2PR5A

Structural basis for light-dependent signaling in the dimeric lov photosensor ytva (dark structure)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
127
structure length
127
Chain Sequence
b'DHVRVGVVITDPALEDNPIVYVNQGFVQMTGYETEEILGKNCRFLQGKHTDPAEVDNIRTALQNKEPVTVQIQNYKKDGTMFWNELNIDPMEIEDKTYFVGIQNDITKQKEYEKLLEDSLTEITALS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Blue-light photoreceptor
molecule tags Flavoprotein, signaling protein
source organism Bacillus subtilis
publication title Structural Basis for Light-dependent Signaling in the Dimeric LOV Domain of the Photosensor YtvA.
pubmed doi rcsb
total genus 45
structure length 127
sequence length 127
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2pr5A00
5J4EA 1OJGA 1X0OA 4LRZE 4NXEA 3F1PA 4I38A 4EQ1A 2Z6DA 3H7WB 3F1OB 3CWFA 4M4XA 3H9WA 3E4QA 2PDRA 3H82A 1V9YA 3ICYA 4R3AA 3C8CA 4R6LA 3CAXA 5KIZA 2V1AA 2KDKA 2R78A 2V1BA 1LSXA 2L4RA 4JGOA 4R70A 5TBMA 1OT6A 3MJQA 2QHKA 3E4PA 1OTBA 3BWLA 5J7EA 1S1ZA 2PYRA 1XFQA 2ZOIA 1GSVA 1LSVA 3KX0X 2V9AA 3HJKA 1XJ6A 2PHYA 3NOPC 4LRXC 5J3WA 3NOTC 1DRMA 3UB9A 1P0ZA 2M1CA 4EESA 5IU1A 2H28A 2V0UA 2EA9A 2WKQA 3LIFA 2GJ3A 5DKLA 2PYPA 4HJ3A 3LIBA 1F98A 4I3JA 5IS1A 2L0WA 1OTIA 2QKPA 5F5YA 4WN5A 5HZHA 4NXGA 3EWKA 2A24A 1XJ3A 1JNUA 1D06A 3HJIA 3G6OA 4HNBA 4R38A 4HJ4A 4HIAA 5HD3A 3NHQA 4YWZA 4WUJA 4L9EA 1T1CA 3UB6A 2ZOHA 2JN7A 4PKYA 2CMNA 1NWZA 2A24B 3F1PB 3MR0A 5HDSA 3F1NA 4HY8A 5F6AA 4LPZA 3F1OA 5DJUA 2PD8A 2ZBBA 4HH2A 3OLOA 4GHIB 4GW9A 1MZUA 3VE3A 3LIAA 3LI8A 4KUKA 4E04A 3GDIA 3VE4A 3D72A 2JHEA 2INWA 1D7EA 4PKYG 4EEUA 3E4OA 2WKPA 2D02A 1XJ2A 5HDCA 4HI4A 5TBMB 3MQQA 1S4RA 4EERA 1S1YA 2KX6A 3UMDA 1LL8A 5G4ZA 2VV7A 4BBTA 1S4SA 3IS2B 4HOIA 2QJ5A 2I9VA 1OT9A 2VEAA 3FC7A 3H82B 2OOLA 3LUQA 4NXBA 1V9ZA 1T1BA 1Y28A 5HWTA 3NJAA 4L9GA 2HV1A 1TS8A 4I39A 2QJ7A 2V0WA 3BY9A 3RH8B 5F69A 1T18A 1DP9A 3A0RA 5A8BA 5HWVA 5G4YA 4EETB 4LRYC 3K3DA 1T1AA 4I3AA 3T50A 5DKKA 5HSQA 1N9LA 2VV8A 3P7NA 1OTDA 3CLOA 4LLOB 3LI9A 4I3IA 4MN6A 3ZQ5A 2WKRA 2OWHA 1TS0A 4GCZA 2YKFA 4MN5A 4B9OA 3UB8A 4EW7A 1ODVA 1LT0A 2VLGA 2W0NA 3SW1A 1LSWA 1T19A 1EW0A 4HHDA 3LIEA 4JGQA 4L9FA 4F3LB 4HJ6A 3BY8A 2J80A 4WL9A 4DJ3A 1N9NA 4HP9A 2D01A 4K08A 3MFXA 3VOLA 2L1MA 2PR5A 4HH3A 4NXFA 4KUOA 4KQDA 3MXQA 1TS6A 2BASA 4WLAA 5AVEA 1GSWA 1TS7A 4XT2A 5I5LA 4F3LA 3GECA 3PHYA 3UE6A 1XFNA 1UWNX 3K3CA 5F68A 3LIDA 1UWPX 2W27A 3F1NB 4H6JB 2PR6A 1G28A 1DP8A 1OJ5A 4GHIA 1N9OA 3NOUC 4HP4A 1OTAA 4I5SA 2PD7A 4RQ9A 4XT2B 5EFWA 5AVFA 5HDDA 1VB6A 3ULFA 4EEPA 1P97A 3EEHA 1WA9A 2B02A 1UGUA 2P7JA 4GS9A 3FG8A 1DP6A 3C2WA 4H6JA 3B33A 4JGPA 2K7SA 4DJ2A 1BYWA 5DJTA 2Z6CA 3PYPA 3RTYA 4BBVA 1OTEA 4BBUA 3IS2A 4JGRA 5HWWA 3A0SA 4GS9B 5HD5A 2VV6A 4HQAA 3LYXA 3UMEA 4EXOA 2OWJA 3H7WA 1F9IA 1KOUA 3MQOA 1GSXA 1XJ4A 4WF0A 1S66L 3A0VA 1S67L 2YKHA 3IBRA 3LICA 2QWSA 3UB7A
chains in the Genus database with same CATH superfamily
4KQQA 1YLYA 1F2KA 3W4OA 2KDKA 3VMAA 1BULA 1H8ZA 2HDQA 5F82A 2L4RA 2ZQDA 3A3JA 3PBRA 4JKTA 3MSHA 3QP1A 3Q7VB 4KZ5A 5CTNA 2H28A 2GJ3A 4ZBEA 3FV7A 1SCWA 4E3JA 3G34A 1L0GA 4DRTA 5HDSA 1SZVA 4CPKA 1I2SA 2VZWA 1P9WA 1MBLA 3LR3A 4E04A 4X56A 1ZKJA 2W1RA 1K4EA 2VK3A 3HUNA 1LHYA 3B42A 3BLSA 1V9ZA 1VETB 1IOUA 3BY9A 4BJPA 1H0MA 2Y55A 3NCKA 4LLOB 1OTDA 3BFEA 3LI9A 1LSWA 5A91A 3JVVA 1W7FA 3CMZA 2J80A 4ETZA 2E8IA 5FAQA 4YINA 3IWOA 1AWIA 1NLZA 1K4FA 1MY8A 2NUTC 2PAVP 2IWBA 3OOVA 4G3WA 3IF6C 3HUOA 4R1GA 3UMEA 4C6YA 2HP9A 5GLAA 5EOOA 4E6XA 2V1ZA 1ERMA 4P6ZS 3M2KA 1EWZA 4OONA 4M4XA 3CUEC 3AGFA 2R78A 2HZ5A 4FCFA 3O87A 3C5AA 5JYOA 3G30A 3LEQA 3UB5P 2V9AA 1D1JA 2XH9A 1W5DA 3C7VA 5IS1A 3UY6A 4OOYA 4C75A 5U47A 2A24A 1XJ3A 4KZ9A 4R38A 2VJWA 1GCEA 2K31A 3NDGA 3MR0A 3PBSA 3C30A 3DTIA 4XUXA 4IVKA 3D72A 2JHEA 3WS5A 2C6WB 2J8YA 4JPMA 4HI4A 5DTTA 4NK3A 4EERA 1ONGA 3VP4A 4QY5A 2VEAA 3FC7A 3IH8A 3GV9A 3LR0A 2A49A 2M7VA 4S2NA 3BFFA 4B9OA 2ZQ7A 3HREA 2ZM8A 4II7A 3PAEA 2Y2JA 2D01A 1K55C 4BLMA 4OQIA 1HD8A 3B47A 1BSGA 3C4PA 1UWNX 3WWXA 4BMWA 1VEUA 1OJ5A 1SDEA 3WS0A 3G31A 1Z6FA 3ZVWA 4B4ZA 3GQZA 4LGWA 2WZZA 1K56A 3TG9A 3G4PA 1CQAA 5KSHA 3KSGA 4E3MA 1XKZA 1XX2A 3UB7A 2IA2A 4PM7A 1Y54A 3IBJA 4OPRA 4E3IA 5IT5A 5DTKA 2XSSA 3TSGA 2WUQA 5FQJA 4Q0IA 4R70A 5FQKA 4OPZA 2HP6A 4OQHA 2ZC5B 1ES5A 3EEAA 3DTMA 1NXYA 4EESA 1PIOA 3UDXA 4S2MA 1QMEA 4GJ4A 3V50A 3BECA 5L10A 5HAPA 4ME4A 1K56D 3FYZA 5FAOA 3VP1A 4R3JA 1FIKA 1CK3A 1GA0A 1H8YA 4EBLA 3IWIA 1KDSA 3KYEA 5GHXA 4K0WA 4R23A 5TBMB 4ID4A 3UMDA 2XROA 4FD8A 1FCNA 2VGLM 4DDYA 2JE5A 4EBPA 1S0WA 5F69A 2RL3A 4OOLA 5CECA 4ESPA 3UNWA 1P9RA 3BFCA 1I5QA 2VX8A 1LT0A 4JF4A 4YFMA 2HJ9C 3GR2A 4OH0A 3R7WA 3S1YA 4KQDA 5M1AA 2P08A 5HARA 2W3HA 5AVFA 1J3WA 3O3VA 2WAEA 2BTFP 4Y0OA 4UAAA 1KE0A 5FDHA 4Q8IA 1YSPA 3PYPA 4GN2A 4CLCC 2VV6A 3LYXA 5FQIA 1TDGA 2EX9A 5J4EA 4IJGA 1QMFA 3W8KA 3MQ0A 3T4QA 1OT6A 3RXWA 4JXWA 2KLIA 4LCLA 5L8MA 1GSVA 1XXMA 3NOPC 1CEGA 3LIFA 3QNCA 4Y3IA 4X6TA 4HESA 2Y2HA 4HNBA 3IXHA 3NHQA 2DRWA 2P9VA 5CEDA 3OPRA 4DE3A 4WZ5A 4GDBA 1K6RA 2VA0A 1VETA 2H0YA 2KX6A 3T1SA 3JPUA 2I9VA 3LCEA 1T1AA 4IUKA 1N9LA 2P74A 3AGDA 4FUWA 5TR7A 4X53A 