3W4QA

Crystal structure of pena beta-lactamase from burkholderia multivorans at ph4.2
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
258
structure length
258
Chain Sequence
ASFAALERAAGGRLGVCAIDTATGRRALHRADERFPFCSTFKAMLGAAVLAQSVAHPGLLQQRVTYGRSDLVNYSPVTERHVDTGMTVAELCAATIQYSDNTAANELMKRIGGPAAVTAYARSIGDDTFRLDRWETELNTALPGDLRDTTTPAAMAANLRVLVLGDALPPAQRAQLIEWLRGNKVGDKRIRAGVPTGWRVGDKTGTGDYGTTNDVGVLWPPSRAPIVLAVYYTQTRADAKAKDDVIAAATRIASATLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into beta-lactamases from Burkholderia species, two phylogenetically related yet distinct resistance determinants
pubmed doi rcsb
source organism Burkholderia multivorans
molecule tags Hydrolase
molecule keywords Beta-lactamase
total genus 94
structure length 258
sequence length 258
chains with identical sequence B, C
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2013-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3w4qA00
1CEGA 5F83A 3ZG7B 2ZC4B 4WZ5C 2J9OA 3A3IA 2Y2LA 3HBRA 4S2LA 5IHVA 1U60A 3VP4A 1EWZA 2XFTA 2HDUA 3OPLA 1K4EA 5CERA 5CECA 4E3LA 3O87A 4E3KA 2RCXA 2PU4A 1K56A 2WAEA 3DTMA 3IWOA 4E3NA 3GVBA 4RX2A 4OKPA 4OONA 1NZOA 4P85A 4JKTA 3V50A 4DRTA 3FKWA 2UWXA 4JXVA 5CEDA 3IWIA 3P98A 2EX6A 3UPNA 5CRFA 3MXSA 4GDBA 3BRMA 3IT9A 2OLUA 4RYEA 4WM9A 3A3EA 3ZNTA 4JF4A 3LY4A 1MBLA 4OOMA 1YM1A 1ES5A 2EFXA 3N7WA 2HPBA 3BEBA 1QMEA 4PPRA 4EQIA 5FA7A 4N9KA 4JF6A 2Y2MA 3BM6A 4KENB 3UN7A 3UPPA 4K91A 4XUXA 4GN2A 3IF6A 2DNSA 3IXDA 5BOHA 3WS4A 5A93A 4QU3A 3IQAA 1H5XA 1TEMA 3E2KA 3MKEA 5F82A 3HL9A 3ZDJA 2VGJA 3VSKA 3HLDA 1YLYA 2OSUA 2QMIA 3CJMA 3FWLA 5TGFA 2JBFA 4GDNA 2XH9A 2P74A 4OQHA 4P0MA 4S2KA 4KZ9A 3AGDA 5FQMA 1RGZA 4EBPA 4GKUA 5HAPA 4KG2A 3VSLA 1IYQA 4LENA 4S2IA 5DTTA 3WS0A 2DCFA 4WEKA 3VOZA 2QPNA 3NDGA 4CPKA 3UDFA 5KZHA 1L0EA 3ZG8B 1O7EA 4S2NC 3WRTA 4JLFA 1YT4A 2HP9A 3IHBA 4UHUA 3BLMA 5EOOA 5DF8A 4QD4A 4ZJ3A 3HREA 3PAGA 4YINA 4H8RA 1W79A 1S6RA 4BD1A 5E43A 5HX9A 4LCLA 4WYYA 3GV9A 4WZ4A 4S2MA 5CTNA 1XXMA 5DF9A 1JTGA 2WKIA 2XLNA 3WWXA 4XXRA 4OLGA 5HARA 4PM9A 3D4FA 3UY6A 2Y2OA 1FR1A 4R4RA 4GZBA 1GHPA 1W5DA 4OP8A 2XGNA 5FAPA 3ZG5A 5EOEA 4S2PA 4K0XA 1Q2PA 3FZCA 2X02A 5E2HA 3CG5A 4PM8A 5KSHA 1PWGA 1C3BA 4OOYA 3G4PA 4RA7A 2BLSA 4R0QA 2IWBA 2J9PA 3G2YA 2Y91A 1BLCA 3IXBA 2HDSA 4OLDA 5GLCA 3Q7VB 3ZVTA 2WK0A 3BYDA 3PBRA 3NY4A 4KZAA 1KGEA 3PBTA 4CJNA 3UE1A 1IYSA 5CHUA 3W4PA 2RL3A 1ONGA 1IYOA 1PI4A 4E6WA 1BULA 4U0TA 1PZOA 3C7VA 2C6WB 3Q81A 1ZKJA 3HLEA 4KG5A 4RVAA 4EBNA 5KSCA 3MZEA 5FDHA 1CI8A 1WYCA 2X71A 4QHCA 1DJBA 4A5RA 2ZQAA 5FSRA 5CEBA 3RXWA 3MXRA 4ZBEA 2ZC5B 3S1YA 3NCKA 1ZG4A 3HVFA 1HZOA 2Y2HA 4X69A 1S0WA 2QZ6A 2XF3A 5E2EA 4UA7A 5AQ9A 2G2UA 3QHYA 3OPRA 1J9MA 3NBLA 1L0FA 2XK1A 3IF6B 3UE0A 5I94A 4WELA 1K56D 3RXXA 3V5MA 4E3MA 3P09A 2Y2QA 3IXHA 4KZBA 1SKFA 1ESIA 2A49A 4N92A 1SDNA 2E8IA 4JXGA 1CEFA 4KQQA 4OH0A 1GA9A 2XDMA 5HAIA 3UPOA 4DE1A 4DKIA 4E3IA 1E3UD 1BTLA 4MNRA 4LV3A 1YLPA 3PAEA 3O3VA 2EX2A 2Y2JA 3QNBA 3WS1A 3GR2A 1TDLA 1L0GA 1SCWA 1DJCA 4OQ0A 4M3KA 4QB8A 3S22A 3VOYA 5U47A 3TSGA 4P87A 3OPHA 1DJAA 5DTSA 1TDGA 2Y2KA 3Q82A 4HBTA 2WGWA 3IH9A 2Y2PA 1KE4A 4GB7A 2V20A 5EVIA 4C6YA 3Q7VA 2ZM2A 1O07A 3NI9A 5CXWA 1GCEA 2G2WA 2PBYA 2WGVA 3V3RA 4BLMA 1YLJA 2WGWB 4N9LA 4U0XA 4FCFA 2XD5A 3TOIA 2EX8A 1PIOA 2Z2MB 1PZPA 1E4DA 3HUMA 5EVLA 5FQQA 1MPLA 4EUZA 1K55A 2WZXA 1BUEA 3C4OA 3RJUA 2XD1A 1Y54A 3BFCA 1MXOA 1YLWA 3VFFA 1H8ZA 1LHYA 4L0LA 4KZ7A 3VP2A 4K0WA 4XUZA 4WMCA 4DF6A 1CI9A 1YLTA 5J8XA 3MZDA 2ZQ7A 4Y0UA 4GOGA 1W8QA 2EXBA 4UAAA 5CGXA 4E6XA 5GL9A 1WYBA 2IWCA 4DXBA 1LI9A 3N8SA 3PBQA 1PI5A 2IWDA 2Y2NA 5E2GA 5AQAA 4EBLA 2HDQA 4JXWA 5DVAA 1K54C 3G30A 1ALQA 3N6IA 4RX3A 1GHIA 3GQZA 1EROA 3N8RA 1BLPA 4UA6A 3G32A 2Q9MA 2ZQDA 3HUNA 1JWVA 3UDXA 2C5WB 3N8LA 1YMSA 1MY8A 4P6BA 4MBHA 4QY6A 1XA1A 4X55A 3DWKA 1ES2A 2Y59A 3LO7A 5GHYA 1LLBA 1ONHA 1PW1A 4ZAMA 3VP3A 4BQMA 1MKIA 4LV0A 1OMEA 3GMWA 1FQGA 3FYZA 4EWFA 3HLWA 5D3OA 3UDIA 2H0YA 1K55C 2JE5A 3C7UA 3ZCZA 3OC2A 2WGIA 1JWPA 1IYPA 4LCMA 4F94A 2ZJ9A 3GSGA 4IVIA 5FI2A 3MKFA 5FQIA 4D2OA 3GRJA 2Y2GA 1TVFA 1W7FA 5EE8A 3ZG0A 3LEZA 1I2WA 1BZAA 2WUQA 4N1XA 3FV7A 3IWQA 4OPQA 1MWTA 4BD0A 4NETA 4GD8A 4B4ZA 1YLZA 5DF7A 4JF5A 1M40A 1QMFA 2WZZA 4HEFA 5F1FA 3C5AA 1ES4A 1SDEA 2XEPA 1AXBA 1BT5A 2VGKA 2ZQ8A 4FD8A 5DTKA 3W4QA 3ZVWA 3EQUA 2A3UA 2ZMAA 1NYMA 4OPZA 1XA7A 2CC1A 1Q2QA 3DW0A 2HDRA 4KQOA 2XQZA 2H5SA 2ZC6B 4GD6A 2Y4AA 4LV1A 3BFGA 4S2OA 4DDSA 1MWRA 1RCJA 4DE3A 1W8YA 2ZM8A 5FQ9A 2J7VA 4OQIA 1JVJA 3ITBA 3OCNA 4E3JA 2Z2LB 3ZGAB 2V1ZA 1N9BA 2BG1A 2Y2IA 3PBOA 1G68A 4MLLA 4R1GA 1NYYA 4HESA 1XP4A 4JPMA 1PYYA 2XR0A 3MBZA 3LY3A 3A3JA 1SHVA 3I7JA 1KGGA 5FAQA 1I5QA 4S2NA 1ZC2A 2X01A 3HLCA 3M6HA 1HVBA 3GTCA 4R3BA 3V39A 1LL5A 4WEJA 4BENA 2Q9NA 1FSYA 5E2FA 1JTDA 5FI6A 4DDYA 3SOIA 5FASA 4R23A 1K38A 3WRZA 2WYXA 5HL1A 4X56A 4KZ6A 4ZJ2A 4DXCA 2Y55A 3A3DA 5A92A 1RGYA 2P9VA 3OCLA 3W8KA 1DY6A 5A91A 2H0TA 4O7DA 5CGWA 3VP1A 4MBFA 1KGFA 3BECA 3O86A 3JYIA 2OV5A 1KVMA 4IBXA 3SS4A 1BSGA 3E2LA 3PBSA 3M2JA 3HLBA 1BLSA 2P9VB 5FATA 2XFSA 3O88A 3OPPA 4R4SA 1KE0A 2HP5A 2ZD8A 4N1HA 1NJ4A 5JYOA 3IH8A 5FQKA 3B3XA 1IKGA 4KG6A 1MWUA 3Q1FA 5EECA 5G18A 1GHMA 2FFYA 1YMXA 4Q8IA 3AGFA 4KZ4A 2EX9A 4JBFA 5FI7A 1K4FA 1L2SA 3N4IA 4OQGA 5EUAA 3G35A 1K6RA 5GLAA 4DE0A 3Q7ZA 1HTZA 1JWZA 3BFFA 1XPBA 2H10A 4YFMA 3LCEA 3Q07A 5FAOA 3SH7A 3CZDA 3ZNYA 3C4PA 1NRFA 4LV2A 3AGEA 4PM7A 1G6AA 1VQQA 1ERQA 3NDEA 3PTEA 4OOLA 4UA9A 4FH4A 3G34A 3HLFA 3IXGA 1KVLA 1KDWA 1L0DA 4OPYA 3MFDA 3IHAA 4PMAA 4Y0TA 2R9XA 1K54A 5M1AA 1XGIA 4B88A 5CTMA 3UNWA 3BFDA 1I2SA 2ZM0A 3EQVA 3PBNA 4Z9QA 5TR7A 1LI0A 1YQSA 2J8YA 4FSFA 4PM6A 4BL3A 2V2FF 4C3QA 4Y7PA 5L2FA 3UE3A 2ZQ9A 1LL9A 4X53A 4Y0OA 1K6SA 3MZFA 4OPRA 4R3JA 5JYPA 3G31A 3W4OA 2EFUA 1HD8A 5FQJA 5GHZA 2I72A 1N4OA 1ES3A 1H8YA 3ZFZA 5M19A 1K57A 4JXSA 3NC8A 4S2JA 3IF5A 5CHJA 4B4XA 4ID4A 3UO9A 2ZC7A 3TG9A 4C75A 1ZG6A 1M6KA 1FR6A 2FFFB 1K57C 1KE3A 3VMAA 4BJPA 1FCMA 4DE2A 4QJGA 3HLGA 4OVDA 5EVIB 5EVID 3M2KA 1E25A 4OP5A 5EVIC 4EV4A 2HP6A 4ZTKA 4X6TA 4QY5A 3DWZA 1FCOA 3ISGA 3S4XA 1KDSA 1WE4A 4X68A 1EI5A 5AQ7A 2EXAA 2JC7A 5M18A 1IELA 3BFEA 4IEDA 4KZ8A 5AQBA 3SS5A 1K25A 1PWCA 1E3UA 1VM1A 2JCHA 3V3SA 4WMCD 2WADA 4ZDXA 2B5RA 1XGJA 3HUOA 1GA0A 5GLDA 3ZG9B 3A3FA 3OZHA 1ERMA 1PW8A 4MEZA 2R9WA 3CMZA 3QNCA 3BLSA 3M6BA 4HBUA 3SH9A 4KZ5A 3VFHA 4IBRA 3FKVA 3VP0A 4ZJ1A 3WS5A 5CHMA 2ZC3B 4WBGA 2WKHA 3SH8A 4PM5A 1NY0A 1ESUA 2DRWA 4IVKA 4KZ3A 2GDNA 2ZQCA 5TFQA 3WS2A 1FSWA 5GLBA 1BLHA 5CGSA 5F1GA 1RP5A 2ZLYA 3G2ZA 1NXYA 1PWDA 1Z6FA 2WKEA 4FH2A 4NK3A 1XX2A 5EPHA 1IKIA 4MBKA 1IEMA 5HAQA 5KMWA 4KQRA 5GHXA 2OLVA 4GNUA 3SS3A 3NIAA 5HFOA 1MWSA 4E3OA 1CK3A 4WZ5A 1XKZA 3ITAA 5HW3A 4U3TA 2WAFA 2PU2A 1NZUA 1FOFA 3IF6C 3ZHHA 5A90A 1FCNA 4BL2A
chains in the Genus database with same CATH superfamily
