2PR5A

Structural basis for light-dependent signaling in the dimeric lov photosensor ytva (dark structure)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
127
structure length
127
Chain Sequence
DHVRVGVVITDPALEDNPIVYVNQGFVQMTGYETEEILGKNCRFLQGKHTDPAEVDNIRTALQNKEPVTVQIQNYKKDGTMFWNELNIDPMEIEDKTYFVGIQNDITKQKEYEKLLEDSLTEITALS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Blue-light photoreceptor
publication title Structural Basis for Light-dependent Signaling in the Dimeric LOV Domain of the Photosensor YtvA.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Flavoprotein, signaling protein
total genus 45
structure length 127
sequence length 127
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2pr5A00
4HHDA 1EW0A 2L0WA 3LIBA 2OWJA 4EERA 1DP8A 1XJ3A 5TBMB 1XJ2A 4KQDA 5F5YA 4EXOA 2VLGA 3BWLA 1Y28A 3ZQ5A 1S66L 2JN7A 4HJ6A 3LIFA 4R70A 1KOUA 1GSVA 2Z6DA 1S4RA 3LICA 3K3CA 1DP9A 2V9AA 4HOIA 4NXFA 4PKYA 3H7WA 2R78A 3VOLA 4EQ1A 2YKFA 3E4OA 4DJ3A 1XFQA 1OJGA 1XFNA 4WUJA 4I38A 4KUOA 5IU1A 3E4QA 2QHKA 1S1YA 1TS8A 4JGQA 3E4PA 1S67L 1OJ5A 4B9OA 3LI9A 4I39A 1T18A 3RTYA 3PHYA 5HWTA 4HH3A 3VE4A 2QWSA 3KX0X 1F9IA 1NWZA 5HDDA 5HDCA 4EESA 4K08A 2PD7A 1P97A 2K7SA 2PYPA 1UWPX 5J4EA 1OTIA 5DKLA 4NXBA 5AVEA 2OWHA 1GSWA 1S1ZA 4MN5A 4NXEA 5AVFA 1G28A 3UMDA 3C2WA 4YWZA 3D72A 2VV7A 2I9VA 3VE3A 1T19A 3UB7A 3EEHA 2V1BA 2A24A 3H7WB 4JGOA 1P0ZA 4HH2A 1WA9A 5HD3A 5I5LA 3MJQA 4GW9A 4I3AA 2QKPA 4EW7A 3F1PB 1TS0A 2KDKA 1XJ6A 1V9YA 1T1AA 5A8BA 3MXQA 4HQAA 4R3AA 1OT6A 2ZOHA 5J7EA 5HDSA 3EWKA 3UE6A 3LYXA 2WKPA 5IS1A 3P7NA 4HY8A 4HI4A 2B02A 1OTDA 2PDRA 3UB8A 4HP9A 2OOLA 3LIAA 3F1NA 3PYPA 5KIZA 4H6JA 3ULFA 3T50A 2D01A 2INWA 4GHIA 4LRZE 4XT2B 2PYRA 4GCZA 2L1MA 2A24B 2W0NA 3F1OA 1OT9A 4WF0A 1S4SA 3NHQA 4LRXC 1LSXA 4F3LA 3IS2A 4WN5A 3GECA 4RQ9A 5HZHA 2PD8A 3H82A 4M4XA 3IBRA 1V9ZA 3UB6A 2GJ3A 2KX6A 3G6OA 3HJKA 3LIDA 3BY9A 4LLOB 1UWNX 3BY8A 3A0RA 4BBUA 1N9LA 4R6LA 5HD5A 5DJUA 4BBTA 4HJ4A 3HJIA 2M1CA 3MR0A 3MFXA 2EA9A 3CLOA 2L4RA 3GDIA 4E04A 3UB9A 1ODVA 1DP6A 4HP4A 3C8CA 1T1BA 3UMEA 1D7EA 3F1NB 1JNUA 4H6JB 4R38A 2QJ7A 4GS9A 5G4YA 5J3WA 4PKYG 1OTAA 4GHIB 4EEPA 4DJ2A 1UGUA 3B33A 2QJ5A 3RH8B 1XJ4A 4L9GA 2VEAA 2ZOIA 3F1OB 1BYWA 1T1CA 1OTBA 4F3LB 2D02A 3FC7A 1DRMA 1OTEA 3IS2B 1LSVA 2CMNA 3NOPC 3H82B 1TS6A 5F6AA 4JGPA 2J80A 1LT0A 4HIAA 3K3DA 4NXGA 3FG8A 1N9OA 1LSWA 5F69A 2VV8A 3H9WA 1MZUA 4HNBA 1D06A 3A0VA 2WKQA 2V0WA 5EFWA 5F68A 3SW1A 2YKHA 3F1PA 4EEUA 4HJ3A 5TBMA 5G4ZA 2W27A 2WKRA 4LRYC 3NOUC 4EETB 4BBVA 4GS9B 5HSQA 4I3IA 1X0OA 2P7JA 3ICYA 4WLAA 1F98A 3MQQA 4KUKA 5DKKA 5DJTA 4I5SA 2Z6CA 4JGRA 3LI8A 4L9EA 1TS7A 3A0SA 3NOTC 2V0UA 2JHEA 4I3JA 4MN6A 2ZBBA 4LPZA 2PHYA 1N9NA 3CAXA 2PR5A 3OLOA 5HWVA 2VV6A 4XT2A 3LUQA 2H28A 2BASA 3NJAA 3MQOA 1GSXA 4L9FA 2V1AA 2PR6A 1VB6A 2HV1A 5HWWA 1LL8A 4WL9A 3LIEA 3CWFA
chains in the Genus database with same CATH superfamily
4HHDA 4U0XA 2OWJA 4DE2A 1PWGA 2UV0E 3DTEA 3LY3A 1DP8A 4JXGA 5FSRA 2VX8A 1XJ2A 5FDHA 4EXOA 2ZM8A 3BWLA 1K54C 5FI7A 3OOVA 3A3FA 2Y2NA 3SS4A 3TRCA 4X25A 3GMWA 1YLWA 4R70A 4LGWA 3K3CA 1I2SA 4X55A 2DCFA 2NUTC 4HOIA 4PM9A 4PKYA 3H7WA 1F5MA 2WAFA 3VOLA 3VOYA 3M2JA 1LL9A 3BYDA 2YKFA 2WGWB 1N4OA 2G2UA 4DKIA 5TGFA 3C7VA 1XFNA 4WUJA 2ZC4B 4I38A 4ZTKA 2V1ZA 4GD6A 4JGQA 1FCNA 4FTXA 1OJ5A 2EXAA 3KO6A 2W3GA 4IVKA 5I94A 1FSWA 4KQQA 1T18A 3ZVTA 4E3OA 3PHYA 2PT7A 5HWTA 1FIKA 3A3DA 3D9YA 4FCFA 1ACFA 4PM7A 4CLCA 4Y13A 1F9IA 1VEUA 5TJJA 5HDCA 1NLZA 5LBRA 4ZJ1A 3E2KA 1PNEA 5FL3A 4P0MA 1AWIA 4Y0OA 3G35A 1GSWA 2XEPA 1S1ZA 3NCKA 2EWWA 2XLNA 3ZCZA 3T4QA 3PAEA 3D72A 5FQ9A 2XQZA 3C30A 2GZAA 2EXBA 4KZ8A 3VE3A 3UB7A 2EX2A 2V1BA 3H7WB 1JTDA 4JGOA 1G68A 3N8SA 2JE5A 4QJGA 2ZQCA 3P09A 4N9KA 5I5LA 1L0GA 4UA9A 3MJQA 4GDNA 3T4JA 2ACGA 4IBRA 1BLCA 4BWIA 4EW7A 2V20A 1W63Q 3F1PB 2KDKA 2HJ9C 3MXQA 5GLAA 4R3AA 2ZOHA 2P08A 2Y2QA 2OV5A 5HAIA 3BFEA 2WKPA 1YSQA 5IS1A 1FR6A 2ZMVA 4R4RA 1SDNA 2PRFA 1VEUB 3WRZA 4R4SA 1O07A 2J3TD 3SS3A 3WS0A 4XXRA 3U2AA 1CK3A 1YMSA 1H8MA 1SCWA 3LIAA 4KENB 3F1NA 4H6JA 1SKFA 3UDIA 4N1HA 4JLFA 1KGFA 4GD8A 1AXBA 5FI6A 2INWA 3ZG7B 4E3LA 2LB9A 1YKDA 4P6ZS 4JXSA 4PHTA 1K38A 3TOIA 1XPBA 2PAVP 2XGNA 1K25A 2XH9A 3BFGA 2OAQ1 4EV4A 4LRXC 4DDSA 3PXPA 4O7DA 4WN5A 3GECA 4GDBA 1BLSA 3HVFA 1BUEA 3D3OA 1SDEA 2ZQ9A 1PW1A 3QP6A 4S2PA 2O99A 3CJMA 3HJKA 5A92A 3HCYA 1NLYA 5EVID 1MPLA 1UWNX 3W2ZA 4D2OA 4BBUA 2VA0A 1EI5A 4OKPA 2Y8HA 2EA9A 3GDIA 5FATA 1YT4A 4E04A 2PU4A 1ODVA 4RVAA 4OPRA 4YNRA 2EFUA 1BZAA 4OLDA 3GVBA 5BOHA 4MLLA 3F1NB 4N92A 4H6JB 2QJ7A 3NBLA 5J3WA 4KQRA 3IX3A 4PKYG 4EEPA 4CLCE 5FEFA 2Y59A 4O0PA 2QJ5A 4E6XA 1ES5A 5AQ9A 1KE0A 1JVJA 4NK3A 4L9GA 2ZOIA 4OH0A 2ZC6B 3IHAA 3JVVA 2O0YA 3KSFA 1OTBA 1DRMA 1LSVA 3FKWA 3EEAA 4LFUA 5HX9A 3VSKA 4DMZA 5F6AA 4OPZA 2JCHA 5GLBA 3V39A 4HIAA 1ES4A 1N9OA 4IJGA 5CGXA 1CQAA 5HARA 3S7NA 2R9XA 5EFWA 5F68A 3A3EA 1TVFA 2FZ0A 4EEUA 2P04A 3LGOA 4CPKA 2WKRA 4FD8A 1KE3A 3NOUC 4BBVA 5HSQA 3LEQA 4I3IA 3ICYA 2VGJA 2H5SA 2IWCA 1E3UD 2RCXA 4DF6A 2I72A 2VGLM 2P9VA 4EBPA 2Y2IA 1F2KA 4PMAA 2Z6CA 3CZDA 3LI8A 2XA7S 4UAAA 1TS7A 1GHIA 3A0SA 3NOTC 2G2WA 