3W4QA

Crystal structure of pena beta-lactamase from burkholderia multivorans at ph4.2
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
258
structure length
258
Chain Sequence
ASFAALERAAGGRLGVCAIDTATGRRALHRADERFPFCSTFKAMLGAAVLAQSVAHPGLLQQRVTYGRSDLVNYSPVTERHVDTGMTVAELCAATIQYSDNTAANELMKRIGGPAAVTAYARSIGDDTFRLDRWETELNTALPGDLRDTTTPAAMAANLRVLVLGDALPPAQRAQLIEWLRGNKVGDKRIRAGVPTGWRVGDKTGTGDYGTTNDVGVLWPPSRAPIVLAVYYTQTRADAKAKDDVIAAATRIASATLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Insights into beta-lactamases from Burkholderia species, two phylogenetically related yet distinct resistance determinants
pubmed doi rcsb
source organism Burkholderia multivorans
molecule tags Hydrolase
total genus 94
structure length 258
sequence length 258
chains with identical sequence B, C
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2013-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3w4qA00
4ZDXA 4O7DA 1NXYA 4MBKA 5DF9A 4RVAA 1PWGA 2WKIA 4IVIA 1ZC2A 2HDQA 4KZ9A 3SOIA 4N1XA 1K4EA 4K0XA 4R3BA 3WRTA 3BM6A 2Q9MA 3OPLA 1PZPA 3SS4A 1XXMA 4GD8A 3FYZA 4ZTKA 2V1ZA 4GKUA 5KMWA 3S4XA 1K38A 4JBFA 4H8RA 5FQ9A 4NETA 3CMZA 4BLMA 1GHPA 4DDSA 2ZC4B 1RGYA 1ESUA 2Y2KA 5HAPA 4DXBA 4UHUA 1ALQA 4DXCA 1FOFA 3O88A 5HW3A 3B3XA 2XD1A 1ZKJA 5DF7A 4E3MA 3W4PA 2DCFA 5CGWA 1LLBA 4ZBEA 1RCJA 5EPHA 1FCOA 1GHMA 2UWXA 4MBFA 1K55A 2Y2NA 2Z2MB 4GNUA 4JLFA 4X69A 3D4FA 3O87A 3VP0A 3IT9A 4R23A 4R4RA 1DJBA 1L0EA 5DF8A 4DE1A 3BEBA 4FSFA 5DTSA 1N4OA 2ZC5B 1RP5A 2QMIA 4UAAA 4E3KA 2WGWA 4ZJ1A 1G6AA 1I2SA 4S2MA 5HL1A 4JXGA 3HREA 4DKIA 3IF6C 4OPYA 1ONHA 3S22A 2EX2A 1PZOA 3M6HA 4OVDA 3PBRA 1I2WA 4LV2A 1PWCA 4S2NC 4KQRA 4P0MA 1K54A 1GCEA 3LY4A 1S0WA 1VQQA 1BLCA 1YLTA 1SCWA 3VSLA 1CEGA 5CTMA 1MWSA 5A92A 4ZJ3A 1O07A 3RJUA 2EXBA 3WS0A 3QHYA 3VP2A 3M2KA 1XPBA 2ZM2A 2I72A 1LHYA 1W7FA 4YINA 4NK3A 2ZMAA 3G34A 2ZM8A 4X56A 1IELA 2HP6A 3GVBA 3VMAA 5CTNA 4B4XA 4MNRA 4S2KA 1GA9A 4S2PA 5FAOA 2EX6A 3G31A 2HPBA 4MBHA 3ZG7B 3IWOA 2C5WB 3OCLA 5GL9A 3Q7ZA 5FQJA 4HBTA 1H8YA 4KZ4A 3UE0A 4Z9QA 2P9VA 5A91A 3RXXA 2ZC3B 3PBQA 5CECA 4E3IA 3ZVWA 1Z6FA 3M6BA 1NY0A 1W79A 2ZC6B 1ES4A 5CHMA 3S1YA 3G2YA 4OP8A 4WZ5C 3HLBA 4OQGA 1M6KA 2OLVA 4OQ0A 2RL3A 2Y2HA 5F1GA 5EUAA 1SHVA 3Q82A 3HL9A 2XF3A 4FH4A 3PBNA 5FQMA 3N7WA 4D2OA 5J8XA 3IF6A 4XUXA 3LCEA 4FCFA 3BFGA 2JC7A 1BT5A 1MKIA 3IXGA 4GN2A 3C7VA 4BL3A 1SDEA 4S2NA 4BD0A 3OPRA 3NDGA 4EUZA 2X71A 3IWIA 4U0XA 5CGSA 1ERMA 2XD5A 3CZDA 3VFFA 5M18A 5CEBA 3ZG8B 3V50A 2IWCA 4JF5A 3W4OA 5AQBA 1NRFA 4OH0A 3WS5A 3UPNA 2XEPA 1WE4A 2FFYA 1DJAA 3A3EA 4ID4A 3C4OA 2QZ6A 2V2FF 5EVIC 4JXVA 4XXRA 3V3RA 2WKHA 2Y55A 3ZNTA 2HP5A 2Y2GA 2WGIA 2J9PA 4LENA 5GLBA 5FA7A 3I7JA 1SDNA 2A49A 4C3QA 1PI4A 5DVAA 3GSGA 4Y7PA 1W5DA 1FR1A 2OLUA 1ES3A 4PM7A 1NYMA 2VGKA 3IF6B 5KZHA 3N8RA 1ESIA 1JVJA 2H10A 3GTCA 1O7EA 4A5RA 1IYPA 3NC8A 1N9BA 2XDMA 3PAGA 1BSGA 5CHJA 1QMFA 1YLJA 5EOEA 4LV1A 1G68A 1BZAA 1XX2A 4R1GA 3N4IA 3V3SA 3FV7A 4WZ5A 5E2GA 3PAEA 3A3FA 1FCMA 3HUNA 2IWBA 1JWVA 2ZQ7A 4DE2A 4F94A 1KDSA 3VOYA 4DRTA 1XGIA 3VSKA 1YMSA 1JTGA 5E43A 1K57C 3A3IA 1PW1A 4JXSA 2B5RA 1XKZA 5AQ9A 3DTMA 4R0QA 4LV3A 2BG1A 5JYOA 1DY6A 3HVFA 4EQIA 4Q8IA 2XK1A 3GV9A 4KZ7A 5E2FA 4HEFA 4JF6A 1PI5A 3HLCA 5GLCA 2QPNA 2EX9A 5E2EA 4OOLA 1NZUA 5HX9A 4QY6A 2GDNA 3P09A 4LCLA 2WKEA 1IYSA 3HLFA 3ZFZA 1L0GA 3WS2A 2ZQCA 4QY5A 1FQGA 1HZOA 5CGXA 5EVIA 4P87A 5KSHA 5L2FA 1NYYA 3BLSA 1KE3A 2WYXA 3DW0A 1Q2QA 3MKEA 3WRZA 4WYYA 3Q7VA 3BFCA 2DNSA 2WZXA 2EXAA 4GDBA 1BLSA 3FZCA 4PM9A 5FASA 4GB7A 3FKVA 4IBRA 3TG9A 4N92A 2WAFA 3BYDA 4CJNA 1I5QA 3A3JA 1BULA 4JF4A 4OPRA 3SS5A 4DF6A 3ZG9B 1KVLA 3LY3A 4HBUA 3HLDA 1M40A 1ERQA 1CI8A 1KGEA 2PU2A 3UO9A 4BD1A 5CERA 4KG2A 5AQAA 1MBLA 1IYQA 5FSRA 3IXBA 5FDHA 4BQMA 1K6SA 1BTLA 3PBTA 5A90A 3G32A 3HUMA 3W4QA 4P6BA 3O86A 2PU4A 3FWLA 4KQQA 1TDGA 2WGWB 3GR2A 4B4ZA 3UE3A 1HD8A 2HP9A 1K57A 2OSUA 4PPRA 2EFUA 4WEKA 3M2JA 3AGFA 5TR7A 3IXDA 2Y2LA 2Y2IA 4S2LA 1L0FA 3IHAA 1Y54A 4OQIA 4YFMA 4QHCA 4GDNA 3SH7A 4C6YA 4IVKA 3GQZA 3E2KA 4X68A 1K56A 2J7VA 4Y0UA 5CHUA 3ZHHA 3IHBA 1GHIA 5EE8A 2ZQ8A 1W8YA 3UPOA 2Y91A 3NIAA 1K25A 3IXHA 4RX3A 4LV0A 4BJPA 1MWUA 1YLPA 5A93A 1DJCA 3NCKA 3IWQA 4B88A 3ZGAB 3BFDA 1XP4A 4PM6A 1L0DA 2JCHA 4GD6A 1EI5A 4E3NA 2EFXA 2WZZA 5DTTA 1K4FA 1MY8A 4Y0OA 4U3TA 3MZEA 3VP3A 1NZOA 2H5SA 2P9VB 1PW8A 1TDLA 2WK0A 5TGFA 3NDEA 4ZAMA 3E2LA 4KZBA 1K6RA 2Q9NA 2G2UA 1EWZA 1YM1A 3QNCA 1YLWA 2WGVA 3BLMA 3BECA 4R4SA 5CRFA 3OZHA 3N8LA 4FH2A 2ZLYA 1CI9A 4WMCA 3ITBA 4OPQA 2G2WA 3BRMA 3RXWA 3TSGA 1K55C 3UE1A 4EBNA 4GOGA 1KDWA 4KG5A 5FAQA 5EVID 1ES2A 5GHYA 2BLSA 4OOMA 4OPZA 5EVLA 5FQIA 4DDYA 1QMEA 1KE0A 4E6XA 2ZC7A 5FQKA 4BL2A 3SS3A 3ZG5A 3WWXA 3ZCZA 5HAQA 4XUZA 1E3UA 4JPMA 4L0LA 1HTZA 1LI0A 2XQZA 4RYEA 3P98A 4OLGA 3PBOA 3IF5A 3MXRA 4KZ8A 4KZAA 1U60A 4WELA 1PWDA 1IYOA 4Y0TA 1KGFA 1FCNA 1MPLA 2J9OA 5FI2A 5GHZA 4PM5A 4EBPA 3HBRA 1BUEA 3N6IA 1KGGA 2Y59A 1IKIA 3W8KA 3SH9A 5TFQA 5DTKA 2ZQAA 4EBLA 3DWZA 1TEMA 3UN7A 3QNBA 5JYPA 2IWDA 3MZDA 4S2OA 2E8IA 1H5XA 2JE5A 2Z2LB 4E3OA 3HLGA 4MLLA 4QB8A 2FFFB 5GHXA 5BOHA 3BFEA 4M3KA 1JTDA 2PBYA 1MWRA 4U0TA 4GZBA 2A3UA 4PM8A 3VFHA 1KVMA 2RCXA 1ZG6A 5EOOA 5CXWA 1LL9A 4OONA 3ZDJA 4JXWA 5F83A 4S2IA 1LI9A 1YMXA 2J8YA 4OOYA 1K56D 1EROA 1FSYA 3G35A 3LO7A 4KQOA 1AXBA 2VGJA 1IEMA 3TOIA 2ZQDA 1RGZA 3HLEA 3V39A 2Y4AA 1XGJA 5HARA 2XLNA 3G2ZA 5EECA 2C6WB 1JWZA 1WYCA 4S2JA 2V20A 3AGDA 3HUOA 2EX8A 1WYBA 3BFFA 2Y2PA 2ZJ9A 3MFDA 1YT4A 1H8ZA 1E4DA 3Q1FA 4UA6A 4E3JA 2JBFA 4QD4A 1S6RA 4P85A 4OKPA 1YQSA 2Y2OA 4BENA 4RX2A 2R9XA 1GA0A 3MBZA 5EVIB 2WADA 5U47A 3OCNA 3PBSA 4EV4A 2CC1A 4CPKA 2HDSA 2XFSA 3EQUA 3Q7VB 3ISGA 4WM9A 3VOZA 1C3BA 4WBGA 4IBXA 3A3DA 2XGNA 2X01A 2H0YA 5FAPA 4OQHA 1VM1A 3NY4A 5M19A 3MKFA 1YLZA 1YLYA 3UPPA 3V5MA 2WAEA 2XH9A 1LL5A 1CEFA 5GLDA 3VP1A 1Q2PA 1L2SA 1TVFA 4KZ6A 1IKGA 4WMCD 4ZJ2A 4DE0A 4KG6A 4OLDA 4KENB 3CG5A 3EQVA 1HVBA 3ZG0A 1PYYA 5FI6A 4FD8A 3CJMA 3UDXA 1ES5A 2Y2QA 3UDIA 5CEDA 1W8QA 5E2HA 4E6WA 1BLHA 3Q07A 3C4PA 3UDFA 3MXSA 2X02A 2XFTA 3C5AA 1CK3A 3O3VA 3ZVTA 2WUQA 1SKFA 1E3UD 3OC2A 4JKTA 4X53A 4C75A 2OV5A 3Q81A 1JWPA 5HFOA 1J9MA 3G30A 5F82A 3SH8A 3FKWA 2ZM0A 3JYIA 3WS1A 4PMAA 3WS4A 2XR0A 3AGEA 1NJ4A 3IQAA 4KZ3A 1ZG4A 5FI7A 2HDRA 2HDUA 4K91A 4LCMA 4QU3A 5F1FA 3DWKA 4UA9A 1FSWA 4RA7A 4E3LA 3ITAA 5AQ7A 1XA7A 1PIOA 4N9LA 4X55A 3MZFA 3GMWA 4QJGA 5FATA 1MWTA 4KZ5A 4UA7A 5D3OA 2H0TA 3PTEA 4OP5A 5IHVA 4IEDA 1FR6A 3OPPA 1OMEA 1BLPA 4DE3A 2R9WA 3IH9A 3N8SA 3IH8A 3NI9A 4HESA 4WZ4A 1E25A 3LEZA 4K0WA 4MEZA 2ZD8A 4N9KA 4N1HA 3ZNYA 1MXOA 2ZQ9A 5M1AA 3G4PA 4WEJA 4EWFA 2P74A 2Y2JA 3NBLA 5GLAA 2DRWA 3UY6A 3C7UA 3HLWA 5FQQA 1XA1A 1KE4A 3OPHA 4R3JA 1ONGA 3UNWA 2Y2MA 5G18A 5KSCA 4X6TA 3GRJA 5I94A 1K54C 5HAIA 3VP4A
chains in the Genus database with same CATH superfamily
