1NWZA

Pyp ultra-high resolution structure of a bacterial photoreceptor
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
publication title Anticipatory active-site motions and chromophore distortions prime photoreceptor PYP for light activation
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Signaling protein
total genus 37
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2003-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1nwzA00
5EFWA 4BBVA 2D01A 1OJGA 1S1YA 3IS2B 4KUOA 2QHKA 5HWWA 1OJ5A 4I3IA 1OT9A 3H7WB 3K3DA 4L9FA 2ZOHA 5HSQA 2Z6DA 4EESA 5J3WA 3GDIA 4L9GA 4KUKA 1OTBA 3HJIA 3NOPC 4HNBA 3C2WA 1XJ6A 2ZBBA 3MQQA 1TS7A 3BY8A 3RTYA 3F1OB 1WA9A 2QKPA 4EQ1A 2OWHA 3LI9A 4HH3A 4DJ3A 3LYXA 3F1NB 2VV6A 4I39A 2A24B 2L0WA 3LIEA 4HP9A 1MZUA 4WUJA 5HDDA 5I5LA 3ICYA 1XFNA 3B33A 4BBUA 3G6OA 1XJ4A 4EEPA 1OTAA 1T19A 4GCZA 2I9VA 4LLOB 2H28A 2Z6CA 4MN6A 3MR0A 3LIAA 2M1CA 2PDRA 4GW9A 4GHIA 3F1PB 4HJ4A 4F3LB 2JHEA 1X0OA 3E4QA 1DP6A 1LSXA 1OTEA 4E04A 4H6JB 2PYPA 1GSVA 1UWPX 2J80A 3H9WA 4L9EA 1Y28A 4YWZA 2KX6A 4JGPA 1DP9A 4XT2A 4NXBA 1G28A 3H82A 3K3CA 2V0UA 2P7JA 4JGOA 3NOUC 3SW1A 2V1AA 3IBRA 2PD7A 3CAXA 5AVEA 4KQDA 1S4SA 5HWTA 4K08A 3HJKA 1P0ZA 1TS8A 2OWJA 2W0NA 4WN5A 5F5YA 4GS9B 1KOUA 3CLOA 5HDSA 1DP8A 4RQ9A 4I5SA 2WKRA 4PKYA 4NXGA 1N9LA 5F6AA 2L1MA 5F69A 4WLAA 3LIDA 3PYPA 1JNUA 2VLGA 4EEUA 4LRXC 5HZHA 4DJ2A 3VE3A 3IS2A 5TBMA 3H7WA 3LIFA 2WKQA 1UWNX 4WF0A 5IU1A 4HH2A 3UMDA 1GSXA 2BASA 3UB8A 1N9NA 1V9YA 3LI8A 3E4PA 3EWKA 3F1OA 4HJ3A 2INWA 3LIBA 1UGUA 4LPZA 2GJ3A 4JGQA 3F1NA 1OTDA 4HQAA 4EW7A 2ZOIA 1V9ZA 3MFXA 1LT0A 1XJ2A 3FC7A 1TS6A 1XJ3A 3P7NA 4MN5A 2V9AA 4HP4A 3UMEA 2PYRA 2YKFA 3MXQA 2QJ5A 3RH8B 2CMNA 1EW0A 3UB7A 1S4RA 2V1BA 3ULFA 3BWLA 1F9IA 1NWZA 1S66L 2VV7A 1XFQA 2KDKA 4HHDA 1T1BA 5DJTA 3BY9A 1T1CA 5HDCA 3NHQA 4I3JA 4LRYC 3NJAA 2L4RA 4HOIA 2QWSA 3E4OA 4HY8A 4H6JA 3EEHA 3A0RA 4B9OA 4R70A 5DJUA 5G4ZA 1ODVA 3FG8A 4R6LA 5TBMB 5DKKA 2PD8A 2PHYA 1DRMA 4NXEA 2VEAA 1N9OA 3VOLA 4I38A 4BBTA 1D06A 4JGRA 1OTIA 3KX0X 2QJ7A 4HI4A 3A0SA 4GHIB 4WL9A 1LSVA 2OOLA 3T50A 1GSWA 3LICA 3OLOA 1S1ZA 1F98A 1TS0A 1T18A 2YKHA 1T1AA 3UE6A 3VE4A 4GS9A 1LL8A 2R78A 3C8CA 5F68A 4XT2B 5DKLA 4M4XA 3H82B 2EA9A 5KIZA 5HD5A 2JN7A 4LRZE 2PR5A 3UB6A 3LUQA 2V0WA 3PHYA 2A24A 5AVFA 2B02A 4R38A 1P97A 4EXOA 3NOTC 3ZQ5A 1BYWA 3GECA 4EETB 5G4YA 4EERA 4I3AA 2WKPA 1D7EA 3CWFA 2PR6A 1OT6A 5IS1A 3MQOA 4PKYG 1VB6A 2K7SA 4NXFA 4HJ6A 4HIAA 4R3AA 5J4EA 2VV8A 3UB9A 2HV1A 3F1PA 5HD3A 3A0VA 4F3LA 3MJQA 1LSWA 5J7EA 2D02A 5A8BA 5HWVA 3D72A 2W27A 1S67L
chains in the Genus database with same CATH superfamily
