2PR5A

Structural basis for light-dependent signaling in the dimeric lov photosensor ytva (dark structure)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
127
structure length
127
Chain Sequence
DHVRVGVVITDPALEDNPIVYVNQGFVQMTGYETEEILGKNCRFLQGKHTDPAEVDNIRTALQNKEPVTVQIQNYKKDGTMFWNELNIDPMEIEDKTYFVGIQNDITKQKEYEKLLEDSLTEITALS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Flavoprotein, signaling protein
molecule keywords Blue-light photoreceptor
publication title Structural Basis for Light-dependent Signaling in the Dimeric LOV Domain of the Photosensor YtvA.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 45
structure length 127
sequence length 127
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2pr5A00
1P0ZA 4JGQA 2B02A 2ZBBA 1V9YA 4EW7A 2M1CA 4HJ6A 5TBMB 4I3AA 3F1OA 2L0WA 4I3JA 1MZUA 2PD7A 3MQOA 4KUOA 1N9NA 3EWKA 4DJ2A 3E4QA 2A24B 1XJ4A 2Z6DA 4HHDA 2YKFA 4LRXC 2OOLA 5HZHA 3MFXA 1XFQA 1Y28A 1WA9A 4GHIA 2GJ3A 4LRYC 3UB8A 5HSQA 4WLAA 3FC7A 4R70A 2H28A 4R3AA 3MR0A 5HWVA 1GSVA 3H9WA 1OJGA 2QWSA 2CMNA 3IS2A 1JNUA 2D02A 3C8CA 3LIAA 2QKPA 1OT9A 1OTBA 1TS6A 3A0VA 3E4OA 4DJ3A 4K08A 2OWHA 3NJAA 2ZOHA 2VV6A 4B9OA 4JGRA 4GS9B 1G28A 3FG8A 3NOPC 4PKYG 2D01A 2J80A 3A0RA 3RTYA 4BBVA 4EQ1A 2WKQA 4L9EA 5J7EA 3F1PA 1X0OA 2V9AA 5HWWA 1S67L 4HP9A 1LL8A 4LLOB 1S4RA 3PYPA 5F69A 2V1AA 1LT0A 4LPZA 4LRZE 4NXEA 1TS7A 1S1ZA 1OTIA 4I5SA 4EXOA 2VV7A 3MQQA 2QHKA 3H7WA 3LI8A 1UWNX 1GSWA 4GW9A 1F98A 4KUKA 2R78A 2WKRA 1KOUA 4L9GA 3MJQA 5I5LA 4XT2A 5J3WA 1LSXA 5KIZA 4WUJA 3BY9A 4H6JB 2VLGA 2V0UA 3LYXA 3BY8A 3HJKA 5HDCA 1VB6A 3MXQA 4EESA 1D06A 5HD5A 5F68A 2PYRA 2V0WA 3H82B 3PHYA 3VOLA 1DP6A 5DJTA 1N9OA 3EEHA 3UB9A 5TBMA 3F1NB 4EEPA 4EERA 2EA9A 4WN5A 2PHYA 3OLOA 5IS1A 3NOTC 3T50A 4M4XA 2KX6A 1P97A 3LIFA 5EFWA 4YWZA 3P7NA 4F3LB 2A24A 2ZOIA 1XJ2A 4NXBA 4HOIA 5HDSA 1LSVA 3UMEA 3GDIA 1OTDA 3GECA 3F1OB 1T1BA 2Z6CA 1D7EA 2PDRA 2QJ5A 4HIAA 4KQDA 4HY8A 2I9VA 2P7JA 1T1CA 5HDDA 4JGPA 2JHEA 4WL9A 4RQ9A 3UE6A 4NXFA 4I39A 3ULFA 4GHIB 2BASA 2VEAA 1TS8A 3LIEA 3LIBA 4HH3A 1S4SA 3B33A 1LSWA 5HD3A 1OTEA 1N9LA 1EW0A 1TS0A 5DJUA 4GS9A 4E04A 3D72A 1XJ6A 2JN7A 4EEUA 1XJ3A 2PD8A 3IS2B 3LUQA 2WKPA 3CLOA 1UGUA 5J4EA 1DP9A 2INWA 4MN5A 4HJ4A 1T19A 3E4PA 5G4YA 2L1MA 4GCZA 2L4RA 5F5YA 3CAXA 1OTAA 3LIDA 2KDKA 1OT6A 4PKYA 2VV8A 2YKHA 4EETB 1DRMA 5F6AA 4I3IA 5HWTA 4HP4A 1F9IA 2W0NA 2PYPA 5AVFA 2V1BA 1XFNA 4HQAA 1V9ZA 1BYWA 4HH2A 3F1PB 3SW1A 3ICYA 5DKKA 3KX0X 1T1AA 3LI9A 4BBUA 3CWFA 3G6OA 4WF0A 1NWZA 2W27A 3RH8B 1UWPX 5AVEA 5A8BA 4I38A 4HI4A 3UB6A 4L9FA 3H7WB 4NXGA 3VE4A 4H6JA 3UB7A 4HJ3A 3HJIA 2QJ7A 3VE3A 2OWJA 2K7SA 1DP8A 1OJ5A 4R38A 1GSXA 4XT2B 3C2WA 3H82A 3K3DA 2PR5A 2HV1A 3K3CA 4R6LA 3F1NA 3UMDA 1T18A 4MN6A 2PR6A 3A0SA 3IBRA 1S66L 3BWLA 3NHQA 5DKLA 3LICA 4F3LA 3ZQ5A 4HNBA 1ODVA 1S1YA 4BBTA 5IU1A 5G4ZA 3NOUC 4JGOA
chains in the Genus database with same CATH superfamily
1P0ZA 3KSHA 3E98A 5CHUA 5HAPA 4EW7A 4S2PA 5TBMB 4I3AA 3F1OA 4NEED 3JPUA 3DTMA 1YMXA 1ZG6A 2B5RA 3ZDJA 3QHYA 5F1FA 5JYPA 1ESUA 2OOLA 5HZHA 3MFXA 1Y28A 4GHIA 5L07A 3QNBA 3UB8A 5FA7A 4E3IA 5HSQA 2WAFA 3GSGA 4Z9QA 1CI8A 4WLAA 2O0YA 2ZC3B 4JBFA 1XP4A 4DE2A 5CTNA 4R70A 3OZHA 4R3AA 4YINA 3QP4A 4ZJ1A 4IUHA 5HWVA 4PM5A 1U60A 4Y13A 2JKFA 3IF6C 4QPRA 2CMNA 3ZYTA 5EE8A 5EVIC 3HLFA 3U2AA 3MXRA 1SDEA 4X1MA 2AVXA 1OT9A 1OMEA 3A0VA 2EX9A 4GDNA 2HGVA 1K57A 1VHMA 2VV6A 3HLCA 4MEZA 5M1AA 4JGRA 1G28A 4IBRA 3NOPC 2D01A 5FAOA 1YPRA 2J80A 2E8JA 1LHYA 2W3EA 4RX2A 4E3KA 1KE0A 3HREA 4OP5A 3CG5A 3F1PA 5IHVA 2V1ZA 1WYBA 4U0XA 1KDSA 1S67L 3G32A 5FQQA 1D1JA 1FSWA 1ZKJA 3FPWA 1NJ4A 4ME4A 5M18A 2V1AA 4LPZA 4PPRA 4LRZE 3IX4A 1YLWA 3V67A 2Q9MA 1CF0A 3HBRA 4EXOA 1MPLA 4O0PA 3H7WA 1MXOA 1RGZA 2W3FA 4O01A 4KZBA 3NC8A 5BOHA 1F98A 1F2KA 2Y2QA 2R78A 2Y4AA 4E3NA 4R4RA 4KZ7A 3BFEA 1BULA 2WKHA 4Y2FA 2ACGA 5FQJA 4O8GA 2OLVA 3OPLA 4CLCA 3KSFA 5TGFA 5KIZA 3DTIA 4A5RA 1O07A 2ZL1A 2V0UA 2IA2A 3BM6A 3PBTA 4JF5A 3V39A 5HDCA 2WK0A 2J3TC 3LR4A 3NBLA 5F68A 2IWCA 1K6SA 3A3IA 3M2KA 2PYRA 4DDSA 5DF7A 2WGIA 3LCEA 3PHYA 4JXGA 3VOLA 1N9OA 3EEHA 4R3JA 4KG2A 4X53A 5TBMA 1K25A 1K6RA 4OH0A 3WRTA 3IHBA 2EA9A 4WN5A 3OLOA 4Y5FA 1FILA 4M4XA 5EFWA 4R1GA 4AFIA 1AWIA 4WELA 1LSVA 1L0FA 4BJPA 2ZC6B 5E43A 2O9CA 4DE3A 5GHZA 1H0MA 4X68A 2VGJA 1PYYA 2A3UA 4U3TA 3UE0A 1OTDA 5FATA 1FCMA 3GECA 3LR0A 4OLGA 4KZ8A 3DWZA 2Y55A 4DXCA 3TSGA 3VP3A 3CI6A 3MSHA 5HL1A 4B93A 1JTDA 3ITAA 2P7JA 1T1CA 4JGPA 2B95A 1SKFA 4OPRA 4WL9A 3N6IA 1HLUP 3D4FA 1NY0A 4OPZA 2VEAA 3WS0A 4LV3A 2HDSA 3LIBA 3IQAA 4KQOA 1LSWA 5HD3A 5HW3A 1Z6FA 4BL2A 1J3WA 1TS0A 3IWIA 1RCJA 4S2MA 1XJ6A 4MLLA 2XF3A 2FFYA 5AQ7A 3IF5A 3LUQA 2V2FF 2WKPA 1W63Q 5CECA 4MN5A 1K54C 3S22A 3IXHA 4N92A 4HJ4A 2EX6A 2Z2MB 1JWZA 2H0TA 5F5YA 3NDGA 4HBTA 2ZC7A 3LIDA 2KDKA 1LL9A 1F9IA 3UDXA 4DE1A 4PAUA 5G18A 2Y2NA 1XFNA 3LFVA 3C4OA 2C6WB 5FL3A 3BLMA 4DF6A 3GTCA 3KX0X 4ZDXA 4G3VA 3LI9A 3NDEA 4FD8A 3G6OA 1UWPX 1NYMA 5HAQA 5A8BA 4DN0A 2EXAA 1IELA 3UB6A 2JKRI 3QP5A 3UB7A 2EXBA 4JF6A 3VE3A 2OWJA 4RVAA 4Q0IA 1Y4OA 3C4PA 2P04A 1OJ5A 1LL5A 2EWVA 4YNRA 4R38A 4BD0A 3SH7A 3IX8A 3FKVA 