4OP5A

Crystal structure of stabilized tem-1 beta-lactamase variant v.13 carrying r164s mutation
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGGRVGYIELDLASGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVGELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDSWEPELNEAIPNDERDTTTPVAMATTLRKLLTGELLTAASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYMTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Extended spectrum beta-lactamase TEM-63
publication title Negative Epistasis and Evolvability in TEM-1 beta-Lactamase--The Thin Line between an Enzyme's Conformational Freedom and Disorder.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 95
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2014-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4op5A00
3IXBA 3PAEA 1FR1A 2ZJ9A 4EQIA 1K54C 3Q7VA 4S2NC 1BLSA 3PTEA 5EVID 4GDNA 3Q81A 3UNWA 1CI9A 4BL2A 3BFGA 3IWQA 5F1GA 3ZG0A 2ZC4B 3ZFZA 3C7VA 2Y2KA 2X01A 5KMWA 3GTCA 4X56A 4KZ5A 1YLWA 1Q2QA 3GQZA 2EX9A 4KG2A 3WS2A 4LV3A 4JKTA 2ZQDA 1C3BA 3W4QA 1RCJA 1ONGA 4OP8A 3DWZA 5GLCA 3DW0A 4Y0TA 2JCHA 2R9XA 4K0XA 2RCXA 3MBZA 2Y2QA 5GLAA 3V39A 3NC8A 3WWXA 1E3UD 5HAIA 1SCWA 3RXWA 3MFDA 1VM1A 1ES5A 1U60A 3MXSA 1PWDA 2J7VA 4N9KA 1KE3A 2J9OA 5U47A 3ITAA 4JBFA 4CPKA 5FA7A 4KQOA 3OPPA 3ZDJA 4E3LA 1LI0A 5GHYA 2PBYA 2P9VA 1M6KA 4PM6A 3G31A 3HLFA 4E3KA 3UE3A 2QMIA 4JF5A 3I7JA 3GMWA 3RXXA 4UA7A 3NI9A 4S2LA 1W7FA 4UA6A 3S22A 4PMAA 4RX3A 1PW1A 1YLJA 4DE0A 1GHPA 1K55A 2VGKA 2HP9A 1XA1A 2WUQA 4NETA 5AQ9A 1IKIA 3PBNA 4YFMA 3S4XA 5FI7A 4OPYA 1K25A 4GN2A 5AQ7A 3D4FA 5GLDA 3UN7A 4S2IA 2EFUA 2ZQ9A 3LEZA 3IF6B 3M2JA 3CMZA 4LV0A 4ZDXA 4KZBA 2BLSA 5HL1A 1N9BA 3CZDA 2WKEA 4DE1A 2DRWA 4DE3A 3N8LA 1GHIA 3HLCA 4KZ8A 1K6RA 5F83A 3QHYA 2HP5A 3HUOA 2ZMAA 1HVBA 5TGFA 1SHVA 4XUXA 3AGFA 3HLBA 5CTMA 1CK3A 1G6AA 1K56A 2G2WA 3P09A 4OLGA 4RYEA 3RJUA 4EBLA 1WE4A 3A3JA 3HUMA 3M6BA 5FSRA 4PPRA 2EFXA 2Z2LB 2V20A 3GVBA 1GA9A 1ES4A 2E8IA 3BLMA 2XDMA 3N7WA 4BENA 1TDLA 3OZHA 3WS4A 1ZKJA 2OV5A 2HDUA 3Q1FA 2B5RA 1BUEA 1GCEA 4M3KA 4FH4A 4IBXA 3B3XA 1DY6A 3UE1A 4GZBA 3LCEA 5JYOA 1PZOA 4DXCA 1MY8A 3V50A 1O7EA 4E6WA 4WBGA 4E6XA 5EVLA 2XFSA 1XGIA 4S2KA 2Z2MB 1YT4A 4JXSA 5KSHA 3P98A 5DF8A 1KGEA 2ZQ7A 1LL5A 5FQJA 4WMCD 1ESIA 3TSGA 4DDSA 3WS0A 4X55A 4DF6A 1ERQA 1NZOA 4WZ4A 3O88A 3UDIA 3SH9A 1W8YA 2EX2A 4WEJA 1ZG4A 1XA7A 1ERMA 2WZZA 2Y55A 5EE8A 4PM8A 5GL9A 3FV7A 4JXWA 2GDNA 3IHAA 4U3TA 2HDQA 5CTNA 1I2WA 4BD0A 4BL3A 1SKFA 4HBUA 5CXWA 3FYZA 5DF9A 4OPRA 3G4PA 2XFTA 4BQMA 4YINA 5E2FA 1FSWA 5E43A 4P87A 4L0LA 2XGNA 4OVDA 2WK0A 4LV2A 1MBLA 3UDXA 1O07A 4K0WA 3VP4A 4OQGA 1OMEA 2Y2HA 1EI5A 1Z6FA 1PWCA 2XH9A 1IKGA 2JC7A 3NDGA 1L2SA 3A3IA 4R0QA 3ZG5A 5F1FA 4FD8A 1PI5A 2ZD8A 3BECA 1XP4A 5M18A 1JTGA 4RX2A 3O86A 3ZVWA 4WYYA 3UE0A 3LY3A 1ESUA 4GD8A 4WEKA 4QHCA 2P9VB 3ZNTA 1JVJA 1J9MA 3TOIA 4S2JA 2WGWA 2X02A 4WZ5C 2Y2IA 2WADA 3OPRA 5DF7A 5FI6A 4E3MA 4QD4A 2J8YA 3IT9A 1PW8A 3ZNYA 1NZUA 1PWGA 1L0EA 1BT5A 4QB8A 3C5AA 4FCFA 5E2EA 5KSCA 1IYOA 4OPQA 4R1GA 3EQUA 2J9PA 1NJ4A 1LHYA 1RP5A 5A92A 3VSLA 1KDWA 1K6SA 4FH2A 4S2MA 1TDGA 3C4PA 5EVIA 1G68A 1PIOA 1JWZA 4KZ9A 3G35A 1K55C 3IXGA 5GHXA 1MWRA 1SDEA 2EX8A 1FOFA 3CG5A 4K91A 4OQ0A 1MKIA 3ZHHA 4S2OA 1IYQA 1BSGA 4Q8IA 3MKEA 2Y59A 3Q07A 4N1HA 2A49A 2WGVA 4D2OA 3M6HA 4P6BA 4ZJ2A 1ZG6A 5HARA 5FQ9A 3HVFA 4ZAMA 5IHVA 3IHBA 3G32A 4X69A 1I5QA 5F82A 4JF4A 2Y2PA 4EWFA 4LV1A 3MZDA 1XX2A 2I72A 2ZQAA 4BJPA 4NK3A 4GKUA 3V5MA 1E3UA 5CERA 3HLEA 5FDHA 1DJCA 2FFFB 2PU2A 3BEBA 3OC2A 3SS4A 4UAAA 1BTLA 1YLTA 1GA0A 3OPHA 2HPBA 3AGEA 5CHUA 4LCLA 5EUAA 4R3JA 3M2KA 3OCNA 2Y4AA 4UA9A 3ZVTA 4DE2A 1NXYA 3PBQA 4KG6A 3ZG9B 1BZAA 2XD5A 3ITBA 5FQMA 1CEGA 1KVLA 5CHJA 3BFFA 1FQGA 4E3JA 2HDRA 4LENA 1KE4A 3WS1A 2P74A 4OOYA 4A5RA 3E2KA 1XKZA 3NY4A 4GDBA 1ONHA 3Q7ZA 4HESA 1BLCA 3HLGA 4OQHA 1L0DA 1RGZA 5G18A 1KGFA 4JLFA 2FFYA 1RGYA 4MBFA 4KG5A 4E3IA 2H0YA 3BM6A 3IH9A 5JYPA 3GR2A 1YMSA 1MWUA 4OQIA 4DXBA 1GHMA 1YLYA 1W8QA 2DNSA 4X53A 4ZJ3A 4QJGA 2X71A 2ZM0A 3IXHA 4OP5A 4P85A 1NYMA 4X6TA 3V3SA 3NIAA 1XXMA 1MWTA 1HD8A 1MWSA 3BYDA 3PBRA 3VMAA 1LLBA 4ZBEA 2XQZA 1IELA 4O7DA 2JE5A 3O87A 1YQSA 2WKHA 3FWLA 4EBPA 3IF6A 4KQQA 2ZLYA 2WZXA 4MLLA 4OOLA 1ALQA 4X68A 4KZ6A 1YMXA 3Q7VB 4OPZA 5M19A 5CEBA 2Y2GA 3SH7A 4HBTA 4MBKA 1Q2PA 4MEZA 1FCMA 2ZC5B 4Y7PA 2EX6A 1W5DA 1K57A 1YLPA 3G2YA 3IQAA 3PBSA 4WM9A 5CEDA 3VFHA 2OSUA 1ES2A 2PU4A 1WYBA 4OKPA 1XPBA 5FQQA 4KZ3A 2ZQCA 2EXBA 4GOGA 5FAQA 4CJNA 5E2HA 2WGWB 1IYPA 1PI4A 3BFDA 2CC1A 2UWXA 1KDSA 2VGJA 3NCKA 4KQRA 3DWKA 4B4XA 5A90A 3O3VA 3PBOA 4KENB 4ZJ1A 2QPNA 3JYIA 5FQIA 5DTTA 1BLPA 4MNRA 1KE0A 1NRFA 5EOOA 5CGXA 2Y91A 3FZCA 4H8RA 5FQKA 1KVMA 2Y2MA 4WMCA 3UDFA 3WRZA 3A3DA 1I2SA 5L2FA 3BRMA 1VQQA 1CI8A 1LI9A 1KGGA 2Y2LA 2WGIA 2V1ZA 4C6YA 5EVIB 3N8RA 4XUZA 3QNBA 1DJBA 2RL3A 3IH8A 1FSYA 4F94A 2XEPA 5FATA 3OCLA 2Q9NA 4R4RA 3A3EA 4MBHA 5EVIC 3VP3A 3VP0A 3BFCA 3OPLA 4IVIA 4Y0OA 5E2GA 4OOMA 4DKIA 2OLUA 1DJAA 3NBLA 3DTMA 3BLSA 5HW3A 1SDNA 1FCOA 4U0XA 4OH0A 3C7UA 4GNUA 3UPOA 1S0WA 1FR6A 5FAOA 3SH8A 3N6IA 5DTSA 4E3NA 5FI2A 1TEMA 5A91A 5AQAA 2QZ6A 1EWZA 4PM5A 1BLHA 2DCFA 3C4OA 3V3RA 4JPMA 2WAEA 4UHUA 5FAPA 1IEMA 1S6RA 2XD1A 1K54A 2A3UA 3Q82A 4PM7A 4S2NA 5HFOA 3ZCZA 5HAQA 5HAPA 4IVKA 4C3QA 2HDSA 2WKIA 4ZTKA 5TR7A 2ZC6B 4R3BA 3UO9A 5AQBA 3HBRA 3HREA 1NY0A 3WS5A 4GB7A 4FSFA 3LO7A 2ZM2A 1N4OA 4WZ5A 1L0GA 4N9LA 3UPPA 3PAGA 4RVAA 4EBNA 4HEFA 2IWCA 3IWOA 4C75A 4E3OA 3EQVA 2C6WB 4S2PA 2EXAA 3HLWA 3S1YA 1E4DA 3VFFA 2XK1A 4QY5A 5FASA 1CEFA 4JXGA 5J8XA 3ZGAB 3G2ZA 4DDYA 2ZC7A 5KZHA 4Y0UA 4PM9A 1K4EA 5BOHA 3MKFA 5CGWA 3IWIA 1K56D 3G30A 3BFEA 5EOEA 4XXRA 3SOIA 2JBFA 4KZAA 5EPHA 3G34A 4KZ4A 3AGDA 4OLDA 5EECA 4N1XA 1IYSA 1K38A 4QY6A 3ZG8B 1QMEA 1QMFA 2ZM8A 2BG1A 4GD6A 3LY4A 3TG9A 3VOZA 5M1AA 3W4PA 4B4ZA 1PYYA 2H5SA 4OONA 3WRTA 5D3OA 3CJMA 1AXBA 3N8SA 4IEDA 3MZEA 4U0TA 5CRFA 3IF6C 3NDEA 2Y2JA 3W4OA 1ZC2A 3GSGA 2XR0A 2IWDA 3SS5A 4Z9QA 3PBTA 3VP2A 3ZG7B 1HZOA 1ES3A 2ZQ8A 5CHMA 1FCNA 5GLBA 1TVFA 3ISGA 1M40A 3FKWA 4N92A 4EV4A 2XLNA 1LL9A 2Y2OA 1K57C 4P0MA 2H0TA 1XGJA 2XF3A 1MPLA 1HTZA 1JWPA 5DTKA 1WYCA 1H8ZA 3IF5A 4R23A 2IWBA 3SS3A 5GHZA 1YLZA 3QNCA 3VP1A 4ID4A 1NYYA 1EROA 4IBRA 3N4IA 3HUNA 1H5XA 2ZC3B 3VSKA 3MXRA 1Y54A 4DRTA 1E25A 3UY6A 4WELA 4LCMA 5HX9A 2HP6A 2OLVA 2WYXA 1PZPA 5DVAA 3VOYA 5CECA 4BD1A 4B88A 2C5WB 4EUZA 4JXVA 1L0FA 4RA7A 3E2LA 3MZFA 1MXOA 3HLDA 2WAFA 3A3FA 1JTDA 4JF6A 4R4SA 2Q9MA 1H8YA 5I94A 2H10A 4BLMA 2Y2NA 2V2FF 4KZ7A 2G2UA 3IXDA 5A93A 3UPNA 3GV9A 5TFQA 4QU3A 1W79A 3GRJA 2R9WA 3HL9A 3FKVA 1K4FA 1BULA 1JWVA 1YM1A 3W8KA 5CGSA
chains in the Genus database with same CATH superfamily