2Y91A 2B18A 3KYQA 3GTCA 2D01A 1PWGA 2WZZA 1OJ5A 4EV4A 3O5YA 3FWLA 4MN7A 3UY6A 2LB5A 1L0GA 1I5QA 3PBOA 1BZAA 4EESA 1RCJA 3NDEA 1MPLA 3NOPC 3W8KA 1XA1A 1DJBA 3C2WA 1NLZA 3F1OB 4KQOA 2XDMA 4U3TA 3BEBA 2XF3A 2VV6A 3P09A 2L0WA 4GDBA 4LV2A 4HP9A 4L0LA 3B3XA 4UEYA 2LB9A 4WUJA 4YOFA 3WS4A 5HDDA 3ICYA 4PMAA 3B33A 3PBNA 1XJ4A 3GRJA 4EEPA 1OTAA 1O07A 4K0XA 2WAEA 5EVEA 5IHVA 4A5RA 2H28A 4DXBA 3DTMA 3T4OA 3N8LA 3NCKA 2Z6CA 4WELA 1CK3A 1K57A 4WZ4A 4OP5A 1CF0A 1NRJA 4GW9A 4GHIA 3GR2A 5GL9A 1W63Q 1NZUA 3R4KA 3VP4A 3WS0A 4X56A 1D1JA 2QZ6A 3NDGA 3UE0A 4E04A 5FQMA 2WAFA 3CJMA 3OBFA 3UB5P 1UWPX 4L9EA 1JWPA 1DP9A 4XT2A 1LLBA 1G28A 4E3KA 2Y2PA 3K3CA 4Y3IA 2P7JA 3A3FA 4H8RA 2HP5A 5U47A 4XXRA 3HVFA 2WGWB 3DW0A 4LENA 2QMIA 5HAQA 5HPFA 5FSRA 3DWKA 4KZ5A 5L2FA 3UN7A 2PD7A 2H5SA 2W3EA 1LL5A 2ZL1A 4P85A 2PU2A 1M40A 4S2KA 5AVEA 4E3NA 3ZDJA 4K08A 4LV1A 1L3LA 3SH9A 1TS8A 4X69A 2PU4A 1PZOA 4O8GA 2W0NA 4E6XA 5FQIA 1FR6A 3VMAA 1DP8A 1K54C 3IHAA 5CGXA 4RQ9A 3TSGA 3FZCA 4I5SA 2WKRA 5F6AA 4PHTA 1SZVA 5F69A 4EBNA 2WADA 4BWIA 1H5XA 3LIDA 3PBQA 3PYPA 1JNUA 3MS6A 4O0PA 3ZVTA 4Y13A 3SS5A 4BD0A 4E3IA 4EEUA 4LRXC 4Q0HA 4R0QA 1RGZA 5EOOA 1ZTUA 5JYOA 4KZ7A 3MMHA 4PM6A 4OQ0A 3OPHA 1JWVA 2EXBA 1KGEA 1STZA 1SKFA 1UWNX 1MBLA 5GHZA 4WF0A 3QP2A 2BLSA 5CX7A 5GLCA 3G2YA 4ME4A 2EFXA 2O9AA 3JVVA 3O3VA 4ZJ2A 1N9NA 4B4ZA 5HX9A 3ZNYA 3U4LP 3F1OA 3ZG9B 1PNEA 3V5MA 3BLSA 1TEMA 3M2KA 1VEUB 2Y2HA 3MFXA 4BQMA 2O0YA 3C38A 3QP4A 1XJ3A 3HLEA 3P7NA 1YLTA 3W4OA 4C6YA 2EWVA 1HLUP 4Y7PA 1PI5A 3MXQA 3ZCZA 5A91A 2QJ5A 4ARZB 1BUEA 4II7A 2W3FA 3Q7VA 3LCEA 1HZOA 1S6RA 5M18A 3I7JA 1OMEA 4HHDA 3TRCA 1T1BA 4CPKA 5HDCA 3IX3A 3NHQA 5EVIB 5IT5A 3HUOA 4P0MA 2WYXA 4S2MA 4BD1A 3HLGA 3BFDA 1J9MA 4X68A 4FOFA 1E4DA 2XD5A 4KQQA 1WE4A 4YNRA 5CGSA 4B9OA 3MF0A 4R70A 4MMNA 3RXXA 1AXBA 4QY6A 4OVDA 2KOIA 5KSHA 1YLWA 1YLYA 1DRMA 3EEAA 4JXVA 2WGWA 2ZC3B 3AGFA 1NYYA 5AJGA 4AFIA 4BBTA 3G30A 2XFTA 2ZM2A 1YLZA 4UA7A 2JCHA 3CG5A 4OPYA 2PBDP 3V50A 5L8MA 3OPPA 2Q9NA 1BSGA 3UPOA 1ES4A 1K55A 1S1ZA 1GHIA 4WMCD 1F98A 1T18A 2Y79A 3UE6A 3S7OA 1ESIA 3M6BA 3IF6A 1LL8A 3PAGA 4BJPA 5DTKA 3SS3A 1LI0A 1PRQA 2EA9A 3OPRA 4DE2A 2W1TB 5HD5A 3HLBA 4O7DA 3UB6A 4OOYA 3C7VA 1DJCA 5FL3A 3M6HA 4GOGA 3V39A 2A24A 5AVFA 3UNWA 4R38A 2JBFA 2E8IA 5EPHA 3SZTA 5G4YA 3KSIA 4QPRA 4GJ4A 5A93A 3GMWA 3CWFA 3IF6C 4WZ5C 3E98A 1IFQA 4PKYG 5FQQA 4C75A 5DF9A 4R3AA 2HV1A 1K6SA 1P9RA 2K31A 4PM9A 1ESUA 2PRFA 3WS1A 4X1MA 3HBRA 1K0KA 5J7EA 4UAAA 5KMWA 5A8BA 3JYIA 5FQJA 3S7QA 4KG6A 4KZ9A 3N7WA 1VEUA 3L9KA 1XPBA 2WKEA 4RA7A 2WGIA 1OJGA 1YAXA 5CHMA 4G3KA 2QHKA 2XEPA 3AGDA 4I3IA 3LO7A 2RL3A 3SS4A 4WEJA 2V2FF 4LV3A 3K3DA 4GLQA 2Y2OA 4OQIA 4L9FA 2Y59A 1IELA 5TJJA 4M3KA 2ZOHA 3MXSA 4ARZA 3CPTB 1P9WA 4DMZA 3DTEA 2P74A 3T12B 4L9GA 4KUKA 1OTBA 3SOIA 1RP5A 2XROA 2XR0A 4HNBA 1CQAA 4R3JA 2C5WB 1XJ6A 2ZBBA 1YSQA 1ZG6A 3BY8A 2Z2LB 2W3HA 3MZDA 3KYZA 4EQ1A 1KE4A 3LYXA 3BRMA 1E25A 2XGNA 3LIEA 4S2JA 1F2KA 3S1YA 3BQ8A 3IBJA 1XFNA 4BBUA 3G6OA 4ZJ1A 1BULA 