4ZDXA 4MBKA 3MQOA 3SOIA 1K4EA 3BM6A 3FYZA 3NULA 4ZTKA 3S4XA 1AWIA 2LB5A 2VGLS 3O88A 1ZKJA 4KUKA 1LLBA 4ZBEA 1RCJA 2HZ5A 4GNUA 3O87A 4R4RA 1L0EA 4DE1A 5DTSA 1RP5A 4L9GA 4UAAA 4E3KA 4IUHA 1I2SA 5HL1A 3HREA 3S22A 2EX2A 1PNEA 3TW8A 2MJ6A 1P9RA 1YSQA 1S0WA 4HNBA 5AVEA 1YLTA 2VEAA 4HJ4A 3RJUA 2PRFA 5DFXA 1LHYA 1T1AA 2M1CA 4NK3A 3G34A 3FPWA 4X56A 2HP6A 3VMAA 4G3VA 4S2KA 3G31A 2HPBA 4EW7A 2Q0OA 3LR0A 2HGVA 5FQJA 5HDDA 4KZ4A 4X1MA 4IUKA 5EVEA 5A91A 3RXXA 3PBQA 5CECA 1NY0A 2OWJA 1W79A 4O01A 3S1YA 2ZL1A 4WZ5C 3HLBA 3R7WA 2OLVA 4OQ0A 1SHVA 3Q82A 4FH4A 1P0ZA 3IF6A 3LR4A 4FCFA 1TD5A 1MKIA 2JC7A 4HHDA 2EWVA 4B93A 3NDGA 3IWIA 4GCZA 3DAVA 1WE4A 2FFYA 4GJ4A 1TF1A 3MSHA 4ID4A 5HZHA 2WKHA 2HP5A 2Y2GA 2WGIA 4LENA 1DP8A 4LRZE 2A49A 5DVAA 4AFIA 3GSGA 1W5DA 4EEUA 3BY9A 3IX4A 3GTCA 4A5RA 1OJGA 1NLZA 1N9BA 3U4LP 2XDMA 4MN5A 1G68A 1XX2A 3P01A 4R1GA 2ZOIA 5E2GA 4HH2A 3SZTA 3HUNA 5L07A 2PBDP 4MDZA 4DJ3A 1JWVA 4I39A 4F94A 1KDSA 3SW1A 1K57C 1CJFA 2XSSA 3IBRA 4E04A 1DY6A 5AJGA 3GV9A 1VB6A 5GLCA 3LR3A 2QPNA 2EX9A 4OOLA 1NZUA 5HX9A 4QY6A 3WS2A 2ZQCA 4O8GA 5L2FA 1KE3A 3WRZA 3Q7VA 3BFCA 2DNSA 2EXAA 1D06A 4PM9A 5HWVA 3B47A 4D60A 2L4RA 4PHTA 3TG9A 2W1RA 2JN7A 3MXQA 1BULA 4HBUA 1W63M 1LSXA 2JKRI 1KGEA 1OTBA 2PU2A 3UO9A 5AQAA 1XJ3A 3IXBA 1A0KA 3G6OA 3DTIA 3HUMA 2PU4A 1TDGA 3QP1A 5K5BA 3UE3A 4PPRA 2OSUA 3EEAA 5TR7A 2Y2IA 1Y4OA 3IHAA 4YFMA 4QHCA 4MMNA 2INWA 1W63Q 5TJJA 2ZQ8A 1W8YA 1J3WA 4XT2A 4BJPA 4UQIS 2M7VA 3ZGAB 2JCHA 2WZZA 5DTTA 1K4FA 1MY8A 5J7EA 4U3TA 3VP3A 4FTXA 3E2LA 4KZBA 3CUEA 1K6RA 2Q9NA 1EWZA 1S4RA 4R38A 2ZL1B 2OAQ1 1CI9A 4WMCA 3ITBA 2VA0A 3BRMA 3TSGA 2XROA 5EVID 2W3FA 4Y17A 5FQIA 1P97A 4E6XA 2O99A 2V1AA 1BYWA 4YOFA 3SS3A 3ZCZA 4KUOA 5HAQA 2V8CA 4JPMA 2BASA 4OLGA 4RQ9A 2P7JA 3MXRA 2ZMVA 1MPLA 5FI2A 3QP6A 4EBPA 3HBRA 3BY8A 3E98A 1D7EA 4I3JA 1OT6A 5DTKA 3DWZA 4WN5A 3BW6A 4E3OA 4MLLA 2K31A 4HQAA 5GHXA 3BFEA 4M3KA 4ARZA 4I3AA 1KVMA 2RCXA 1LL9A 4OONA 1OJ5A 4JXWA 5F83A 3F1OA 4S2IA 1LI9A 5MC7A 1FSYA 1AXBA 5L10A 2D02A 2PD7A 3HLEA 1XGJA 5HARA 3G2ZA 3HUOA 1WYBA 5F5YA 5HWWA 1YQSA 4G3WA 1NLYA 3RFBA 2HDSA 1OTAA 4WF0A 3Q7VB 4MCWA 2X01A 3FG8A 5M19A 1YLZA 2XH9A 3VP1A 1IKGA 4L9FA 1UWPX 4KG6A 3CG5A 3VE3A 3UDXA 3CJMA 3Q07A 3LFVA 2X02A 3C5AA 3OC2A 4JKTA 4X53A 4NXBA 1J9MA 3VV4A 3FKWA 4PMAA 1NJ4A 4KZ3A 3LIEA 3DWKA 4E3LA 3ITAA 4N9LA 4X55A 3RTYA 3OOVA 2XRNA 5FATA 4KZ5A 5D3OA 5IHVA 3PTEA 3EEHA 1TS0A 2B18A 4WZ4A 4K0WA 2B95A 2ZD8A 4HIAA 4EWFA 1FILA 5GLAA 4HI4A 1KE4A 3OPHA 4R3JA 1MKMA 5I94A 4IVIA 1K54C 5HAIA 5J3WA 1GSXA 4O7DA 1NXYA 4HJ3A 4KZ9A 2HDQA 4K0XA 3WRTA 3D72A 1PZPA 3LICA 2V1ZA 3LI9A 4GKUA 5KMWA 1K38A 2J80A 4DDSA 2Y2KA 1ALQA 2R78A 4DXCA 3A0VA 3B3XA 5DF7A 4E3MA 2DCFA 5EM1A 4MBFA 2Y2NA 4X69A 4JLFA 3D4FA 4R23A 5DF8A 2ZC5B 1ODVA 4WUJA 3MS6A 5A8BA 5HSQA 3S7QA 3UB8A 1PZOA 3M6HA 4OVDA 3PBRA 1I2WA 4LV2A 3H7WB 4S2NC 4P0MA 3K3CA 1CEGA 5CTMA 2EWWA 2EXBA 5DJTA 4HY8A 4MN6A 1XPBA 2ZM2A 2I72A 3F1OB 2ZMAA 1XJ2A 3NOTC 3TJZC 4B4XA 4MNRA 2EX6A 3IWOA 4GS9A 2P9VA 2G7UA 5FL3A 2QJ5A 1ES4A 1OT9A 1H3QA 3FPVA 3KSGA 3MQ0A 4H6JA 2Y2HA 2W3EA 5EUAA 3HL9A 5FQMA 4D2OA 3N7WA 5J8XA 3LCEA 3MR0A 3C7VA 4BD0A 2M7UA 4U0XA 4PKYA 1ERMA 2XD5A 3ZG8B 3V50A 2IWCA 4JF5A 4OH0A 2V9AA 3UPNA 2ZBBA 2QZ6A 5EVIC 4JXVA 4XXRA 3T4JA 3ZNTA 2OOLA 5FA7A 1FR1A 3K2NA 2VGKA 2W1TB 3N8RA 1JVJA 1TS8A 4Y13A 2H10A 1O7EA 1BSGA 5CHJA 1QMFA 3FC7A 1YLJA 4NXFA 1OTEA 5EOEA 5IU1A 3FV7A 4WZ5A 2NUTC 4FUWA 4R70A 2IWBA 3LIBA 3PXPA 3IX3A 4DRTA 5HL6A 3UMDA 5E43A 4JXSA 2B5RA 4EQIA 2XK1A 4UQIM 1PI5A 4PKYG 3KYQA 3KSHA 3P09A 1STZA 2E8JA 4QY5A 1FQGA 4WL9A 2WYXA 4WYYA 3FZCA 4IBRA 3KSFA 3BYDA 4OPRA 3ZG9B 1M40A 4KG2A 1DP9A 1IYQA 5FSRA 5CX7A 5FDHA 1K6SA 3PBTA 5A90A 3G32A 1EW0A 5AVFA 2W27A 3W4QA 3QP8A 1G6OA 2J3TD 1F9IA 3L9KA 3T4QA 4IJGA 4BBUA 1K57A 2EFUA 4R3AA 2Y8HA 3IXDA 1LSWA 4O0PA 3E2KA 4X68A 1K56A 4KQDA 2PAVP 2Y91A 2A2LA 1K25A 3CWFA 3NCKA 3ZQ5A 4B88A 3BFDA 4GS9B 5F68A 4EETB 4Y0OA 3MZEA 2P9VB 1PW8A 3NDEA 4ZAMA 1MZUA 4NG2A 2JHEA 1FIKA 3LYXA 4MN7A 3BLMA 4H6JB 4FH2A 5FEGA 2G2WA 1ES2A 5GHYA 4OOMA 2VJWA 3WWXA 2VZWA 4LPZA 3ULFA 1UWNX 2XQZA 3F1NB 3E4PA 4RYEA 4M4XA 3PBOA 4KZ8A 4GHIB 1PWDA 3T12B 1KGFA 1FCNA 5GHZA 1BUEA 1VEUA 2GNXA 3N6IA 2Y59A 1IKIA 1MC0A 3SH9A 5TFQA 5JYPA 1G28A 3QNBA 2OAP1 3MZDA 4I38A 4S2OA 2E8IA 2JE5A 2Z2LB 3HLGA 3VOLA 4GW9A 4BWIA 1MWRA 3VFHA 1CQAA 3ZDJA 1H0MA 4OOYA 1EROA 4Q0JA 3G35A 4DN0A 3LO7A 1IEMA 4JGRA 2Y4AA 2XLNA 2C6WB 4S2JA 3AGDA 4II7A 2Y2PA 3QP4A 3MFDA 3CPTA 1YT4A 4E3JA 2JBFA 1XJ4A 4OKPA 3MBZA 3PBSA 3R4KA 2KDKA 2XFSA 3NJAA 1VM1A 3ICYA 3MKFA 3UPPA 1F98A 1VETB 2WAEA 2O9BA 4DE0A 4KENB 1F5MA 1HVBA 4EXOA 5CEDA 3UDIA 3E4QA 1XJ6A 1W8QA 4LGWA 2OWHA 3C4PA 3UDFA 1YAXA 2XFTA 4JGQA 1E3UD 2ZOHA 3HCYA 5F82A 2ZM0A 3WS1A 4EU0A 3UE6A 1WA9A 3AGEA 3IQAA 5FI7A 2HDUA 4QU3A 4RA7A 2D01A 5AQ7A 1PIOA 3GMWA 4OP5A 3LR5A 1OMEA 3IH9A 3T4TA 4HESA 3NI9A 1E25A 4CLCD 2B02A 4N1HA 2LB9A 3MJQA 3T1RA 5M1AA 4WEJA 2P74A 3NBLA 3C7UA 3GECA 3D9YA 2Y2MA 4X6TA 3VP4A 4RVAA 1PWGA 2O9CA 1T1BA 3OPLA 2Q9MA 4GLQA 1XXMA 4GD8A 3MFXA 3KSIA 5HPFA 3H7WA 4BLMA 3T4OA 1GHPA 1HLUP 1RGYA 5HAPA 2W3DA 2Z6DA 3T4SA 4DXBA 4ETXA 1FOFA 4P6ZS 5FDSA 3W4PA 1ZHHB 5EPHA 1GHMA 1K55A 2Z2MB 3VP0A 1XFNA 3LGOA 4FSFA 2JKTM 1N4OA 1VEUB 1YPRA 2KOIA 1P9WA 1GSWA 2WGWA 3F1PA 4OPYA 1ONHA 2FH5A 4PAUA 4KQRA 1K54A 1GCEA 3LY4A 1VQQA 1N9NA 4ESPA 5IS1A 5G4ZA 1MWSA 2J3TC 1O07A 4G3KA 3D3OA 3GDIA 1W7FA 3CUEC 2ZM8A 3NOPC 5CTNA 2FZ0A 1ACFA 1V9ZA 2K7SA 2C5WB 2W3HA 3HJIA 4HBTA 3UE0A 3CPTB 4Z9QA 1T1CA 2ZC3B 4E3IA 4HJ6A 3ZVWA 1Z6FA 3M6BA 3MQQA 4Y2FA 2Y79A 4UEYA 5CHMA 4OP8A 4OQGA 1M6KA 2RL3A 2W1TA 3BFGA 1BT5A 4S2NA 3OPRA 3CZDA 3VFFA 5CEBA 3TE8A 2EA9A 1DJAA 3C4OA 2V2FF 3V3RA 1JNUA 2Y55A 2J9PA 4NXGA 5GLBA 3KYEA 2OLUA 4PM7A 1NYMA 1VHMA 4ME4A 4BMWA 5KZHA 2ACGA 4YNRA 1IYPA 3NC8A 3PAGA 2GX5A 2PDRA 4LV1A 3N4IA 3CI6A 3V3SA 3EGXC 1FCMA 4LRYC 2ZQ7A 3VOYA 2WKQA 1XGIA 2P08A 3BQAA 3VSKA 1YMSA 1PW1A 4NKPA 5AQ9A 4R0QA 5DKLA 3T4KA 5L09A 4HEFA 1OTIA 2WKEA 1IYSA 3ZFZA 5KSHA 1HZOA 5EVIA 1X0OA 3DW0A 4Y3IA 3T1SA 1BLSA 2A24B 5FASA 4GB7A 2I9VA 1I5QA 3B33A 3A3JA 2DMWA 4JF4A 4DF6A 1KVLA 1CI8A 5CERA 3H9WA 1BTLA 4I5SA 3T1QB 2VV8A 4LRXC 3O86A 4WLAA 1KOUA 3FWLA 4KQQA 4B4ZA 2WGWB 1HD8A 2HP9A 3M2JA 4B9OA 3AGFA 3F1PB 2Y2LA 4S2LA 1L0FA 4OQIA 3SH7A 4IVKA 1NWZA 2J7VA 3H82A 4Y0UA 5CHUA 3ZHHA 1GHIA 3BWLA 5EE8A 3NIAA 2VLGA 4LV0A 1MWUA 1YLPA 3IWQA 1XP4A 4PM6A 2HJ9C 3CAXA 1EI5A 1S67L 2PT7A 2ZMFA 3LIFA 3F1NA 2H5SA 2IA2A 1TDLA 5TGFA 4GHIA 4BBTA 2G2UA 4CLCC 3QNCA 3NHQA 3O5YA 3N8LA 4OPQA 4EBNA 2VKSA 5FAQA 1SKOB 2BLSA 5EVLA 1QMEA 1KE0A 4BL2A 4F3LB 4XUZA 4L0LA 1HTZA 3P98A 3IF5A 4KZAA 1U60A 4LLOB 4Y0TA 3C2WA 1S1YA 2J9OA 3C30A 4I3IA 1KGGA 1TS6A 2JKTI 5HWTA 4HH3A 4IHQA 1TEMA 1PFLA 1CF0A 5G4YA 2IWDA 2JKFA 1H5XA 3L7HA 4JGOA 2FFFB 2WKPA 4BBVA 2PBYA 2PR5A 4U0TA 2A3UA 3JPUA 5EOOA 5CXWA 1PRQA 2Z6CA 1YMXA 1VETA 4KQOA 2VGJA 3MF0A 1RGZA 2KX6A 4DMZA 5EECA 1IOUA 1WYCA 2V20A 2EX8A 3BFFA 2PR6A 4UA6A 1S6RA 3T1XA 5LBRA 2WKRA 5EVIB 3OCNA 2AVXA 2CC1A 4CLCB 4CPKA 3EQUA 3ISGA 3JVUA 1C3BA 5F69A 4WBGA 4IBXA 3A3DA 