1ES5A 1PZOA 2P74A 3G2ZA 4OP8A 3S1YA 4KQOA 3V3RA 2JBFA 4MBKA 4E6WA 5FASA 1DY6A 1KE3A 1CI9A 3UPNA 2WGIA 5CGXA 1NYMA 4Y0OA 1L0DA 3A3FA 4IBXA 1AXBA 3P09A 4R1GA 3RXWA 1KDWA 1DJAA 2I72A 2P9VB 1IKGA 2DNSA 2Y4AA 3ZHHA 3O3VA 4L0LA 4S2PA 5IHVA 1ZG6A 3JYIA 1CI8A 5FQMA 3BM6A 2OV5A 5HAPA 3Q7VB 4WZ5A 4OLGA 3HLGA 4JXSA 3TOIA 2HDQA 1WE4A 3HVFA 4ZJ3A 4GKUA 2ZD8A 5CRFA 3A3JA 1BTLA 3DWZA 4HEFA 1FQGA 4P6BA 5EVLA 2ZC4B 3MXSA 2JC7A 3ZGAB 4ID4A 3TG9A 2R9XA 4KENB 4B88A 4WBGA 1YLWA 1EROA 3QNBA 4OOYA 4S2MA 4Y0UA 5CHJA 5M1AA 1K54C 4GNUA 1NYYA 4N1HA 4KG6A 4ZAMA 4WELA 1XGJA 2EX2A 2XLNA 1M6KA 4S2JA 3UE0A 2EX8A 4K91A 4OVDA 2ZQCA 3GSGA 5FQQA 3HLWA 1YQSA 2HP9A 3QNCA 3G31A 4EV4A 1SCWA 3NIAA 4QB8A 4OH0A 3G4PA 2EXBA 3BLMA 3ZVTA 4N92A 1SKFA 4E3LA 5FDHA 4QY5A 4B4XA 3Q82A 1WYBA 4X53A 4FH4A 4N9LA 1N9BA 4DKIA 3MKEA 3G32A 3UY6A 3WS0A 4IBRA 5CTNA 2RL3A 1NZUA 2Q9MA 1K57C 1BLCA 1LL9A 2WGWA 3AGFA 1PW8A 3FKVA 2IWDA 2C5WB 4K0XA 3ZG0A 1VM1A 1FSWA 1ZC2A 4JBFA 1PZPA 3DWKA 4S2IA 2VGKA 5DF9A 3OC2A 3V50A 3SH7A 1NRFA 2H0TA 2ZC3B 4UHUA 3NDEA 1U60A 3I7JA 4KG5A 1PWGA 2WUQA 5CHMA 1PWCA 1FR6A 4PPRA 2G2UA 4PM5A 3MZEA 3GVBA 5A91A 3UPOA 5HFOA 2P9VA 4OQHA 4U0TA 5A90A 3DTMA 2J7VA 3SH9A 2HP5A 3D4FA 4IVKA 3IF6B 5AQ7A 3MXRA 1OMEA 5FI2A 3Q7VA 4WZ5C 5DTSA 4BQMA 3VSKA 4JF5A 3UNWA 4RVAA 1JTGA 4UA9A 5E43A 1BULA 4OOMA 4PM7A 5KZHA 3W4QA 1GA9A 3HLDA 2J9PA 1IYOA 1FR1A 1KVLA 2ZQAA 2OLUA 5FAPA 3VP2A 1SHVA 3VP1A 2ZQDA 2G2WA 2WAFA 3IF6C 1HD8A 1MWRA 3IH9A 3UO9A 5GHXA 4Y0TA 1JWVA 3BFFA 2RCXA 1FCMA 1PYYA 4OLDA 4ZJ1A 2ZLYA 4R4SA 5JYPA 3PAGA 3A3EA 1H8YA 5JYOA 3G35A 1PIOA 2WGVA 1RGYA 4IVIA 2Y2PA 4N1XA 4RYEA 3OCNA 1BSGA 5M18A 2Y2JA 5CTMA 5FSRA 3SH8A 3IHBA 2V20A 3G2YA 1BLSA 3P98A 4R0QA 4CJNA 2VGJA 1W7FA 5AQBA 1KGEA 4R3BA 3S4XA 3UDXA 2Y2QA 3W8KA 1L2SA 2BLSA 3OCLA 2DRWA 3BFDA 4EQIA 3ZDJA 1LHYA 3CMZA 3BFCA 4E3JA 3FWLA 1FOFA 1GHIA 5F1FA 3OPHA 1FCNA 2ZQ7A 2EXAA 5GLBA 3OZHA 2XD5A 3VSLA 4BL3A 1SDNA 3Q81A 1LLBA 4E3NA 4JXWA 1K4EA 5GHZA 2B5RA 4LV0A 1DJBA 3BYDA 1XP4A 4U0XA 3IWQA 4GDBA 2XF3A 1MY8A 3OPRA 2PU2A 3WS1A 3VOYA 4XXRA 4H8RA 3WS4A 4OONA 2EFXA 1BZAA 3G30A 1J9MA 3BEBA 2XDMA 4KZ9A 2ZM2A 1HZOA 3IF6A 3EQVA 1HTZA 5DTKA 2Y2HA 5HARA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H5X A;  1ES2 A;  1DJC A;  2XH9 A;  4X55 A;  5HAI A;  4EWF A;  3M2K A;  3BFG A;  1ZG4 A;  4JKT A;  4WMC D;  4DXC A;  4S2O A;  4EUZ A;  5CGS A;  2EX6 A;  4QY6 A;  3IXD A;  1KGF A;  1YLZ A;  3N8R A;  4GDN A;  1MXO A;  5TR7 A;  3GTC A;  3MBZ A;  5HX9 A;  3Q7Z A;  2GDN A;  1JVJ A;  4ZJ2 A;  3ITB A;  3N8S A;  1L0G A;  1ONG A;  1BT5 A;  1K25 A;  2ZJ9 A;  4GD6 A;  1I5Q A;  1YLT A;  3NY4 A;  4Q8I A;  3O86 A;  5GLA A;  2HDR A;  2Z2M B;  4BD0 A;  4DDY A;  4O7D A;  5AQ9 A;  5CXW A;  1JTD A;  4KZ5 A;  4OOL A;  5F1G A;  4FSF A;  1PWD A;  4UA7 A;  1L0E A;  2Y2O A;  3CG5 A;  4P85 A;  2WKH A;  2X02 A;  1G6A A;  4CPK A;  2R9W A;  4OPR A;  4X56 A;  3N7W A;  4WYY A;  5EVI D;  4MBF A;  4PM6 A;  4R3J A;  2Y2G A;  3FKW A;  4RX2 A;  3SS4 A;  4EBN A;  4LCL A;  4HES A;  3VP0 A;  1Y54 A;  2Y2M A;  1M40 A;  1NJ4 A;  3C4P A;  3V39 A;  3VFF A;  5CED A;  1I2S A;  4PM8 A;  4DE0 A;  2JE5 A;  2PU4 A;  2EFU A;  1E3U D;  3HLF A;  5TGF A;  4X68 A;  3UDF A;  4BEN A;  2WKI A;  4WZ4 A;  1IEM A;  2V1Z A;  1GHM A;  2X71 A;  4GOG A;  2Y55 A;  4JF6 A;  4LV1 A;  2WZX A;  3GQZ A;  5CGW A;  3AGE A;  4EBL A;  4HBT A;  5EVI B;  1SDE A;  3BLS A;  3LY4 A;  1GHP A;  4KG2 A;  5KMW A;  4OQG A;  2OSU A;  2WAD A;  3HBR A;  1MWS A;  2WKE A;  3M6H A;  5F82 A;  3ZFZ A;  1ESI A;  3ZG5 A;  3MZD A;  1W5D A;  4OPZ A;  1XA7 A;  2XD1 A;  5TFQ A;  4OPQ A;  3C7V A;  3UN7 A;  1K38 A;  4JXV A;  5FA7 A;  1Q2Q A;  3QHY A;  3IWO A;  1MWU A;  1XX2 A;  1E4D A;  1ESU A;  2XFT A;  3CZD A;  2Z2L B;  1K6R A;  1EWZ A;  5A93 A;  3B3X A;  4MLL A;  2IWB A;  1Q2P A;  4FD8 A;  5G18 A;  2WK0 A;  2PBY A;  3GRJ A;  1K4F A;  2Y2N A;  4XUZ A;  1W8Y A;  5EVI C;  4OQ0 A;  5HW3 A;  3BEC A;  2A3U A;  4GB7 A;  3W4O A;  2IWC A;  3ZG8 B;  4DDS A;  1YMX A;  2OLV A;  4KQQ A;  4P87 A;  3VMA A;  1BLH A;  4KZ6 A;  3M6B A;  4ZTK A;  2BG1 A;  1CEG A;  3BFE A;  4OPY A;  4QHC A;  1KDS A;  4KZ8 A;  4ZBE A;  5CEC A;  1ERM A;  3ZVW A;  3FZC A;  4KZ7 A;  4R23 A;  2XFS A;  4E3O A;  1PI5 A;  1KGG A;  2V2F F;  4IED A;  4E3M A;  1C3B A;  4WMC A;  3S22 A;  1MKI A;  3TSG