2XD5A 3BFGA 2Y2GA 2M7UA 2A2LA 1H5XA 3VOLA 3MXQA 4R4SA 4WZ4A 4BWIA 5AQ7A 1BLSA 4WBGA 2AVXA 1OTAA 4EU0A 1OMEA 2O9CA 1CJFA 5EUAA 4JGPA 2EFUA 2RCXA 4QB8A 1VM1A 4IBRA 3ISGA 2GZAA 4WM9A 1VEUB 3LICA 3VOZA 1OJGA 1G5UA 2W1TB 3H7WB 3ZNTA 4A5RA 1K25A 2FFYA 3IX4A 4S2OA 4GOGA 3CAXA 4MMNA 2O0YA 2HJEA 2HGVA 3KX0X 2Y2OA 2ZJ9A 4F94A 2VGJA 2Y91A 3LIBA 2V20A 4WMCD 3S7NA 1VHMA 5CGXA 2G7UA 5AQ9A 3QP5A 2ZQ9A 4HH2A 4QPRA 1RGZA 5C5KA 5CHJA 5HAQA 3ZGAB 4EEUA 3E4OA 3MQQA 3UO9A 2EXBA 2PBDP 2P04A 4Y15A 3A0RA 1ZHHB 2OV5A 1M40A 5HPFA 2OLVA 2H0TA 3MMHA 4GCZA 5EVIA 1EW0A 4GKUA 3LIEA 4NKPA 2X01A 3IX3A 2JBFA 2QPNA 4NETA 1KGEA 1XFNA 1KVMA 1G28A 4GHIA 3P98A 4HP4A 5L07A 5EVIB 2E8JA 1JWVA 4KZBA 1UGUA 5AQAA 1DP6A 3N8SA 1SKFA 5DVAA 4JXVA 3RTYA 4JGRA 1H3QA 2Y4AA 4GS9B 2J3TD 4HQAA 3GTCA 1EI5A 2X02A 1XJ4A 4ZJ1A 3IBRA 3QP4A 2OLUA 3E4QA 4EUVA 5EM1A 5DF9A 3OC2A 2XFTA 1KE4A 3LY3A 1BLHA 5J7EA 2X71A 3UN7A 4L0LA 5JYPA 3OZHA 3UB9A 2M1CA 4GD6A 2QKPA 1BZAA 4DMZA 5HPIA 1YKDA 5DFYA 1FQGA 1NWZA 5E2HA 5F6AA 3RJUA 4B88A 2HDRA 1G6OA 1D7EA 1XJ2A 4P0MA 2W3GA 3DBAA 4PM8A 3BEBA 1S4RA 1K57C 4BBTA 4HOIA 4NXBA 4U0XA 3BQAA 4L9GA 1TS8A 4E3LA 3IQAA 4O7DA 2XQZA 2QMIA 3T50A 3GSGA 2DCFA 4MN5A 4UA6A 2GDNA 1PFLA 3DW0A 1T19A 3RXXA 2ZMFA 5GL9A 3T4JA 3C4OA 3LY4A 3EGDC 5EE8A 3MFXA 4WZ5C 3MFDA 2PR5A 4KUOA 2PT7A 2XEPA 4ZRRA 3GECA 5G18A 3T4OA 3JYIA 1LL5A 1ESIA 1NYYA 1MC0A 4OOMA 4GLQA 5CXWA 1K55A 4O0PA 2EFXA 4DJ2A 2WGVA 1NZUA 3PBQA 1JWPA 3IS2A 5HL6A 1IYPA 2HDUA 1SDNA 2GNXA 3T4LA 1Q2PA 2EX6A 4G3KA 4JGOA 5MC7A 3SW1A 2XDMA 1X0OA 4I38A 2Z6DA 5CHMA 4Y17A 2WGWB 4UQIS 3H82A 4OP8A 5GLBA 4GD8A 2IWDA 4FOFA 3NIAA 5TBMA 1ZTUA 2QHKA 4MBHA 2QYBA 1S6RA 3BLMA 4PHTA 2LB9A 5IU1A 2V0UA 5EV0A 1ALQA 1FCMA 1OTIA 5F5YA 3LGOA 4MDZA 3VSKA 4WUJA 2XA7M 4PKYA 2A24B 2EWVA 4EUZA 1VQQA 4LPZA 3UPPA 4CLCA 2EX2A 3ITAA 4XXRA 5AJGA 1DY6A 1L0DA 1ZG6A 1JTDA 5A90A 2JKTM 3MKEA 3A3FA 3FKWA 4DE0A 1O7EA 2HV1A 4KG6A 1T18A 2OSUA 3ZDJA 1WYCA 3TW8A 3ZQ5A 4KZAA 1XA7A 1YLTA 4BENA 3UB8A 1YSQA 4HJ6A 5EPHA 1N9NA 4WELA 4EQIA 1TS7A 1K6SA 3HCYA 3UE6A 4BD0A 4H6JB 4MBKA 5DF8A 4JLFA 5EFWA 4S2JA 1P97A 4Y13A 1F5MA 2K7SA 3MZDA 4U0TA 1BYWA 1PI5A 2PBYA 3UE1A 5A93A 4G3VA 3IF6A 1KVLA 2XRNA 1YT4A 2W1TA 3H7WA 1F9IA 1S66L 5DTSA 4OLDA 2QWSA 1MWRA 3CJMA 5I94A 2HF6A 4Z1WA 1YQSA 1RCJA 5E43A 3HLGA 3IHAA 3MZFA 1MWTA 2EWWA 3U2AA 2WKQA 1LI9A 3T4SA 4PM9A 1F98A 5FATA 2JKFA 2L0WA 3EGXC 1D06A 3GVBA 2I72A 2CC1A 4KENB 5FI6A 5FEFA 5KSCA 2V8FA 3F1PB 2PD8A 3NBLA 1NLYA 3GMWA 4OLGA 2VV7A 1S4SA 3H82B 4P6BA 2WKIA 1BUEA 4ZTKA 5F1FA 2C5WB 1DJCA 4I3IA 1CI9A 2WKRA 3HVFA 4R3BA 4S2NC 3T4TA 4BL2A 1N9BA 4JXSA 2Y2QA 4DJ3A 4FH2A 2ZC7A 1NYMA 5AVEA 3G2ZA 2BASA 3IH9A 3K3CA 2PR6A 3NOUC 2PD7A 1WA9A 3B33A 3ZG8B 3CHWP 4ETXA 3SOIA 3LEZA 1ERQA 4MLLA 2XFSA 4QJGA 5E2GA 2YKHA 3IT9A 4QU3A 5GLCA 3LR5A 1PWCA 4CLCD 2Q0OA 4R3AA 3T12B 2Y2KA 3QNBA 3MJQA 2XA7S 2ZOIA 4UEYA 5BOHA 5F1GA 4KG5A 2UWXA 5DKLA 3BW6A 4DN0A 4OQGA 1E4DA 4HIAA 4IBXA 3UB6A 1ACFA 2EX8A 4MEZA 4HY8A 2ZL1B 3OLOA 3OBFA 5FI2A 1GA9A 2O9BA 1YMXA 2D02A 3HLWA 4GDNA 4X55A 5DFXA 2NUPC 2QJ5A 3HLEA 3WS2A 5HWTA 3RH8B 4N1XA 1RP5A 4O01A 5HSQA 5CGSA 3KYZA 1TS0A 4EW7A 4X69A 2O9AA 3HLDA 4RX2A 1Q2QA 2Y2NA 2J3TC 5FDSA 4Z9QA 3PBTA 2V8CA 4QHCA 2W27A 4MCWA 3OCNA 1W63Q 1DP8A 1NZOA 4X68A 4IHQA 1KGGA 3N6IA 1IYQA 5DJTA 3OCLA 1CI8A 1JWZA 3N8LA 3E2LA 3U4LP 1PRQA 2WGIA 3HUMA 3ZHHA 3W4QA 5HL1A 3P01A 3S7QA 1L3LA 1PZOA 1W8QA 2V1AA 4LENA 3OPHA 4IVIA 1XFQA 3M2JA 4HBTA 2PHYA 4LFUA 4KZ7A 1E3UA 1JNUA 3R7WB 1YAXA 3NECA 2HP5A 3O86A 4HEFA 1K57A 3W4PA 2CMNA 1JTGA 5AQBA 1XGIA 2ZBBA 4GW9A 1FOFA 3E2KA 3MF0A 5F83A 3VE3A 4KUKA 3GDIA 5EECA 3VOYA 3ZNYA 1IEMA 4QWOA 2WKPA 4H8RA 2Y59A 5CTMA 1IFQA 1Y28A 4KZ6A 3TJZC 3UDIA 3BJNA 4E6WA 2V0WA 4BL3A 1DP9A 4N92A 5A8BA 1STZA 5G4YA 1TD5A 4I3AA 2HPBA 3Q7VA 4MNRA 2OWHA 4X1MA 3BM6A 3LR4A 4ZJ3A 1H8MA 4JBFA 3SH8A 4NXFA 2ZD8A 3FPWA 4WLAA 1GSWA 5EOEA 3R4KA 3S7OA 2JCHA 4B93A 4NEED 3KSIA 4RQ9A 3SS5A 5HDDA 3C2WA 4K0XA 4P85A 5EVLA 3D3OA 4N9LA 4RVAA 4S2IA 1NY0A 3FPVA 1PZPA 1TDLA 3NY4A 3UE0A 3QP8A 3ZFZA 2PDRA 4KQOA 2Y8HA 1W63M 2V1BA 3E4PA 1ESUA 1LSVA 4Y2FA 3HJKA 4WEKA 1XPBA 1DRMA 1P0ZA 2XF3A 4I3JA 1CEFA 3DTEA 3EQUA 2J9PA 3W2ZA 3MBZA 2JN7A 2J9OA 2ZLYA 3MXSA 5FSRA 1ES4A 3EOIA 2P9VB 4GB7A 3N4IA 3CPTB 1A0KA 4D2OA 3ZYTA 1S1YA 4E3KA 1LL9A 3OPLA 1OT9A 3B3XA 3VSLA 1W8YA 1FILA 1I2WA 1K0KA 2B5RA 2Z2LB 5CGWA 5DF7A 5CERA 2EXAA 4PMAA 3CPTA 1ES2A 2W0NA 3BY8A 5EVIC 4YNRA 4YOFA 2PU2A 4LCMA 3G32A 5KMWA 5F68A 5HX9A 4DE1A 1ZG4A 1VB6A 1NRJA 2B02A 2W3EA 2P7JA 3T4KA 4R0QA 4ARZB 5FQQA 5HWWA 4E3NA 1E3UD 3V3RA 2BG1A 1KE3A 4ZAMA 4PM5A 3FKVA 4Q0HA 3P09A 1GSXA 3L9KA 2DNSA 2JKTI 4LV1A 1WE4A 4FH4A 3F1PA 1Y4OA 4MN7A 4UHUA 2ZQAA 4P87A 1HTZA 1V9YA 3ICYA 3C8CA 5GLDA 2B95A 5E2FA 4S2KA 2XK1A 3N8RA 4ZDXA 1S1ZA 1NRFA 2PYRA 3IXDA 2Y79A 2WKHA 2EA9A 1K38A 1DJBA 3IF6B 3K2NA 4WN5A 4NXGA 3NULA 1J9MA 4EWFA 4Q0JA 1KDWA 3WS1A 2XR0A 1AXBA 1MKMA 2V2FF 1PYYA 4GHIB 2QZ6A 3D9YA 1SHVA 2INWA 4PKYG 1IYSA 3SH9A 4X25A 2B18A 3UPNA 3KSHA 4PAUA 2UV0E 1T1BA 3A3EA 4DKIA 1NJ4A 2Q9NA 2Y2IA 5EVID 4EV4A 3A3DA 2WADA 3HLCA 3P7NA 1YMSA 1MWUA 4CQHA 3SH7A 3MKFA 4X1LA 