1CEGA 2J9OA 3HBRA 5IHVA 1EWZA 5CERA 2PU4A 1K56A 3F1PB 4MDZA 3EEHA 3V50A 3P98A 2EX6A 3UPNA 5CRFA 3CWFA 3IT9A 4JF4A 3LY4A 4OOMA 1YM1A 2EFXA 3BEBA 1QMEA 4PPRA 5FA7A 4N9KA 3BM6A 3HJIA 1NLYA 2DNSA 4HJ4A 5A93A 5F82A 3S7QA 3HLDA 4IUKA 2QMIA 3FWLA 1TS0A 2XH9A 4KZ9A 4EBPA 5HAPA 4S2IA 5DTTA 2DCFA 5L8MA 3CPTA 5HL6A 4CPKA 5KZHA 3IHBA 2P08A 5DF8A 1W79A 2H28A 5HX9A 1XXMA 5DF9A 3G6OA 2YKHA 3WWXA 2EA9A 4R4RA 2NUPC 2PRFA 3FPVA 5EOEA 2I9VA 4PM8A 2B18A 1TS7A 4RA7A 2J9PA 2UV0E 3G2YA 2Y91A 5LBRA 2HDSA 3NY4A 4KZAA 1KGEA 3PBTA 4UQIM 1ONGA 1PI4A 2KOIA 1PZOA 2HJEA 3NJAA 2Z6CA 4EBNA 5KSCA 3MZEA 1CI8A 5FSRA 3RXWA 4LFUA 1GSVA 3MXRA 1ZG4A 3HVFA 3EWKA 2Y2HA 4X69A 2Q0OA 2QZ6A 5FDSA 3K3DA 3OPRA 2D02A 3MMHA 3NBLA 1L0FA 2XK1A 2L0WA 3JVVA 2PR5A 1DP8A 5KIZA 3CAXA 1NWZA 2B02A 4KZBA 1SKFA 4N92A 4PHTA 5HAIA 4E04A 1BTLA 3F1OB 3QNBA 3WS1A 5HWVA 3V67A 3TW8A 2WGWA 3IH9A 4C6YA 1O07A 2G2WA 4BLMA 3T50A 2WGWB 3IX3A 3TJZC 5FQQA 4EW7A 3S7PA 3S7OA 1Y54A 4Y13A 2VK3A 3KYQA 1LHYA 4KZ7A 4DF6A 1TD5A 1YLTA 3R7WA 4Y0UA 2ZQ7A 1XFNA 1W63Q 2YKFA 2L4RA 1K0KA 2IWCA 3C8CA 3N8SA 3PBQA 5AQAA 5E2GA 2AVXA 2HDQA 4JXWA 1K54C 3G30A 3PYPA 1GHIA 4IHQA 1BLPA 2ZQDA 4Y15A 3TE8A 4QY6A 3DWKA 4UEYA 5GHYA 1LLBA 4YOFA 4MMNA 4ZAMA 3VP3A 3MR0A 3T1SA 3C7UA 5L07A 4AFIA 1IYPA 4F94A 2ZJ9A 4IVIA 4GHIA 3F1NB 5DFYA 1I2WA 1NLZA 4HJ6A 2WUQA 4XT2A 2Y79A 4MN5A 4BD0A 4WUJA 1QMFA 1BT5A 2V8FA 5L10A 2A3UA 1G6OA 2VX8A 2V8CA 1DP9A 4KQOA 2WKRA 2H5SA 3CUEA 1OTDA 1W8YA 2J3WA 4JGOA 5EV0A 1JVJA 4ESPA 3BQ8A 3ZGAB 3HCYA 4JPMA 1PYYA 3LY3A 1SHVA 1KGGA 4HNBA 3GTCA 3V39A 3ULFA 5DJUA 2Z6DA 4BENA 4R70A 1FSYA 2W3GA 3BY9A 5HL1A 2WYXA 4KZ6A 4DXCA 2VEAA 2Y55A 3A3DA 1H0MA 2P9VA 3W8KA 1DY6A 5A91A 3VOLA 4O7DA 3KX0X 1KGFA 3O86A 1D7EA 1KVMA 4IBXA 3E2LA 1BLSA 3O88A 2EWVA 4G3VA 3OPPA 1ZTUA 1NJ4A 5FQKA 1VHMA 1F98A 4KG6A 4BMWA 3Q1FA 5G18A 1GHMA 1FIKA 3N4IA 4OQGA 4FTXA 3Q7ZA 3BFFA 3LCEA 1NRFA 3T4LA 1ERQA 4OOLA 3IXGA 1KVLA 5HDCA 1L0DA 4OPYA 1LT0A 1XFQA 4B88A 1ODVA 4NXBA 2JKRM 3UNWA 4D60A 4PM6A 4X53A 4Y0OA 1K6SA 5IU1A 5DKLA 4OPRA 1S1YA 3G31A 5JYPA 4GW9A 1H8YA 1K57A 3NC8A 3H7WA 2HF6A 3SZTA 2GJ3A 4UQIS 4HOIA 3R7WB 4BJPA 3HLGA 1SKOB 2OAQ1 4B9OA 3A0SA 3UB8A 3OBFA 4OP5A 5EVIC 3PXPA 1UGUA 1FCOA 3ISGA 2V1AA 3E4OA 4X68A 4HY8A 5AQBA 3BFEA 1E3UA 3V3SA 1OTAA 2W1RA 1XGJA 3ZG9B 1GA0A 1ERMA 4I39A 3CMZA 3QNCA 2W3DA 1TS8A 1ESUA 2GDNA 1RP5A 3G2ZA 2WKEA 1YKDA 1XX2A 5EPHA 1IEMA 4L9EA 3MQ0A 3NIAA 1MWSA 1CK3A 4U3TA 2WAFA 4JGQA 3ZHHA 5A90A 4E3KA 3A3IA 4S2LA 4ME4A 2XFTA 5CECA 4PKYA 4E3LA 4Y2FA 3IWOA 4RX2A 4OONA 4LRYC 1P9RA 1NZOA 4DN0A 4EXOA 2UWXA 2OWJA 4GDBA 3ZNTA 4WM9A 1ZHHB 2ZMVA 2Y2MA 4KENB 4CQHA 4K91A 4XUXA 1LSVA 3WS4A 1H5XA 3MKEA 2Y8HA 5TGFA 3K2NA 4S2KA 3AGDA 1RGZA 4GKUA 4O0PA 3LIAA 3WS0A 4WEKA 3VOZA 4KUKA 4GCZA 3UB5P 3UDFA 4S2NC 1YT4A 3BLMA 4ZJ3A 3HREA 1S6RA 5E43A 4LCLA 4WZ4A 4S2MA 3LI9A 2OAP1 2DMWA 4XXRA 4OLGA 5HARA 1W5DA 3ZG5A 3VE3A 4K0XA 3FZCA 3CG5A 3UE6A 3QP4A 4OOYA 1BLCA 3NOTC 3ZVTA 4CJNA 1EW0A 2PD8A 2RL3A 4E6WA 4F3LA 5IS1A 1NRJA 3C7VA 2C6WB 1ZKJA 2V0WA 4L9GA 4RVAA 5FDHA 1WYCA 2X71A 3LIEA 3LIDA 4ZBEA 3S1YA 1HZOA 4O01A 1S0WA 5AQ9A 1J9MA 1K56D 3RXXA 3F1OA 2Y2QA 3JPUA 1SDNA 1H3QA 1CEFA 4OH0A 2XDMA 1T1BA 2VGLM 3UPOA 4DE1A 1H8MA 4MNRA 4LV3A 3PAEA 1TDLA 3ZYTA 1SCWA 4QB8A 3S22A 3VOYA 5U47A 1Y28A 3D9YA 4P87A 3Q82A 3LR3A 2Y2PA 1KE4A 4GB7A 5EVIA 3Q7VA 3NI9A 4EU0A 1GCEA 4P6ZS 1GSWA 4FCFA 4I3JA 2P04A 1E4DA 3LFVA 3C4OA 1H8ZA 2ZL1A 3VP2A 1CI9A 1MZUA 5J8XA 5F6AA 1W8QA 4E6XA 2PT7A 2P7JA 1PI5A 2Y2NA 1OT6A 1J3WA 5J3WA 3N6IA 4Y17A 1EROA 2Q9MA 3HUNA 2C5WB 2W27A 3EEAA 3GDIA 1MY8A 4RQ9A 4MBHA 4X55A 3LO7A 1ACFA 4BBVA 4BQMA 4KQDA 1MKIA 1FQGA 5D3OA 3E4QA 2H0YA 5AVFA 3ZCZA 3OC2A 2WGIA 2D01A 5FQIA 2PYPA 3UMDA 1IFQA 5EE8A 1BZAA 3FV7A 3IWQA 4OPQA 4NETA 4B4ZA 5DF7A 3MQOA 4JF5A 5F1FA 4G3KA 3C5AA 1ES4A 1SDEA 5DTKA 3W4QA 2O9CA 1F9IA 3VV4A 1NYMA 1XA7A 3IS2B 4CLCC 3DW0A 3LYXA 2XQZA 2V9AA 2Y4AA 4LV1A 4PAUA 3LIBA 1RCJA 2ZOIA 2ZM8A 4II7A 2HZ5A 1P97A 3O5YA 4E3JA 3B47A 4Q0HA 2M1CA 1N9BA 2BG1A 2V1ZA 4GJ4A 4HESA 4I3AA 3MQQA 2XR0A 2VJWA 4GS9B 4S2NA 4WLAA 2JHEA 3M6HA 1HVBA 4R3BA 1S67L 2Q9NA 5FASA 3SOIA 1K38A 5EM0A 3KSFA 4X1LA 3C38A 2ZOHA 4MBFA 1CJFA 2JKFA 3SS4A 4K08A 5HSQA 4R4SA 2HP5A 4N1HA 3T4QA 2XRNA 3IH8A 4HP9A 2J3TC 3AGFA 4JBFA 5EUAA 5GLAA 1HTZA 4IJGA 5FAOA 2K31A 4LLOB 3AGEA 4PM7A 4UA9A 4FH4A 3MF0A 3G34A 3HLFA 3MFDA 4LPZA 3KSHA 4PMAA 1K54A 2W3FA 4NKPA 5CTMA 3QP8A 1I2SA 4Z9QA 5TR7A 1LI0A 1YQSA 4FSFA 4C3QA 3DTKA 5L2FA 1DP6A 3UE3A 3UB9A 3H7WB 4R3JA 1HD8A 1VB6A 2I72A 1N4OA 4L9FA 1OTIA 3IF5A 4HQAA 5CHJA 2ZC7A 3TG9A 4C75A 3C30A 3W2ZA 1KE3A 4DE2A 4QJGA 4QWOA 4Z1WA 1XJ4A 5DFXA 5EVID 4Q0IA 2HP6A 3PR6A 3E0YA 4X6TA 1X0OA 1KDSA 1WE4A 2JC7A 1K25A 1VM1A 2WADA 3A3FA 2VV6A 3BLSA 3M6BA 3SH9A 4IBRA 3FKVA 1STZA 1Z09A 4WBGA 3SH8A 2FH5A 2DRWA 3TRCA 4R38A 2ZQCA 4G3WA 5K5BA 3WS2A 2MJ6A 5CGSA 1NXYA 1PWDA 4FH2A 4NK3A 1IKIA 3LEQA 5TBMA 4HIAA 1TF1A 4GNUA 2QYBA 5HW3A 5HZHA 3LICA 4NG2A 4Y5FA 3A0VA 3L7HA 2OOLA 1FCNA 4BL2A 3SW1A 2ZC4B 5F5YA 2ZBBA 1U60A 4GHIB 3OPLA 1PRQA 2HDUA 2PYRA 3O87A 2RCXA 3DTMA 2PHYA 3GVBA 3DAVA 4OKPA 4P85A 4ETZA 2KDKA 4DRTA 3FG8A 4JXVA 2NUTC 4Y3IA 1MC0A 3A3EA 1T19A 1MBLA 2VZWA 1ES5A 3N7WA 4EQIA 4QU3A 3IQAA 1Y4OA 4NXEA 3ZDJA 2VGJA 3VSKA 1YLYA 3IX4A 5HWWA 2JBFA 4OQHA 2L1MA 5FQMA 3VSLA 3H9WA 4LENA 4HI4A 2BASA 1L0EA 3WRTA 2A2LA 2HP9A 2K7SA 3PAGA 4PKYG 4YINA 4BD1A 1VEUA 4HHDA 4NXFA 4WYYA 3BY8A 5A8BA 4X25A 1S4SA 1JTGA 4PM9A 3D4FA 4GZBA 4OP8A 2XGNA 5FAPA 2GNXA 1Q2PA 5E2HA 2X02A 5KSHA 1FILA 1JNUA 1PWGA 1C3BA 3G4PA 1UWNX 4R0QA 2IWBA 3IXBA 4OLDA 5GLCA 3UE1A 1IYSA 5CHUA 3W4PA 1IYOA 3FC7A 4U0TA 3HLEA 5G4YA 1YAXA 2PR6A 3UB6A 1OJGA 5CEBA 1N9OA 2W3EA 4CLCA 2ZC5B 4YNRA 5E2EA 4EETB 1DRMA 1OT9A 2M7VA 4ETXA 5C5KA 1YSQA 5I94A 2O9BA 4E3MA 2BTFP 2PDRA 2A49A 4DKIA 1E3UD 5HDSA 2JKRI 3O3VA 2EX2A 3MJQA 1VETB 1DJCA 4M3KA 3QP2A 3OPHA 5DTSA 1TDGA 3VE4A 2FZ0A 5FEGA 4KUOA 2ZM2A 2KLIA 2O99A 1P9WA 2PBYA 4N9LA 3LR5A 5F68A 2XD5A 3TOIA 2EX8A 2Z2MB 2EWWA 3HUMA 5EVLA 1MPLA 1K55A 1BUEA 2XD1A 3BFCA 2R78A 1MXOA 1YLWA 4CLCE 1T1AA 4K0WA 4H6JA 2XA7S 3CI6A 4XUZA 1HLUP 4GOGA 5CGXA 1LI9A 2IWDA 4EBLA 1VEUB 5DVAA 1ALQA 4RX3A 2OWHA 2E8JA 3G32A 2VV8A 3UDXA 3N8LA 3H82B 1ES2A 1AWIA 4LV0A 3GMWA 4JGPA 4EWFA 3HLWA 5G4ZA 1K55C 1W63M 4LCMA 5FI2A 4D2OA 2Y2GA 4ZRRA 3LEZA 3F1PA 4N1XA 1OTEA 4MN6A 4GD8A 1YLZA 4HEFA 3IS2A 3OLOA 1AXBA 2ZQ8A 3LI8A 3EQUA 4X1MA 5TBMB 2ZMAA 1L3LA 2CC1A 3B42A 4I3IA 2HDRA 4GS9A 2ZC6B 2PBDP 3B33A 4DDSA 1LSWA 2JKTM 4OQIA 3CITA 1D1JA 5IT5A 2QHKA 2Y2IA 3PBOA 5DJTA 4R1GA 1NYYA 1XP4A 3MBZA 3A3JA 3I7JA 5FAQA 3CLOA 1ZC2A 4FOFA 3HLCA 2X01A 2VA0A 1LL5A 4NXGA 4WEJA 1F2KA 1D06A 1XJ6A 1JTDA 5FI6A 4DDYA 3WRZA 4X56A 4ZJ2A 3CHWP 5A92A 1RGYA 4R3AA 2LB9A 2J3TD 3VP1A 3BECA 1BSGA 3HLBA 1S1ZA 2XFSA 2ZMFA 2ZD8A 5JYOA 1IKGA 1MWUA 2FFYA 1YMXA 5EM1A 4Q8IA 2A24B 5FI7A 4KZ4A 2EX9A 1L2SA 1G28A 1K6RA 1F5MA 1XPBA 2H10A 3Q07A 3SH7A 3CZDA 5HDDA 1VQQA 3NDEA 4Y0TA 2R9XA 1YPRA 5M1AA 1XGIA 3S7NA 3BQAA 4ARZB 3BFDA 3MFXA 4NEED 2J8YA 3T4TA 4Y7PA 1LSXA 3MZFA 3W4OA 4R6LA 