A;  4DE3 A;  4S2L A;  3OPP A;  2FFY A;  5E2E A;  1S6R A;  1FCO A;  2ZC5 B;  5EE8 A;  1MWT A;  1PW1 A;  3E2K A;  3WRT A;  2HPB A;  4DF6 A;  4QJG A;  3RXX A;  3HUO A;  3MKF A;  3O88 A;  1ONH A;  3Q07 A;  4BJP A;  4WM9 A;  4MBH A;  5FI7 A;  2XK1 A;  4GN2 A;  1RP5 A;  1IYS A;  4E3I A;  4YIN A;  1K56 D;  2ZMA A;  3A3I A;  1TEM A;  4WEJ A;  4C3Q A;  3AGD A;  2QZ6 A;  5E2G A;  3UE3 A;  5FI6 A;  2FFF B;  3IH8 A;  4FCF A;  2Y59 A;  1H8Z A;  1LI9 A;  2XR0 A;  4D2O A;  1QME A;  3IF5 A;  1O07 A;  3V5M A;  1E25 A;  1O7E A;  1QMF A;  1VQQ A;  5CEB A;  5E2F A;  4MEZ A;  3VP3 A;  1CK3 A;  1YM1 A;  5KSH A;  1IKI A;  1BLP A;  1BUE A;  3O87 A;  1NXY A;  3HUN A;  1GA0 A;  1KE4 A;  3LY3 A;  4RX3 A;  5EEC A;  1W8Q A;  2A49 A;  5EVI A;  4LCM A;  2C6W B;  1IYQ A;  1IEL A;  2XEP A;  4E3K A;  1KE0 A;  1GCE A;  4N9K A;  4HBU A;  5F83 A;  3WWX A;  3LEZ A;  4KZ4 A;  3HLC A;  3ZCZ A;  4DRT A;  3W4P A;  4DXB A;  4X69 A;  1E3U A;  1XPB A;  2HDU A;  5E2H A;  4JPM A;  1MPL A;  4YFM A;  2Y91 A;  4BL2 A;  3NDG A;  4R4R A;  2E8I A;  3N6I A;  3IT9 A;  4PMA A;  1JWP A;  3NI9 A;  3IXB A;  1CEF A;  1I2W A;  4E6X A;  3DW0 A;  2EX9 A;  2H5S A;  3NC8 A;  3GR2 A;  4DE1 A;  4LV2 A;  1ZKJ A;  5FQ9 A;  2JCH A;  3SS5 A;  4Z9Q A;  3EQU A;  3IHA A;  3E2L A;  4WEK A;  3UDI A;  1YLJ A;  4S2N A;  3VP4 A;  3UPP A;  1ALQ A;  5M19 A;  4KQR A;  4U3T A;  3IQA A;  1PI4 A;  4P0M A;  4Y7P A;  5HL1 A;  4OKP A;  3WRZ A;  3ZNT A;  5FAT A;  3WS5 A;  4BD1 A;  4LV3 A;  3MZF A;  2HP6 A;  4ZDX A;  3PTE A;  1YLY A;  3CJM A;  3UE1 A;  1ES3 A;  1ES4 A;  4M3K A;  5AQA A;  3ZG7 B;  3IXH A;  4JLF A;  3IWI A;  4NK3 A;  1LI0 A;  1Z6F A;  1MBL A;  4OP5 A;  1S0W A;  3ZNY A;  3PBT A;  2H0Y A;  4GZB A;  1ERQ A;  1RCJ A;  3PBN A;  2Y2I A;  5I94 A;  5FAQ A;  1K55 C;  1YLP A;  2CC1 A;  2J9O A;  3HRE A;  2Y2K A;  3PBQ A;  3PAE A;  3G34 A;  3IXG A;  3LCE A;  5DVA A;  1YT4 A;  4DE2 A;  2XGN A;  1KVM A;  3OPL A;  2XQZ A;  4KZB A;  5GHY A;  2DCF A;  3MFD A;  4X6T A;  1IYP A;  4OQI A;  4QD4 A;  4XUX A;  3SS3 A;  1WYC A;  1TDG A;  4S2K A;  5DF8 A;  3ISG A;  2ZQ8 A;  2Q9N A;  4KZA A;  3SOI A;  5EOE A;  2Y2L A;  5DF7 A;  5GLC A;  2ZM0 A;  1HVB A;  3PBR A;  5CER A;  2WYX A;  3M2J A;  3WS2 A;  5DTT A;  5HAQ A;  3NCK A;  3C7U A;  3ZG9 B;  2QPN A;  1W79 A;  4RA7 A;  4BLM A;  4LEN A;  1K54 A;  5BOH A;  1L0F A;  2WAE A;  5KSC A;  3N4I A;  1FSY A;  5CHU A;  4JXG A;  2J8Y A;  1NZO A;  1XKZ A;  3LO7 A;  1XA1 A;  5J8X A;  3FV7 A;  3HL9 A;  2ZC6 B;  3NBL A;  3HUM A;  1NY0 A;  1TVF A;  3ITA A;  4UAA A;  4GD8 A;  3Q1F A;  3N8L A;  3VOZ A;  1K56 A;  2ZM8 A;  4K0W A;  2HDS A;  5L2F A;  5EPH A;  1XGI A;  1LL5 A;  4A5R A;  5EUA A;  4B4Z A;  3FYZ A;  5FQI A;  4UA6 A;  1K6S A;  3BRM A;  1TDL A;  5D3O A;  4NET A;  4QU3 A;  5A92 A;  1YMS A;  2X01 A;  4PM9 A;  5FQJ A;  3GMW A;  3V3S A;  1N4O A;  4KZ3 A;  3RJU A;  4FH2 A;  5FAO A;  4F94 A;  2WZZ A;  2H10 A;  3HLB A;  4C6Y A;  1G68 A;  5GL9 A;  2ZC7 A;  3PBO A;  3HLE A;  1K55 A;  4JF4 A;  3A3D A;  1XXM A;  3C4O A;  4MNR A;  5GLD A;  3VFH A;  1RGZ A;  1K57 A;  2WGW B;  4S2N C;  5U47 A;  1EI5 A;  2UWX A;  4C75 A;  2QMI A;  1JWZ A;  2ZQ9 A;  3GV9 A;  3PBS A;  5EOO A;  3C5A A;  4EBP A;  5FQK A;  1ES5 A;  1PZO A;  2P74 A;  3G2Z A;  4OP8 A;  3S1Y A;  4KQO A;  3V3R A;  2JBF A;  4MBK A;  4E6W A;  5FAS A;  1DY6 A;  1KE3 A;  1CI9 A;  3UPN A;  2WGI A;  5CGX A;  1NYM A;  4Y0O A;  1L0D A;  3A3F A;  4IBX A;  1AXB A;  3P09 A;  4R1G A;  3RXW A;  1KDW A;  1DJA A;  2I72 A;  2P9V B;  1IKG A;  2DNS A;  2Y4A A;  3ZHH A;  3O3V A;  4L0L A;  4S2P A;  5IHV A;  1ZG6 A;  3JYI A;  1CI8 A;  5FQM A;  3BM6 A;  2OV5 A;  5HAP A;  3Q7V B;  4WZ5 A;  4OLG A;  3HLG A;  4JXS A;  3TOI A;  2HDQ A;  1WE4 A;  3HVF A;  4ZJ3 A;  4GKU A;  2ZD8 A;  5CRF A;  3A3J A;  1BTL A;  3DWZ A;  4HEF A;  1FQG A;  4P6B A;  5EVL A;  2ZC4 B;  3MXS A;  2JC7 A;  3ZGA B;  4ID4 A;  3TG9 A;  2R9X A;  4KEN B;  4B88 A;  4WBG A;  1YLW A;  1ERO A;  3QNB A;  4OOY A;  4S2M A;  4Y0U A;  5CHJ A;  5M1A A;  1K54 C;  4GNU A;  1NYY A;  4N1H A;  4KG6 A;  4ZAM A;  4WEL A;  1XGJ A;  2EX2 A;  2XLN A;  1M6K A;  4S2J A;  3UE0 A;  2EX8 A;  4K91 A;  4OVD A;  2ZQC A;  3GSG A;  5FQQ A;  3HLW A;  1YQS A;  2HP9 A;  3QNC A;  3G31 A;  4EV4 A;  1SCW A;  3NIA A;  4QB8 A;  4OH0 A;  3G4P A;  2EXB