2XGNA 3VOZA 2H0YA 5FAPA 4OQHA 2L1MA 2V1BA 2VV6A 1LL5A 5GLDA 2GZAA 1L2SA 4WMCD 4KZ6A 4OLDA 3EQVA 1LSVA 5TBMB 3ZG0A 1PYYA 1ES5A 2Y2QA 1BLHA 1SZVA 3MXSA 1CK3A 3O3VA 2WUQA 1SKFA 1DRMA 1JWPA 4P6ZM 3G30A 3JYIA 3NECA 1D1JA 1ZG4A 2HDRA 4CLCE 4LCMA 1S66L 4IEDA 3H82B 2P04A 5HPIA 2R9WA 1N9LA 3MMHA 3LEZA 2O9AA 2K2NA 3UB6A 5EM0A 3ZNYA 3IS2B 3UB9A 2Y2JA 3OLOA 3HLWA 2W0NA 5FQQA 1OPXA 1XA1A 1ONGA 5KSCA 3C8CA 2JKGA 2PHYA 3IBJA 5DF9A 4QPRA 2WKIA 1ZC2A 4N1XA 3KX0X 1V9YA 4R3BA 3SS4A 4JBFA 4H8RA 5FQ9A 4NETA 3CMZA 4CQHA 2J3WA 2ZC4B 1ESUA 2HF6A 4NEED 2QHKA 4UHUA 5HW3A 2KLIA 2XD1A 4JGPA 5CGWA 1FCOA 1YKDA 2UWXA 3E4OA 3IT9A 3HJKA 1DJBA 3BEBA 3A0SA 5DJUA 2PYRA 2QMIA 4ZJ1A 5C5KA 1G6AA 4S2MA 4JXGA 4DKIA 3IF6C 4QWOA 1PWCA 3W2ZA 5J4EA 1BLCA 3VSLA 1SCWA 5HDCA 5A92A 1LL8A 4ZJ3A 4Y15A 3WS0A 3QHYA 2V0UA 3M2KA 3VP2A 2XA7M 4EERA 4YINA 3CHWP 4K08A 1YSPA 1IELA 3GVBA 1GA9A 2QYBA 4S2PA 5FAOA 4MBHA 3ZG7B 5HD5A 3OCLA 5GL9A 3Q7ZA 1H8YA 2CMNA 2V0WA 3UMEA 3IX8A 2ZC6B 5IT5A 3G2YA 5F1GA 2HJEA 2XF3A 3PBNA 4XUXA 4ZRRA 1DP6A 4ETZA 3IXGA 4GN2A 4BL3A 1SDEA 4EUZA 2X71A 3QP5A 5CGSA 5M18A 3VE4A 3BQ8A 3W4OA 5AQBA 2HV1A 1NRFA 3EWKA 3U2AA 3WS5A 4NXEA 2XEPA 3A3EA 3T50A 2QWSA 5L8MA 3I7JA 1SDNA 4C3QA 1PI4A 3R7WB 4Y7PA 1ES3A 3BJNA 4R6LA 1N9OA 3IF6B 1ESIA 3TRCA 2BTFP 4HP4A 4YWZA 4EQ1A 5EFWA 1BZAA 2A24A 2O0YA 3PAEA 3A3FA 4DE2A 3JVVA 1JTGA 3A3IA 1H8MA 3DBAA 4Z1WA 1XKZA 3DTMA 4HOIA 4LV3A 2BG1A 5JYOA 3HVFA 4Q8IA 4KZ7A 5E2FA 4L9EA 4JF6A 3DTEA 3HLCA 2PD8A 3NOUC 1XFQA 5E2EA 1G5UA 2GDNA 4LCLA 3HLFA 2YKFA 1L0GA 5CGXA 4P87A 1NYYA 3BLSA 1Q2QA 3MKEA 2WZXA 4GDBA 4LFUA 4FOFA 3FKVA 3EOIA 4N92A 2WAFA 4CJNA 3SS5A 1NRJA 3LY3A 3HLDA 1ERQA 4BD1A 2VK3A 1MBLA 4Q0HA 4BQMA 2VX8A 2NUPC 2UV0E 2H28A 4P6BA 3CLOA 3QP2A 3GR2A 5HD3A 4WEKA 1GSVA 3B42A 1Y54A 2W3GA 4GDNA 4C6YA 3CITA 1TS7A 3GQZA 3IHBA 3UPOA 4RX3A 3IXHA 4EEPA 1SKOA 5F6AA 5A93A 1DJCA 2VGLM 1L0DA 4GD6A 3S7OA 4F3LA 4E3NA 5EV0A 2EFXA 3S7PA 1NZOA 2WK0A 1T19A 1YM1A 1YLWA 2WGVA 4R4SA 3BECA 5CRFA 3OZHA 4HP9A 2ZLYA 3P7NA 3RXWA 3UE1A 1K55C 4GOGA 2L0WA 1KDWA 3LI8A 4KG5A 2XA7S 4XT2B 3ZYTA 4X25A 4OPZA 4DDYA 2ZC7A 5FQKA 1LT0A 3KO6A 3ZG5A 4Y5FA 1E3UA 1LI0A 3PHYA 3V67A 4WELA 1IYOA 4PM5A 3DTKA 2QKPA 3W8KA 5HDSA 4EBLA 2ZQAA 3K3DA 3UB7A 3UN7A 2GJ3A 1K0KA 4QB8A 1OTDA 4CLCA 5BOHA 1JTDA 4GZBA 4PM8A 1ZG6A 5DKKA 3PYPA 2J8YA 1K56D 3PR6A 3TOIA 2ZQDA 3V39A 5DFYA 4DJ2A 5TBMA 3UB5P 1JWZA 2ZJ9A 3LUQA 1H8ZA 1E4DA 3Q1FA 1T18A 4QD4A 4P85A 2Y2OA 4BENA 2YKHA 4RX2A 2R9XA 1GA0A 5U47A 2WADA 4EV4A 3A0RA 1S4SA 4WM9A 4ARZB 5KIZA 3NY4A 2V8FA 1YLYA 3V5MA 2JKRM 5FEFA 1CEFA 3E0YA 1Q2PA 1TVFA 3LIDA 4ZJ2A 5FI6A 4FD8A 3KYZA 3LIAA 5E2HA 4E6WA 3S7NA 4EUVA 1Y28A 3ZVTA 3IS2A 1UGUA 4C75A 1S1ZA 2OV5A 3Q81A 5I5LA 5HFOA 1F2KA 3T4LA 3SH8A 4X1LA 3WS4A 1IFQA 2XR0A 4K91A 5F1FA 4UA9A 1FSWA 1XA7A 1ZTUA 3MZFA 1L3LA 4QJGA 1MWTA 4UA7A 2H0TA 4EESA 3EGDC 1FR6A 3OPPA 1BLPA 4Q0IA 4DE3A 3N8SA 3IH8A 2QJ7A 4MEZA 4N9KA 1MXOA 3RH8B 2ZQ9A 3G4PA 2VV7A 3C38A 3UY6A 2DRWA 3LEQA 3UNWA 1Z09A 3OBFA 5G18A 3GRJA 2PYPA
chains in the Genus database with same CATH topology
4ZDXA 4O7DA 1NXYA 4MBKA 5DF9A 4RVAA 1PWGA 2WKIA 4IVIA 1ZC2A 2HDQA 4KZ9A 3SOIA 4N1XA 1K4EA 4K0XA 4R3BA 3WRTA 3BM6A 2Q9MA 3OPLA 1PZPA 3SS4A 1XXMA 4GD8A 3FYZA 4ZTKA 2V1ZA 4GKUA 5KMWA 3S4XA 1K38A 4JBFA 4H8RA 5FQ9A 4NETA 3CMZA 4BLMA 1GHPA 4DDSA 2ZC4B 1RGYA 1ESUA 2Y2KA 5HAPA 4DXBA 4UHUA 1ALQA 4DXCA 1FOFA 3O88A 5HW3A 3B3XA 2XD1A 1ZKJA 5DF7A 4E3MA 3W4PA 2DCFA 5CGWA 1LLBA 4ZBEA 1RCJA 5EPHA 1FCOA 1GHMA 2UWXA 4MBFA 1K55A 2Y2NA 2Z2MB 4GNUA 4JLFA 4X69A 3D4FA 3O87A 3VP0A 3IT9A 4R23A 4R4RA 1DJBA 1L0EA 5DF8A 4DE1A 3BEBA 4FSFA 5DTSA 1N4OA 2ZC5B 1RP5A 2QMIA 4UAAA 4E3KA 2WGWA 4ZJ1A 1G6AA 1I2SA 4S2MA 5HL1A 4JXGA 3HREA 4DKIA 3IF6C 4OPYA 1ONHA 3S22A 2EX2A 1PZOA 3M6HA 4OVDA 3PBRA 1I2WA 4LV2A 1PWCA 4S2NC 4KQRA 4P0MA 1K54A 1GCEA 3LY4A 1S0WA 1VQQA 1BLCA 1YLTA 1SCWA 3VSLA 1CEGA 5CTMA 1MWSA 5A92A 4ZJ3A 1O07A 3RJUA 2EXBA 3WS0A 3QHYA 3VP2A 3M2KA 1XPBA 2ZM2A 2I72A 1LHYA 1W7FA 4YINA 4NK3A 2ZMAA 3G34A 2ZM8A 4X56A 1IELA 2HP6A 3GVBA 3VMAA 5CTNA 4B4XA 4MNRA 4S2KA 1GA9A 4S2PA 5FAOA 2EX6A 3G31A 2HPBA 4MBHA 3ZG7B 3IWOA 2C5WB 3OCLA 5GL9A 3Q7ZA 5FQJA 4HBTA 1H8YA 4KZ4A 3UE0A 4Z9QA 2P9VA 5A91A 3RXXA 2ZC3B 3PBQA 5CECA 4E3IA 3ZVWA 1Z6FA 3M6BA 1NY0A 1W79A 2ZC6B 1ES4A 5CHMA 3S1YA 3G2YA 4OP8A 4WZ5C 3HLBA 4OQGA 1M6KA 2OLVA 4OQ0A 2RL3A 2Y2HA 5F1GA 5EUAA 1SHVA 3Q82A 3HL9A 2XF3A 4FH4A 3PBNA 5FQMA 3N7WA 4D2OA 5J8XA 3IF6A 4XUXA 3LCEA 4FCFA 3BFGA 2JC7A 1BT5A 1MKIA 3IXGA 4GN2A 3C7VA 4BL3A 1SDEA 4S2NA 4BD0A 3OPRA 3NDGA 4EUZA 2X71A 3IWIA 4U0XA 5CGSA 1ERMA 2XD5A 3CZDA 3VFFA 5M18A 5CEBA 3ZG8B 3V50A 2IWCA 4JF5A 3W4OA 5AQBA 1NRFA 4OH0A 3WS5A 3UPNA 2XEPA 1WE4A 2FFYA 1DJAA 3A3EA 4ID4A 3C4OA 2QZ6A 2V2FF 5EVIC 4JXVA 4XXRA 3V3RA 2WKHA 2Y55A 3ZNTA 2HP5A 2Y2GA 2WGIA 2J9PA 4LENA 5GLBA 5FA7A 3I7JA 1SDNA 2A49A 4C3QA 1PI4A 5DVAA 3GSGA 4Y7PA 1W5DA 1FR1A 2OLUA 1ES3A 4PM7A 1NYMA 2VGKA 3IF6B 5KZHA 3N8RA 1ESIA 1JVJA 2H10A 3GTCA 1O7EA 4A5RA 1IYPA 3NC8A 1N9BA 2XDMA 3PAGA 1BSGA 5CHJA 1QMFA 1YLJA 5EOEA 4LV1A 1G68A 1BZAA 1XX2A 4R1GA 3N4IA 3V3SA 3FV7A 4WZ5A 5E2GA 3PAEA 3A3FA 1FCMA 3HUNA 2IWBA 1JWVA 2ZQ7A 4DE2A 4F94A 1KDSA 3VOYA 4DRTA 1XGIA 3VSKA 1YMSA 1JTGA 5E43A 1K57C 3A3IA 1PW1A 4JXSA 2B5RA 1XKZA 5AQ9A 3DTMA 4R0QA 4LV3A 2BG1A 5JYOA 1DY6A 3HVFA 4EQIA 4Q8IA 2XK1A 3GV9A 4KZ7A 5E2FA 4HEFA 4JF6A 1PI5A 3HLCA 5GLCA 2QPNA 2EX9A 5E2EA 4OOLA 1NZUA 5HX9A 4QY6A 2GDNA 3P09A 4LCLA 2WKEA 1IYSA 3HLFA 3ZFZA 1L0GA 3WS2A 2ZQCA 4QY5A 1FQGA 1HZOA 5CGXA 5EVIA 4P87A 5KSHA 5L2FA 1NYYA 3BLSA 1KE3A 2WYXA 3DW0A 1Q2QA 3MKEA 3WRZA 4WYYA 3Q7VA 3BFCA 2DNSA 2WZXA 2EXAA 4GDBA 1BLSA 3FZCA 4PM9A 5FASA 4GB7A 3FKVA 4IBRA 3TG9A 4N92A 2WAFA 3BYDA 4CJNA 1I5QA 3A3JA 1BULA 4JF4A 4OPRA 3SS5A 4DF6A 3ZG9B 1KVLA 3LY3A 4HBUA 3HLDA 1M40A 1ERQA 1CI8A 1KGEA 2PU2A 3UO9A 4BD1A 5CERA 4KG2A 5AQAA 1MBLA 1IYQA 5FSRA 3IXBA 5FDHA 4BQMA 1K6SA 1BTLA 3PBTA 5A90A 3G32A 3HUMA 3W4QA 4P6BA 3O86A 2PU4A 3FWLA 4KQQA 1TDGA 2WGWB 3GR2A 4B4ZA 3UE3A 1HD8A 2HP9A 1K57A 2OSUA 4PPRA 2EFUA 4WEKA 3M2JA 3AGFA 5TR7A 3IXDA 2Y2LA 2Y2IA 4S2LA 1L0FA 3IHAA 1Y54A 4OQIA 4YFMA 4QHCA 4GDNA 3SH7A 4C6YA 4IVKA 3GQZA 3E2KA 4X68A 1K56A 2J7VA 4Y0UA 5CHUA 3ZHHA 3IHBA 1GHIA 5EE8A 2ZQ8A 1W8YA 3UPOA 2Y91A 3NIAA 1K25A 3IXHA 4RX3A 4LV0A 4BJPA 1MWUA 1YLPA 5A93A 1DJCA 3NCKA 3IWQA 4B88A 3ZGAB 3BFDA 1XP4A 4PM6A 1L0DA 2JCHA 4GD6A 1EI5A 4E3NA 2EFXA 2WZZA 5DTTA 1K4FA 1MY8A 4Y0OA 4U3TA 3MZEA 3VP3A 1NZOA 2H5SA 2P9VB 1PW8A 1TDLA 2WK0A 5TGFA 3NDEA 4ZAMA 3E2LA 4KZBA 1K6RA 2Q9NA 2G2UA 1EWZA 1YM1A 3QNCA 1YLWA 2WGVA 3BLMA 3BECA 4R4SA 5CRFA 3OZHA 3N8LA 4FH2A 2ZLYA 1CI9A 4WMCA 3ITBA 4OPQA 2G2WA 3BRMA 3RXWA 3TSGA 1K55C 3UE1A 4EBNA 4GOGA 1KDWA 4KG5A 5FAQA 5EVID 1ES2A 5GHYA 2BLSA 4OOMA 4OPZA 5EVLA 5FQIA 4DDYA 1QMEA 1KE0A 4E6XA 2ZC7A 5FQKA 4BL2A 3SS3A 3ZG5A 3WWXA 3ZCZA 5HAQA 4XUZA 1E3UA 4JPMA 4L0LA 1HTZA 1LI0A 2XQZA 4RYEA 3P98A 4OLGA 3PBOA 3IF5A 3MXRA 4KZ8A 