1ES3A 3ZFZA 3MS6A 4I5SA 5M19A 4JXSA 4B4XA 4ID4A 1ZG6A 1M6KA 1FR6A 2GZAA 3VMAA 4O8GA 2XA7M 4OVDA 1XJ3A 5EVIB 4EESA 3M2KA 3MXQA 1E25A 4EV4A 4QY5A 3DWZA 3EOIA 3S4XA 3A0RA 3KYZA 1T1CA 2EXAA 5M18A 1IELA 4KZ8A 3QP5A 4WMCD 2W1TB 4ZDXA 5GLDA 3HUOA 3IX8A 1PW8A 1G5UA 3VFHA 3VP0A 1BYWA 3WS5A 2ZC3B 1NY0A 4IVKA 4KZ3A 4Q0JA 4WF0A 1BLHA 5F1GA 2ZLYA 1Z6FA 4BWIA 5HAQA 2G7UA 3DTEA 3RFBA 3ITAA 3IF6C 2QKPA 5F83A 3ZG7B 4WZ5C 2Y2LA 5F69A 3VP4A 1K4EA 2WAEA 5FL3A 4E3NA 1P0ZA 4JKTA 2B95A 3FKWA 5CEDA 3IWIA 4DMZA 1A0KA 3HJKA 3MXSA 3BW6A 3NOUC 3BRMA 2OLUA 4RYEA 2PD7A 3T4JA 4LRXC 2HPBA 1MKMA 2VV7A 4JF6A 4DJ2A 3UN7A 3D72A 3E98A 3UPPA 5BOHA 4GN2A 3IF6A 3IXDA 4B93A 1TEMA 3E2KA 3HL9A 3UB7A 2OSUA 3CJMA 4GDNA 2P74A 4P0MA 4KG2A 1KOUA 1IYQA 2O9AA 3T1QB 2QPNA 3NDGA 3T1RA 5HWTA 3ZG8B 1O7EA 4JLFA 3QP6A 4UHUA 5EOOA 4WN5A 3RH8B 4QD4A 4H8RA 3JVUA 3GV9A 3P01A 5CTNA 2JKTI 2WKIA 2XLNA 3UY6A 2Y2OA 1FR1A 4ARZA 1GHPA 5L09A 4S2PA 3GECA 3DTIA 2XROA 3EGDC 3U2AA 2BLSA 3U4LP 4MCWA 3Q7VB 2WK0A 3BYDA 3PBRA 4XT2B 5HD3A 1CQAA 2HJ9C 2GX5A 3KO6A 1BULA 3Q81A 4FUWA 4KG5A 2JKGA 2WKQA 4QHCA 1DJBA 4A5RA 2ZQAA 3IBJA 3LR0A 5J4EA 1OJ5A 2PAVP 4EEPA 4EERA 3NCKA 2QJ7A 2XF3A 4UA7A 2G2UA 3QHYA 1XJ2A 5EVEA 2XSSA 3IF6B 3QP1A 3UE0A 3FPWA 4WELA 3V5MA 3P7NA 3P09A 5HPIA 3IXHA 2LB5A 2W0NA 1ESIA 2E8IA 4JXGA 4KQQA 1GA9A 4E3IA 2KX6A 2A24A 1YLPA 2Y2JA 3GR2A 1L0GA 4OQ0A 4EUVA 3TSGA 5MC7A 5AVEA 1DJAA 4LRZE 2Y2KA 5FEFA 4HBTA 2V20A 5CXWA 2WGVA 3V3RA 1YLJA 4U0XA 4I38A 4WL9A 1PIOA 4EUZA 1PZPA 1LL8A 3EGXC 2WZXA 1UWPX 3RJUA 3VFFA 5HD5A 4L0LA 4IUHA 4WMCA 1IOUA 3MZDA 2EXBA 4UAAA 2HV1A 1WA9A 2QJ5A 1WYBA 5GL9A 2HGVA 4DXBA 4DJ3A 2VLGA 2ACGA 3GQZA 1YSPA 3N8RA 4UA6A 1S4RA 1JWVA 1OTBA 2QWSA 1YMSA 5AJGA 3T12B 4P6BA 3PHYA 1XA1A 2Y59A 1ONHA 1GSXA 1PW1A 1OMEA 3CPTB 3C2WA 3KSIA 3FYZA 3K3CA 4EQ1A 3UDIA 2JE5A 3T1XA 1JWPA 3GSGA 3MKFA 3GRJA 1TVFA 1W7FA 1OPXA 3OOVA 3ZG0A 1N9LA 3LGOA 3E4PA 1PNEA 1TS6A 1MWTA 2VGLS 4HH2A 2VKSA 1M40A 2WZZA 4YWZA 2O0YA 4BBTA 2XEPA 3T4KA 4FD8A 2VGKA 2W3HA 3KYEA 3NULA 3ZVWA 4OPZA 1Q2QA 1V9ZA 4LGWA 5TJJA 4CLCB 5I5LA 3BJNA 4JGRA 4GD6A 4P6ZM 3BFGA 4S2OA 1MWRA 2WKPA 3CUEC 4HP4A 1N9NA 4DE3A 5FQ9A 2J7VA 2JN7A 3ITBA 5EFWA 4F3LB 3OCNA 2Z2LB 3LR4A 1G68A 3H82A 4MLLA 1T18A 1I5QA 3UMEA 3DBAA 3D3OA 3NHQA 5E2FA 4R23A 3OCLA 2H0TA 5CGWA 3JYIA 2OV5A 3PBSA 3M2JA 2P9VB 5FATA 1KE0A 4MN7A 3B3XA 5EECA 1K4FA 2INWA 3G35A 4CLCD 4H6JB 4DE0A 4BBUA 1JWZA 3L9KA 4YFMA 4HJ3A 3ZNYA 3C4PA 4LV2A 4GLQA 1G6AA 3PTEA 2V0UA 1KDWA 3IHAA 2V1BA 3PBNA 2ZM0A 3EQVA 3BWLA 4BL3A 2V2FF 2ZQ9A 1LL9A 3IBRA 2EFUA 5FQJA 5GHZA 2CMNA 5DKKA 3MSHA 4S2JA 3UO9A 5CX7A 4EEUA 3ZQ5A 2FFFB 1K57C 1FCMA 3KSGA 3LIFA 3LUQA 3RTYA 4ZTKA 3NOPC 4M4XA 1SKOA 2W1TA 1SZVA 1VETA 1EI5A 5AQ7A 3SS5A 4IEDA 3T4SA 1PWCA 4HH3A 2JCHA 2B5RA 3F1NA 3R4KA 3OZHA 4MEZA 2R9WA 2J80A 4HBUA 4KZ5A 4ZJ1A 2K2NA 3NECA 5CHMA 2WKHA 4PM5A 3ICYA 2M7UA 5TFQA 4QPRA 5GLBA 1FSWA 2IA2A 1CF0A 1PFLA 3T4OA 4MBKA 5KMWA 2ZL1B 4KQRA 5GHXA 1S66L 3SS3A 2OLVA 5HPFA 5HFOA 4E3OA 4WZ5A 1XKZA 5J7EA 2PU2A 1NZUA 1FOFA 1V9YA
chains in the Genus database with same CATH topology
1CEGA 5F83A 3ZG7B 2ZC4B 4WZ5C 2J9OA 3A3IA 2Y2LA 3HBRA 4S2LA 5IHVA 1U60A 3VP4A 1EWZA 2XFTA 2HDUA 3OPLA 1K4EA 5CERA 5CECA 4E3LA 3O87A 4E3KA 2RCXA 2PU4A 1K56A 2WAEA 3DTMA 3IWOA 4E3NA 3GVBA 4RX2A 4OKPA 4OONA 1NZOA 4P85A 4JKTA 3V50A 4DRTA 3FKWA 2UWXA 4JXVA 5CEDA 3IWIA 3P98A 2EX6A 3UPNA 5CRFA 3MXSA 4GDBA 3BRMA 3IT9A 2OLUA 4RYEA 4WM9A 3A3EA 3ZNTA 4JF4A 3LY4A 1MBLA 4OOMA 1YM1A 1ES5A 2EFXA 3N7WA 2HPBA 3BEBA 1QMEA 4PPRA 4EQIA 5FA7A 4N9KA 4JF6A 2Y2MA 3BM6A 4KENB 3UN7A 3UPPA 4K91A 4XUXA 4GN2A 3IF6A 2DNSA 3IXDA 5BOHA 3WS4A 5A93A 4QU3A 3IQAA 1H5XA 1TEMA 3E2KA 3MKEA 5F82A 3HL9A 3ZDJA 2VGJA 3VSKA 3HLDA 1YLYA 2OSUA 2QMIA 3CJMA 3FWLA 5TGFA 2JBFA 4GDNA 2XH9A 2P74A 4OQHA 4P0MA 4S2KA 4KZ9A 3AGDA 5FQMA 1RGZA 4EBPA 4GKUA 5HAPA 4KG2A 3VSLA 1IYQA 4LENA 4S2IA 5DTTA 3WS0A 2DCFA 4WEKA 3VOZA 2QPNA 3NDGA 4CPKA 3UDFA 5KZHA 1L0EA 3ZG8B 1O7EA 4S2NC 3WRTA 4JLFA 1YT4A 2HP9A 3IHBA 4UHUA 3BLMA 5EOOA 5DF8A 4QD4A 4ZJ3A 3HREA 3PAGA 4YINA 4H8RA 1W79A 1S6RA 4BD1A 5E43A 5HX9A 4LCLA 4WYYA 3GV9A 4WZ4A 4S2MA 5CTNA 1XXMA 5DF9A 1JTGA 2WKIA 2XLNA 3WWXA 4XXRA 4OLGA 5HARA 4PM9A 3D4FA 3UY6A 2Y2OA 1FR1A 4R4RA 4GZBA 1GHPA 1W5DA 4OP8A 2XGNA 5FAPA 3ZG5A 5EOEA 4S2PA 4K0XA 1Q2PA 3FZCA 2X02A 5E2HA 3CG5A 4PM8A 5KSHA 1PWGA 1C3BA 4OOYA 3G4PA 4RA7A 2BLSA 4R0QA 2IWBA 2J9PA 3G2YA 2Y91A 1BLCA 3IXBA 2HDSA 4OLDA 5GLCA 3Q7VB 3ZVTA 2WK0A 3BYDA 3PBRA 3NY4A 4KZAA 1KGEA 3PBTA 4CJNA 3UE1A 1IYSA 5CHUA 3W4PA 2RL3A 1ONGA 1IYOA 1PI4A 4E6WA 1BULA 4U0TA 1PZOA 3C7VA 2C6WB 3Q81A 1ZKJA 3HLEA 4KG5A 4RVAA 4EBNA 5KSCA 3MZEA 5FDHA 1CI8A 1WYCA 2X71A 4QHCA 1DJBA 4A5RA 2ZQAA 5FSRA 5CEBA 3RXWA 3MXRA 4ZBEA 2ZC5B 3S1YA 3NCKA 1ZG4A 3HVFA 1HZOA 2Y2HA 4X69A 1S0WA 2QZ6A 2XF3A 5E2EA 4UA7A 5AQ9A 2G2UA 3QHYA 3OPRA 1J9MA 3NBLA 1L0FA 2XK1A 3IF6B 3UE0A 5I94A 4WELA 1K56D 3RXXA 3V5MA 4E3MA 3P09A 2Y2QA 3IXHA 4KZBA 1SKFA 1ESIA 2A49A 4N92A 1SDNA 2E8IA 4JXGA 1CEFA 4KQQA 4OH0A 1GA9A 2XDMA 5HAIA 3UPOA 4DE1A 4DKIA 4E3IA 1E3UD 1BTLA 4MNRA 4LV3A 1YLPA 3PAEA 3O3VA 2EX2A 2Y2JA 3QNBA 3WS1A 3GR2A 1TDLA 1L0GA 1SCWA 1DJCA 4OQ0A 4M3KA 4QB8A 3S22A 3VOYA 5U47A 3TSGA 4P87A 3OPHA 1DJAA 5DTSA 1TDGA 2Y2KA 3Q82A 4HBTA 2WGWA 3IH9A 2Y2PA 1KE4A 4GB7A 2V20A 5EVIA 4C6YA 3Q7VA 2ZM2A 1O07A 3NI9A 5CXWA 1GCEA 2G2WA 2PBYA 2WGVA 3V3RA 4BLMA 1YLJA 2WGWB 4N9LA 4U0XA 4FCFA 2XD5A 3TOIA 2EX8A 1PIOA 2Z2MB 1PZPA 1E4DA 3HUMA 5EVLA 5FQQA 1MPLA 4EUZA 1K55A 2WZXA 1BUEA 3C4OA 3RJUA 2XD1A 1Y54A 3BFCA 1MXOA 1YLWA 3VFFA 1H8ZA 1LHYA 4L0LA 4KZ7A 3VP2A 4K0WA 4XUZA 4WMCA 4DF6A 1CI9A 1YLTA 5J8XA 3MZDA 2ZQ7A 4Y0UA 4GOGA 1W8QA 2EXBA 4UAAA 5CGXA 4E6XA 5GL9A 1WYBA 2IWCA 4DXBA 1LI9A 3N8SA 3PBQA 1PI5A 2IWDA 2Y2NA 5E2GA 5AQAA 4EBLA 2HDQA 4JXWA 5DVAA 1K54C 3G30A 1ALQA 3N6IA 4RX3A 1GHIA 3GQZA 1EROA 3N8RA 1BLPA 4UA6A 3G32A 2Q9MA 2ZQDA 3HUNA 1JWVA 3UDXA 2C5WB 3N8LA 1YMSA 1MY8A 4P6BA 4MBHA 4QY6A 1XA1A 4X55A 3DWKA 1ES2A 2Y59A 3LO7A 5GHYA 1LLBA 1ONHA 1PW1A 4ZAMA 3VP3A 4BQMA 1MKIA 4LV0A 1OMEA 3GMWA 1FQGA 3FYZA 4EWFA 3HLWA 5D3OA 3UDIA 2H0YA 1K55C 2JE5A 3C7UA 3ZCZA 3OC2A 2WGIA 1JWPA 1IYPA 4LCMA 4F94A 2ZJ9A 3GSGA 4IVIA 5FI2A 3MKFA 5FQIA 4D2OA 3GRJA 2Y2GA 1TVFA 1W7FA 5EE8A 3ZG0A 3LEZA 1I2WA 1BZAA 2WUQA 4N1XA 3FV7A 3IWQA 4OPQA 1MWTA 4BD0A 4NETA 4GD8A 4B4ZA 1YLZA 5DF7A 4JF5A 1M40A 1QMFA 2WZZA 4HEFA 5F1FA 3C5AA 1ES4A 1SDEA 2XEPA 1AXBA 1BT5A 2VGKA 2ZQ8A 4FD8A 5DTKA 3W4QA 3ZVWA 3EQUA 2A3UA 2ZMAA 1NYMA 4OPZA 1XA7A 2CC1A 1Q2QA 3DW0A 2HDRA 4KQOA 2XQZA 2H5SA 2ZC6B 4GD6A 2Y4AA 4LV1A 3BFGA 4S2OA 4DDSA 1MWRA 1RCJA 4DE3A 1W8YA 2ZM8A 5FQ9A 2J7VA 4OQIA 1JVJA 3ITBA 3OCNA 4E3JA 2Z2LB 3ZGAB 2V1ZA 1N9BA 2BG1A 2Y2IA 3PBOA 1G68A 4MLLA 4R1GA 1NYYA 4HESA 1XP4A 4JPMA 1PYYA 2XR0A 3MBZA 3LY3A 3A3JA 1SHVA 3I7JA 1KGGA 5FAQA 1I5QA 4S2NA 1ZC2A 2X01A 3HLCA 3M6HA 1HVBA 3GTCA 4R3BA 3V39A 1LL5A 4WEJA 4BENA 2Q9NA 1FSYA 5E2FA 1JTDA 5FI6A 4DDYA 3SOIA 