A;  3BLM A;  3ZVT A;  4N92 A;  1SKF A;  4E3L A;  5FDH A;  4QY5 A;  4B4X A;  3Q82 A;  1WYB A;  4X53 A;  4FH4 A;  4N9L A;  1N9B A;  4DKI A;  3MKE A;  3G32 A;  3UY6 A;  3WS0 A;  4IBR A;  5CTN A;  2RL3 A;  1NZU A;  2Q9M A;  1K57 C;  1BLC A;  1LL9 A;  2WGW A;  3AGF A;  1PW8 A;  3FKV A;  2IWD A;  2C5W B;  4K0X A;  3ZG0 A;  1VM1 A;  1FSW A;  1ZC2 A;  4JBF A;  1PZP A;  3DWK A;  4S2I A;  2VGK A;  5DF9 A;  3OC2 A;  3V50 A;  3SH7 A;  1NRF A;  2H0T A;  2ZC3 B;  4UHU A;  3NDE A;  1U60 A;  3I7J A;  4KG5 A;  1PWG A;  2WUQ A;  5CHM A;  1PWC A;  1FR6 A;  4PPR A;  2G2U A;  4PM5 A;  3MZE A;  3GVB A;  5A91 A;  3UPO A;  5HFO A;  2P9V A;  4OQH A;  4U0T A;  5A90 A;  3DTM A;  2J7V A;  3SH9 A;  2HP5 A;  3D4F A;  4IVK A;  3IF6 B;  5AQ7 A;  3MXR A;  1OME A;  5FI2 A;  3Q7V A;  4WZ5 C;  5DTS A;  4BQM A;  3VSK A;  4JF5 A;  3UNW A;  4RVA A;  1JTG A;  4UA9 A;  5E43 A;  1BUL A;  4OOM A;  4PM7 A;  5KZH A;  3W4Q A;  1GA9 A;  3HLD A;  2J9P A;  1IYO A;  1FR1 A;  1KVL A;  2ZQA A;  2OLU A;  5FAP A;  3VP2 A;  1SHV A;  3VP1 A;  2ZQD A;  2G2W A;  2WAF A;  3IF6 C;  1HD8 A;  1MWR A;  3IH9 A;  3UO9 A;  5GHX A;  4Y0T A;  1JWV A;  3BFF A;  2RCX A;  1FCM A;  1PYY A;  4OLD A;  4ZJ1 A;  2ZLY A;  4R4S A;  5JYP A;  3PAG A;  3A3E A;  1H8Y A;  5JYO A;  3G35 A;  1PIO A;  2WGV A;  1RGY A;  4IVI A;  2Y2P A;  4N1X A;  4RYE A;  3OCN A;  1BSG A;  5M18 A;  2Y2J A;  5CTM A;  5FSR A;  3SH8 A;  3IHB A;  2V20 A;  3G2Y A;  1BLS A;  3P98 A;  4R0Q A;  4CJN A;  2VGJ A;  1W7F A;  5AQB A;  1KGE A;  4R3B A;  3S4X A;  3UDX A;  2Y2Q A;  3W8K A;  1L2S A;  2BLS A;  3OCL A;  2DRW A;  3BFD A;  4EQI A;  3ZDJ A;  1LHY A;  3CMZ A;  3BFC A;  4E3J A;  3FWL A;  1FOF A;  1GHI A;  5F1F A;  3OPH A;  1FCN A;  2ZQ7 A;  2EXA A;  5GLB A;  3OZH A;  2XD5 A;  3VSL A;  4BL3 A;  1SDN A;  3Q81 A;  1LLB A;  4E3N A;  4JXW A;  1K4E A;  5GHZ A;  2B5R A;  4LV0 A;  1DJB A;  3BYD A;  1XP4 A;  4U0X A;  3IWQ A;  4GDB A;  2XF3 A;  1MY8 A;  3OPR A;  2PU2 A;  3WS1 A;  3VOY A;  4XXR A;  4H8R A;  3WS4 A;  4OON A;  2EFX A;  1BZA A;  3G30 A;  1J9M A;  3BEB A;  2XDM A;  4KZ9 A;  2ZM2 A;  1HZO A;  3IF6 A;  3EQV A;  1HTZ A;  5DTK A;  2Y2H A;  5HAR A; 
#chains in the Genus database with same CATH topology
 3LUQ A;  4X55 A;  5HAI A;  4ME4 A;  4JKT A;  4WMC D;  5CGS A;  4PHT A;  5HWV A;  5TR7 A;  2JN7 A;  2GDN A;  3B42 A;  1CJF A;  1L0G A;  1I5Q A;  1K0K A;  1YLT A;  1OTD A;  2HDR A;  4UQI M;  4DDY A;  5AQ9 A;  2VV7 A;  1JTD A;  5F1G A;  4FSF A;  1L0E A;  4Z1W A;  5G4Z A;  1KOU A;  4CLC A;  4MBF A;  1N9L A;  3SS4 A;  4EBN A;  3VFF A;  1I2S A;  4PM8 A;  4DE0 A;  5TGF A;  4X68 A;  4MN5 A;  4GOG A;  1OJ5 A;  3GQZ A;  5HDS A;  2JKR I;  3AGE A;  3E4Q A;  4HBT A;  1SDE A;  3BLS A;  3LY4 A;  3KYQ A;  2NUT C;  1XA7 A;  2XD1 A;  5TFQ A;  1G6O A;  1BYW A;  1Q2Q A;  3QHY A;  4BBU A;  1MWU A;  1XX2 A;  1ESU A;  3CZD A;  2Z6C A;  4F3L A;  4FD8 A;  4LRZ E;  4XUZ A;  2Y2N A;  1W8Y A;  4OQ0 A;  5L09 A;  3ZG8 B;  2OLV A;  4P87 A;  4HY8 A;  4KQQ A;  3VMA A;  2VGL M;  3T4T A;  4MN6 A;  3S7Q A;  2MJ6 A;  3K3D A;  2W27 A;  4ZBE A;  4R23 A;  4EET B;  1PI5 A;  4IED A;  1WA9 A;  4WMC A;  4S2L A;  4QJG A;  2J3T C;  3HUO A;  4DMZ A;  3K2N A;  4GN2 A;  4C3Q A;  1TEM A;  4WEJ A;  2JKF A;  2PBD P;  2O9C A;  5FI6 A;  2FFF B;  2Y59 A;  1H8Z A;  3NOU C;  1QME A;  3IF5 A;  1O07 A;  4O8G A;  1O7E A;  1VQQ A;  5CEB A;  1YM1 A;  5KSH A;  1IKI A;  1BLP A;  3IX8 A;  3O87 A;  4RX3 A;  4MN7 A;  2A49 A;  4JGO A;  4LCM A;  2C6W B;  3FG8 A;  3WWX A;  4DXB A;  3LR5 A;  5E2H A;  2V8F A;  1EW0 A;  2E8I A;  1JWP A;  1I2W A;  2ZOI A;  3NC8 A;  1YKD A;  1ZKJ A;  1A0K A;  2ZL1 A;  4NEE D;  1ALQ A;  1PI4 A;  5HL1 A;  3WRZ A;  3ZNT A;  3NHQ A;  4LV3 A;  3MZF A;  2HP6 A;  4DJ2 A;  3CJM A;  3IXH A;  4HH2 A;  4JLF A;  4NKP A;  3PBT A;  2H0Y A;  4GZB A;  1ERQ A;  2Y8H A;  3QP1 A;  3PBN A;  2Y2I A;  3A0V A;  5I94 A;  1K55 C;  1YLP A;  2CC1 A;  2J9O A;  3G34 A;  3LCE A;  4O0P A;  5DVA A;  2XQZ A;  4KZB A;  5GHY A;  4NXG A;  4S2K A;  3H7W A;  3SOI A;  2W1R A;  2PD7 A;  5CER A;  3VE3 A;  3WS2 A;  5HAQ A;  3NCK A;  3TW8 A;  5HSQ A;  1L0F A;  2WAE A;  2P04 A;  1TS8 A;  5CHU A;  3LO7 A;  1XKZ A;  5FEG A;  3FV7 A;  3HL9 A;  1NY0 A;  1TVF A;  3CUE C;  3ITA A;  2ZM8 A;  4K0W A;  2HDS A;  1P9R A;  5EUA A;  3E4P A;  3C8C