3HLDA 2ZMFA 4GCZA 3LEZA 1JWZA 3LIAA 5C5KA 3Q82A 3KSHA 3LEQA 4S2IA 3T4KA 4OP8A 4IVIA 4LGWA 3E0YA 4F3LB 1X0OA 3BFEA 4IEDA 1ZC2A 1K6RA 4OH0A 5EOEA 2NUPC 4KZ4A 3FPWA 1OTEA 4H6JB 1JVJA 1GSVA 4KZ6A 2KX6A 1NLYA 1VETB 3C5AA 1LI9A 1BLSA 3S4XA 3PXPA 1H8MA 2HP9A 1NY0A 3NOUC 5FAPA 1BLHA 5FAQA 2V1AA 4JXGA 4OOMA 3NULA 2M7UA 3CAXA 4CLCC 4DE0A 1MY8A 3T4LA 1YQSA 3O88A 1GA9A 5CECA 4P87A 4B88A 1P0ZA 1MKMA 1ES3A 2WZXA 3AGEA 4WN5A 1EROA 4Z1WA 4GS9B 5EM1A 4IBXA 4UA9A 3CLOA 5HDSA 4PAUA 3TE8A 4PKYA 3B47A 4NXGA 2XQZA 1N9LA 1NRFA 3FKVA 4WLAA 1W8QA 3VP0A 4JKTA 3FYZA 4Y0TA 2VGJA 4K91A 4KZAA 3GV9A 3SH7A 3VE3A 4RX3A 3W4PA 2EFUA 1N9BA 5TBMA 1PW8A 1H0MA 3CZDA 4LCMA 2RCXA 5FDHA 3E2LA 1K38A 1NXYA 4PM5A 2ZMAA 1PI4A 3HLWA 3PTEA 3NIAA 1PW1A 5IU1A 2WGVA 3UMDA 2BASA 3UB8A 1MKIA 1V9YA 1CI9A 5F83A 2INWA 1UGUA 4KG5A 2VGKA 4IJGA 2ZOIA 1V9ZA 2PT7A 1AWIA 2QYBA 3GVBA 3C30A 4P6ZM 3ZNTA 5CTNA 3JVUA 2G2UA 4X1LA 4BENA 3EQUA 2EXAA 3D3OA 3IWOA 2J3WA 1BLPA 2V9AA 1JTGA 3PBSA 2Y2KA 1MWRA 3G35A 3RH8B 4MBKA 1EW0A 1PZPA 3UB7A 4KZ3A 1XXMA 1K57C 3BWLA 2O9BA 1YKDA 5TFQA 2Y2GA 2BTFP 3EGDC 1S66L 1L0DA 2ZJ9A 4RYEA 1FR1A 2JE5A 2AVXA 2XD1A 2HJ9C 3WRZA 2B5RA 4DF6A 4E6WA 3NJAA 2R9WA 3IWIA 4HOIA 4X25A 1MC0A 3ITBA 5EUAA 4H6JA 1QMEA 3T1RA 3ZYTA 1G6OA 1ZHHB 2HJEA 1VETA 3FG8A 3D9YA 3T1QB 3MXRA 4X53A 1MWUA 1N4OA 4HBUA 2PD8A 4CQHA 3QP5A 2DRWA 4OLDA 2VEAA 1K4FA 1N9OA 4N92A 1ES5A 3VOLA 4S2LA 4R4SA 2G7UA 2EX2A 2QJ7A 2O99A 3A0SA 3VSKA 1FIKA 4EQIA 4N9KA 4UQIM 1Z09A 1ZG4A 1U60A 5L07A 5FQ9A 2P08A 3G31A 3HUMA 1CJFA 1TS0A 3MQ0A 1XX2A 2C6WB 2DNSA 2Y4AA 3IX4A 4P6ZS 4GS9A 3C8CA 1IKIA 4ZRRA 5F68A 2JKFA 1G6AA 4GB7A 4M4XA 3H82B 5CEBA 1K56D 5KSCA 3LFVA 2V0WA 3LGOA 3A3DA 5FA7A 1IKGA 3LR5A 3PHYA 2XRNA 2HP6A 5CHUA 1F5MA 4EU0A 5GLBA 2X71A 4G3VA 2ZQ7A 2B02A 1M6KA 1DY6A 2XH9A 3PBRA 1P97A 5MC7A 2V20A 3ZG8B 3TG9A 3ZQ5A 3EOIA 2ZQ9A 3O87A 4ESPA 1SKOB 2Y55A 4NG2A 3UO9A 2MJ6A 1LL9A 2JKGA 4GZBA 3OZHA 4KZBA 3VSLA 1KVLA 3MSHA 4E3OA 4DRTA 1ES2A 4D2OA 5DFXA 4S2PA 2ZD8A 3GQZA 4N1HA 1L0EA 4U0TA 4NEED 3MJQA 5CRFA 4S2NA 3LR4A 4MEZA 2W27A 1KGGA 1S67L 4DE3A 5EFWA 5LBRA 4BBVA 1ONHA 4CJNA 3ZG7B 1GHMA 4KUOA 5HWWA 4UQIS 3JPUA 2JKTM 4JF6A 4U0XA 5CXWA 1JTDA 3H7WB 2A49A 5L10A 1RGYA 4BLMA 2KLIA 4GD6A 5DTSA 2X01A 2P9VB 2PBYA 5EM0A 5HSQA 4N1XA 3C4OA 5J3WA 2ZM0A 3GDIA 4Q0IA 3FKWA 3CI6A 3DTKA 2WKIA 3HL9A 3UDFA 4P6BA 3MQQA 4ETXA 4OPQA 3RTYA 2Q0OA 3KSFA 5FASA 1WA9A 4QU3A 2DCFA 2OWHA 1K4EA 4DJ3A 3BYDA 3F1NB 1TDGA 4I39A 3LY4A 4RVAA 2IA2A 2ACGA 4IVKA 3BLMA 4DDSA 4KG2A 5HPIA 1GA0A 3MKFA 2EX9A 1T19A 4CLCE 2I9VA 4LLOB 3T1XA 3ZVWA 4DDYA 3UPNA 3N8RA 3OOVA 4FUWA 1E3UA 3HREA 1CI8A 5AQAA 3LR0A 2PDRA 3E2KA 3F1PB 4CLCD 3IXGA 4NETA 2JHEA 4X6TA 4K0WA 3PAEA 4R23A 1K55C 1Y4OA 4OOLA 2Y2NA 5CGWA 4MBFA 4ID4A 3TW8A 1KE0A 2J80A 1J3WA 3NC8A 2Y2JA 3NECA 4JGPA 2EX6A 1I2WA 