5J8XA 2G2UA 3KYQA 3TOIA 1LLBA 3I7JA 1TEMA 3IXBA 4F3LA 3PHYA 3T1QB 4RYEA 3VP3A 5TGFA 1YLPA 4RA7A 3EEHA 3S7PA 4H6JA 1IYOA 3CG5A 3CZDA 3ZG0A 1HLUP 4BBUA 1MKIA 3DTKA 3M6BA 3PBNA 3HL9A 2H10A 5HAIA 2R9XA 2OAQ1 3KSFA 3A3IA 3NDEA 5FEGA 5LBRA 1S67L 2XLNA 3H9WA 1W79A 2W3DA 1OPXA 3FZCA 4KZ4A 2JKGA 2VGLS 4CLCE 3WRTA 3SZTA 4JXGA 1HZOA 4CLCB 2VGKA 3GRJA 4HJ3A 4CJNA 4Y0TA 1PW8A 4RX3A 4FTXA 4WYYA 3ZCZA 3G6OA 5L2FA 4YWZA 3AGEA 4L9EA 4DE2A 1BLCA 4UA9A 3PXPA 3F1NA 4HBUA 3F1OA 3D4FA 4Y7PA 5FA7A 3L7HA 5K5BA 2Y2PA 2ZMVA 4U3TA 3VE4A 4LV3A 3MS6A 1WYBA 5HDCA 3IF5A 5G4ZA 3CITA 3SS3A 3IS2B 3G2YA 3S22A 2OOLA 5FASA 1PNEA 4GZBA 5EM0A 3RFBA 3OPPA 5HWVA 3SS4A 3QHYA 4N1HA 5DKKA 3WRZA 3DWZA 1IKGA 4ZJ2A 1G68A 3CLOA 4MN6A 3KO6A 2YKFA 2WK0A 1ODVA 2VLGA 4HHDA 3QP6A 5D3OA 1C3BA 2JKRI 4KZ8A 4DXBA 2L1MA 3EQVA 3HLBA 4UA7A 1O07A 1UWPX 4R4RA 4WEJA 4Y5FA 2ZQCA 4I5SA 4XT2B 3ULFA 1SKOB 1FR1A 3LFVA 1OTEA 1K54A 2ACGA 4K91A 2ZMAA 4KG2A 2OWJA 4WMCA 1ZC2A 2Z2MB 1SKOA 4KQRA 4LRZE 4C3QA 4NXEA 2ZC4B 5FAPA 1K54C 4OQ0A 4ARZA 4R6LA 4GNUA 3NC8A 5TJJA 1XJ6A 3IXGA 1XA1A 3ZVTA 3UE3A 1XP4A 1ES3A 3DWKA 5HZHA 4PPRA 3IHBA 5HD3A 1T1CA 5CEBA 4LV0A 5DJUA 4B4XA 1MPLA 3LIAA 5HW3A 3IWQA 2ZM2A 4EBNA 5TFQA 2ZL1A 3LUQA 5GHYA 2J7VA 3NJAA 3O88A 3Q07A 4PM6A 1KGFA 3WS4A 4EETB 4BQMA 3K3DA 4BD1A 2R9WA 5L09A 3BQ8A 4KZ3A 2G2WA 4L9FA 1GHPA 5E2EA 4FSFA 4K08A 4DXCA 3T1XA 3E98A 4S2LA 1M6KA 2PU4A 3V67A 2Y2MA 2OAP1 3F1NB 1JVJA 3MXRA 4AFIA 1N9OA 4EEPA 1ONHA 3ZG5A 4OP5A 4E3OA 3ZG7B 3HBRA 1YPRA 3A0SA 3LO7A 3MZEA 2W3FA 1KOUA 3CI6A 1XGJA 3A0VA 3F1OB 4NG2A 1PWDA 5KIZA 5HFOA 2WAFA 1LSXA 1OTBA 3BWLA 2GX5A 3HLFA 3NOTC 3C38A 4DF6A 3ZG9B 1MWSA 2PYPA 2J3WA 4OKPA 1YM1A 1LI0A 3EWKA 2XD1A 3V39A 2ZOHA 3BRMA 2JKRM 1Z09A 1IELA 2JC7A 3FWLA 1MZUA 1G6AA 2K2NA 2H5SA 1LL8A 3TE8A 1YLJA 2WZXA 3UPOA 2MJ6A 4IUHA 1CF0A 3VP0A 4OVDA 5CHUA 1L2SA 4MBFA 2QJ7A 4LV2A 2HDSA 4XUZA 3G35A 1L0EA 2O99A 2VV8A 1PWGA 4D60A 1MXOA 5FI7A 1FSYA 5FQ9A 3PAGA 1IKIA 4JGQA 4F3LB 4WL9A 4JF5A 2ZC6B 4HH3A 1FSWA 1TS6A 5I5LA 2BLSA 5EVEA 3TRCA 3O5YA 3QP2A 5M18A 2VKSA 1BLPA 3NI9A 4UQIM 4BBVA 4OPQA 3VP2A 1U60A 2IWCA 1RGYA 3PTEA 3S4XA 3MQOA 2XGNA 5FQMA 4EQ1A 3CWFA 3DAVA 1TVFA 4P6ZM 3JVUA 2FFFB 3VFHA 2A3UA 3M6HA 1GHIA 2KOIA 1PW1A 4LRXC 5J3WA 3VV4A 1E25A 4DDSA 3T1RA 1BT5A 3UDFA 2PRFA 3BFDA 2WKEA 3HJIA 1TF1A 3Q82A 3PBOA 4HJ4A 5A92A 2Q9MA 1FR6A 4N9KA 3IX8A 1BTLA 2FZ0A 3CUEA 4QD4A 3Q1FA 3LI8A 1YLWA 3PR6A 3VFFA 1EROA 4JF6A 1L0FA 3Q7ZA 2ZC3B 1N4OA 1PI4A 4I39A 4Y0UA 1GHMA 2WYXA 2ZM0A 3V3SA 4LRYC 3Q81A 5FL3A 4S2PA 3E0YA 5GHZA 2DMWA 2ZQ8A 3N7WA 4O8GA 5CRFA 4HP9A 2Y2LA 2WGWA 4XT2A 4OPYA 3BYDA 4M3KA 3LIDA 4EXOA 3ITBA 4GS9A 4QY6A 3FG8A 2LB5A 1HVBA 3V5MA 5IHVA 2Z6CA 1FCOA 4IEDA 1DJAA 5HD5A 5KZHA 1YLZA 5CX7A 3C7UA 4WF0A 2FH5A 5M19A
chains in the Genus database with same CATH topology
1OJGA 2W1TB 3H7WB 3LR5A 4CLCD 3H9WA 4R3AA 2W3DA 3CAXA 1OPXA 4MMNA 2KDKA 2O0YA 2L4RA 3MJQA 2XA7S 3PBRA 2HJEA 2HGVA 2VGLS 2ZOIA 3KX0X 4UEYA 4CLCE 2H28A 5DKLA 2GJ3A 4CLCB 4HJ3A 3LIBA 3BW6A 3S7NA 4DN0A 3G6OA 4HIAA 1VHMA 4YWZA 4L9EA 2G7UA 3UB6A 5HDSA 3PXPA 3F1NA 4HY8A 3F1OA 4HH2A 2VZWA 1P9WA 3OLOA 3OBFA 4QPRA 3LR3A 5C5KA 4E04A 5K5BA 3VE4A 2ZMVA 2O9BA 4EEUA 3E4OA 2D02A 5HDCA 2W1RA 3MQQA 5DFXA 5G4ZA 3CITA 2NUPC 3IS2B 2QJ5A 2OOLA 3B42A 2P04A 1V9ZA 5HWTA 1IOUA 3RFBA 3RH8B 3BY9A 4BJPA 3A0RA 1ZHHB 5HWVA 4O01A 5HSQA 5DKKA 5HPFA 1OTDA 3CLOA 4LLOB 3LI9A 3KO6A 4MN6A 3KYZA 1TS0A 3MMHA 2YKFA 4GCZA 4EW7A 1ODVA 2VLGA 1LSWA 4HHDA 1EW0A 2O9AA 3LIEA 4NKPA 3JVVA 2J3TC 2J80A 2JKRI 4ETZA 2L1MA 3PBTA 3EQVA 1NLZA 1XFNA 1UWPX 2W27A 4WEJA 2NUTC 4MCWA 3OCNA 1W63Q 4Y5FA 1G28A 1DP8A 4GHIA 4I5SA 4HP4A 4XT2B 4IHQA 3ULFA 1UGUA 3OOVA 4G3WA 1DP6A 3LFVA 5DJTA 3OCLA 3RTYA 1OTEA 4JGRA 1H3QA 4GS9B 2J3TD 4HQAA 3UMEA 2OWJA 1XJ4A 3IBRA 4LRZE 4NXEA 4P6ZS 4M4XA 3CUEC 3E4QA 4ARZA 4EUVA 3P01A 5DF9A 3S7QA 3OC2A 4R6LA 2V1AA 2R78A 5J7EA 1XFQA 2V9AA 1XJ6A 2PHYA 5TJJA 4L0LA 3UB9A 2M1CA 3UE3A 5IS1A 2QKPA 5HZHA 4DMZA 2A24A 5HPIA 1XJ3A 1JNUA 1YKDA 3R7WB 1YAXA 4R38A 5DFYA 5HD3A 2VJWA 2K31A 1T1CA 2CMNA 1NWZA 3MR0A 3PBSA 5DJUA 5F6AA 2ZBBA 3C30A 4GW9A 3MF0A 3VE3A 3LIAA 4KUKA 3GDIA 3D72A 2JHEA 1G6OA 1D7EA 2WKPA 1XJ2A 2W3GA 4HI4A 3DBAA 1S4RA 4EERA 4BBTA 4HOIA 4NXBA 2VEAA 3FC7A 1IFQA 3LUQA 3BQAA 1Y28A 3TJZC 3BJNA 3NJAA 4L9GA 1TS8A 3LR0A 2V0WA 1DP9A 5A8BA 1STZA 5G4YA 4EETB 2M7VA 1TD5A 3K3DA 4I3AA 3T50A 2OWHA 4MN5A 4B9OA 3BQ8A 1T19A 2ZMFA 4L9FA 3T4JA 4II7A 3LR4A 3EGDC 4FSFA 2D01A 4K08A 1H8MA 3MFXA 2PR5A 4NXFA 4KUOA 3FPWA 4WLAA 3E98A 1GSWA 2PT7A 3B47A 3R4KA 3GECA 4ZRRA 3S7OA 3T4OA 3V67A 4B93A 1UWNX 2OAP1 3KSIA 4NEED 3F1NB 4BMWA 1OJ5A 1MC0A 4OOMA 1N9OA 4RQ9A 4AFIA 4GLQA 4EEPA 5HDDA 4O0PA 3C2WA 4DJ2A 3PBQA 3IS2A 5HL6A 3A0SA 2GNXA 3T4LA 3D3OA 5KSHA 2W3FA 3KSGA 1KOUA 3FPVA 4G3KA 3CI6A 3A0VA 4JGOA 5MC7A 3SW1A 3UB7A 2IA2A 1X0OA 4I38A 2Z6DA 3F1OB 2PDRA 3IBJA 4KQOA 4UQIS 3H82A 5IT5A 2XSSA 2Y8HA 5KIZA 4Q0IA 1W63M 4FOFA 2V1BA 1LSXA 4R70A 5TBMA 1ZTUA 2QHKA 3E4PA 1OTBA 2QYBA 3BWLA 2GX5A 3EEAA 1LSVA 4PHTA 4Y2FA 3HJKA 4WEKA 2LB9A 3NOTC 1DRMA 4EESA 1P0ZA 3C38A 5IU1A 2V0UA 4GJ4A 2PYPA 4I3JA 2J3WA 1OTIA 5F5YA 