3T50A 4EQIA 3Q7VA 3NOPC 1VHMA 3P01A 3EGDC 3Q81A 3UNWA 1CI9A 3BFGA 3IWQA 4B93A 3C7VA 2Y2KA 3GTCA 2EX9A 3UB8A 1C3BA 4Z1WA 1ONGA 3DW0A 1FILA 3NC8A 4PAUA 1ES5A 2L4RA 2VX8A 2J7VA 5U47A 3ITAA 3OPPA 3B47A 1LI0A 2VA0A 1OJGA 1F2KA 4B9OA 3UE3A 4DJ3A 2HJ9C 3GMWA 4G3KA 3NI9A 4UA6A 3S22A 3MJQA 1VEUA 5L07A 5AQ7A 2JKTM 4S2IA 2EFUA 2ZQ9A 3BWLA 3IF6B 2W1RA 4LV0A 2BLSA 4HJ6A 1TS6A 2V8CA 2ZMAA 1HVBA 1SHVA 4XUXA 1XJ3A 3HLBA 1CK3A 4Y0TA 1Y4OA 3RJUA 1WE4A 3LR4A 2Z2LB 2V20A 1GA9A 1ES4A 1TDLA 4O0PA 5L09A 3S7PA 1ZKJA 2HDUA 2B5RA 1GCEA 1DY6A 4GZBA 5JYOA 1PZOA 2PD8A 4E6WA 2OOLA 1YT4A 4DN0A 5FQJA 2VJWA 2ZMVA 3WS0A 4F3LA 3RFBA 3SH9A 5DKKA 2R78A 5EM0A 1ERMA 2WZZA 5EE8A 2GJ3A 3FV7A 3EGXC 1G28A 2HDQA 5CTNA 1I2WA 4GJ4A 2OAQ1 5CXWA 5F5YA 2J3TC 4OPRA 3G4PA 5E43A 4X1LA 2WK0A 3UDXA 2V0UA 2Y2HA 2JC7A 4LFUA 1L2SA 1PI5A 5M18A 4RX2A 4WYYA 4P6ZS 3DBAA 4GD8A 2FZ0A 4QHCA 4G3WA 4S2JA 3ICYA 2WADA 4Q0IA 1LL8A 1PW8A 3EQUA 1YKDA 5A92A 3VE4A 4S2MA 1TDGA 4DMZA 1OT6A 3T1RA 2FH5A 2EX8A 3CG5A 1NLYA 4OQ0A 2W3DA 1MKIA 4S2OA 4N1HA 2W3FA 4ZJ2A 4ZRRA 1I5QA 1PNEA 2Y2PA 3IX4A 2I72A 4Y5FA 4H6JA 5CERA 3HLEA 3PHYA 1DJCA 2PU2A 3BEBA 5FDHA 5FL3A 1GA0A 2DMWA 3OPHA 2HPBA 3UB6A 4R3JA 1BZAA 2PD7A 2JHEA 3ITBA 3BFFA 2E8JA 1KE4A 1UWNX 3WS1A 4A5RA 4GDBA 2YKHA 1ONHA 5CX7A 1OTIA 5G18A 4F3LB 4O01A 1XFNA 3IS2B 4NKPA 3D9YA 3GR2A 3LR3A 4DXBA 4QJGA 4MDZA 2ZM0A 4P85A 1NYMA 3EEHA 2WKQA 3BYDA 3VMAA 2EWWA 1LLBA 4ZBEA 4O7DA 2WZXA 4MLLA 4X68A 4KZ6A 3EOIA 5K5BA 2V9AA 4MN5A 1K57A 3A0RA 3PBSA 3VFHA 1Y28A 1ES2A 2PU4A 4OKPA 4HI4A 2ZQCA 1PI4A 2UWXA 3R4KA 4RQ9A 2QPNA 3JYIA 5DTTA 1BLPA 4D60A 2LB9A 2Y2MA 4WMCA 3WRZA 5L2FA 1VQQA 3N8RA 4XUZA 2RL3A 3C38A 1L3LA 3OCLA 3VP0A 4IVIA 2W1TB 2OLUA 3DTMA 5HW3A 3LICA 4GNUA 1P9RA 3R7WA 5FI2A 2PYRA 2O9CA 4ETZA 2QZ6A 1BLHA 5HPFA 3C4OA 5F68A 5FAPA 3Q82A 2A3UA 5HAPA 5HFOA 3OBFA 2HDSA 5TR7A 2ZC6B 4GHIA 3ULFA 5AQBA 2A24B 2H28A 3HBRA 3HREA 4GB7A 3LO7A 2M7VA 4RVAA 4FUWA 5J4EA 3VFFA 5FASA 2XROA 5J8XA 1G5UA 3G2ZA 4WL9A 1JNUA 3ZGAB 3QP1A 1K4EA 3MKFA 4HJ4A 2ZL1B 4XXRA 4KZAA 3MQQA 4ESPA 1H0MA 4N1XA 2XA7S 3VOZA 1DP6A 4B4ZA 4OONA 3WRTA 5D3OA 3BQAA 4HQAA 2BTFP 4GLQA 1F98A 3UE6A 1ZC2A 2XR0A 4HP9A 1LSWA 1ZHHB 3VP2A 5CHMA 3ISGA 5G4ZA 1TS7A 1M40A 3FKWA 4N92A 2Y2OA 4P0MA 1K57C 2H0TA 1MPLA 1HTZA 1WYCA 1H8ZA 2A2LA 5GHZA 2QYBA 3QNCA 4ID4A 1NYYA 1EROA 2W3HA 4IBRA 2NUPC 2ZC3B 3C30A 2VEAA 1T18A 1E25A 3UY6A 4PKYA 2UV0E 4WELA 3VOYA 4NG2A 5DVAA 4BD1A 4CLCB 4YNRA 3CUEA 4RA7A 3E2LA 2WAFA 1OTDA 2H10A 4NXFA 3R7WB 3H7WB 2G2UA 2J80A 4ETXA 2R9WA 2AVXA 1YM1A 3T4OA 3IXBA 4GHIB 1FR1A 2ZJ9A 3LIAA 1BLSA 3PTEA 1EW0A 5EVID 4GDNA 3ZFZA 2X01A 5KMWA 4X56A 4KG2A 3WS2A 3BJNA 1RCJA 3DWZA 4I38A 2RCXA 3CLOA 2Y2QA 1E3UD 3ZQ5A 3RXWA 1VM1A 1U60A 3CAXA 2J9OA 1LSVA 3ZDJA 4E3LA 2P9VA 4E3KA 4JF5A 1F9IA 3F1NA 1IOUA 3CPTA 4I3AA 4S2LA 1W7FA 4RX3A 1PW1A 2Z6DA 2HP9A 3A0SA 4NETA 4MCWA 3HJKA 4HH2A 3K3CA 2V0WA 5FI7A 4GN2A 3E4OA 5GLDA 3UN7A 3CITA 3F1PB 3CMZA 3S7NA 1N9BA 3CZDA 2WKEA 4DE1A 4G3VA 3N8LA 5TGFA 3DAVA 1K56A 1G6AA 4OLGA 4RYEA 3P09A 1NWZA 2QJ7A 3BLMA 2XDMA 3OZHA 3WS4A 3EWKA 2IA2A 4R3AA 3CUEC 1MY8A 4WBGA 4LPZA 1UGUA 4JXSA 3P98A 5HWVA 5DF8A 2JN7A 1ESIA 4DDSA 4X55A 4DF6A 2M1CA 2BASA 1W8YA 4YOFA 4WEJA 3DTKA 5MC7A 1XA7A 2ZBBA 5GL9A 4JXWA 3VV4A 1HLUP 4BL3A 1SKFA 2Q0OA 5DJUA 3FYZA 4YINA 4LV2A 1MBLA 4K0WA 4OQGA 1OMEA 2XH9A 1H3QA 1XP4A 1YSQA 1JTGA 2P9VB 1JVJA 1J9MA 4HJ3A 2X02A 3RTYA 3OPRA 5FI6A 4E3MA 2J8YA 3F1NB 3T1QB 1PWGA 4QB8A 1NRJA 2W0NA 4OPQA 5EV0A 1NJ4A 3QP8A 1KDWA 4ARZA 3T12B 3G35A 3IXGA 5GHXA 5TJJA 2XRNA 2JKTI 4GCZA 3LEQA 5HARA 3K2NA 4EWFA 3MZDA 2OAP1 5G4YA 3OC2A 4UAAA 5CHUA 2ZOHA 4LCLA 3IBRA 3M2KA 2O99A 1NXYA 3PBQA 4KG6A 5HPIA 3ZG9B 1OTEA 4FOFA 4NXGA 4OOYA 3E2KA 3NY4A 3Q7ZA 3T4SA 1KGFA 4Y15A 3BM6A 3IH9A 1G6OA 4EUVA 4ZJ3A 1YLYA 4Y3IA 1S1YA 4UQIM 3LI8A 3T4JA 4X6TA 3NIAA 4HY8A 1XXMA 1MWTA 1MWSA 3PBRA 2XQZA 1XJ6A 3O87A 4EBPA 4KQQA 2ZLYA 4OOLA 1V9ZA 3Q7VB 4OPZA 2Y2GA 2L1MA 4HBTA 2P08A 3U2AA 2EX6A 3G2YA 5CEDA 2P7JA 4KQDA 2NUTC 2VGLS 1XPBA 5FQQA 2EXBA 4GOGA 5E2HA 3T1SA 4HOIA 3UB9A 1VETA 3NCKA 3O3VA 4ZJ1A 5FQIA 3KYEA 4H8RA 5HZHA 3BW6A 3A3DA 1YPRA 1I2SA 3BRMA 1CI8A 4ARZB 4C6YA 3IH8A 5IS1A 3A3EA 3VP3A 3OPLA 4OOMA 4I3JA 5HDSA 1FCOA 2G7UA 1VEUB 3UPOA 3NULA 5FAOA 3T1XA 3N6IA 3TRCA 5AQAA 4PM5A 2K31A 2WAEA 1S6RA 1K54A 4PM7A 4S2NA 4C3QA 4CLCE 1CF0A 2VLGA 4GS9A 4WZ5A 4N9LA 3KSGA 4HEFA 4C75A 4E3OA 4IHQA 4S2PA 1CEFA 2O9AA 2V1BA 5HDDA 3MSHA 5BOHA 1N9OA 3GDIA 4NXEA 3SW1A 4BMWA 2INWA 3KO6A 3QP6A 2JKFA 4CQHA 3AGDA 3LR5A 1IYSA 1K38A 1TF1A 1QMFA 3LY4A 5M1AA 2H5SA 3BQ8A 3PXPA 1AXBA 3N8SA 3NECA 1T1BA 5CRFA 2Y2JA 3GSGA 3SS5A 4Z9QA 3E98A 2ZQ8A 1TVFA 3P7NA 1OJ5A 2V1AA 3EEAA 2XF3A 2VV7A 4EESA 4R23A 2VKSA 1YLZA 3MMHA 2EA9A 5AJGA 4HIAA 3BY8A 1P97A 5HX9A 5CECA 1PZPA 4B88A 3FPVA 4JXVA 1XFQA 4LLOB 3MZFA 3HLDA 2I9VA 1D06A 2B95A 3A3FA 5HD5A 4R4SA 2Q9MA 4BLMA 2QJ5A 2XSSA 1V9YA 4KZ7A 4L9EA 4CLCD 1IFQA 3FKVA 3IBJA 3CI6A 1K54C 3OLOA 4S2NC 1Z09A 1D7EA 4E04A 3LIFA 4BL2A 4H6JB 4EXOA 1YLWA 3GQZA 4LV3A 3FC7A 2ZQDA 4WUJA 5GLCA 3D72A 2J3WA 2JCHA 5IT5A 2R9XA 4K0XA 2PRFA 5GLAA 3V39A 5HAIA 3UB7A 1SCWA 3VOLA 3MFDA 2GX5A 3MXSA 1KE3A 3A0VA 2WKPA 4KQOA 2PBYA 1M6KA 4PM6A 1XJ4A 3CWFA 3MQ0A 3RXXA 2KX6A 4R70A 1F5MA 1YLJA 4DE0A 1GHPA 1K55A 5AQ9A 3UMEA 3LFVA 3PBNA 3S4XA 1K25A 2ZOIA 3LEZA 3DTEA 5HL1A 1ODVA 4JGOA 1GHIA 5F83A 3AGFA 5CTMA 2G2WA 4EBLA 3FPWA 3HUMA 2EFXA 3GVBA 3N7WA 4BENA 2KLIA 4BWIA 1ZTUA 1BYWA 1DP8A 4DXCA 1O7EA 4E6XA 3L9KA 3S7QA 5EVLA 2XFSA 2ACGA 1CJFA 4S2KA 1S1ZA 1LSXA 1LL5A 2ZQ7A 3TSGA 2JKRM 1AWIA 4WLAA 3MQOA 1ERQA 3UDIA 5DJTA 3IHAA 4EEPA 4U3TA 4BD0A 4I3IA 3KX0X 4K08A 5DF9A 4HH3A 2XFTA 1GSXA 4XT2A 4P87A 4OVDA 3VP4A 1FIKA 1XJ2A 1EI5A 1Z6FA 1PWCA 3NDGA 4R0QA 5F1FA 4FD8A 2ZD8A 3BECA 2EWVA 3LI9A 2K7SA 1ESUA 4WEKA 3NOUC 3D3OA 5DF7A 1P9WA 5FDSA 3IT9A 1NZUA 1L0EA 1BT5A 3C5AA 5KSCA 1IYOA 4R1GA 1LHYA 1RP5A 3VSLA 4FH2A 5L8MA 5EVIA 1JWZA 4KZ9A 5HD3A 1K55C 1FOFA 1IYQA 4Q8IA 3MKEA 2Y59A 3KSIA 3M6HA 2PR6A 4P6BA 4R6LA 5FQ9A 5F82A 4X69A 4JF4A 4LV1A 5AVEA 1YSPA 4BJPA 4NK3A 4GKUA 1E3UA 4LRZE 2FFFB 1YLTA 3LGOA 3F1OA 3TE8A 5EUAA 2Y4AA 4UA9A 3B33A 4DE2A 1DP9A 1KVLA 5CHJA 2Z6CA 4HNBA 4HHDA 4HESA 1BLCA 1OT9A 3HLGA 4L9GA 4LRYC 2FFYA 1RGYA 4MBFA 4KG5A 4E3IA 2H0YA 3FG8A 5JYPA 1MWUA 3IX3A 2DNSA 3T4QA 3IXHA 3NHQA 3QP2A 5HWWA 2JE5A 3FWLA 3C2WA 3IF6A 1ALQA 2P04A 1YMXA 5M19A 5CEBA 4BBTA 4MEZA 2ZC5B 4Y7PA 3IQAA 4WM9A 2OSUA 1WYBA 2PBDP 4KZ3A 5FAQA 4CJNA 3BFDA 2CC1A 1KDSA 4KQRA 3DWKA 4B4XA 5A90A 5AVFA 4EEUA 2J3TD 5EOOA 5CGXA 2Y91A 3FZCA 1GSVA 3HJIA 1KVMA 3UDFA 2M7UA 1T19A 4I39A 1KGGA 2Y2LA 2WGIA 5EVIB 2W3GA 3PYPA 1DJBA 4F94A 2XEPA 4R4RA 4MBHA 5EVIC 4Y0OA 1S66L 2PAVP 2YKFA 5E2GA 3SZTA 3CPTB 3BLSA 4O8GA 3CHWP 1YAXA 1SDNA 4U0XA 4OH0A 3C7UA 5LBRA 1S0WA 1FR6A 3JPUA 5DTSA 5TBMA 1TEMA 5A91A 1EWZA 5HL6A 2HV1A 5J3WA 1DRMA 5KIZA 3V3RA 4JPMA 1IEMA 3F1OB 4IVKA 4ZTKA 3UO9A 4QPRA 3WS5A 5HWTA 2ZM2A 3PAGA 2JKGA 3EQVA 1D1JA 2KOIA 3U4LP 2EXAA 4JXGA 3TJZC 2ZC7A 4II7A 4DJ2A 5CGWA 3G30A 3BFEA 5EOEA 4EQ1A 4KZ4A 3B42A 4OLDA 5EECA 3T4LA 5FEFA 1NLZA 1TD5A 3ZG8B 4IUHA 4GD6A 3TG9A 3T4KA 3W4PA 3CJMA 4IEDA 4U0TA 3IF6C 3W4OA 2KDKA 2IWDA 