3K3DA 2QPNA 3BFFA 4P0MA 2W1TB 3B3XA 4K0WA 1VEUB 1DY6A 3S4XA 3NHQA 4OQ0A 3SS5A 5DKLA 1SHVA 3HLGA 3VP2A 3ZQ5A 4HNBA 4UQIS 2XSSA 1TD5A 1ODVA 3M6BA 1K4FA 3NOUC 4IVKA 3GR2A 3MKFA 2PAVP 2BLSA 4JGQA 4DMZA 2OSUA 2B02A 3RFBA 1V9YA 2EFXA 4HJ6A 1P9RA 2L0WA 4I3JA 2DRWA 3Q82A 2WZXA 2XDMA 4LV2A 5E2GA 2PD7A 3E4QA 3O3VA 3AGEA 2VA0A 1XJ4A 1BUEA 3O88A 3CZDA 1K55C 2H5SA 3UB5P 3ZG5A 1VM1A 5K5BA 4U0TA 4LRYC 3M6HA 2H28A 1YLTA 5CX7A 3FPVA 5E2EA 4E3LA 2J3WA 1H8MA 1EWZA 3MR0A 1GSVA 3W4QA 3PBRA 4EBLA 4WEKA 1MKMA 5CHMA 3DBAA 3T4QA 2PT7A 4ZRRA 2J3TD 3IHAA 2OV5A 4EBPA 5EPHA 4DJ3A 5DTKA 5MC7A 2EX8A 2Q9NA 4B9OA 2WADA 2LB9A 2ZLYA 1IEMA 4PKYG 4IHQA 4MCWA 4S2NC 4GD8A 1A0KA 2GX5A 4FCFA 2QYBA 2P74A 5KMWA 5J7EA 3A3FA 1K56A 5HWWA 3KSIA 4OLDA 5FQMA 2O99A 2V8CA 4HP9A 4CLCC 1LT0A 4NXEA 1S1ZA 1WYCA 2WGVA 2X02A 4E6WA 1OTIA 1P9WA 2IWDA 3WS5A 4WMCA 3S7NA 3P98A 3MZDA 3LI8A 1W7FA 1GSWA 2OAQ1 3UDFA 1E3UA 3OCNA 4GW9A 1DJBA 3IWOA 4KZ4A 1FQGA 3BRMA 5I94A 2K2NA 3BQ8A 4L9GA 2DMWA 3MJQA 3HLEA 3P01A 3V50A 4LENA 4UEYA 2ZQ7A 4NG2A 1FR6A 2W1TA 3L7HA 4WUJA 1VQQA 2ZQ8A 3BY9A 2Y2KA 1VEUA 2VGLS 2VLGA 2ZJ9A 3UE3A 4N9LA 3HJKA 3MXQA 2ZC5B 1TF1A 2ZQDA 4HBUA 1D06A 5HD5A 4FOFA 2P08A 3R7WB 2XR0A 5AQBA 1ERQA 1DJCA 5FDSA 5TJJA 4E3OA 5EECA 4WYYA 5DFYA 3F1NB 2V8FA 4Y15A 3T50A 4GB7A 3JYIA 4NK3A 1PFLA 4M3KA 2ZD8A 1I5QA 2ZOIA 3KYEA 4NXBA 5FAPA 4PM8A 1K56D 1PZOA 2C5WB 5TR7A 3HUOA 3T4SA 3UMEA 3V3RA 3QP6A 4KQRA 3CUEC 4OOYA 4JXSA 5IT5A 5JYOA 2I72A 4WMCD 3MKEA 5TFQA 2Y2IA 3N8RA 4ETXA 5EM1A 3BW6A 2I9VA 1ES5A 5HDDA 2JHEA 1E3UD 4CJNA 2Y8HA 3SH8A 1HVBA 1J9MA 1PZPA 4HESA 4WZ5A 5AQAA 1PWGA 4OQGA 5CHJA 2HZ5A 1HD8A 1I2SA 1OTEA 1N9LA 4ZBEA 2ZMVA 1EW0A 3IH8A 2PRFA 4N1XA 3SH9A 4FH2A 3D72A 1NRFA 2JN7A 3NY4A 4ZJ2A 2A49A 3CLOA 3ITBA 1UGUA 1DP9A 3VFHA 1TDGA 2L4RA 1KGFA 4ESPA 1OTAA 3MZFA 1OT6A 4FSFA 4EETB 3IXGA 2W0NA 2PYPA 2FZ0A 2Y2HA 1STZA 5A93A 3V3SA 2V1BA 3HUNA 5EUAA 4E3MA 4Y17A 4LV1A 1CK3A 1W8QA 2ZQ9A 1TVFA 3MFDA 5EOOA 3PTEA 4BBUA 3SZTA 4EUZA 1LLBA 4JXWA 3RH8B 1E4DA 2EX2A 4BENA 4FTXA 5FSRA 3C7VA 2HJ9C 1BT5A 1G6OA 2OLUA 4NXGA 3ZCZA 1NZUA 1IKGA 5F1GA 4LCMA 4HJ3A 3CJMA 4R0QA 3TG9A 1DP8A 2VX8A 1L0GA 3PAGA 3R7WA 1GSXA 4XT2B 3WWXA 1EI5A 1WE4A 2PR5A 3VSKA 3F1NA 4PHTA 1T18A 1YLPA 3TOIA 4MN6A 1IYPA 5DFXA 4UA6A 3E2KA 3A0SA 3HCYA 4RYEA 1YM1A 2Z2LB 4O7DA 3FWLA 1S66L 4X6TA 1QMFA 2EFUA 3B42A 1AXBA 3GQZA 4N9KA 5G4ZA 4OP8A 3WS1A 2ZQAA 2ZC4B 1BLSA 4ARZB 2J9PA 1NLYA 4JGOA 3IX3A 3OC2A 2ZBBA 3G4PA 5CGXA 1JVJA 5FI2A 4K91A 3EGXC 1MZUA 3MMHA 3VP0A 1Q2PA 4B4XA 3MQOA 4KUOA 4S2LA 4K0XA 2PU2A 5EVLA 2Z6DA 1TEMA 4HHDA 1YAXA 3LEQA 2YKFA 2JE5A 1FCNA 1PNEA 2HP9A 3T12B 1WA9A 2J9OA 1SCWA 2BG1A 3T4LA 4QWOA 3RXWA 4Y0TA 1F5MA 2DNSA 2Y59A 3MBZA 3IBJA 2RCXA 3FC7A 1M6KA 3NIAA 1NXYA 3BFGA 2UWXA 1IOUA 1ESIA 3ZHHA 3NI9A 3H9WA 1OJGA 3FV7A 4EWFA 1ZG4A 3VOZA 5GLDA 3WS2A 5L10A 1JNUA 3NULA 2D02A 3C8CA 4F94A 2QKPA 1S0WA 1BLPA 5CEBA 1OTBA 1TS6A 3IXBA 3T4KA 2HDQA 3W4PA 3BLSA 3S7OA 4K08A 5HPFA 2OWHA 3NJAA 2ZOHA 4XXRA 3OOVA 4GS9B 1NRJA 3FG8A 1JWPA 3HLDA 4Y0UA 2XFSA 5EVID 4GNUA 1XA1A 3A0RA 3KYQA 3RTYA 1PW8A 5FDHA 4EU0A 4Q8IA 3M2JA 5FEGA 4EUVA 2OAP1 4DE0A 4JXVA 4LLOB 1HZOA 1YKDA 3KO6A 4B88A 1DJAA 4B4ZA 3IWQA 3VOYA 4I5SA 1PI5A 3ZFZA 2VV7A 4X1LA 3AGDA 4P6ZS 3MQQA 1CI9A 1UWNX 1GHPA 1FIKA 4KUKA 1Q2QA 3N7WA 2VZWA 4UAAA 2UV0E 5GLCA 3N8SA 4G3WA 3UN7A 3VV4A 4KZ9A 3S7QA 5I5LA 4XT2A 4R3BA 4XUZA 3LY4A 2G2WA 2H10A 2HP6A 1LSXA 2XRNA 5HX9A 5FQ9A 4PM9A 4Q0HA 2ZM8A 3DAVA 3MF0A 2B18A 4Z1WA 4H6JB 4UA9A 5GHYA 3VMAA 3BY8A 1K57C 3BEBA 4HEFA 3KSGA 1VB6A 3HLBA 2VK3A 2XA7S 3TW8A 5FASA 1NLZA 2XLNA 5HARA 1XGJA 3LGOA 1O7EA 4ARZA 4E6XA 1CEGA 4YFMA 2V0WA 2Y2GA 3T1QB 5DJTA 3MS6A 3QP1A 4EEPA 3EEAA 4EERA 2XH9A 3E2LA 3QP8A 3NOTC 1JTGA 3PBNA 5IS1A 2R9WA 2WAEA 3ZVTA 3G2YA 3Q07A 4BQMA 4GJ4A 1OPXA 3L9KA 3FZCA 3LIFA 4YWZA 3ZGAB 3OPRA 2FFFB 4JLFA 4HOIA 4UQIM 4CQHA 4OQHA 5HDSA 1L0DA 4MBHA 4KZAA 1QMEA 4WZ5C 2XD5A 1W79A 4IJGA 3T1RA 1MKIA 1XA7A 1PRQA 3A3JA 3ZG0A 1LI9A 4BD1A 2ZM0A 1GA0A 4S2JA 2Z6CA 3SS3A 1L0EA 4Y0OA 2PDRA 5L2FA 4HIAA 4KQDA 4BMWA 1YT4A 3UPNA 3PBQA 4HY8A 4LCLA 3BECA 4X69A 3LY3A 4RQ9A 1PW1A 4YOFA 3UE6A 4NXFA 4GLQA 4I39A 3ULFA 3VSLA 4KZ6A 3Q81A 2Y2OA 5DVAA 3T4TA 3DWKA 2GDNA 3LIEA 1W8YA 1ONGA 4HH3A 4MMNA 5CTMA 5E2FA 1S4SA 4EV4A 2ZQCA 2JBFA 1H8YA 4OOLA 2J8YA 4S2OA 2WKIA 3D9YA 5HAIA 4BL3A 4MBKA 5LBRA 4GS9A 5KZHA 1FOFA 2M7VA 4EEUA 5CERA 4DRTA 2PD8A 3IS2B 3FKWA 1BSGA 1N9BA 2IWBA 1RGYA 4DKIA 1XXMA 2PU4A 3E4PA 3SS4A 5G4YA 4QY6A 2L1MA 3HVFA 3CAXA 4KZ3A 3DTKA 2W3HA 2XGNA 1SKOB 2R9XA 3BFDA 4DXBA 3G35A 1MWSA 4D2OA 1DRMA 5F6AA 3O87A 4I3IA 5HWTA 5GHXA 1MY8A 4S2IA 5FI7A 2BTFP 4OOMA 3G30A 3GMWA 3IF6B 3ICYA 2Q0OA 3U4LP 2DCFA 1ZTUA 3MZEA 5EVIB 4UA7A 5CRFA 3B47A 2ZMAA 3CWFA 3SOIA 1L2SA 5F83A 3W4OA 2O9BA 4JKTA 3FYZA 2W27A 2QMIA 1HTZA 3IXDA 5A92A 2XQZA 2JKTI 5D3OA 1E25A 4I38A 4MNRA 1MWRA 4HI4A 2G2UA 4MBFA 4ID4A 1K55A 4L9FA 5C5KA 3VP1A 3N4IA 5FAQA 3VE4A 4H6JA 4Q0JA 3Q7VB 4GDBA 3EOIA 4FH4A 1IFQA 2QJ7A 2K7SA 4WBGA 3ZG7B 4C6YA 3C2WA 1Y54A 1NZOA 1XX2A 3K3CA 5EV0A 3UMDA 2PR6A 3BJNA 5HFOA 2VGKA 3IBRA 2VGLM 2Y2LA 5DTTA 5U47A 3LO7A 3O86A 2XD1A 4CLCE 