3EQUA 3EWKA 4ME4A 4MDZA 4WUJA 3W2ZA 2XA7M 2ZOHA 2JN7A 4PKYA 2A24B 2EWVA 2JKRM 4LPZA 1MZUA 4CLCA 3EOIA 2K2NA 5AJGA 5TBMB 3ZYTA 1S1YA 2JKTM 1LL8A 3UMDA 2XROA 3TE8A 1OT9A 2MJ6A 4IUHA 2VGLM 2HV1A 2QJ7A 5F69A 1T18A 4OOLA 2O99A 1P9RA 3TW8A 2VV8A 3ZQ5A 3UB8A 2VX8A 1LT0A 2W0NA 2HJ9C 1YSQA 4JGQA 4F3LB 4HJ6A 3BY8A 4WL9A 1N9NA 4WELA 3R7WA 4YNRA 4YOFA 4HH3A 4KQDA 1TS6A 2P08A 1TS7A 5I5LA 2W3HA 3HCYA 3UE6A 5F68A 4H6JB 3TRCA 3O5YA 5AVFA 5EFWA 1VB6A 1NRJA 1P97A 2B02A 2VKSA 2P7JA 2W3EA 4UQIM 1F5MA 3T4KA 2K7SA 1BYWA 1YSPA 4ARZB 3PYPA 4BBVA 4CLCC 4G3VA 5HWWA 2VV6A 3LYXA 2XRNA 2FH5A 2W1TA 3H7WA 1F9IA 4Q0HA 3MQOA 1GSXA 1S66L 2JKTI 2QWSA 5J4EA 4IJGA 4EQ1A 3F1PA 4MN7A 3CWFA 1V9YA 3ICYA 3MQ0A 3C8CA 4P6ZM 3T4QA 2HF6A 3JVUA 4Z1WA 1OT6A 2KLIA 1S1ZA 2KOIA 2PYRA 5L8MA 1GSVA 2EWWA 3U2AA 4LRXC 3NOPC 5J3WA 3VV4A 2Y79A 2WKQA 2EA9A 3LIFA 3T4SA 1F98A 2L0WA 3K2NA 4Y3IA 3EGXC 4WN5A 4NXGA 3HJIA 1D06A 1TF1A 3PBOA 4HNBA 4HJ4A 3NHQA 4Q0JA 3F1PB 1MKMA 2FZ0A 2PD8A 3CUEA 4GHIB 1NLYA 3LI8A 3PR6A 2VA0A 2INWA 4PKYG 2KX6A 2VV7A 1S4SA 2B18A 3H82B 2I9VA 3KSHA 4PAUA 1T1BA 4I39A 4LRYC 1T1AA 4IUKA 1N9LA 3P7NA 4I3IA 2WKRA 4CQHA 3T4TA 5FL3A 3E0YA 2DMWA 4O8GA 2M7UA 2A2LA 4DJ3A 3KYQA 4HP9A 3VOLA 5AVEA 3MXQA 2BASA 4XT2A 4BWIA 4F3LA 3PHYA 3K3CA 3LIDA 2PR6A 4EXOA 3NOUC 1OTAA 4EU0A 2PD7A 2O9CA 3EEHA 1WA9A 3S7PA 4GS9A 3FG8A 2LB5A 4H6JA 3B33A 4JGPA 2Z6CA 4BBUA 3PBNA 5HD5A 4ETXA 2GZAA 2OAQ1 3KSFA 5CX7A 4WF0A 5LBRA 1S67L 2YKHA 3LICA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J4E A;  1OJG A;  1X0O A;  4LRZ E;  4NXE A;  3F1P A;  4I38 A;  4EQ1 A;  2Z6D A;  3H7W B;  3F1O B;  3CWF A;  4M4X A;  3H9W A;  3E4Q A;  2PDR A;  3H82 A;  1V9Y A;  3ICY A;  4R3A A;  3C8C A;  4R6L A;  3CAX A;  5KIZ A;  2V1A A;  2KDK A;  2R78 A;  2V1B A;  1LSX A;  2L4R A;  4JGO A;  4R70 A;  5TBM A;  1OT6 A;  3MJQ A;  2QHK A;  3E4P A;  1OTB A;  3BWL A;  5J7E A;  1S1Z A;  2PYR A;  1XFQ A;  2ZOI A;  1GSV A;  1LSV A;  3KX0 X;  2V9A A;  3HJK A;  1XJ6 A;  2PHY A;  3NOP C;  4LRX C;  5J3W A;  3NOT C;  1DRM A;  3UB9 A;  1P0Z A;  2M1C A;  4EES A;  5IU1 A;  2H28 A;  2V0U A;  2EA9 A;  2WKQ A;  3LIF A;  2GJ3 A;  5DKL A;  2PYP A;  4HJ3 A;  3LIB A;  1F98 A;  4I3J A;  5IS1 A;  2L0W A;  1OTI A;  2QKP A;  5F5Y A;  4WN5 A;  5HZH A;  4NXG A;  3EWK A;  2A24 A;  1XJ3 A;  1JNU A;  1D06 A;  3HJI A;  3G6O A;  4HNB A;  4R38 A;  4HJ4 A;  4HIA A;  5HD3 A;  3NHQ A;  4YWZ A;  4WUJ A;  4L9E A;  1T1C A;  3UB6 A;  2ZOH A;  2JN7 A;  4PKY A;  2CMN A;  1NWZ A;  2A24 B;  3F1P B;  3MR0 A;  5HDS A;  3F1N A;  4HY8 A;  5F6A A;  4LPZ A;  3F1O A;  5DJU A;  2PD8 A;  2ZBB A;  4HH2 A;  3OLO A;  4GHI B;  4GW9 A;  1MZU A;  3VE3 A;  3LIA A;  3LI8 A;  4KUK A;  4E04 A;  3GDI A;  3VE4 A;  3D72 A;  2JHE A;  2INW A;  1D7E A;  4PKY G;  4EEU A;  3E4O A;  2WKP A;  2D02 A;  1XJ2 A;  5HDC A;  4HI4 A;  5TBM B;  3MQQ A;  1S4R A;  4EER A;  1S1Y A;  2KX6 A;  3UMD A;  1LL8 A;  5G4Z A;  2VV7 A;  4BBT A;  1S4S A;  3IS2 B;  4HOI A;  2QJ5 A;  2I9V A;  1OT9 A;  2VEA A;  3FC7 A;  3H82 B;  2OOL A;  3LUQ A;  4NXB A;  1V9Z A;  1T1B A;  1Y28 A;  5HWT A;  3NJA A;  4L9G A;  2HV1 A;  1TS8 A;  4I39 A;  2QJ7 A;  2V0W A;  3BY9 A;  3RH8 B;  5F69 A;  1T18 A;  1DP9 A;  3A0R A;  5A8B A;  5HWV A;  5G4Y A;  4EET B;  4LRY C;  3K3D A;  1T1A A;  4I3A A;  3T50 A;  5DKK A;  5HSQ A;  1N9L A;  2VV8 A;  3P7N A;  1OTD A;  3CLO A;  4LLO B;  3LI9 A;  4I3I A;  4MN6 A;  3ZQ5 A;  2WKR A;  2OWH A;  1TS0 A;  4GCZ A;  2YKF A;  4MN5 A;  4B9O A;  3UB8 A;  4EW7 A;  1ODV A;  1LT0 A;  2VLG A;  2W0N A;  3SW1 A;  1LSW A;  1T19 A;  1EW0 A;  4HHD A;  3LIE A;  4JGQ A;  4L9F A;  4F3L B;  4HJ6 A;  3BY8 A;  2J80 A;  4WL9 A;  4DJ3 A;  1N9N A;  4HP9 A;  2D01 A;  4K08 A;  3MFX A;  3VOL A;  2L1M A;  2PR5 A;  4HH3 A;  4NXF A;  4KUO A;  4KQD A;  3MXQ A;  1TS6 A;  2BAS A;  4WLA A;  5AVE A;  1GSW A;  1TS7 A;  4XT2 A;  5I5L A;  4F3L A;  3GEC A;  3PHY A;  3UE6 A;  1XFN A;  1UWN X;  3K3C A;  5F68 A;  3LID A;  1UWP X;  2W27 A;  3F1N B;  4H6J B;  2PR6 A;  1G28 A;  1DP8 A;  1OJ5 A;  4GHI A;  1N9O A;  3NOU C;  4HP4 A;  1OTA A;  4I5S A;  2PD7 A;  4RQ9 A;  4XT2 B;  5EFW A;  5AVF A;  5HDD A;  1VB6 A;  3ULF A;  4EEP A;  1P97 A;  3EEH A;  1WA9 A;  2B02 A;  1UGU A;  2P7J A;  4GS9 A;  3FG8 A;  1DP6 A;  3C2W A;  4H6J A;  3B33 A;  4JGP A;  2K7S A;  4DJ2 A;  1BYW A;  5DJT A;  2Z6C A;  3PYP A;  3RTY A;  4BBV A;  1OTE A;  4BBU A;  3IS2 A;  4JGR A;  5HWW A;  3A0S A;  4GS9 B;  5HD5 A;  2VV6 A;  4HQA A;  3LYX A;  3UME A;  4EXO A;  2OWJ A;  3H7W A;  1F9I A;  1KOU A;  3MQO A;  1GSX A;  1XJ4 A;  4WF0 A;  1S66 L;  3A0V A;  1S67 L;  2YKH A;  3IBR A;  3LIC A;  2QWS A;  3UB7 A; 
#chains in the Genus database with same CATH topology