3H82A 4DXCA 2V0UA 3N8SA 2HGVA 1FCOA 5FAOA 5F1FA 1KGFA 3ITAA 2XA7M 1KVMA 5K5BA 2H0TA 4KQDA 1S4SA 5E2EA 4EUZA 2Y2IA 2ZMVA 4EWFA 4DKIA 2OWJA 3TOIA 1VM1A 1SKOA 4S2OA 3CITA 5M1AA 5DTTA 1KOUA 4QD4A 3FPVA 3RJUA 4FTXA 2JKRM 3BW6A 4IUHA 1TVFA 1CEGA 2Y2QA 4GNUA 2GX5A 5EVIA 1Z6FA 2PAVP 4FSFA 4LCLA 2M7VA 1ALQA 4Y0UA 4OQGA 2VLGA 2WUQA 3CUEA 4ZDXA 3IXHA 4UHUA 3UDXA 2J3TC 5HZHA 1MWSA 1XP4A 4IUKA 3P98A 4RX2A 4DJ2A 2FFFB 2FH5A 4KQRA 4YINA 4PM7A 1FQGA 1L0FA 3V3RA 3H7WA 2DMWA 4WMCA 4F94A 2WKQA 1PYYA 2P9VA 1L2SA 1SDNA 4QB8A 3A3EA 1HTZA 3Q1FA 5FI2A 5A90A 3BFFA 4HH2A 4R1GA 1H3QA 3FV7A 5E43A 1SHVA 5CHJA 5EVIC 4O01A 2VA0A 4Y17A 2JKTI 4JBFA 4JGQA 3F1NA 1OTDA 5HFOA 1VHMA 1LT0A 2XA7S 4IHQA 3FC7A 1OPXA 1YMXA 3IF5A 4MN5A 3VV4A 2W1TA 2IWDA 2WKHA 2Z2MB 4HP4A 5DFYA 2PYRA 3T4TA 2YKFA 3CHWP 3P01A 2UV0E 2CMNA 3IXDA 1S4RA 2V1BA 4FH4A 1NWZA 3TJZC 4B93A 1WYBA 3T4JA 2VV7A 3KO6A 1XFQA 3DAVA 3QP8A 3HUNA 5DJTA 4OKPA 3BY9A 1T1CA 5M19A 1W8YA 4I3JA 4LRYC 4BL3A 5HW3A 4JF5A 3C4PA 4WEKA 3BQAA 4QHCA 3E4OA 4HY8A 4KZ8A 3EEHA 4WM9A 3A3IA 5GLAA 4R6LA 3K2NA 3DWZA 4NXEA 1C3BA 4PM8A 5F1GA 4I38A 3ZGAB 4LV0A 3G34A 1D06A 4JGRA 2W3GA 3Q7ZA 4HI4A 4R3BA 5EE8A 2CC1A 1IYOA 2OOLA 3LICA 3OLOA 5L09A 1FCMA 3CMZA 4BMWA 2XSSA 2YKHA 2X02A 1A0KA 2VGLM 2XK1A 1T1AA 3CPTA 1FSYA 3PR6A 5CERA 3UE3A 5BOHA 4IBRA 1ACFA 3O86A 1PFLA 4ZAMA 5DKLA 4QY5A 5KIZA 3EGXC 4G3WA 3D4FA 4LRZE 2PR5A 2W3DA 2G2WA 3LUQA 1SDEA 4WBGA 3Q7VB 3ISGA 3W2ZA 4BL2A 4NKPA 3OC2A 3G2ZA 3Q81A 4LFUA 4EXOA 2Q9MA 1BYWA 2JKRI 2ZC6B 5HAIA 4EETB 4EERA 4Q0JA 2J8YA 4I3AA 2HPBA 4X55A 1D7EA 3ZG0A 1OT6A 1ERQA 3W4QA 3VFHA 3L7HA 1EWZA 2ZC7A 1YSPA 1K54A 1O7EA 1KDSA 3QP1A 2VX8A 3UB9A 3A0VA 4F3LA 4Q8IA 1DJAA 1LSWA 2IWCA 4OPRA 5HWVA 4FD8A 3MFDA 4Y0OA 3D72A 1FCNA 1IEMA 3QP6A 3GSGA 1S0WA 3UE1A 1S1YA 1HVBA 1GCEA 3IS2B 5D3OA 4EUVA 4B4XA 2VJWA 5G18A 2J7VA 3S7NA 1OT9A 5HL6A 4E3JA 1YMSA 3G32A 1Y54A 4HESA 2VGLS 3T1SA 2V8CA 2P04A 2VKSA 4MNRA 2Z6DA 3IF6B 4NK3A 5FQKA 4N9LA 3HJIA 4MLLA 2HDRA 2OV5A 1FSWA 3IT9A 1TS7A 1EI5A 4DN0A 4Y15A 2QKPA 3G4PA 3LI9A 2XFSA 4HH3A 5CEDA 2FZ0A 4GDNA 2A24B 5FI6A 1TD5A 1BT5A 1MZUA 2HDQA 1FOFA 1FILA 3BM6A 1NYMA 4ZBEA 5I5LA 5HL1A 1MXOA 1WYCA 3DBAA 2W1RA 3A3JA 2A3UA 5E2HA 4MN6A 3MR0A 2V1ZA 2K2NA 3BECA 2M1CA 1E3UD 1XKZA 2UWXA 3WRTA 5DF7A 5KZHA 4HJ4A 2ZQCA 3E4QA 3ZFZA 1DP6A 4OQHA 3B42A 2HDUA 5GHYA 3S7PA 1LSXA 5HAPA 4R4RA 4MCWA 4GD8A 3BFCA 2PYPA 4E3MA 4C3QA 3H9WA 1Y28A 4YWZA 5HARA 3MZFA 1PWCA 4NXBA 4OONA 2HF6A 3HLCA 1W5DA 4JGOA 4ZTKA 4EBPA 5CTMA 5AQ7A 1H8ZA 2B95A 3V3SA 1PWDA 3WWXA 5FEFA 3SW1A 1W79A 4Y2FA 3IBRA 1XGJA 2V8FA 2OLVA 5E2FA 1KE3A 2ZQ8A 2J3TD 2Y2MA 5F82A 3EQVA 5HWTA 2ZLYA 3HJKA 3R7WB 3WS2A 3VFFA 5GLDA 3BJNA 2ZQDA 2NUTC 4HEFA 2VK3A 2O9CA 5F5YA 4EBLA 1K25A 4OPZA 2Y8HA 1TF1A 2XLNA 1I2SA 3HLFA 2GZAA 2L1MA 4S2NC 5EVID 2FFYA 4JF4A 