2HGVA 4R3BA 2X71A 4S2NC 4WEKA 4EQIA 1I5QA 4I3JA 1K57C 3S22A 5HFOA 3MBZA 2EFXA 3FKVA 4BJPA 5GLDA 1ZHHB 2JKRI 5HWVA 1PWCA 3HL9A 4XT2A 1E25A 1K55C 2H28A 1SKOA 3OPPA 1N9BA 1GSXA 3VP0A 3CI6A 3EGDC 3N7WA 2HDRA 1W8QA 2H0YA 1H8YA 1LLBA 1NJ4A 1W79A 1CEFA 1PYYA 5EUAA 1LL8A 4JF4A 3WS1A 2L0WA 4Z1WA 4YFMA 1LI0A 3ZG8B 1G5UA 4X53A 3JYIA 4PM8A 4OVDA 2XK1A 3KSHA 4OQ0A 1ZKJA 1CJFA 1NYYA 1Y28A 3TW8A 3B42A 3BQAA 4HJ6A 1H5XA 5E2HA 3FPWA 1Y54A 4DXCA 3E2LA 1DJCA 2P9VB 3LFVA 5CEDA 3IXGA 3VMAA 2V8FA 1VHMA 3OCLA 4UQIM 1DP9A 2Y2PA 5FQQA 1J9MA 1XXMA 1HD8A 3PBQA 1XP4A 5C5KA 4OQHA 5DVAA 5FEGA 3JPUA 5HL1A 4KUOA 3SH9A 2WGVA 3PTEA 1H0MA 3SH8A 1S1YA 3QP2A 4KZBA 5DFXA 3O86A 4OPYA 1SKOB 2A3UA 4X69A 1FOFA 2XD5A 5F1FA 4EBLA 3G2ZA 4R1GA 3MZEA 4HH3A 1MWUA 5GHYA 3C5AA 2R9WA 4D60A 3UB5P 1M6KA 3ZGAB 3FWLA 3GR2A 3D4FA 1PFLA 2EWVA 2PD7A 2K7SA 4QHCA 5EPHA 2PYPA 1CI8A 2J8YA 5DFYA 4K0WA 3U4LP 4DXBA 3BFDA 2OLVA 5DKLA 3VP3A 5M1AA 3W4OA 4MN5A 2QPNA 5AVFA 1A0KA 2LB5A 3C2WA 3UMDA 1Q2PA 3AGDA 3QP4A 2O9CA 1VETA 1YMXA 1T19A 1K55A 4HH2A 3OCNA 2HZ5A 1XA1A 3V67A 3DW0A 2E8IA 3GQZA 3GV9A 2EX9A 4GW9A 4JXVA 3LY4A 4I3AA 4WEJA 2QKPA 1OPXA 2GDNA 4BD1A 1GA9A 4LV0A 1NRJA 1V9YA 3VOZA 4UA7A 1BLHA 3Q81A 3EWKA 1YLTA 4JBFA 4Y17A 3DBAA 1RGZA 2O9AA 4LV2A 3KYZA 3RFBA 4H8RA 3DAVA 1W63M 2OAP1 3OPHA 1LL5A 3OBFA 2Y2MA 3IT9A 1BLPA 2B02A 2C6WB 4HESA 4HI4A 3TSGA 3HLDA 2W1RA 1I2WA 4HP9A 4N9LA 2A2LA 1ZG6A 3T50A 1PRQA 4OQIA 1MKIA 5DTSA 4GHIA 4LRZE 3B47A 3UN7A 4KG5A 1J3WA 4R0QA 5HL6A 1STZA 1VETB 3FZCA 4OPQA 4WF0A 1S4SA 3WRTA 5AQ7A 5EV0A 5A91A 4G3KA 1FCMA 5CRFA 4RQ9A 3TE8A 5HZHA 2PD8A 5JYPA 3C38A 1P9WA 3IH9A 4EUVA 1Y4OA 4IHQA 4Y15A 4S2KA 2GJ3A 3LIDA 3KYQA 5E2GA 4LLOB 2WGIA 5FQIA 1W7FA 3BY8A 3WS2A 2AVXA 5HD5A 1YLJA 5DJUA 5GHXA 3MR0A 3MFXA 1JWVA 1ONHA 3L9KA 3Q82A 2V2FF 4FH4A 2IA2A 3UB9A 4HP4A 5E2EA 1FSYA 1MBLA 1PZOA 1L0FA 1XGJA 3BM6A 3FPVA 4OOLA 1JNUA 1RGYA 4LV1A 4MBHA 1PZPA 4O8GA 1OTAA 4GHIB 4PPRA 2Y55A 4WMCD 2K2NA 5EE8A 2JBFA 2Y91A 4E3NA 3PBNA 3DWKA 5A93A 4L0LA 4Q0IA 3ZG9B 3UE1A 2B5RA 2BTFP 4WYYA 1NZOA 4CLCB 1K54A 1DY6A 2FFYA 3RJUA 3Q07A 5AQBA 1KGEA 3NOPC 5DF9A 1WYCA 1TS6A 5CGSA 4QU3A 2NUPC 5FDSA 1MWTA 4OONA 1ERMA 4BMWA 2J80A 3DTIA 5EVEA 4MMNA 1PI4A 4QPRA 4JXWA 4NXGA 3FG8A 3CPTA 1IEMA 2ZL1A 3QP8A 3BJNA 5EVIC 1NYMA 1MZUA 3E0YA 4K0XA 1YPRA 3NDEA 4GNUA 2ZQDA 5F83A 3ZDJA 2K31A 3RXXA 3SW1A 1QMFA 3K2NA 5AQAA 3VP2A 5TBMA 2KLIA 1M40A 4C6YA 2X02A 5MC7A 5FQKA 2VK3A 4XUXA 1HZOA 1YAXA 4BQMA 2Q9NA 5AJGA 3HLWA 4E3KA 5DJTA 4I5SA 3ITBA 4L9EA 3ISGA 4XUZA 3MS6A 5FQJA 5M18A 3HUOA 2V0UA 3QP5A 1K56A 2X01A 4KZ5A 2HDUA 4YOFA 3S7OA 4QB8A 1PI5A 2PHYA 1N9NA 5FQMA 2ZMFA 3MF0A 3OLOA 3LR3A 4X1LA 3ZYTA 4R3JA 4QY6A 4KZ4A 1KE4A 2Y2LA 3NJAA 3CPTB 2ZL1B 3NI9A 2J9OA 3MQOA 1L3LA 3BLSA 2PR6A 3MKEA 2VGKA 2HV1A 1GHPA 2Q0OA 5CGWA 3LIEA 3CWFA 4MCWA 1EW0A 3LIBA 2WKHA 2JKTI 1XJ3A 3GTCA 3UPPA 5TBMB 5F5YA 3GRJA 4A5RA 2XROA 3Q7VA 3UE0A 3MZFA 3M6BA 2CC1A 3LIFA 4O01A 1WYBA 1U60A 4S2MA 4UEYA 4FSFA 2Z6DA 2FFFB 2H0TA 1XA7A 2V9AA 1TEMA 2R78A 4Q0JA 4EQ1A 1FR1A 2A49A 2QZ6A 1GCEA 4KG6A 3E4OA 4DJ3A 1XFQA 1OJGA 3QNCA 2XFSA 4GKUA 5EVIA 3TG9A 2WKEA 2VJWA 2RL3A 1HTZA 4KQOA 1MWSA 3E4QA 5TFQA 4E3JA 3E4PA 1ES2A 3HLCA 5DTKA 2ZJ9A 3IHBA 3SZTA 4B9OA 4I39A 4B88A 3HREA 3RTYA 4LENA 3KX0X 5D3OA 3MZDA 1NWZA 1GHMA 3FYZA 3C7UA 3LR4A 4K08A 4Z9QA 2G7UA 2Y2HA 4ID4A 4PM5A 4FH2A 4HBTA 3O5YA 4Y2FA 4B4XA 2VGLS 1IFQA 4NXBA 1ERQA 5AVEA 4NXEA 1CEGA 4KZ3A 3Q7VB 2Y2KA 3T1SA 3IF6C 2Z2LB 4YWZA 5GL9A 1L0DA 2VV7A 4ESPA 2I9VA 2QYBA 2XRNA 3MQ0A 4DRTA 1L2SA 1KDWA 2A24A 1P0ZA 1WA9A 2DMWA 2HDQA 1NY0A 3LR5A 2Y2JA 1KVLA 2HF6A 5EVIB 3V3RA 1YM1A 5CHMA 5EVLA 1XX2A 1QMEA 3V3SA 1TS0A 1XJ6A 3T1XA 4HQAA 4KZ7A 5J7EA 4GOGA 1PIOA 4Q8IA 3HLFA 2WAEA 3ITAA 4M3KA 3G4PA 4N1XA 3S7PA 5CECA 1VQQA 5FAOA 1DJAA 1HVBA 1IYPA 3P7NA 3IH8A 3LEZA 3HLBA 3KSIA 2PBDP 4JPMA 4IUHA 1OTDA 3UB8A 1SHVA 3QP1A 2W3EA 3SH7A 2OOLA 1MWRA 3PBTA 5KMWA 3ULFA 3ZNYA 4UQIS 2ZM0A 5FASA 2MJ6A 1RP5A 1YLPA 3JVUA 4XT2B 4UHUA 3MFDA 1PWDA 2JKRM 3QHYA 1PW8A 2L1MA 3AGEA 2A24B 2W0NA 3F1OA 1OT9A 1TDGA 2WK0A 3VSLA 3M6HA 3N4IA 4F3LA 4NEED 5FI2A 4U3TA 3S4XA 2ZMAA 4Y3IA 3H82A 1IYSA 1D1JA 4DE3A 3G31A 3IBRA 5IHVA 2ZQ8A 1XKZA 3G6OA 4C75A 1TDLA 1IELA 3A0RA 2Q9MA 3N8RA 4Q0HA 4S2NA 1H8ZA 3W4PA 1K57A 4BBTA 5FA7A 4HJ4A 1C3BA 3HJIA 2M1CA 5FAQA 4X6TA 3RXWA 4AFIA 2XDMA 3IF6A 4G3WA 3IX4A 4B93A 3S1YA 3CHWP 4CLCD 2W3HA 4IVIA 3IXDA 1D7EA 5CTNA 4P6BA 4GS9A 5G4YA 1K0KA 3UY6A 3MSHA 4DJ2A 3P98A 2WZZA 1UGUA 1MC0A 2KOIA 4MDZA 3F1OB 3T4OA 5M19A 4GB7A 4FOFA 1T1CA 4OP8A 4F3LB 1NXYA 2CMNA 1KDSA 4GZBA 3H82B 2Z2MB 3SOIA 2OSUA 5KSHA 5EECA 2PU2A 1SZVA 2ZQAA 1LI9A 3LCEA 2Y4AA 3K3DA 3Q1FA 4RX2A 3T4SA 1W8YA 5HPFA 1LHYA 2B18A 1LSWA 4Y0UA 5F69A 3N6IA 2VV8A 3H9WA 2J7VA 2ZC5B 4RX3A 4HNBA 2XD1A 1ESIA 3V5MA 1D06A 3WS5A 3IF6B 1NZUA 4X1MA 2WKQA 4F94A 2V0WA 2V8CA 3WWXA 3F1PA 4P85A 4OOMA 3UPOA 2FH5A 1JWPA 3O87A 5G4ZA 4LRYC 1FQGA 3VP4A 4GS9B 4MBFA 2JC7A 1X0OA 4S2IA 2P7JA 4WLAA 5EM1A 3UNWA 3MQQA 1CI9A 3OZHA 4KUKA 4WM9A 3MKFA 5DKKA 2XFTA 3PBOA 2ZM2A 1TF1A 4MNRA 2W1TA 1VM1A 2XSSA 4BD0A 3IXBA 4MN6A 4OOYA 4LPZA 5F82A 4YINA 3CAXA 3BEBA 