5FASA 4R23A 1K38A 3WRZA 2WYXA 5HL1A 4X56A 4KZ6A 4ZJ2A 4DXCA 2Y55A 3A3DA 5A92A 1RGYA 2P9VA 3OCLA 3W8KA 1DY6A 5A91A 2H0TA 4O7DA 5CGWA 3VP1A 4MBFA 1KGFA 3BECA 3O86A 3JYIA 2OV5A 1KVMA 4IBXA 3SS4A 1BSGA 3E2LA 3PBSA 3M2JA 3HLBA 1BLSA 2P9VB 5FATA 2XFSA 3O88A 3OPPA 4R4SA 1KE0A 2HP5A 2ZD8A 4N1HA 1NJ4A 5JYOA 3IH8A 5FQKA 3B3XA 1IKGA 4KG6A 1MWUA 3Q1FA 5EECA 5G18A 1GHMA 2FFYA 1YMXA 4Q8IA 3AGFA 4KZ4A 2EX9A 4JBFA 5FI7A 1K4FA 1L2SA 3N4IA 4OQGA 5EUAA 3G35A 1K6RA 5GLAA 4DE0A 3Q7ZA 1HTZA 1JWZA 3BFFA 1XPBA 2H10A 4YFMA 3LCEA 3Q07A 5FAOA 3SH7A 3CZDA 3ZNYA 3C4PA 1NRFA 4LV2A 3AGEA 4PM7A 1G6AA 1VQQA 1ERQA 3NDEA 3PTEA 4OOLA 4UA9A 4FH4A 3G34A 3HLFA 3IXGA 1KVLA 1KDWA 1L0DA 4OPYA 3MFDA 3IHAA 4PMAA 4Y0TA 2R9XA 1K54A 5M1AA 1XGIA 4B88A 5CTMA 3UNWA 3BFDA 1I2SA 2ZM0A 3EQVA 3PBNA 4Z9QA 5TR7A 1LI0A 1YQSA 2J8YA 4FSFA 4PM6A 4BL3A 2V2FF 4C3QA 4Y7PA 5L2FA 3UE3A 2ZQ9A 1LL9A 4X53A 4Y0OA 1K6SA 3MZFA 4OPRA 4R3JA 5JYPA 3G31A 3W4OA 2EFUA 1HD8A 5FQJA 5GHZA 2I72A 1N4OA 1ES3A 1H8YA 3ZFZA 5M19A 1K57A 4JXSA 3NC8A 4S2JA 3IF5A 5CHJA 4B4XA 4ID4A 3UO9A 2ZC7A 3TG9A 4C75A 1ZG6A 1M6KA 1FR6A 2FFFB 1K57C 1KE3A 3VMAA 4BJPA 1FCMA 4DE2A 4QJGA 3HLGA 4OVDA 5EVIB 5EVID 3M2KA 1E25A 4OP5A 5EVIC 4EV4A 2HP6A 4ZTKA 4X6TA 4QY5A 3DWZA 1FCOA 3ISGA 3S4XA 1KDSA 1WE4A 4X68A 1EI5A 5AQ7A 2EXAA 2JC7A 5M18A 1IELA 3BFEA 4IEDA 4KZ8A 5AQBA 3SS5A 1K25A 1PWCA 1E3UA 1VM1A 2JCHA 3V3SA 4WMCD 2WADA 4ZDXA 2B5RA 1XGJA 3HUOA 1GA0A 5GLDA 3ZG9B 3A3FA 3OZHA 1ERMA 1PW8A 4MEZA 2R9WA 3CMZA 3QNCA 3BLSA 3M6BA 4HBUA 3SH9A 4KZ5A 3VFHA 4IBRA 3FKVA 3VP0A 4ZJ1A 3WS5A 5CHMA 2ZC3B 4WBGA 2WKHA 3SH8A 4PM5A 1NY0A 1ESUA 2DRWA 4IVKA 4KZ3A 2GDNA 2ZQCA 5TFQA 3WS2A 1FSWA 5GLBA 1BLHA 5CGSA 5F1GA 1RP5A 2ZLYA 3G2ZA 1NXYA 1PWDA 1Z6FA 2WKEA 4FH2A 4NK3A 1XX2A 5EPHA 1IKIA 4MBKA 1IEMA 5HAQA 5KMWA 4KQRA 5GHXA 2OLVA 4GNUA 3SS3A 3NIAA 5HFOA 1MWSA 4E3OA 1CK3A 4WZ5A 1XKZA 3ITAA 5HW3A 4U3TA 2WAFA 2PU2A 1NZUA 1FOFA 3IF6C 3ZHHA 5A90A 1FCNA 4BL2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CEG A;  5F83 A;  3ZG7 B;  2ZC4 B;  4WZ5 C;  2J9O A;  3A3I A;  2Y2L A;  3HBR A;  4S2L A;  5IHV A;  1U60 A;  3VP4 A;  1EWZ A;  2XFT A;  2HDU A;  3OPL A;  1K4E A;  5CER A;  5CEC A;  4E3L A;  3O87 A;  4E3K A;  2RCX A;  2PU4 A;  1K56 A;  2WAE A;  3DTM A;  3IWO A;  4E3N A;  3GVB A;  4RX2 A;  4OKP A;  4OON A;  1NZO A;  4P85 A;  4JKT A;  3V50 A;  4DRT A;  3FKW A;  2UWX A;  4JXV A;  5CED A;  3IWI A;  3P98 A;  2EX6 A;  3UPN A;  5CRF A;  3MXS A;  4GDB A;  3BRM A;  3IT9 A;  2OLU A;  4RYE A;  4WM9 A;  3A3E A;  3ZNT A;  4JF4 A;  3LY4 A;  1MBL A;  4OOM A;  1YM1 A;  1ES5 A;  2EFX A;  3N7W A;  2HPB A;  3BEB A;  1QME A;  4PPR A;  4EQI A;  5FA7 A;  4N9K A;  4JF6 A;  2Y2M A;  3BM6 A;  4KEN B;  3UN7 A;  3UPP A;  4K91 A;  4XUX A;  4GN2 A;  3IF6 A;  2DNS A;  3IXD A;  5BOH A;  3WS4 A;  5A93 A;  4QU3 A;  3IQA A;  1H5X A;  1TEM A;  3E2K A;  3MKE A;  5F82 A;  3HL9 A;  3ZDJ A;  2VGJ A;  3VSK A;  3HLD A;  1YLY A;  2OSU A;  2QMI A;  3CJM A;  3FWL A;  5TGF A;  2JBF A;  4GDN A;  2XH9 A;  2P74 A;  4OQH A;  4P0M A;  4S2K A;  4KZ9 A;  3AGD A;  5FQM A;  1RGZ A;  4EBP A;  4GKU A;  5HAP A;  4KG2 A;  3VSL A;  1IYQ A;  4LEN A;  4S2I A;  5DTT A;  3WS0 A;  2DCF A;  4WEK A;  3VOZ A;  2QPN A;  3NDG A;  4CPK A;  3UDF A;  5KZH A;  1L0E A;  3ZG8 B;  1O7E A;  4S2N C;  3WRT A;  4JLF A;  1YT4 A;  2HP9 A;  3IHB A;  4UHU A;  3BLM A;  5EOO A;  5DF8 A;  4QD4 A;  4ZJ3 A;  3HRE A;  3PAG A;  4YIN A;  4H8R A;  1W79 A;  1S6R A;  4BD1 A;  5E43 A;  5HX9 A;  4LCL A;  4WYY A;  3GV9 A;  4WZ4 A;  4S2M A;  5CTN A;  1XXM A;  5DF9 A;  1JTG A;  2WKI A;  2XLN A;  3WWX A;  4XXR A;  4OLG A;  5HAR A;  4PM9 A;  3D4F A;  3UY6 A;  2Y2O A;  1FR1 A;  4R4R A;  4GZB A;  1GHP A;  1W5D A;  4OP8 A;  2XGN A;  5FAP A;  3ZG5 A;  5EOE A;  4S2P A;  4K0X A;  1Q2P A;  3FZC A;  2X02 A;  5E2H A;  3CG5 A;  4PM8 A;  5KSH A;  1PWG A;  1C3B A;  4OOY A;  3G4P A;  4RA7 A;  2BLS A;  4R0Q A;  2IWB A;  2J9P A;  3G2Y A;  2Y91 A;  1BLC A;  3IXB A;  2HDS A;  4OLD A;  5GLC A;  3Q7V B;  3ZVT A;  2WK0 A;  3BYD A;  3PBR A;  3NY4 A;  4KZA A;  1KGE A;  3PBT A;  4CJN A;  3UE1 A;  1IYS A;  5CHU A;  3W4P A;  2RL3 A;  1ONG A;  1IYO A;  1PI4 A;  4E6W A;  1BUL A;  4U0T A;  1PZO A;  3C7V A;  2C6W B;  3Q81 A;  1ZKJ A;  3HLE A;  4KG5 A;  4RVA A;  4EBN A;  5KSC A;  3MZE A;  5FDH A;  1CI8 A;  1WYC A;  2X71 A;  4QHC A;  1DJB A;  4A5R A;  2ZQA A;  5FSR A;  5CEB A;  3RXW A;  3MXR A;  4ZBE A;  2ZC5 B;  3S1Y A;  3NCK A;  1ZG4 A;  3HVF A;  1HZO A;  2Y2H A;  4X69 A;  1S0W A;  2QZ6 A;  2XF3 A;  5E2E A;  4UA7 A;  5AQ9 A;  2G2U A;  3QHY A;  3OPR A;  1J9M A;  3NBL A;  1L0F A;  2XK1 A;  3IF6 B;  3UE0 A;  5I94 A;  4WEL A;  1K56 D;  3RXX A;  3V5M A;  4E3M A;  3P09 A;  2Y2Q A;  3IXH A;  4KZB A;  1SKF A;  1ESI A;  2A49 A;  4N92 A;  1SDN A;  2E8I A;  4JXG A;  1CEF A;  4KQQ A;  4OH0 A;  1GA9 A;  2XDM A;  5HAI A;  3UPO A;  4DE1 A;  4DKI A;  4E3I A;  1E3U D;  1BTL A;  4MNR A;  4LV3 A;  1YLP A;  3PAE A;  3O3V A;  2EX2 A;  2Y2J A;  3QNB A;  3WS1 A;  3GR2 A;  1TDL A;  1L0G A;  1SCW A;  1DJC A;  4OQ0 A;  4M3K A;  4QB8 A;  3S22 A;  3VOY A;  5U47 A;  3TSG A;  4P87 A;  3OPH A;  1DJA A;  5DTS A;  1TDG A;  2Y2K A;  3Q82 A;  4HBT A;  2WGW A;  3IH9 A;  2Y2P A;  1KE4 A;  4GB7 A;  2V20 A;  5EVI A;  4C6Y A;  3Q7V A;  2ZM2 A;  1O07 A;  3NI9 A;  5CXW A;  1GCE A;  2G2W A;  2PBY A;  2WGV A;  3V3R A;  4BLM A;  1YLJ A;  2WGW B;  4N9L A;  4U0X A;  4FCF A;  2XD5 A;  3TOI A;  2EX8 A;  1PIO A;  2Z2M B;  1PZP A;  1E4D A;  3HUM A;  5EVL A;  5FQQ A;  1MPL A;  4EUZ A;  1K55 A;  2WZX A;  1BUE A;  3C4O A;  3RJU A;  2XD1 A;  1Y54 A;  3BFC A;  1MXO A;  1YLW A;  3VFF A;  1H8Z A;  1LHY A;  4L0L A;  4KZ7 A;  3VP2 A;  4K0W A;  4XUZ A;  4WMC A;  4DF6 A;  1CI9 A;  1YLT A;  5J8X A;  3MZD A;  2ZQ7 A;  4Y0U A;  4GOG A;  1W8Q A;  2EXB A;  4UAA A;  5CGX A;  4E6X A;  5GL9 A;  1WYB A;  2IWC A;  4DXB A;  1LI9 A;  3N8S A;  3PBQ A;  1PI5 A;  2IWD A;  2Y2N A;  5E2G A;  5AQA A;  4EBL A;  2HDQ A;  4JXW A;  5DVA A;  1K54 C;  3G30 A;  1ALQ A;  3N6I A;  4RX3 A;  1GHI A;  3GQZ A;  1ERO A;  3N8R A;  1BLP A;  4UA6 A;  3G32 A;  2Q9M A;  2ZQD A;  3HUN A;  1JWV A;  3UDX A;  2C5W B;  3N8L A;  1YMS A;  1MY8 A;  4P6B A;  4MBH A;  4QY6 A;  1XA1 A;  4X55 A;  3DWK A;  1ES2 A;  2Y59 A;  3LO7 A;  5GHY A;  1LLB A;  1ONH A;  1PW1 A;  4ZAM A;  3VP3 A;  4BQM A;  1MKI A;  4LV0 A;  1OME A;  3GMW A;  1FQG A;  3FYZ A;  4EWF A;  3HLW A;  5D3O A;  3UDI A;  2H0Y A;  1K55 C;  2JE5 A;  3C7U A;  3ZCZ A;  3OC2 A;  2WGI A;  1JWP A;  1IYP A;  4LCM A;  4F94 A;  2ZJ9 A;  3GSG A;  4IVI A;  5FI2 A;  3MKF A;  5FQI A;  4D2O A;  3GRJ A;  2Y2G A;  1TVF A;  1W7F A;  5EE8 A;  3ZG0 A;  3LEZ A;  1I2W A;  1BZA A;  2WUQ A;  4N1X A;  3FV7 A;  3IWQ A;  4OPQ A;  1MWT A;  4BD0 A;  4NET A;  4GD8 A;  4B4Z A;  1YLZ A;  5DF7 A;  4JF5 A;  1M40 A;  1QMF A;  2WZZ A;  4HEF A;  5F1F A;  3C5A A;  1ES4 