4KZAA 1U60A 4WELA 1PWDA 1IYOA 4Y0TA 1KGFA 1FCNA 1MPLA 2J9OA 5FI2A 5GHZA 4PM5A 4EBPA 3HBRA 1BUEA 3N6IA 1KGGA 2Y59A 1IKIA 3W8KA 3SH9A 5TFQA 5DTKA 2ZQAA 4EBLA 3DWZA 1TEMA 3UN7A 3QNBA 5JYPA 2IWDA 3MZDA 4S2OA 2E8IA 1H5XA 2JE5A 2Z2LB 4E3OA 3HLGA 4MLLA 4QB8A 2FFFB 5GHXA 5BOHA 3BFEA 4M3KA 1JTDA 2PBYA 1MWRA 4U0TA 4GZBA 2A3UA 4PM8A 3VFHA 1KVMA 2RCXA 1ZG6A 5EOOA 5CXWA 1LL9A 4OONA 3ZDJA 4JXWA 5F83A 4S2IA 1LI9A 1YMXA 2J8YA 4OOYA 1K56D 1EROA 1FSYA 3G35A 3LO7A 4KQOA 1AXBA 2VGJA 1IEMA 3TOIA 2ZQDA 1RGZA 3HLEA 3V39A 2Y4AA 1XGJA 5HARA 2XLNA 3G2ZA 5EECA 2C6WB 1JWZA 1WYCA 4S2JA 2V20A 3AGDA 3HUOA 2EX8A 1WYBA 3BFFA 2Y2PA 2ZJ9A 3MFDA 1YT4A 1H8ZA 1E4DA 3Q1FA 4UA6A 4E3JA 2JBFA 4QD4A 1S6RA 4P85A 4OKPA 1YQSA 2Y2OA 4BENA 4RX2A 2R9XA 1GA0A 3MBZA 5EVIB 2WADA 5U47A 3OCNA 3PBSA 4EV4A 2CC1A 4CPKA 2HDSA 2XFSA 3EQUA 3Q7VB 3ISGA 4WM9A 3VOZA 1C3BA 4WBGA 4IBXA 3A3DA 2XGNA 2X01A 2H0YA 5FAPA 4OQHA 1VM1A 3NY4A 5M19A 3MKFA 1YLZA 1YLYA 3UPPA 3V5MA 2WAEA 2XH9A 1LL5A 1CEFA 5GLDA 3VP1A 1Q2PA 1L2SA 1TVFA 4KZ6A 1IKGA 4WMCD 4ZJ2A 4DE0A 4KG6A 4OLDA 4KENB 3CG5A 3EQVA 1HVBA 3ZG0A 1PYYA 5FI6A 4FD8A 3CJMA 3UDXA 1ES5A 2Y2QA 3UDIA 5CEDA 1W8QA 5E2HA 4E6WA 1BLHA 3Q07A 3C4PA 3UDFA 3MXSA 2X02A 2XFTA 3C5AA 1CK3A 3O3VA 3ZVTA 2WUQA 1SKFA 1E3UD 3OC2A 4JKTA 4X53A 4C75A 2OV5A 3Q81A 1JWPA 5HFOA 1J9MA 3G30A 5F82A 3SH8A 3FKWA 2ZM0A 3JYIA 3WS1A 4PMAA 3WS4A 2XR0A 3AGEA 1NJ4A 3IQAA 4KZ3A 1ZG4A 5FI7A 2HDRA 2HDUA 4K91A 4LCMA 4QU3A 5F1FA 3DWKA 4UA9A 1FSWA 4RA7A 4E3LA 3ITAA 5AQ7A 1XA7A 1PIOA 4N9LA 4X55A 3MZFA 3GMWA 4QJGA 5FATA 1MWTA 4KZ5A 4UA7A 5D3OA 2H0TA 3PTEA 4OP5A 5IHVA 4IEDA 1FR6A 3OPPA 1OMEA 1BLPA 4DE3A 2R9WA 3IH9A 3N8SA 3IH8A 3NI9A 4HESA 4WZ4A 1E25A 3LEZA 4K0WA 4MEZA 2ZD8A 4N9KA 4N1HA 3ZNYA 1MXOA 2ZQ9A 5M1AA 3G4PA 4WEJA 4EWFA 2P74A 2Y2JA 3NBLA 5GLAA 2DRWA 3UY6A 3C7UA 3HLWA 5FQQA 1XA1A 1KE4A 3OPHA 4R3JA 1ONGA 3UNWA 2Y2MA 5G18A 5KSCA 4X6TA 3GRJA 5I94A 1K54C 5HAIA 3VP4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZDX A;  4O7D A;  1NXY A;  4MBK A;  5DF9 A;  4RVA A;  1PWG A;  2WKI A;  4IVI A;  1ZC2 A;  2HDQ A;  4KZ9 A;  3SOI A;  4N1X A;  1K4E A;  4K0X A;  4R3B A;  3WRT A;  3BM6 A;  2Q9M A;  3OPL A;  1PZP A;  3SS4 A;  1XXM A;  4GD8 A;  3FYZ A;  4ZTK A;  2V1Z A;  4GKU A;  5KMW A;  3S4X A;  1K38 A;  4JBF A;  4H8R A;  5FQ9 A;  4NET A;  3CMZ A;  4BLM A;  1GHP A;  4DDS A;  2ZC4 B;  1RGY A;  1ESU A;  2Y2K A;  5HAP A;  4DXB A;  4UHU A;  1ALQ A;  4DXC A;  1FOF A;  3O88 A;  5HW3 A;  3B3X A;  2XD1 A;  1ZKJ A;  5DF7 A;  4E3M A;  3W4P A;  2DCF A;  5CGW A;  1LLB A;  4ZBE A;  1RCJ A;  5EPH A;  1FCO A;  1GHM A;  2UWX A;  4MBF A;  1K55 A;  2Y2N A;  2Z2M B;  4GNU A;  4JLF A;  4X69 A;  3D4F A;  3O87 A;  3VP0 A;  3IT9 A;  4R23 A;  4R4R A;  1DJB A;  1L0E A;  5DF8 A;  4DE1 A;  3BEB A;  4FSF A;  5DTS A;  1N4O A;  2ZC5 B;  1RP5 A;  2QMI A;  4UAA A;  4E3K A;  2WGW A;  4ZJ1 A;  1G6A A;  1I2S A;  4S2M A;  5HL1 A;  4JXG A;  3HRE A;  4DKI A;  3IF6 C;  4OPY A;  1ONH A;  3S22 A;  2EX2 A;  1PZO A;  3M6H A;  4OVD A;  3PBR A;  1I2W A;  4LV2 A;  1PWC A;  4S2N C;  4KQR A;  4P0M A;  1K54 A;  1GCE A;  3LY4 A;  1S0W A;  1VQQ A;  1BLC A;  1YLT A;  1SCW A;  3VSL A;  1CEG A;  5CTM A;  1MWS A;  5A92 A;  4ZJ3 A;  1O07 A;  3RJU A;  2EXB A;  3WS0 A;  3QHY A;  3VP2 A;  3M2K A;  1XPB A;  2ZM2 A;  2I72 A;  1LHY A;  1W7F A;  4YIN A;  4NK3 A;  2ZMA A;  3G34 A;  2ZM8 A;  4X56 A;  1IEL A;  2HP6 A;  3GVB A;  3VMA A;  5CTN A;  4B4X A;  4MNR A;  4S2K A;  1GA9 A;  4S2P A;  5FAO A;  2EX6 A;  3G31 A;  2HPB A;  4MBH A;  3ZG7 B;  3IWO A;  2C5W B;  3OCL A;  5GL9 A;  3Q7Z A;  5FQJ A;  4HBT A;  1H8Y A;  4KZ4 A;  3UE0 A;  4Z9Q A;  2P9V A;  5A91 A;  3RXX A;  2ZC3 B;  3PBQ A;  5CEC A;  4E3I A;  3ZVW A;  1Z6F A;  3M6B A;  1NY0 A;  1W79 A;  2ZC6 B;  1ES4 A;  5CHM A;  3S1Y A;  3G2Y A;  4OP8 A;  4WZ5 C;  3HLB A;  4OQG A;  1M6K A;  2OLV A;  4OQ0 A;  2RL3 A;  2Y2H A;  5F1G A;  5EUA A;  1SHV A;  3Q82 A;  3HL9 A;  2XF3 A;  4FH4 A;  3PBN A;  5FQM A;  3N7W A;  4D2O A;  5J8X A;  3IF6 A;  4XUX A;  3LCE A;  4FCF A;  3BFG A;  2JC7 A;  1BT5 A;  1MKI A;  3IXG A;  4GN2 A;  3C7V A;  4BL3 A;  1SDE A;  4S2N A;  4BD0 A;  3OPR A;  3NDG A;  4EUZ A;  2X71 A;  3IWI A;  4U0X A;  5CGS A;  1ERM A;  2XD5 A;  3CZD A;  3VFF A;  5M18 A;  5CEB A;  3ZG8 B;  3V50 A;  2IWC A;  4JF5 A;  3W4O A;  5AQB A;  1NRF A;  4OH0 A;  3WS5 A;  3UPN A;  2XEP A;  1WE4 A;  2FFY A;  1DJA A;  3A3E A;  4ID4 A;  3C4O A;  2QZ6 A;  2V2F F;  5EVI C;  4JXV A;  4XXR A;  3V3R A;  2WKH A;  2Y55 A;  3ZNT A;  2HP5 A;  2Y2G A;  2WGI A;  2J9P A;  4LEN A;  5GLB A;  5FA7 A;  3I7J A;  1SDN A;  2A49 A;  4C3Q A;  1PI4 A;  5DVA A;  3GSG A;  4Y7P A;  1W5D A;  1FR1 A;  2OLU A;  1ES3 A;  4PM7 A;  1NYM A;  2VGK A;  3IF6 B;  5KZH A;  3N8R A;  1ESI A;  1JVJ A;  2H10 A;  3GTC A;  1O7E A;  4A5R A;  1IYP A;  3NC8 A;  1N9B A;  2XDM A;  3PAG A;  1BSG A;  5CHJ A;  1QMF A;  1YLJ A;  5EOE A;  4LV1 A;  1G68 A;  1BZA A;  1XX2 A;  4R1G A;  3N4I A;  3V3S A;  3FV7 A;  4WZ5 A;  5E2G A;  3PAE A;  3A3F A;  1FCM A;  3HUN A;  2IWB A;  1JWV A;  2ZQ7 A;  4DE2 A;  4F94 A;  1KDS A;  3VOY A;  4DRT A;  1XGI A;  3VSK A;  1YMS A;  1JTG A;  5E43 A;  1K57 C;  3A3I A;  1PW1 A;  4JXS A;  2B5R A;  1XKZ A;  5AQ9 A;  3DTM A;  4R0Q A;  4LV3 A;  2BG1 A;  5JYO A;  1DY6 A;  3HVF A;  4EQI A;  4Q8I A;  2XK1 A;  3GV9 A;  4KZ7 A;  5E2F A;  4HEF A;  4JF6 A;  1PI5 A;  3HLC A;  5GLC A;  2QPN A;  2EX9 A;  5E2E A;  4OOL A;  1NZU A;  5HX9 A;  4QY6 A;  2GDN A;  3P09 A;  4LCL A;  2WKE A;  1IYS A;  3HLF A;  3ZFZ A;  1L0G A;  3WS2 A;  2ZQC A;  4QY5 A;  1FQG A;  1HZO A;  5CGX A;  5EVI A;  4P87 A;  5KSH A;  5L2F A;  1NYY A;  3BLS A;  1KE3 A;  2WYX A;  3DW0 A;  1Q2Q A;  3MKE A;  3WRZ A;  4WYY A;  3Q7V A;  3BFC A;  2DNS A;  2WZX A;  2EXA A;  4GDB A;  1BLS A;  3FZC A;  4PM9 A;  5FAS A;  4GB7 A;  3FKV A;  4IBR A;  3TG9 A;  4N92 A;  2WAF A;  3BYD A;  4CJN A;  1I5Q A;  3A3J A;  1BUL A;  4JF4 A;  4OPR A;  3SS5 A;  4DF6 A;  3ZG9 B;  1KVL A;  3LY3 A;  4HBU A;  3HLD A;  1M40 A;  1ERQ A;  1CI8 A;  1KGE A;  2PU2 A;  3UO9 A;  4BD1 A;  5CER A;  4KG2 A;  5AQA A;  1MBL A;  1IYQ A;  5FSR A;  3IXB A;  5FDH A;  4BQM A;  1K6S A;  1BTL A;  3PBT A;  5A90 A;  3G32 A;  3HUM A;  3W4Q A;  4P6B A;  3O86 A;  2PU4 A;  3FWL A;  4KQQ A;  1TDG A;  2WGW B;  3GR2 A;  4B4Z A;  3UE3 A;  1HD8 A;  2HP9 A;  1K57 A;  2OSU A;  4PPR A;  2EFU A;  4WEK A;  3M2J A;  3AGF A;  5TR7 A;  3IXD A;  2Y2L A;  2Y2I A;  4S2L A;  1L0F A;  3IHA A;  1Y54 A;  4OQI A;  4YFM A;  4QHC A;  4GDN A;  3SH7 A;  4C6Y A;  4IVK A;  3GQZ A;  3E2K A;  4X68 A;  1K56 A;  2J7V A;  4Y0U A;  5CHU A;  3ZHH A;  3IHB A;  1GHI A;  5EE8 A;  2ZQ8 A;  1W8Y A;  3UPO A;  2Y91 A;  3NIA A;  1K25 A;  3IXH A;  4RX3 A;  4LV0 A;  4BJP A;  1MWU A;  1YLP A;  5A93 A;  1DJC A;  3NCK A;  3IWQ A;  4B88 A;  3ZGA B;  3BFD A;  1XP4 A;  4PM6 A;  1L0D A;  2JCH A;  4GD6 A;  