4MN7A 4CQHA 1FCOA 2J3TC 1G6AA 2XR0A 3O3VA 1Z6FA 3DTKA 3G32A 2VV6A 4QWOA 1KVMA 5EM0A 3LUQA 1MY8A 5GLCA 1G6OA 2VKSA 1ES3A 2V1AA 5CEBA 1W5DA 5HWWA 2ZQ7A 5CHJA 2ZD8A 4WL9A 3UPNA 2ZC3B 4QD4A 4NG2A 4EERA 1K56D 4ETXA 3L7HA 4KQDA 1ONGA 3R7WA 2BLSA 4EU0A 3EGXC 1K6RA 2VLGA 4OQGA 4UA6A 3ZQ5A 1S66L 2JN7A 3BW6A 4IUKA 4LCMA 1S0WA 5J8XA 3VV4A 4BLMA 3DWZA 3W4QA 1KOUA 1K6SA 3LO7A 1GSVA 1S4RA 3LICA 1MKMA 4WZ4A 3C4OA 4NXFA 2W1TB 4K91A 5L10A 3GSGA 5DF7A 2WKIA 3ZHHA 3OC2A 4OLGA 4P6ZM 4GLQA 3A3IA 4Y7PA 3WS4A 1Q2QA 5L2FA 2QMIA 1JWZA 5IU1A 2QHKA 1TS8A 4EWFA 5L09A 5FAPA 4JF5A 1S67L 2WUQA 1DJBA 2DRWA 1BTLA 3LI9A 3VE4A 2QWSA 3IF5A 5U47A 2W3FA 4EUZA 5HDDA 3ZG0A 4EESA 4DE1A 4NKPA 4OP5A 1P97A 1IKGA 3T4KA 3I7JA 1UWPX 5J4EA 1OTIA 1RCJA 3AGFA 4WMCA 4E3IA 1O7EA 5L07A 3R7WB 2OWHA 3T4LA 1ALQA 1G28A 4Y5FA 3MXRA 5JYOA 1WE4A 4PAUA 1TD5A 1OMEA 1ESUA 3IXHA 4KZAA 2JKGA 2HP6A 3EEHA 4PM6A 3IQAA 5CTMA 1Z09A 5HD3A 3UDXA 4X68A 3HLEA 3N8LA 2UWXA 2J3WA 2ZLYA 3CUEC 1K4FA 5L8MA 4II7A 3ZG5A 3P01A 4ME4A 3W8KA 3SS5A 4G3VA 4RA7A 1T1AA 5A8BA 1GA0A 3KYEA 1OT6A 5HDSA 3MMHA 3OPLA 2HPBA 5K5BA 2WADA 3MXSA 2J9PA 4S2OA 1ZC2A 3UE6A 3T1RA 3LYXA 2H10A 4JF6A 4WZ5C 1E4DA 4ZJ2A 1IKIA 4GJ4A 4HY8A 1NRFA 2PDRA 5EOOA 5HW3A 3T12B 1MXOA 3PYPA 5CX7A 5KIZA 1CF0A 1ZG4A 4ZAMA 5GHZA 2D01A 3UE3A 1S6RA 4DDYA 1K4EA 4S2LA 4ZRRA 2PYRA 5CXWA 4GCZA 3IWIA 4GN2A 3T1QB 4E3MA 4EBNA 2B95A 2BG1A 4S2JA 3NHQA 1LSXA 5CERA 2JKFA 3IS2A 2HP9A 3NY4A 2IWBA 2Y2GA 2WZXA 2XA7M 1FILA 3BFCA 4M4XA 1BSGA 3NC8A 1EROA 2E8JA 4IEDA 5KZHA 4DE0A 1P9RA 1V9ZA 4BL3A 4HEFA 3UB6A 1IYOA 1YQSA 2KX6A 4FUWA 3BY9A 4X56A 4B4ZA 2JKTM 1JTGA 1IOUA 3HBRA 2GNXA 2XF3A 2HJEA 3IWQA 4NETA 1N9LA 4R6LA 1KGGA 3OPRA 2M7UA 3B3XA 3C4PA 3CLOA 2L4RA 3R4KA 4JKTA 5HPIA 1H3QA 4WELA 5HAQA 3HUNA 1DP6A 3M2KA 3C8CA 1T1BA 4LV3A 5KSCA 1BULA 1HLUP 3UMEA 4R23A 3BQ8A 3BLMA 4R38A 1BT5A 4RYEA 4C3QA 3CUEA 3KSGA 1YLZA 3B33A 5TR7A 3RH8B 1XJ4A 3ZFZA 4BL2A 4QY5A 2VEAA 2OLUA 3CMZA 2HDSA 2HP5A 3T4TA 1BYWA 2EX8A 3UO9A 2D02A 2PBYA 1YSPA 1OTEA 3FC7A 3IS2B 4KG2A 3S7QA 1XGIA 3IBJA 3NECA 3DTMA 2WYXA 3V50A 3ZNTA 3HLGA 4ARZA 4KZ9A 3CITA 1E3UA 3LR0A 4WZ5A 3BECA 3HUMA 4JGPA 3PBRA 5DF8A 1LT0A 5CHUA 3EQUA 3EQVA 4BENA 2P74A 3CG5A 4WBGA 4MBKA 4ZDXA 5IT5A 3VFFA 3NIAA 3NULA 3A0VA 3ZVWA 3E98A 2YKHA 3PR6A 2EX6A 4P87A 2O9BA 5EOEA 4HJ3A 3G30A 3QNBA 2W27A 4CLCC 4EETB 3IX8A 1F98A 3IWOA 1ZTUA 1IYQA 2IWDA 5F1GA 3Q7ZA 4E6WA 3G2YA 4JGRA 1L0EA 4DN0A 3O88A 4HBUA 3TJZC 4ZJ3A 2Y79A 4CJNA 4U0TA 4MEZA 3EOIA 3NDGA 2VZWA 2M7VA 2JHEA 4IBXA 4KZ6A 2WGWA 4ZBEA 3BFFA 2Y2OA 2ZBBA 2W3DA 1YLYA 3UDFA 2PR5A 5DTTA 4ARZB 1EWZA 2DNSA 3FV7A 4Y0TA 3PBSA 5G18A 3VFHA 4LCLA 5E43A 2BASA 5E2FA 3G34A 4L9FA 5HAPA 3VP1A 2ZC7A 3A3JA 3PAGA 5A90A 4ETZA 2C5WB 1VB6A 2GX5A 3BRMA
chains in the Genus database with same CATH topology
4MCWA 4HHDA 1EW0A 2L0WA 4Z1WA 3LIBA 2OWJA 4EERA 2JKTI 4ETXA 1DP8A 1XJ3A 2VX8A 5TBMB 1XJ2A 4KQDA 5F5YA 3KSHA 3R7WA 4EXOA 4EU0A 3EGXC 2VLGA 2XROA 3BWLA 1Y28A 3OOVA 3ZQ5A 1S66L 2JN7A 3BW6A 4IUKA 3TW8A 3B42A 3TRCA 3BQAA 4HJ6A 3FPWA 3VV4A 3LIFA 4R70A 4O01A 1KOUA 3LFVA 4UEYA 4FSFA 1GSVA 2Z6DA 1S4RA 1VHMA 3LICA 1MKMA 3K3CA 3OCLA 4UQIM 1DP9A 2V9AA 2NUTC 4HOIA 2W1TB 4NXFA 4PKYA 3H7WA 1F5MA 4Q0JA 2R78A 3VOLA 4EQ1A 3OC2A 4P6ZM 4GLQA 3PBQA 2YKFA 3E4OA 4DJ3A 5C5KA 1XFQA 1OJGA 1XFNA 4WUJA 4I38A 2VJWA 4KQOA 4KUOA 5IU1A 3E4QA 2QHKA 1S1YA 1TS8A 4JGQA 3E4PA 5DFXA 1S67L 1OJ5A 3KO6A 2W3GA 4B9OA 3LI9A 4I39A 1T18A 3RTYA 3PHYA 2PT7A 4HH3A 5HWTA 3VE4A 2QWSA 3KX0X 2W3FA 4CLCA 1F9IA 1NWZA 5HDDA 3LR4A 5TJJA 5HDCA 1NLZA 5LBRA 4K08A 4EESA 2G7UA 2EWVA 2PD7A 4NKPA 1P97A 2K7SA 2PYPA 5DFYA 3T4KA 3O5YA 1UWPX 4Y2FA 5J4EA 1OTIA 5FL3A 5DKLA 2VGLS 1IFQA 4NXBA 5AVEA 3R7WB 2OWHA 3T4LA 1GSWA 1S1ZA 4MN5A 4NXEA 5AVFA 2EWWA 2LB5A 1G28A 4Y5FA 3T4QA 3C2WA 3UMDA 4YWZA 3D72A 3C30A 2VV7A 4PAUA 1TD5A 2GZAA 2I9VA 2QYBA 2XRNA 3MQ0A 2O9CA 3VE3A 1T19A 3UB7A 3EEHA 2V1BA 2A24A 3H7WB 4JGOA 1P0ZA 4HH2A 1WA9A 2DMWA 3LR5A 5HD3A 3OCNA 5I5LA 3V67A 2J3WA 3CUEC 3MJQA 5L8MA 2HF6A 4II7A 4GW9A 3T4JA 4I3AA 4WEJA 4BWIA 2QKPA 1OPXA 4EW7A 1W63Q 3P01A 4ME4A 3F1PB 1TS0A 2KDKA 1NRJA 1XJ6A 1V9YA 2HJ9C 4G3VA 1T1AA 5A8BA 3MXQA 4HQAA 4R3AA 1OT6A 2ZOHA 5J7EA 5HDSA 3MMHA 2P08A 5K5BA 3EWKA 3UE6A 3DBAA 2O9AA 3LYXA 3KYZA 2WKPA 3RFBA 1YSQA 5IS1A 3S7PA 2ZMVA 1W63M 2OAP1 3P7NA 2J3TD 4GJ4A 3OBFA 4HY8A 3KSIA 3U2AA 4HI4A 2B02A 4IUHA 1OTDA 2PDRA 3UB8A 2W1RA 2W3EA 4HP9A 1H8MA 2OOLA 3PBTA 2A2LA 3LIAA 3F1NA 3PYPA 5CX7A 5KIZA 4H6JA 3ULFA 4UQIS 3T50A 2MJ6A 2D01A 2INWA 4GHIA 4LRZE 3UE3A 2LB9A 3B47A 1YKDA 3JVUA 4P6ZS 4XT2B 4ZRRA 2PYRA 5HL6A 2JKRM 4PHTA 1STZA 4GCZA 2L1MA 2OAQ1 2A24B 2W0NA 3F1OA 1OT9A 4WF0A 1S4SA 3NHQA 4LRXC 1LSXA 3PXPA 4F3LA 4G3KA 4NEED 3IS2A 4WN5A 3GECA 4RQ9A 3TE8A 5HZHA 2PD8A 2XA7M 4Y3IA 3C38A 3H82A 4M4XA 1P9WA 4EUVA 3D3OA 3IBRA 4IHQA 1P9RA 1V9ZA 2O99A 3UB6A 3LIDA 2GJ3A 2KX6A 3G6OA 3HJKA 3KYQA 3BY9A 3HCYA 4LLOB 2JKTM 1NLYA 1IOUA 1UWNX 2GNXA 3W2ZA 3BY8A 2HJEA 3A0RA 4BBUA 1N9LA 4R6LA 4Q0HA 2M7UA 5HD5A 2VA0A 5DJUA 4BBTA 4HJ4A 3HJIA 2M1CA 3MR0A 3MFXA 2Y8HA 2EA9A 3CLOA 4AFIA 2L4RA 3GDIA 3R4KA 5HPIA 1H3QA 4E04A 4WELA 2IA2A 