A;  5FQJ A;  3GMW A;  3ICY A;  4FH2 A;  1G68 A;  3MJQ A;  1D7E A;  1CF0 A;  3PXP A;  1EI5 A;  4EW7 A;  1JWZ A;  2ZQ9 A;  1Z09 A;  3S1Y A;  4E6W A;  4XT2 A;  2P08 A;  2WGI A;  5CGX A;  1L0D A;  4IBX A;  4R1G A;  3RXW A;  2DNS A;  1CI8 A;  5HAP A;  2OV5 A;  3B47 A;  3HVF A;  4HEF A;  3MXS A;  3PR6 A;  3TG9 A;  3D3O A;  4KEN B;  3LR3 A;  3QNB A;  5CHJ A;  1NYY A;  2EX2 A;  2EX8 A;  4K91 A;  4ARZ A;  4LRY C;  1T1C A;  3EWK A;  3G31 A;  4KUK A;  3S7N A;  5LBR A;  2EXB A;  4N92 A;  1SKF A;  3QP6 A;  1WYB A;  4HI4 A;  3MKE A;  1K57 C;  2Q9M A;  1ZC2 A;  3OBF A;  5HL6 A;  3RFB A;  1P0Z A;  3T4L A;  3BY9 A;  2I9V A;  4UHU A;  3NDE A;  2WUQ A;  4H6J A;  4PM5 A;  3GVB A;  5HWW A;  4RQ9 A;  4OQH A;  1S1Z A;  4U0T A;  1VET A;  2J7V A;  3SH9 A;  1S66 L;  3Q7V A;  2D02 A;  3T1Q B;  1F98 A;  4HHD A;  4LLO B;  1DRM A;  3LGO A;  2VV6 A;  5FAP A;  1DP6 A;  1SHV A;  2ZQD A;  5FEF A;  2G2W A;  4G3W A;  3MQ0 A;  1JWV A;  2RCX A;  4ZJ1 A;  4R4S A;  3PAG A;  3BQA A;  5AVE A;  4N1X A;  3OCN A;  4EQ1 A;  3IHB A;  4JGP A;  4NXB A;  4CLC B;  3T50 A;  5EVE A;  3CI6 A;  3U2A A;  3DTI A;  1FCN A;  2ZQ7 A;  2EXA A;  4BL3 A;  3F1N A;  3Q81 A;  3BY8 A;  3LI8 A;  3BYD A;  3OPR A;  5A8B A;  3LI9 A;  2W3E A;  3B33 A;  2XDM A;  4KZ9 A;  4F3L B;  3ZQ5 A;  3EQV A;  2PRF A;  3BRM A;  5HAR A;  1T1A A;  1DJC A;  4EWF A;  4DXC A;  2B95 A;  3BFG A;  4S2O A;  2QJ7 A;  3N8R A;  3MBZ A;  5DJT A;  5EM0 A;  1N9N A;  4ZJ2 A;  3N8S A;  3UB7 A;  1ONG A;  1K25 A;  1S1Y A;  4GD6 A;  1NRJ A;  2INW A;  4Q0I A;  4O7D A;  1UWP X;  2J80 A;  3H82 A;  1T19 A;  1ODV A;  5L07 A;  4R3J A;  2Z6D A;  4LRX C;  1Y54 A;  1LSX A;  2JE5 A;  2EFU A;  4BEN A;  4WZ4 A;  2V1Z A;  1GHM A;  3CIT A;  4JF6 A;  4LV1 A;  2WZX A;  4Y3I A;  4EBL A;  3KSF A;  3LID A;  5KMW A;  3HBR A;  2WKE A;  5TBM A;  2R78 A;  3C7V A;  3T4S A;  5FA7 A;  2D01 A;  4CLC D;  1J3W A;  2XFT A;  5A93 A;  2IWB A;  3GRJ A;  1K4F A;  2V0W A;  2ZL1 B;  2A3U A;  2IWC A;  2KLI A;  4FTX A;  1CEG A;  3BFE A;  1JNU A;  4MDZ A;  1KDS A;  4KZ8 A;  3UMD A;  1W63 M;  4K08 A;  4II7 A;  2V0U A;  4E3O A;  1FIL A;  2V2F F;  2XRN A;  4E3M A;  3S22 A;  1FCO A;  5EE8 A;  1MWT A;  1PW1 A;  3E2K A;  3LIC A;  3A0S A;  3WRT A;  4NXF A;  3F1P A;  3P7N A;  4FOF A;  3T4K A;  4BBV A;  4BJP A;  1RP5 A;  3H7W B;  4LGW A;  3A3I A;  2ZMA A;  4YIN A;  1MZU A;  3AGD A;  3VE4 A;  4BBT A;  1TD5 A;  4R3A A;  4HP4 A;  1QMF A;  1N9O A;  4MEZ A;  3VP3 A;  1V9Y A;  1CK3 A;  4GJ4 A;  1S67 L;  1NXY A;  4R38 A;  5EEC A;  3KSI A;  1IYQ A;  4E3K A;  1KE0 A;  4M4X A;  5F5Y A;  4HBU A;  3LEZ A;  4DRT A;  1XPB A;  4HNB A;  4BL2 A;  3NDG A;  4R4R A;  3N6I A;  3IT9 A;  4PMA A;  4E6X A;  3DW0 A;  2H5S A;  2XA7 S;  3TE8 A;  2B18 A;  2JCH A;  4FUW A;  3UDI A;  4S2N A;  3VP4 A;  4GHI A;  4OKP A;  3WS5 A;  2WKR A;  4ZDX A;  1ES3 A;  4XT2 B;  3JPU A;  1S0W A;  2OWJ A;  2JKT M;  3HRE A;  3PAE A;  2XGN A;  1KVM A;  1G28 A;  1IYP A;  2HF6 A;  3ISG A;  2VX8 A;  4D60 A;  5DF7 A;  5GLC A;  3PBR A;  3MR0 A;  3C7U A;  1XJ2 A;  4RA7 A;  4BLM A;  4LEN A;  1K54 A;  5KSC A;  3N4I A;  1FSY A;  5J8X A;  1NZO A;  1XA1 A;  1NLY A;  4ARZ B;  3QP2 A;  3N8L A;  3D9Y A;  3LIA A;  4I3A A;  5D3O A;  2X01 A;  1N4O A;  4KZ3 A;  3RJU A;  3OLO A;  3HLB A;  3U4L P;  3CAX A;  1Y28 A;  1S4S A;  2QWS A;  2ZC7 A;  1XXM A;  5EM1 A;  5U47 A;  3GV9 A;  3CWF A;  5EOO A;  4EEP A;  2JKG A;  5FQK A;  2P74 A;  4R6L A;  3V3R A;  4MBK A;  1DY6 A;  1KE3 A;  3F1O A;  1CI9 A;  1NYM A;  4H6J B;  3P09 A;  2I72 A;  1DJA A;  1IKG A;  1VET B;  2W1T A;  1ZG6 A;  3JYI A;  5FQM A;  3Q7V B;  4OLG A;  3TOI A;  2W0N A;  2HDQ A;  2Q0O A;  4ZJ3 A;  1LSV A;  2ZD8 A;  4GKU A;  2P7J A;  2M7V A;  1OPX A;  5EVL A;  1FQG A;  3ZGA B;  4ID4 A;  1W63 Q;  1ERO A;  3MQQ A;  4N1H A;  4KG6 A;  4B93 A;  2OAP 1;  2ZQC A;  1YQS A;  2L4R A;  3ZVT A;  4QY5 A;  4B4X A;  5DJU A;  3S7O A;  1NZU A;  1VM1 A;  3F1N B;  5EV0 A;  3DWK A;  3H9W A;  3OC2 A;  3V50 A;  1U60 A;  4QPR A;  4KG5 A;  2OOL A;  3UE6 A;  1TS7 A;  1SKO A;  5A90 A;  3BJN A;  3DTM A;  5HD5 A;  3D4F A;  3HJI A;  4WZ5 C;  1OT9 A;  4RVA A;  1JTG A;  1GA9 A;  1IYO A;  1FR1 A;  5MC7 A;  2VGL S;  4GS9 A;  3NUL A;  1HD8 A;  5GHX A;  3KSH A;  4Y0T A;  3BFF A;  4IUK A;  2ZLY A;  5JYP A;  3G35 A;  1PIO A;  1RGY A;  4IVI