A;  1SDE A;  2XEP A;  1AXB A;  1BT5 A;  2VGK A;  2ZQ8 A;  4FD8 A;  5DTK A;  3W4Q A;  3ZVW A;  3EQU A;  2A3U A;  2ZMA A;  1NYM A;  4OPZ A;  1XA7 A;  2CC1 A;  1Q2Q A;  3DW0 A;  2HDR A;  4KQO A;  2XQZ A;  2H5S A;  2ZC6 B;  4GD6 A;  2Y4A A;  4LV1 A;  3BFG A;  4S2O A;  4DDS A;  1MWR A;  1RCJ A;  4DE3 A;  1W8Y A;  2ZM8 A;  5FQ9 A;  2J7V A;  4OQI A;  1JVJ A;  3ITB A;  3OCN A;  4E3J A;  2Z2L B;  3ZGA B;  2V1Z A;  1N9B A;  2BG1 A;  2Y2I A;  3PBO A;  1G68 A;  4MLL A;  4R1G A;  1NYY A;  4HES A;  1XP4 A;  4JPM A;  1PYY A;  2XR0 A;  3MBZ A;  3LY3 A;  3A3J A;  1SHV A;  3I7J A;  1KGG A;  5FAQ A;  1I5Q A;  4S2N A;  1ZC2 A;  2X01 A;  3HLC A;  3M6H A;  1HVB A;  3GTC A;  4R3B A;  3V39 A;  1LL5 A;  4WEJ A;  4BEN A;  2Q9N A;  1FSY A;  5E2F A;  1JTD A;  5FI6 A;  4DDY A;  3SOI A;  5FAS A;  4R23 A;  1K38 A;  3WRZ A;  2WYX A;  5HL1 A;  4X56 A;  4KZ6 A;  4ZJ2 A;  4DXC A;  2Y55 A;  3A3D A;  5A92 A;  1RGY A;  2P9V A;  3OCL A;  3W8K A;  1DY6 A;  5A91 A;  2H0T A;  4O7D A;  5CGW A;  3VP1 A;  4MBF A;  1KGF A;  3BEC A;  3O86 A;  3JYI A;  2OV5 A;  1KVM A;  4IBX A;  3SS4 A;  1BSG A;  3E2L A;  3PBS A;  3M2J A;  3HLB A;  1BLS A;  2P9V B;  5FAT A;  2XFS A;  3O88 A;  3OPP A;  4R4S A;  1KE0 A;  2HP5 A;  2ZD8 A;  4N1H A;  1NJ4 A;  5JYO A;  3IH8 A;  5FQK A;  3B3X A;  1IKG A;  4KG6 A;  1MWU A;  3Q1F A;  5EEC A;  5G18 A;  1GHM A;  2FFY A;  1YMX A;  4Q8I A;  3AGF A;  4KZ4 A;  2EX9 A;  4JBF A;  5FI7 A;  1K4F A;  1L2S A;  3N4I A;  4OQG A;  5EUA A;  3G35 A;  1K6R A;  5GLA A;  4DE0 A;  3Q7Z A;  1HTZ A;  1JWZ A;  3BFF A;  1XPB A;  2H10 A;  4YFM A;  3LCE A;  3Q07 A;  5FAO A;  3SH7 A;  3CZD A;  3ZNY A;  3C4P A;  1NRF A;  4LV2 A;  3AGE A;  4PM7 A;  1G6A A;  1VQQ A;  1ERQ A;  3NDE A;  3PTE A;  4OOL A;  4UA9 A;  4FH4 A;  3G34 A;  3HLF A;  3IXG A;  1KVL A;  1KDW A;  1L0D A;  4OPY A;  3MFD A;  3IHA A;  4PMA A;  4Y0T A;  2R9X A;  1K54 A;  5M1A A;  1XGI A;  4B88 A;  5CTM A;  3UNW A;  3BFD A;  1I2S A;  2ZM0 A;  3EQV A;  3PBN A;  4Z9Q A;  5TR7 A;  1LI0 A;  1YQS A;  2J8Y A;  4FSF A;  4PM6 A;  4BL3 A;  2V2F F;  4C3Q A;  4Y7P A;  5L2F A;  3UE3 A;  2ZQ9 A;  1LL9 A;  4X53 A;  4Y0O A;  1K6S A;  3MZF A;  4OPR A;  4R3J A;  5JYP A;  3G31 A;  3W4O A;  2EFU A;  1HD8 A;  5FQJ A;  5GHZ A;  2I72 A;  1N4O A;  1ES3 A;  1H8Y A;  3ZFZ A;  5M19 A;  1K57 A;  4JXS A;  3NC8 A;  4S2J A;  3IF5 A;  5CHJ A;  4B4X A;  4ID4 A;  3UO9 A;  2ZC7 A;  3TG9 A;  4C75 A;  1ZG6 A;  1M6K A;  1FR6 A;  2FFF B;  1K57 C;  1KE3 A;  3VMA A;  4BJP A;  1FCM A;  4DE2 A;  4QJG A;  3HLG A;  4OVD A;  5EVI B;  5EVI D;  3M2K A;  1E25 A;  4OP5 A;  5EVI C;  4EV4 A;  2HP6 A;  4ZTK A;  4X6T A;  4QY5 A;  3DWZ A;  1FCO A;  3ISG A;  3S4X A;  1KDS A;  1WE4 A;  4X68 A;  1EI5 A;  5AQ7 A;  2EXA A;  2JC7 A;  5M18 A;  1IEL A;  3BFE A;  4IED A;  4KZ8 A;  5AQB A;  3SS5 A;  1K25 A;  1PWC A;  1E3U A;  1VM1 A;  2JCH A;  3V3S A;  4WMC D;  2WAD A;  4ZDX A;  2B5R A;  1XGJ A;  3HUO A;  1GA0 A;  5GLD A;  3ZG9 B;  3A3F A;  3OZH A;  1ERM A;  1PW8 A;  4MEZ A;  2R9W A;  3CMZ A;  3QNC A;  3BLS A;  3M6B A;  4HBU A;  3SH9 A;  4KZ5 A;  3VFH A;  4IBR A;  3FKV A;  3VP0 A;  4ZJ1 A;  3WS5 A;  5CHM A;  2ZC3 B;  4WBG A;  2WKH A;  3SH8 A;  4PM5 A;  1NY0 A;  1ESU A;  2DRW A;  4IVK A;  4KZ3 A;  2GDN A;  2ZQC A;  5TFQ A;  3WS2 A;  1FSW A;  5GLB A;  1BLH A;  5CGS A;  5F1G A;  1RP5 A;  2ZLY A;  3G2Z A;  1NXY A;  1PWD A;  1Z6F A;  2WKE A;  4FH2 A;  4NK3 A;  1XX2 A;  5EPH A;  1IKI A;  4MBK A;  1IEM A;  5HAQ A;  5KMW A;  4KQR A;  5GHX A;  2OLV A;  4GNU A;  3SS3 A;  3NIA A;  5HFO A;  1MWS A;  4E3O A;  1CK3 A;  4WZ5 A;  1XKZ A;  3ITA A;  5HW3 A;  4U3T A;  2WAF A;  2PU2 A;  1NZU A;  1FOF A;  3IF6 C;  3ZHH A;  5A90 A;  1FCN A;  4BL2 A; 
#chains in the Genus database with same CATH topology
 1CEG A;  2J9O A;  3HBR A;  5IHV A;  1EWZ A;  5CER A;  2PU4 A;  1K56 A;  3F1P B;  4MDZ A;  3EEH A;  3V50 A;  3P98 A;  2EX6 A;  3UPN A;  5CRF A;  3CWF A;  3IT9 A;  4JF4 A;  3LY4 A;  4OOM A;  1YM1 A;  2EFX A;  3BEB A;  1QME A;  4PPR A;  5FA7 A;  4N9K A;  3BM6 A;  3HJI A;  1NLY A;  2DNS A;  4HJ4 A;  5A93 A;  5F82 A;  3S7Q A;  3HLD A;  4IUK A;  2QMI A;  3FWL A;  1TS0 A;  2XH9 A;  4KZ9 A;  4EBP A;  5HAP A;  4S2I A;  5DTT A;  2DCF A;  5L8M A;  3CPT A;  5HL6 A;  4CPK A;  5KZH A;  3IHB A;  2P08 A;  5DF8 A;  1W79 A;  2H28 A;  5HX9 A;  1XXM A;  5DF9 A;  3G6O A;  2YKH A;  3WWX A;  2EA9 A;  4R4R A;  2NUP C;  2PRF A;  3FPV A;  5EOE A;  2I9V A;  4PM8 A;  2B18 A;  1TS7 A;  4RA7 A;  2J9P A;  2UV0 E;  3G2Y A;  2Y91 A;  5LBR A;  2HDS A;  3NY4 A;  4KZA A;  1KGE A;  3PBT A;  4UQI M;  1ONG A;  1PI4 A;  2KOI A;  1PZO A;  2HJE A;  3NJA A;  2Z6C A;  4EBN A;  5KSC A;  3MZE A;  1CI8 A;  5FSR A;  3RXW A;  4LFU A;  1GSV A;  3MXR A;  1ZG4 A;  3HVF A;  3EWK A;  2Y2H A;  4X69 A;  2Q0O A;  2QZ6 A;  5FDS A;  3K3D A;  3OPR A;  2D02 A;  3MMH A;  3NBL A;  1L0F A;  2XK1 A;  2L0W A;  3JVV A;  2PR5 A;  1DP8 A;  5KIZ A;  3CAX A;  1NWZ A;  2B02 A;  4KZB A;  1SKF A;  4N92 A;  4PHT A;  5HAI A;  4E04 A;  1BTL A;  3F1O B;  3QNB A;  3WS1 A;  5HWV A;  3V67 A;  3TW8 A;  2WGW A;  3IH9 A;  4C6Y A;  1O07 A;  2G2W A;  4BLM A;  3T50 A;  2WGW B;  3IX3 A;  3TJZ C;  5FQQ A;  4EW7 A;  3S7P A;  3S7O A;  1Y54 A;  4Y13 A;  2VK3 A;  3KYQ A;  1LHY A;  4KZ7 A;  4DF6 A;  1TD5 A;  1YLT A;  3R7W A;  4Y0U A;  2ZQ7 A;  1XFN A;  1W63 Q;  2YKF A;  2L4R A;  1K0K A;  2IWC A;  3C8C A;  3N8S A;  3PBQ A;  5AQA A;  5E2G A;  2AVX A;  2HDQ A;  4JXW A;  1K54 C;  3G30 A;  3PYP A;  1GHI A;  4IHQ A;  1BLP A;  2ZQD A;  4Y15 A;  3TE8 A;  4QY6 A;  3DWK A;  4UEY A;  5GHY A;  1LLB A;  4YOF A;  4MMN A;  4ZAM A;  3VP3 A;  3MR0 A;  3T1S A;  3C7U A;  5L07 A;  4AFI A;  1IYP A;  4F94 A;  2ZJ9 A;  4IVI A;  4GHI A;  3F1N B;  5DFY A;  1I2W A;  1NLZ A;  4HJ6 A;  2WUQ A;  4XT2 A;  2Y79 A;  4MN5 A;  4BD0 A;  4WUJ A;  1QMF A;  1BT5 A;  2V8F A;  5L10 A;  2A3U A;  1G6O A;  2VX8 A;  2V8C A;  1DP9 A;  4KQO A;  2WKR A;  2H5S A;  3CUE A;  1OTD A;  1W8Y A;  2J3W A;  4JGO A;  5EV0 A;  1JVJ A;  4ESP A;  3BQ8 A;  3ZGA B;  3HCY A;  4JPM A;  1PYY A;  3LY3 A;  1SHV A;  1KGG A;  4HNB A;  3GTC A;  3V39 A;  3ULF A;  5DJU A;  2Z6D A;  4BEN A;  4R70 A;  1FSY A;  2W3G A;  3BY9 A;  5HL1 A;  2WYX A;  4KZ6 A;  4DXC A;  2VEA A;  2Y55 A;  3A3D A;  1H0M A;  2P9V A;  3W8K A;  1DY6 A;  5A91 A;  3VOL A;  4O7D A;  3KX0 X;  1KGF A;  3O86 A;  1D7E A;  1KVM A;  4IBX A;  3E2L A;  1BLS A;  3O88 A;  2EWV A;  4G3V A;  3OPP A;  1ZTU A;  1NJ4 A;  5FQK A;  1VHM A;  1F98 A;  4KG6 A;  4BMW A;  3Q1F A;  5G18 A;  1GHM A;  1FIK A;  3N4I A;  4OQG A;  4FTX A;  3Q7Z A;  3BFF A;  3LCE A;  1NRF A;  3T4L A;  1ERQ A;  4OOL A;  3IXG A;  1KVL A;  5HDC A;  1L0D A;  4OPY A;  1LT0 A;  1XFQ A;  4B88 A;  1ODV A;  4NXB A;  2JKR M;  3UNW A;  4D60 A;  4PM6 A;  4X53 A;  4Y0O A;  1K6S A;  5IU1 A;  5DKL A;  4OPR A;  1S1Y A;  3G31 A;  5JYP A;  4GW9 A;  