4G3WA 3UB9A 1ODVA 1DP6A 4HP4A 4YNRA 4B93A 3C8CA 1T1BA 4CLCD 2W3HA 3FPVA 4OOLA 1D7EA 3F1NB 1JNUA 3UMEA 4H6JB 3BQ8A 4R38A 2QJ7A 4O8GA 4GS9A 5G4YA 5J3WA 4PKYG 1OTAA 4GHIB 4EEPA 4CLCE 3CUEA 4DJ2A 3KSGA 1UGUA 2K2NA 4O0PA 1MC0A 3B33A 2QJ5A 3RH8B 3PBNA 1XJ4A 2KOIA 4L9GA 4L0LA 2VEAA 2ZOIA 4Q0IA 4MDZA 3F1OB 3T4OA 3JVVA 2O0YA 3KSFA 4FOFA 3T4TA 1BYWA 1T1CA 1OTBA 4CLCB 4F3LB 2D02A 3FC7A 1DRMA 1OTEA 1YSPA 3IS2B 1LSVA 2CMNA 3EEAA 3S7QA 3IBJA 3NOPC 3H82B 5DF9A 4DMZA 1TS6A 5F6AA 4ARZA 5KSHA 2NUPC 3CITA 3LR0A 4BMWA 4JGPA 2J80A 4MMNA 3PBRA 1LT0A 4HIAA 3K3DA 4QPRA 4NXGA 3FG8A 1N9OA 3EQUA 3EQVA 3T4SA 5HPFA 2B18A 1LSWA 3BJNA 5F69A 4IJGA 2VV8A 3H9WA 1MZUA 3E0YA 4HNBA 5IT5A 1D06A 3A0VA 3S7NA 3E98A 2K31A 2WKQA 2V0WA 5EFWA 5F68A 3SW1A 3K2NA 2YKHA 3PR6A 2FZ0A 3F1PA 4OOMA 2O9BA 4EEUA 2P04A 4HJ3A 5TBMA 2FH5A 5G4ZA 2W27A 2WKRA 4LRYC 2KLIA 4CLCC 3NOUC 4EETB 4BBVA 4GS9B 5HSQA 5MC7A 4I3IA 1X0OA 1YAXA 2P7JA 3ICYA 4WLAA 1F98A 3MQQA 1ZTUA 5AJGA 2VGLM 4KUKA 5DKKA 3PBOA 5DJTA 4I5SA 2Z6CA 4JGRA 1TF1A 3LI8A 2XA7S 4L9EA 4DN0A 1TS7A 2W1TA 3TJZC 2XSSA 3A0SA 3NOTC 2Y79A 2HGVA 3EOIA 2V0UA 2VZWA 2M7VA 4WEKA 2JHEA 4I3JA 4MN6A 2ZBBA 4LPZA 4BJPA 4YOFA 3S7OA 2W3DA 2PHYA 1N9NA 3CAXA 2PR5A 2ZMFA 4ARZB 4MN7A 1ZHHB 4CQHA 3MF0A 2J3TC 3OLOA 3LR3A 2JKRI 5HWVA 2VV6A 3PBSA 3ZYTA 4XT2A 3LUQA 2H28A 2BASA 3NJAA 1G6OA 3MQOA 2VKSA 1GSXA 4L9FA 3CI6A 3EGDC 2V1AA 4ETZA 2PR6A 1VB6A 2HV1A 5HWWA 2GX5A 1LL8A 4WL9A 3LIEA 3CWFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HHD A;  1EW0 A;  2L0W A;  3LIB A;  2OWJ A;  4EER A;  1DP8 A;  1XJ3 A;  5TBM B;  1XJ2 A;  4KQD A;  5F5Y A;  4EXO A;  2VLG A;  3BWL A;  1Y28 A;  3ZQ5 A;  1S66 L;  2JN7 A;  4HJ6 A;  3LIF A;  4R70 A;  1KOU A;  1GSV A;  2Z6D A;  1S4R A;  3LIC A;  3K3C A;  1DP9 A;  2V9A A;  4HOI A;  4NXF A;  4PKY A;  3H7W A;  2R78 A;  3VOL A;  4EQ1 A;  2YKF A;  3E4O A;  4DJ3 A;  1XFQ A;  1OJG A;  1XFN A;  4WUJ A;  4I38 A;  4KUO A;  5IU1 A;  3E4Q A;  2QHK A;  1S1Y A;  1TS8 A;  4JGQ A;  3E4P A;  1S67 L;  1OJ5 A;  4B9O A;  3LI9 A;  4I39 A;  1T18 A;  3RTY A;  3PHY A;  5HWT A;  4HH3 A;  3VE4 A;  2QWS A;  3KX0 X;  1F9I A;  1NWZ A;  5HDD A;  5HDC A;  4EES A;  4K08 A;  2PD7 A;  1P97 A;  2K7S A;  2PYP A;  1UWP X;  5J4E A;  1OTI A;  5DKL A;  4NXB A;  5AVE A;  2OWH A;  1GSW A;  1S1Z A;  4MN5 A;  4NXE A;  5AVF A;  1G28 A;  3UMD A;  3C2W A;  4YWZ A;  3D72 A;  2VV7 A;  2I9V A;  3VE3 A;  1T19 A;  3UB7 A;  3EEH A;  2V1B A;  2A24 A;  3H7W B;  4JGO A;  1P0Z A;  4HH2 A;  1WA9 A;  5HD3 A;  5I5L A;  3MJQ A;  4GW9 A;  4I3A A;  2QKP A;  4EW7 A;  3F1P B;  1TS0 A;  2KDK A;  1XJ6 A;  1V9Y A;  1T1A A;  5A8B A;  3MXQ A;  4HQA A;  4R3A A;  1OT6 A;  2ZOH A;  5J7E A;  5HDS A;  3EWK A;  3UE6 A;  3LYX A;  2WKP A;  5IS1 A;  3P7N A;  4HY8 A;  4HI4 A;  2B02 A;  1OTD A;  2PDR A;  3UB8 A;  4HP9 A;  2OOL A;  3LIA A;  3F1N A;  3PYP A;  5KIZ A;  4H6J A;  3ULF A;  3T50 A;  2D01 A;  2INW A;  4GHI A;  4LRZ E;  4XT2 B;  2PYR A;  4GCZ A;  2L1M A;  2A24 B;  2W0N A;  3F1O A;  1OT9 A;  4WF0 A;  1S4S A;  3NHQ A;  4LRX C;  1LSX A;  4F3L A;  3IS2 A;  4WN5 A;  3GEC A;  4RQ9 A;  5HZH A;  2PD8 A;  3H82 A;  4M4X A;  3IBR A;  1V9Z A;  3UB6 A;  2GJ3 A;  2KX6 A;  3G6O A;  3HJK A;  3LID A;  3BY9 A;  4LLO B;  1UWN X;  3BY8 A;  3A0R A;  4BBU A;  1N9L A;  4R6L A;  5HD5 A;  5DJU A;  4BBT A;  4HJ4 A;  3HJI A;  2M1C A;  3MR0 A;  3MFX A;  2EA9 A;  3CLO A;  2L4R A;  3GDI A;  4E04 A;  3UB9 A;  1ODV A;  1DP6 A;  4HP4 A;  3C8C A;  1T1B A;  3UME A;  1D7E A;  3F1N B;  1JNU A;  4H6J B;  4R38 A;  2QJ7 A;  4GS9 A;  5G4Y A;  5J3W A;  4PKY G;  1OTA A;  4GHI B;  4EEP A;  4DJ2 A;  1UGU A;  3B33 A;  2QJ5 A;  3RH8 B;  1XJ4 A;  4L9G A;  2VEA A;  2ZOI A;  3F1O B;  1BYW A;  1T1C A;  1OTB A;  4F3L B;  2D02 A;  3FC7 A;  1DRM A;  1OTE A;  3IS2 B;  1LSV A;  2CMN A;  3NOP C;  3H82 B;  1TS6 A;  5F6A A;  4JGP A;  2J80 A;  1LT0 A;  4HIA A;  3K3D A;  4NXG A;  3FG8 A;  1N9O A;  1LSW A;  5F69 A;  2VV8 A;  3H9W A;  1MZU A;  4HNB A;  1D06 A;  3A0V A;  2WKQ A;  2V0W A;  5EFW A;  5F68 A;  3SW1 A;  2YKH A;  3F1P A;  4EEU A;  4HJ3 A;  5TBM A;  5G4Z A;  2W27 A;  2WKR A;  4LRY C;  3NOU C;  4EET B;  4BBV A;  4GS9 B;  5HSQ A;  4I3I A;  1X0O A;  2P7J A;  3ICY A;  4WLA A;  1F98 A;  3MQQ A;  4KUK A;  5DKK A;  5DJT A;  4I5S A;  2Z6C A;  4JGR A;  3LI8 A;  4L9E A;  1TS7 A;  3A0S A;  3NOT C;  2V0U A;  2JHE A;  4I3J A;  4MN6 A;  2ZBB A;  4LPZ A;  2PHY A;  1N9N A;  3CAX A;  2PR5 A;  3OLO A;  5HWV A;  2VV6 A;  4XT2 A;  3LUQ A;  2H28 A;  2BAS A;  3NJA A;  3MQO A;  1GSX A;  4L9F A;  2V1A A;  2PR6 A;  1VB6 A;  2HV1 A;  5HWW A;  1LL8 A;  4WL9 A;  3LIE A;  3CWF A; 
#chains in the Genus database with same CATH topology