 4KQQ A;  1YLY A;  1F2K A;  3W4O A;  2KDK A;  3VMA A;  1BUL A;  1H8Z A;  2HDQ A;  5F82 A;  2L4R A;  2ZQD A;  3A3J A;  3PBR A;  4JKT A;  3MSH A;  3QP1 A;  3Q7V B;  4KZ5 A;  5CTN A;  2H28 A;  2GJ3 A;  4ZBE A;  3FV7 A;  1SCW A;  4E3J A;  3G34 A;  1L0G A;  4DRT A;  5HDS A;  1SZV A;  4CPK A;  1I2S A;  2VZW A;  1P9W A;  1MBL A;  3LR3 A;  4E04 A;  4X56 A;  1ZKJ A;  2W1R A;  1K4E A;  2VK3 A;  3HUN A;  1LHY A;  3B42 A;  3BLS A;  1V9Z A;  1VET B;  1IOU A;  3BY9 A;  4BJP A;  1H0M A;  2Y55 A;  3NCK A;  4LLO B;  1OTD A;  3BFE A;  3LI9 A;  1LSW A;  5A91 A;  3JVV A;  1W7F A;  3CMZ A;  2J80 A;  4ETZ A;  2E8I A;  5FAQ A;  4YIN A;  3IWO A;  1AWI A;  1NLZ A;  1K4F A;  1MY8 A;  2NUT C;  2PAV P;  2IWB A;  3OOV A;  4G3W A;  3IF6 C;  3HUO A;  4R1G A;  3UME A;  4C6Y A;  2HP9 A;  5GLA A;  5EOO A;  4E6X A;  2V1Z A;  1ERM A;  4P6Z S;  3M2K A;  1EWZ A;  4OON A;  4M4X A;  3CUE C;  3AGF A;  2R78 A;  2HZ5 A;  4FCF A;  3O87 A;  3C5A A;  5JYO A;  3G30 A;  3LEQ A;  3UB5 P;  2V9A A;  1D1J A;  2XH9 A;  1W5D A;  3C7V A;  5IS1 A;  3UY6 A;  4OOY A;  4C75 A;  5U47 A;  2A24 A;  1XJ3 A;  4KZ9 A;  4R38 A;  2VJW A;  1GCE A;  2K31 A;  3NDG A;  3MR0 A;  3PBS A;  3C30 A;  3DTI A;  4XUX A;  4IVK A;  3D72 A;  2JHE A;  3WS5 A;  2C6W B;  2J8Y A;  4JPM A;  4HI4 A;  5DTT A;  4NK3 A;  4EER A;  1ONG A;  3VP4 A;  4QY5 A;  2VEA A;  3FC7 A;  3IH8 A;  3GV9 A;  3LR0 A;  2A49 A;  2M7V A;  4S2N A;  3BFF A;  4B9O A;  2ZQ7 A;  3HRE A;  2ZM8 A;  4II7 A;  3PAE A;  2Y2J A;  2D01 A;  1K55 C;  4BLM A;  4OQI A;  1HD8 A;  3B47 A;  1BSG A;  3C4P A;  1UWN X;  3WWX A;  4BMW A;  1VEU A;  1OJ5 A;  1SDE A;  3WS0 A;  3G31 A;  1Z6F A;  3ZVW A;  4B4Z A;  3GQZ A;  4LGW A;  2WZZ A;  1K56 A;  3TG9 A;  3G4P A;  1CQA A;  5KSH A;  3KSG A;  4E3M A;  1XKZ A;  1XX2 A;  3UB7 A;  2IA2 A;  4PM7 A;  1Y54 A;  3IBJ A;  4OPR A;  4E3I A;  5IT5 A;  5DTK A;  2XSS A;  3TSG A;  2WUQ A;  5FQJ A;  4Q0I A;  4R70 A;  5FQK A;  4OPZ A;  2HP6 A;  4OQH A;  2ZC5 B;  1ES5 A;  3EEA A;  3DTM A;  1NXY A;  4EES A;  1PIO A;  3UDX A;  4S2M A;  1QME A;  4GJ4 A;  3V50 A;  3BEC A;  5L10 A;  5HAP A;  4ME4 A;  1K56 D;  3FYZ A;  5FAO A;  3VP1 A;  4R3J A;  1FIK A;  1CK3 A;  1GA0 A;  1H8Y A;  4EBL A;  3IWI A;  1KDS A;  3KYE A;  5GHX A;  4K0W A;  4R23 A;  5TBM B;  4ID4 A;  3UMD A;  2XRO A;  4FD8 A;  1FCN A;  2VGL M;  4DDY A;  2JE5 A;  4EBP A;  1S0W A;  5F69 A;  2RL3 A;  4OOL A;  5CEC A;  4ESP A;  3UNW A;  1P9R A;  3BFC A;  1I5Q A;  2VX8 A;  1LT0 A;  4JF4 A;  4YFM A;  2HJ9 C;  3GR2 A;  4OH0 A;  3R7W A;  3S1Y A;  4KQD A;  5M1A A;  2P08 A;  5HAR A;  2W3H A;  5AVF A;  1J3W A;  3O3V A;  2WAE A;  2BTF P;  4Y0O A;  4UAA A;  1KE0 A;  5FDH A;  4Q8I A;  1YSP A;  3PYP A;  4GN2 A;  4CLC C;  2VV6 A;  3LYX A;  5FQI A;  1TDG A;  2EX9 A;  5J4E A;  4IJG A;  1QMF A;  3W8K A;  3MQ0 A;  3T4Q A;  1OT6 A;  3RXW A;  4JXW A;  2KLI A;  4LCL A;  5L8M A;  1GSV A;  1XXM A;  3NOP C;  1CEG A;  3LIF A;  3QNC A;  4Y3I A;  4X6T A;  4HES A;  2Y2H A;  4HNB A;  3IXH A;  3NHQ A;  2DRW A;  2P9V A;  5CED A;  3OPR A;  4DE3 A;  4WZ5 A;  4GDB A;  1K6R A;  2VA0 A;  1VET A;  2H0Y A;  2KX6 A;  3T1S A;  3JPU A;  2I9V A;  3LCE A;  1T1A A;  4IUK A;  1N9L A;  2P74 A;  3AGD A;  4FUW A;  5TR7 A;  4X53 A;  2XD5 A;  3BFG A;  2Y2G A;  2M7U A;  2A2L A;  1H5X A;  3VOL A;  3MXQ A;  4R4S A;  4WZ4 A;  4BWI A;  5AQ7 A;  1BLS A;  4WBG A;  2AVX A;  1OTA A;  4EU0 A;  1OME A;  2O9C A;  1CJF A;  5EUA A;  4JGP A;  2EFU A;  2RCX A;  4QB8 A;  1VM1 A;  4IBR A;  3ISG A;  2GZA A;  4WM9 A;  1VEU B;  3LIC A;  3VOZ A;  1OJG A;  1G5U A;  2W1T B;  3H7W B;  3ZNT A;  4A5R A;  1K25 A;  2FFY A;  3IX4 A;  4S2O A;  4GOG A;  3CAX A;  4MMN A;  2O0Y A;  2HJE A;  2HGV A;  3KX0 X;  2Y2O A;  2ZJ9 A;  4F94 A;  2VGJ A;  2Y91 A;  3LIB A;  2V20 A;  4WMC D;  3S7N A;  1VHM A;  5CGX A;  2G7U A;  5AQ9 A;  3QP5 A;  2ZQ9 A;  4HH2 A;  4QPR A;  1RGZ A;  5C5K A;  5CHJ A;  5HAQ A;  3ZGA B;  4EEU A;  3E4O A;  3MQQ A;  3UO9 A;  2EXB A;  2PBD P;  2P04 A;  4Y15 A;  3A0R A;  1ZHH B;  2OV5 A;  1M40 A;  5HPF A;  2OLV A;  2H0T A;  3MMH A;  4GCZ A;  5EVI A;  1EW0 A;  4GKU A;  3LIE A;  4NKP A;  2X01 A;  3IX3 A;  2JBF A;  2QPN A;  4NET A;  1KGE A;  1XFN A;  1KVM A;  1G28 A;  4GHI A;  3P98 A;  4HP4 A;  5L07 A;  5EVI B;  2E8J A;  1JWV A;  4KZB A;  1UGU A;  5AQA A;  1DP6 A;  3N8S A;  1SKF A;  5DVA A;  4JXV A;  3RTY A;  4JGR A;  1H3Q A;  2Y4A A;  4GS9 B;  2J3T D;  4HQA A;  3GTC A;  1EI5 A;  2X02 A;  1XJ4 A;  4ZJ1 A;  3IBR A;  3QP4 A;  2OLU A;  3E4Q A;  4EUV A;  5EM1 A;  5DF9 A;  3OC2 A;  2XFT A;  1KE4 A;  3LY3 A;  1BLH A;  5J7E A;  2X71 A;  3UN7 A;  4L0L A;  5JYP A;  3OZH A;  3UB9 A;  2M1C A;  4GD6 A;  2QKP A;  1BZA A;  4DMZ A;  5HPI A;  1YKD A;  5DFY A;  1FQG A;  1NWZ A;  5E2H A;  5F6A A;  3RJU A;  4B88 A;  2HDR A;  1G6O A;  1D7E A;  1XJ2 A;  4P0M A;  2W3G A;  3DBA A;  4PM8 A;  3BEB A;  1S4R A;  1K57 C;  4BBT A;  4HOI A;  4NXB A;  4U0X A;  3BQA A;  4L9G A;  1TS8 A;  4E3L A;  3IQA A;  4O7D A;  2XQZ A;  2QMI A;  3T50 A;  3GSG A;  2DCF A;  4MN5 A;  4UA6 A;  2GDN A;  1PFL A;  3DW0 A;  1T19 A;  3RXX A;  2ZMF A;  5GL9 A;  3T4J A;  3C4O A;  3LY4 A;  3EGD C;  5EE8 A;  3MFX A;  4WZ5 C;  3MFD A;  2PR5 A;  4KUO A;  2PT7 A;  2XEP A;  4ZRR A;  3GEC A;  5G18 A;  3T4O A;  3JYI A;  1LL5 A;  1ESI A;  1NYY A;  1MC0 A;  4OOM A;  4GLQ A;  5CXW A;  1K55 A;  4O0P A;  2EFX A;  4DJ2 A;  2WGV A;  1NZU A;  3PBQ A;  1JWP A;  3IS2 A;  5HL6 A;  1IYP A;  2HDU A;  1SDN