4MN7A 1HZOA 2HGVA 3E4QA 4EV4A 2XLNA 1LL9A 3H9WA 2HJEA 1ACFA 2PYPA 3IF5A 3VP1A 2Y8HA 2PHYA 4X25A 3HUNA 1H5XA 3VSKA 2CMNA 3BY9A 4DRTA 4LCMA 2HP6A 2WYXA 5DKLA 4I5SA 2C5WB 1S4RA 1MXOA 3HCYA 3IS2A 1JTDA 4JF6A 1H8YA 3TW8A 2Y2NA 5TBMB 5A93A 3MXQA 5TFQA 2PR5A 1W79A 3GRJA 1K4FA 2XA7M 1TS8A 5C5KA 3PAEA 5F1GA 3ZG0A 2ZC4B 4KZ5A 1Q2QA 4JKTA 4EETB 2GNXA 3W4QA 4OP8A 1A0KA 4R38A 2B18A 3L7HA 3PR6A 3MBZA 3WWXA 3LIDA 4Y13A 1WA9A 4N9KA 1PWDA 2LB5A 4JBFA 4CPKA 5FA7A 3LIBA 1PRQA 5GHYA 3G31A 3HLFA 2QMIA 4NEED 3UB5P 3I7JA 2W1TA 4UA7A 2O0YA 3W2ZA 2PT7A 4PMAA 2VGKA 1KOUA 1XA1A 2WUQA 1UWPX 1IKIA 4IUKA 4YFMA 5F69A 4OPYA 3D4FA 2VZWA 1STZA 2D01A 3M2JA 4ZDXA 3IX8A 4KZBA 4L9FA 2DRWA 4DE3A 2B02A 3HLCA 4KZ8A 2A24A 1K6RA 3QHYA 2HP5A 3HUOA 4Y17A 4YWZA 2K2NA 3A3JA 5FSRA 3M6BA 4PPRA 3QP5A 2E8IA 2OV5A 1OTAA 1VETB 3Q1FA 1BUEA 4M3KA 4FH4A 3RH8B 4IBXA 3MR0A 3B3XA 2ZL1A 3UE1A 3LCEA 3V50A 2W3EA 4PKYG 1XGIA 2WKRA 1VB6A 2Z2MB 5KSHA 3NOTC 1KGEA 4WMCD 3GECA 5DFYA 1NZOA 5EM1A 4WZ4A 3O88A 3C8CA 1TS0A 2EX2A 1ZG4A 4Q0HA 4IJGA 4ME4A 1S67L 2Y55A 4PM8A 2GDNA 5J7EA 4M4XA 4HBUA 4BQMA 5E2FA 1FSWA 3QP4A 2XGNA 4L0LA 1K0KA 5EVEA 1O07A 2VV8A 1IKGA 3ZG5A 3A3IA 3H82A 4GS9B 3ZVWA 3O86A 4KUKA 3UE0A 3LY3A 1W63M 3ZNTA 3O5YA 3TOIA 2WGWA 4WZ5C 2Y2IA 3UMDA 4CLCA 4QD4A 3ZNYA 4FCFA 5E2EA 5I5LA 2J9PA 4UQIS 1K6SA 3H7WA 3VE3A 3C4PA 1G68A 3G6OA 1PIOA 4LRXC 1MWRA 1SDEA 4K91A 3ZHHA 1BSGA 3Q07A 2A49A 2WGVA 4D2OA 1GSWA 1ZG6A 3HVFA 4ZAMA 5IHVA 3IHBA 3G32A 3ZYTA 1XX2A 2ZQAA 3V5MA 1S4SA 3MF0A 3SS4A 1BTLA 3AGEA 5FEGA 3OCNA 3ZVTA 3KYQA 4LGWA 3S7OA 2XD5A 5FQMA 1CEGA 4EU0A 4E3JA 1FQGA 2HDRA 3KSFA 4LENA 2P74A 1XKZA 3LIEA 4BBUA 4OQHA 1L0DA 1RGZA 1MC0A 4JLFA 4KUOA 3LR0A 2QKPA 2W27A 2JKRI 1YMSA 4OQIA 1GHMA 4X53A 1W8QA 1J3WA 4JGPA 2X71A 4OP5A 3V3SA 1HD8A 1IELA 2O9BA 4Y2FA 1YQSA 2WKHA 2L0WA 3F1PA 1MKMA 4MMNA 3SH7A 4MBKA 1Q2PA 1FCMA 3H82B 1W5DA 1YLPA 4WF0A 4FTXA 2WGWB 2D02A 4MN6A 1IYPA 2VGJA 2QHKA 4GW9A 3PBOA 4KENB 2MJ6A 4MNRA 1KE0A 3K3DA 4AFIA 1NRFA 4CLCC 5DFXA 5FQKA 3V67A 1LI9A 1N9NA 2V1ZA 2Y79A 3QNBA 1FSYA 5FATA 1PFLA 2Q9NA 3BFCA 4DKIA 1DJAA 4Q0JA 3NBLA 3E4PA 1P0ZA 3DTIA 3SH8A 4E3NA 2ZMFA 1SKOA 2DCFA 5HSQA 4UHUA 3ZCZA 5HAQA 2XD1A 4PHTA 2VK3A 1OTBA 2WKIA 4R3BA 5A8BA 3LYXA 1SZVA 1T1CA 4X1MA 3OOVA 1NY0A 4FSFA 1N4OA 1L0GA 3UPPA 4EBNA 2IWCA 3IWOA 2C6WB 2VGLM 3KYZA 3HLWA 3S1YA 1E4DA 4JGQA 1MZUA 2XK1A 4QY5A 5HDCA 4DDYA 5KZHA 3E0YA 1N9LA 3JVVA 4Y0UA 4PM9A 3IWIA 1K56D 3SOIA 2JBFA 2OWJA 2PDRA 1T1AA 5EPHA 3G34A 4BBVA 4EERA 2HZ5A 4QY6A 4P6ZM 1QMEA 2ZM8A 2BG1A 1PYYA 2V8FA 3LUQA 3MZEA 5F6AA 3NDEA 3T4TA 3MS6A 5L10A 1X0OA 3PBTA 3ZG7B 3KSHA 1ES3A 1FCNA 5GLBA 5IU1A 1OPXA 2HF6A 4EW7A 4QWOA 1XGJA 5DTKA 1JWPA 4NXBA 4XT2B 5EFWA 1H8MA 2IWBA 1W63Q 3SS3A 1LT0A 3N4IA 2GZAA 2QWSA 4UEYA 3MXRA 1Y54A 4HP4A 3JVUA 2OLVA 4EUZA 2OWHA 1L0FA 1CQAA 4WN5A 2VV6A 3NJAA 5I94A 3MFXA 4JGRA 2V2FF 3IXDA 3UPNA 1SKOB 3GV9A 4QU3A 3HL9A 1BULA 1JWVA 3W8KA 5CGSA
chains in the Genus database with same CATH topology
3IXBA 3PAEA 1FR1A 2ZJ9A 4EQIA 1K54C 3Q7VA 4S2NC 1BLSA 3PTEA 5EVID 4GDNA 3Q81A 3UNWA 1CI9A 4BL2A 3BFGA 3IWQA 5F1GA 3ZG0A 2ZC4B 3ZFZA 3C7VA 2Y2KA 2X01A 5KMWA 3GTCA 4X56A 4KZ5A 1YLWA 1Q2QA 3GQZA 2EX9A 4KG2A 3WS2A 4LV3A 4JKTA 2ZQDA 1C3BA 3W4QA 1RCJA 1ONGA 4OP8A 3DWZA 5GLCA 3DW0A 4Y0TA 2JCHA 2R9XA 4K0XA 2RCXA 3MBZA 2Y2QA 5GLAA 3V39A 3NC8A 3WWXA 1E3UD 5HAIA 1SCWA 3RXWA 3MFDA 1VM1A 1ES5A 1U60A 3MXSA 1PWDA 2J7VA 4N9KA 1KE3A 2J9OA 5U47A 3ITAA 4JBFA 4CPKA 5FA7A 4KQOA 3OPPA 3ZDJA 4E3LA 1LI0A 5GHYA 2PBYA 2P9VA 1M6KA 4PM6A 3G31A 3HLFA 4E3KA 3UE3A 2QMIA 4JF5A 3I7JA 3GMWA 3RXXA 4UA7A 3NI9A 4S2LA 1W7FA 4UA6A 3S22A 4PMAA 4RX3A 1PW1A 1YLJA 4DE0A 1GHPA 1K55A 2VGKA 2HP9A 1XA1A 2WUQA 4NETA 5AQ9A 1IKIA 3PBNA 4YFMA 3S4XA 5FI7A 4OPYA 1K25A 4GN2A 5AQ7A 3D4FA 5GLDA 3UN7A 4S2IA 2EFUA 2ZQ9A 3LEZA 3IF6B 3M2JA 3CMZA 4LV0A 4ZDXA 4KZBA 2BLSA 5HL1A 1N9BA 3CZDA 2WKEA 4DE1A 2DRWA 4DE3A 3N8LA 1GHIA 3HLCA 4KZ8A 1K6RA 5F83A 3QHYA 2HP5A 3HUOA 2ZMAA 1HVBA 5TGFA 1SHVA 4XUXA 3AGFA 3HLBA 5CTMA 1CK3A 1G6AA 1K56A 2G2WA 3P09A 4OLGA 4RYEA 3RJUA 4EBLA 1WE4A 3A3JA 3HUMA 3M6BA 5FSRA 4PPRA 2EFXA 2Z2LB 2V20A 3GVBA 1GA9A 1ES4A 2E8IA 3BLMA 2XDMA 3N7WA 4BENA 1TDLA 3OZHA 3WS4A 1ZKJA 2OV5A 2HDUA 3Q1FA 2B5RA 1BUEA 1GCEA 4M3KA 4FH4A 4IBXA 3B3XA 1DY6A 3UE1A 4GZBA 3LCEA 5JYOA 1PZOA 4DXCA 1MY8A 3V50A 1O7EA 4E6WA 4WBGA 4E6XA 5EVLA 2XFSA 1XGIA 4S2KA 2Z2MB 1YT4A 4JXSA 5KSHA 3P98A 5DF8A 1KGEA 2ZQ7A 1LL5A 5FQJA 4WMCD 1ESIA 3TSGA 4DDSA 3WS0A 4X55A 4DF6A 1ERQA 1NZOA 4WZ4A 3O88A 3UDIA 3SH9A 1W8YA 2EX2A 4WEJA 1ZG4A 1XA7A 1ERMA 2WZZA 2Y55A 5EE8A 4PM8A 5GL9A 3FV7A 4JXWA 2GDNA 3IHAA 4U3TA 2HDQA 5CTNA 1I2WA 4BD0A 4BL3A 1SKFA 4HBUA 5CXWA 3FYZA 5DF9A 4OPRA 3G4PA 2XFTA 4BQMA 4YINA 5E2FA 1FSWA 5E43A 4P87A 4L0LA 2XGNA 4OVDA 2WK0A 4LV2A 1MBLA 3UDXA 1O07A 4K0WA 3VP4A 4OQGA 1OMEA 2Y2HA 1EI5A 1Z6FA 1PWCA 2XH9A 1IKGA 2JC7A 3NDGA 1L2SA 3A3IA 4R0QA 3ZG5A 5F1FA 4FD8A 1PI5A 2ZD8A 3BECA 1XP4A 5M18A 1JTGA 4RX2A 3O86A 3ZVWA 4WYYA 3UE0A 3LY3A 1ESUA 4GD8A 4WEKA 4QHCA 2P9VB 3ZNTA 1JVJA 1J9MA 3TOIA 4S2JA 2WGWA 2X02A 4WZ5C 2Y2IA 2WADA 3OPRA 5DF7A 5FI6A 4E3MA 4QD4A 2J8YA 3IT9A 1PW8A 3ZNYA 1NZUA 1PWGA 1L0EA 1BT5A 4QB8A 3C5AA 4FCFA 5E2EA 5KSCA 1IYOA 4OPQA 4R1GA 3EQUA 2J9PA 1NJ4A 1LHYA 1RP5A 5A92A 3VSLA 1KDWA 1K6SA 4FH2A 4S2MA 1TDGA 3C4PA 5EVIA 1G68A 1PIOA 1JWZA 4KZ9A 3G35A 1K55C 3IXGA 5GHXA 1MWRA 1SDEA 2EX8A 1FOFA 3CG5A 4K91A 4OQ0A 1MKIA 3ZHHA 4S2OA 1IYQA 1BSGA 4Q8IA 3MKEA 2Y59A 3Q07A 4N1HA 2A49A 2WGVA 4D2OA 3M6HA 4P6BA 4ZJ2A 1ZG6A 5HARA 5FQ9A 3HVFA 4ZAMA 5IHVA 3IHBA 3G32A 4X69A 1I5QA 5F82A 4JF4A 2Y2PA 4EWFA 4LV1A 3MZDA 1XX2A 2I72A 2ZQAA 4BJPA 4NK3A 4GKUA 3V5MA 1E3UA 5CERA 3HLEA 5FDHA 1DJCA 2FFFB 2PU2A 3BEBA 3OC2A 3SS4A 4UAAA 1BTLA 1YLTA 1GA0A 3OPHA 2HPBA 3AGEA 5CHUA 4LCLA 5EUAA 4R3JA 3M2KA 3OCNA 2Y4AA 4UA9A 3ZVTA 4DE2A 1NXYA 3PBQA 4KG6A 3ZG9B 1BZAA 2XD5A 3ITBA 5FQMA 1CEGA 1KVLA 5CHJA 3BFFA 1FQGA 4E3JA 2HDRA 4LENA 1KE4A 3WS1A 2P74A 4OOYA 4A5RA 3E2KA 1XKZA 3NY4A 4GDBA 1ONHA 3Q7ZA 4HESA 1BLCA 3HLGA 4OQHA 1L0DA 1RGZA 5G18A 1KGFA 4JLFA 2FFYA 1RGYA 4MBFA 4KG5A 4E3IA 2H0YA 3BM6A 3IH9A 5JYPA 3GR2A 1YMSA 1MWUA 4OQIA 4DXBA 1GHMA 1YLYA 1W8QA 2DNSA 4X53A 4ZJ3A 4QJGA 2X71A 2ZM0A 3IXHA 4OP5A 4P85A 1NYMA 4X6TA 3V3SA 3NIAA 1XXMA 1MWTA 1HD8A 1MWSA 3BYDA 3PBRA 3VMAA 1LLBA 4ZBEA 2XQZA 1IELA 4O7DA 2JE5A 3O87A 1YQSA 2WKHA 3FWLA 4EBPA 3IF6A 4KQQA 2ZLYA 2WZXA 4MLLA 4OOLA 1ALQA 4X68A 4KZ6A 1YMXA 3Q7VB 4OPZA 5M19A 5CEBA 2Y2GA 3SH7A 4HBTA 4MBKA 1Q2PA 4MEZA 1FCMA 2ZC5B 4Y7PA 2EX6A 1W5DA 1K57A 1YLPA 3G2YA 3IQAA 3PBSA 4WM9A 5CEDA 3VFHA 2OSUA 1ES2A 2PU4A 1WYBA 4OKPA 1XPBA 5FQQA 4KZ3A 2ZQCA 2EXBA 4GOGA 5FAQA 4CJNA 5E2HA 2WGWB 1IYPA 1PI4A 3BFDA 2CC1A 2UWXA 1KDSA 2VGJA 3NCKA 4KQRA 3DWKA 4B4XA 5A90A 3O3VA 3PBOA 4KENB 4ZJ1A 2QPNA 3JYIA 5FQIA 5DTTA 1BLPA 4MNRA 1KE0A 1NRFA 5EOOA 5CGXA 2Y91A 3FZCA 4H8RA 5FQKA 1KVMA 2Y2MA 4WMCA 3UDFA 3WRZA 3A3DA 1I2SA 5L2FA 3BRMA 