3MBZA 1YPRA 2QPNA 1Q2QA 3OPLA 2J9PA 3IH9A 4CLCB 3UPPA 3IS2A 3KSGA 3Q07A 1BTLA 2GNXA 1YM1A 3QNCA 3LIFA 3MKEA 1XA7A 1HD8A 4GN2A 4JXSA 4WZ5A 2ZM8A 3KYEA 2I72A 1BLCA 4MBHA 1K56A 4JPMA 1GSXA 3IXBA 3DTIA 2WK0A 3LI8A 3E4PA 3EWKA 3N6IA 3VP3A 4HJ3A 4OLGA 3LIBA 4QJGA 4LPZA 2GJ3A 5TGFA 1KDWA 4HQAA 4EW7A 1YLPA 4XUZA 1XJ2A 5EECA 5FATA 4FCFA 5J8XA 4GKUA 1TS6A 3QNBA 5FEGA 3IWQA 4ETZA 3T4QA 2OLUA 3N4IA 3OCLA 3UMEA 3HCYA 2R9XA 1MWTA 4JLFA 1SCWA 5DVAA 5AQ9A 5JYPA 3ULFA 3LY3A 3ZHHA 5EV0A 1F9IA 3RFBA 4KENB 1NJ4A 2ZC4B 1TDLA 1IYSA 2KDKA 5GHXA 3MZEA 2HDSA 2H10A 1QMFA 1ERMA 2L4RA 4PPRA 2QWSA 3SH8A 5TR7A 3NY4A 3C7UA 3A0RA 5DJUA 5G4ZA 5I94A 1ODVA 1XGIA 5TBMB 3S22A 5DKKA 2OAP1 2PHYA 5AQBA 3VP1A 4ZJ3A 4MDZA 1OTIA 3KX0X 3RXWA 4JXWA 2EWWA 5FI7A 4GHIB 2EX8A 4WL9A 5FDSA 1LSVA 3WS5A 4WYYA 4E3LA 3T50A 2BG1A 1GSWA 5EVLA 3M2JA 3R7WA 3IX8A 4YFMA 2VZWA 3T4SA 3VE4A 3UDIA 1NZOA 3OCNA 3V67A 3IQAA 2R78A 1ZKJA 2HZ5A 3QHYA 4HBTA 4DE1A 4XT2B 1Q2PA 4Y5FA 2JN7A 3NBLA 1YLJA 3VOYA 1LHYA 3NI9A 3IHBA 2OAQ1 1G5UA 3CUEC 1PIOA 3ZG5A 1IYPA 2ZL1B 2A2LA 3IH8A 1W7FA 4CLCA 2Y2LA 1YT4A 5E2GA 1VQQA 2IWBA 3LR3A 1G68A 3VOZA 1ONGA 2OSUA 3VP2A 3BFGA 3NOTC 3GECA 1CEFA 4QWOA 1GHPA 1H8YA 2ZQAA 3U2AA 2WKPA 2PR6A 2J9OA 4D60A 5A92A 5IS1A 2JC7A 3MQOA 2H0YA 1VB6A 5DF8A 2K7SA 4FH2A 4NXFA 1IOUA 4HJ6A 4HIAA 4UA6A 5J4EA 2VV8A 1IYQA 2ZC5B 2GDNA 3F1PA 5HD3A 4Z9QA 3PBTA 2D02A 1W63M 2E8JA 4XUXA
chains in the Genus database with same CATH topology
5EFWA 5LBRA 4BBVA 2B18A 3KYQA 2D01A 1OJGA 1S1YA 1YAXA 4G3KA 3IS2B 4KUOA 4EUVA 2QHKA 5HWWA 1OJ5A 2VJWA 4UQIS 4I3IA 3O5YA 2JKTM 1OT9A 4WEJA 5HL6A 3S7NA 3H7WB 3K3DA 4GLQA 4MN7A 4L9FA 2LB5A 5TJJA 2KLIA 2VGLS 2P04A 2VKSA 2ZOHA 4ARZA 5HSQA 3PBOA 1P9WA 2Z6DA 4EESA 5J3WA 4DMZA 3GDIA 4L9GA 4KUKA 1OTBA 3HJIA 3NOPC 4Q0IA 2XROA 3CI6A 4HNBA 3C2WA 1XJ6A 2ZBBA 4ETXA 3MQQA 1NLZA 1YSQA 1TS7A 3BY8A 3RTYA 4DN0A 3KSFA 3F1OB 1WA9A 2W3HA 2QKPA 3KYZA 4KQOA 4EQ1A 2OWHA 3LI9A 4HH3A 4DJ3A 3LYXA 3F1NB 2FZ0A 2VV6A 4I39A 2A24B 2L0WA 1TD5A 3LIEA 4HP9A 4L0LA 1MZUA 4UEYA 2IA2A 3BQ8A 2LB9A 4WUJA 4YOFA 3IBJA 5HDDA 5I5LA 3ICYA 1XFNA 3B33A 5HPIA 4BBUA 3G6OA 3PBNA 1XJ4A 4EEPA 1OTAA 1T19A 3DBAA 4CLCE 2W1RA 2ZMFA 2I9VA 4GCZA 4LLOB 2H28A 3T4OA 2Z6CA 4WELA 4MN6A 3MR0A 3OOVA 3LIAA 5C5KA 2K2NA 2M1CA 3KSHA 3LR0A 2PDRA 3T4KA 1NRJA 4GW9A 4GHIA 3F1PB 4CLCD 3E0YA 4HJ4A 4F3LB 2JHEA 1X0OA 3E4QA 1W63Q 1DP6A 3R4KA 2NUPC 3B42A 3FPWA 3S7PA 1LSXA 4OOLA 1OTEA 4E04A 4MCWA 4H6JB 3TW8A 2PYPA 3OBFA 1GSVA 1UWPX 2J80A 3H9WA 4L9EA 1Y28A 4YWZA 2KX6A 4JGPA 1NLYA 1DP9A 4XT2A 4NXBA 1G28A 3H82A 3K3CA 2HF6A 2V0UA 2P7JA 4Y3IA 3PXPA 4JGOA 1H8MA 3NOUC 2HGVA 3SW1A 2V1AA 4Y2FA 3IBRA 5HPFA 4OOMA 2M7UA 2PD7A 2W3EA 3CAXA 2XA7M 4CLCC 2J3TD 5AVEA 3T4LA 5K5BA 4KQDA 1S4SA 3EQVA 5HWTA 4K08A 3HJKA 2ZMVA 3R7WB 1P0ZA 1TS8A 1MKMA 3BJNA 2OWJA 