1CJFA 1H3QA 4ZTKA 1YSQA 5IU1A 3CITA 5KSCA 5FQKA 3GV9A 4GZBA 3BWLA 3EQVA 1KDWA 4S2NA 3BQAA 4XUXA 3S1YA 2M1CA 2Y2MA 1H8ZA 2EWWA 2P9VB 2HF6A 3D3OA 2JCHA 2PBDP 1N9NA 1G6AA 1K4EA 3EWKA 4DJ2A 4LFUA 3CPTB 2HJEA 2A24B 4GD6A 1VETB 4PM6A 4QHCA 4LRXC 1ZHHB 3K2NA 3PXPA 1XFQA 2JKRM 4OPQA 5J8XA 2GJ3A 2VKSA 3MQ0A 3QNCA 4JPMA 3BFCA 1TDLA 4OONA 4EQIA 3N8LA 1FR1A 2K31A 4KZ5A 5E2HA 1PIOA 1BLHA 5L09A 2O9AA 3G2ZA 3OPHA 3RXXA 3JVUA 3UPPA 3Q1FA 5EM0A 3WS4A 2QWSA 4N1HA 3IS2A 1MBLA 5EVEA 1KVLA 1KVMA 3LIAA 3G31A 3ZNYA 2NUPC 3V5MA 1YSPA 4E3JA 3E4OA 1SKOA 4QJGA 2GZAA 4OKPA 4GKUA 3S7PA 3T1XA 1W5DA 2WGWB 4NETA 4BBVA 4EQ1A 2WKQA 4L9EA 1X0OA 3PBSA 1YLYA 2V9AA 3IF6A 1KGEA 1JWVA 3HUMA 4LV0A 2JKGA 1GCEA 4BWIA 4P6BA 5EVIA 3RJUA 4PMAA 4WEJA 5KSHA 1YLZA 5HPIA 1ALQA 1LL8A 1S4RA 1ES3A 3PYPA 5F69A 2W3GA 4ZAMA 1TS7A 2ZM2A 3C38A 3P09A 2X71A 1XPBA 1PWDA 4EBNA 2PBYA 2QHKA 1KE4A 2MJ6A 3Q7VA 1EROA 1ES4A 3HLWA 1M40A 2E8IA 1YMSA 4IUKA 3TE8A 3CUEA 4CLCD 2WKRA 1KOUA 1IYOA 2HP5A 2A2LA 5A91A 1MWUA 2FH5A 3C30A 1BZAA 1IYQA 4UHUA 4CPKA 5J3WA 1FCOA 3T4JA 4Y7PA 2KLIA 4X25A 3AGFA 1KE3A 3LYXA 5F82A 5M19A 2X01A 3T4OA 4EESA 1IKIA 4JF4A 3DW0A 5AJGA 3UE1A 3NECA 2QZ6A 1K38A 1I2WA 4X55A 5FEFA 4KG5A 3H82B 4OPYA 3UNWA 3PAEA 1DP6A 3UB9A 1BLCA 5A90A 3GVBA 1FSYA 2P9VA 1S6RA 2PHYA 3O5YA 2WUQA 3CPTA 2KX6A 1P97A 4IBXA 4KQQA 4L0LA 3P7NA 4F3LB 2A24A 1VETA 4D60A 1W63M 1XJ2A 1ACFA 5L8MA 4QY5A 2JC7A 5DF8A 3IH9A 5HL6A 3HL9A 4QU3A 1MWTA 3GDIA 3KYZA 4G3KA 3IT9A 3ZNTA 1N4OA 5GLAA 2WKEA 3F1OB 1T1BA 5CXWA 1D7EA 5CGSA 5CEDA 1ERMA 4OVDA 4RX3A 2QJ5A 3PBOA 4MDZA 4P87A 1PWCA 4C3QA 3ZG9B 3ISGA 1CQAA 3DTEA 1RP5A 4GHIB 4NKPA 1CEFA 2BASA 1YLJA 1TS8A 3VP4A 3R4KA 4R23A 5FI6A 3GRJA 3T1SA 3B33A 1ONHA 1GHMA 5DJUA 4MN7A 1MC0A 1PI4A 3MXSA 4FUWA 2XFTA 4E04A 2Y2PA 3C7UA 5CGWA 4QD4A 4ETZA 1XJ3A 2WGWA 3E0YA 3OBFA 2HDRA 1G5UA 4C75A 3ZG8B 4IVIA 3WRZA 1C3BA 2W3DA 5J4EA 4RA7A 2INWA 5DTSA 4ZJ3A 3OCLA 1XKZA 1T19A 1BTLA 3EGDC 3I7JA 3CMZA 4GCZA 2JKTM 2XROA 3UPOA 2XEPA 4H8RA 5AQ9A 4BLMA 4PKYA 2VV8A 2YKHA 3G34A 4II7A 4KENB 3W2ZA 3JVVA 4HP4A 2WZZA 5AVFA 1YQSA 4HQAA 5DF9A 1V9ZA 1BYWA 5GLBA 4HH2A 3F1PB 3SW1A 5DKKA 3BYDA 1IYSA 4PM7A 2W1RA 1T1AA 4GN2A 4WF0A 1NWZA 2J7VA 4DDYA 1K54A 3VFFA 5AVEA 3UY6A 2G7UA 1KGGA 1Z09A 2Y79A 2CC1A 3NCKA 3UDIA 3TRCA 4P85A 1XGIA 3H7WB 5FQIA 4P6ZM 4R4SA 3CHWP 4GOGA 1SZVA 2V20A 3HJIA 3W8KA 1LI0A 1ES2A 2VJWA 2ZMFA 4X56A 5EOEA 1G68A 4WZ4A 2NUTC 4Y3IA 2RL3A 4OQIA 2GNXA 3A3EA 3QP2A 3LR3A 2M7UA 3H82A 3UO9A 1GA9A 2XK1A 4LGWA 3TJZC 3A3DA 4CLCB 2HV1A 1K0KA 2KOIA 5GL9A 4R6LA 4IEDA 3ZVWA 1H5XA 1GHIA 2ZL1B 3C5AA 1SDNA 4WM9A 2Y91A 3EQUA 3Q7ZA 2LB5A 2Y2JA 3LEZA 3LICA 4F3LA 4KG6A 4QB8A 2HDUA 1S1YA 4BBTA 3LR5A 4S2KA 2WYXA 2XA7M 1NYYA 3OPPA 2H0YA 1L3LA 1ZC2A 2HPBA 3PR6A
chains in the Genus database with same CATH topology
1P0ZA 4JGQA 3EQVA 4DMZA 2B02A 3E98A 3KSHA 2ZBBA 1V9YA 3OC2A 3RFBA 4EW7A 3BQAA 2M1CA 4HJ6A 5TBMB 1P9RA 4I3AA 3EGXC 3F1OA 2L0WA 4I3JA 1MZUA 2EWWA 3MMHA 4NEED 2HF6A 2PD7A 3D3OA 3MQOA 4KUOA 1N9NA 3EWKA 4DJ2A 3E4QA 2HJEA 2VA0A 2A24B 1XJ4A 2Z6DA 4HHDA 1YAXA 2YKFA 4LRXC 2OOLA 1ZHHB 3K2NA 5HZHA 3MFXA 3PXPA 1XFQA 1Y28A 2JKRM 1WA9A 5K5BA 4GHIA 2GJ3A 2VKSA 4LRYC 3MQ0A 3T4LA 3UB8A 5HSQA 1F5MA 3IBJA 4WLAA 3FC7A 2O0YA 2K31A 4R70A 2H28A 5CX7A 4R3AA 3FPVA 2J3WA 1H8MA 3MR0A 4IUHA 5HWVA 2O9AA 1IOUA 1GSVA 3PBRA 4WEKA 3JVUA 1MKMA 3H9WA 1OJGA 2QWSA 2CMNA 3DBAA 4QPRA 3IS2A 3ZYTA 3T4QA 2PT7A 3U2AA 1JNUA 2D02A 3C8CA 3LIAA 2QKPA 4ZRRA 2J3TD 2NUPC 4JGOA 1OT9A 1OTBA 1YSPA 1TS6A 3T4KA 3A0VA 3E4OA 4DJ3A 5MC7A 3S7OA 2HGVA 4K08A 5HPFA 2OWHA 3NJAA 2ZOHA 1VHMA 2VV6A 2GZAA 4JGRA 4B9OA 2LB9A 3OOVA 4GS9B 1G28A 1NRJA 3FG8A 3S7PA 3NOPC 4PKYG 2D01A 4IHQA 2J80A 4MCWA 3A0RA 3KYQA 2GX5A 2W3EA 3RTYA 2QYBA 4BBVA 4EQ1A 4EU0A 2WKQA 4L9EA 5J7EA 3F1PA 1X0OA 3PBSA 2V9AA 5HWWA 3KSIA 1S67L 4BWIA 2O99A 4HP9A 4WEJA 4EUVA 5KSHA 5HPIA 2OAP1 3FPWA 1LL8A 4LLOB 1S4RA 3PYPA 5F69A 4ME4A 1YKDA 2W3GA 3KO6A 2V1AA 4CLCC 1LT0A 4LPZA 4LRZE 4NXEA 1TS7A 1S1ZA 3C38A 3V67A 1OTIA 1P9WA 4I5SA 4EXOA 2VV7A 4O0PA 3S7NA 4P6ZS 3MQQA 2QHKA 3H7WA 3LI8A 1UWNX 2W3FA 4O01A 2MJ6A 1GSWA 2OAQ1 3OCNA 4GW9A 1F98A 4KUKA 4IUKA 3TE8A 2VZWA 2R78A 3CUEA 4CLCD 2WKRA 2K2NA 1KOUA 4G3WA 2A2LA 4Y2FA 3BQ8A 3VV4A 3S7QA 2FH5A 4L9GA 3C30A 2DMWA 3MJQA 5I5LA 3P01A 4O8GA 4XT2A 4UEYA 5J3WA 1LSXA 3T4JA 4CLCA 2XRNA 3KSFA 5KIZA 2W1TA 2KLIA 4Q0HA 4WUJA 3BY9A 3MF0A 2B18A 4Z1WA 4H6JB 2VGLS 2V0UA 2VLGA 3LYXA 2IA2A 3BY8A 3UE3A 3PBTA 3HJKA 3KSGA 5HDCA 3T4OA 1VB6A 3MXQA 4EESA 1TF1A 2J3TC 5AJGA 2XA7S 3TW8A 1D06A 1NLZA 3LR4A 5HD5A 5F68A 4FOFA 2P08A 3R7WB 4ARZA 2PYRA 2V0WA 3H82B 3PHYA 1DP6A 3VOLA 5DJTA 1N9OA 3EEHA 5TJJA 3UB9A 5DFYA 5TBMA 3F1NB 4EEPA 3EEAA 4EERA 2EA9A 4WN5A 2PHYA 3O5YA 3OLOA 5IS1A 3NOTC 3PBNA 3T50A 4Y5FA 4M4XA 4GJ4A 1OPXA 2KX6A 1P97A 3LIFA 5EFWA 4L0LA 3P7NA 4YWZA 2A24A 4F3LB 2ZOIA 1W63M 1XJ2A 5L8MA 4NXBA 4CQHA 4HOIA 4UQIM 4AFIA 5HDSA 4WELA 5HL6A 1LSVA 3T4SA 4BJPA 3UMEA 3GDIA 4IJGA 2O9CA 3KYZA 4G3KA 3CUEC 1OTDA 3GECA 3LR0A 5IT5A 3F1OB 1T1BA 2Z6CA 1D7EA 2PDRA 2QJ5A 3PBOA 4HIAA 3CI6A 4KQDA 4BMWA 4MDZA 4B93A 4ETXA 3BW6A 3PBQA 4HY8A 2I9VA 