A;  3H82 B;  2Y2P A;  3T1R A;  3TRC A;  3G2Y A;  4R0Q A;  4CJN A;  3IX4 A;  2VGJ A;  1W7F A;  2A24 A;  3LYX A;  5AQB A;  2Y2Q A;  3C30 A;  3W8K A;  3OCL A;  3MXQ A;  2DRW A;  4EQI A;  1LHY A;  3FWL A;  1NLZ A;  2XD5 A;  3VSL A;  1AWI A;  4E3N A;  5GHZ A;  4I3I A;  1DJB A;  1XP4 A;  4U0X A;  4GDB A;  5TBM B;  2PR6 A;  2PU2 A;  4XXR A;  3WS4 A;  5HPF A;  5G4Y A;  4I3J A;  2EFX A;  3JVU A;  2A2L A;  1BZA A;  3BEB A;  5J3W A;  2O9B A;  1XFQ A;  4IUH A;  5DTK A;  4I5S A;  1H5X A;  4JGQ A;  4EUZ A;  1F2K A;  4DJ3 A;  4QY6 A;  3IXD A;  1YLZ A;  4GDN A;  1MXO A;  2G7U A;  3DTE A;  3Q7Z A;  1JVJ A;  1STZ A;  3ITB A;  3MQO A;  4LPZ A;  3KX0 X;  3LFV A;  1BT5 A;  3DBA A;  2ZJ9 A;  4Q8I A;  3O86 A;  3LIE A;  5GLA A;  4BD0 A;  3FPV A;  4ETX A;  1PWD A;  4HJ4 A;  4UA7 A;  3CG5 A;  4P85 A;  2X02 A;  1G6A A;  4CPK A;  2R9W A;  3F1P B;  4EXO A;  2O0Y A;  4WYY A;  5EVI D;  3A0R A;  2Y2G A;  3FKW A;  4LCL A;  1OT6 A;  4HIA A;  2PU4 A;  1E3U D;  2QHK A;  2WKI A;  2X71 A;  5CGW A;  2ZMF A;  2YKH A;  4KG2 A;  1GHP A;  2WAD A;  5I5L A;  2VZW A;  3M6H A;  3ZFZ A;  1ESI A;  3ZG5 A;  3UB5 P;  4OPZ A;  3UB8 A;  4OPQ A;  3UN7 A;  4JXV A;  4YNR A;  3IWO A;  4PKY G;  3EEH A;  2Z2L B;  1GSV A;  3B3X A;  4MLL A;  1Q2P A;  5G18 A;  2WK0 A;  3OOV A;  5J4E A;  4BMW A;  1X0O A;  2KX6 A;  2HZ5 A;  3T1S A;  3BEC A;  3W4O A;  2V1A A;  4GHI B;  1YMX A;  2V8C A;  1TS6 A;  4ZTK A;  2FH5 A;  2BG1 A;  4OPY A;  3LR0 A;  2XRO A;  1ERM A;  3ZVW A;  4KZ7 A;  2W3D A;  1KGG A;  1C3B A;  3UB9 A;  1MKI A;  3TSG A;  3OPP A;  2K31 A;  4WF0 A;  1UWN X;  2ZC5 B;  4HJ3 A;  4EU0 A;  2HPB A;  3FC7 A;  2BAS A;  3Q07 A;  5FI7 A;  2QYB A;  4BWI A;  4CLC C;  2XK1 A;  4E3I A;  1IYS A;  1K56 D;  2QZ6 A;  4EER A;  3IH8 A;  2GNX A;  1DP8 A;  1LI9 A;  3IBR A;  3QP8 A;  4I39 A;  1OJG A;  3V5M A;  3UME A;  3CPT A;  5E2F A;  3D72 A;  1BUE A;  3LY3 A;  1KE4 A;  1W8Q A;  5EVI A;  3CUE A;  4QWO A;  1GCE A;  2UV0 E;  1H3Q A;  5F83 A;  3HLC A;  3ZCZ A;  1E3U A;  2HDU A;  1MPL A;  2Y91 A;  1P97 A;  3NI9 A;  4P6Z S;  5FDS A;  5FQ9 A;  3SS5 A;  5J7E A;  4Z9Q A;  3EQU A;  3E2L A;  1YLJ A;  2K2N A;  4GLQ A;  4U3T A;  4P0M A;  3HJK A;  4Y7P A;  3PHY A;  1YLY A;  3UE1 A;  5AQA A;  4M3K A;  5HWT A;  3IWI A;  1LI0 A;  1Z6F A;  3F1O B;  4OP5 A;  2LB9 A;  1RCJ A;  1T1B A;  3E98 A;  5FAQ A;  2Y2K A;  1XFN A;  3PBQ A;  4DE2 A;  1YT4 A;  2W1T B;  3OPL A;  3MFD A;  4OQI A;  4XUX A;  3SS3 A;  4G3V A;  1WYC A;  5DF8 A;  2ZQ8 A;  2Q9N A;  5C5K A;  4HQA A;  1HVB A;  2PT7 A;  3EGX C;  3M2J A;  5DTT A;  1OTB A;  1W79 A;  3R7W B;  2FZ0 A;  3EEA A;  3T4J A;  2J8Y A;  1ZHH B;  2HV1 A;  3HUM A;  5K5B A;  4UAA A;  3Q1F A;  3VOZ A;  1K56 A;  5EPH A;  4A5R A;  2QJ5 A;  5FQI A;  4UA6 A;  1K6S A;  1TDL A;  5A92 A;  1YMS A;  4PM9 A;  3L7H A;  2GX5 A;  4MCW A;  5FAO A;  3MFX A;  2WZZ A;  2H10 A;  4F94 A;  5GL9 A;  4JF4 A;  3A3D A;  1T18 A;  3C4O A;  5GLD A;  3VFH A;  1K57 A;  2UWX A;  4C75 A;  2QMI A;  2L0W A;  3PBS A;  4EBP A;  2QKP A;  4GCZ A;  3G2Z A;  4OP8 A;  4KQO A;  2JBF A;  2PD8 A;  1UGU A;  3UPN A;  3QP4 A;  4Y0O A;  5KIZ A;  1SKO B;  3T4O A;  2PYP A;  2Y4A A;  3O3V A;  4L0L A;  4S2P A;  4PAU A;  3LIB A;  3BM6 A;  1WE4 A;  3A3J A;  3BQ8 A;  4Y17 A;  3DWZ A;  2R9X A;  4B88 A;  3KYZ A;  4OOY A;  4S2M A;  4Y0U A;  5M1A A;  4GNU A;  4GS9 B;  2YKF A;  4X25 A;  4WEL A;  1TF1 A;  1M6K A;  3UE0 A;  3NEC A;  2EWV A;  3GSG A;  3QNC A;  2M1C A;  3NIA A;  2A24 B;  2PR5 A;  3LIF A;  2VA0 A;  4FH4 A;  3DAV A;  4Q0H A;  1N9B A;  4DKI A;  3UY6 A;  4IBR A;  5AJG A;  5CTN A;  3NJA A;  3AGF A;  4L9G A;  2WGW A;  3FKV A;  2C5W B;  3RTY A;  3ZG0 A;  3KSG A;  5DF9 A;  2PDR A;  1L3L A;  1NRF A;  2H0T A;  2WKP A;  2ZC3 B;  5CHM A;  4PPR A;  5A91 A;  3UPO A;  4R70 A;  2P9V A;  3NOT C;  4Y2F A;  4EUV A;  1OME A;  5FI2 A;  5DTS A;  4JGR A;  4BQM A;  3VSK A;  3UNW A;  2O9A A;  3ZYT A;  3FPW A;  4HJ6 A;  2HJE A;  4WL9 A;  5E43 A;  1BUL A;  4OOM A;  4PM7 A;  5FL3 A;  5KZH A;  1DP9 A;  3HLD A;  3PYP A;  1KVL A;  2M7U A;  3VP2 A;  2WAF A;  1MWR A;  3UO9 A;  1PYY A;  5EFW A;  4WN5 A;  5JYO A;  4X1M A;  2Y2J A;  5FSR A;  1VHM A;  2V20 A;  3P98 A;  1KGE A;  2ZOH A;  2L1M A;  3UDX A;  2BLS A;  3BFD A;  3ZDJ A;  3BFC A;  3UB6 A;  1FOF A;  4Y5F A;  1GHI A;  3IS2 A;  4Y15 