1H8Y A;  1K57 A;  3NC8 A;  3H7W A;  2HF6 A;  3SZT A;  2GJ3 A;  4UQI S;  4HOI A;  3R7W B;  4BJP A;  3HLG A;  1SKO B;  2OAQ 1;  4B9O A;  3A0S A;  3UB8 A;  3OBF A;  4OP5 A;  5EVI C;  3PXP A;  1UGU A;  1FCO A;  3ISG A;  2V1A A;  3E4O A;  4X68 A;  4HY8 A;  5AQB A;  3BFE A;  1E3U A;  3V3S A;  1OTA A;  2W1R A;  1XGJ A;  3ZG9 B;  1GA0 A;  1ERM A;  4I39 A;  3CMZ A;  3QNC A;  2W3D A;  1TS8 A;  1ESU A;  2GDN A;  1RP5 A;  3G2Z A;  2WKE A;  1YKD A;  1XX2 A;  5EPH A;  1IEM A;  4L9E A;  3MQ0 A;  3NIA A;  1MWS A;  1CK3 A;  4U3T A;  2WAF A;  4JGQ A;  3ZHH A;  5A90 A;  4E3K A;  3A3I A;  4S2L A;  4ME4 A;  2XFT A;  5CEC A;  4PKY A;  4E3L A;  4Y2F A;  3IWO A;  4RX2 A;  4OON A;  4LRY C;  1P9R A;  1NZO A;  4DN0 A;  4EXO A;  2UWX A;  2OWJ A;  4GDB A;  3ZNT A;  4WM9 A;  1ZHH B;  2ZMV A;  2Y2M A;  4KEN B;  4CQH A;  4K91 A;  4XUX A;  1LSV A;  3WS4 A;  1H5X A;  3MKE A;  2Y8H A;  5TGF A;  3K2N A;  4S2K A;  3AGD A;  1RGZ A;  4GKU A;  4O0P A;  3LIA A;  3WS0 A;  4WEK A;  3VOZ A;  4KUK A;  4GCZ A;  3UB5 P;  3UDF A;  4S2N C;  1YT4 A;  3BLM A;  4ZJ3 A;  3HRE A;  1S6R A;  5E43 A;  4LCL A;  4WZ4 A;  4S2M A;  3LI9 A;  2OAP 1;  2DMW A;  4XXR A;  4OLG A;  5HAR A;  1W5D A;  3ZG5 A;  3VE3 A;  4K0X A;  3FZC A;  3CG5 A;  3UE6 A;  3QP4 A;  4OOY A;  1BLC A;  3NOT C;  3ZVT A;  4CJN A;  1EW0 A;  2PD8 A;  2RL3 A;  4E6W A;  4F3L A;  5IS1 A;  1NRJ A;  3C7V A;  2C6W B;  1ZKJ A;  2V0W A;  4L9G A;  4RVA A;  5FDH A;  1WYC A;  2X71 A;  3LIE A;  3LID A;  4ZBE A;  3S1Y A;  1HZO A;  4O01 A;  1S0W A;  5AQ9 A;  1J9M A;  1K56 D;  3RXX A;  3F1O A;  2Y2Q A;  3JPU A;  1SDN A;  1H3Q A;  1CEF A;  4OH0 A;  2XDM A;  1T1B A;  2VGL M;  3UPO A;  4DE1 A;  1H8M A;  4MNR A;  4LV3 A;  3PAE A;  1TDL A;  3ZYT A;  1SCW A;  4QB8 A;  3S22 A;  3VOY A;  5U47 A;  1Y28 A;  3D9Y A;  4P87 A;  3Q82 A;  3LR3 A;  2Y2P A;  1KE4 A;  4GB7 A;  5EVI A;  3Q7V A;  3NI9 A;  4EU0 A;  1GCE A;  4P6Z S;  1GSW A;  4FCF A;  4I3J A;  2P04 A;  1E4D A;  3LFV A;  3C4O A;  1H8Z A;  2ZL1 A;  3VP2 A;  1CI9 A;  1MZU A;  5J8X A;  5F6A A;  1W8Q A;  4E6X A;  2PT7 A;  2P7J A;  1PI5 A;  2Y2N A;  1OT6 A;  1J3W A;  5J3W A;  3N6I A;  4Y17 A;  1ERO A;  2Q9M A;  3HUN A;  2C5W B;  2W27 A;  3EEA A;  3GDI A;  1MY8 A;  4RQ9 A;  4MBH A;  4X55 A;  3LO7 A;  1ACF A;  4BBV A;  4BQM A;  4KQD A;  1MKI A;  1FQG A;  5D3O A;  3E4Q A;  2H0Y A;  5AVF A;  3ZCZ A;  3OC2 A;  2WGI A;  2D01 A;  5FQI A;  2PYP A;  3UMD A;  1IFQ A;  5EE8 A;  1BZA A;  3FV7 A;  3IWQ A;  4OPQ A;  4NET A;  4B4Z A;  5DF7 A;  3MQO A;  4JF5 A;  5F1F A;  4G3K A;  3C5A A;  1ES4 A;  1SDE A;  5DTK A;  3W4Q A;  2O9C A;  1F9I A;  3VV4 A;  1NYM A;  1XA7 A;  3IS2 B;  4CLC C;  3DW0 A;  3LYX A;  2XQZ A;  2V9A A;  2Y4A A;  4LV1 A;  4PAU A;  3LIB A;  1RCJ A;  2ZOI A;  2ZM8 A;  4II7 A;  2HZ5 A;  1P97 A;  3O5Y A;  4E3J A;  3B47 A;  4Q0H A;  2M1C A;  1N9B A;  2BG1 A;  2V1Z A;  4GJ4 A;  4HES A;  4I3A A;  3MQQ A;  2XR0 A;  2VJW A;  4GS9 B;  4S2N A;  4WLA A;  2JHE A;  3M6H A;  1HVB A;  4R3B A;  1S67 L;  2Q9N A;  5FAS A;  3SOI A;  1K38 A;  5EM0 A;  3KSF A;  4X1L A;  3C38 A;  2ZOH A;  4MBF A;  1CJF A;  2JKF A;  3SS4 A;  4K08 A;  5HSQ A;  4R4S A;  2HP5 A;  4N1H A;  3T4Q A;  2XRN A;  3IH8 A;  4HP9 A;  2J3T C;  3AGF A;  4JBF A;  5EUA A;  5GLA A;  1HTZ A;  4IJG A;  5FAO A;  2K31 A;  4LLO B;  3AGE A;  4PM7 A;  4UA9 A;  4FH4 A;  3MF0 A;  3G34 A;  3HLF A;  3MFD A;  4LPZ A;  3KSH A;  4PMA A;  1K54 A;  2W3F A;  4NKP A;  5CTM A;  3QP8 A;  1I2S A;  4Z9Q A;  5TR7 A;  1LI0 A;  1YQS A;  4FSF A;  4C3Q A;  3DTK A;  5L2F A;  1DP6 A;  3UE3 A;  3UB9 A;  3H7W B;  4R3J A;  1HD8 A;  1VB6 A;  2I72 A;  1N4O A;  4L9F A;  1OTI A;  3IF5 A;  4HQA A;  5CHJ A;  2ZC7 A;  3TG9 A;  4C75 A;  3C30 A;  3W2Z A;  1KE3 A;  4DE2 A;  4QJG A;  4QWO A;  4Z1W A;  1XJ4 A;  5DFX A;  5EVI D;  4Q0I A;  2HP6 A;  3PR6 A;  3E0Y A;  4X6T A;  1X0O A;  1KDS A;  1WE4 A;  2JC7 A;  1K25 A;  1VM1 A;  2WAD A;  3A3F A;  2VV6 A;  3BLS A;  3M6B A;  3SH9 A;  4IBR A;  3FKV A;  1STZ A;  1Z09 A;  4WBG A;  3SH8 A;  2FH5 A;  2DRW A;  3TRC A;  4R38 A;  2ZQC A;  4G3W A;  5K5B A;  3WS2 A;  2MJ6 A;  5CGS A;  1NXY A;  1PWD A;  4FH2 A;  4NK3 A;  1IKI A;  3LEQ A;  5TBM A;  4HIA A;  1TF1 A;  4GNU A;  2QYB A;  5HW3 A;  5HZH A;  3LIC A;  4NG2 A;  4Y5F A;  3A0V A;  3L7H A;  2OOL A;  1FCN A;  4BL2 A;  3SW1 A;  2ZC4 B;  5F5Y A;  2ZBB A;  1U60 A;  4GHI B;  3OPL A;  1PRQ A;  2HDU A;  2PYR A;  3O87 A;  2RCX A;  3DTM A;  2PHY A;  3GVB A;  3DAV A;  4OKP A;  4P85 A;  4ETZ A;  2KDK A;  4DRT A;  3FG8 A;  4JXV A;  2NUT C;  4Y3I A;  1MC0 A;  3A3E A;  1T19 A;  1MBL A;  2VZW A;  1ES5 A;  3N7W A;  4EQI A;  4QU3 A;  3IQA A;  1Y4O A;  4NXE A;  3ZDJ A;  2VGJ A;  3VSK A;  1YLY A;  3IX4 A;  5HWW A;  2JBF A;  4OQH A;  2L1M A;  5FQM A;  3VSL A;  3H9W A;  4LEN A;  4HI4 A;  2BAS A;  1L0E A;  3WRT A;  2A2L A;  2HP9 A;  2K7S A;  3PAG A;  4PKY G;  4YIN A;  4BD1 A;  1VEU A;  4HHD A;  4NXF A;  4WYY A;  3BY8 A;  5A8B A;  4X25 A;  1S4S A;  1JTG A;  4PM9 A;  3D4F A;  4GZB A;  4OP8 A;  2XGN A;  5FAP A;  2GNX A;  1Q2P A;  5E2H A;  2X02 A;  5KSH A;  1FIL A;  1JNU A;  1PWG A;  1C3B A;  3G4P A;  1UWN X;  4R0Q A;  2IWB A;  3IXB A;  4OLD A;  5GLC A;  3UE1 A;  1IYS A;  5CHU A;  3W4P A;  1IYO A;  3FC7 A;  4U0T A;  3HLE A;  5G4Y A;  1YAX A;  2PR6 A;  3UB6 A;  1OJG A;  5CEB A;  1N9O A;  2W3E A;  4CLC A;  2ZC5 B;  4YNR A;  5E2E A;  4EET B;  1DRM A;  1OT9 A;  2M7V A;  4ETX A;  5C5K A;  1YSQ A;  5I94 A;  2O9B A;  4E3M A;  2BTF P;  2PDR A;  2A49 A;  4DKI A;  1E3U D;  5HDS A;  2JKR I;  3O3V A;  2EX2 A;  3MJQ A;  1VET B;  1DJC A;  4M3K A;  3QP2 A;  3OPH A;  5DTS A;  1TDG A;  3VE4 A;  2FZ0 A;  5FEG A;  4KUO A;  2ZM2 A;  2KLI A;  2O99 A;  1P9W A;  2PBY A;  4N9L A;  3LR5 A;  5F68 A;  2XD5 A;  3TOI A;  2EX8 A;  2Z2M B;  2EWW A;  3HUM A;  5EVL A;  1MPL A;  1K55 A;  1BUE A;  2XD1 A;  3BFC A;  2R78 A;  1MXO A;  1YLW A;  4CLC E;  1T1A A;  4K0W A;  4H6J A;  2XA7 S;  3CI6 A;  4XUZ A;  1HLU P;  4GOG A;  5CGX A;  1LI9 A;  2IWD A;  4EBL A;  1VEU B;  5DVA A;  1ALQ A;  4RX3 A;  2OWH A;  2E8J A;  3G32 A;  2VV8 A;  3UDX A;  3N8L A;  3H82 B;  1ES2 A;  1AWI A;  4LV0 A;  3GMW A;  4JGP A;  4EWF A;  3HLW A;  5G4Z A;  1K55 C;  1W63 M;  4LCM A;  5FI2 A;  4D2O A;  2Y2G A;  4ZRR A;  3LEZ A;  3F1P A;  4N1X A;  1OTE A;  4MN6 A;  4GD8 A;  1YLZ A;  4HEF A;  3IS2 A;  3OLO A;  1AXB A;  2ZQ8 A;  3LI8 A;  3EQU A;  4X1M A;  5TBM B;  2ZMA A;  1L3L A;  2CC1 A;  3B42 A;  4I3I A;  2HDR A;  4GS9 A;  2ZC6 B;  2PBD P;  3B33 A;  4DDS A;  1LSW A;  2JKT M;  4OQI A;  3CIT A;  1D1J A;  5IT5 A;  2QHK A;  2Y2I A;  3PBO A;  5DJT A;  4R1G A;  1NYY A;  1XP4 A;  3MBZ A;  3A3J A;  3I7J A;  5FAQ A;  3CLO A;  1ZC2 A;  4FOF A;  3HLC A;  2X01 A;  2VA0 A;  1LL5 A;  4NXG A;  4WEJ A;  1F2K A;  1D06 A;  1XJ6 A;  1JTD A;  5FI6 A;  4DDY A;  3WRZ A;  4X56 A;  4ZJ2 A;  3CHW P;  5A92 A;  