2P7JA 1T1CA 5HDDA 4JGPA 2JHEA 4WL9A 4RQ9A 4YOFA 3UE6A 2Y8HA 4NXFA 4GLQA 4I39A 3ULFA 4GHIB 4NKPA 2BASA 2VEAA 1TS8A 3T4TA 3LIEA 3LIBA 3R4KA 4HH3A 4MMNA 4KQOA 1S4SA 3B33A 1LSWA 5HD3A 1OTEA 4OOLA 1N9LA 2ZMVA 1EW0A 1TS0A 5DJUA 4MN7A 1MC0A 5LBRA 4GS9A 4E04A 3D72A 1XJ6A 4ETZA 2M7VA 2JN7A 4EEUA 1XJ3A 3E0YA 2PD8A 3OBFA 3IS2B 3LUQA 2WKPA 1W63Q 2W3DA 3CLOA 1UGUA 5J4EA 1DP9A 2INWA 4MN5A 3OCLA 4HJ4A 1T19A 3E4PA 5G4YA 3EGDC 2L1MA 4GCZA 2L4RA 2JKTM 5F5YA 3CAXA 2XROA 2W3HA 1OTAA 3LIDA 2KDKA 1OT6A 4PKYA 2VV8A 2YKHA 4FSFA 4EETB 1DRMA 5F6AA 4I3IA 4II7A 5HWTA 3W2ZA 3JVVA 4HP4A 1F9IA 2W0NA 2PYPA 2FZ0A 4PAUA 1STZA 4OOMA 5AVFA 2V1BA 1XFNA 3LFVA 4HQAA 5DF9A 1V9ZA 1BYWA 4HH2A 3F1PB 5FL3A 3SW1A 3ICYA 5DKKA 3KX0X 1ZTUA 2W1RA 1T1AA 4G3VA 3LI9A 4BBUA 3B47A 3CWFA 3G6OA 4WF0A 1NWZA 2O9BA 2W27A 3RH8B 1UWPX 5AVEA 2G7UA 5A8BA 4DN0A 2JKTI 4I38A 2Y79A 4HI4A 3UB6A 3TRCA 4L9FA 5C5KA 2HJ9C 1G6OA 2JKRI 3H7WB 4NXGA 4P6ZM 3VE4A 4H6JA 3UB7A 4Q0JA 4HJ3A 3EOIA 1IFQA 3HJIA 2ZMFA 2VJWA 2QJ7A 3VE3A 2OWJA 2K7SA 1DP8A 4Q0IA 2VX8A 2NUTC 2P04A 1OJ5A 4Y3IA 2GNXA 2EWVA 4YNRA 4R38A 3R7WA 1GSXA 3LR3A 4XT2B 3C2WA 2M7UA 3H82A 3TJZC 3K3DA 4CLCB 2PR5A 2HV1A 3K3CA 2KOIA 4R6LA 3F1NA 4PHTA 3UMDA 1T18A 2W1TB 4MN6A 2PR6A 3BJNA 5DFXA 3A0SA 3HCYA 3IBRA 3EQUA 2VGLM 1S66L 2LB5A 3NHQA 5DKLA 3LICA 4F3LA 3ZQ5A 3B42A 4HNBA 4CLCE 4UQIS 2XSSA 1TD5A 1H3QA 1ODVA 1YSQA 1S1YA 4BBTA 3LR5A 5IU1A 2XA7M 3CITA 5G4ZA 3NOUC 4ARZB 3PR6A 1NLYA 3BWLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P0Z A;  4JGQ A;  2B02 A;  2ZBB A;  1V9Y A;  4EW7 A;  2M1C A;  4HJ6 A;  5TBM B;  4I3A A;  3F1O A;  2L0W A;  4I3J A;  1MZU A;  2PD7 A;  3MQO A;  4KUO A;  1N9N A;  3EWK A;  4DJ2 A;  3E4Q A;  2A24 B;  1XJ4 A;  2Z6D A;  4HHD A;  2YKF A;  4LRX C;  2OOL A;  5HZH A;  3MFX A;  1XFQ A;  1Y28 A;  1WA9 A;  4GHI A;  2GJ3 A;  4LRY C;  3UB8 A;  5HSQ A;  4WLA A;  3FC7 A;  4R70 A;  2H28 A;  4R3A A;  3MR0 A;  5HWV A;  1GSV A;  3H9W A;  1OJG A;  2QWS A;  2CMN A;  3IS2 A;  1JNU A;  2D02 A;  3C8C A;  3LIA A;  2QKP A;  1OT9 A;  1OTB A;  1TS6 A;  3A0V A;  3E4O A;  4DJ3 A;  4K08 A;  2OWH A;  3NJA A;  2ZOH A;  2VV6 A;  4B9O A;  4JGR A;  4GS9 B;  1G28 A;  3FG8 A;  3NOP C;  4PKY G;  2D01 A;  2J80 A;  3A0R A;  3RTY A;  4BBV A;  4EQ1 A;  2WKQ A;  4L9E A;  5J7E A;  3F1P A;  1X0O A;  2V9A A;  5HWW A;  1S67 L;  4HP9 A;  1LL8 A;  4LLO B;  1S4R A;  3PYP A;  5F69 A;  2V1A A;  1LT0 A;  4LPZ A;  4LRZ E;  4NXE A;  1TS7 A;  1S1Z A;  1OTI A;  4I5S A;  4EXO A;  2VV7 A;  3MQQ A;  2QHK A;  3H7W A;  3LI8 A;  1UWN X;  1GSW A;  4GW9 A;  1F98 A;  4KUK A;  2R78 A;  2WKR A;  1KOU A;  4L9G A;  3MJQ A;  5I5L A;  4XT2 A;  5J3W A;  1LSX A;  5KIZ A;  4WUJ A;  3BY9 A;  4H6J B;  2VLG A;  2V0U A;  3LYX A;  3BY8 A;  3HJK A;  5HDC A;  1VB6 A;  3MXQ A;  4EES A;  1D06 A;  5HD5 A;  5F68 A;  2PYR A;  2V0W A;  3H82 B;  3PHY A;  3VOL A;  1DP6 A;  5DJT A;  1N9O A;  3EEH A;  3UB9 A;  5TBM A;  3F1N B;  4EEP A;  4EER A;  2EA9 A;  4WN5 A;  2PHY A;  3OLO A;  5IS1 A;  3NOT C;  3T50 A;  4M4X A;  2KX6 A;  1P97 A;  3LIF A;  5EFW A;  4YWZ A;  3P7N A;  4F3L B;  2A24 A;  2ZOI A;  1XJ2 A;  4NXB A;  4HOI A;  5HDS A;  1LSV A;  3UME A;  3GDI A;  1OTD A;  3GEC A;  3F1O B;  1T1B A;  2Z6C A;  1D7E A;  2PDR A;  2QJ5 A;  4HIA A;  4KQD A;  4HY8 A;  2I9V A;  2P7J A;  1T1C A;  5HDD A;  4JGP A;  2JHE A;  4WL9 A;  4RQ9 A;  3UE6 A;  4NXF A;  4I39 A;  3ULF A;  4GHI B;  2BAS A;  2VEA A;  1TS8 A;  3LIE A;  3LIB A;  4HH3 A;  1S4S A;  3B33 A;  1LSW A;  5HD3 A;  1OTE A;  1N9L A;  1EW0 A;  1TS0 A;  5DJU A;  4GS9 A;  4E04 A;  3D72 A;  1XJ6 A;  2JN7 A;  4EEU A;  1XJ3 A;  2PD8 A;  3IS2 B;  3LUQ A;  2WKP A;  3CLO A;  1UGU A;  5J4E A;  1DP9 A;  2INW A;  4MN5 A;  4HJ4 A;  1T19 A;  3E4P A;  5G4Y A;  2L1M A;  4GCZ A;  2L4R A;  5F5Y A;  3CAX A;  1OTA A;  3LID A;  2KDK A;  1OT6 A;  4PKY A;  2VV8 A;  2YKH A;  4EET B;  1DRM A;  5F6A A;  4I3I A;  5HWT A;  4HP4 A;  1F9I A;  2W0N A;  2PYP A;  5AVF A;  2V1B A;  1XFN A;  4HQA A;  1V9Z A;  1BYW A;  4HH2 A;  3F1P B;  3SW1 A;  3ICY A;  5DKK A;  3KX0 X;  1T1A A;  3LI9 A;  4BBU A;  3CWF A;  3G6O A;  4WF0 A;  1NWZ A;  2W27 A;  3RH8 B;  1UWP X;  5AVE A;  5A8B A;  4I38 A;  4HI4 A;  3UB6 A;  4L9F A;  3H7W B;  4NXG A;  3VE4 A;  4H6J A;  3UB7 A;  4HJ3 A;  3HJI A;  2QJ7 A;  3VE3 A;  2OWJ A;  2K7S A;  1DP8 A;  1OJ5 A;  4R38 A;  1GSX A;  4XT2 B;  3C2W A;  3H82 A;  3K3D A;  2PR5 A;  2HV1 A;  3K3C A;  4R6L A;  3F1N A;  3UMD A;  1T18 A;  4MN6 A;  2PR6 A;  3A0S A;  3IBR A;  1S66 L;  3BWL A;  3NHQ A;  5DKL A;  3LIC A;  4F3L A;  3ZQ5 A;  4HNB A;  1ODV A;  1S1Y A;  4BBT A;  5IU1 A;  5G4Z A;  3NOU C;  4JGO A; 
#chains in the Genus database with same CATH topology