A;  2GNX A;  3T4L A;  1Q2P A;  2EX6 A;  4G3K A;  4JGO A;  5MC7 A;  3SW1 A;  2XDM A;  1X0O A;  4I38 A;  2Z6D A;  5CHM A;  4Y17 A;  2WGW B;  4UQI S;  3H82 A;  4OP8 A;  5GLB A;  4GD8 A;  2IWD A;  4FOF A;  3NIA A;  5TBM A;  1ZTU A;  2QHK A;  4MBH A;  2QYB A;  1S6R A;  3BLM A;  4PHT A;  2LB9 A;  5IU1 A;  2V0U A;  5EV0 A;  1ALQ A;  1FCM A;  1OTI A;  5F5Y A;  3LGO A;  4MDZ A;  3VSK A;  4WUJ A;  2XA7 M;  4PKY A;  2A24 B;  2EWV A;  4EUZ A;  1VQQ A;  4LPZ A;  3UPP A;  4CLC A;  2EX2 A;  3ITA A;  4XXR A;  5AJG A;  1DY6 A;  1L0D A;  1ZG6 A;  1JTD A;  5A90 A;  2JKT M;  3MKE A;  3A3F A;  3FKW A;  4DE0 A;  1O7E A;  2HV1 A;  4KG6 A;  1T18 A;  2OSU A;  3ZDJ A;  1WYC A;  3TW8 A;  3ZQ5 A;  4KZA A;  1XA7 A;  1YLT A;  4BEN A;  3UB8 A;  1YSQ A;  4HJ6 A;  5EPH A;  1N9N A;  4WEL A;  4EQI A;  1TS7 A;  1K6S A;  3HCY A;  3UE6 A;  4BD0 A;  4H6J B;  4MBK A;  5DF8 A;  4JLF A;  5EFW A;  4S2J A;  1P97 A;  4Y13 A;  1F5M A;  2K7S A;  3MZD A;  4U0T A;  1BYW A;  1PI5 A;  2PBY A;  3UE1 A;  5A93 A;  4G3V A;  3IF6 A;  1KVL A;  2XRN A;  1YT4 A;  2W1T A;  3H7W A;  1F9I A;  1S66 L;  5DTS A;  4OLD A;  2QWS A;  1MWR A;  3CJM A;  5I94 A;  2HF6 A;  4Z1W A;  1YQS A;  1RCJ A;  5E43 A;  3HLG A;  3IHA A;  3MZF A;  1MWT A;  2EWW A;  3U2A A;  2WKQ A;  1LI9 A;  3T4S A;  4PM9 A;  1F98 A;  5FAT A;  2JKF A;  2L0W A;  3EGX C;  1D06 A;  3GVB A;  2I72 A;  2CC1 A;  4KEN B;  5FI6 A;  5FEF A;  5KSC A;  2V8F A;  3F1P B;  2PD8 A;  3NBL A;  1NLY A;  3GMW A;  4OLG A;  2VV7 A;  1S4S A;  3H82 B;  4P6B A;  2WKI A;  1BUE A;  4ZTK A;  5F1F A;  2C5W B;  1DJC A;  4I3I A;  1CI9 A;  2WKR A;  3HVF A;  4R3B A;  4S2N C;  3T4T A;  4BL2 A;  1N9B A;  4JXS A;  2Y2Q A;  4DJ3 A;  4FH2 A;  2ZC7 A;  1NYM A;  5AVE A;  3G2Z A;  2BAS A;  3IH9 A;  3K3C A;  2PR6 A;  3NOU C;  2PD7 A;  1WA9 A;  3B33 A;  3ZG8 B;  3CHW P;  4ETX A;  3SOI A;  3LEZ A;  1ERQ A;  4MLL A;  2XFS A;  4QJG A;  5E2G A;  2YKH A;  3IT9 A;  4QU3 A;  5GLC A;  3LR5 A;  1PWC A;  4CLC D;  2Q0O A;  4R3A A;  3T12 B;  2Y2K A;  3QNB A;  3MJQ A;  2XA7 S;  2ZOI A;  4UEY A;  5BOH A;  5F1G A;  4KG5 A;  2UWX A;  5DKL A;  3BW6 A;  4DN0 A;  4OQG A;  1E4D A;  4HIA A;  4IBX A;  3UB6 A;  1ACF A;  2EX8 A;  4MEZ A;  4HY8 A;  2ZL1 B;  3OLO A;  3OBF A;  5FI2 A;  1GA9 A;  2O9B A;  1YMX A;  2D02 A;  3HLW A;  4GDN A;  4X55 A;  5DFX A;  2NUP C;  2QJ5 A;  3HLE A;  3WS2 A;  5HWT A;  3RH8 B;  4N1X A;  1RP5 A;  4O01 A;  5HSQ A;  5CGS A;  3KYZ A;  1TS0 A;  4EW7 A;  4X69 A;  2O9A A;  3HLD A;  4RX2 A;  1Q2Q A;  2Y2N A;  2J3T C;  5FDS A;  4Z9Q A;  3PBT A;  2V8C A;  4QHC A;  2W27 A;  4MCW A;  3OCN A;  1W63 Q;  1DP8 A;  1NZO A;  4X68 A;  4IHQ A;  1KGG A;  3N6I A;  1IYQ A;  5DJT A;  3OCL A;  1CI8 A;  1JWZ A;  3N8L A;  3E2L A;  3U4L P;  1PRQ A;  2WGI A;  3HUM A;  3ZHH A;  3W4Q A;  5HL1 A;  3P01 A;  3S7Q A;  1L3L A;  1PZO A;  1W8Q A;  2V1A A;  4LEN A;  3OPH A;  4IVI A;  1XFQ A;  3M2J A;  4HBT A;  2PHY A;  4LFU A;  4KZ7 A;  1E3U A;  1JNU A;  3R7W B;  1YAX A;  3NEC A;  2HP5 A;  3O86 A;  4HEF A;  1K57 A;  3W4P A;  2CMN A;  1JTG A;  5AQB A;  1XGI A;  2ZBB A;  4GW9 A;  1FOF A;  3E2K A;  3MF0 A;  5F83 A;  3VE3 A;  4KUK A;  3GDI A;  5EEC A;  3VOY A;  3ZNY A;  1IEM A;  4QWO A;  2WKP A;  4H8R A;  2Y59 A;  5CTM A;  1IFQ A;  1Y28 A;  4KZ6 A;  3TJZ C;  3UDI A;  3BJN A;  4E6W A;  2V0W A;  4BL3 A;  1DP9 A;  4N92 A;  5A8B A;  1STZ A;  5G4Y A;  1TD5 A;  4I3A A;  2HPB A;  3Q7V A;  4MNR A;  2OWH A;  4X1M A;  3BM6 A;  3LR4 A;  4ZJ3 A;  1H8M A;  4JBF A;  3SH8 A;  4NXF A;  2ZD8 A;  3FPW A;  4WLA A;  1GSW A;  5EOE A;  3R4K A;  3S7O A;  2JCH A;  4B93 A;  4NEE D;  3KSI A;  4RQ9 A;  3SS5 A;  5HDD A;  3C2W A;  4K0X A;  4P85 A;  5EVL A;  3D3O A;  4N9L A;  4RVA A;  4S2I A;  1NY0 A;  3FPV A;  1PZP A;  1TDL A;  3NY4 A;  3UE0 A;  3QP8 A;  3ZFZ A;  2PDR A;  4KQO A;  2Y8H A;  1W63 M;  2V1B A;  3E4P A;  1ESU A;  1LSV A;  4Y2F A;  3HJK A;  4WEK A;  1XPB A;  1DRM A;  1P0Z A;  2XF3 A;  4I3J A;  1CEF A;  3DTE A;  3EQU A;  2J9P A;  3W2Z A;  3MBZ A;  2JN7 A;  2J9O A;  2ZLY A;  3MXS A;  5FSR A;  1ES4 A;  3EOI A;  2P9V B;  4GB7 A;  3N4I A;  3CPT B;  1A0K A;  4D2O A;  3ZYT A;  1S1Y A;  4E3K A;  1LL9 A;  3OPL A;  1OT9 A;  3B3X A;  3VSL A;  1W8Y A;  1FIL A;  1I2W A;  1K0K A;  2B5R A;  2Z2L B;  5CGW A;  5DF7 A;  5CER A;  2EXA A;  4PMA A;  3CPT A;  1ES2 A;  2W0N A;  3BY8 A;  5EVI C;  4YNR A;  4YOF A;  2PU2 A;  4LCM A;  3G32 A;  5KMW A;  5F68 A;  5HX9 A;  4DE1 A;  1ZG4 A;  1VB6 A;  1NRJ A;  2B02 A;  2W3E A;  2P7J A;  3T4K A;  4R0Q A;  4ARZ B;  5FQQ A;  5HWW A;  4E3N A;  1E3U D;  3V3R A;  2BG1 A;  1KE3 A;  4ZAM A;  4PM5 A;  3FKV A;  4Q0H A;  3P09 A;  1GSX A;  3L9K A;  2DNS A;  2JKT I;  4LV1 A;  1WE4 A;  4FH4 A;  3F1P A;  1Y4O A;  4MN7 A;  4UHU A;  2ZQA A;  4P87 A;  1HTZ A;  1V9Y A;  3ICY A;  3C8C A;  5GLD A;  2B95 A;  5E2F A;  4S2K A;  2XK1 A;  3N8R A;  4ZDX A;  1S1Z A;  1NRF A;  2PYR A;  3IXD A;  2Y79 A;  2WKH A;  2EA9 A;  1K38 A;  1DJB A;  3IF6 B;  3K2N A;  4WN5 A;  4NXG A;  3NUL A;  1J9M A;  4EWF A;  4Q0J A;  1KDW A;  3WS1 A;  2XR0 A;  1AXB A;  1MKM A;  