1EI5 A;  4E3N A;  2EFX A;  2WZZ A;  5DTT A;  1K4F A;  1MY8 A;  4Y0O A;  4U3T A;  3MZE A;  3VP3 A;  1NZO A;  2H5S A;  2P9V B;  1PW8 A;  1TDL A;  2WK0 A;  5TGF A;  3NDE A;  4ZAM A;  3E2L A;  4KZB A;  1K6R A;  2Q9N A;  2G2U A;  1EWZ A;  1YM1 A;  3QNC A;  1YLW A;  2WGV A;  3BLM A;  3BEC A;  4R4S A;  5CRF A;  3OZH A;  3N8L A;  4FH2 A;  2ZLY A;  1CI9 A;  4WMC A;  3ITB A;  4OPQ A;  2G2W A;  3BRM A;  3RXW A;  3TSG A;  1K55 C;  3UE1 A;  4EBN A;  4GOG A;  1KDW A;  4KG5 A;  5FAQ A;  5EVI D;  1ES2 A;  5GHY A;  2BLS A;  4OOM A;  4OPZ A;  5EVL A;  5FQI A;  4DDY A;  1QME A;  1KE0 A;  4E6X A;  2ZC7 A;  5FQK A;  4BL2 A;  3SS3 A;  3ZG5 A;  3WWX A;  3ZCZ A;  5HAQ A;  4XUZ A;  1E3U A;  4JPM A;  4L0L A;  1HTZ A;  1LI0 A;  2XQZ A;  4RYE A;  3P98 A;  4OLG A;  3PBO A;  3IF5 A;  3MXR A;  4KZ8 A;  4KZA A;  1U60 A;  4WEL A;  1PWD A;  1IYO A;  4Y0T A;  1KGF A;  1FCN A;  1MPL A;  2J9O A;  5FI2 A;  5GHZ A;  4PM5 A;  4EBP A;  3HBR A;  1BUE A;  3N6I A;  1KGG A;  2Y59 A;  1IKI A;  3W8K A;  3SH9 A;  5TFQ A;  5DTK A;  2ZQA A;  4EBL A;  3DWZ A;  1TEM A;  3UN7 A;  3QNB A;  5JYP A;  2IWD A;  3MZD A;  4S2O A;  2E8I A;  1H5X A;  2JE5 A;  2Z2L B;  4E3O A;  3HLG A;  4MLL A;  4QB8 A;  2FFF B;  5GHX A;  5BOH A;  3BFE A;  4M3K A;  1JTD A;  2PBY A;  1MWR A;  4U0T A;  4GZB A;  2A3U A;  4PM8 A;  3VFH A;  1KVM A;  2RCX A;  1ZG6 A;  5EOO A;  5CXW A;  1LL9 A;  4OON A;  3ZDJ A;  4JXW A;  5F83 A;  4S2I A;  1LI9 A;  1YMX A;  2J8Y A;  4OOY A;  1K56 D;  1ERO A;  1FSY A;  3G35 A;  3LO7 A;  4KQO A;  1AXB A;  2VGJ A;  1IEM A;  3TOI A;  2ZQD A;  1RGZ A;  3HLE A;  3V39 A;  2Y4A A;  1XGJ A;  5HAR A;  2XLN A;  3G2Z A;  5EEC A;  2C6W B;  1JWZ A;  1WYC A;  4S2J A;  2V20 A;  3AGD A;  3HUO A;  2EX8 A;  1WYB A;  3BFF A;  2Y2P A;  2ZJ9 A;  3MFD A;  1YT4 A;  1H8Z A;  1E4D A;  3Q1F A;  4UA6 A;  4E3J A;  2JBF A;  4QD4 A;  1S6R A;  4P85 A;  4OKP A;  1YQS A;  2Y2O A;  4BEN A;  4RX2 A;  2R9X A;  1GA0 A;  3MBZ A;  5EVI B;  2WAD A;  5U47 A;  3OCN A;  3PBS A;  4EV4 A;  2CC1 A;  4CPK A;  2HDS A;  2XFS A;  3EQU A;  3Q7V B;  3ISG A;  4WM9 A;  3VOZ A;  1C3B A;  4WBG A;  4IBX A;  3A3D A;  2XGN A;  2X01 A;  2H0Y A;  5FAP A;  4OQH A;  1VM1 A;  3NY4 A;  5M19 A;  3MKF A;  1YLZ A;  1YLY A;  3UPP A;  3V5M A;  2WAE A;  2XH9 A;  1LL5 A;  1CEF A;  5GLD A;  3VP1 A;  1Q2P A;  1L2S A;  1TVF A;  4KZ6 A;  1IKG A;  4WMC D;  4ZJ2 A;  4DE0 A;  4KG6 A;  4OLD A;  4KEN B;  3CG5 A;  3EQV A;  1HVB A;  3ZG0 A;  1PYY A;  5FI6 A;  4FD8 A;  3CJM A;  3UDX A;  1ES5 A;  2Y2Q A;  3UDI A;  5CED A;  1W8Q A;  5E2H A;  4E6W A;  1BLH A;  3Q07 A;  3C4P A;  3UDF A;  3MXS A;  2X02 A;  2XFT A;  3C5A A;  1CK3 A;  3O3V A;  3ZVT A;  2WUQ A;  1SKF A;  1E3U D;  3OC2 A;  4JKT A;  4X53 A;  4C75 A;  2OV5 A;  3Q81 A;  1JWP A;  5HFO A;  1J9M A;  3G30 A;  5F82 A;  3SH8 A;  3FKW A;  2ZM0 A;  3JYI A;  3WS1 A;  4PMA A;  3WS4 A;  2XR0 A;  3AGE A;  1NJ4 A;  3IQA A;  4KZ3 A;  1ZG4 A;  5FI7 A;  2HDR A;  2HDU A;  4K91 A;  4LCM A;  4QU3 A;  5F1F A;  3DWK A;  4UA9 A;  1FSW A;  4RA7 A;  4E3L A;  3ITA A;  5AQ7 A;  1XA7 A;  1PIO A;  4N9L A;  4X55 A;  3MZF A;  3GMW A;  4QJG A;  5FAT A;  1MWT A;  4KZ5 A;  4UA7 A;  5D3O A;  2H0T A;  3PTE A;  4OP5 A;  5IHV A;  4IED A;  1FR6 A;  3OPP A;  1OME A;  1BLP A;  4DE3 A;  2R9W A;  3IH9 A;  3N8S A;  3IH8 A;  3NI9 A;  4HES A;  4WZ4 A;  1E25 A;  3LEZ A;  4K0W A;  4MEZ A;  2ZD8 A;  4N9K A;  4N1H A;  3ZNY A;  1MXO A;  2ZQ9 A;  5M1A A;  3G4P A;  4WEJ A;  4EWF A;  2P74 A;  2Y2J A;  3NBL A;  5GLA A;  2DRW A;  3UY6 A;  3C7U A;  3HLW A;  5FQQ A;  1XA1 A;  1KE4 A;  3OPH A;  4R3J A;  1ONG A;  3UNW A;  2Y2M A;  5G18 A;  5KSC A;  4X6T A;  3GRJ A;  5I94 A;  1K54 C;  5HAI A;  3VP4 A; 
#chains in the Genus database with same CATH topology
 4ZDX A;  4MBK A;  3MQO A;  3SOI A;  1K4E A;  3BM6 A;  3FYZ A;  3NUL A;  4ZTK A;  3S4X A;  1AWI A;  2LB5 A;  2VGL S;  3O88 A;  1ZKJ A;  4KUK A;  1LLB A;  4ZBE A;  1RCJ A;  2HZ5 A;  4GNU A;  3O87 A;  4R4R A;  1L0E A;  4DE1 A;  5DTS A;  1RP5 A;  4L9G A;  4UAA A;  4E3K A;  4IUH A;  1I2S A;  5HL1 A;  3HRE A;  3S22 A;  2EX2 A;  1PNE A;  3TW8 A;  2MJ6 A;  1P9R A;  1YSQ A;  1S0W A;  4HNB A;  5AVE A;  1YLT A;  2VEA A;  4HJ4 A;  3RJU A;  2PRF A;  5DFX A;  1LHY A;  1T1A A;  2M1C A;  4NK3 A;  3G34 A;  3FPW A;  4X56 A;  2HP6 A;  3VMA A;  4G3V A;  4S2K A;  3G31 A;  2HPB A;  4EW7 A;  2Q0O A;  3LR0 A;  2HGV A;  5FQJ A;  5HDD A;  4KZ4 A;  4X1M A;  4IUK A;  5EVE A;  5A91 A;  3RXX A;  3PBQ A;  5CEC A;  1NY0 A;  2OWJ A;  1W79 A;  4O01 A;  3S1Y A;  2ZL1 A;  4WZ5 C;  3HLB A;  3R7W A;  2OLV A;  4OQ0 A;  1SHV A;  3Q82 A;  4FH4 A;  1P0Z A;  3IF6 A;  3LR4 A;  4FCF A;  1TD5 A;  1MKI A;  2JC7 A;  4HHD A;  2EWV A;  4B93 A;  3NDG A;  3IWI A;  4GCZ A;  3DAV A;  1WE4 A;  2FFY A;  4GJ4 A;  1TF1 A;  3MSH A;  4ID4 A;  5HZH A;  2WKH A;  2HP5 A;  2Y2G A;  2WGI A;  4LEN A;  1DP8 A;  4LRZ E;  2A49 A;  5DVA A;  4AFI A;  3GSG A;  1W5D A;  4EEU A;  3BY9 A;  3IX4 A;  3GTC A;  4A5R A;  1OJG A;  1NLZ A;  1N9B A;  3U4L P;  2XDM A;  4MN5 A;  1G68 A;  1XX2 A;  3P01 A;  4R1G A;  2ZOI A;  5E2G A;  4HH2 A;  3SZT A;  3HUN A;  5L07 A;  2PBD P;  4MDZ A;  4DJ3 A;  1JWV A;  4I39 A;  4F94 A;  1KDS A;  3SW1 A;  1K57 C;  1CJF A;  2XSS A;  3IBR A;  4E04 A;  1DY6 A;  5AJG A;  3GV9 A;  1VB6 A;  5GLC A;  3LR3 A;  2QPN A;  2EX9 A;  4OOL A;  1NZU A;  5HX9 A;  4QY6 A;  3WS2 A;  2ZQC A;  4O8G A;  5L2F A;  1KE3 A;  3WRZ A;  3Q7V A;  3BFC A;  2DNS A;  2EXA A;  1D06 A;  4PM9 A;  5HWV A;  3B47 A;  4D60 A;  2L4R A;  4PHT A;  3TG9 A;  2W1R A;  2JN7 A;  3MXQ A;  1BUL A;  4HBU A;  1W63 M;  1LSX A;  2JKR I;  1KGE A;  1OTB A;  2PU2 A;  3UO9 A;  5AQA A;  1XJ3 A;  3IXB A;  1A0K A;  3G6O A;  3DTI A;  3HUM A;  2PU4 A;  1TDG A;  3QP1 A;  5K5B A;  3UE3 A;  4PPR A;  2OSU A;  3EEA A;  5TR7 A;  2Y2I A;  1Y4O A;  3IHA A;  4YFM A;  4QHC A;  4MMN A;  2INW A;  1W63 Q;  5TJJ A;  2ZQ8 A;  1W8Y A;  1J3W A;  4XT2 A;  4BJP A;  4UQI S;  2M7V A;  3ZGA B;  2JCH A;  2WZZ A;  5DTT A;  1K4F A;  1MY8 A;  5J7E A;  4U3T A;  3VP3 A;  4FTX A;  3E2L A;  4KZB A;  3CUE A;  1K6R A;  2Q9N A;  1EWZ A;  1S4R A;  4R38 A;  2ZL1 B;  2OAQ 1;  1CI9 A;  4WMC A;  3ITB A;  2VA0 A;  3BRM A;  3TSG A;  2XRO A;  5EVI D;  2W3F A;  4Y17 A;  5FQI A;  1P97 A;  4E6X A;  2O99 A;  2V1A A;  1BYW A;  4YOF A;  3SS3 A;  3ZCZ A;  4KUO A;  5HAQ A;  2V8C A;  4JPM A;  2BAS A;  4OLG A;  4RQ9 A;  2P7J A;  3MXR A;  2ZMV A;  1MPL A;  5FI2 A;  3QP6 A;  4EBP A;  3HBR A;  3BY8 A;  3E98 A;  1D7E A;  4I3J A;  1OT6 A;  5DTK A;  3DWZ A;  4WN5 A;  3BW6 A;  4E3O A;  4MLL A;  2K31 A;  4HQA A;  5GHX A;  3BFE A;  4M3K A;  4ARZ A;  4I3A A;  1KVM A;  2RCX A;  1LL9 A;  4OON A;  1OJ5 A;  4JXW A;  5F83 A;  3F1O A;  4S2I A;  1LI9 A;  5MC7 A;  1FSY A;  1AXB A;  5L10 A;  2D02 A;  2PD7 A;  3HLE A;  1XGJ A;  5HAR A;  3G2Z A;  3HUO A;  1WYB A;  5F5Y A;  5HWW A;  