A;  4O01 A;  5F1F A;  5GLB A;  3OZH A;  4GW9 A;  1SDN A;  1LLB A;  2B5R A;  3T12 B;  3O5Y A;  3IWQ A;  1OTI A;  3IX3 A;  2CMN A;  5IT5 A;  1LSW A;  3W2Z A;  1ZTU A;  4EEU A;  3KO6 A;  4OON A;  3R7W A;  1VEU A;  1J9M A;  2ZM2 A;  3IF6 A;  1HTZ A;  5HDC A;  2KDK A;  1ES2 A;  2XH9 A;  4CLC E;  3M2K A;  1ZG4 A;  4CQH A;  4ESP A;  2EX6 A;  1KGF A;  3DTK A;  4UQI S;  2Y79 A;  1OTE A;  3GTC A;  5HX9 A;  3NY4 A;  4Q0J A;  1XJ3 A;  2Z2M B;  2W3H A;  3CHW P;  5CXW A;  4KZ5 A;  4OOL A;  2OWH A;  2Y2O A;  2KOI A;  2WKH A;  4OPR A;  4X56 A;  3N7W A;  1GSX A;  4ZRR A;  3SZT A;  4PM6 A;  4RX2 A;  5DKL A;  3V67 A;  4HES A;  3VP0 A;  1D1J A;  2Y2M A;  1M40 A;  1NJ4 A;  3C4P A;  3V39 A;  5CED A;  2WKQ A;  3UDF A;  3HLF A;  5HD3 A;  5HPI A;  1IEM A;  2O99 A;  4G3K A;  3CPT B;  4I38 A;  2Y55 A;  3IBJ A;  5EVI B;  4OQG A;  2OSU A;  1MWS A;  1MKM A;  2JKR M;  5F82 A;  3MZD A;  1W5D A;  2J3T D;  1K38 A;  1PFL A;  3R4K A;  1E4D A;  1K6R A;  1EWZ A;  3SW1 A;  3BWL A;  2H28 A;  5F69 A;  2PBY A;  1F5M A;  3T4Q A;  2PAV P;  2E8J A;  5EVI C;  1YSP A;  5HW3 A;  4GB7 A;  4DDS A;  3GDI A;  1D06 A;  3P01 A;  1BLH A;  4KZ6 A;  3M6B A;  4QHC A;  2PYR A;  5CEC A;  3FZC A;  2XFS A;  1LT0 A;  4E04 A;  2K7S A;  4DE3 A;  2FFY A;  4IJG A;  1S6R A;  3C2W A;  5E2E A;  4DF6 A;  3RXX A;  3MKF A;  3O88 A;  1ONH A;  4L9F A;  4WM9 A;  4MBH A;  1S4R A;  4AFI A;  1PNE A;  5E2G A;  1CQA A;  3UE3 A;  4FCF A;  4IHQ A;  3VV4 A;  2XR0 A;  4D2O A;  3VOL A;  1E25 A;  1XJ4 A;  3HUN A;  1GA0 A;  1IFQ A;  5F68 A;  1IEL A;  2XEP A;  4N9K A;  3QP5 A;  4KZ4 A;  3W4P A;  4X69 A;  4JPM A;  5HDD A;  2VK3 A;  4YFM A;  3HCY A;  5DKK A;  4X1L A;  3IXB A;  1CEF A;  2EX9 A;  4NXE A;  2XSS A;  3GR2 A;  4DE1 A;  4LV2 A;  1TS0 A;  4WEK A;  3IHA A;  3UPP A;  3LR4 A;  5M19 A;  4KQR A;  4YOF A;  3IQA A;  4P6Z M;  4BD1 A;  5FAT A;  2VV8 A;  4YWZ A;  3PTE A;  3ZG7 B;  1ES4 A;  4NK3 A;  3G6O A;  1MBL A;  1H0M A;  3ZNY A;  3K3C A;  1YAX A;  1NWZ A;  3IXG A;  5AVF A;  1GSW A;  3LEQ A;  2DCF A;  5DFX A;  4X6T A;  4QD4 A;  1TDG A;  4KZA A;  3EGD C;  5EOE A;  4EES A;  2Y2L A;  2ZM0 A;  2WYX A;  3ZG9 B;  1G5U A;  2QPN A;  3MF0 A;  4JXG A;  3NBL A;  2ZC6 B;  3KYE A;  4GD8 A;  5L2F A;  1XGI A;  1LL5 A;  4B4Z A;  3FYZ A;  4L9E A;  1YPR A;  5BOH A;  4NET A;  4QU3 A;  2W3F A;  1OTA A;  3V3S A;  4HH3 A;  3ULF A;  1MC0 A;  2NUP C;  4C6Y A;  1XJ6 A;  2J3W A;  3PBO A;  3HLE A;  2DMW A;  1K55 A;  4PKY A;  4MNR A;  1RGZ A;  5L8M A;  4S2N C;  2WGW B;  5L10 A;  2V9A A;  1ACF A;  3JVV A;  4Y13 A;  3GEC A;  3C5A A;  1ES5 A;  1PZO A;  4KUO A;  1IOU A;  5FAS A;  4HP9 A;  3E4O A;  3A3F A;  1AXB A;  3S7P A;  2HGV A;  1KDW A;  2P9V B;  1VB6 A;  3ZHH A;  5IHV A;  1P9W A;  2VJW A;  4WZ5 A;  3HLG A;  2ZBB A;  4JXS A;  5CRF A;  1BTL A;  3C38 A;  4LFU A;  1PRQ A;  4P6B A;  5CX7 A;  4B9O A;  2ZC4 B;  2JC7 A;  2ZMV A;  2W3G A;  2VEA A;  4WBG A;  1YLW A;  3E0Y A;  2B02 A;  1K54 C;  4ZAM A;  1XGJ A;  2XLN A;  2VKS A;  5DFY A;  3T1X A;  2HJ9 C;  4S2J A;  1V9Z A;  4OVD A;  5HZH A;  5FQQ A;  3HLW A;  2HP9 A;  4EV4 A;  1SCW A;  4QB8 A;  4OH0 A;  3G4P A;  3BLM A;  2XA7 M;  4E3L A;  5FDH A;  2JKT I;  4UEY A;  5IU1 A;  3Q82 A;  4X53 A;  4MMN A;  1Y4O A;  4N9L A;  3G32 A;  4NG2 A;  3WS0 A;  1SZV A;  3IS2 B;  2RL3 A;  1LL9 A;  1BLC A;  1PW8 A;  2IWD A;  1HLU P;  4K0X A;  3TJZ C;  1FSW A;  4JBF A;  1PZP A;  4S2I A;  2VGK A;  4DN0 A;  4ETZ A;  3SH7 A;  5F6A A;  4KQD A;  3I7J A;  1PWG A;  1PWC A;  1FR6 A;  3CLO A;  2G2U A;  3MZE A;  5HFO A;  1H8M A;  2GJ3 A;  1VEU B;  2HP5 A;  3L9K A;  3IF6 B;  4IVK A;  5AQ7 A;  3MS6 A;  3MXR A;  2IA2 A;  4JF5 A;  3MMH A;  5IS1 A;  2GZA A;  4UA9 A;  5TJJ A;  3BW6 A;  2EWW A;  2LB5 A;  3W4Q A;  2J9P A;  2ZQA A;  2OLU A;  3VP1 A;  1FIK A;  3IF6 C;  3IH9 A;  2ACG A;  1FCM A;  4OLD A;  3A3E A;  1H8Y A;  2WGV A;  1LL8 A;  4RYE A;  1BSG A;  5M18 A;  2BTF P;  5CTM A;  3SH8 A;  1BLS A;  3NOP C;  2EA9 A;  4R3B A;  3S4X A;  2OAQ 1;  1L2S A;  1YSQ A;  3CMZ A;  3MSH A;  4E3J A;  2PHY A;  1F9I A;  3OPH A;  3EOI A;  3RH8 B;  4JXW A;  1K4E A;  4LV0 A;  4WLA A;  2VLG A;  2XF3 A;  1MY8 A;  2AVX A;  3WS1 A;  3VOY A;  4H8R A;  2V1B A;  2JHE A;  3G30 A;  4WUJ A;  1HZO A;  4HOI A;  2Y2H A; 
#chains in the Genus database with same CATH homology