 1P0Z A;  3KSH A;  3E98 A;  5CHU A;  5HAP A;  4EW7 A;  4S2P A;  5TBM B;  4I3A A;  3F1O A;  4NEE D;  3JPU A;  3DTM A;  1YMX A;  1ZG6 A;  2B5R A;  3ZDJ A;  3QHY A;  5F1F A;  5JYP A;  1ESU A;  2OOL A;  5HZH A;  3MFX A;  1Y28 A;  4GHI A;  5L07 A;  3QNB A;  3UB8 A;  5FA7 A;  4E3I A;  5HSQ A;  2WAF A;  3GSG A;  4Z9Q A;  1CI8 A;  4WLA A;  2O0Y A;  2ZC3 B;  4JBF A;  1XP4 A;  4DE2 A;  5CTN A;  4R70 A;  3OZH A;  4R3A A;  4YIN A;  3QP4 A;  4ZJ1 A;  4IUH A;  5HWV A;  4PM5 A;  1U60 A;  4Y13 A;  2JKF A;  3IF6 C;  4QPR A;  2CMN A;  3ZYT A;  5EE8 A;  5EVI C;  3HLF A;  3U2A A;  3MXR A;  1SDE A;  4X1M A;  2AVX A;  1OT9 A;  1OME A;  3A0V A;  2EX9 A;  4GDN A;  2HGV A;  1K57 A;  1VHM A;  2VV6 A;  3HLC A;  4MEZ A;  5M1A A;  4JGR A;  1G28 A;  4IBR A;  3NOP C;  2D01 A;  5FAO A;  1YPR A;  2J80 A;  2E8J A;  1LHY A;  2W3E A;  4RX2 A;  4E3K A;  1KE0 A;  3HRE A;  4OP5 A;  3CG5 A;  3F1P A;  5IHV A;  2V1Z A;  1WYB A;  4U0X A;  1KDS A;  1S67 L;  3G32 A;  5FQQ A;  1D1J A;  1FSW A;  1ZKJ A;  3FPW A;  1NJ4 A;  4ME4 A;  5M18 A;  2V1A A;  4LPZ A;  4PPR A;  4LRZ E;  3IX4 A;  1YLW A;  3V67 A;  2Q9M A;  1CF0 A;  3HBR A;  4EXO A;  1MPL A;  4O0P A;  3H7W A;  1MXO A;  1RGZ A;  2W3F A;  4O01 A;  4KZB A;  3NC8 A;  5BOH A;  1F98 A;  1F2K A;  2Y2Q A;  2R78 A;  2Y4A A;  4E3N A;  4R4R A;  4KZ7 A;  3BFE A;  1BUL A;  2WKH A;  4Y2F A;  2ACG A;  5FQJ A;  4O8G A;  2OLV A;  3OPL A;  4CLC A;  3KSF A;  5TGF A;  5KIZ A;  3DTI A;  4A5R A;  1O07 A;  2ZL1 A;  2V0U A;  2IA2 A;  3BM6 A;  3PBT A;  4JF5 A;  3V39 A;  5HDC A;  2WK0 A;  2J3T C;  3LR4 A;  3NBL A;  5F68 A;  2IWC A;  1K6S A;  3A3I A;  3M2K A;  2PYR A;  4DDS A;  5DF7 A;  2WGI A;  3LCE A;  3PHY A;  4JXG A;  3VOL A;  1N9O A;  3EEH A;  4R3J A;  4KG2 A;  4X53 A;  5TBM A;  1K25 A;  1K6R A;  4OH0 A;  3WRT A;  3IHB A;  2EA9 A;  4WN5 A;  3OLO A;  4Y5F A;  1FIL A;  4M4X A;  5EFW A;  4R1G A;  4AFI A;  1AWI A;  4WEL A;  1LSV A;  1L0F A;  4BJP A;  2ZC6 B;  5E43 A;  2O9C A;  4DE3 A;  5GHZ A;  1H0M A;  4X68 A;  2VGJ A;  1PYY A;  2A3U A;  4U3T A;  3UE0 A;  1OTD A;  5FAT A;  1FCM A;  3GEC A;  3LR0 A;  4OLG A;  4KZ8 A;  3DWZ A;  2Y55 A;  4DXC A;  3TSG A;  3VP3 A;  3CI6 A;  3MSH A;  5HL1 A;  4B93 A;  1JTD A;  3ITA A;  2P7J A;  1T1C A;  4JGP A;  2B95 A;  1SKF A;  4OPR A;  4WL9 A;  3N6I A;  1HLU P;  3D4F A;  1NY0 A;  4OPZ A;  2VEA A;  3WS0 A;  4LV3 A;  2HDS A;  3LIB A;  3IQA A;  4KQO A;  1LSW A;  5HD3 A;  5HW3 A;  1Z6F A;  4BL2 A;  1J3W A;  1TS0 A;  3IWI A;  1RCJ A;  4S2M A;  1XJ6 A;  4MLL A;  2XF3 A;  2FFY A;  5AQ7 A;  3IF5 A;  3LUQ A;  2V2F F;  2WKP A;  1W63 Q;  5CEC A;  4MN5 A;  1K54 C;  3S22 A;  3IXH A;  4N92 A;  4HJ4 A;  2EX6 A;  2Z2M B;  1JWZ A;  2H0T A;  5F5Y A;  3NDG A;  4HBT A;  2ZC7 A;  3LID A;  2KDK A;  1LL9 A;  1F9I A;  3UDX A;  4DE1 A;  4PAU A;  5G18 A;  2Y2N A;  1XFN A;  3LFV A;  3C4O A;  2C6W B;  5FL3 A;  3BLM A;  4DF6 A;  3GTC A;  3KX0 X;  4ZDX A;  4G3V A;  3LI9 A;  3NDE A;  4FD8 A;  3G6O A;  1UWP X;  1NYM A;  5HAQ A;  5A8B A;  4DN0 A;  2EXA A;  1IEL A;  3UB6 A;  2JKR I;  3QP5 A;  3UB7 A;  2EXB A;  4JF6 A;  3VE3 A;  2OWJ A;  4RVA A;  4Q0I A;  1Y4O A;  3C4P A;  2P04 A;  1OJ5 A;  1LL5 A;  2EWV A;  4YNR A;  4R38 A;  4BD0 A;  3SH7 A;  3IX8 A;  3FKV A;  3K3D A;  2QPN A;  3BFF A;  4P0M A;  2W1T B;  3B3X A;  4K0W A;  1VEU B;  1DY6 A;  3S4X A;  3NHQ A;  4OQ0 A;  3SS5 A;  5DKL A;  1SHV A;  3HLG A;  3VP2 A;  3ZQ5 A;  4HNB A;  4UQI S;  2XSS A;  1TD5 A;  1ODV A;  3M6B A;  1K4F A;  3NOU C;  4IVK A;  3GR2 A;  3MKF A;  2PAV P;  2BLS A;  4JGQ A;  4DMZ A;  2OSU A;  2B02 A;  3RFB A;  1V9Y A;  2EFX A;  4HJ6 A;  1P9R A;  2L0W A;  4I3J A;  2DRW A;  3Q82 A;  2WZX A;  2XDM A;  4LV2 A;  5E2G A;  2PD7 A;  3E4Q A;  3O3V A;  3AGE A;  2VA0 A;  1XJ4 A;  1BUE A;  3O88 A;  3CZD A;  1K55 C;  2H5S A;  3UB5 P;  3ZG5 A;  1VM1 A;  5K5B A;  4U0T A;  4LRY C;  3M6H A;  2H28 A;  1YLT A;  5CX7 A;  3FPV A;  5E2E A;  4E3L A;  2J3W A;  1H8M A;  1EWZ A;  3MR0 A;  1GSV A;  3W4Q A;  3PBR A;  4EBL A;  4WEK A;  1MKM A;  5CHM A;  3DBA A;  3T4Q A;  2PT7 A;  4ZRR A;  2J3T D;  3IHA A;  2OV5 A;  4EBP A;  5EPH A;  4DJ3 A;  5DTK A;  5MC7 A;  2EX8 A;  2Q9N A;  4B9O A;  2WAD A;  2LB9 A;  2ZLY A;  1IEM A;  4PKY G;  4IHQ A;  4MCW A;  4S2N C;  4GD8 A;  1A0K A;  2GX5 A;  4FCF A;  2QYB A;  2P74 A;  5KMW A;  5J7E A;  3A3F A;  1K56 A;  5HWW A;  3KSI A;  4OLD A;  5FQM A;  2O99 A;  2V8C A;  4HP9 A;  4CLC C;  1LT0 A;  4NXE A;  1S1Z A;  1WYC A;  2WGV A;  2X02 A;  4E6W A;  1OTI A;  1P9W A;  2IWD A;  3WS5 A;  4WMC A;  3S7N A;  3P98 A;  3MZD A;  3LI8 A;  1W7F A;  1GSW A;  2OAQ 1;  3UDF A;  1E3U A;  3OCN A;  4GW9 A;  1DJB A;  3IWO A;  4KZ4 A;  1FQG A;  3BRM A;  5I94 A;  2K2N A;  3BQ8 A;  4L9G A;  2DMW A;  3MJQ A;  3HLE A;  3P01 A;  3V50 A;  4LEN A;  4UEY A;  2ZQ7 A;  4NG2 A;  1FR6 A;  2W1T A;  3L7H A;  4WUJ A;  1VQQ A;  2ZQ8 A;  3BY9 A;  2Y2K A;  1VEU A;  2VGL S;  2VLG A;  2ZJ9 A;  3UE3 A;  4N9L A;  3HJK A;  3MXQ A;  2ZC5 B;  1TF1 A;  2ZQD A;  4HBU A;  1D06 A;  5HD5 A;  4FOF A;  2P08 A;  3R7W B;  2XR0 A;  5AQB A;  1ERQ A;  1DJC A;  5FDS A;  5TJJ A;  4E3O A;  5EEC A;  4WYY A;  5DFY A;  3F1N B;  2V8F A;  4Y15 A;  3T50 A;  4GB7 A;  3JYI A;  4NK3 A;  1PFL A;  4M3K A;  2ZD8 A;  1I5Q A;  2ZOI A;  3KYE A;  4NXB A;  5FAP A;  4PM8 A;  1K56 D;  1PZO A;  2C5W B;  5TR7 A;  3HUO A;  3T4S A;  3UME A;  3V3R A;  3QP6 A;  4KQR A;  3CUE C;  4OOY A;  4JXS A;  5IT5 A;  5JYO A;  2I72 A;  4WMC D;  3MKE A;  