1RGY A;  4R3A A;  2LB9 A;  2J3T D;  3VP1 A;  3BEC A;  1BSG A;  3HLB A;  1S1Z A;  2XFS A;  2ZMF A;  2ZD8 A;  5JYO A;  1IKG A;  1MWU A;  2FFY A;  1YMX A;  5EM1 A;  4Q8I A;  2A24 B;  5FI7 A;  4KZ4 A;  2EX9 A;  1L2S A;  1G28 A;  1K6R A;  1F5M A;  1XPB A;  2H10 A;  3Q07 A;  3SH7 A;  3CZD A;  5HDD A;  1VQQ A;  3NDE A;  4Y0T A;  2R9X A;  1YPR A;  5M1A A;  1XGI A;  3S7N A;  3BQA A;  4ARZ B;  3BFD A;  3MFX A;  4NEE D;  2J8Y A;  3T4T A;  4Y7P A;  1LSX A;  3MZF A;  3W4O A;  4R6L A;  1ES3 A;  3ZFZ A;  3MS6 A;  4I5S A;  5M19 A;  4JXS A;  4B4X A;  4ID4 A;  1ZG6 A;  1M6K A;  1FR6 A;  2GZA A;  3VMA A;  4O8G A;  2XA7 M;  4OVD A;  1XJ3 A;  5EVI B;  4EES A;  3M2K A;  3MXQ A;  1E25 A;  4EV4 A;  4QY5 A;  3DWZ A;  3EOI A;  3S4X A;  3A0R A;  3KYZ A;  1T1C A;  2EXA A;  5M18 A;  1IEL A;  4KZ8 A;  3QP5 A;  4WMC D;  2W1T B;  4ZDX A;  5GLD A;  3HUO A;  3IX8 A;  1PW8 A;  1G5U A;  3VFH A;  3VP0 A;  1BYW A;  3WS5 A;  2ZC3 B;  1NY0 A;  4IVK A;  4KZ3 A;  4Q0J A;  4WF0 A;  1BLH A;  5F1G A;  2ZLY A;  1Z6F A;  4BWI A;  5HAQ A;  2G7U A;  3DTE A;  3RFB A;  3ITA A;  3IF6 C;  2QKP A;  5F83 A;  3ZG7 B;  4WZ5 C;  2Y2L A;  5F69 A;  3VP4 A;  1K4E A;  2WAE A;  5FL3 A;  4E3N A;  1P0Z A;  4JKT A;  2B95 A;  3FKW A;  5CED A;  3IWI A;  4DMZ A;  1A0K A;  3HJK A;  3MXS A;  3BW6 A;  3NOU C;  3BRM A;  2OLU A;  4RYE A;  2PD7 A;  3T4J A;  4LRX C;  2HPB A;  1MKM A;  2VV7 A;  4JF6 A;  4DJ2 A;  3UN7 A;  3D72 A;  3E98 A;  3UPP A;  5BOH A;  4GN2 A;  3IF6 A;  3IXD A;  4B93 A;  1TEM A;  3E2K A;  3HL9 A;  3UB7 A;  2OSU A;  3CJM A;  4GDN A;  2P74 A;  4P0M A;  4KG2 A;  1KOU A;  1IYQ A;  2O9A A;  3T1Q B;  2QPN A;  3NDG A;  3T1R A;  5HWT A;  3ZG8 B;  1O7E A;  4JLF A;  3QP6 A;  4UHU A;  5EOO A;  4WN5 A;  3RH8 B;  4QD4 A;  4H8R A;  3JVU A;  3GV9 A;  3P01 A;  5CTN A;  2JKT I;  2WKI A;  2XLN A;  3UY6 A;  2Y2O A;  1FR1 A;  4ARZ A;  1GHP A;  5L09 A;  4S2P A;  3GEC A;  3DTI A;  2XRO A;  3EGD C;  3U2A A;  2BLS A;  3U4L P;  4MCW A;  3Q7V B;  2WK0 A;  3BYD A;  3PBR A;  4XT2 B;  5HD3 A;  1CQA A;  2HJ9 C;  2GX5 A;  3KO6 A;  1BUL A;  3Q81 A;  4FUW A;  4KG5 A;  2JKG A;  2WKQ A;  4QHC A;  1DJB A;  4A5R A;  2ZQA A;  3IBJ A;  3LR0 A;  5J4E A;  1OJ5 A;  2PAV P;  4EEP A;  4EER A;  3NCK A;  2QJ7 A;  2XF3 A;  4UA7 A;  2G2U A;  3QHY A;  1XJ2 A;  5EVE A;  2XSS A;  3IF6 B;  3QP1 A;  3UE0 A;  3FPW A;  4WEL A;  3V5M A;  3P7N A;  3P09 A;  5HPI A;  3IXH A;  2LB5 A;  2W0N A;  1ESI A;  2E8I A;  4JXG A;  4KQQ A;  1GA9 A;  4E3I A;  2KX6 A;  2A24 A;  1YLP A;  2Y2J A;  3GR2 A;  1L0G A;  4OQ0 A;  4EUV A;  3TSG A;  5MC7 A;  5AVE A;  1DJA A;  4LRZ E;  2Y2K A;  5FEF A;  4HBT A;  2V20 A;  5CXW A;  2WGV A;  3V3R A;  1YLJ A;  4U0X A;  4I38 A;  4WL9 A;  1PIO A;  4EUZ A;  1PZP A;  1LL8 A;  3EGX C;  2WZX A;  1UWP X;  3RJU A;  3VFF A;  5HD5 A;  4L0L A;  4IUH A;  4WMC A;  1IOU A;  3MZD A;  2EXB A;  4UAA A;  2HV1 A;  1WA9 A;  2QJ5 A;  1WYB A;  5GL9 A;  2HGV A;  4DXB A;  4DJ3 A;  2VLG A;  2ACG A;  3GQZ A;  1YSP A;  3N8R A;  4UA6 A;  1S4R A;  1JWV A;  1OTB A;  2QWS A;  1YMS A;  5AJG A;  3T12 B;  4P6B A;  3PHY A;  1XA1 A;  2Y59 A;  1ONH A;  1GSX A;  1PW1 A;  1OME A;  3CPT B;  3C2W A;  3KSI A;  3FYZ A;  3K3C A;  4EQ1 A;  3UDI A;  2JE5 A;  3T1X A;  1JWP A;  3GSG A;  3MKF A;  3GRJ A;  1TVF A;  1W7F A;  1OPX A;  3OOV A;  3ZG0 A;  1N9L A;  3LGO A;  3E4P A;  1PNE A;  1TS6 A;  1MWT A;  2VGL S;  4HH2 A;  2VKS A;  1M40 A;  2WZZ A;  4YWZ A;  2O0Y A;  4BBT A;  2XEP A;  3T4K A;  4FD8 A;  2VGK A;  2W3H A;  3KYE A;  3NUL A;  3ZVW A;  4OPZ A;  1Q2Q A;  1V9Z A;  4LGW A;  5TJJ A;  4CLC B;  5I5L A;  3BJN A;  4JGR A;  4GD6 A;  4P6Z M;  3BFG A;  4S2O A;  1MWR A;  2WKP A;  3CUE C;  4HP4 A;  1N9N A;  4DE3 A;  5FQ9 A;  2J7V A;  2JN7 A;  3ITB A;  5EFW A;  4F3L B;  3OCN A;  2Z2L B;  3LR4 A;  1G68 A;  3H82 A;  4MLL A;  1T18 A;  1I5Q A;  3UME A;  3DBA A;  3D3O A;  3NHQ A;  5E2F A;  4R23 A;  3OCL A;  2H0T A;  5CGW A;  3JYI A;  2OV5 A;  3PBS A;  3M2J A;  2P9V B;  5FAT A;  1KE0 A;  4MN7 A;  3B3X A;  5EEC A;  1K4F A;  2INW A;  3G35 A;  4CLC D;  4H6J B;  4DE0 A;  4BBU A;  1JWZ A;  3L9K A;  4YFM A;  4HJ3 A;  3ZNY A;  3C4P A;  4LV2 A;  4GLQ A;  1G6A A;  3PTE A;  2V0U A;  1KDW A;  3IHA A;  2V1B A;  3PBN A;  2ZM0 A;  3EQV A;  3BWL A;  4BL3 A;  2V2F F;  2ZQ9 A;  1LL9 A;  3IBR A;  2EFU A;  5FQJ A;  5GHZ A;  2CMN A;  5DKK A;  3MSH A;  4S2J A;  3UO9 A;  5CX7 A;  4EEU A;  3ZQ5 A;  2FFF B;  1K57 C;  1FCM A;  3KSG A;  3LIF A;  3LUQ A;  3RTY A;  4ZTK A;  3NOP C;  4M4X A;  1SKO A;  2W1T A;  1SZV A;  1VET A;  1EI5 A;  5AQ7 A;  3SS5 A;  4IED A;  3T4S A;  1PWC A;  4HH3 A;  2JCH A;  2B5R A;  3F1N A;  3R4K A;  3OZH A;  4MEZ A;  2R9W A;  2J80 A;  4HBU A;  4KZ5 A;  4ZJ1 A;  2K2N A;  3NEC A;  5CHM A;  2WKH A;  4PM5 A;  3ICY A;  2M7U A;  5TFQ A;  4QPR A;  5GLB A;  1FSW A;  2IA2 A;  1CF0 A;  1PFL A;  3T4O A;  4MBK A;  5KMW A;  2ZL1 B;  4KQR A;  5GHX A;  1S66 L;  3SS3 A;  2OLV A;  5HPF A;  5HFO A;  4E3O A;  4WZ5 A;  1XKZ A;  5J7E A;  2PU2 A;  1NZU A;  1FOF A;  1V9Y A; 
#chains in the Genus database with same CATH homology
 1CEG A;  5F83 A;  3ZG7 B;  2ZC4 B;  4WZ5 C;  2J9O A;  3A3I A;  2Y2L A;  3HBR A;  4S2L A;  5IHV A;  1U60 A;  3VP4 A;  1EWZ A;  2XFT A;  2HDU A;  3OPL A;  1K4E A;  5CER A;  5CEC A;  4E3L A;  3O87 A;  4E3K A;  2RCX A;  2PU4 A;  1K56 A;  2WAE A;  3DTM A;  3IWO A;  4E3N A;  3GVB A;  4RX2 A;  4OKP A;  4OON A;  1NZO A;  4P85 A;  4JKT A;  3V50 A;  4DRT A;  3FKW A;  2UWX A;  4JXV A;  5CED A;  3IWI A;  3P98 A;  2EX6 A;  3UPN A;  5CRF A;  3MXS A;  4GDB A;  3BRM A;  3IT9 A;  2OLU A;  4RYE A;  4WM9 A;  3A3E A;  3ZNT A;  4JF4 A;  3LY4 A;  1MBL A;  4OOM A;  1YM1 A;  1ES5 A;  2EFX A;  3N7W A;  2HPB A;  3BEB A;  1QME A;  4PPR A;  4EQI A;  5FA7 A;  4N9K A;  4JF6 A;  2Y2M A;  3BM6 A;  4KEN B;  3UN7 A;  3UPP A;  4K91 A;  4XUX A;  4GN2 A;  3IF6 A;  2DNS A;  3IXD A;  5BOH A;  3WS4 A;  5A93 A;  4QU3 A;  3IQA A;  1H5X A;  1TEM A;  3E2K A;  3MKE A;  5F82 A;  3HL9 A;  3ZDJ A;  2VGJ A;  3VSK A;  3HLD A;  1YLY A;  2OSU A;  2QMI A;  3CJM A;  3FWL A;  5TGF A;  2JBF A;  4GDN A;  2XH9 A;  2P74 A;  4OQH A;  4P0M A;  4S2K A;  4KZ9 A;  3AGD A;  5FQM A;  1RGZ A;  4EBP A;  4GKU A;  5HAP A;  4KG2 A;  3VSL A;  1IYQ A;  4LEN A;  4S2I A;  5DTT A;  3WS0 A;  2DCF A;  4WEK A;  3VOZ A;  2QPN A;  3NDG A;  4CPK A;  3UDF A;  5KZH A;  1L0E A;  3ZG8 B;  1O7E A;  4S2N C;  3WRT A;  4JLF A;  1YT4 A;  2HP9 A;  3IHB A;  4UHU A;  3BLM A;  5EOO A;  5DF8 A;  4QD4 A;  4ZJ3 A;  3HRE A;  3PAG A;  4YIN A;  4H8R A;  1W79 A;  1S6R A;  4BD1 A;  5E43 A;  5HX9 A;  4LCL A;  4WYY A;  3GV9 A;  4WZ4 A;  4S2M A;  5CTN A;  1XXM A;  5DF9 A;  1JTG A;  2WKI A;  2XLN A;  3WWX A;  4XXR A;  4OLG A;  5HAR A;  4PM9 A;  3D4F A;  3UY6 A;  2Y2O A;  1FR1 A;  4R4R A;  4GZB A;  1GHP A;  1W5D A;  4OP8 A;  2XGN A;  5FAP A;  3ZG5 A;  5EOE A;  4S2P A;  4K0X