 4HHD A;  4U0X A;  2OWJ A;  4DE2 A;  1PWG A;  2UV0 E;  3DTE A;  3LY3 A;  1DP8 A;  4JXG A;  5FSR A;  2VX8 A;  1XJ2 A;  5FDH A;  4EXO A;  2ZM8 A;  3BWL A;  1K54 C;  5FI7 A;  3OOV A;  3A3F A;  2Y2N A;  3SS4 A;  3TRC A;  4X25 A;  3GMW A;  1YLW A;  4R70 A;  4LGW A;  3K3C A;  1I2S A;  4X55 A;  2DCF A;  2NUT C;  4HOI A;  4PM9 A;  4PKY A;  3H7W A;  1F5M A;  2WAF A;  3VOL A;  3VOY A;  3M2J A;  1LL9 A;  3BYD A;  2YKF A;  2WGW B;  1N4O A;  2G2U A;  4DKI A;  5TGF A;  3C7V A;  1XFN A;  4WUJ A;  2ZC4 B;  4I38 A;  4ZTK A;  2V1Z A;  4GD6 A;  4JGQ A;  1FCN A;  4FTX A;  1OJ5 A;  2EXA A;  3KO6 A;  2W3G A;  4IVK A;  5I94 A;  1FSW A;  4KQQ A;  1T18 A;  3ZVT A;  4E3O A;  3PHY A;  2PT7 A;  5HWT A;  1FIK A;  3A3D A;  3D9Y A;  4FCF A;  1ACF A;  4PM7 A;  4CLC A;  4Y13 A;  1F9I A;  1VEU A;  5TJJ A;  5HDC A;  1NLZ A;  5LBR A;  4ZJ1 A;  3E2K A;  1PNE A;  5FL3 A;  4P0M A;  1AWI A;  4Y0O A;  3G35 A;  1GSW A;  2XEP A;  1S1Z A;  3NCK A;  2EWW A;  2XLN A;  3ZCZ A;  3T4Q A;  3PAE A;  3D72 A;  5FQ9 A;  2XQZ A;  3C30 A;  2GZA A;  2EXB A;  4KZ8 A;  3VE3 A;  3UB7 A;  2EX2 A;  2V1B A;  3H7W B;  1JTD A;  4JGO A;  1G68 A;  3N8S A;  2JE5 A;  4QJG A;  2ZQC A;  3P09 A;  4N9K A;  5I5L A;  1L0G A;  4UA9 A;  3MJQ A;  4GDN A;  3T4J A;  2ACG A;  4IBR A;  1BLC A;  4BWI A;  4EW7 A;  2V20 A;  1W63 Q;  3F1P B;  2KDK A;  2HJ9 C;  3MXQ A;  5GLA A;  4R3A A;  2ZOH A;  2P08 A;  2Y2Q A;  2OV5 A;  5HAI A;  3BFE A;  2WKP A;  1YSQ A;  5IS1 A;  1FR6 A;  2ZMV A;  4R4R A;  1SDN A;  2PRF A;  1VEU B;  3WRZ A;  4R4S A;  1O07 A;  2J3T D;  3SS3 A;  3WS0 A;  4XXR A;  3U2A A;  1CK3 A;  1YMS A;  1H8M A;  1SCW A;  3LIA A;  4KEN B;  3F1N A;  4H6J A;  1SKF A;  3UDI A;  4N1H A;  4JLF A;  1KGF A;  4GD8 A;  1AXB A;  5FI6 A;  2INW A;  3ZG7 B;  4E3L A;  2LB9 A;  1YKD A;  4P6Z S;  4JXS A;  4PHT A;  1K38 A;  3TOI A;  1XPB A;  2PAV P;  2XGN A;  1K25 A;  2XH9 A;  3BFG A;  2OAQ 1;  4EV4 A;  4LRX C;  4DDS A;  3PXP A;  4O7D A;  4WN5 A;  3GEC A;  4GDB A;  1BLS A;  3HVF A;  1BUE A;  3D3O A;  1SDE A;  2ZQ9 A;  1PW1 A;  3QP6 A;  4S2P A;  2O99 A;  3CJM A;  3HJK A;  5A92 A;  3HCY A;  1NLY A;  5EVI D;  1MPL A;  1UWN X;  3W2Z A;  4D2O A;  4BBU A;  2VA0 A;  1EI5 A;  4OKP A;  2Y8H A;  2EA9 A;  3GDI A;  5FAT A;  1YT4 A;  4E04 A;  2PU4 A;  1ODV A;  4RVA A;  4OPR A;  4YNR A;  2EFU A;  1BZA A;  4OLD A;  3GVB A;  5BOH A;  4MLL A;  3F1N B;  4N92 A;  4H6J B;  2QJ7 A;  3NBL A;  5J3W A;  4KQR A;  3IX3 A;  4PKY G;  4EEP A;  4CLC E;  5FEF A;  2Y59 A;  4O0P A;  2QJ5 A;  4E6X A;  1ES5 A;  5AQ9 A;  1KE0 A;  1JVJ A;  4NK3 A;  4L9G A;  2ZOI A;  4OH0 A;  2ZC6 B;  3IHA A;  3JVV A;  2O0Y A;  3KSF A;  1OTB A;  1DRM A;  1LSV A;  3FKW A;  3EEA A;  4LFU A;  5HX9 A;  3VSK A;  4DMZ A;  5F6A A;  4OPZ A;  2JCH A;  5GLB A;  3V39 A;  4HIA A;  1ES4 A;  1N9O A;  4IJG A;  5CGX A;  1CQA A;  5HAR A;  3S7N A;  2R9X A;  5EFW A;  5F68 A;  3A3E A;  1TVF A;  2FZ0 A;  4EEU A;  2P04 A;  3LGO A;  4CPK A;  2WKR A;  4FD8 A;  1KE3 A;  3NOU C;  4BBV A;  5HSQ A;  3LEQ A;  4I3I A;  3ICY A;  2VGJ A;  2H5S A;  2IWC A;  1E3U D;  2RCX A;  4DF6 A;  2I72 A;  2VGL M;  2P9V A;  4EBP A;  2Y2I A;  1F2K A;  4PMA A;  2Z6C A;  3CZD A;  3LI8 A;  2XA7 S;  4UAA A;  1TS7 A;  1GHI A;  3A0S A;  3NOT C;  2G2W A;  2HGV A;  4R3B A;  2X71 A;  4S2N C;  4WEK A;  4EQI A;  1I5Q A;  4I3J A;  1K57 C;  3S22 A;  5HFO A;  3MBZ A;  2EFX A;  3FKV A;  4BJP A;  5GLD A;  1ZHH B;  2JKR I;  5HWV A;  1PWC A;  3HL9 A;  4XT2 A;  1E25 A;  1K55 C;  2H28 A;  1SKO A;  3OPP A;  1N9B A;  1GSX A;  3VP0 A;  3CI6 A;  3EGD C;  3N7W A;  2HDR A;  1W8Q A;  2H0Y A;  1H8Y A;  1LLB A;  1NJ4 A;  1W79 A;  1CEF A;  1PYY A;  5EUA A;  1LL8 A;  4JF4 A;  3WS1 A;  2L0W A;  4Z1W A;  4YFM A;  1LI0 A;  3ZG8 B;  1G5U A;  4X53 A;  3JYI A;  4PM8 A;  4OVD A;  2XK1 A;  3KSH A;  4OQ0 A;  1ZKJ A;  1CJF A;  1NYY A;  1Y28 A;  3TW8 A;  3B42 A;  3BQA A;  4HJ6 A;  1H5X A;  5E2H A;  3FPW A;  1Y54 A;  4DXC A;  3E2L A;  1DJC A;  2P9V B;  3LFV A;  5CED A;  3IXG A;  3VMA A;  2V8F A;  1VHM A;  3OCL A;  4UQI M;  1DP9 A;  2Y2P A;  5FQQ A;  1J9M A;  1XXM A;  1HD8 A;  3PBQ A;  1XP4 A;  5C5K A;  4OQH A;  5DVA A;  5FEG A;  3JPU A;  5HL1 A;  4KUO A;  3SH9 A;  2WGV A;  3PTE A;  1H0M A;  3SH8 A;  1S1Y A;  3QP2 A;  4KZB A;  5DFX A;  3O86 A;  4OPY A;  1SKO B;  2A3U A;  4X69 A;  1FOF A;  2XD5 A;  5F1F A;  4EBL A;  3G2Z A;  4R1G A;  3MZE A;  4HH3 A;  1MWU A;  5GHY A;  3C5A A;  2R9W A;  4D60 A;  3UB5 P;  1M6K A;  3ZGA B;  3FWL A;  3GR2 A;  3D4F A;  1PFL A;  2EWV A;  2PD7 A;  2K7S A;  4QHC A;  5EPH A;  2PYP A;  1CI8 A;  2J8Y A;  5DFY A;  4K0W A;  3U4L P;  4DXB A;  3BFD A;  2OLV A;  5DKL A;  3VP3 A;  5M1A A;  3W4O A;  4MN5 A;  2QPN A;  5AVF A;  1A0K A;  2LB5 A;  3C2W A;  3UMD A;  1Q2P A;  3AGD A;  3QP4 A;  2O9C A;  1VET A;  1YMX A;  1T19 A;  1K55 A;  4HH2 A;  3OCN A;  2HZ5 A;  1XA1 A;  3V67 A;  3DW0 A;  2E8I A;  3GQZ A;  3GV9 A;  2EX9 A;  4GW9 A;  4JXV A;  3LY4 A;  4I3A A;  4WEJ A;  2QKP A;  1OPX A;  2GDN A;  4BD1 A;  1GA9 A;  4LV0 A;  1NRJ A;  1V9Y A;  3VOZ A;  4UA7 A;  1BLH A;  3Q81 A;  3EWK A;  1YLT A;  4JBF A;  4Y17 A;  3DBA A;  1RGZ A;  2O9A A;  4LV2 A;  3KYZ A;  3RFB A;  4H8R A;  3DAV A;  1W63 M;  2OAP 1;  3OPH A;  1LL5 A;  3OBF A;  2Y2M A;  3IT9 A;  1BLP A;  2B02 A;  2C6W B;  4HES A;  4HI4 A;  3TSG A;  3HLD A;  2W1R A;  1I2W A;  4HP9 A;  4N9L A;  2A2L A;  1ZG6 A;  3T50 A;  1PRQ A;  4OQI A;  1MKI A;  5DTS A;  4GHI A;  4LRZ E;  3B47 A;  3UN7 A;  