5TFQ A;  2Y2I A;  3N8R A;  4ETX A;  5EM1 A;  3BW6 A;  2I9V A;  1ES5 A;  5HDD A;  2JHE A;  1E3U D;  4CJN A;  2Y8H A;  3SH8 A;  1HVB A;  1J9M A;  1PZP A;  4HES A;  4WZ5 A;  5AQA A;  1PWG A;  4OQG A;  5CHJ A;  2HZ5 A;  1HD8 A;  1I2S A;  1OTE A;  1N9L A;  4ZBE A;  2ZMV A;  1EW0 A;  3IH8 A;  2PRF A;  4N1X A;  3SH9 A;  4FH2 A;  3D72 A;  1NRF A;  2JN7 A;  3NY4 A;  4ZJ2 A;  2A49 A;  3CLO A;  3ITB A;  1UGU A;  1DP9 A;  3VFH A;  1TDG A;  2L4R A;  1KGF A;  4ESP A;  1OTA A;  3MZF A;  1OT6 A;  4FSF A;  4EET B;  3IXG A;  2W0N A;  2PYP A;  2FZ0 A;  2Y2H A;  1STZ A;  5A93 A;  3V3S A;  2V1B A;  3HUN A;  5EUA A;  4E3M A;  4Y17 A;  4LV1 A;  1CK3 A;  1W8Q A;  2ZQ9 A;  1TVF A;  3MFD A;  5EOO A;  3PTE A;  4BBU A;  3SZT A;  4EUZ A;  1LLB A;  4JXW A;  3RH8 B;  1E4D A;  2EX2 A;  4BEN A;  4FTX A;  5FSR A;  3C7V A;  2HJ9 C;  1BT5 A;  1G6O A;  2OLU A;  4NXG A;  3ZCZ A;  1NZU A;  1IKG A;  5F1G A;  4LCM A;  4HJ3 A;  3CJM A;  4R0Q A;  3TG9 A;  1DP8 A;  2VX8 A;  1L0G A;  3PAG A;  3R7W A;  1GSX A;  4XT2 B;  3WWX A;  1EI5 A;  1WE4 A;  2PR5 A;  3VSK A;  3F1N A;  4PHT A;  1T18 A;  1YLP A;  3TOI A;  4MN6 A;  1IYP A;  5DFX A;  4UA6 A;  3E2K A;  3A0S A;  3HCY A;  4RYE A;  1YM1 A;  2Z2L B;  4O7D A;  3FWL A;  1S66 L;  4X6T A;  1QMF A;  2EFU A;  3B42 A;  1AXB A;  3GQZ A;  4N9K A;  5G4Z A;  4OP8 A;  3WS1 A;  2ZQA A;  2ZC4 B;  1BLS A;  4ARZ B;  2J9P A;  1NLY A;  4JGO A;  3IX3 A;  3OC2 A;  2ZBB A;  3G4P A;  5CGX A;  1JVJ A;  5FI2 A;  4K91 A;  3EGX C;  1MZU A;  3MMH A;  3VP0 A;  1Q2P A;  4B4X A;  3MQO A;  4KUO A;  4S2L A;  4K0X A;  2PU2 A;  5EVL A;  2Z6D A;  1TEM A;  4HHD A;  1YAX A;  3LEQ A;  2YKF A;  2JE5 A;  1FCN A;  1PNE A;  2HP9 A;  3T12 B;  1WA9 A;  2J9O A;  1SCW A;  2BG1 A;  3T4L A;  4QWO A;  3RXW A;  4Y0T A;  1F5M A;  2DNS A;  2Y59 A;  3MBZ A;  3IBJ A;  2RCX A;  3FC7 A;  1M6K A;  3NIA A;  1NXY A;  3BFG A;  2UWX A;  1IOU A;  1ESI A;  3ZHH A;  3NI9 A;  3H9W A;  1OJG A;  3FV7 A;  4EWF A;  1ZG4 A;  3VOZ A;  5GLD A;  3WS2 A;  5L10 A;  1JNU A;  3NUL A;  2D02 A;  3C8C A;  4F94 A;  2QKP A;  1S0W A;  1BLP A;  5CEB A;  1OTB A;  1TS6 A;  3IXB A;  3T4K A;  2HDQ A;  3W4P A;  3BLS A;  3S7O A;  4K08 A;  5HPF A;  2OWH A;  3NJA A;  2ZOH A;  4XXR A;  3OOV A;  4GS9 B;  1NRJ A;  3FG8 A;  1JWP A;  3HLD A;  4Y0U A;  2XFS A;  5EVI D;  4GNU A;  1XA1 A;  3A0R A;  3KYQ A;  3RTY A;  1PW8 A;  5FDH A;  4EU0 A;  4Q8I A;  3M2J A;  5FEG A;  4EUV A;  2OAP 1;  4DE0 A;  4JXV A;  4LLO B;  1HZO A;  1YKD A;  3KO6 A;  4B88 A;  1DJA A;  4B4Z A;  3IWQ A;  3VOY A;  4I5S A;  1PI5 A;  3ZFZ A;  2VV7 A;  4X1L A;  3AGD A;  4P6Z S;  3MQQ A;  1CI9 A;  1UWN X;  1GHP A;  1FIK A;  4KUK A;  1Q2Q A;  3N7W A;  2VZW A;  4UAA A;  2UV0 E;  5GLC A;  3N8S A;  4G3W A;  3UN7 A;  3VV4 A;  4KZ9 A;  3S7Q A;  5I5L A;  4XT2 A;  4R3B A;  4XUZ A;  3LY4 A;  2G2W A;  2H10 A;  2HP6 A;  1LSX A;  2XRN A;  5HX9 A;  5FQ9 A;  4PM9 A;  4Q0H A;  2ZM8 A;  3DAV A;  3MF0 A;  2B18 A;  4Z1W A;  4H6J B;  4UA9 A;  5GHY A;  3VMA A;  3BY8 A;  1K57 C;  3BEB A;  4HEF A;  3KSG A;  1VB6 A;  3HLB A;  2VK3 A;  2XA7 S;  3TW8 A;  5FAS A;  1NLZ A;  2XLN A;  5HAR A;  1XGJ A;  3LGO A;  1O7E A;  4ARZ A;  4E6X A;  1CEG A;  4YFM A;  2V0W A;  2Y2G A;  3T1Q B;  5DJT A;  3MS6 A;  3QP1 A;  4EEP A;  3EEA A;  4EER A;  2XH9 A;  3E2L A;  3QP8 A;  3NOT C;  1JTG A;  3PBN A;  5IS1 A;  2R9W A;  2WAE A;  3ZVT A;  3G2Y A;  3Q07 A;  4BQM A;  4GJ4 A;  1OPX A;  3L9K A;  3FZC A;  3LIF A;  4YWZ A;  3ZGA B;  3OPR A;  2FFF B;  4JLF A;  4HOI A;  4UQI M;  4CQH A;  4OQH A;  5HDS A;  1L0D A;  4MBH A;  4KZA A;  1QME A;  4WZ5 C;  2XD5 A;  1W79 A;  4IJG A;  3T1R A;  1MKI A;  1XA7 A;  1PRQ A;  3A3J A;  3ZG0 A;  1LI9 A;  4BD1 A;  2ZM0 A;  1GA0 A;  4S2J A;  2Z6C A;  3SS3 A;  1L0E A;  4Y0O A;  2PDR A;  5L2F A;  4HIA A;  4KQD A;  4BMW A;  1YT4 A;  3UPN A;  3PBQ A;  4HY8 A;  4LCL A;  3BEC A;  4X69 A;  3LY3 A;  4RQ9 A;  1PW1 A;  4YOF A;  3UE6 A;  4NXF A;  4GLQ A;  4I39 A;  3ULF A;  3VSL A;  4KZ6 A;  3Q81 A;  2Y2O A;  5DVA A;  3T4T A;  3DWK A;  2GDN A;  3LIE A;  1W8Y A;  1ONG A;  4HH3 A;  4MMN A;  5CTM A;  5E2F A;  1S4S A;  4EV4 A;  2ZQC A;  2JBF A;  1H8Y A;  4OOL A;  2J8Y A;  4S2O A;  2WKI A;  3D9Y A;  5HAI A;  4BL3 A;  4MBK A;  5LBR A;  4GS9 A;  5KZH A;  1FOF A;  2M7V A;  4EEU A;  5CER A;  4DRT A;  2PD8 A;  3IS2 B;  3FKW A;  1BSG A;  1N9B A;  2IWB A;  1RGY A;  4DKI A;  1XXM A;  2PU4 A;  3E4P A;  3SS4 A;  5G4Y A;  4QY6 A;  2L1M A;  3HVF A;  3CAX A;  4KZ3 A;  3DTK A;  2W3H A;  2XGN A;  1SKO B;  2R9X A;  3BFD A;  4DXB A;  3G35 A;  1MWS A;  4D2O A;  1DRM A;  5F6A A;  3O87 A;  4I3I A;  5HWT A;  5GHX A;  1MY8 A;  4S2I A;  5FI7 A;  2BTF P;  4OOM A;  3G30 A;  3GMW A;  3IF6 B;  3ICY A;  2Q0O A;  3U4L P;  2DCF A;  1ZTU A;  3MZE A;  5EVI B;  4UA7 A;  5CRF A;  3B47 A;  2ZMA A;  3CWF A;  3SOI A;  1L2S A;  5F83 A;  3W4O A;  2O9B A;  4JKT A;  3FYZ A;  2W27 A;  2QMI A;  1HTZ A;  3IXD A;  5A92 A;  2XQZ A;  2JKT I;  5D3O A;  1E25 A;  4I38 A;  4MNR A;  1MWR A;  4HI4 A;  2G2U A;  4MBF A;  4ID4 A;  1K55 A;  4L9F A;  5C5K A;  3VP1 A;  