A;  1Q2P A;  3FZC A;  2X02 A;  5E2H A;  3CG5 A;  4PM8 A;  5KSH A;  1PWG A;  1C3B A;  4OOY A;  3G4P A;  4RA7 A;  2BLS A;  4R0Q A;  2IWB A;  2J9P A;  3G2Y A;  2Y91 A;  1BLC A;  3IXB A;  2HDS A;  4OLD A;  5GLC A;  3Q7V B;  3ZVT A;  2WK0 A;  3BYD A;  3PBR A;  3NY4 A;  4KZA A;  1KGE A;  3PBT A;  4CJN A;  3UE1 A;  1IYS A;  5CHU A;  3W4P A;  2RL3 A;  1ONG A;  1IYO A;  1PI4 A;  4E6W A;  1BUL A;  4U0T A;  1PZO A;  3C7V A;  2C6W B;  3Q81 A;  1ZKJ A;  3HLE A;  4KG5 A;  4RVA A;  4EBN A;  5KSC A;  3MZE A;  5FDH A;  1CI8 A;  1WYC A;  2X71 A;  4QHC A;  1DJB A;  4A5R A;  2ZQA A;  5FSR A;  5CEB A;  3RXW A;  3MXR A;  4ZBE A;  2ZC5 B;  3S1Y A;  3NCK A;  1ZG4 A;  3HVF A;  1HZO A;  2Y2H A;  4X69 A;  1S0W A;  2QZ6 A;  2XF3 A;  5E2E A;  4UA7 A;  5AQ9 A;  2G2U A;  3QHY A;  3OPR A;  1J9M A;  3NBL A;  1L0F A;  2XK1 A;  3IF6 B;  3UE0 A;  5I94 A;  4WEL A;  1K56 D;  3RXX A;  3V5M A;  4E3M A;  3P09 A;  2Y2Q A;  3IXH A;  4KZB A;  1SKF A;  1ESI A;  2A49 A;  4N92 A;  1SDN A;  2E8I A;  4JXG A;  1CEF A;  4KQQ A;  4OH0 A;  1GA9 A;  2XDM A;  5HAI A;  3UPO A;  4DE1 A;  4DKI A;  4E3I A;  1E3U D;  1BTL A;  4MNR A;  4LV3 A;  1YLP A;  3PAE A;  3O3V A;  2EX2 A;  2Y2J A;  3QNB A;  3WS1 A;  3GR2 A;  1TDL A;  1L0G A;  1SCW A;  1DJC A;  4OQ0 A;  4M3K A;  4QB8 A;  3S22 A;  3VOY A;  5U47 A;  3TSG A;  4P87 A;  3OPH A;  1DJA A;  5DTS A;  1TDG A;  2Y2K A;  3Q82 A;  4HBT A;  2WGW A;  3IH9 A;  2Y2P A;  1KE4 A;  4GB7 A;  2V20 A;  5EVI A;  4C6Y A;  3Q7V A;  2ZM2 A;  1O07 A;  3NI9 A;  5CXW A;  1GCE A;  2G2W A;  2PBY A;  2WGV A;  3V3R A;  4BLM A;  1YLJ A;  2WGW B;  4N9L A;  4U0X A;  4FCF A;  2XD5 A;  3TOI A;  2EX8 A;  1PIO A;  2Z2M B;  1PZP A;  1E4D A;  3HUM A;  5EVL A;  5FQQ A;  1MPL A;  4EUZ A;  1K55 A;  2WZX A;  1BUE A;  3C4O A;  3RJU A;  2XD1 A;  1Y54 A;  3BFC A;  1MXO A;  1YLW A;  3VFF A;  1H8Z A;  1LHY A;  4L0L A;  4KZ7 A;  3VP2 A;  4K0W A;  4XUZ A;  4WMC A;  4DF6 A;  1CI9 A;  1YLT A;  5J8X A;  3MZD A;  2ZQ7 A;  4Y0U A;  4GOG A;  1W8Q A;  2EXB A;  4UAA A;  5CGX A;  4E6X A;  5GL9 A;  1WYB A;  2IWC A;  4DXB A;  1LI9 A;  3N8S A;  3PBQ A;  1PI5 A;  2IWD A;  2Y2N A;  5E2G A;  5AQA A;  4EBL A;  2HDQ A;  4JXW A;  5DVA A;  1K54 C;  3G30 A;  1ALQ A;  3N6I A;  4RX3 A;  1GHI A;  3GQZ A;  1ERO A;  3N8R A;  1BLP A;  4UA6 A;  3G32 A;  2Q9M A;  2ZQD A;  3HUN A;  1JWV A;  3UDX A;  2C5W B;  3N8L A;  1YMS A;  1MY8 A;  4P6B A;  4MBH A;  4QY6 A;  1XA1 A;  4X55 A;  3DWK A;  1ES2 A;  2Y59 A;  3LO7 A;  5GHY A;  1LLB A;  1ONH A;  1PW1 A;  4ZAM A;  3VP3 A;  4BQM A;  1MKI A;  4LV0 A;  1OME A;  3GMW A;  1FQG A;  3FYZ A;  4EWF A;  3HLW A;  5D3O A;  3UDI A;  2H0Y A;  1K55 C;  2JE5 A;  3C7U A;  3ZCZ A;  3OC2 A;  2WGI A;  1JWP A;  1IYP A;  4LCM A;  4F94 A;  2ZJ9 A;  3GSG A;  4IVI A;  5FI2 A;  3MKF A;  5FQI A;  4D2O A;  3GRJ A;  2Y2G A;  1TVF A;  1W7F A;  5EE8 A;  3ZG0 A;  3LEZ A;  1I2W A;  1BZA A;  2WUQ A;  4N1X A;  3FV7 A;  3IWQ A;  4OPQ A;  1MWT A;  4BD0 A;  4NET A;  4GD8 A;  4B4Z A;  1YLZ A;  5DF7 A;  4JF5 A;  1M40 A;  1QMF A;  2WZZ A;  4HEF A;  5F1F A;  3C5A A;  1ES4 A;  1SDE A;  2XEP A;  1AXB A;  1BT5 A;  2VGK A;  2ZQ8 A;  4FD8 A;  5DTK A;  3W4Q A;  3ZVW A;  3EQU A;  2A3U A;  2ZMA A;  1NYM A;  4OPZ A;  1XA7 A;  2CC1 A;  1Q2Q A;  3DW0 A;  2HDR A;  4KQO A;  2XQZ A;  2H5S A;  2ZC6 B;  4GD6 A;  2Y4A A;  4LV1 A;  3BFG A;  4S2O A;  4DDS A;  1MWR A;  1RCJ A;  4DE3 A;  1W8Y A;  2ZM8 A;  5FQ9 A;  2J7V A;  4OQI A;  1JVJ A;  3ITB A;  3OCN A;  4E3J A;  2Z2L B;  3ZGA B;  2V1Z A;  1N9B A;  2BG1 A;  2Y2I A;  3PBO A;  1G68 A;  4MLL A;  4R1G A;  1NYY A;  4HES A;  1XP4 A;  4JPM A;  1PYY A;  2XR0 A;  3MBZ A;  3LY3 A;  3A3J A;  1SHV A;  3I7J A;  1KGG A;  5FAQ A;  1I5Q A;  4S2N A;  1ZC2 A;  2X01 A;  3HLC A;  3M6H A;  1HVB A;  3GTC A;  4R3B A;  3V39 A;  1LL5 A;  4WEJ A;  4BEN A;  2Q9N A;  1FSY A;  5E2F A;  1JTD A;  5FI6 A;  4DDY A;  3SOI A;  5FAS A;  4R23 A;  1K38 A;  3WRZ A;  2WYX A;  5HL1 A;  4X56 A;  4KZ6 A;  4ZJ2 A;  4DXC A;  2Y55 A;  3A3D A;  5A92 A;  1RGY A;  2P9V A;  3OCL A;  3W8K A;  1DY6 A;  5A91 A;  2H0T A;  4O7D A;  5CGW A;  3VP1 A;  4MBF A;  1KGF A;  3BEC A;  3O86 A;  3JYI A;  2OV5 A;  1KVM A;  4IBX A;  3SS4 A;  1BSG A;  3E2L A;  3PBS A;  3M2J A;  3HLB A;  1BLS A;  2P9V B;  5FAT A;  2XFS A;  3O88 A;  3OPP A;  4R4S A;  1KE0 A;  2HP5 A;  2ZD8 A;  4N1H A;  1NJ4 A;  5JYO A;  3IH8 A;  5FQK A;  3B3X A;  1IKG A;  4KG6 A;  1MWU A;  3Q1F A;  5EEC A;  5G18 A;  1GHM A;  2FFY A;  1YMX A;  4Q8I A;  3AGF A;  4KZ4 A;  2EX9 A;  4JBF A;  5FI7 A;  1K4F A;  1L2S A;  3N4I A;  4OQG A;  5EUA A;  3G35 A;  1K6R A;  5GLA A;  4DE0 A;  3Q7Z A;  1HTZ A;  1JWZ A;  3BFF A;  1XPB A;  2H10 A;  4YFM A;  3LCE A;  3Q07 A;  5FAO A;  3SH7 A;  3CZD A;  3ZNY A;  3C4P A;  1NRF A;  4LV2 A;  3AGE A;  4PM7 A;  1G6A A;  1VQQ A;  1ERQ A;  3NDE A;  3PTE A;  4OOL A;  4UA9 A;  4FH4 A;  3G34 A;  3HLF A;  3IXG A;  1KVL A;  1KDW A;  1L0D A;  4OPY A;  3MFD A;  3IHA A;  4PMA A;  4Y0T A;  2R9X A;  1K54 A;  5M1A A;  1XGI A;  4B88 A;  5CTM A;  3UNW A;  3BFD A;  1I2S A;  2ZM0 A;  3EQV A;  3PBN A;  4Z9Q A;  5TR7 A;  1LI0 A;  1YQS A;  2J8Y A;  4FSF A;  4PM6 A;  4BL3 A;  2V2F F;  4C3Q A;  4Y7P A;  5L2F A;  3UE3 A;  2ZQ9 A;  1LL9 A;  4X53 A;  4Y0O A;  1K6S A;  3MZF A;  4OPR A;  4R3J A;  5JYP A;  3G31 A;  3W4O A;  2EFU A;  1HD8 A;  5FQJ A;  5GHZ A;  2I72 A;  1N4O A;  1ES3 A;  1H8Y A;  3ZFZ A;  5M19 A;  1K57 A;  4JXS A;  3NC8 A;  4S2J A;  3IF5 A;  5CHJ A;  4B4X A;  4ID4 A;  3UO9 A;  2ZC7 A;  3TG9 A;  4C75 A;  1ZG6 A;  1M6K A;  1FR6 A;  2FFF B;  1K57 C;  1KE3 A;  3VMA A;  4BJP A;  1FCM A;  4DE2 A;  4QJG A;  3HLG A;  4OVD A;  5EVI B;  5EVI D;  3M2K A;  1E25 A;  4OP5 A;  5EVI C;  4EV4 A;  2HP6 A;  4ZTK A;  4X6T A;  4QY5 A;  3DWZ A;  1FCO A;  3ISG A;  3S4X A;  1KDS A;  1WE4 A;  4X68 A;  1EI5 A;  5AQ7 A;  2EXA A;  2JC7 A;  5M18 A;  1IEL A;  3BFE A;  4IED A;  4KZ8 A;  5AQB A;  3SS5 A;  1K25 A;  1PWC A;  1E3U A;  1VM1 A;  2JCH A;  3V3S A;  4WMC D;  2WAD A;  4ZDX A;  2B5R A;  1XGJ A;  3HUO A;  1GA0 A;  5GLD A;  3ZG9 B;  3A3F A;  3OZH A;  1ERM A;  1PW8 A;  4MEZ A;  2R9W A;  3CMZ A;  3QNC A;  3BLS A;  3M6B A;  4HBU A;  3SH9 A;  4KZ5 A;  3VFH A;  4IBR A;  3FKV A;  3VP0 A;  4ZJ1 A;  3WS5 A;  5CHM A;  2ZC3 B;  4WBG A;  2WKH A;  3SH8 A;  4PM5 A;  1NY0 A;  1ESU A;  2DRW A;  4IVK A;  4KZ3 A;  2GDN A;  2ZQC A;  5TFQ A;  3WS2 A;  1FSW A;  5GLB A;  1BLH A;  5CGS A;  5F1G A;  1RP5 A;  2ZLY A;  3G2Z A;  1NXY A;  1PWD A;  1Z6F A;  2WKE A;  4FH2 A;  4NK3 A;  1XX2 A;  5EPH A;  1IKI A;  4MBK A;  1IEM A;  5HAQ A;  5KMW A;  4KQR A;  5GHX A;  2OLV A;  4GNU A;  3SS3 A;  3NIA A;  5HFO A;  1MWS A;  4E3O A;  1CK3 A;  4WZ5 A;  1XKZ A;  3ITA A;  5HW3 A;  4U3T A;  2WAF A;  2PU2 A;  1NZU A;  1FOF A;  3IF6 C;  3ZHH A;  5A90 A;  1FCN A;  4BL2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...