4KG5 A;  1J3W A;  4R0Q A;  5HL6 A;  1STZ A;  1VET B;  3FZC A;  4OPQ A;  4WF0 A;  1S4S A;  3WRT A;  5AQ7 A;  5EV0 A;  5A91 A;  4G3K A;  1FCM A;  5CRF A;  4RQ9 A;  3TE8 A;  5HZH A;  2PD8 A;  5JYP A;  3C38 A;  1P9W A;  3IH9 A;  4EUV A;  1Y4O A;  4IHQ A;  4Y15 A;  4S2K A;  2GJ3 A;  3LID A;  3KYQ A;  5E2G A;  4LLO B;  2WGI A;  5FQI A;  1W7F A;  3BY8 A;  3WS2 A;  2AVX A;  5HD5 A;  1YLJ A;  5DJU A;  5GHX A;  3MR0 A;  3MFX A;  1JWV A;  1ONH A;  3L9K A;  3Q82 A;  2V2F F;  4FH4 A;  2IA2 A;  3UB9 A;  4HP4 A;  5E2E A;  1FSY A;  1MBL A;  1PZO A;  1L0F A;  1XGJ A;  3BM6 A;  3FPV A;  4OOL A;  1JNU A;  1RGY A;  4LV1 A;  4MBH A;  1PZP A;  4O8G A;  1OTA A;  4GHI B;  4PPR A;  2Y55 A;  4WMC D;  2K2N A;  5EE8 A;  2JBF A;  2Y91 A;  4E3N A;  3PBN A;  3DWK A;  5A93 A;  4L0L A;  4Q0I A;  3ZG9 B;  3UE1 A;  2B5R A;  2BTF P;  4WYY A;  1NZO A;  4CLC B;  1K54 A;  1DY6 A;  2FFY A;  3RJU A;  3Q07 A;  5AQB A;  1KGE A;  3NOP C;  5DF9 A;  1WYC A;  1TS6 A;  5CGS A;  4QU3 A;  2NUP C;  5FDS A;  1MWT A;  4OON A;  1ERM A;  4BMW A;  2J80 A;  3DTI A;  5EVE A;  4MMN A;  1PI4 A;  4QPR A;  4JXW A;  4NXG A;  3FG8 A;  3CPT A;  1IEM A;  2ZL1 A;  3QP8 A;  3BJN A;  5EVI C;  1NYM A;  1MZU A;  3E0Y A;  4K0X A;  1YPR A;  3NDE A;  4GNU A;  2ZQD A;  5F83 A;  3ZDJ A;  2K31 A;  3RXX A;  3SW1 A;  1QMF A;  3K2N A;  5AQA A;  3VP2 A;  5TBM A;  2KLI A;  1M40 A;  4C6Y A;  2X02 A;  5MC7 A;  5FQK A;  2VK3 A;  4XUX A;  1HZO A;  1YAX A;  4BQM A;  2Q9N A;  5AJG A;  3HLW A;  4E3K A;  5DJT A;  4I5S A;  3ITB A;  4L9E A;  3ISG A;  4XUZ A;  3MS6 A;  5FQJ A;  5M18 A;  3HUO A;  2V0U A;  3QP5 A;  1K56 A;  2X01 A;  4KZ5 A;  2HDU A;  4YOF A;  3S7O A;  4QB8 A;  1PI5 A;  2PHY A;  1N9N A;  5FQM A;  2ZMF A;  3MF0 A;  3OLO A;  3LR3 A;  4X1L A;  3ZYT A;  4R3J A;  4QY6 A;  4KZ4 A;  1KE4 A;  2Y2L A;  3NJA A;  3CPT B;  2ZL1 B;  3NI9 A;  2J9O A;  3MQO A;  1L3L A;  3BLS A;  2PR6 A;  3MKE A;  2VGK A;  2HV1 A;  1GHP A;  2Q0O A;  5CGW A;  3LIE A;  3CWF A;  4MCW A;  1EW0 A;  3LIB A;  2WKH A;  2JKT I;  1XJ3 A;  3GTC A;  3UPP A;  5TBM B;  5F5Y A;  3GRJ A;  4A5R A;  2XRO A;  3Q7V A;  3UE0 A;  3MZF A;  3M6B A;  2CC1 A;  3LIF A;  4O01 A;  1WYB A;  1U60 A;  4S2M A;  4UEY A;  4FSF A;  2Z6D A;  2FFF B;  2H0T A;  1XA7 A;  2V9A A;  1TEM A;  2R78 A;  4Q0J A;  4EQ1 A;  1FR1 A;  2A49 A;  2QZ6 A;  1GCE A;  4KG6 A;  3E4O A;  4DJ3 A;  1XFQ A;  1OJG A;  3QNC A;  2XFS A;  4GKU A;  5EVI A;  3TG9 A;  2WKE A;  2VJW A;  2RL3 A;  1HTZ A;  4KQO A;  1MWS A;  3E4Q A;  5TFQ A;  4E3J A;  3E4P A;  1ES2 A;  3HLC A;  5DTK A;  2ZJ9 A;  3IHB A;  3SZT A;  4B9O A;  4I39 A;  4B88 A;  3HRE A;  3RTY A;  4LEN A;  3KX0 X;  5D3O A;  3MZD A;  1NWZ A;  1GHM A;  3FYZ A;  3C7U A;  3LR4 A;  4K08 A;  4Z9Q A;  2G7U A;  2Y2H A;  4ID4 A;  4PM5 A;  4FH2 A;  4HBT A;  3O5Y A;  4Y2F A;  4B4X A;  2VGL S;  1IFQ A;  4NXB A;  1ERQ A;  5AVE A;  4NXE A;  1CEG A;  4KZ3 A;  3Q7V B;  2Y2K A;  3T1S A;  3IF6 C;  2Z2L B;  4YWZ A;  5GL9 A;  1L0D A;  2VV7 A;  4ESP A;  2I9V A;  2QYB A;  2XRN A;  3MQ0 A;  4DRT A;  1L2S A;  1KDW A;  2A24 A;  1P0Z A;  1WA9 A;  2DMW A;  2HDQ A;  1NY0 A;  3LR5 A;  2Y2J A;  1KVL A;  2HF6 A;  5EVI B;  3V3R A;  1YM1 A;  5CHM A;  5EVL A;  1XX2 A;  1QME A;  3V3S A;  1TS0 A;  1XJ6 A;  3T1X A;  4HQA A;  4KZ7 A;  5J7E A;  4GOG A;  1PIO A;  4Q8I A;  3HLF A;  2WAE A;  3ITA A;  4M3K A;  3G4P A;  4N1X A;  3S7P A;  5CEC A;  1VQQ A;  5FAO A;  1DJA A;  1HVB A;  1IYP A;  3P7N A;  3IH8 A;  3LEZ A;  3HLB A;  3KSI A;  2PBD P;  4JPM A;  4IUH A;  1OTD A;  3UB8 A;  1SHV A;  3QP1 A;  2W3E A;  3SH7 A;  2OOL A;  1MWR A;  3PBT A;  5KMW A;  3ULF A;  3ZNY A;  4UQI S;  2ZM0 A;  5FAS A;  2MJ6 A;  1RP5 A;  1YLP A;  3JVU A;  4XT2 B;  4UHU A;  3MFD A;  1PWD A;  2JKR M;  3QHY A;  1PW8 A;  2L1M A;  3AGE A;  2A24 B;  2W0N A;  3F1O A;  1OT9 A;  1TDG A;  2WK0 A;  3VSL A;  3M6H A;  3N4I A;  4F3L A;  4NEE D;  5FI2 A;  4U3T A;  3S4X A;  2ZMA A;  4Y3I A;  3H82 A;  1IYS A;  1D1J A;  4DE3 A;  3G31 A;  3IBR A;  5IHV A;  2ZQ8 A;  1XKZ A;  3G6O A;  4C75 A;  1TDL A;  1IEL A;  3A0R A;  2Q9M A;  3N8R A;  4Q0H A;  4S2N A;  1H8Z A;  3W4P A;  1K57 A;  4BBT A;  5FA7 A;  4HJ4 A;  1C3B A;  3HJI A;  2M1C A;  5FAQ A;  4X6T A;  3RXW A;  4AFI A;  2XDM A;  3IF6 A;  4G3W A;  3IX4 A;  4B93 A;  3S1Y A;  3CHW P;  4CLC D;  2W3H A;  4IVI A;  3IXD A;  1D7E A;  5CTN A;  4P6B A;  4GS9 A;  5G4Y A;  1K0K A;  3UY6 A;  3MSH A;  4DJ2 A;  3P98 A;  2WZZ A;  1UGU A;  1MC0 A;  2KOI A;  4MDZ A;  3F1O B;  3T4O A;  5M19 A;  4GB7 A;  4FOF A;  1T1C A;  4OP8 A;  4F3L B;  1NXY A;  2CMN A;  1KDS A;  4GZB A;  3H82 B;  2Z2M B;  3SOI A;  2OSU A;  5KSH A;  5EEC A;  2PU2 A;  1SZV A;  2ZQA A;  1LI9 A;  3LCE A;  2Y4A A;  3K3D A;  3Q1F A;  4RX2 A;  3T4S A;  1W8Y A;  5HPF A;  1LHY A;  2B18 A;  1LSW A;  4Y0U A;  5F69 A;  3N6I A;  2VV8 A;  3H9W A;  2J7V A;  2ZC5 B;  4RX3 A;  4HNB A;  2XD1 A;  1ESI A;  3V5M A;  1D06 A;  3WS5 A;  3IF6 B;  1NZU A;  4X1M A;  2WKQ A;  4F94 A;  2V0W A;  2V8C A;  3WWX A;  3F1P A;  4P85 A;  4OOM A;  3UPO A;  2FH5 A;  1JWP A;  3O87 A;  5G4Z A;  4LRY