2V2F F;  1PYY A;  4GHI B;  2QZ6 A;  3D9Y A;  1SHV A;  2INW A;  4PKY G;  1IYS A;  3SH9 A;  4X25 A;  2B18 A;  3UPN A;  3KSH A;  4PAU A;  2UV0 E;  1T1B A;  3A3E A;  4DKI A;  1NJ4 A;  2Q9N A;  2Y2I A;  5EVI D;  4EV4 A;  3A3D A;  2WAD A;  3HLC A;  3P7N A;  1YMS A;  1MWU A;  4CQH A;  3SH7 A;  3MKF A;  4X1L A;  5J8X A;  2G2U A;  3KYQ A;  3TOI A;  1LLB A;  3I7J A;  1TEM A;  3IXB A;  4F3L A;  3PHY A;  3T1Q B;  4RYE A;  3VP3 A;  5TGF A;  1YLP A;  4RA7 A;  3EEH A;  3S7P A;  4H6J A;  1IYO A;  3CG5 A;  3CZD A;  3ZG0 A;  1HLU P;  4BBU A;  1MKI A;  3DTK A;  3M6B A;  3PBN A;  3HL9 A;  2H10 A;  5HAI A;  2R9X A;  2OAQ 1;  3KSF A;  3A3I A;  3NDE A;  5FEG A;  5LBR A;  1S67 L;  2XLN A;  3H9W A;  1W79 A;  2W3D A;  1OPX A;  3FZC A;  4KZ4 A;  2JKG A;  2VGL S;  4CLC E;  3WRT A;  3SZT A;  4JXG A;  1HZO A;  4CLC B;  2VGK A;  3GRJ A;  4HJ3 A;  4CJN A;  4Y0T A;  1PW8 A;  4RX3 A;  4FTX A;  4WYY A;  3ZCZ A;  3G6O A;  5L2F A;  4YWZ A;  3AGE A;  4L9E A;  4DE2 A;  1BLC A;  4UA9 A;  3PXP A;  3F1N A;  4HBU A;  3F1O A;  3D4F A;  4Y7P A;  5FA7 A;  3L7H A;  5K5B A;  2Y2P A;  2ZMV A;  4U3T A;  3VE4 A;  4LV3 A;  3MS6 A;  1WYB A;  5HDC A;  3IF5 A;  5G4Z A;  3CIT A;  3SS3 A;  3IS2 B;  3G2Y A;  3S22 A;  2OOL A;  5FAS A;  1PNE A;  4GZB A;  5EM0 A;  3RFB A;  3OPP A;  5HWV A;  3SS4 A;  3QHY A;  4N1H A;  5DKK A;  3WRZ A;  3DWZ A;  1IKG A;  4ZJ2 A;  1G68 A;  3CLO A;  4MN6 A;  3KO6 A;  2YKF A;  2WK0 A;  1ODV A;  2VLG A;  4HHD A;  3QP6 A;  5D3O A;  1C3B A;  2JKR I;  4KZ8 A;  4DXB A;  2L1M A;  3EQV A;  3HLB A;  4UA7 A;  1O07 A;  1UWP X;  4R4R A;  4WEJ A;  4Y5F A;  2ZQC A;  4I5S A;  4XT2 B;  3ULF A;  1SKO B;  1FR1 A;  3LFV A;  1OTE A;  1K54 A;  2ACG A;  4K91 A;  2ZMA A;  4KG2 A;  2OWJ A;  4WMC A;  1ZC2 A;  2Z2M B;  1SKO A;  4KQR A;  4LRZ E;  4C3Q A;  4NXE A;  2ZC4 B;  5FAP A;  1K54 C;  4OQ0 A;  4ARZ A;  4R6L A;  4GNU A;  3NC8 A;  5TJJ A;  1XJ6 A;  3IXG A;  1XA1 A;  3ZVT A;  3UE3 A;  1XP4 A;  1ES3 A;  3DWK A;  5HZH A;  4PPR A;  3IHB A;  5HD3 A;  1T1C A;  5CEB A;  4LV0 A;  5DJU A;  4B4X A;  1MPL A;  3LIA A;  5HW3 A;  3IWQ A;  2ZM2 A;  4EBN A;  5TFQ A;  2ZL1 A;  3LUQ A;  5GHY A;  2J7V A;  3NJA A;  3O88 A;  3Q07 A;  4PM6 A;  1KGF A;  3WS4 A;  4EET B;  4BQM A;  3K3D A;  4BD1 A;  2R9W A;  5L09 A;  3BQ8 A;  4KZ3 A;  2G2W A;  4L9F A;  1GHP A;  5E2E A;  4FSF A;  4K08 A;  4DXC A;  3T1X A;  3E98 A;  4S2L A;  1M6K A;  2PU4 A;  3V67 A;  2Y2M A;  2OAP 1;  3F1N B;  1JVJ A;  3MXR A;  4AFI A;  1N9O A;  4EEP A;  1ONH A;  3ZG5 A;  4OP5 A;  4E3O A;  3ZG7 B;  3HBR A;  1YPR A;  3A0S A;  3LO7 A;  3MZE A;  2W3F A;  1KOU A;  3CI6 A;  1XGJ A;  3A0V A;  3F1O B;  4NG2 A;  1PWD A;  5KIZ A;  5HFO A;  2WAF A;  1LSX A;  1OTB A;  3BWL A;  2GX5 A;  3HLF A;  3NOT C;  3C38 A;  4DF6 A;  3ZG9 B;  1MWS A;  2PYP A;  2J3W A;  4OKP A;  1YM1 A;  1LI0 A;  3EWK A;  2XD1 A;  3V39 A;  2ZOH A;  3BRM A;  2JKR M;  1Z09 A;  1IEL A;  2JC7 A;  3FWL A;  1MZU A;  1G6A A;  2K2N A;  2H5S A;  1LL8 A;  3TE8 A;  1YLJ A;  2WZX A;  3UPO A;  2MJ6 A;  4IUH A;  1CF0 A;  3VP0 A;  4OVD A;  5CHU A;  1L2S A;  4MBF A;  2QJ7 A;  4LV2 A;  2HDS A;  4XUZ A;  3G35 A;  1L0E A;  2O99 A;  2VV8 A;  1PWG A;  4D60 A;  1MXO A;  5FI7 A;  1FSY A;  5FQ9 A;  3PAG A;  1IKI A;  4JGQ A;  4F3L B;  4WL9 A;  4JF5 A;  2ZC6 B;  4HH3 A;  1FSW A;  1TS6 A;  5I5L A;  2BLS A;  5EVE A;  3TRC A;  3O5Y A;  3QP2 A;  5M18 A;  2VKS A;  1BLP A;  3NI9 A;  4UQI M;  4BBV A;  4OPQ A;  3VP2 A;  1U60 A;  2IWC A;  1RGY A;  3PTE A;  3S4X A;  3MQO A;  2XGN A;  5FQM A;  4EQ1 A;  3CWF A;  3DAV A;  1TVF A;  4P6Z M;  3JVU A;  2FFF B;  3VFH A;  2A3U A;  3M6H A;  1GHI A;  2KOI A;  1PW1 A;  4LRX C;  5J3W A;  3VV4 A;  1E25 A;  4DDS A;  3T1R A;  1BT5 A;  3UDF A;  2PRF A;  3BFD A;  2WKE A;  3HJI A;  1TF1 A;  3Q82 A;  3PBO A;  4HJ4 A;  5A92 A;  2Q9M A;  1FR6 A;  4N9K A;  3IX8 A;  1BTL A;  2FZ0 A;  3CUE A;  4QD4 A;  3Q1F A;  3LI8 A;  1YLW A;  3PR6 A;  3VFF A;  1ERO A;  4JF6 A;  1L0F A;  3Q7Z A;  2ZC3 B;  1N4O A;  1PI4 A;  4I39 A;  4Y0U A;  1GHM A;  2WYX A;  2ZM0 A;  3V3S A;  4LRY C;  3Q81 A;  5FL3 A;  4S2P A;  3E0Y A;  5GHZ A;  2DMW A;  2ZQ8 A;  3N7W A;  4O8G A;  5CRF A;  4HP9 A;  2Y2L A;  2WGW A;  4XT2 A;  4OPY A;  3BYD A;  4M3K A;  3LID A;  4EXO A;  3ITB A;  4GS9 A;  4QY6 A;  3FG8 A;  2LB5 A;  1HVB A;  3V5M A;  5IHV A;  2Z6C A;  1FCO A;  4IED A;  1DJA A;  5HD5 A;  5KZH A;  1YLZ A;  5CX7 A;  3C7U A;  4WF0 A;  2FH5 A;  5M19 A; 
#chains in the Genus database with same CATH homology