1VQQA 1CI8A 1LI9A 1KGGA 2Y2LA 2WGIA 2V1ZA 4C6YA 5EVIB 3N8RA 4XUZA 3QNBA 1DJBA 2RL3A 3IH8A 1FSYA 4F94A 2XEPA 5FATA 3OCLA 2Q9NA 4R4RA 3A3EA 4MBHA 5EVIC 3VP3A 3VP0A 3BFCA 3OPLA 4IVIA 4Y0OA 5E2GA 4OOMA 4DKIA 2OLUA 1DJAA 3NBLA 3DTMA 3BLSA 5HW3A 1SDNA 1FCOA 4U0XA 4OH0A 3C7UA 4GNUA 3UPOA 1S0WA 1FR6A 5FAOA 3SH8A 3N6IA 5DTSA 4E3NA 5FI2A 1TEMA 5A91A 5AQAA 2QZ6A 1EWZA 4PM5A 1BLHA 2DCFA 3C4OA 3V3RA 4JPMA 2WAEA 4UHUA 5FAPA 1IEMA 1S6RA 2XD1A 1K54A 2A3UA 3Q82A 4PM7A 4S2NA 5HFOA 3ZCZA 5HAQA 5HAPA 4IVKA 4C3QA 2HDSA 2WKIA 4ZTKA 5TR7A 2ZC6B 4R3BA 3UO9A 5AQBA 3HBRA 3HREA 1NY0A 3WS5A 4GB7A 4FSFA 3LO7A 2ZM2A 1N4OA 4WZ5A 1L0GA 4N9LA 3UPPA 3PAGA 4RVAA 4EBNA 4HEFA 2IWCA 3IWOA 4C75A 4E3OA 3EQVA 2C6WB 4S2PA 2EXAA 3HLWA 3S1YA 1E4DA 3VFFA 2XK1A 4QY5A 5FASA 1CEFA 4JXGA 5J8XA 3ZGAB 3G2ZA 4DDYA 2ZC7A 5KZHA 4Y0UA 4PM9A 1K4EA 5BOHA 3MKFA 5CGWA 3IWIA 1K56D 3G30A 3BFEA 5EOEA 4XXRA 3SOIA 2JBFA 4KZAA 5EPHA 3G34A 4KZ4A 3AGDA 4OLDA 5EECA 4N1XA 1IYSA 1K38A 4QY6A 3ZG8B 1QMEA 1QMFA 2ZM8A 2BG1A 4GD6A 3LY4A 3TG9A 3VOZA 5M1AA 3W4PA 4B4ZA 1PYYA 2H5SA 4OONA 3WRTA 5D3OA 3CJMA 1AXBA 3N8SA 4IEDA 3MZEA 4U0TA 5CRFA 3IF6C 3NDEA 2Y2JA 3W4OA 1ZC2A 3GSGA 2XR0A 2IWDA 3SS5A 4Z9QA 3PBTA 3VP2A 3ZG7B 1HZOA 1ES3A 2ZQ8A 5CHMA 1FCNA 5GLBA 1TVFA 3ISGA 1M40A 3FKWA 4N92A 4EV4A 2XLNA 1LL9A 2Y2OA 1K57C 4P0MA 2H0TA 1XGJA 2XF3A 1MPLA 1HTZA 1JWPA 5DTKA 1WYCA 1H8ZA 3IF5A 4R23A 2IWBA 3SS3A 5GHZA 1YLZA 3QNCA 3VP1A 4ID4A 1NYYA 1EROA 4IBRA 3N4IA 3HUNA 1H5XA 2ZC3B 3VSKA 3MXRA 1Y54A 4DRTA 1E25A 3UY6A 4WELA 4LCMA 5HX9A 2HP6A 2OLVA 2WYXA 1PZPA 5DVAA 3VOYA 5CECA 4BD1A 4B88A 2C5WB 4EUZA 4JXVA 1L0FA 4RA7A 3E2LA 3MZFA 1MXOA 3HLDA 2WAFA 3A3FA 1JTDA 4JF6A 4R4SA 2Q9MA 1H8YA 5I94A 2H10A 4BLMA 2Y2NA 2V2FF 4KZ7A 2G2UA 3IXDA 5A93A 3UPNA 3GV9A 5TFQA 4QU3A 1W79A 3GRJA 2R9WA 3HL9A 3FKVA 1K4FA 1BULA 1JWVA 1YM1A 3W8KA 5CGSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IXB A;  3PAE A;  1FR1 A;  2ZJ9 A;  4EQI A;  1K54 C;  3Q7V A;  4S2N C;  1BLS A;  3PTE A;  5EVI D;  4GDN A;  3Q81 A;  3UNW A;  1CI9 A;  4BL2 A;  3BFG A;  3IWQ A;  5F1G A;  3ZG0 A;  2ZC4 B;  3ZFZ A;  3C7V A;  2Y2K A;  2X01 A;  5KMW A;  3GTC A;  4X56 A;  4KZ5 A;  1YLW A;  1Q2Q A;  3GQZ A;  2EX9 A;  4KG2 A;  3WS2 A;  4LV3 A;  4JKT A;  2ZQD A;  1C3B A;  3W4Q A;  1RCJ A;  1ONG A;  4OP8 A;  3DWZ A;  5GLC A;  3DW0 A;  4Y0T A;  2JCH A;  2R9X A;  4K0X A;  2RCX A;  3MBZ A;  2Y2Q A;  5GLA A;  3V39 A;  3NC8 A;  3WWX A;  1E3U D;  5HAI A;  1SCW A;  3RXW A;  3MFD A;  1VM1 A;  1ES5 A;  1U60 A;  3MXS A;  1PWD A;  2J7V A;  4N9K A;  1KE3 A;  2J9O A;  5U47 A;  3ITA A;  4JBF A;  4CPK A;  5FA7 A;  4KQO A;  3OPP A;  3ZDJ A;  4E3L A;  1LI0 A;  5GHY A;  2PBY A;  2P9V A;  1M6K A;  4PM6 A;  3G31 A;  3HLF A;  4E3K A;  3UE3 A;  2QMI A;  4JF5 A;  3I7J A;  3GMW A;  3RXX A;  4UA7 A;  3NI9 A;  4S2L A;  1W7F A;  4UA6 A;  3S22 A;  4PMA A;  4RX3 A;  1PW1 A;  1YLJ A;  4DE0 A;  1GHP A;  1K55 A;  2VGK A;  2HP9 A;  1XA1 A;  2WUQ A;  4NET A;  5AQ9 A;  1IKI A;  3PBN A;  4YFM A;  3S4X A;  5FI7 A;  4OPY A;  1K25 A;  4GN2 A;  5AQ7 A;  3D4F A;  5GLD A;  3UN7 A;  4S2I A;  2EFU A;  2ZQ9 A;  3LEZ A;  3IF6 B;  3M2J A;  3CMZ A;  4LV0 A;  4ZDX A;  4KZB A;  2BLS A;  5HL1 A;  1N9B A;  3CZD A;  2WKE A;  4DE1 A;  2DRW A;  4DE3 A;  3N8L A;  1GHI A;  3HLC A;  4KZ8 A;  1K6R A;  5F83 A;  3QHY A;  2HP5 A;  3HUO A;  2ZMA A;  1HVB A;  5TGF A;  1SHV A;  4XUX A;  3AGF A;  3HLB A;  5CTM A;  1CK3 A;  1G6A A;  1K56 A;  2G2W A;  3P09 A;  4OLG A;  4RYE A;  3RJU A;  4EBL A;  1WE4 A;  3A3J A;  3HUM A;  3M6B A;  5FSR A;  4PPR A;  2EFX A;  2Z2L B;  2V20 A;  3GVB A;  1GA9 A;  1ES4 A;  2E8I A;  3BLM A;  2XDM A;  3N7W A;  4BEN A;  1TDL A;  3OZH A;  3WS4 A;  1ZKJ A;  2OV5 A;  2HDU A;  3Q1F A;  2B5R A;  1BUE A;  1GCE A;  4M3K A;  4FH4 A;  4IBX A;  3B3X A;  1DY6 A;  3UE1 A;  4GZB A;  3LCE A;  5JYO A;  1PZO A;  4DXC A;  1MY8 A;  3V50 A;  1O7E A;  4E6W A;  4WBG A;  4E6X A;  5EVL A;  2XFS A;  1XGI A;  4S2K A;  2Z2M B;  1YT4 A;  4JXS A;  5KSH A;  3P98 A;  5DF8 A;  1KGE A;  2ZQ7 A;  1LL5 A;  5FQJ A;  4WMC D;  1ESI A;  3TSG A;  4DDS A;  3WS0 A;  4X55 A;  4DF6 A;  1ERQ A;  1NZO A;  4WZ4 A;  3O88 A;  3UDI A;  3SH9 A;  1W8Y A;  2EX2 A;  4WEJ A;  1ZG4 A;  1XA7 A;  1ERM A;  2WZZ A;  2Y55 A;  5EE8 A;  4PM8 A;  5GL9 A;  3FV7 A;  4JXW A;  2GDN A;  3IHA A;  4U3T A;  2HDQ A;  5CTN A;  1I2W A;  4BD0 A;  4BL3 A;  1SKF A;  4HBU A;  5CXW A;  3FYZ A;  5DF9 A;  4OPR A;  3G4P A;  2XFT A;  4BQM A;  4YIN A;  5E2F A;  1FSW A;  5E43 A;  4P87 A;  4L0L A;  2XGN A;  4OVD A;  2WK0 A;  4LV2 A;  1MBL A;  3UDX A;  1O07 A;  4K0W A;  3VP4 A;  4OQG A;  1OME A;  2Y2H A;  1EI5 A;  1Z6F A;  1PWC A;  2XH9 A;  1IKG A;  2JC7 A;  3NDG A;  1L2S A;  3A3I A;  4R0Q A;  3ZG5 A;  5F1F A;  4FD8 A;  1PI5 A;  2ZD8 A;  3BEC A;  1XP4 A;  5M18 A;  1JTG A;  4RX2 A;  3O86 A;  3ZVW A;  4WYY A;  3UE0 A;  3LY3 A;  1ESU A;  4GD8 A;  4WEK A;  4QHC A;  2P9V B;  3ZNT A;  1JVJ A;  1J9M A;  3TOI A;  4S2J A;  2WGW A;  2X02 A;  4WZ5 C;  2Y2I A;  2WAD A;  3OPR A;  5DF7 A;  5FI6 A;  4E3M A;  4QD4 A;  2J8Y A;  3IT9 A;  1PW8 A;  3ZNY A;  1NZU A;  1PWG A;  1L0E A;  1BT5 A;  4QB8 A;  3C5A A;  4FCF A;  5E2E A;  5KSC A;  1IYO A;  4OPQ A;  4R1G A;  3EQU A;  2J9P A;  1NJ4 A;  1LHY A;  1RP5 A;  5A92 A;  3VSL A;  1KDW A;  1K6S A;  4FH2 A;  4S2M A;  1TDG A;  3C4P A;  5EVI A;  1G68 A;  1PIO A;  1JWZ A;  4KZ9 A;  3G35 A;  1K55 C;  3IXG A;  5GHX A;  1MWR A;  1SDE A;  2EX8 A;  1FOF A;  3CG5 A;  4K91 A;  4OQ0 A;  1MKI A;  3ZHH A;  4S2O A;  1IYQ A;  1BSG A;  4Q8I A;  3MKE A;  2Y59 A;  3Q07 A;  4N1H A;  2A49 A;  2WGV A;  4D2O A;  3M6H A;  4P6B A;  4ZJ2 A;  1ZG6 A;  5HAR A;  5FQ9 A;  3HVF A;  4ZAM A;  5IHV A;  3IHB A;  3G32 A;  4X69 A;  1I5Q A;  5F82 A;  4JF4 A;  2Y2P A;  4EWF A;  4LV1 A;  3MZD A;  1XX2 A;  2I72 A;  2ZQA A;  4BJP A;  4NK3 A;  4GKU A;  3V5M A;  1E3U A;  5CER A;  3HLE A;  5FDH A;  1DJC A;  2FFF B;  2PU2 A;  3BEB A;  3OC2 A;  3SS4 A;  4UAA A;  1BTL A;  1YLT A;  1GA0 A;  3OPH A;  2HPB A;  3AGE A;  5CHU A;  4LCL A;  5EUA A;  4R3J A;  3M2K A;  3OCN A;  2Y4A A;  4UA9 A;  3ZVT A;  4DE2 A;  1NXY A;  3PBQ A;  4KG6 A;  3ZG9 B;  1BZA A;  2XD5 A;  3ITB A;  5FQM A;  1CEG A;  1KVL A;  5CHJ A;  3BFF A;  1FQG A;  4E3J A;  2HDR A;  4LEN A;  1KE4 A;  3WS1 A;  2P74 A;  4OOY A;  4A5R A;  3E2K A;  1XKZ A;  3NY4 A;  4GDB A;  1ONH A;  3Q7Z A;  4HES A;  1BLC A;  3HLG A;  4OQH A;  1L0D A;  1RGZ A;  5G18 A;  1KGF A;  4JLF A;  2FFY A;  1RGY A;  4MBF A;  4KG5 A;  4E3I A;  2H0Y A;  3BM6 A;  3IH9 A;  5JYP A;  3GR2 A;  1YMS A;  1MWU A;  4OQI A;  4DXB A;  1GHM A;  1YLY A;  1W8Q A;  2DNS A;  4X53 A;  4ZJ3 A;  4QJG A;  2X71 A;  2ZM0 A;  3IXH A;  4OP5 A;  4P85 A;  1NYM A;  4X6T A;  3V3S A;  3NIA A;  1XXM A;  1MWT A;  1HD8 A;  1MWS A;  3BYD A;  3PBR A;  3VMA A;  1LLB A;  4ZBE A;  2XQZ A;  1IEL A;  4O7D A;  2JE5 