C;  1FQG A;  3VP4 A;  4GS9 B;  4MBF A;  2JC7 A;  1X0O A;  4S2I A;  2P7J A;  4WLA A;  5EM1 A;  3UNW A;  3MQQ A;  1CI9 A;  3OZH A;  4KUK A;  4WM9 A;  3MKF A;  5DKK A;  2XFT A;  3PBO A;  2ZM2 A;  1TF1 A;  4MNR A;  2W1T A;  1VM1 A;  2XSS A;  4BD0 A;  3IXB A;  4MN6 A;  4OOY A;  4LPZ A;  5F82 A;  4YIN A;  3CAX A;  3BEB A;  4MN7 A;  4CQH A;  1FCO A;  2J3T C;  1G6A A;  2XR0 A;  3O3V A;  1Z6F A;  3DTK A;  3G32 A;  2VV6 A;  4QWO A;  1KVM A;  5EM0 A;  3LUQ A;  1MY8 A;  5GLC A;  1G6O A;  2VKS A;  1ES3 A;  2V1A A;  5CEB A;  1W5D A;  5HWW A;  2ZQ7 A;  5CHJ A;  2ZD8 A;  4WL9 A;  3UPN A;  2ZC3 B;  4QD4 A;  4NG2 A;  4EER A;  1K56 D;  4ETX A;  3L7H A;  4KQD A;  1ONG A;  3R7W A;  2BLS A;  4EU0 A;  3EGX C;  1K6R A;  2VLG A;  4OQG A;  4UA6 A;  3ZQ5 A;  1S66 L;  2JN7 A;  3BW6 A;  4IUK A;  4LCM A;  1S0W A;  5J8X A;  3VV4 A;  4BLM A;  3DWZ A;  3W4Q A;  1KOU A;  1K6S A;  3LO7 A;  1GSV A;  1S4R A;  3LIC A;  1MKM A;  4WZ4 A;  3C4O A;  4NXF A;  2W1T B;  4K91 A;  5L10 A;  3GSG A;  5DF7 A;  2WKI A;  3ZHH A;  3OC2 A;  4OLG A;  4P6Z M;  4GLQ A;  3A3I A;  4Y7P A;  3WS4 A;  1Q2Q A;  5L2F A;  2QMI A;  1JWZ A;  5IU1 A;  2QHK A;  1TS8 A;  4EWF A;  5L09 A;  5FAP A;  4JF5 A;  1S67 L;  2WUQ A;  1DJB A;  2DRW A;  1BTL A;  3LI9 A;  3VE4 A;  2QWS A;  3IF5 A;  5U47 A;  2W3F A;  4EUZ A;  5HDD A;  3ZG0 A;  4EES A;  4DE1 A;  4NKP A;  4OP5 A;  1P97 A;  1IKG A;  3T4K A;  3I7J A;  1UWP X;  5J4E A;  1OTI A;  1RCJ A;  3AGF A;  4WMC A;  4E3I A;  1O7E A;  5L07 A;  3R7W B;  2OWH A;  3T4L A;  1ALQ A;  1G28 A;  4Y5F A;  3MXR A;  5JYO A;  1WE4 A;  4PAU A;  1TD5 A;  1OME A;  1ESU A;  3IXH A;  4KZA A;  2JKG A;  2HP6 A;  3EEH A;  4PM6 A;  3IQA A;  5CTM A;  1Z09 A;  5HD3 A;  3UDX A;  4X68 A;  3HLE A;  3N8L A;  2UWX A;  2J3W A;  2ZLY A;  3CUE C;  1K4F A;  5L8M A;  4II7 A;  3ZG5 A;  3P01 A;  4ME4 A;  3W8K A;  3SS5 A;  4G3V A;  4RA7 A;  1T1A A;  5A8B A;  1GA0 A;  3KYE A;  1OT6 A;  5HDS A;  3MMH A;  3OPL A;  2HPB A;  5K5B A;  2WAD A;  3MXS A;  2J9P A;  4S2O A;  1ZC2 A;  3UE6 A;  3T1R A;  3LYX A;  2H10 A;  4JF6 A;  4WZ5 C;  1E4D A;  4ZJ2 A;  1IKI A;  4GJ4 A;  4HY8 A;  1NRF A;  2PDR A;  5EOO A;  5HW3 A;  3T12 B;  1MXO A;  3PYP A;  5CX7 A;  5KIZ A;  1CF0 A;  1ZG4 A;  4ZAM A;  5GHZ A;  2D01 A;  3UE3 A;  1S6R A;  4DDY A;  1K4E A;  4S2L A;  4ZRR A;  2PYR A;  5CXW A;  4GCZ A;  3IWI A;  4GN2 A;  3T1Q B;  4E3M A;  4EBN A;  2B95 A;  2BG1 A;  4S2J A;  3NHQ A;  1LSX A;  5CER A;  2JKF A;  3IS2 A;  2HP9 A;  3NY4 A;  2IWB A;  2Y2G A;  2WZX A;  2XA7 M;  1FIL A;  3BFC A;  4M4X A;  1BSG A;  3NC8 A;  1ERO A;  2E8J A;  4IED A;  5KZH A;  4DE0 A;  1P9R A;  1V9Z A;  4BL3 A;  4HEF A;  3UB6 A;  1IYO A;  1YQS A;  2KX6 A;  4FUW A;  3BY9 A;  4X56 A;  4B4Z A;  2JKT M;  1JTG A;  1IOU A;  3HBR A;  2GNX A;  2XF3 A;  2HJE A;  3IWQ A;  4NET A;  1N9L A;  4R6L A;  1KGG A;  3OPR A;  2M7U A;  3B3X A;  3C4P A;  3CLO A;  2L4R A;  3R4K A;  4JKT A;  5HPI A;  1H3Q A;  4WEL A;  5HAQ A;  3HUN A;  1DP6 A;  3M2K A;  3C8C A;  1T1B A;  4LV3 A;  5KSC A;  1BUL A;  1HLU P;  3UME A;  4R23 A;  3BQ8 A;  3BLM A;  4R38 A;  1BT5 A;  4RYE A;  4C3Q A;  3CUE A;  3KSG A;  1YLZ A;  3B33 A;  5TR7 A;  3RH8 B;  1XJ4 A;  3ZFZ A;  4BL2 A;  4QY5 A;  2VEA A;  2OLU A;  3CMZ A;  2HDS A;  2HP5 A;  3T4T A;  1BYW A;  2EX8 A;  3UO9 A;  2D02 A;  2PBY A;  1YSP A;  1OTE A;  3FC7 A;  3IS2 B;  4KG2 A;  3S7Q A;  1XGI A;  3IBJ A;  3NEC A;  3DTM A;  2WYX A;  3V50 A;  3ZNT A;  3HLG A;  4ARZ A;  4KZ9 A;  3CIT A;  1E3U A;  3LR0 A;  4WZ5 A;  3BEC A;  3HUM A;  4JGP A;  3PBR A;  5DF8 A;  1LT0 A;  5CHU A;  3EQU A;  3EQV A;  4BEN A;  2P74 A;  3CG5 A;  4WBG A;  4MBK A;  4ZDX A;  5IT5 A;  3VFF A;  3NIA A;  3NUL A;  3A0V A;  3ZVW A;  3E98 A;  2YKH A;  3PR6 A;  2EX6 A;  4P87 A;  2O9B A;  5EOE A;  4HJ3 A;  3G30 A;  3QNB A;  2W27 A;  4CLC C;  4EET B;  3IX8 A;  1F98 A;  3IWO A;  1ZTU A;  1IYQ A;  2IWD A;  5F1G A;  3Q7Z A;  4E6W A;  3G2Y A;  4JGR A;  1L0E A;  4DN0 A;  3O88 A;  4HBU A;  3TJZ C;  4ZJ3 A;  2Y79 A;  4CJN A;  4U0T A;  4MEZ A;  3EOI A;  3NDG A;  2VZW A;  2M7V A;  2JHE A;  4IBX A;  4KZ6 A;  2WGW A;  4ZBE A;  3BFF A;  2Y2O A;  2ZBB A;  2W3D A;  1YLY A;  3UDF A;  2PR5 A;  5DTT A;  4ARZ B;  1EWZ A;  2DNS A;  3FV7 A;  4Y0T A;  3PBS A;  5G18 A;  3VFH A;  4LCL A;  5E43 A;  2BAS A;  5E2F A;  3G34 A;  4L9F A;  5HAP A;  3VP1 A;  2ZC7 A;  3A3J A;  3PAG A;  5A90 A;  4ETZ A;  2C5W B;  1VB6 A;  2GX5 A;  3BRM A; 
#chains in the Genus database with same CATH homology