 1H5X A;  1ES2 A;  1DJC A;  2XH9 A;  4X55 A;  5HAI A;  4EWF A;  3M2K A;  3BFG A;  1ZG4 A;  4JKT A;  4WMC D;  4DXC A;  4S2O A;  4EUZ A;  5CGS A;  2EX6 A;  4QY6 A;  3IXD A;  1KGF A;  1YLZ A;  3N8R A;  4GDN A;  1MXO A;  5TR7 A;  3GTC A;  3MBZ A;  5HX9 A;  3Q7Z A;  2GDN A;  1JVJ A;  4ZJ2 A;  3ITB A;  3N8S A;  1L0G A;  1ONG A;  1BT5 A;  1K25 A;  2ZJ9 A;  4GD6 A;  1I5Q A;  1YLT A;  3NY4 A;  4Q8I A;  3O86 A;  5GLA A;  2HDR A;  2Z2M B;  4BD0 A;  4DDY A;  4O7D A;  5AQ9 A;  5CXW A;  1JTD A;  4KZ5 A;  4OOL A;  5F1G A;  4FSF A;  1PWD A;  4UA7 A;  1L0E A;  2Y2O A;  3CG5 A;  4P85 A;  2WKH A;  2X02 A;  1G6A A;  4CPK A;  2R9W A;  4OPR A;  4X56 A;  3N7W A;  4WYY A;  5EVI D;  4MBF A;  4PM6 A;  4R3J A;  2Y2G A;  3FKW A;  4RX2 A;  3SS4 A;  4EBN A;  4LCL A;  4HES A;  3VP0 A;  1Y54 A;  2Y2M A;  1M40 A;  1NJ4 A;  3C4P A;  3V39 A;  3VFF A;  5CED A;  1I2S A;  4PM8 A;  4DE0 A;  2JE5 A;  2PU4 A;  2EFU A;  1E3U D;  3HLF A;  5TGF A;  4X68 A;  3UDF A;  4BEN A;  2WKI A;  4WZ4 A;  1IEM A;  2V1Z A;  1GHM A;  2X71 A;  4GOG A;  2Y55 A;  4JF6 A;  4LV1 A;  2WZX A;  3GQZ A;  5CGW A;  3AGE A;  4EBL A;  4HBT A;  5EVI B;  1SDE A;  3BLS A;  3LY4 A;  1GHP A;  4KG2 A;  5KMW A;  4OQG A;  2OSU A;  2WAD A;  3HBR A;  1MWS A;  2WKE A;  3M6H A;  5F82 A;  3ZFZ A;  1ESI A;  3ZG5 A;  3MZD A;  1W5D A;  4OPZ A;  1XA7 A;  2XD1 A;  5TFQ A;  4OPQ A;  3C7V A;  3UN7 A;  1K38 A;  4JXV A;  5FA7 A;  1Q2Q A;  3QHY A;  3IWO A;  1MWU A;  1XX2 A;  1E4D A;  1ESU A;  2XFT A;  3CZD A;  2Z2L B;  1K6R A;  1EWZ A;  5A93 A;  3B3X A;  4MLL A;  2IWB A;  1Q2P A;  4FD8 A;  5G18 A;  2WK0 A;  2PBY A;  3GRJ A;  1K4F A;  2Y2N A;  4XUZ A;  1W8Y A;  5EVI C;  4OQ0 A;  5HW3 A;  3BEC A;  2A3U A;  4GB7 A;  3W4O A;  2IWC A;  3ZG8 B;  4DDS A;  1YMX A;  2OLV A;  4KQQ A;  4P87 A;  3VMA A;  1BLH A;  4KZ6 A;  3M6B A;  4ZTK A;  2BG1 A;  1CEG A;  3BFE A;  4OPY A;  4QHC A;  1KDS A;  4KZ8 A;  4ZBE A;  5CEC A;  1ERM A;  3ZVW A;  3FZC A;  4KZ7 A;  4R23 A;  2XFS A;  4E3O A;  1PI5 A;  1KGG A;  2V2F F;  4IED A;  4E3M A;  1C3B A;  4WMC A;  3S22 A;  1MKI A;  3TSG A;  4DE3 A;  4S2L A;  3OPP A;  2FFY A;  5E2E A;  1S6R A;  1FCO A;  2ZC5 B;  5EE8 A;  1MWT A;  1PW1 A;  3E2K A;  3WRT A;  2HPB A;  4DF6 A;  4QJG A;  3RXX A;  3HUO A;  3MKF A;  3O88 A;  1ONH A;  3Q07 A;  4BJP A;  4WM9 A;  4MBH A;  5FI7 A;  2XK1 A;  4GN2 A;  1RP5 A;  1IYS A;  4E3I A;  4YIN A;  1K56 D;  2ZMA A;  3A3I A;  1TEM A;  4WEJ A;  4C3Q A;  3AGD A;  2QZ6 A;  5E2G A;  3UE3 A;  5FI6 A;  2FFF B;  3IH8 A;  4FCF A;  2Y59 A;  1H8Z A;  1LI9 A;  2XR0 A;  4D2O A;  1QME A;  3IF5 A;  1O07 A;  3V5M A;  1E25 A;  1O7E A;  1QMF A;  1VQQ A;  5CEB A;  5E2F A;  4MEZ A;  3VP3 A;  1CK3 A;  1YM1 A;  5KSH A;  1IKI A;  1BLP A;  1BUE A;  3O87 A;  1NXY A;  3HUN A;  1GA0 A;  1KE4 A;  3LY3 A;  4RX3 A;  5EEC A;  1W8Q A;  2A49 A;  5EVI A;  4LCM A;  2C6W B;  1IYQ A;  1IEL A;  2XEP A;  4E3K A;  1KE0 A;  1GCE A;  4N9K A;  4HBU A;  5F83 A;  3WWX A;  3LEZ A;  4KZ4 A;  3HLC A;  3ZCZ A;  4DRT A;  3W4P A;  4DXB A;  4X69 A;  1E3U A;  1XPB A;  2HDU A;  5E2H A;  4JPM A;  1MPL A;  4YFM A;  2Y91 A;  4BL2 A;  3NDG A;  4R4R A;  2E8I A;  3N6I A;  3IT9 A;  4PMA A;  1JWP A;  3NI9 A;  3IXB A;  1CEF A;  1I2W A;  4E6X A;  3DW0 A;  2EX9 A;  2H5S A;  3NC8 A;  3GR2 A;  4DE1 A;  4LV2 A;  1ZKJ A;  5FQ9 A;  2JCH A;  3SS5 A;  4Z9Q A;  3EQU A;  3IHA A;  3E2L A;  4WEK A;  3UDI A;  1YLJ A;  4S2N A;  3VP4 A;  3UPP A;  1ALQ A;  5M19 A;  4KQR A;  4U3T A;  3IQA A;  1PI4 A;  4P0M A;  4Y7P A;  5HL1 A;  4OKP A;  3WRZ A;  3ZNT A;  5FAT A;  3WS5 A;  4BD1 A;  4LV3 A;  3MZF A;  2HP6 A;  4ZDX A;  3PTE A;  1YLY A;  3CJM A;  3UE1 A;  1ES3 A;  1ES4 A;  4M3K A;  5AQA A;  3ZG7 B;  3IXH A;  4JLF A;  3IWI A;  4NK3 A;  1LI0 A;  1Z6F A;  1MBL A;  4OP5 A;  1S0W A;  3ZNY A;  3PBT A;  2H0Y A;  4GZB A;  1ERQ A;  1RCJ A;  3PBN A;  2Y2I A;  5I94 A;  5FAQ A;  1K55 C;  1YLP A;  2CC1 A;  2J9O A;  3HRE A;  2Y2K A;  3PBQ A;  3PAE A;  3G34 A;  3IXG A;  3LCE A;  5DVA A;  1YT4 A;  4DE2 A;  2XGN A;  1KVM A;  3OPL A;  2XQZ A;  4KZB A;  5GHY A;  2DCF A;  3MFD A;  4X6T A;  1IYP A;  4OQI A;  4QD4 A;  4XUX A;  3SS3 A;  1WYC A;  1TDG A;  4S2K A;  5DF8 A;  3ISG A;  2ZQ8 A;  2Q9N A;  4KZA A;  3SOI A;  5EOE A;  2Y2L A;  5DF7 A;  5GLC A;  2ZM0 A;  1HVB A;  3PBR A;  5CER A;  2WYX A;  3M2J