1YQS A;  4G3W A;  1NLY A;  3RFB A;  2HDS A;  1OTA A;  4WF0 A;  3Q7V B;  4MCW A;  2X01 A;  3FG8 A;  5M19 A;  1YLZ A;  2XH9 A;  3VP1 A;  1IKG A;  4L9F A;  1UWP X;  4KG6 A;  3CG5 A;  3VE3 A;  3UDX A;  3CJM A;  3Q07 A;  3LFV A;  2X02 A;  3C5A A;  3OC2 A;  4JKT A;  4X53 A;  4NXB A;  1J9M A;  3VV4 A;  3FKW A;  4PMA A;  1NJ4 A;  4KZ3 A;  3LIE A;  3DWK A;  4E3L A;  3ITA A;  4N9L A;  4X55 A;  3RTY A;  3OOV A;  2XRN A;  5FAT A;  4KZ5 A;  5D3O A;  5IHV A;  3PTE A;  3EEH A;  1TS0 A;  2B18 A;  4WZ4 A;  4K0W A;  2B95 A;  2ZD8 A;  4HIA A;  4EWF A;  1FIL A;  5GLA A;  4HI4 A;  1KE4 A;  3OPH A;  4R3J A;  1MKM A;  5I94 A;  4IVI A;  1K54 C;  5HAI A;  5J3W A;  1GSX A;  4O7D A;  1NXY A;  4HJ3 A;  4KZ9 A;  2HDQ A;  4K0X A;  3WRT A;  3D72 A;  1PZP A;  3LIC A;  2V1Z A;  3LI9 A;  4GKU A;  5KMW A;  1K38 A;  2J80 A;  4DDS A;  2Y2K A;  1ALQ A;  2R78 A;  4DXC A;  3A0V A;  3B3X A;  5DF7 A;  4E3M A;  2DCF A;  5EM1 A;  4MBF A;  2Y2N A;  4X69 A;  4JLF A;  3D4F A;  4R23 A;  5DF8 A;  2ZC5 B;  1ODV A;  4WUJ A;  3MS6 A;  5A8B A;  5HSQ A;  3S7Q A;  3UB8 A;  1PZO A;  3M6H A;  4OVD A;  3PBR A;  1I2W A;  4LV2 A;  3H7W B;  4S2N C;  4P0M A;  3K3C A;  1CEG A;  5CTM A;  2EWW A;  2EXB A;  5DJT A;  4HY8 A;  4MN6 A;  1XPB A;  2ZM2 A;  2I72 A;  3F1O B;  2ZMA A;  1XJ2 A;  3NOT C;  3TJZ C;  4B4X A;  4MNR A;  2EX6 A;  3IWO A;  4GS9 A;  2P9V A;  2G7U A;  5FL3 A;  2QJ5 A;  1ES4 A;  1OT9 A;  1H3Q A;  3FPV A;  3KSG A;  3MQ0 A;  4H6J A;  2Y2H A;  2W3E A;  5EUA A;  3HL9 A;  5FQM A;  4D2O A;  3N7W A;  5J8X A;  3LCE A;  3MR0 A;  3C7V A;  4BD0 A;  2M7U A;  4U0X A;  4PKY A;  1ERM A;  2XD5 A;  3ZG8 B;  3V50 A;  2IWC A;  4JF5 A;  4OH0 A;  2V9A A;  3UPN A;  2ZBB A;  2QZ6 A;  5EVI C;  4JXV A;  4XXR A;  3T4J A;  3ZNT A;  2OOL A;  5FA7 A;  1FR1 A;  3K2N A;  2VGK A;  2W1T B;  3N8R A;  1JVJ A;  1TS8 A;  4Y13 A;  2H10 A;  1O7E A;  1BSG A;  5CHJ A;  1QMF A;  3FC7 A;  1YLJ A;  4NXF A;  1OTE A;  5EOE A;  5IU1 A;  3FV7 A;  4WZ5 A;  2NUT C;  4FUW A;  4R70 A;  2IWB A;  3LIB A;  3PXP A;  3IX3 A;  4DRT A;  5HL6 A;  3UMD A;  5E43 A;  4JXS A;  2B5R A;  4EQI A;  2XK1 A;  4UQI M;  1PI5 A;  4PKY G;  3KYQ A;  3KSH A;  3P09 A;  1STZ A;  2E8J A;  4QY5 A;  1FQG A;  4WL9 A;  2WYX A;  4WYY A;  3FZC A;  4IBR A;  3KSF A;  3BYD A;  4OPR A;  3ZG9 B;  1M40 A;  4KG2 A;  1DP9 A;  1IYQ A;  5FSR A;  5CX7 A;  5FDH A;  1K6S A;  3PBT A;  5A90 A;  3G32 A;  1EW0 A;  5AVF A;  2W27 A;  3W4Q A;  3QP8 A;  1G6O A;  2J3T D;  1F9I A;  3L9K A;  3T4Q A;  4IJG A;  4BBU A;  1K57 A;  2EFU A;  4R3A A;  2Y8H A;  3IXD A;  1LSW A;  4O0P A;  3E2K A;  4X68 A;  1K56 A;  4KQD A;  2PAV P;  2Y91 A;  2A2L A;  1K25 A;  3CWF A;  3NCK A;  3ZQ5 A;  4B88 A;  3BFD A;  4GS9 B;  5F68 A;  4EET B;  4Y0O A;  3MZE A;  2P9V B;  1PW8 A;  3NDE A;  4ZAM A;  1MZU A;  4NG2 A;  2JHE A;  1FIK A;  3LYX A;  4MN7 A;  3BLM A;  4H6J B;  4FH2 A;  5FEG A;  2G2W A;  1ES2 A;  5GHY A;  4OOM A;  2VJW A;  3WWX A;  2VZW A;  4LPZ A;  3ULF A;  1UWN X;  2XQZ A;  3F1N B;  3E4P A;  4RYE A;  4M4X A;  3PBO A;  4KZ8 A;  4GHI B;  1PWD A;  3T12 B;  1KGF A;  1FCN A;  5GHZ A;  1BUE A;  1VEU A;  2GNX A;  3N6I A;  2Y59 A;  1IKI A;  1MC0 A;  3SH9 A;  5TFQ A;  5JYP A;  1G28 A;  3QNB A;  2OAP 1;  3MZD A;  4I38 A;  4S2O A;  2E8I A;  2JE5 A;  2Z2L B;  3HLG A;  3VOL A;  4GW9 A;  4BWI A;  1MWR A;  3VFH A;  1CQA A;  3ZDJ A;  1H0M A;  4OOY A;  1ERO A;  4Q0J A;  3G35 A;  4DN0 A;  3LO7 A;  1IEM A;  4JGR A;  2Y4A A;  2XLN A;  2C6W B;  4S2J A;  3AGD A;  4II7 A;  2Y2P A;  3QP4 A;  3MFD A;  3CPT A;  1YT4 A;  4E3J A;  2JBF A;  1XJ4 A;  4OKP A;  3MBZ A;  3PBS A;  3R4K A;  2KDK A;  2XFS A;  3NJA A;  1VM1 A;  3ICY A;  3MKF A;  3UPP A;  1F98 A;  1VET B;  2WAE A;  2O9B A;  4DE0 A;  4KEN B;  1F5M A;  1HVB A;  4EXO A;  5CED A;  3UDI A;  3E4Q A;  1XJ6 A;  1W8Q A;  4LGW A;  2OWH A;  3C4P A;  3UDF A;  1YAX A;  2XFT A;  4JGQ A;  1E3U D;  2ZOH A;  3HCY A;  5F82 A;  2ZM0 A;  3WS1 A;  4EU0 A;  3UE6 A;  1WA9 A;  3AGE A;  3IQA A;  5FI7 A;  2HDU A;  4QU3 A;  4RA7 A;  2D01 A;  5AQ7 A;  1PIO A;  3GMW A;  4OP5 A;  3LR5 A;  1OME A;  3IH9 A;  3T4T A;  4HES A;  3NI9 A;  1E25 A;  4CLC D;  2B02 A;  4N1H A;  2LB9 A;  3MJQ A;  3T1R A;  5M1A A;  4WEJ A;  2P74 A;  3NBL A;  3C7U A;  3GEC A;  3D9Y A;  2Y2M A;  4X6T A;  3VP4 A;  4RVA A;  1PWG A;  2O9C A;  1T1B A;  3OPL A;  2Q9M A;  4GLQ A;  1XXM A;  4GD8 A;  3MFX A;  3KSI A;  5HPF A;  3H7W A;  4BLM A;  3T4O A;  1GHP A;  1HLU P;  1RGY A;  5HAP A;  2W3D A;  2Z6D A;  3T4S A;  4DXB A;  4ETX A;  1FOF A;  4P6Z S;  5FDS A;  3W4P A;  1ZHH B;  5EPH A;  1GHM A;  1K55 A;  2Z2M B;  3VP0 A;  1XFN A;  3LGO A;  4FSF A;  2JKT M;  1N4O A;  1VEU B;  1YPR A;  2KOI A;  1P9W A;  1GSW A;  2WGW A;  3F1P A;  4OPY A;  1ONH A;  2FH5 A;  4PAU A;  4KQR A;  1K54 A;  1GCE A;  3LY4 A;  1VQQ A;  1N9N A;  4ESP A;  5IS1 A;  5G4Z A;  1MWS A;  2J3T C;  1O07 A;  4G3K A;  3D3O A;  3GDI A;  1W7F A;  3CUE C;  2ZM8 A;  3NOP C;  5CTN A;  2FZ0 A;  1ACF A;  1V9Z A;  2K7S A;  2C5W B;  2W3H A;  3HJI A;  4HBT A;  3UE0 A;  3CPT B;  4Z9Q A;  1T1C A;  2ZC3 B;  4E3I A;  4HJ6 A;  3ZVW A;  1Z6F A;  3M6B A;  3MQQ A;  4Y2F A;  2Y79 A;  4UEY A;  5CHM A;  4OP8 A;  4OQG A;  1M6K A;  2RL3 A;  2W1T A;  3BFG A;  1BT5 A;  4S2N A;  3OPR A;  3CZD A;  3VFF A;  5CEB A;  3TE8 A;  2EA9 A;  1DJA A;  3C4O A;  2V2F F;  3V3R A;  1JNU A;  2Y55 A;  2J9P A;  4NXG A;  5GLB A;  3KYE A;  2OLU A;  4PM7 A;  1NYM A;  1VHM A;  4ME4 A;  4BMW A;  5KZH A;  2ACG A;  4YNR A;  1IYP A;  3NC8 A;  3PAG A;  2GX5 A;  2PDR A;  4LV1 A;  3N4I A;  3CI6 A;  3V3S A;  3EGX C;  1FCM A;  4LRY C;  2ZQ7 A;  3VOY A;  2WKQ A;  1XGI A;  2P08 A;  3BQA A;  3VSK A;  1YMS A;  1PW1 A;  4NKP A;  5AQ9 A;  4R0Q A;  5DKL A;  3T4K A;  5L09 A;  4HEF A;  1OTI A;  2WKE A;  1IYS A;  3ZFZ A;  5KSH A;  1HZO A;  5EVI A;  1X0O A;  3DW0 A;  4Y3I A;  3T1S A;  1BLS A;  2A24 B;  5FAS A;  4GB7 A;  2I9V A;  1I5Q A;  3B33 A;  3A3J A;  2DMW A;  4JF4 A;  4DF6 A;  1KVL A;  1CI8 A;  5CER A;  3H9W A;  1BTL A;  4I5S A;  3T1Q B;  2VV8 A;  4LRX C;  3O86 A;  4WLA A;  1KOU A;  3FWL A;  4KQQ A;  4B4Z A;  2WGW B;  1HD8 A;  2HP9 A;  3M2J A;  4B9O A;  3AGF A;  3F1P B;  2Y2L A;  4S2L A;  1L0F A;  4OQI A;  3SH7 A;  4IVK A;  1NWZ A;  2J7V A;  3H82 A;  4Y0U A;  5CHU A;  3ZHH A;  1GHI A;  3BWL A;  5EE8 A;  3NIA A;  2VLG A;  4LV0 A;  1MWU A;  1YLP A;  3IWQ A;  1XP4 A;  4PM6 A;  2HJ9 C;  3CAX A;  1EI5 A;  1S67 L;  2PT7 A;  2ZMF A;  3LIF A;  3F1N A;  2H5S A;  2IA2 A;  1TDL A;  5TGF A;  4GHI A;  4BBT A;  2G2U A;  4CLC C;  3QNC A;  3NHQ A;  3O5Y A;  3N8L A;  4OPQ A;  4EBN A;  2VKS A;  5FAQ A;  1SKO B;  2BLS A;  5EVL A;  1QME A;  1KE0 A;  4BL2 A;  4F3L B;  4XUZ A;  4L0L A;  1HTZ A;  3P98 A;  3IF5 A;  4KZA A;  1U60 A;  4LLO B;  4Y0T A;  3C2W A;  1S1Y A;  2J9O A;  3C30 A;  4I3I A;  1KGG A;  1TS6 A;  2JKT I;  5HWT A;  4HH3 A;  4IHQ A;  