3N4I A;  5FAQ A;  3VE4 A;  4H6J A;  4Q0J A;  3Q7V B;  4GDB A;  3EOI A;  4FH4 A;  1IFQ A;  2QJ7 A;  2K7S A;  4WBG A;  3ZG7 B;  4C6Y A;  3C2W A;  1Y54 A;  1NZO A;  1XX2 A;  3K3C A;  5EV0 A;  3UMD A;  2PR6 A;  3BJN A;  5HFO A;  2VGK A;  3IBR A;  2VGL M;  2Y2L A;  5DTT A;  5U47 A;  3LO7 A;  3O86 A;  2XD1 A;  4CLC E;  1CJF A;  1H3Q A;  4ZTK A;  1YSQ A;  5IU1 A;  3CIT A;  5KSC A;  5FQK A;  3GV9 A;  4GZB A;  3BWL A;  3EQV A;  1KDW A;  4S2N A;  3BQA A;  4XUX A;  3S1Y A;  2M1C A;  2Y2M A;  1H8Z A;  2EWW A;  2P9V B;  2HF6 A;  3D3O A;  2JCH A;  2PBD P;  1N9N A;  1G6A A;  1K4E A;  3EWK A;  4DJ2 A;  4LFU A;  3CPT B;  2HJE A;  2A24 B;  4GD6 A;  1VET B;  4PM6 A;  4QHC A;  4LRX C;  1ZHH B;  3K2N A;  3PXP A;  1XFQ A;  2JKR M;  4OPQ A;  5J8X A;  2GJ3 A;  2VKS A;  3MQ0 A;  3QNC A;  4JPM A;  3BFC A;  1TDL A;  4OON A;  4EQI A;  3N8L A;  1FR1 A;  2K31 A;  4KZ5 A;  5E2H A;  1PIO A;  1BLH A;  5L09 A;  2O9A A;  3G2Z A;  3OPH A;  3RXX A;  3JVU A;  3UPP A;  3Q1F A;  5EM0 A;  3WS4 A;  2QWS A;  4N1H A;  3IS2 A;  1MBL A;  5EVE A;  1KVL A;  1KVM A;  3LIA A;  3G31 A;  3ZNY A;  2NUP C;  3V5M A;  1YSP A;  4E3J A;  3E4O A;  1SKO A;  4QJG A;  2GZA A;  4OKP A;  4GKU A;  3S7P A;  3T1X A;  1W5D A;  2WGW B;  4NET A;  4BBV A;  4EQ1 A;  2WKQ A;  4L9E A;  1X0O A;  3PBS A;  1YLY A;  2V9A A;  3IF6 A;  1KGE A;  1JWV A;  3HUM A;  4LV0 A;  2JKG A;  1GCE A;  4BWI A;  4P6B A;  5EVI A;  3RJU A;  4PMA A;  4WEJ A;  5KSH A;  1YLZ A;  5HPI A;  1ALQ A;  1LL8 A;  1S4R A;  1ES3 A;  3PYP A;  5F69 A;  2W3G A;  4ZAM A;  1TS7 A;  2ZM2 A;  3C38 A;  3P09 A;  2X71 A;  1XPB A;  1PWD A;  4EBN A;  2PBY A;  2QHK A;  1KE4 A;  2MJ6 A;  3Q7V A;  1ERO A;  1ES4 A;  3HLW A;  1M40 A;  2E8I A;  1YMS A;  4IUK A;  3TE8 A;  3CUE A;  4CLC D;  2WKR A;  1KOU A;  1IYO A;  2HP5 A;  2A2L A;  5A91 A;  1MWU A;  2FH5 A;  3C30 A;  1BZA A;  1IYQ A;  4UHU A;  4CPK A;  5J3W A;  1FCO A;  3T4J A;  4Y7P A;  2KLI A;  4X25 A;  3AGF A;  1KE3 A;  3LYX A;  5F82 A;  5M19 A;  2X01 A;  3T4O A;  4EES A;  1IKI A;  4JF4 A;  3DW0 A;  5AJG A;  3UE1 A;  3NEC A;  2QZ6 A;  1K38 A;  1I2W A;  4X55 A;  5FEF A;  4KG5 A;  3H82 B;  4OPY A;  3UNW A;  3PAE A;  1DP6 A;  3UB9 A;  1BLC A;  5A90 A;  3GVB A;  1FSY A;  2P9V A;  1S6R A;  2PHY A;  3O5Y A;  2WUQ A;  3CPT A;  2KX6 A;  1P97 A;  4IBX A;  4KQQ A;  4L0L A;  3P7N A;  4F3L B;  2A24 A;  1VET A;  4D60 A;  1W63 M;  1XJ2 A;  1ACF A;  5L8M A;  4QY5 A;  2JC7 A;  5DF8 A;  3IH9 A;  5HL6 A;  3HL9 A;  4QU3 A;  1MWT A;  3GDI A;  3KYZ A;  4G3K A;  3IT9 A;  3ZNT A;  1N4O A;  5GLA A;  2WKE A;  3F1O B;  1T1B A;  5CXW A;  1D7E A;  5CGS A;  5CED A;  1ERM A;  4OVD A;  4RX3 A;  2QJ5 A;  3PBO A;  4MDZ A;  4P87 A;  1PWC A;  4C3Q A;  3ZG9 B;  3ISG A;  1CQA A;  3DTE A;  1RP5 A;  4GHI B;  4NKP A;  1CEF A;  2BAS A;  1YLJ A;  1TS8 A;  3VP4 A;  3R4K A;  4R23 A;  5FI6 A;  3GRJ A;  3T1S A;  3B33 A;  1ONH A;  1GHM A;  5DJU A;  4MN7 A;  1MC0 A;  1PI4 A;  3MXS A;  4FUW A;  2XFT A;  4E04 A;  2Y2P A;  3C7U A;  5CGW A;  4QD4 A;  4ETZ A;  1XJ3 A;  2WGW A;  3E0Y A;  3OBF A;  2HDR A;  1G5U A;  4C75 A;  3ZG8 B;  4IVI A;  3WRZ A;  1C3B A;  2W3D A;  5J4E A;  4RA7 A;  2INW A;  5DTS A;  4ZJ3 A;  3OCL A;  1XKZ A;  1T19 A;  1BTL A;  3EGD C;  3I7J A;  3CMZ A;  4GCZ A;  2JKT M;  2XRO A;  3UPO A;  2XEP A;  4H8R A;  5AQ9 A;  4BLM A;  4PKY A;  2VV8 A;  2YKH A;  3G34 A;  4II7 A;  4KEN B;  3W2Z A;  3JVV A;  4HP4 A;  2WZZ A;  5AVF A;  1YQS A;  4HQA A;  5DF9 A;  1V9Z A;  1BYW A;  5GLB A;  4HH2 A;  3F1P B;  3SW1 A;  5DKK A;  3BYD A;  1IYS A;  4PM7 A;  2W1R A;  1T1A A;  4GN2 A;  4WF0 A;  1NWZ A;  2J7V A;  4DDY A;  1K54 A;  3VFF A;  5AVE A;  3UY6 A;  2G7U A;  1KGG A;  1Z09 A;  2Y79 A;  2CC1 A;  3NCK A;  3UDI A;  3TRC A;  4P85 A;  1XGI A;  3H7W B;  5FQI A;  4P6Z M;  4R4S A;  3CHW P;  4GOG A;  1SZV A;  2V20 A;  3HJI A;  3W8K A;  1LI0 A;  1ES2 A;  2VJW A;  2ZMF A;  4X56 A;  5EOE A;  1G68 A;  4WZ4 A;  2NUT C;  4Y3I A;  2RL3 A;  4OQI A;  2GNX A;  3A3E A;  3QP2 A;  3LR3 A;  2M7U A;  3H82 A;  3UO9 A;  1GA9 A;  2XK1 A;  4LGW A;  3TJZ C;  3A3D A;  4CLC B;  2HV1 A;  1K0K A;  2KOI A;  5GL9 A;  4R6L A;  4IED A;  3ZVW A;  1H5X A;  1GHI A;  2ZL1 B;  3C5A A;  1SDN A;  4WM9 A;  2Y91 A;  3EQU A;  3Q7Z A;  2LB5 A;  2Y2J A;  3LEZ A;  3LIC A;  4F3L A;  4KG6 A;  4QB8 A;  2HDU A;  1S1Y A;  4BBT A;  3LR5 A;  4S2K A;  2WYX A;  2XA7 M;  1NYY A;  3OPP A;  2H0Y A;  1L3L A;  1ZC2 A;  2HPB A;  3PR6 A; 
#chains in the Genus database with same CATH homology