4O8GA 2NUTC 2W0NA 4WN5A 5F5YA 2O9CA 3CITA 4Z1WA 4GS9B 1KOUA 2Y8HA 3CLOA 5HDSA 3FPVA 1DP8A 2JKRM 3BW6A 4IUHA 4RQ9A 4I5SA 1TF1A 2WKRA 4PAUA 3TE8A 4PKYA 3B47A 4NXGA 1N9LA 5F6AA 2GX5A 2GZAA 4PHTA 2L1MA 5F69A 4BWIA 4FSFA 4WLAA 3LIDA 3PBQA 3PYPA 1JNUA 2M7VA 2VLGA 3CUEA 4O0PA 4EEUA 2J3TC 4LRXC 5HZHA 4Q0HA 4IUKA 4CLCB 4DJ2A 3VE3A 2FH5A 3IS2A 3KSGA 1ZTUA 5TBMA 3MMHA 3H7WA 2DMWA 2GNXA 3LIFA 1STZA 2WKQA 1UWNX 4WF0A 5CX7A 5IU1A 4HH2A 1H3QA 4ME4A 3UMDA 1GSXA 2BASA 3UB8A 2O9AA 3JVVA 1N9NA 1V9YA 3LI8A 3E4PA 3EWKA 3F1OA 4O01A 2VA0A 4HJ3A 2INWA 3LIBA 1UGUA 4LPZA 2GJ3A 2JKTI 4JGQA 3F1NA 1OTDA 4HQAA 4IJGA 2ZOIA 1V9ZA 2PT7A 2QYBA 4EW7A 3C30A 1VHMA 4P6ZM 3MFXA 1LT0A 2XA7S 1XJ2A 4IHQA 3FC7A 1OPXA 2O0YA 3C38A 1TS6A 1XJ3A 3JVUA 3EQUA 3P7NA 4MN5A 3VV4A 4ETZA 2EWVA 3D3OA 2W1TA 2J3WA 3T4QA 3OCLA 2V9AA 4HP4A 5DFYA 3UMEA 2PYRA 3HCYA 3PBSA 2YKFA 3MXQA 3T4TA 3P01A 2QJ5A 4ARZB 3RH8B 2CMNA 1EW0A 3UB7A 1S4RA 2V1BA 2W3FA 4II7A 3ULFA 3BWLA 1F9IA 2O9BA 1NWZA 3TJZC 4B93A 1YKDA 3RFBA 3EGDC 3T4JA 1S66L 2VV7A 1XFQA 3KO6A 2KDKA 4HHDA 3TRCA 1T1BA 5DJTA 3BY9A 1T1CA 5HDCA 2HJ9C 3NHQA 5IT5A 4I3JA 4LRYC 3NJAA 4WEKA 2L4RA 3BQAA 4HOIA 4FOFA 1MC0A 2QWSA 3E4OA 4HY8A 4H6JA 3EEHA 4YNRA 3ZYTA 3A0RA 4B9OA 3MF0A 4R70A 5DJUA 5G4ZA 1G6OA 1ODVA 1ZHHB 2HJEA 4MMNA 3FG8A 4R6LA 5TBMB 5DKKA 2PD8A 4CQHA 2OAP1 2KOIA 3K2NA 5KSHA 2PHYA 1DRMA 4NXEA 2VEAA 1N9OA 3EEAA 3VOLA 4I38A 4MDZA 5AJGA 2G7UA 4AFIA 4BBTA 1D06A 4JGRA 1OTIA 3KX0X 2W3GA 2QJ7A 4HI4A 2O99A 2EWWA 3A0SA 4GHIB 4WL9A 1LSVA 2OOLA 5L8MA 4UQIM 3T50A 1GSWA 3LICA 3OLOA 3R7WA 4BMWA 2P08A 1S1ZA 2XSSA 1F98A 1TS0A 1T18A 2VZWA 2YKHA 3MQ0A 3T4SA 2VGLM 1T1AA 2Y79A 3UE6A 3S7OA 3VE4A 3PR6A 4P6ZS 3V67A 3OCNA 4GS9A 1LL8A 2R78A 3C8CA 4BJPA 4ZRRA 5F68A 3UE3A 4XT2B 5DKLA 4M4XA 3H82B 2EA9A 2W1TB 5KIZA 4Y5FA 5HD5A 2JN7A 3EGXC 4G3WA 3LFVA 4LRZE 2PR5A 2W3DA 3UB6A 3LUQA 2V0WA 2OAQ1 5FL3A 3W2ZA 3LR5A 3CUEC 4NKPA 3PHYA 2A24A 2XRNA 3OC2A 5AVFA 2A2LA 1F5MA 4EU0A 4G3VA 4CLCA 2B02A 3LR3A 3PBRA 4R38A 1P97A 4EXOA 5MC7A 3NOTC 3ZQ5A 1BYWA 2JKRI 3EOIA 3GECA 4EETB 5G4YA 3KSIA 4EERA 4Q0JA 4QPRA 4GJ4A 4I3AA 3U2AA 2WKPA 1D7EA 3CWFA 2PR6A 2MJ6A 3E98A 1IFQA 1OT6A 5IS1A 3MQOA 4PKYG 1VB6A 2K7SA 4NXFA 1IOUA 1YSPA 4HJ6A 4HIAA 5DF9A 4R3AA 2VX8A 5DFXA 5J4EA 2VV8A 3UB9A 2HV1A 1P9RA 3F1PA 5HD3A 3A0VA 2K31A 4F3LA 4NEED 3PBTA 3MJQA 1LSWA 5J7EA 2D02A 5A8BA 5HWVA 1W63M 3LR4A 3S7QA 3D72A 2W27A 1S67L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EFW A;  4BBV A;  2D01 A;  1OJG A;  1S1Y A;  3IS2 B;  4KUO A;  2QHK A;  5HWW A;  1OJ5 A;  4I3I A;  1OT9 A;  3H7W B;  3K3D A;  4L9F A;  2ZOH A;  5HSQ A;  2Z6D A;  4EES A;  5J3W A;  3GDI A;  4L9G A;  4KUK A;  1OTB A;  3HJI A;  3NOP C;  4HNB A;  3C2W A;  1XJ6 A;  2ZBB A;  3MQQ A;  1TS7 A;  3BY8 A;  3RTY A;  3F1O B;  1WA9 A;  2QKP A;  4EQ1 