1TEM A;  1PFL A;  1CF0 A;  5G4Y A;  2IWD A;  2JKF A;  1H5X A;  3L7H A;  4JGO A;  2FFF B;  2WKP A;  4BBV A;  2PBY A;  2PR5 A;  4U0T A;  2A3U A;  3JPU A;  5EOO A;  5CXW A;  1PRQ A;  2Z6C A;  1YMX A;  1VET A;  4KQO A;  2VGJ A;  3MF0 A;  1RGZ A;  2KX6 A;  4DMZ A;  5EEC A;  1IOU A;  1WYC A;  2V20 A;  2EX8 A;  3BFF A;  2PR6 A;  4UA6 A;  1S6R A;  3T1X A;  5LBR A;  2WKR A;  5EVI B;  3OCN A;  2AVX A;  2CC1 A;  4CLC B;  4CPK A;  3EQU A;  3ISG A;  3JVU A;  1C3B A;  5F69 A;  4WBG A;  4IBX A;  3A3D A;  2XGN A;  3VOZ A;  2H0Y A;  5FAP A;  4OQH A;  2L1M A;  2V1B A;  2VV6 A;  1LL5 A;  5GLD A;  2GZA A;  1L2S A;  4WMC D;  4KZ6 A;  4OLD A;  3EQV A;  1LSV A;  5TBM B;  3ZG0 A;  1PYY A;  1ES5 A;  2Y2Q A;  1BLH A;  1SZV A;  3MXS A;  1CK3 A;  3O3V A;  2WUQ A;  1SKF A;  1DRM A;  1JWP A;  4P6Z M;  3G30 A;  3JYI A;  3NEC A;  1D1J A;  1ZG4 A;  2HDR A;  4CLC E;  4LCM A;  1S66 L;  4IED A;  3H82 B;  2P04 A;  5HPI A;  2R9W A;  1N9L A;  3MMH A;  3LEZ A;  2O9A A;  2K2N A;  3UB6 A;  5EM0 A;  3ZNY A;  3IS2 B;  3UB9 A;  2Y2J A;  3OLO A;  3HLW A;  2W0N A;  5FQQ A;  1OPX A;  1XA1 A;  1ONG A;  5KSC A;  3C8C A;  2JKG A;  2PHY A;  3IBJ A;  5DF9 A;  4QPR A;  2WKI A;  1ZC2 A;  4N1X A;  3KX0 X;  1V9Y A;  4R3B A;  3SS4 A;  4JBF A;  4H8R A;  5FQ9 A;  4NET A;  3CMZ A;  4CQH A;  2J3W A;  2ZC4 B;  1ESU A;  2HF6 A;  4NEE D;  2QHK A;  4UHU A;  5HW3 A;  2KLI A;  2XD1 A;  4JGP A;  5CGW A;  1FCO A;  1YKD A;  2UWX A;  3E4O A;  3IT9 A;  3HJK A;  1DJB A;  3BEB A;  3A0S A;  5DJU A;  2PYR A;  2QMI A;  4ZJ1 A;  5C5K A;  1G6A A;  4S2M A;  4JXG A;  4DKI A;  3IF6 C;  4QWO A;  1PWC A;  3W2Z A;  5J4E A;  1BLC A;  3VSL A;  1SCW A;  5HDC A;  5A92 A;  1LL8 A;  4ZJ3 A;  4Y15 A;  3WS0 A;  3QHY A;  2V0U A;  3M2K A;  3VP2 A;  2XA7 M;  4EER A;  4YIN A;  3CHW P;  4K08 A;  1YSP A;  1IEL A;  3GVB A;  1GA9 A;  2QYB A;  4S2P A;  5FAO A;  4MBH A;  3ZG7 B;  5HD5 A;  3OCL A;  5GL9 A;  3Q7Z A;  1H8Y A;  2CMN A;  2V0W A;  3UME A;  3IX8 A;  2ZC6 B;  5IT5 A;  3G2Y A;  5F1G A;  2HJE A;  2XF3 A;  3PBN A;  4XUX A;  4ZRR A;  1DP6 A;  4ETZ A;  3IXG A;  4GN2 A;  4BL3 A;  1SDE A;  4EUZ A;  2X71 A;  3QP5 A;  5CGS A;  5M18 A;  3VE4 A;  3BQ8 A;  3W4O A;  5AQB A;  2HV1 A;  1NRF A;  3EWK A;  3U2A A;  3WS5 A;  4NXE A;  2XEP A;  3A3E A;  3T50 A;  2QWS A;  5L8M A;  3I7J A;  1SDN A;  4C3Q A;  1PI4 A;  3R7W B;  4Y7P A;  1ES3 A;  3BJN A;  4R6L A;  1N9O A;  3IF6 B;  1ESI A;  3TRC A;  2BTF P;  4HP4 A;  4YWZ A;  4EQ1 A;  5EFW A;  1BZA A;  2A24 A;  2O0Y A;  3PAE A;  3A3F A;  4DE2 A;  3JVV A;  1JTG A;  3A3I A;  1H8M A;  3DBA A;  4Z1W A;  1XKZ A;  3DTM A;  4HOI A;  4LV3 A;  2BG1 A;  5JYO A;  3HVF A;  4Q8I A;  4KZ7 A;  5E2F A;  4L9E A;  4JF6 A;  3DTE A;  3HLC A;  2PD8 A;  3NOU C;  1XFQ A;  5E2E A;  1G5U A;  2GDN A;  4LCL A;  3HLF A;  2YKF A;  1L0G A;  5CGX A;  4P87 A;  1NYY A;  3BLS A;  1Q2Q A;  3MKE A;  2WZX A;  4GDB A;  4LFU A;  4FOF A;  3FKV A;  3EOI A;  4N92 A;  2WAF A;  4CJN A;  3SS5 A;  1NRJ A;  3LY3 A;  3HLD A;  1ERQ A;  4BD1 A;  2VK3 A;  1MBL A;  4Q0H A;  4BQM A;  2VX8 A;  2NUP C;  2UV0 E;  2H28 A;  4P6B A;  3CLO A;  3QP2 A;  3GR2 A;  5HD3 A;  4WEK A;  1GSV A;  3B42 A;  1Y54 A;  2W3G A;  4GDN A;  4C6Y A;  3CIT A;  1TS7 A;  3GQZ A;  3IHB A;  3UPO A;  4RX3 A;  3IXH A;  4EEP A;  1SKO A;  5F6A A;  5A93 A;  1DJC A;  2VGL M;  1L0D A;  4GD6 A;  3S7O A;  4F3L A;  4E3N A;  5EV0 A;  2EFX A;  3S7P A;  1NZO A;  2WK0 A;  1T19 A;  1YM1 A;  1YLW A;  2WGV A;  4R4S A;  3BEC A;  5CRF A;  3OZH A;  4HP9 A;  2ZLY A;  3P7N A;  3RXW A;  3UE1 A;  1K55 C;  4GOG A;  2L0W A;  1KDW A;  3LI8 A;  4KG5 A;  2XA7 S;  4XT2 B;  3ZYT A;  4X25 A;  4OPZ A;  4DDY A;  2ZC7 A;  5FQK A;  1LT0 A;  3KO6 A;  3ZG5 A;  4Y5F A;  1E3U A;  1LI0 A;  3PHY A;  3V67 A;  4WEL A;  1IYO A;  4PM5 A;  3DTK A;  2QKP A;  3W8K A;  5HDS A;  4EBL A;  2ZQA A;  3K3D A;  3UB7 A;  3UN7 A;  2GJ3 A;  1K0K A;  4QB8 A;  1OTD A;  4CLC A;  5BOH A;  1JTD A;  4GZB A;  4PM8 A;  1ZG6 A;  5DKK A;  3PYP A;  2J8Y A;  1K56 D;  3PR6 A;  3TOI A;  2ZQD A;  3V39 A;  5DFY A;  4DJ2 A;  5TBM A;  3UB5 P;  1JWZ A;  2ZJ9 A;  3LUQ A;  1H8Z A;  1E4D A;  3Q1F A;  1T18 A;  4QD4 A;  4P85 A;  2Y2O A;  4BEN A;  2YKH A;  4RX2 A;  2R9X A;  1GA0 A;  5U47 A;  2WAD A;  4EV4 A;  3A0R A;  1S4S A;  4WM9 A;  4ARZ B;  5KIZ A;  3NY4 A;  2V8F A;  1YLY A;  3V5M A;  2JKR M;  5FEF A;  1CEF A;  3E0Y A;  1Q2P A;  1TVF A;  3LID A;  4ZJ2 A;  5FI6 A;  4FD8 A;  3KYZ A;  3LIA A;  5E2H A;  4E6W A;  3S7N A;  4EUV A;  1Y28 A;  3ZVT A;  3IS2 A;  1UGU A;  4C75 A;  1S1Z A;  2OV5 A;  3Q81 A;  5I5L A;  5HFO A;  1F2K A;  3T4L A;  3SH8 A;  4X1L A;  3WS4 A;  1IFQ A;  2XR0 A;  4K91 A;  5F1F A;  4UA9 A;  1FSW A;  1XA7 A;  1ZTU A;  3MZF A;  1L3L A;  4QJG A;  1MWT A;  4UA7 A;  2H0T A;  4EES A;  3EGD C;  1FR6 A;  3OPP A;  1BLP A;  4Q0I A;  4DE3 A;  3N8S A;  3IH8 A;  2QJ7 A;  4MEZ A;  4N9K A;  1MXO A;  3RH8 B;  2ZQ9 A;  3G4P A;  2VV7 A;  3C38 A;  3UY6 A;  2DRW A;  3LEQ A;  3UNW A;  1Z09 A;  3OBF A;  5G18 A;  3GRJ A;  2PYP A; 
#chains in the Genus database with same CATH homology
 4ZDX A;  4O7D A;  1NXY A;  4MBK A;  5DF9 A;  4RVA A;  1PWG A;  2WKI A;  4IVI A;  1ZC2 A;  2HDQ A;  4KZ9 A;  3SOI A;  4N1X A;  1K4E A;  4K0X A;  4R3B A;  3WRT A;  3BM6 A;  2Q9M A;  3OPL A;  1PZP A;  3SS4 A;  1XXM A;  4GD8 A;  3FYZ A;  4ZTK A;  2V1Z A;  4GKU A;  5KMW A;  3S4X A;  1K38 A;  4JBF A;  4H8R A;  5FQ9 A;  4NET A;  3CMZ A;  4BLM A;  1GHP A;  4DDS A;  2ZC4 B;  1RGY A;  1ESU A;  2Y2K A;  5HAP A;  4DXB A;  4UHU A;  1ALQ A;  4DXC A;  1FOF A;  3O88 A;  5HW3 A;  3B3X A;  2XD1 A;  1ZKJ A;  5DF7 A;  4E3M A;  3W4P A;  2DCF A;  5CGW A;  1LLB A;  4ZBE A;  1RCJ A;  5EPH A;  1FCO A;  1GHM A;  2UWX A;  4MBF A;  1K55 A;  2Y2N A;  2Z2M B;  4GNU A;  4JLF A;  4X69 A;  3D4F A;  3O87 A;  3VP0 A;  3IT9 A;  4R23 A;  4R4R A;  1DJB A;  1L0E A;  5DF8 A;  4DE1 A;  3BEB A;  4FSF A;  5DTS A;  1N4O A;  2ZC5 B;  1RP5 A;  2QMI A;  4UAA A;  4E3K A;  2WGW A;  4ZJ1 A;  1G6A A;  1I2S A;  4S2M A;  5HL1 A;  4JXG A;  3HRE A;  4DKI A;  3IF6 C;  4OPY A;  1ONH A;  3S22 A;  2EX2 A;  1PZO A;  3M6H A;  4OVD A;  3PBR A;  1I2W A;  4LV2 A;  1PWC A;  4S2N C;  4KQR A;  4P0M A;  1K54 A;  1GCE A;  3LY4 A;  1S0W A;  1VQQ A;  1BLC A;  1YLT A;  1SCW A;  3VSL A;  1CEG A;  5CTM A;  1MWS A;  5A92 A;  4ZJ3 A;  1O07 A;  3RJU A;  2EXB A;  3WS0 A;  3QHY A;  3VP2 A;  3M2K A;  1XPB A;  2ZM2 A;  2I72 A;  1LHY A;  1W7F A;  4YIN A;  4NK3 A;  2ZMA A;  3G34 A;  2ZM8 A;  4X56 A;  1IEL A;  2HP6 A;  3GVB A;  3VMA A;  5CTN A;  4B4X A;  4MNR A;  4S2K A;  1GA9 A;  4S2P A;  5FAO A;  2EX6 A;  3G31 A;  2HPB A;  4MBH A;  3ZG7 B;  3IWO A;  2C5W B;  3OCL A;  5GL9 A;  3Q7Z A;  5FQJ A;  4HBT A;  1H8Y A;  4KZ4 A;  3UE0 A;  4Z9Q A;  2P9V A;  5A91 A;  3RXX A;  2ZC3 B;  3PBQ A;  5CEC A;  4E3I A;  3ZVW A;  1Z6F A;  3M6B A;  1NY0 A;  1W79 A;  2ZC6 