A;  3O87 A;  1YQS A;  2WKH A;  3FWL A;  4EBP A;  3IF6 A;  4KQQ A;  2ZLY A;  2WZX A;  4MLL A;  4OOL A;  1ALQ A;  4X68 A;  4KZ6 A;  1YMX A;  3Q7V B;  4OPZ A;  5M19 A;  5CEB A;  2Y2G A;  3SH7 A;  4HBT A;  4MBK A;  1Q2P A;  4MEZ A;  1FCM A;  2ZC5 B;  4Y7P A;  2EX6 A;  1W5D A;  1K57 A;  1YLP A;  3G2Y A;  3IQA A;  3PBS A;  4WM9 A;  5CED A;  3VFH A;  2OSU A;  1ES2 A;  2PU4 A;  1WYB A;  4OKP A;  1XPB A;  5FQQ A;  4KZ3 A;  2ZQC A;  2EXB A;  4GOG A;  5FAQ A;  4CJN A;  5E2H A;  2WGW B;  1IYP A;  1PI4 A;  3BFD A;  2CC1 A;  2UWX A;  1KDS A;  2VGJ A;  3NCK A;  4KQR A;  3DWK A;  4B4X A;  5A90 A;  3O3V A;  3PBO A;  4KEN B;  4ZJ1 A;  2QPN A;  3JYI A;  5FQI A;  5DTT A;  1BLP A;  4MNR A;  1KE0 A;  1NRF A;  5EOO A;  5CGX A;  2Y91 A;  3FZC A;  4H8R A;  5FQK A;  1KVM A;  2Y2M A;  4WMC A;  3UDF A;  3WRZ A;  3A3D A;  1I2S A;  5L2F A;  3BRM A;  1VQQ A;  1CI8 A;  1LI9 A;  1KGG A;  2Y2L A;  2WGI A;  2V1Z A;  4C6Y A;  5EVI B;  3N8R A;  4XUZ A;  3QNB A;  1DJB A;  2RL3 A;  3IH8 A;  1FSY A;  4F94 A;  2XEP A;  5FAT A;  3OCL A;  2Q9N A;  4R4R A;  3A3E A;  4MBH A;  5EVI C;  3VP3 A;  3VP0 A;  3BFC A;  3OPL A;  4IVI A;  4Y0O A;  5E2G A;  4OOM A;  4DKI A;  2OLU A;  1DJA A;  3NBL A;  3DTM A;  3BLS A;  5HW3 A;  1SDN A;  1FCO A;  4U0X A;  4OH0 A;  3C7U A;  4GNU A;  3UPO A;  1S0W A;  1FR6 A;  5FAO A;  3SH8 A;  3N6I A;  5DTS A;  4E3N A;  5FI2 A;  1TEM A;  5A91 A;  5AQA A;  2QZ6 A;  1EWZ A;  4PM5 A;  1BLH A;  2DCF A;  3C4O A;  3V3R A;  4JPM A;  2WAE A;  4UHU A;  5FAP A;  1IEM A;  1S6R A;  2XD1 A;  1K54 A;  2A3U A;  3Q82 A;  4PM7 A;  4S2N A;  5HFO A;  3ZCZ A;  5HAQ A;  5HAP A;  4IVK A;  4C3Q A;  2HDS A;  2WKI A;  4ZTK A;  5TR7 A;  2ZC6 B;  4R3B A;  3UO9 A;  5AQB A;  3HBR A;  3HRE A;  1NY0 A;  3WS5 A;  4GB7 A;  4FSF A;  3LO7 A;  2ZM2 A;  1N4O A;  4WZ5 A;  1L0G A;  4N9L A;  3UPP A;  3PAG A;  4RVA A;  4EBN A;  4HEF A;  2IWC A;  3IWO A;  4C75 A;  4E3O A;  3EQV A;  2C6W B;  4S2P A;  2EXA A;  3HLW A;  3S1Y A;  1E4D A;  3VFF A;  2XK1 A;  4QY5 A;  5FAS A;  1CEF A;  4JXG A;  5J8X A;  3ZGA B;  3G2Z A;  4DDY A;  2ZC7 A;  5KZH A;  4Y0U A;  4PM9 A;  1K4E A;  5BOH A;  3MKF A;  5CGW A;  3IWI A;  1K56 D;  3G30 A;  3BFE A;  5EOE A;  4XXR A;  3SOI A;  2JBF A;  4KZA A;  5EPH A;  3G34 A;  4KZ4 A;  3AGD A;  4OLD A;  5EEC A;  4N1X A;  1IYS A;  1K38 A;  4QY6 A;  3ZG8 B;  1QME A;  1QMF A;  2ZM8 A;  2BG1 A;  4GD6 A;  3LY4 A;  3TG9 A;  3VOZ A;  5M1A A;  3W4P A;  4B4Z A;  1PYY A;  2H5S A;  4OON A;  3WRT A;  5D3O A;  3CJM A;  1AXB A;  3N8S A;  4IED A;  3MZE A;  4U0T A;  5CRF A;  3IF6 C;  3NDE A;  2Y2J A;  3W4O A;  1ZC2 A;  3GSG A;  2XR0 A;  2IWD A;  3SS5 A;  4Z9Q A;  3PBT A;  3VP2 A;  3ZG7 B;  1HZO A;  1ES3 A;  2ZQ8 A;  5CHM A;  1FCN A;  5GLB A;  1TVF A;  3ISG A;  1M40 A;  3FKW A;  4N92 A;  4EV4 A;  2XLN A;  1LL9 A;  2Y2O A;  1K57 C;  4P0M A;  2H0T A;  1XGJ A;  2XF3 A;  1MPL A;  1HTZ A;  1JWP A;  5DTK A;  1WYC A;  1H8Z A;  3IF5 A;  4R23 A;  2IWB A;  3SS3 A;  5GHZ A;  1YLZ A;  3QNC A;  3VP1 A;  4ID4 A;  1NYY A;  1ERO A;  4IBR A;  3N4I A;  3HUN A;  1H5X A;  2ZC3 B;  3VSK A;  3MXR A;  1Y54 A;  4DRT A;  1E25 A;  3UY6 A;  4WEL A;  4LCM A;  5HX9 A;  2HP6 A;  2OLV A;  2WYX A;  1PZP A;  5DVA A;  3VOY A;  5CEC A;  4BD1 A;  4B88 A;  2C5W B;  4EUZ A;  4JXV A;  1L0F A;  4RA7 A;  3E2L A;  3MZF A;  1MXO A;  3HLD A;  2WAF A;  3A3F A;  1JTD A;  4JF6 A;  4R4S A;  2Q9M A;  1H8Y A;  5I94 A;  2H10 A;  4BLM A;  2Y2N A;  2V2F F;  4KZ7 A;  2G2U A;  3IXD A;  5A93 A;  3UPN A;  3GV9 A;  5TFQ A;  4QU3 A;  1W79 A;  3GRJ A;  2R9W A;  3HL9 A;  3FKV A;  1K4F A;  1BUL A;  1JWV A;  1YM1 A;  3W8K A;  5CGS A; 
#chains in the Genus database with same CATH topology
 3T50 A;  4EQI A;  3Q7V A;  3NOP C;  1VHM A;  3P01 A;  3EGD C;  3Q81 A;  3UNW A;  1CI9 A;  3BFG A;  3IWQ A;  4B93 A;  3C7V A;  2Y2K A;  3GTC A;  2EX9 A;  3UB8 A;  1C3B A;  4Z1W A;  1ONG A;  3DW0 A;  1FIL A;  3NC8 A;  4PAU A;  1ES5 A;  2L4R A;  2VX8 A;  2J7V A;  5U47 A;  3ITA A;  3OPP A;  3B47 A;  1LI0 A;  2VA0 A;  1OJG A;  1F2K A;  4B9O A;  3UE3 A;  4DJ3 A;  2HJ9 C;  3GMW A;  4G3K A;  3NI9 A;  4UA6 A;  3S22 A;  3MJQ A;  1VEU A;  5L07 A;  5AQ7 A;  2JKT M;  4S2I A;  2EFU A;  2ZQ9 A;  3BWL A;  3IF6 B;  2W1R A;  4LV0 A;  2BLS A;  4HJ6 A;  1TS6 A;  2V8C A;  2ZMA A;  1HVB A;  1SHV A;  4XUX A;  1XJ3 A;  3HLB A;  1CK3 A;  4Y0T A;  1Y4O A;  3RJU A;  1WE4 A;  3LR4 A;  2Z2L B;  2V20 A;  1GA9 A;  1ES4 A;  1TDL A;  4O0P A;  5L09 A;  3S7P A;  1ZKJ A;  2HDU A;  2B5R A;  1GCE A;  1DY6 A;  4GZB A;  5JYO A;  1PZO A;  2PD8 A;  4E6W A;  2OOL A;  1YT4 A;  4DN0 A;  5FQJ A;  2VJW A;  2ZMV A;  3WS0 A;  4F3L A;  3RFB A;  3SH9 A;  5DKK A;  2R78 A;  5EM0 A;  1ERM A;  2WZZ A;  5EE8 A;  2GJ3 A;  3FV7 A;  3EGX C;  1G28 A;  2HDQ A;  5CTN A;  1I2W A;  4GJ4 A;  2OAQ 1;  5CXW A;  5F5Y A;  2J3T C;  4OPR A;  3G4P A;  5E43 A;  4X1L A;  2WK0 A;  3UDX A;  2V0U A;  2Y2H A;  2JC7 A;  4LFU A;  1L2S A;  1PI5 A;  5M18 A;  4RX2 A;  4WYY A;  4P6Z S;  3DBA A;  4GD8 A;  2FZ0 A;  4QHC A;  4G3W A;  4S2J A;  3ICY A;  2WAD A;  4Q0I A;  1LL8 A;  1PW8 A;  3EQU A;  1YKD A;  5A92 A;  3VE4 A;  4S2M A;  1TDG A;  4DMZ A;  1OT6 A;  3T1R A;  2FH5 A;  2EX8 A;  3CG5 A;  1NLY A;  4OQ0 A;  2W3D A;  1MKI A;  4S2O A;  4N1H A;  2W3F A;  4ZJ2 A;  4ZRR A;  1I5Q A;  1PNE A;  2Y2P A;  3IX4 A;  2I72 A;  4Y5F A;  4H6J A;  5CER A;  3HLE A;  3PHY A;  1DJC A;  2PU2 A;  3BEB A;  5FDH A;  5FL3 A;  1GA0 A;  2DMW A;  3OPH A;  2HPB A;  3UB6 A;  4R3J A;  1BZA A;  2PD7 A;  2JHE A;  3ITB A;  3BFF A;  2E8J A;  1KE4 A;  1UWN X;  3WS1 A;  4A5R A;  4GDB A;  2YKH A;  1ONH A;  5CX7 A;  1OTI A;  5G18 A;  4F3L B;  4O01 A;  1XFN A;  3IS2 B;  4NKP A;  3D9Y A;  3GR2 A;  3LR3 A;  4DXB A;  4QJG A;  4MDZ A;  2ZM0 A;  4P85 A;  1NYM A;  3EEH A;  2WKQ A;  3BYD A;  3VMA A;  2EWW A;  1LLB A;  4ZBE A;  4O7D A;  2WZX A;  4MLL A;  4X68 A;  4KZ6 A;  3EOI A;  5K5B A;  2V9A A;  4MN5 A;  1K57 A;  3A0R A;  3PBS A;  3VFH A;  1Y28 A;  1ES2 A;  2PU4 A;  4OKP A;  4HI4 A;  2ZQC A;  1PI4 A;  2UWX A;  3R4K A;  4RQ9 A;  2QPN A;  3JYI A;  5DTT A;  1BLP A;  4D60 A;  2LB9 A;  2Y2M A;  4WMC A;  3WRZ A;  5L2F A;  1VQQ A;  3N8R A;  4XUZ A;  2RL3 A;  3C38 A;  1L3L A;  3OCL A;  3VP0 A;  4IVI A;  2W1T B;  2OLU A;  3DTM A;  5HW3 A;  3LIC A;  4GNU A;  1P9R A;  3R7W A;  5FI2 A;  2PYR A;  2O9C A;  4ETZ A;  2QZ6 A;  1BLH A;  5HPF A;  3C4O A;  5F68 A;  5FAP A;  3Q82 A;  2A3U A;  5HAP A;  5HFO A;  3OBF A;  2HDS A;  5TR7 A;  2ZC6 B;  4GHI A;  3ULF A;  5AQB A;  2A24 B;  2H28 A;  3HBR A;  3HRE A;  4GB7 A;  3LO7 A;  2M7V A;  4RVA A;  4FUW A;  5J4E A;  3VFF A;  5FAS A;  2XRO A;  5J8X A;  1G5U A;  3G2Z A;  4WL9 A;  1JNU A;  3ZGA B;  3QP1 A;  1K4E A;  3MKF A;  4HJ4 A;  2ZL1 B;  4XXR A;  4KZA A;  3MQQ A;  4ESP A;  1H0M A;  4N1X A;  2XA7 S;  3VOZ A;  1DP6 A;  4B4Z A;  4OON A;  3WRT