A;  2OWH A;  3LI9 A;  4HH3 A;  4DJ3 A;  3LYX A;  3F1N B;  2VV6 A;  4I39 A;  2A24 B;  2L0W A;  3LIE A;  4HP9 A;  1MZU A;  4WUJ A;  5HDD A;  5I5L A;  3ICY A;  1XFN A;  3B33 A;  4BBU A;  3G6O A;  1XJ4 A;  4EEP A;  1OTA A;  1T19 A;  4GCZ A;  2I9V A;  4LLO B;  2H28 A;  2Z6C A;  4MN6 A;  3MR0 A;  3LIA A;  2M1C A;  2PDR A;  4GW9 A;  4GHI A;  3F1P B;  4HJ4 A;  4F3L B;  2JHE A;  1X0O A;  3E4Q A;  1DP6 A;  1LSX A;  1OTE A;  4E04 A;  4H6J B;  2PYP A;  1GSV A;  1UWP X;  2J80 A;  3H9W A;  4L9E A;  1Y28 A;  4YWZ A;  2KX6 A;  4JGP A;  1DP9 A;  4XT2 A;  4NXB A;  1G28 A;  3H82 A;  3K3C A;  2V0U A;  2P7J A;  4JGO A;  3NOU C;  3SW1 A;  2V1A A;  3IBR A;  2PD7 A;  3CAX A;  5AVE A;  4KQD A;  1S4S A;  5HWT A;  4K08 A;  3HJK A;  1P0Z A;  1TS8 A;  2OWJ A;  2W0N A;  4WN5 A;  5F5Y A;  4GS9 B;  1KOU A;  3CLO A;  5HDS A;  1DP8 A;  4RQ9 A;  4I5S A;  2WKR A;  4PKY A;  4NXG A;  1N9L A;  5F6A A;  2L1M A;  5F69 A;  4WLA A;  3LID A;  3PYP A;  1JNU A;  2VLG A;  4EEU A;  4LRX C;  5HZH A;  4DJ2 A;  3VE3 A;  3IS2 A;  5TBM A;  3H7W A;  3LIF A;  2WKQ A;  1UWN X;  4WF0 A;  5IU1 A;  4HH2 A;  3UMD A;  1GSX A;  2BAS A;  3UB8 A;  1N9N A;  1V9Y A;  3LI8 A;  3E4P A;  3EWK A;  3F1O A;  4HJ3 A;  2INW A;  3LIB A;  1UGU A;  4LPZ A;  2GJ3 A;  4JGQ A;  3F1N A;  1OTD A;  4HQA A;  4EW7 A;  2ZOI A;  1V9Z A;  3MFX A;  1LT0 A;  1XJ2 A;  3FC7 A;  1TS6 A;  1XJ3 A;  3P7N A;  4MN5 A;  2V9A A;  4HP4 A;  3UME A;  2PYR A;  2YKF A;  3MXQ A;  2QJ5 A;  3RH8 B;  2CMN A;  1EW0 A;  3UB7 A;  1S4R A;  2V1B A;  3ULF A;  3BWL A;  1F9I A;  1NWZ A;  1S66 L;  2VV7 A;  1XFQ A;  2KDK A;  4HHD A;  1T1B A;  5DJT A;  3BY9 A;  1T1C A;  5HDC A;  3NHQ A;  4I3J A;  4LRY C;  3NJA A;  2L4R A;  4HOI A;  2QWS A;  3E4O A;  4HY8 A;  4H6J A;  3EEH A;  3A0R A;  4B9O A;  4R70 A;  5DJU A;  5G4Z A;  1ODV A;  3FG8 A;  4R6L A;  5TBM B;  5DKK A;  2PD8 A;  2PHY A;  1DRM A;  4NXE A;  2VEA A;  1N9O A;  3VOL A;  4I38 A;  4BBT A;  1D06 A;  4JGR A;  1OTI A;  3KX0 X;  2QJ7 A;  4HI4 A;  3A0S A;  4GHI B;  4WL9 A;  1LSV A;  2OOL A;  3T50 A;  1GSW A;  3LIC A;  3OLO A;  1S1Z A;  1F98 A;  1TS0 A;  1T18 A;  2YKH A;  1T1A A;  3UE6 A;  3VE4 A;  4GS9 A;  1LL8 A;  2R78 A;  3C8C A;  5F68 A;  4XT2 B;  5DKL A;  4M4X A;  3H82 B;  2EA9 A;  5KIZ A;  5HD5 A;  2JN7 A;  4LRZ E;  2PR5 A;  3UB6 A;  3LUQ A;  2V0W A;  3PHY A;  2A24 A;  5AVF A;  2B02 A;  4R38 A;  1P97 A;  4EXO A;  3NOT C;  3ZQ5 A;  1BYW A;  3GEC A;  4EET B;  5G4Y A;  4EER A;  4I3A A;  2WKP A;  1D7E A;  3CWF A;  2PR6 A;  1OT6 A;  5IS1 A;  3MQO A;  4PKY G;  1VB6 A;  2K7S A;  4NXF A;  4HJ6 A;  4HIA A;  4R3A A;  5J4E A;  2VV8 A;  3UB9 A;  2HV1 A;  3F1P A;  5HD3 A;  3A0V A;  4F3L A;  3MJQ A;  1LSW A;  5J7E A;  2D02 A;  5A8B A;  5HWV A;  3D72 A;  2W27 A;  1S67 L; 