 1OJG A;  2W1T B;  3H7W B;  3LR5 A;  4CLC D;  3H9W A;  4R3A A;  2W3D A;  3CAX A;  1OPX A;  4MMN A;  2KDK A;  2O0Y A;  2L4R A;  3MJQ A;  2XA7 S;  3PBR A;  2HJE A;  2HGV A;  2VGL S;  2ZOI A;  3KX0 X;  4UEY A;  4CLC E;  2H28 A;  5DKL A;  2GJ3 A;  4CLC B;  4HJ3 A;  3LIB A;  3BW6 A;  3S7N A;  4DN0 A;  3G6O A;  4HIA A;  1VHM A;  4YWZ A;  4L9E A;  2G7U A;  3UB6 A;  5HDS A;  3PXP A;  3F1N A;  4HY8 A;  3F1O A;  4HH2 A;  2VZW A;  1P9W A;  3OLO A;  3OBF A;  4QPR A;  3LR3 A;  5C5K A;  4E04 A;  5K5B A;  3VE4 A;  2ZMV A;  2O9B A;  4EEU A;  3E4O A;  2D02 A;  5HDC A;  2W1R A;  3MQQ A;  5DFX A;  5G4Z A;  3CIT A;  2NUP C;  3IS2 B;  2QJ5 A;  2OOL A;  3B42 A;  2P04 A;  1V9Z A;  5HWT A;  1IOU A;  3RFB A;  3RH8 B;  3BY9 A;  4BJP A;  3A0R A;  1ZHH B;  5HWV A;  4O01 A;  5HSQ A;  5DKK A;  5HPF A;  1OTD A;  3CLO A;  4LLO B;  3LI9 A;  3KO6 A;  4MN6 A;  3KYZ A;  1TS0 A;  3MMH A;  2YKF A;  4GCZ A;  4EW7 A;  1ODV A;  2VLG A;  1LSW A;  4HHD A;  1EW0 A;  2O9A A;  3LIE A;  4NKP A;  3JVV A;  2J3T C;  2J80 A;  2JKR I;  4ETZ A;  2L1M A;  3PBT A;  3EQV A;  1NLZ A;  1XFN A;  1UWP X;  2W27 A;  4WEJ A;  2NUT C;  4MCW A;  3OCN A;  1W63 Q;  4Y5F A;  1G28 A;  1DP8 A;  4GHI A;  4I5S A;  4HP4 A;  4XT2 B;  4IHQ A;  3ULF A;  1UGU A;  3OOV A;  4G3W A;  1DP6 A;  3LFV A;  5DJT A;  3OCL A;  3RTY A;  1OTE A;  4JGR A;  1H3Q A;  4GS9 B;  2J3T D;  4HQA A;  3UME A;  2OWJ A;  1XJ4 A;  3IBR A;  4LRZ E;  4NXE A;  4P6Z S;  4M4X A;  3CUE C;  3E4Q A;  4ARZ A;  4EUV A;  3P01 A;  5DF9 A;  3S7Q A;  3OC2 A;  4R6L A;  2V1A A;  2R78 A;  5J7E A;  1XFQ A;  2V9A A;  1XJ6 A;  2PHY A;  5TJJ A;  4L0L A;  3UB9 A;  2M1C A;  3UE3 A;  5IS1 A;  2QKP A;  5HZH A;  4DMZ A;  2A24 A;  5HPI A;  1XJ3 A;  1JNU A;  1YKD A;  3R7W B;  1YAX A;  4R38 A;  5DFY A;  5HD3 A;  2VJW A;  2K31 A;  1T1C A;  2CMN A;  1NWZ A;  3MR0 A;  3PBS A;  5DJU A;  5F6A A;  2ZBB A;  3C30 A;  4GW9 A;  3MF0 A;  3VE3 A;  3LIA A;  4KUK A;  3GDI A;  3D72 A;  2JHE A;  1G6O A;  1D7E A;  2WKP A;  1XJ2 A;  2W3G A;  4HI4 A;  3DBA A;  1S4R A;  4EER A;  4BBT A;  4HOI A;  4NXB A;  2VEA A;  3FC7 A;  1IFQ A;  3LUQ A;  3BQA A;  1Y28 A;  3TJZ C;  3BJN A;  3NJA A;  4L9G A;  1TS8 A;  3LR0 A;  2V0W A;  1DP9 A;  5A8B A;  1STZ A;  5G4Y A;  4EET B;  2M7V A;  1TD5 A;  3K3D A;  4I3A A;  3T50 A;  2OWH A;  4MN5 A;  4B9O A;  3BQ8 A;  1T19 A;  2ZMF A;  4L9F A;  3T4J A;  4II7 A;  3LR4 A;  3EGD C;  4FSF A;  2D01 A;  4K08 A;  1H8M A;  3MFX A;  2PR5 A;  4NXF A;  4KUO A;  3FPW A;  4WLA A;  3E98 A;  1GSW A;  2PT7 A;  3B47 A;  3R4K A;  3GEC A;  4ZRR A;  3S7O A;  3T4O A;  3V67 A;  4B93 A;  1UWN X;  2OAP 1;  3KSI A;  4NEE D;  3F1N B;  4BMW A;  1OJ5 A;  1MC0 A;  4OOM A;  1N9O A;  4RQ9 A;  4AFI A;  4GLQ A;  4EEP A;  5HDD A;  4O0P A;  3C2W A;  4DJ2 A;  3PBQ A;  3IS2 A;  5HL6 A;  3A0S A;  2GNX A;  3T4L A;  3D3O A;  5KSH A;  2W3F A;  3KSG A;  1KOU A;  3FPV A;  4G3K A;  3CI6 A;  3A0V A;  4JGO A;  5MC7 A;  3SW1 A;  3UB7 A;  2IA2 A;  1X0O A;  4I38 A;  2Z6D A;  3F1O B;  2PDR A;  3IBJ A;  4KQO A;  4UQI S;  3H82 A;  5IT5 A;  2XSS A;  2Y8H A;  5KIZ A;  4Q0I A;  1W63 M;  4FOF A;  2V1B A;  1LSX A;  4R70 A;  5TBM A;  1ZTU A;  2QHK A;  3E4P A;  1OTB A;  2QYB A;  3BWL A;  2GX5 A;  3EEA A;  1LSV A;  4PHT A;  4Y2F A;  3HJK A;  4WEK A;  2LB9 A;  3NOT C;  1DRM A;  4EES A;  1P0Z A;  3C38 A;  5IU1 A;  2V0U A;  4GJ4 A;  2PYP A;  4I3J A;  2J3W A;  1OTI A;  5F5Y A;  3EQU A;  3EWK A;  4ME4 A;  4MDZ A;  4WUJ A;  3W2Z A;  2XA7 M;  2ZOH A;  2JN7 A;  4PKY A;  2A24 B;  2EWV A;  2JKR M;  4LPZ A;  1MZU A;  4CLC A;  3EOI A;  2K2N A;  5AJG A;  5TBM B;  3ZYT A;  1S1Y A;  2JKT M;  1LL8 A;  3UMD A;  2XRO A;  3TE8 A;  1OT9 A;  2MJ6 A;  4IUH A;  2VGL M;  2HV1 A;  2QJ7 A;  5F69 A;  1T18 A;  4OOL A;  2O99 A;  1P9R A;  3TW8 A;  2VV8 A;  3ZQ5 A;  3UB8 A;  2VX8 A;  1LT0 A;  2W0N A;  2HJ9 C;  1YSQ A;  4JGQ A;  4F3L B;  4HJ6 A;  3BY8 A;  4WL9 A;  1N9N A;  4WEL A;  3R7W A;  4YNR A;  4YOF A;  4HH3 A;  4KQD A;  1TS6 A;  2P08 A;  1TS7 A;  5I5L A;  2W3H A;  3HCY A;  3UE6 A;  5F68 A;  4H6J B;  3TRC A;  3O5Y A;  5AVF A;  5EFW A;  1VB6 A;  1NRJ A;  1P97 A;  2B02 A;  2VKS A;  2P7J A;  2W3E A;  4UQI M;  1F5M A;  3T4K A;  2K7S A;  1BYW A;  1YSP A;  4ARZ B;  3PYP A;  4BBV A;  4CLC C;  4G3V A;  5HWW A;  2VV6 A;  3LYX A;  2XRN A;  2FH5 A;  2W1T A;  3H7W A;  1F9I A;  4Q0H A;  3MQO A;  1GSX A;  1S66 L;  2JKT I;  2QWS A;  5J4E A;  4IJG A;  4EQ1 A;  3F1P A;  4MN7 A;  3CWF A;  1V9Y A;  3ICY A;  3MQ0 A;  3C8C A;  4P6Z M;  3T4Q A;  2HF6 A;  3JVU A;  4Z1W A;  1OT6 A;  2KLI A;  1S1Z A;  2KOI A;  2PYR A;  5L8M A;  1GSV A;  2EWW A;  3U2A A;  4LRX C;  3NOP C;  5J3W A;  3VV4 A;  2Y79 A;  2WKQ A;  2EA9 A;  3LIF A;  3T4S A;  1F98 A;  2L0W A;  3K2N A;  4Y3I A;  3EGX C;  4WN5 A;  4NXG A;  3HJI A;  1D06 A;  1TF1 A;  3PBO A;  4HNB A;  4HJ4 A;  3NHQ A;  4Q0J A;  3F1P B;  1MKM A;  2FZ0 A;  2PD8 A;  3CUE A;  4GHI B;  1NLY A;  3LI8 A;  3PR6 A;  2VA0 A;  2INW A;  4PKY G;  2KX6 A;  2VV7 A;  1S4S A;  2B18 A;  3H82 B;  2I9V A;  3KSH A;  4PAU A;  1T1B A;  4I39 A;  4LRY C;  1T1A A;  4IUK A;  1N9L A;  3P7N A;  4I3I A;  2WKR A;  4CQH A;  3T4T A;  5FL3 A;  3E0Y A;  2DMW A;  4O8G A;  2M7U A;  2A2L A;  4DJ3 A;  3KYQ A;  4HP9 A;  3VOL A;  5AVE A;  3MXQ A;  2BAS A;  4XT2 A;  4BWI A;  4F3L A;  3PHY A;  3K3C A;  3LID A;  2PR6 A;  4EXO A;  3NOU C;  1OTA A;  4EU0 A;  2PD7 A;  2O9C A;  3EEH A;  1WA9 A;  3S7P A;  4GS9 A;  3FG8 A;  2LB5 A;  4H6J A;  3B33 A;  4JGP A;  2Z6C A;  4BBU A;  3PBN A;  5HD5 A;  4ETX A;  2GZA A;  2OAQ 1;  3KSF A;  5CX7 A;  4WF0 A;  5LBR A;  1S67 L;  2YKH A;  3LIC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...