 4MCW A;  4HHD A;  1EW0 A;  2L0W A;  4Z1W A;  3LIB A;  2OWJ A;  4EER A;  2JKT I;  4ETX A;  1DP8 A;  1XJ3 A;  2VX8 A;  5TBM B;  1XJ2 A;  4KQD A;  5F5Y A;  3KSH A;  3R7W A;  4EXO A;  4EU0 A;  3EGX C;  2VLG A;  2XRO A;  3BWL A;  1Y28 A;  3OOV A;  3ZQ5 A;  1S66 L;  2JN7 A;  3BW6 A;  4IUK A;  3TW8 A;  3B42 A;  3TRC A;  3BQA A;  4HJ6 A;  3FPW A;  3VV4 A;  3LIF A;  4R70 A;  4O01 A;  1KOU A;  3LFV A;  4UEY A;  4FSF A;  1GSV A;  2Z6D A;  1S4R A;  1VHM A;  3LIC A;  1MKM A;  3K3C A;  3OCL A;  4UQI M;  1DP9 A;  2V9A A;  2NUT C;  4HOI A;  2W1T B;  4NXF A;  4PKY A;  3H7W A;  1F5M A;  4Q0J A;  2R78 A;  3VOL A;  4EQ1 A;  3OC2 A;  4P6Z M;  4GLQ A;  3PBQ A;  2YKF A;  3E4O A;  4DJ3 A;  5C5K A;  1XFQ A;  1OJG A;  1XFN A;  4WUJ A;  4I38 A;  2VJW A;  4KQO A;  4KUO A;  5IU1 A;  3E4Q A;  2QHK A;  1S1Y A;  1TS8 A;  4JGQ A;  3E4P A;  5DFX A;  1S67 L;  1OJ5 A;  3KO6 A;  2W3G A;  4B9O A;  3LI9 A;  4I39 A;  1T18 A;  3RTY A;  3PHY A;  2PT7 A;  4HH3 A;  5HWT A;  3VE4 A;  2QWS A;  3KX0 X;  2W3F A;  4CLC A;  1F9I A;  1NWZ A;  5HDD A;  3LR4 A;  5TJJ A;  5HDC A;  1NLZ A;  5LBR A;  4K08 A;  4EES A;  2G7U A;  2EWV A;  2PD7 A;  4NKP A;  1P97 A;  2K7S A;  2PYP A;  5DFY A;  3T4K A;  3O5Y A;  1UWP X;  4Y2F A;  5J4E A;  1OTI A;  5FL3 A;  5DKL A;  2VGL S;  1IFQ A;  4NXB A;  5AVE A;  3R7W B;  2OWH A;  3T4L A;  1GSW A;  1S1Z A;  4MN5 A;  4NXE A;  5AVF A;  2EWW A;  2LB5 A;  1G28 A;  4Y5F A;  3T4Q A;  3C2W A;  3UMD A;  4YWZ A;  3D72 A;  3C30 A;  2VV7 A;  4PAU A;  1TD5 A;  2GZA A;  2I9V A;  2QYB A;  2XRN A;  3MQ0 A;  2O9C A;  3VE3 A;  1T19 A;  3UB7 A;  3EEH A;  2V1B A;  2A24 A;  3H7W B;  4JGO A;  1P0Z A;  4HH2 A;  1WA9 A;  2DMW A;  3LR5 A;  5HD3 A;  3OCN A;  5I5L A;  3V67 A;  2J3W A;  3CUE C;  3MJQ A;  5L8M A;  2HF6 A;  4II7 A;  4GW9 A;  3T4J A;  4I3A A;  4WEJ A;  4BWI A;  2QKP A;  1OPX A;  4EW7 A;  1W63 Q;  3P01 A;  4ME4 A;  3F1P B;  1TS0 A;  2KDK A;  1NRJ A;  1XJ6 A;  1V9Y A;  2HJ9 C;  4G3V A;  1T1A A;  5A8B A;  3MXQ A;  4HQA A;  4R3A A;  1OT6 A;  2ZOH A;  5J7E A;  5HDS A;  3MMH A;  2P08 A;  5K5B A;  3EWK A;  3UE6 A;  3DBA A;  2O9A A;  3LYX A;  3KYZ A;  2WKP A;  3RFB A;  1YSQ A;  5IS1 A;  3S7P A;  2ZMV A;  1W63 M;  2OAP 1;  3P7N A;  2J3T D;  4GJ4 A;  3OBF A;  4HY8 A;  3KSI A;  3U2A A;  4HI4 A;  2B02 A;  4IUH A;  1OTD A;  2PDR A;  3UB8 A;  2W1R A;  2W3E A;  4HP9 A;  1H8M A;  2OOL A;  3PBT A;  2A2L A;  3LIA A;  3F1N A;  3PYP A;  5CX7 A;  5KIZ A;  4H6J A;  3ULF A;  4UQI S;  3T50 A;  2MJ6 A;  2D01 A;  2INW A;  4GHI A;  4LRZ E;  3UE3 A;  2LB9 A;  3B47 A;  1YKD A;  3JVU A;  4P6Z S;  4XT2 B;  4ZRR A;  2PYR A;  5HL6 A;  2JKR M;  4PHT A;  1STZ A;  4GCZ A;  2L1M A;  2OAQ 1;  2A24 B;  2W0N A;  3F1O A;  1OT9 A;  4WF0 A;  1S4S A;  3NHQ A;  4LRX C;  1LSX A;  3PXP A;  4F3L A;  4G3K A;  4NEE D;  3IS2 A;  4WN5 A;  3GEC A;  4RQ9 A;  3TE8 A;  5HZH A;  2PD8 A;  2XA7 M;  4Y3I A;  3C38 A;  3H82 A;  4M4X A;  1P9W A;  4EUV A;  3D3O A;  3IBR A;  4IHQ A;  1P9R A;  1V9Z A;  2O99 A;  3UB6 A;  3LID A;  2GJ3 A;  2KX6 A;  3G6O A;  3HJK A;  3KYQ A;  3BY9 A;  3HCY A;  4LLO B;  2JKT M;  1NLY A;  1IOU A;  1UWN X;  2GNX A;  3W2Z A;  3BY8 A;  2HJE A;  3A0R A;  4BBU A;  1N9L A;  4R6L A;  4Q0H A;  2M7U A;  5HD5 A;  2VA0 A;  5DJU A;  4BBT A;  4HJ4 A;  3HJI A;  2M1C A;  3MR0 A;  3MFX A;  2Y8H A;  2EA9 A;  3CLO A;  4AFI A;  2L4R A;  3GDI A;  3R4K A;  5HPI A;  1H3Q A;  4E04 A;  4WEL A;  2IA2 A;  4G3W A;  3UB9 A;  1ODV A;  1DP6 A;  4HP4 A;  4YNR A;  4B93 A;  3C8C A;  1T1B A;  4CLC D;  2W3H A;  3FPV A;  4OOL A;  1D7E A;  3F1N B;  1JNU A;  3UME A;  4H6J B;  3BQ8 A;  4R38 A;  2QJ7 A;  4O8G A;  4GS9 A;  5G4Y A;  5J3W A;  4PKY G;  1OTA A;  4GHI B;  4EEP A;  4CLC E;  3CUE A;  4DJ2 A;  3KSG A;  1UGU A;  2K2N A;  4O0P A;  1MC0 A;  3B33 A;  2QJ5 A;  3RH8 B;  3PBN A;  1XJ4 A;  2KOI A;  4L9G A;  4L0L A;  2VEA A;  2ZOI A;  4Q0I A;  4MDZ A;  3F1O B;  3T4O A;  3JVV A;  2O0Y A;  3KSF A;  4FOF A;  3T4T A;  1BYW A;  1T1C A;  1OTB A;  4CLC B;  4F3L B;  2D02 A;  3FC7 A;  1DRM A;  1OTE A;  1YSP A;  3IS2 B;  1LSV A;  2CMN A;  3EEA A;  3S7Q A;  3IBJ A;  3NOP C;  3H82 B;  5DF9 A;  4DMZ A;  1TS6 A;  5F6A A;  4ARZ A;  5KSH A;  2NUP C;  3CIT A;  3LR0 A;  4BMW A;  4JGP A;  2J80 A;  4MMN A;  3PBR A;  1LT0 A;  4HIA A;  3K3D A;  4QPR A;  4NXG A;  3FG8 A;  1N9O A;  3EQU A;  3EQV A;  3T4S A;  5HPF A;  2B18 A;  1LSW A;  3BJN A;  5F69 A;  4IJG A;  2VV8 A;  3H9W A;  1MZU A;  3E0Y A;  4HNB A;  5IT5 A;  1D06 A;  3A0V A;  3S7N A;  3E98 A;  2K31 A;  2WKQ A;  2V0W A;  5EFW A;  5F68 A;  3SW1 A;  3K2N A;  2YKH A;  3PR6 A;  2FZ0 A;  3F1P A;  4OOM A;  2O9B A;  4EEU A;  2P04 A;  4HJ3 A;  5TBM A;  2FH5 A;  5G4Z A;  2W27 A;  2WKR A;  4LRY C;  2KLI A;  4CLC C;  3NOU C;  4EET B;  4BBV A;  4GS9 B;  5HSQ A;  5MC7 A;  4I3I A;  1X0O A;  1YAX A;  2P7J A;  3ICY A;  4WLA A;  1F98 A;  3MQQ A;  1ZTU A;  5AJG A;  2VGL M;  4KUK A;  5DKK A;  3PBO A;  5DJT A;  4I5S A;  2Z6C A;  4JGR A;  1TF1 A;  3LI8 A;  2XA7 S;  4L9E A;  4DN0 A;  1TS7 A;  2W1T A;  3TJZ C;  2XSS A;  3A0S A;  3NOT C;  2Y79 A;  2HGV A;  3EOI A;  2V0U A;  2VZW A;  2M7V A;  4WEK A;  2JHE A;  4I3J A;  4MN6 A;  2ZBB A;  4LPZ A;  4BJP A;  4YOF A;  3S7O A;  2W3D A;  2PHY A;  1N9N A;  3CAX A;  2PR5 A;  2ZMF A;  4ARZ B;  4MN7 A;  1ZHH B;  4CQH A;  3MF0 A;  2J3T C;  3OLO A;  3LR3 A;  2JKR I;  5HWV A;  2VV6 A;  3PBS A;  3ZYT A;  4XT2 A;  3LUQ A;  2H28 A;  2BAS A;  3NJA A;  1G6O A;  3MQO A;  2VKS A;  1GSX A;  4L9F A;  3CI6 A;  3EGD C;  2V1A A;  4ETZ A;  2PR6 A;  1VB6 A;  2HV1 A;  5HWW A;  2GX5 A;  1LL8 A;  4WL9 A;  3LIE A;  3CWF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...