 1P0Z A;  4JGQ A;  3EQV A;  4DMZ A;  2B02 A;  3E98 A;  3KSH A;  2ZBB A;  1V9Y A;  3OC2 A;  3RFB A;  4EW7 A;  3BQA A;  2M1C A;  4HJ6 A;  5TBM B;  1P9R A;  4I3A A;  3EGX C;  3F1O A;  2L0W A;  4I3J A;  1MZU A;  2EWW A;  3MMH A;  4NEE D;  2HF6 A;  2PD7 A;  3D3O A;  3MQO A;  4KUO A;  1N9N A;  3EWK A;  4DJ2 A;  3E4Q A;  2HJE A;  2VA0 A;  2A24 B;  1XJ4 A;  2Z6D A;  4HHD A;  1YAX A;  2YKF A;  4LRX C;  2OOL A;  1ZHH B;  3K2N A;  5HZH A;  3MFX A;  3PXP A;  1XFQ A;  1Y28 A;  2JKR M;  1WA9 A;  5K5B A;  4GHI A;  2GJ3 A;  2VKS A;  4LRY C;  3MQ0 A;  3T4L A;  3UB8 A;  5HSQ A;  1F5M A;  3IBJ A;  4WLA A;  3FC7 A;  2O0Y A;  2K31 A;  4R70 A;  2H28 A;  5CX7 A;  4R3A A;  3FPV A;  2J3W A;  1H8M A;  3MR0 A;  4IUH A;  5HWV A;  2O9A A;  1IOU A;  1GSV A;  3PBR A;  4WEK A;  3JVU A;  1MKM A;  3H9W A;  1OJG A;  2QWS A;  2CMN A;  3DBA A;  4QPR A;  3IS2 A;  3ZYT A;  3T4Q A;  2PT7 A;  3U2A A;  1JNU A;  2D02 A;  3C8C A;  3LIA A;  2QKP A;  4ZRR A;  2J3T D;  2NUP C;  4JGO A;  1OT9 A;  1OTB A;  1YSP A;  1TS6 A;  3T4K A;  3A0V A;  3E4O A;  4DJ3 A;  5MC7 A;  3S7O A;  2HGV A;  4K08 A;  5HPF A;  2OWH A;  3NJA A;  2ZOH A;  1VHM A;  2VV6 A;  2GZA A;  4JGR A;  4B9O A;  2LB9 A;  3OOV A;  4GS9 B;  1G28 A;  1NRJ A;  3FG8 A;  3S7P A;  3NOP C;  4PKY G;  2D01 A;  4IHQ A;  2J80 A;  4MCW A;  3A0R A;  3KYQ A;  2GX5 A;  2W3E A;  3RTY A;  2QYB A;  4BBV A;  4EQ1 A;  4EU0 A;  2WKQ A;  4L9E A;  5J7E A;  3F1P A;  1X0O A;  3PBS A;  2V9A A;  5HWW A;  3KSI A;  1S67 L;  4BWI A;  2O99 A;  4HP9 A;  4WEJ A;  4EUV A;  5KSH A;  5HPI A;  2OAP 1;  3FPW A;  1LL8 A;  4LLO B;  1S4R A;  3PYP A;  5F69 A;  4ME4 A;  1YKD A;  2W3G A;  3KO6 A;  2V1A A;  4CLC C;  1LT0 A;  4LPZ A;  4LRZ E;  4NXE A;  1TS7 A;  1S1Z A;  3C38 A;  3V67 A;  1OTI A;  1P9W A;  4I5S A;  4EXO A;  2VV7 A;  4O0P A;  3S7N A;  4P6Z S;  3MQQ A;  2QHK A;  3H7W A;  3LI8 A;  1UWN X;  2W3F A;  4O01 A;  2MJ6 A;  1GSW A;  2OAQ 1;  3OCN A;  4GW9 A;  1F98 A;  4KUK A;  4IUK A;  3TE8 A;  2VZW A;  2R78 A;  3CUE A;  4CLC D;  2WKR A;  2K2N A;  1KOU A;  4G3W A;  2A2L A;  4Y2F A;  3BQ8 A;  3VV4 A;  3S7Q A;  2FH5 A;  4L9G A;  3C30 A;  2DMW A;  3MJQ A;  5I5L A;  3P01 A;  4O8G A;  4XT2 A;  4UEY A;  5J3W A;  1LSX A;  3T4J A;  4CLC A;  2XRN A;  3KSF A;  5KIZ A;  2W1T A;  2KLI A;  4Q0H A;  4WUJ A;  3BY9 A;  3MF0 A;  2B18 A;  4Z1W A;  4H6J B;  2VGL S;  2V0U A;  2VLG A;  3LYX A;  2IA2 A;  3BY8 A;  3UE3 A;  3PBT A;  3HJK A;  3KSG A;  5HDC A;  3T4O A;  1VB6 A;  3MXQ A;  4EES A;  1TF1 A;  2J3T C;  5AJG A;  2XA7 S;  3TW8 A;  1D06 A;  1NLZ A;  3LR4 A;  5HD5 A;  5F68 A;  4FOF A;  2P08 A;  3R7W B;  4ARZ A;  2PYR A;  2V0W A;  3H82 B;  3PHY A;  1DP6 A;  3VOL A;  5DJT A;  1N9O A;  3EEH A;  5TJJ A;  3UB9 A;  5DFY A;  5TBM A;  3F1N B;  4EEP A;  3EEA A;  4EER A;  2EA9 A;  4WN5 A;  2PHY A;  3O5Y A;  3OLO A;  5IS1 A;  3NOT C;  3PBN A;  3T50 A;  4Y5F A;  4M4X A;  4GJ4 A;  1OPX A;  2KX6 A;  1P97 A;  3LIF A;  5EFW A;  4L0L A;  3P7N A;  4YWZ A;  2A24 A;  4F3L B;  2ZOI A;  1W63 M;  1XJ2 A;  5L8M A;  4NXB A;  4CQH A;  4HOI A;  4UQI M;  4AFI A;  5HDS A;  4WEL A;  5HL6 A;  1LSV A;  3T4S A;  4BJP A;  3UME A;  3GDI A;  4IJG A;  2O9C A;  3KYZ A;  4G3K A;  3CUE C;  1OTD A;  3GEC A;  3LR0 A;  5IT5 A;  3F1O B;  1T1B A;  2Z6C A;  1D7E A;  2PDR A;  2QJ5 A;  3PBO A;  4HIA A;  3CI6 A;  4KQD A;  4BMW A;  4MDZ A;  4B93 A;  4ETX A;  3BW6 A;  3PBQ A;  4HY8 A;  2I9V A;  2P7J A;  1T1C A;  5HDD A;  4JGP A;  2JHE A;  4WL9 A;  4RQ9 A;  4YOF A;  3UE6 A;  2Y8H A;  4NXF A;  4GLQ A;  4I39 A;  3ULF A;  4GHI B;  4NKP A;  2BAS A;  2VEA A;  1TS8 A;  3T4T A;  3LIE A;  3LIB A;  3R4K A;  4HH3 A;  4MMN A;  4KQO A;  1S4S A;  3B33 A;  1LSW A;  5HD3 A;  1OTE A;  4OOL A;  1N9L A;  2ZMV A;  1EW0 A;  1TS0 A;  5DJU A;  4MN7 A;  1MC0 A;  5LBR A;  4GS9 A;  4E04 A;  3D72 A;  1XJ6 A;  4ETZ A;  2M7V A;  2JN7 A;  4EEU A;  1XJ3 A;  3E0Y A;  2PD8 A;  3OBF A;  3IS2 B;  3LUQ A;  2WKP A;  1W63 Q;  2W3D A;  3CLO A;  1UGU A;  5J4E A;  1DP9 A;  2INW A;  4MN5 A;  3OCL A;  4HJ4 A;  1T19 A;  3E4P A;  5G4Y A;  3EGD C;  2L1M A;  4GCZ A;  2L4R A;  2JKT M;  5F5Y A;  3CAX A;  2XRO A;  2W3H A;  1OTA A;  3LID A;  2KDK A;  1OT6 A;  4PKY A;  2VV8 A;  2YKH A;  4FSF A;  4EET B;  1DRM A;  5F6A A;  4I3I A;  4II7 A;  5HWT A;  3W2Z A;  3JVV A;  4HP4 A;  1F9I A;  2W0N A;  2PYP A;  2FZ0 A;  4PAU A;  1STZ A;  4OOM A;  5AVF A;  2V1B A;  1XFN A;  3LFV A;  4HQA A;  5DF9 A;  1V9Z A;  1BYW A;  4HH2 A;  3F1P B;  5FL3 A;  3SW1 A;  3ICY A;  5DKK A;  3KX0 X;  1ZTU A;  2W1R A;  1T1A A;  4G3V A;  3LI9 A;  4BBU A;  3B47 A;  3CWF A;  3G6O A;  4WF0 A;  1NWZ A;  2O9B A;  2W27 A;  3RH8 B;  1UWP X;  5AVE A;  2G7U A;  5A8B A;  4DN0 A;  2JKT I;  4I38 A;  2Y79 A;  4HI4 A;  3UB6 A;  3TRC A;  4L9F A;  5C5K A;  2HJ9 C;  1G6O A;  2JKR I;  3H7W B;  4NXG A;  4P6Z M;  3VE4 A;  4H6J A;  3UB7 A;  4Q0J A;  4HJ3 A;  3EOI A;  1IFQ A;  3HJI A;  2ZMF A;  2VJW A;  2QJ7 A;  3VE3 A;  2OWJ A;  2K7S A;  1DP8 A;  4Q0I A;  2VX8 A;  2NUT C;  2P04 A;  1OJ5 A;  4Y3I A;  2GNX A;  2EWV A;  4YNR A;  4R38 A;  3R7W A;  1GSX A;  3LR3 A;  4XT2 B;  3C2W A;  2M7U A;  3H82 A;  3TJZ C;  3K3D A;  4CLC B;  2PR5 A;  2HV1 A;  3K3C A;  2KOI A;  4R6L A;  3F1N A;  4PHT A;  3UMD A;  1T18 A;  2W1T B;  4MN6 A;  2PR6 A;  3BJN A;  5DFX A;  3A0S A;  3HCY A;  3IBR A;  3EQU A;  2VGL M;  1S66 L;  2LB5 A;  3NHQ A;  5DKL A;  3LIC A;  4F3L A;  3ZQ5 A;  3B42 A;  4HNB A;  4CLC E;  4UQI S;  2XSS A;  1TD5 A;  1H3Q A;  1ODV A;  1YSQ A;  1S1Y A;  4BBT A;  3LR5 A;  5IU1 A;  2XA7 M;  3CIT A;  5G4Z A;  3NOU C;  4ARZ B;  3PR6 A;  1NLY A;  3BWL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...