A;  5D3O A;  3BQA A;  4HQA A;  2BTF P;  4GLQ A;  1F98 A;  3UE6 A;  1ZC2 A;  2XR0 A;  4HP9 A;  1LSW A;  1ZHH B;  3VP2 A;  5CHM A;  3ISG A;  5G4Z A;  1TS7 A;  1M40 A;  3FKW A;  4N92 A;  2Y2O A;  4P0M A;  1K57 C;  2H0T A;  1MPL A;  1HTZ A;  1WYC A;  1H8Z A;  2A2L A;  5GHZ A;  2QYB A;  3QNC A;  4ID4 A;  1NYY A;  1ERO A;  2W3H A;  4IBR A;  2NUP C;  2ZC3 B;  3C30 A;  2VEA A;  1T18 A;  1E25 A;  3UY6 A;  4PKY A;  2UV0 E;  4WEL A;  3VOY A;  4NG2 A;  5DVA A;  4BD1 A;  4CLC B;  4YNR A;  3CUE A;  4RA7 A;  3E2L A;  2WAF A;  1OTD A;  2H10 A;  4NXF A;  3R7W B;  3H7W B;  2G2U A;  2J80 A;  4ETX A;  2R9W A;  2AVX A;  1YM1 A;  3T4O A;  3IXB A;  4GHI B;  1FR1 A;  2ZJ9 A;  3LIA A;  1BLS A;  3PTE A;  1EW0 A;  5EVI D;  4GDN A;  3ZFZ A;  2X01 A;  5KMW A;  4X56 A;  4KG2 A;  3WS2 A;  3BJN A;  1RCJ A;  3DWZ A;  4I38 A;  2RCX A;  3CLO A;  2Y2Q A;  1E3U D;  3ZQ5 A;  3RXW A;  1VM1 A;  1U60 A;  3CAX A;  2J9O A;  1LSV A;  3ZDJ A;  4E3L A;  2P9V A;  4E3K A;  4JF5 A;  1F9I A;  3F1N A;  1IOU A;  3CPT A;  4I3A A;  4S2L A;  1W7F A;  4RX3 A;  1PW1 A;  2Z6D A;  2HP9 A;  3A0S A;  4NET A;  4MCW A;  3HJK A;  4HH2 A;  3K3C A;  2V0W A;  5FI7 A;  4GN2 A;  3E4O A;  5GLD A;  3UN7 A;  3CIT A;  3F1P B;  3CMZ A;  3S7N A;  1N9B A;  3CZD A;  2WKE A;  4DE1 A;  4G3V A;  3N8L A;  5TGF A;  3DAV A;  1K56 A;  1G6A A;  4OLG A;  4RYE A;  3P09 A;  1NWZ A;  2QJ7 A;  3BLM A;  2XDM A;  3OZH A;  3WS4 A;  3EWK A;  2IA2 A;  4R3A A;  3CUE C;  1MY8 A;  4WBG A;  4LPZ A;  1UGU A;  4JXS A;  3P98 A;  5HWV A;  5DF8 A;  2JN7 A;  1ESI A;  4DDS A;  4X55 A;  4DF6 A;  2M1C A;  2BAS A;  1W8Y A;  4YOF A;  4WEJ A;  3DTK A;  5MC7 A;  1XA7 A;  2ZBB A;  5GL9 A;  4JXW A;  3VV4 A;  1HLU P;  4BL3 A;  1SKF A;  2Q0O A;  5DJU A;  3FYZ A;  4YIN A;  4LV2 A;  1MBL A;  4K0W A;  4OQG A;  1OME A;  2XH9 A;  1H3Q A;  1XP4 A;  1YSQ A;  1JTG A;  2P9V B;  1JVJ A;  1J9M A;  4HJ3 A;  2X02 A;  3RTY A;  3OPR A;  5FI6 A;  4E3M A;  2J8Y A;  3F1N B;  3T1Q B;  1PWG A;  4QB8 A;  1NRJ A;  2W0N A;  4OPQ A;  5EV0 A;  1NJ4 A;  3QP8 A;  1KDW A;  4ARZ A;  3T12 B;  3G35 A;  3IXG A;  5GHX A;  5TJJ A;  2XRN A;  2JKT I;  4GCZ A;  3LEQ A;  5HAR A;  3K2N A;  4EWF A;  3MZD A;  2OAP 1;  5G4Y A;  3OC2 A;  4UAA A;  5CHU A;  2ZOH A;  4LCL A;  3IBR A;  3M2K A;  2O99 A;  1NXY A;  3PBQ A;  4KG6 A;  5HPI A;  3ZG9 B;  1OTE A;  4FOF A;  4NXG A;  4OOY A;  3E2K A;  3NY4 A;  3Q7Z A;  3T4S A;  1KGF A;  4Y15 A;  3BM6 A;  3IH9 A;  1G6O A;  4EUV A;  4ZJ3 A;  1YLY A;  4Y3I A;  1S1Y A;  4UQI M;  3LI8 A;  3T4J A;  4X6T A;  3NIA A;  4HY8 A;  1XXM A;  1MWT A;  1MWS A;  3PBR A;  2XQZ A;  1XJ6 A;  3O87 A;  4EBP A;  4KQQ A;  2ZLY A;  4OOL A;  1V9Z A;  3Q7V B;  4OPZ A;  2Y2G A;  2L1M A;  4HBT A;  2P08 A;  3U2A A;  2EX6 A;  3G2Y A;  5CED A;  2P7J A;  4KQD A;  2NUT C;  2VGL S;  1XPB A;  5FQQ A;  2EXB A;  4GOG A;  5E2H A;  3T1S A;  4HOI A;  3UB9 A;  1VET A;  3NCK A;  3O3V A;  4ZJ1 A;  5FQI A;  3KYE A;  4H8R A;  5HZH A;  3BW6 A;  3A3D A;  1YPR A;  1I2S A;  3BRM A;  1CI8 A;  4ARZ B;  4C6Y A;  3IH8 A;  5IS1 A;  3A3E A;  3VP3 A;  3OPL A;  4OOM A;  4I3J A;  5HDS A;  1FCO A;  2G7U A;  1VEU B;  3UPO A;  3NUL A;  5FAO A;  3T1X A;  3N6I A;  3TRC A;  5AQA A;  4PM5 A;  2K31 A;  2WAE A;  1S6R A;  1K54 A;  4PM7 A;  4S2N A;  4C3Q A;  4CLC E;  1CF0 A;  2VLG A;  4GS9 A;  4WZ5 A;  4N9L A;  3KSG A;  4HEF A;  4C75 A;  4E3O A;  4IHQ A;  4S2P A;  1CEF A;  2O9A A;  2V1B A;  5HDD A;  3MSH A;  5BOH A;  1N9O A;  3GDI A;  4NXE A;  3SW1 A;  4BMW A;  2INW A;  3KO6 A;  3QP6 A;  2JKF A;  4CQH A;  3AGD A;  3LR5 A;  1IYS A;  1K38 A;  1TF1 A;  1QMF A;  3LY4 A;  5M1A A;  2H5S A;  3BQ8 A;  3PXP A;  1AXB A;  3N8S A;  3NEC A;  1T1B A;  5CRF A;  2Y2J A;  3GSG A;  3SS5 A;  4Z9Q A;  3E98 A;  2ZQ8 A;  1TVF A;  3P7N A;  1OJ5 A;  2V1A A;  3EEA A;  2XF3 A;  2VV7 A;  4EES A;  4R23 A;  2VKS A;  1YLZ A;  3MMH A;  2EA9 A;  5AJG A;  4HIA A;  3BY8 A;  1P97 A;  5HX9 A;  5CEC A;  1PZP A;  4B88 A;  3FPV A;  4JXV A;  1XFQ A;  4LLO B;  3MZF A;  3HLD A;  2I9V A;  1D06 A;  2B95 A;  3A3F A;  5HD5 A;  4R4S A;  2Q9M A;  4BLM A;  2QJ5 A;  2XSS A;  1V9Y A;  4KZ7 A;  4L9E A;  4CLC D;  1IFQ A;  3FKV A;  3IBJ A;  3CI6 A;  1K54 C;  3OLO A;  4S2N C;  1Z09 A;  1D7E A;  4E04 A;  3LIF A;  4BL2 A;  4H6J B;  4EXO A;  1YLW A;  3GQZ A;  4LV3 A;  3FC7 A;  2ZQD A;  4WUJ A;  5GLC A;  3D72 A;  2J3W A;  2JCH A;  5IT5 A;  2R9X A;  4K0X A;  2PRF A;  5GLA A;  3V39 A;  5HAI A;  3UB7 A;  1SCW A;  3VOL A;  3MFD A;  2GX5 A;  3MXS A;  1KE3 A;  3A0V A;  2WKP A;  4KQO A;  2PBY A;  1M6K A;  4PM6 A;  1XJ4 A;  3CWF A;  3MQ0 A;  3RXX A;  2KX6 A;  4R70 A;  1F5M A;  1YLJ A;  4DE0 A;  1GHP A;  1K55 A;  5AQ9 A;  3UME A;  3LFV A;  3PBN A;  3S4X A;  1K25 A;  2ZOI A;  3LEZ A;  3DTE A;  5HL1 A;  1ODV A;  4JGO A;  1GHI A;  5F83 A;  3AGF A;  5CTM A;  2G2W A;  4EBL A;  3FPW A;  3HUM A;  2EFX A;  3GVB A;  3N7W A;  4BEN A;  2KLI A;  4BWI A;  1ZTU A;  1BYW A;  1DP8 A;  4DXC A;  1O7E A;  4E6X A;  3L9K A;  3S7Q A;  5EVL A;  2XFS A;  2ACG A;  1CJF A;  4S2K A;  1S1Z A;  1LSX A;  1LL5 A;  2ZQ7 A;  3TSG A;  2JKR M;  1AWI A;  4WLA A;  3MQO A;  1ERQ A;  3UDI A;  5DJT A;  3IHA A;  4EEP A;  4U3T A;  4BD0 A;  4I3I A;  3KX0 X;  4K08 A;  5DF9 A;  4HH3 A;  2XFT A;  1GSX A;  4XT2 A;  4P87 A;  4OVD A;  3VP4 A;  1FIK A;  1XJ2 A;  1EI5 A;  1Z6F A;  1PWC A;  3NDG A;  4R0Q A;  5F1F A;  4FD8 A;  2ZD8 A;  3BEC A;  2EWV A;  3LI9 A;  2K7S A;  1ESU A;  4WEK A;  3NOU C;  3D3O A;  5DF7 A;  1P9W A;  5FDS A;  3IT9 A;  1NZU A;  1L0E A;  1BT5 A;  3C5A A;  5KSC A;  1IYO A;  4R1G A;  1LHY A;  1RP5 A;  3VSL A;  4FH2 A;  5L8M A;  5EVI A;  1JWZ A;  4KZ9 A;  5HD3 A;  1K55 C;  1FOF A;  1IYQ A;  4Q8I A;  3MKE A;  2Y59 A;  3KSI A;  3M6H A;  2PR6 A;  4P6B A;  4R6L A;  5FQ9 A;  5F82 A;  4X69 A;  4JF4 A;  4LV1 A;  5AVE A;  1YSP A;  4BJP A;  4NK3 A;  4GKU A;  1E3U A;  4LRZ E;  2FFF B;  1YLT A;  3LGO A;  3F1O A;  3TE8 A;  5EUA A;  2Y4A A;  4UA9 A;  3B33 A;  4DE2 A;  1DP9 A;  1KVL A;  5CHJ A;  2Z6C A;  4HNB A;  4HHD A;  4HES A;  1BLC A;  1OT9 A;  3HLG A;  4L9G A;  4LRY C;  2FFY A;  1RGY A;  4MBF A;  4KG5 A;  4E3I A;  2H0Y A;  3FG8 A;  5JYP A;  1MWU A;  3IX3 A;  2DNS A;  3T4Q A;  3IXH A;  3NHQ A;  3QP2 A;  5HWW A;  2JE5 A;  3FWL A;  3C2W A;  3IF6 A;  1ALQ A;  2P04 A;  1YMX A;  5M19 A;  5CEB A;  4BBT A;  4MEZ A;  2ZC5 B;  4Y7P A;  3IQA A;  4WM9 A;  2OSU A;  1WYB A;  2PBD P;  4KZ3 A;  5FAQ A;  4CJN A;  3BFD A;  2CC1 A;  1KDS A;  4KQR A;  3DWK A;  4B4X A;  5A90 A;  5AVF A;  4EEU A;  2J3T D;  5EOO A;  5CGX A;  2Y91 A;  3FZC A;  1GSV A;  3HJI A;  1KVM A;  3UDF A;  2M7U A;  1T19 A;  4I39 A;  1KGG A;  2Y2L A;  2WGI A;  5EVI B;  2W3G A;  3PYP A;  1DJB A;  4F94 A;  2XEP A;  4R4R A;  4MBH A;  5EVI C;  4Y0O A;  1S66 L;  2PAV P;  2YKF A;  5E2G A;  3SZT A;  3CPT B;  3BLS A;  4O8G A;  3CHW P;  1YAX A;  1SDN A;  