B;  1ES4 A;  5CHM A;  3S1Y A;  3G2Y A;  4OP8 A;  4WZ5 C;  3HLB A;  4OQG A;  1M6K A;  2OLV A;  4OQ0 A;  2RL3 A;  2Y2H A;  5F1G A;  5EUA A;  1SHV A;  3Q82 A;  3HL9 A;  2XF3 A;  4FH4 A;  3PBN A;  5FQM A;  3N7W A;  4D2O A;  5J8X A;  3IF6 A;  4XUX A;  3LCE A;  4FCF A;  3BFG A;  2JC7 A;  1BT5 A;  1MKI A;  3IXG A;  4GN2 A;  3C7V A;  4BL3 A;  1SDE A;  4S2N A;  4BD0 A;  3OPR A;  3NDG A;  4EUZ A;  2X71 A;  3IWI A;  4U0X A;  5CGS A;  1ERM A;  2XD5 A;  3CZD A;  3VFF A;  5M18 A;  5CEB A;  3ZG8 B;  3V50 A;  2IWC A;  4JF5 A;  3W4O A;  5AQB A;  1NRF A;  4OH0 A;  3WS5 A;  3UPN A;  2XEP A;  1WE4 A;  2FFY A;  1DJA A;  3A3E A;  4ID4 A;  3C4O A;  2QZ6 A;  2V2F F;  5EVI C;  4JXV A;  4XXR A;  3V3R A;  2WKH A;  2Y55 A;  3ZNT A;  2HP5 A;  2Y2G A;  2WGI A;  2J9P A;  4LEN A;  5GLB A;  5FA7 A;  3I7J A;  1SDN A;  2A49 A;  4C3Q A;  1PI4 A;  5DVA A;  3GSG A;  4Y7P A;  1W5D A;  1FR1 A;  2OLU A;  1ES3 A;  4PM7 A;  1NYM A;  2VGK A;  3IF6 B;  5KZH A;  3N8R A;  1ESI A;  1JVJ A;  2H10 A;  3GTC A;  1O7E A;  4A5R A;  1IYP A;  3NC8 A;  1N9B A;  2XDM A;  3PAG A;  1BSG A;  5CHJ A;  1QMF A;  1YLJ A;  5EOE A;  4LV1 A;  1G68 A;  1BZA A;  1XX2 A;  4R1G A;  3N4I A;  3V3S A;  3FV7 A;  4WZ5 A;  5E2G A;  3PAE A;  3A3F A;  1FCM A;  3HUN A;  2IWB A;  1JWV A;  2ZQ7 A;  4DE2 A;  4F94 A;  1KDS A;  3VOY A;  4DRT A;  1XGI A;  3VSK A;  1YMS A;  1JTG A;  5E43 A;  1K57 C;  3A3I A;  1PW1 A;  4JXS A;  2B5R A;  1XKZ A;  5AQ9 A;  3DTM A;  4R0Q A;  4LV3 A;  2BG1 A;  5JYO A;  1DY6 A;  3HVF A;  4EQI A;  4Q8I A;  2XK1 A;  3GV9 A;  4KZ7 A;  5E2F A;  4HEF A;  4JF6 A;  1PI5 A;  3HLC A;  5GLC A;  2QPN A;  2EX9 A;  5E2E A;  4OOL A;  1NZU A;  5HX9 A;  4QY6 A;  2GDN A;  3P09 A;  4LCL A;  2WKE A;  1IYS A;  3HLF A;  3ZFZ A;  1L0G A;  3WS2 A;  2ZQC A;  4QY5 A;  1FQG A;  1HZO A;  5CGX A;  5EVI A;  4P87 A;  5KSH A;  5L2F A;  1NYY A;  3BLS A;  1KE3 A;  2WYX A;  3DW0 A;  1Q2Q A;  3MKE A;  3WRZ A;  4WYY A;  3Q7V A;  3BFC A;  2DNS A;  2WZX A;  2EXA A;  4GDB A;  1BLS A;  3FZC A;  4PM9 A;  5FAS A;  4GB7 A;  3FKV A;  4IBR A;  3TG9 A;  4N92 A;  2WAF A;  3BYD A;  4CJN A;  1I5Q A;  3A3J A;  1BUL A;  4JF4 A;  4OPR A;  3SS5 A;  4DF6 A;  3ZG9 B;  1KVL A;  3LY3 A;  4HBU A;  3HLD A;  1M40 A;  1ERQ A;  1CI8 A;  1KGE A;  2PU2 A;  3UO9 A;  4BD1 A;  5CER A;  4KG2 A;  5AQA A;  1MBL A;  1IYQ A;  5FSR A;  3IXB A;  5FDH A;  4BQM A;  1K6S A;  1BTL A;  3PBT A;  5A90 A;  3G32 A;  3HUM A;  3W4Q A;  4P6B A;  3O86 A;  2PU4 A;  3FWL A;  4KQQ A;  1TDG A;  2WGW B;  3GR2 A;  4B4Z A;  3UE3 A;  1HD8 A;  2HP9 A;  1K57 A;  2OSU A;  4PPR A;  2EFU A;  4WEK A;  3M2J A;  3AGF A;  5TR7 A;  3IXD A;  2Y2L A;  2Y2I A;  4S2L A;  1L0F A;  3IHA A;  1Y54 A;  4OQI A;  4YFM A;  4QHC A;  4GDN A;  3SH7 A;  4C6Y A;  4IVK A;  3GQZ A;  3E2K A;  4X68 A;  1K56 A;  2J7V A;  4Y0U A;  5CHU A;  3ZHH A;  3IHB A;  1GHI A;  5EE8 A;  2ZQ8 A;  1W8Y A;  3UPO A;  2Y91 A;  3NIA A;  1K25 A;  3IXH A;  4RX3 A;  4LV0 A;  4BJP A;  1MWU A;  1YLP A;  5A93 A;  1DJC A;  3NCK A;  3IWQ A;  4B88 A;  3ZGA B;  3BFD A;  1XP4 A;  4PM6 A;  1L0D A;  2JCH A;  4GD6 A;  1EI5 A;  4E3N A;  2EFX A;  2WZZ A;  5DTT A;  1K4F A;  1MY8 A;  4Y0O A;  4U3T A;  3MZE A;  3VP3 A;  1NZO A;  2H5S A;  2P9V B;  1PW8 A;  1TDL A;  2WK0 A;  5TGF A;  3NDE A;  4ZAM A;  3E2L A;  4KZB A;  1K6R A;  2Q9N A;  2G2U A;  1EWZ A;  1YM1 A;  3QNC A;  1YLW A;  2WGV A;  3BLM A;  3BEC A;  4R4S A;  5CRF A;  3OZH A;  3N8L A;  4FH2 A;  2ZLY A;  1CI9 A;  4WMC A;  3ITB A;  4OPQ A;  2G2W A;  3BRM A;  3RXW A;  3TSG A;  1K55 C;  3UE1 A;  4EBN A;  4GOG A;  1KDW A;  4KG5 A;  5FAQ A;  5EVI D;  1ES2 A;  5GHY A;  2BLS A;  4OOM A;  4OPZ A;  5EVL A;  5FQI A;  4DDY A;  1QME A;  1KE0 A;  4E6X A;  2ZC7 A;  5FQK A;  4BL2 A;  3SS3 A;  3ZG5 A;  3WWX A;  3ZCZ A;  5HAQ A;  4XUZ A;  1E3U A;  4JPM A;  4L0L A;  1HTZ A;  1LI0 A;  2XQZ A;  4RYE A;  3P98 A;  4OLG A;  3PBO A;  3IF5 A;  3MXR A;  4KZ8 A;  4KZA A;  1U60 A;  4WEL A;  1PWD A;  1IYO A;  4Y0T A;  1KGF A;  1FCN A;  1MPL A;  2J9O A;  5FI2 A;  5GHZ A;  4PM5 A;  4EBP A;  3HBR A;  1BUE A;  3N6I A;  1KGG A;  2Y59 A;  1IKI A;  3W8K A;  3SH9 A;  5TFQ A;  5DTK A;  2ZQA A;  4EBL A;  3DWZ A;  1TEM A;  3UN7 A;  3QNB A;  5JYP A;  2IWD A;  3MZD A;  4S2O A;  2E8I A;  1H5X A;  2JE5 A;  2Z2L B;  4E3O A;  3HLG A;  4MLL A;  4QB8 A;  2FFF B;  5GHX A;  5BOH A;  3BFE A;  4M3K A;  1JTD A;  2PBY A;  1MWR A;  4U0T A;  4GZB A;  2A3U A;  4PM8 A;  3VFH A;  1KVM A;  2RCX A;  1ZG6 A;  5EOO A;  5CXW A;  1LL9 A;  4OON A;  3ZDJ A;  4JXW A;  5F83 A;  4S2I A;  1LI9 A;  1YMX A;  2J8Y A;  4OOY A;  1K56 D;  1ERO A;  1FSY A;  3G35 A;  3LO7 A;  4KQO A;  1AXB A;  2VGJ A;  1IEM A;  3TOI A;  2ZQD A;  1RGZ A;  3HLE A;  3V39 A;  2Y4A A;  1XGJ A;  5HAR A;  2XLN A;  3G2Z A;  5EEC A;  2C6W B;  1JWZ A;  1WYC A;  4S2J A;  2V20 A;  3AGD A;  3HUO A;  2EX8 A;  1WYB A;  3BFF A;  2Y2P A;  2ZJ9 A;  3MFD A;  1YT4 A;  1H8Z A;  1E4D A;  3Q1F A;  4UA6 A;  4E3J A;  2JBF A;  4QD4 A;  1S6R A;  4P85 A;  4OKP A;  1YQS A;  2Y2O A;  4BEN A;  4RX2 A;  2R9X A;  1GA0 A;  3MBZ A;  5EVI B;  2WAD A;  5U47 A;  3OCN A;  3PBS A;  4EV4 A;  2CC1 A;  4CPK A;  2HDS A;  2XFS A;  3EQU A;  3Q7V B;  3ISG A;  4WM9 A;  3VOZ A;  1C3B A;  4WBG A;  4IBX A;  3A3D A;  2XGN A;  2X01 A;  2H0Y A;  5FAP A;  4OQH A;  1VM1 A;  3NY4 A;  5M19 A;  3MKF A;  1YLZ A;  1YLY A;  3UPP A;  3V5M A;  2WAE A;  2XH9 A;  1LL5 A;  1CEF A;  5GLD A;  3VP1 A;  1Q2P A;  1L2S A;  1TVF A;  4KZ6 A;  1IKG A;  4WMC D;  4ZJ2 A;  4DE0 A;  4KG6 A;  4OLD A;  4KEN B;  3CG5 A;  3EQV A;  1HVB A;  3ZG0 A;  1PYY A;  5FI6 A;  4FD8 A;  3CJM A;  3UDX A;  1ES5 A;  2Y2Q A;  3UDI A;  5CED A;  1W8Q A;  5E2H A;  4E6W A;  1BLH A;  3Q07 A;  3C4P A;  3UDF A;  3MXS A;  2X02 A;  2XFT A;  3C5A A;  1CK3 A;  3O3V A;  3ZVT A;  2WUQ A;  1SKF A;  1E3U D;  3OC2 A;  4JKT A;  4X53 A;  4C75 A;  2OV5 A;  3Q81 A;  1JWP A;  5HFO A;  1J9M A;  3G30 A;  5F82 A;  3SH8 A;  3FKW A;  2ZM0 A;  3JYI A;  3WS1 A;  4PMA A;  3WS4 A;  2XR0 A;  3AGE A;  1NJ4 A;  3IQA A;  4KZ3 A;  1ZG4 A;  5FI7 A;  2HDR A;  2HDU A;  4K91 A;  4LCM A;  4QU3 A;  5F1F A;  3DWK A;  4UA9 A;  1FSW A;  4RA7 A;  4E3L A;  3ITA A;  5AQ7 A;  1XA7 A;  1PIO A;  4N9L A;  4X55 A;  3MZF A;  3GMW A;  4QJG A;  5FAT A;  1MWT A;  4KZ5 A;  4UA7 A;  5D3O A;  2H0T A;  3PTE A;  4OP5 A;  5IHV A;  4IED A;  1FR6 A;  3OPP A;  1OME A;  1BLP A;  4DE3 A;  2R9W A;  3IH9 A;  3N8S A;  3IH8 A;  3NI9 A;  4HES A;  4WZ4 A;  1E25 A;  3LEZ A;  4K0W A;  4MEZ A;  2ZD8 A;  4N9K A;  4N1H A;  3ZNY A;  1MXO A;  2ZQ9 A;  5M1A A;  3G4P A;  4WEJ A;  4EWF A;  2P74 A;  2Y2J A;  3NBL A;  5GLA A;  2DRW A;  3UY6 A;  3C7U A;  3HLW A;  5FQQ A;  1XA1 A;  1KE4 A;  3OPH A;  4R3J A;  1ONG A;  3UNW A;  2Y2M A;  5G18 A;  5KSC A;  4X6T A;  3GRJ A;  5I94 A;  1K54 C;  5HAI A;  3VP4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...