A;  3WS2 A;  5DTT A;  5HAQ A;  3NCK A;  3C7U A;  3ZG9 B;  2QPN A;  1W79 A;  4RA7 A;  4BLM A;  4LEN A;  1K54 A;  5BOH A;  1L0F A;  2WAE A;  5KSC A;  3N4I A;  1FSY A;  5CHU A;  4JXG A;  2J8Y A;  1NZO A;  1XKZ A;  3LO7 A;  1XA1 A;  5J8X A;  3FV7 A;  3HL9 A;  2ZC6 B;  3NBL A;  3HUM A;  1NY0 A;  1TVF A;  3ITA A;  4UAA A;  4GD8 A;  3Q1F A;  3N8L A;  3VOZ A;  1K56 A;  2ZM8 A;  4K0W A;  2HDS A;  5L2F A;  5EPH A;  1XGI A;  1LL5 A;  4A5R A;  5EUA A;  4B4Z A;  3FYZ A;  5FQI A;  4UA6 A;  1K6S A;  3BRM A;  1TDL A;  5D3O A;  4NET A;  4QU3 A;  5A92 A;  1YMS A;  2X01 A;  4PM9 A;  5FQJ A;  3GMW A;  3V3S A;  1N4O A;  4KZ3 A;  3RJU A;  4FH2 A;  5FAO A;  4F94 A;  2WZZ A;  2H10 A;  3HLB A;  4C6Y A;  1G68 A;  5GL9 A;  2ZC7 A;  3PBO A;  3HLE A;  1K55 A;  4JF4 A;  3A3D A;  1XXM A;  3C4O A;  4MNR A;  5GLD A;  3VFH A;  1RGZ A;  1K57 A;  2WGW B;  4S2N C;  5U47 A;  1EI5 A;  2UWX A;  4C75 A;  2QMI A;  1JWZ A;  2ZQ9 A;  3GV9 A;  3PBS A;  5EOO A;  3C5A A;  4EBP A;  5FQK A;  1ES5 A;  1PZO A;  2P74 A;  3G2Z A;  4OP8 A;  3S1Y A;  4KQO A;  3V3R A;  2JBF A;  4MBK A;  4E6W A;  5FAS A;  1DY6 A;  1KE3 A;  1CI9 A;  3UPN A;  2WGI A;  5CGX A;  1NYM A;  4Y0O A;  1L0D A;  3A3F A;  4IBX A;  1AXB A;  3P09 A;  4R1G A;  3RXW A;  1KDW A;  1DJA A;  2I72 A;  2P9V B;  1IKG A;  2DNS A;  2Y4A A;  3ZHH A;  3O3V A;  4L0L A;  4S2P A;  5IHV A;  1ZG6 A;  3JYI A;  1CI8 A;  5FQM A;  3BM6 A;  2OV5 A;  5HAP A;  3Q7V B;  4WZ5 A;  4OLG A;  3HLG A;  4JXS A;  3TOI A;  2HDQ A;  1WE4 A;  3HVF A;  4ZJ3 A;  4GKU A;  2ZD8 A;  5CRF A;  3A3J A;  1BTL A;  3DWZ A;  4HEF A;  1FQG A;  4P6B A;  5EVL A;  2ZC4 B;  3MXS A;  2JC7 A;  3ZGA B;  4ID4 A;  3TG9 A;  2R9X A;  4KEN B;  4B88 A;  4WBG A;  1YLW A;  1ERO A;  3QNB A;  4OOY A;  4S2M A;  4Y0U A;  5CHJ A;  5M1A A;  1K54 C;  4GNU A;  1NYY A;  4N1H A;  4KG6 A;  4ZAM A;  4WEL A;  1XGJ A;  2EX2 A;  2XLN A;  1M6K A;  4S2J A;  3UE0 A;  2EX8 A;  4K91 A;  4OVD A;  2ZQC A;  3GSG A;  5FQQ A;  3HLW A;  1YQS A;  2HP9 A;  3QNC A;  3G31 A;  4EV4 A;  1SCW A;  3NIA A;  4QB8 A;  4OH0 A;  3G4P A;  2EXB A;  3BLM A;  3ZVT A;  4N92 A;  1SKF A;  4E3L A;  5FDH A;  4QY5 A;  4B4X A;  3Q82 A;  1WYB A;  4X53 A;  4FH4 A;  4N9L A;  1N9B A;  4DKI A;  3MKE A;  3G32 A;  3UY6 A;  3WS0 A;  4IBR A;  5CTN A;  2RL3 A;  1NZU A;  2Q9M A;  1K57 C;  1BLC A;  1LL9 A;  2WGW A;  3AGF A;  1PW8 A;  3FKV A;  2IWD A;  2C5W B;  4K0X A;  3ZG0 A;  1VM1 A;  1FSW A;  1ZC2 A;  4JBF A;  1PZP A;  3DWK A;  4S2I A;  2VGK A;  5DF9 A;  3OC2 A;  3V50 A;  3SH7 A;  1NRF A;  2H0T A;  2ZC3 B;  4UHU A;  3NDE A;  1U60 A;  3I7J A;  4KG5 A;  1PWG A;  2WUQ A;  5CHM A;  1PWC A;  1FR6 A;  4PPR A;  2G2U A;  4PM5 A;  3MZE A;  3GVB A;  5A91 A;  3UPO A;  5HFO A;  2P9V A;  4OQH A;  4U0T A;  5A90 A;  3DTM A;  2J7V A;  3SH9 A;  2HP5 A;  3D4F A;  4IVK A;  3IF6 B;  5AQ7 A;  3MXR A;  1OME A;  5FI2 A;  3Q7V A;  4WZ5 C;  5DTS A;  4BQM A;  3VSK A;  4JF5 A;  3UNW A;  4RVA A;  1JTG A;  4UA9 A;  5E43 A;  1BUL A;  4OOM A;  4PM7 A;  5KZH A;  3W4Q A;  1GA9 A;  3HLD A;  2J9P A;  1IYO A;  1FR1 A;  1KVL A;  2ZQA A;  2OLU A;  5FAP A;  3VP2 A;  1SHV A;  3VP1 A;  2ZQD A;  2G2W A;  2WAF A;  3IF6 C;  1HD8 A;  1MWR A;  3IH9 A;  3UO9 A;  5GHX A;  4Y0T A;  1JWV A;  3BFF A;  2RCX A;  1FCM A;  1PYY A;  4OLD A;  4ZJ1 A;  2ZLY A;  4R4S A;  5JYP A;  3PAG A;  3A3E A;  1H8Y A;  5JYO A;  3G35 A;  1PIO A;  2WGV A;  1RGY A;  4IVI A;  2Y2P A;  4N1X A;  4RYE A;  3OCN A;  1BSG A;  5M18 A;  2Y2J A;  5CTM A;  5FSR A;  3SH8 A;  3IHB A;  2V20 A;  3G2Y A;  1BLS A;  3P98 A;  4R0Q A;  4CJN A;  2VGJ A;  1W7F A;  5AQB A;  1KGE A;  4R3B A;  3S4X A;  3UDX A;  2Y2Q A;  3W8K A;  1L2S A;  2BLS A;  3OCL A;  2DRW A;  3BFD A;  4EQI A;  3ZDJ A;  1LHY A;  3CMZ A;  3BFC A;  4E3J A;  3FWL A;  1FOF A;  1GHI A;  5F1F A;  3OPH A;  1FCN A;  2ZQ7 A;  2EXA A;  5GLB A;  3OZH A;  2XD5 A;  3VSL A;  4BL3 A;  1SDN A;  3Q81 A;  1LLB A;  4E3N A;  4JXW A;  1K4E A;  5GHZ A;  2B5R A;  4LV0 A;  1DJB A;  3BYD A;  1XP4 A;  4U0X A;  3IWQ A;  4GDB A;  2XF3 A;  1MY8 A;  3OPR A;  2PU2 A;  3WS1 A;  3VOY A;  4XXR A;  4H8R A;  3WS4 A;  4OON A;  2EFX A;  1BZA A;  3G30 A;  1J9M A;  3BEB A;  2XDM A;  4KZ9 A;  2ZM2 A;  1HZO A;  3IF6 A;  3EQV A;  1HTZ A;  5DTK A;  2Y2H A;  5HAR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...