4U0X A;  4OH0 A;  3C7U A;  5LBR A;  1S0W A;  1FR6 A;  3JPU A;  5DTS A;  5TBM A;  1TEM A;  5A91 A;  1EWZ A;  5HL6 A;  2HV1 A;  5J3W A;  1DRM A;  5KIZ A;  3V3R A;  4JPM A;  1IEM A;  3F1O B;  4IVK A;  4ZTK A;  3UO9 A;  4QPR A;  3WS5 A;  5HWT A;  2ZM2 A;  3PAG A;  2JKG A;  3EQV A;  1D1J A;  2KOI A;  3U4L P;  2EXA A;  4JXG A;  3TJZ C;  2ZC7 A;  4II7 A;  4DJ2 A;  5CGW A;  3G30 A;  3BFE A;  5EOE A;  4EQ1 A;  4KZ4 A;  3B42 A;  4OLD A;  5EEC A;  3T4L A;  5FEF A;  1NLZ A;  1TD5 A;  3ZG8 B;  4IUH A;  4GD6 A;  3TG9 A;  3T4K A;  3W4P A;  3CJM A;  4IED A;  4U0T A;  3IF6 C;  3W4O A;  2KDK A;  2IWD A;  4MN7 A;  1HZO A;  2HGV A;  3E4Q A;  4EV4 A;  2XLN A;  1LL9 A;  3H9W A;  2HJE A;  1ACF A;  2PYP A;  3IF5 A;  3VP1 A;  2Y8H A;  2PHY A;  4X25 A;  3HUN A;  1H5X A;  3VSK A;  2CMN A;  3BY9 A;  4DRT A;  4LCM A;  2HP6 A;  2WYX A;  5DKL A;  4I5S A;  2C5W B;  1S4R A;  1MXO A;  3HCY A;  3IS2 A;  1JTD A;  4JF6 A;  1H8Y A;  3TW8 A;  2Y2N A;  5TBM B;  5A93 A;  3MXQ A;  5TFQ A;  2PR5 A;  1W79 A;  3GRJ A;  1K4F A;  2XA7 M;  1TS8 A;  5C5K A;  3PAE A;  5F1G A;  3ZG0 A;  2ZC4 B;  4KZ5 A;  1Q2Q A;  4JKT A;  4EET B;  2GNX A;  3W4Q A;  4OP8 A;  1A0K A;  4R38 A;  2B18 A;  3L7H A;  3PR6 A;  3MBZ A;  3WWX A;  3LID A;  4Y13 A;  1WA9 A;  4N9K A;  1PWD A;  2LB5 A;  4JBF A;  4CPK A;  5FA7 A;  3LIB A;  1PRQ A;  5GHY A;  3G31 A;  3HLF A;  2QMI A;  4NEE D;  3UB5 P;  3I7J A;  2W1T A;  4UA7 A;  2O0Y A;  3W2Z A;  2PT7 A;  4PMA A;  2VGK A;  1KOU A;  1XA1 A;  2WUQ A;  1UWP X;  1IKI A;  4IUK A;  4YFM A;  5F69 A;  4OPY A;  3D4F A;  2VZW A;  1STZ A;  2D01 A;  3M2J A;  4ZDX A;  3IX8 A;  4KZB A;  4L9F A;  2DRW A;  4DE3 A;  2B02 A;  3HLC A;  4KZ8 A;  2A24 A;  1K6R A;  3QHY A;  2HP5 A;  3HUO A;  4Y17 A;  4YWZ A;  2K2N A;  3A3J A;  5FSR A;  3M6B A;  4PPR A;  3QP5 A;  2E8I A;  2OV5 A;  1OTA A;  1VET B;  3Q1F A;  1BUE A;  4M3K A;  4FH4 A;  3RH8 B;  4IBX A;  3MR0 A;  3B3X A;  2ZL1 A;  3UE1 A;  3LCE A;  3V50 A;  2W3E A;  4PKY G;  1XGI A;  2WKR A;  1VB6 A;  2Z2M B;  5KSH A;  3NOT C;  1KGE A;  4WMC D;  3GEC A;  5DFY A;  1NZO A;  5EM1 A;  4WZ4 A;  3O88 A;  3C8C A;  1TS0 A;  2EX2 A;  1ZG4 A;  4Q0H A;  4IJG A;  4ME4 A;  1S67 L;  2Y55 A;  4PM8 A;  2GDN A;  5J7E A;  4M4X A;  4HBU A;  4BQM A;  5E2F A;  1FSW A;  3QP4 A;  2XGN A;  4L0L A;  1K0K A;  5EVE A;  1O07 A;  2VV8 A;  1IKG A;  3ZG5 A;  3A3I A;  3H82 A;  4GS9 B;  3ZVW A;  3O86 A;  4KUK A;  3UE0 A;  3LY3 A;  1W63 M;  3ZNT A;  3O5Y A;  3TOI A;  2WGW A;  4WZ5 C;  2Y2I A;  3UMD A;  4CLC A;  4QD4 A;  3ZNY A;  4FCF A;  5E2E A;  5I5L A;  2J9P A;  4UQI S;  1K6S A;  3H7W A;  3VE3 A;  3C4P A;  1G68 A;  3G6O A;  1PIO A;  4LRX C;  1MWR A;  1SDE A;  4K91 A;  3ZHH A;  1BSG A;  3Q07 A;  2A49 A;  2WGV A;  4D2O A;  1GSW A;  1ZG6 A;  3HVF A;  4ZAM A;  5IHV A;  3IHB A;  3G32 A;  3ZYT A;  1XX2 A;  2ZQA A;  3V5M A;  1S4S A;  3MF0 A;  3SS4 A;  1BTL A;  3AGE A;  5FEG A;  3OCN A;  3ZVT A;  3KYQ A;  4LGW A;  3S7O A;  2XD5 A;  5FQM A;  1CEG A;  4EU0 A;  4E3J A;  1FQG A;  2HDR A;  3KSF A;  4LEN A;  2P74 A;  1XKZ A;  3LIE A;  4BBU A;  4OQH A;  1L0D A;  1RGZ A;  1MC0 A;  4JLF A;  4KUO A;  3LR0 A;  2QKP A;  2W27 A;  2JKR I;  1YMS A;  4OQI A;  1GHM A;  4X53 A;  1W8Q A;  1J3W A;  4JGP A;  2X71 A;  4OP5 A;  3V3S A;  1HD8 A;  1IEL A;  2O9B A;  4Y2F A;  1YQS A;  2WKH A;  2L0W A;  3F1P A;  1MKM A;  4MMN A;  3SH7 A;  4MBK A;  1Q2P A;  1FCM A;  3H82 B;  1W5D A;  1YLP A;  4WF0 A;  4FTX A;  2WGW B;  2D02 A;  4MN6 A;  1IYP A;  2VGJ A;  2QHK A;  4GW9 A;  3PBO A;  4KEN B;  2MJ6 A;  4MNR A;  1KE0 A;  3K3D A;  4AFI A;  1NRF A;  4CLC C;  5DFX A;  5FQK A;  3V67 A;  1LI9 A;  1N9N A;  2V1Z A;  2Y79 A;  3QNB A;  1FSY A;  5FAT A;  1PFL A;  2Q9N A;  3BFC A;  4DKI A;  1DJA A;  4Q0J A;  3NBL A;  3E4P A;  1P0Z A;  3DTI A;  3SH8 A;  4E3N A;  2ZMF A;  1SKO A;  2DCF A;  5HSQ A;  4UHU A;  3ZCZ A;  5HAQ A;  2XD1 A;  4PHT A;  2VK3 A;  1OTB A;  2WKI A;  4R3B A;  5A8B A;  3LYX A;  1SZV A;  1T1C A;  4X1M A;  3OOV A;  1NY0 A;  4FSF A;  1N4O A;  1L0G A;  3UPP A;  4EBN A;  2IWC A;  3IWO A;  2C6W B;  2VGL M;  3KYZ A;  3HLW A;  3S1Y A;  1E4D A;  4JGQ A;  1MZU A;  2XK1 A;  4QY5 A;  5HDC A;  4DDY A;  5KZH A;  3E0Y A;  1N9L A;  3JVV A;  4Y0U A;  4PM9 A;  3IWI A;  1K56 D;  3SOI A;  2JBF A;  2OWJ A;  2PDR A;  1T1A A;  5EPH A;  3G34 A;  4BBV A;  4EER A;  2HZ5 A;  4QY6 A;  4P6Z M;  1QME A;  2ZM8 A;  2BG1 A;  1PYY A;  2V8F A;  3LUQ A;  3MZE A;  5F6A A;  3NDE A;  3T4T A;  3MS6 A;  5L10 A;  1X0O A;  3PBT A;  3ZG7 B;  3KSH A;  1ES3 A;  1FCN A;  5GLB A;  5IU1 A;  1OPX A;  2HF6 A;  4EW7 A;  4QWO A;  1XGJ A;  5DTK A;  1JWP A;  4NXB A;  4XT2 B;  5EFW A;  1H8M A;  2IWB A;  1W63 Q;  3SS3 A;  1LT0 A;  3N4I A;  2GZA A;  2QWS A;  4UEY A;  3MXR A;  1Y54 A;  4HP4 A;  3JVU A;  2OLV A;  4EUZ A;  2OWH A;  1L0F A;  1CQA A;  4WN5 A;  2VV6 A;  3NJA A;  5I94 A;  3MFX A;  4JGR A;  2V2F F;  3IXD A;  3UPN A;  1SKO B;  3GV9 A;  4QU3 A;  3HL9 A;  1BUL A;  1JWV A;  3W8K A;  5CGS A; 
#chains in the Genus database with same CATH homology
 3IXB A;  3PAE A;  1FR1 A;  2ZJ9 A;  4EQI A;  1K54 C;  3Q7V A;  4S2N C;  1BLS A;  3PTE A;  5EVI D;  4GDN A;  3Q81 A;  3UNW A;  1CI9 A;  4BL2 A;  3BFG A;  3IWQ A;  5F1G A;  3ZG0 A;  2ZC4 B;  3ZFZ A;  3C7V A;  2Y2K A;  2X01 A;  5KMW A;  3GTC A;  4X56 A;  4KZ5 A;  1YLW A;  1Q2Q A;  3GQZ A;  2EX9 A;  4KG2 A;  3WS2 A;  4LV3 A;  4JKT A;  2ZQD A;  1C3B A;  3W4Q A;  1RCJ A;  1ONG A;  4OP8 A;  3DWZ A;  5GLC A;  3DW0 A;  4Y0T A;  2JCH A;  2R9X A;  4K0X A;  2RCX A;  3MBZ A;  2Y2Q A;  5GLA A;  3V39 A;  3NC8 A;  3WWX A;  1E3U D;  5HAI A;  1SCW A;  3RXW A;  3MFD A;  1VM1 A;  1ES5 A;  1U60 A;  3MXS A;  1PWD A;  2J7V A;  4N9K A;  1KE3 A;  2J9O A;  5U47 A;  3ITA A;  4JBF A;  4CPK A;  5FA7 A;  4KQO A;  3OPP A;  3ZDJ A;  4E3L A;  1LI0 A;  5GHY A;  2PBY A;  2P9V A;  1M6K A;  4PM6 A;  3G31 A;  3HLF A;  4E3K A;  3UE3 A;  2QMI A;  4JF5 A;  3I7J A;  3GMW A;  3RXX A;  4UA7 A;  3NI9 A;  4S2L A;  1W7F A;  4UA6 A;  3S22 A;  4PMA A;  4RX3 A;  1PW1 A;  1YLJ A;  4DE0 A;  1GHP A;  1K55 A;  2VGK A;  2HP9 A;  1XA1 A;  2WUQ A;  4NET A;  5AQ9 A;  1IKI A;  3PBN A;  4YFM A;  3S4X A;  5FI7 A;  4OPY A;  1K25 A;  4GN2 A;  5AQ7 A;  3D4F A;  5GLD A;  3UN7 A;  4S2I A;  2EFU A;  2ZQ9 A;  3LEZ A;  3IF6 B;  3M2J A;  3CMZ A;  4LV0 A;  4ZDX A;  4KZB A;  2BLS A;  5HL1 A;  1N9B A;  3CZD A;  2WKE A;  4DE1 A;  2DRW A;  4DE3 A;  3N8L A;  1GHI A;  3HLC A;  4KZ8 A;  1K6R A;  5F83 A;  3QHY A;  2HP5 A;  3HUO A;  2ZMA A;  1HVB A;  5TGF A;  1SHV A;  4XUX A;  3AGF A;  3HLB A;  5CTM A;  1CK3 A;  1G6A A;  1K56 A;  2G2W A;  3P09 A;  4OLG A;  4RYE A;  3RJU A;  4EBL A;  1WE4 A;  3A3J A;  3HUM A;  3M6B A;  5FSR A;  4PPR A;  2EFX A;  2Z2L B;  2V20 A;  3GVB A;  1GA9 A;  1ES4 A;  2E8I A;  3BLM A;  2XDM A;  3N7W A;  4BEN A;  1TDL A;  3OZH A;  3WS4 A;  1ZKJ A;  2OV5 A;  2HDU A;  3Q1F A;  2B5R A;  1BUE A;  1GCE A;  4M3K A;  4FH4 A;  4IBX A;  3B3X A;  1DY6 A;  3UE1 A;  4GZB A;  3LCE A;  5JYO A;  1PZO A;  4DXC A;  1MY8 A;  3V50 A;  1O7E A;  4E6W A;  4WBG A;  4E6X A;  5EVL A;  2XFS A;  1XGI A;  4S2K A;  2Z2M B;  1YT4 A;  4JXS A;  5KSH A;  3P98 A;  5DF8 A;  1KGE A;  2ZQ7 A;  1LL5 A;  5FQJ A;  4WMC D;  1ESI A;  3TSG A;  4DDS A;  3WS0 A;  4X55 A;  4DF6 A;  1ERQ A;  1NZO A;  4WZ4 A;  3O88 A;  3UDI A;  3SH9 A;  1W8Y A;  2EX2 A;  4WEJ A;  1ZG4 A;  1XA7 A;  1ERM A;  2WZZ A;  2Y55 A;  5EE8 A;  4PM8 A;  5GL9 A;  3FV7 A;  4JXW A;  2GDN A;  3IHA A;  4U3T A;  2HDQ A;  5CTN A;  1I2W A;  4BD0 A;  4BL3 A;  1SKF A;  4HBU A;  5CXW A;  3FYZ A;  5DF9 A;  4OPR A;  3G4P A;  2XFT A;  4BQM A;  4YIN A;  5E2F A;  1FSW A;  5E43 A;  4P87 A;  4L0L A;  2XGN A;  4OVD A;  2WK0 A;  4LV2 A;  1MBL A;  3UDX A;  1O07 A;  4K0W A;  3VP4 A;  4OQG A;  1OME A;  2Y2H A;  1EI5 A;  1Z6F A;  1PWC A;  2XH9 A;  1IKG A;  2JC7 A;  3NDG A;  1L2S A;  3A3I A;  4R0Q A;  3ZG5 A;  5F1F A;  4FD8 A;  1PI5 A;  2ZD8 A;  3BEC A;  1XP4 A;  5M18 A;  1JTG A;  4RX2 A;  3O86 A;  3ZVW A;  4WYY A;  3UE0 A;  3LY3 A;  1ESU A;  4GD8 A;  4WEK A;  4QHC A;  2P9V B;  3ZNT A;  1JVJ A;  1J9M A;  3TOI A;  4S2J A;  2WGW A;  2X02 A;  4WZ5 C;  2Y2I A;  2WAD A;  3OPR A;  5DF7 A;  5FI6 A;  4E3M A;  4QD4 A;  2J8Y A;  3IT9 A;  1PW8 A;  3ZNY A;  1NZU A;  1PWG A;  1L0E A;  1BT5 A;  4QB8 A;  3C5A A;  4FCF A;  5E2E A;  5KSC A;  1IYO A;  4OPQ A;  4R1G A;  3EQU A;  2J9P A;  1NJ4 A;  1LHY A;  1RP5 A;  5A92 A;  3VSL A;  1KDW A;  1K6S A;  4FH2 A;  4S2M A;  1TDG A;  3C4P A;  5EVI A;  1G68 A;  1PIO A;  1JWZ A;  4KZ9 A;  3G35 A;  1K55 C;  3IXG A;  5GHX A;  1MWR A;  1SDE A;  2EX8 A;  1FOF A;  3CG5 A;  4K91 A;  4OQ0 A;  1MKI A;  3ZHH A;  4S2O A;  1IYQ A;  1BSG A;  4Q8I A;  3MKE A;  2Y59 A;  3Q07 A;  4N1H A;  2A49 A;  2WGV A;  4D2O A;  3M6H A;  4P6B A;  4ZJ2 A;  1ZG6 A;  5HAR A;  5FQ9 A;  3HVF A;  4ZAM A;  5IHV A;  3IHB A;  3G32 A;  4X69 A;  1I5Q A;  5F82 A;  4JF4 A;  2Y2P A;  4EWF A;  4LV1 A;  3MZD A;  1XX2 A;  2I72 A;  2ZQA A;  4BJP A;  4NK3 A;  4GKU A;  3V5M A;  1E3U A;  5CER A;  3HLE A;  5FDH A;  1DJC A;  2FFF B;  2PU2 A;  3BEB A;  3OC2 A;  3SS4 A;  4UAA A;  1BTL A;  1YLT A;  1GA0 A;  3OPH A;  2HPB A;  3AGE A;  5CHU A;  4LCL A;  5EUA A;  4R3J A;  3M2K A;  3OCN A;  2Y4A A;  4UA9 A;  3ZVT A;  4DE2 A;  1NXY A;  3PBQ A;  4KG6 A;  3ZG9 B;  1BZA A;  2XD5 A;  3ITB A;  5FQM A;  1CEG A;  1KVL A;  5CHJ A;  3BFF A;  1FQG A;  4E3J A;  2HDR A;  4LEN A;  1KE4 A;  3WS1 A;  2P74 A;  4OOY A;  4A5R A;  3E2K A;  1XKZ A;  3NY4 A;  4GDB A;  1ONH A;  3Q7Z A;  4HES A;  1BLC A;  3HLG A;  4OQH A;  1L0D A;  1RGZ A;  5G18 A;  1KGF A;  4JLF A;  2FFY A;  1RGY A;  4MBF A;  4KG5 A;  4E3I A;  2H0Y A;  3BM6 A;  3IH9 A;  5JYP A;  3GR2 A;  1YMS A;  1MWU A;  4OQI A;  4DXB A;  1GHM A;  1YLY A;  1W8Q A;  2DNS A;  4X53 A;  4ZJ3 A;  4QJG A;  2X71 A;  2ZM0 A;  3IXH A;  4OP5 A;  4P85 A;  1NYM A;  4X6T A;  3V3S A;  3NIA A;  1XXM A;  1MWT A;  1HD8 A;  1MWS A;  3BYD A;  3PBR A;  3VMA A;  1LLB A;  4ZBE A;  2XQZ A;  1IEL A;  4O7D A;  2JE5 A;  3O87 A;  1YQS A;  2WKH A;  3FWL A;  4EBP A;  3IF6 A;  4KQQ A;  2ZLY A;  2WZX A;  4MLL A;  4OOL A;  1ALQ A;  4X68 A;  4KZ6 A;  1YMX A;  3Q7V B;  4OPZ A;  5M19 A;  5CEB A;  2Y2G A;  3SH7 A;  4HBT A;  4MBK A;  1Q2P A;  4MEZ A;  1FCM A;  2ZC5 B;  4Y7P A;  2EX6 A;  1W5D A;  1K57 A;  1YLP A;  3G2Y A;  3IQA A;  3PBS A;  4WM9 A;  5CED A;  3VFH A;  2OSU A;  1ES2 A;  2PU4 A;  1WYB A;  4OKP A;  1XPB A;  5FQQ A;  4KZ3 A;  2ZQC A;  2EXB A;  4GOG A;  5FAQ A;  4CJN A;  5E2H A;  2WGW B;  1IYP A;  1PI4 A;  3BFD A;  2CC1 A;  2UWX A;  1KDS A;  2VGJ A;  3NCK A;  4KQR A;  3DWK A;  4B4X A;  5A90 A;  3O3V A;  3PBO A;  4KEN B;  4ZJ1 A;  2QPN A;  3JYI A;  5FQI A;  5DTT A;  1BLP A;  4MNR A;  1KE0 A;  1NRF A;  5EOO A;  5CGX A;  2Y91 A;  3FZC A;  4H8R A;  5FQK A;  1KVM A;  2Y2M A;  4WMC A;  3UDF A;  3WRZ A;  3A3D A;  1I2S A;  5L2F A;  3BRM A;  1VQQ A;  1CI8 A;  1LI9 A;  1KGG A;  2Y2L A;  2WGI A;  2V1Z A;  4C6Y A;  5EVI B;  3N8R A;  4XUZ A;  3QNB A;  1DJB A;  2RL3 A;  3IH8 A;  1FSY A;  4F94 A;  2XEP A;  5FAT A;  3OCL A;  2Q9N A;  4R4R A;  3A3E A;  4MBH A;  5EVI C;  3VP3 A;  3VP0 A;  3BFC A;  3OPL A;  4IVI A;  4Y0O A;  5E2G A;  4OOM A;  4DKI A;  2OLU A;  1DJA A;  3NBL A;  3DTM A;  3BLS A;  5HW3 A;  1SDN A;  1FCO A;  4U0X A;  4OH0 A;  3C7U A;  4GNU A;  3UPO A;  1S0W A;  1FR6 A;  5FAO A;  3SH8 A;  3N6I A;  5DTS A;  4E3N A;  5FI2 A;  1TEM A;  5A91 A;  5AQA A;  2QZ6 A;  1EWZ A;  4PM5 A;  1BLH A;  2DCF A;  3C4O A;  3V3R A;  4JPM A;  2WAE A;  4UHU A;  5FAP A;  1IEM A;  1S6R A;  2XD1 A;  1K54 A;  2A3U A;  3Q82 A;  4PM7 A;  4S2N A;  5HFO A;  3ZCZ A;  5HAQ A;  5HAP A;  4IVK A;  4C3Q A;  2HDS A;  2WKI A;  4ZTK A;  5TR7 A;  2ZC6 B;  4R3B A;  3UO9 A;  5AQB A;  3HBR A;  3HRE A;  1NY0 A;  3WS5 A;  4GB7 A;  4FSF A;  3LO7 A;  2ZM2 A;  1N4O A;  4WZ5 A;  1L0G A;  4N9L A;  3UPP A;  3PAG A;  4RVA A;  4EBN A;  4HEF A;  2IWC A;  3IWO A;  4C75 A;  4E3O A;  3EQV A;  2C6W B;  4S2P A;  2EXA A;  3HLW A;  3S1Y A;  1E4D A;  3VFF A;  2XK1 A;  4QY5 A;  5FAS A;  1CEF A;  4JXG A;  5J8X A;  3ZGA B;  3G2Z A;  4DDY A;  2ZC7 A;  5KZH A;  4Y0U A;  4PM9 A;  1K4E A;  5BOH A;  3MKF A;  5CGW A;  3IWI A;  1K56 D;  3G30 A;  3BFE A;  5EOE A;  4XXR A;  3SOI A;  2JBF A;  4KZA A;  5EPH A;  3G34 A;  4KZ4 A;  3AGD A;  4OLD A;  5EEC A;  4N1X A;  1IYS A;  1K38 A;  4QY6 A;  3ZG8 B;  1QME A;  1QMF A;  2ZM8 A;  2BG1 A;  4GD6 A;  3LY4 A;  3TG9 A;  3VOZ A;  5M1A A;  3W4P A;  4B4Z A;  1PYY A;  2H5S A;  4OON A;  3WRT A;  5D3O A;  3CJM A;  1AXB A;  3N8S A;  4IED A;  3MZE A;  4U0T A;  5CRF A;  3IF6 C;  3NDE A;  2Y2J A;  3W4O A;  1ZC2 A;  3GSG A;  2XR0 A;  2IWD A;  3SS5 A;  4Z9Q A;  3PBT A;  3VP2 A;  3ZG7 B;  1HZO A;  1ES3 A;  2ZQ8 A;  5CHM A;  1FCN A;  5GLB A;  1TVF A;  3ISG A;  1M40 A;  3FKW A;  4N92 A;  4EV4 A;  2XLN A;  1LL9 A;  2Y2O A;  1K57 C;  4P0M A;  2H0T A;  1XGJ A;  2XF3 A;  1MPL A;  1HTZ A;  1JWP A;  5DTK A;  1WYC A;  1H8Z A;  3IF5 A;  4R23 A;  2IWB A;  3SS3 A;  5GHZ A;  1YLZ A;  3QNC A;  3VP1 A;  4ID4 A;  1NYY A;  1ERO A;  4IBR A;  3N4I A;  3HUN A;  1H5X A;  2ZC3 B;  3VSK A;  3MXR A;  1Y54 A;  4DRT A;  1E25 A;  3UY6 A;  4WEL A;  4LCM A;  5HX9 A;  2HP6 A;  2OLV A;  2WYX A;  1PZP A;  5DVA A;  3VOY A;  5CEC A;  4BD1 A;  4B88 A;  2C5W B;  4EUZ A;  4JXV A;  1L0F A;  4RA7 A;  3E2L A;  3MZF A;  1MXO A;  3HLD A;  2WAF A;  3A3F A;  1JTD A;  4JF6 A;  4R4S A;  2Q9M A;  1H8Y A;  5I94 A;  2H10 A;  4BLM A;  2Y2N A;  2V2F F;  4KZ7 A;  2G2U A;  3IXD A;  5A93 A;  3UPN A;  3GV9 A;  5TFQ A;  4QU3 A;  1W79 A;  3GRJ A;  2R9W A;  3HL9 A;  3FKV A;  1K4F A;  1BUL A;  1JWV A;  1YM1 A;  3W8K A;  5CGS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...