#chains in the Genus database with same CATH topology
 2Y91 A;  2B18 A;  3KYQ A;  3GTC A;  2D01 A;  1PWG A;  2WZZ A;  1OJ5 A;  4EV4 A;  3O5Y A;  3FWL A;  4MN7 A;  3UY6 A;  2LB5 A;  1L0G A;  1I5Q A;  3PBO A;  1BZA A;  4EES A;  1RCJ A;  3NDE A;  1MPL A;  3NOP C;  3W8K A;  1XA1 A;  1DJB A;  3C2W A;  1NLZ A;  3F1O B;  4KQO A;  2XDM A;  4U3T A;  3BEB A;  2XF3 A;  2VV6 A;  3P09 A;  2L0W A;  4GDB A;  4LV2 A;  4HP9 A;  4L0L A;  3B3X A;  4UEY A;  2LB9 A;  4WUJ A;  4YOF A;  3WS4 A;  5HDD A;  3ICY A;  4PMA A;  3B33 A;  3PBN A;  1XJ4 A;  3GRJ A;  4EEP A;  1OTA A;  1O07 A;  4K0X A;  2WAE A;  5EVE A;  5IHV A;  4A5R A;  2H28 A;  4DXB A;  3DTM A;  3T4O A;  3N8L A;  3NCK A;  2Z6C A;  4WEL A;  1CK3 A;  1K57 A;  4WZ4 A;  4OP5 A;  1CF0 A;  1NRJ A;  4GW9 A;  4GHI A;  3GR2 A;  5GL9 A;  1W63 Q;  1NZU A;  3R4K A;  3VP4 A;  3WS0 A;  4X56 A;  1D1J A;  2QZ6 A;  3NDG A;  3UE0 A;  4E04 A;  5FQM A;  2WAF A;  3CJM A;  3OBF A;  3UB5 P;  1UWP X;  4L9E A;  1JWP A;  1DP9 A;  4XT2 A;  1LLB A;  1G28 A;  4E3K A;  2Y2P A;  3K3C A;  4Y3I A;  2P7J A;  3A3F A;  4H8R A;  2HP5 A;  5U47 A;  4XXR A;  3HVF A;  2WGW B;  3DW0 A;  4LEN A;  2QMI A;  5HAQ A;  5HPF A;  5FSR A;  3DWK A;  4KZ5 A;  5L2F A;  3UN7 A;  2PD7 A;  2H5S A;  2W3E A;  1LL5 A;  2ZL1 A;  4P85 A;  2PU2 A;  1M40 A;  4S2K A;  5AVE A;  4E3N A;  3ZDJ A;  4K08 A;  4LV1 A;  1L3L A;  3SH9 A;  1TS8 A;  4X69 A;  2PU4 A;  1PZO A;  4O8G A;  2W0N A;  4E6X A;  5FQI A;  1FR6 A;  3VMA A;  1DP8 A;  1K54 C;  3IHA A;  5CGX A;  4RQ9 A;  3TSG A;  3FZC A;  4I5S A;  2WKR A;  5F6A A;  4PHT A;  1SZV A;  5F69 A;  4EBN A;  2WAD A;  4BWI A;  1H5X A;  3LID A;  3PBQ A;  3PYP A;  1JNU A;  3MS6 A;  4O0P A;  3ZVT A;  4Y13 A;  3SS5 A;  4BD0 A;  4E3I A;  4EEU A;  4LRX C;  4Q0H A;  4R0Q A;  1RGZ A;  5EOO A;  1ZTU A;  5JYO A;  4KZ7 A;  3MMH A;  4PM6 A;  4OQ0 A;  3OPH A;  1JWV A;  2EXB A;  1KGE A;  1STZ A;  1SKF A;  1UWN X;  1MBL A;  5GHZ A;  4WF0 A;  3QP2 A;  2BLS A;  5CX7 A;  5GLC A;  3G2Y A;  4ME4 A;  2EFX A;  2O9A A;  3JVV A;  3O3V A;  4ZJ2 A;  1N9N A;  4B4Z A;  5HX9 A;  3ZNY A;  3U4L P;  3F1O A;  3ZG9 B;  1PNE A;  3V5M A;  3BLS A;  1TEM A;  3M2K A;  1VEU B;  2Y2H A;  3MFX A;  4BQM A;  2O0Y A;  3C38 A;  3QP4 A;  1XJ3 A;  3HLE A;  3P7N A;  1YLT A;  3W4O A;  4C6Y A;  2EWV A;  1HLU P;  4Y7P A;  1PI5 A;  3MXQ A;  3ZCZ A;  5A91 A;  2QJ5 A;  4ARZ B;  1BUE A;  4II7 A;  2W3F A;  3Q7V A;  3LCE A;  1HZO A;  1S6R A;  5M18 A;  3I7J A;  1OME A;  4HHD A;  3TRC A;  1T1B A;  4CPK A;  5HDC A;  3IX3 A;  3NHQ A;  5EVI B;  5IT5 A;  3HUO A;  4P0M A;  2WYX A;  4S2M A;  4BD1 A;  3HLG A;  3BFD A;  1J9M A;  4X68 A;  4FOF A;  1E4D A;  2XD5 A;  4KQQ A;  1WE4 A;  4YNR A;  5CGS A;  4B9O A;  3MF0 A;  4R70 A;  4MMN A;  3RXX A;  1AXB A;  4QY6 A;  4OVD A;  2KOI A;  5KSH A;  1YLW A;  1YLY A;  1DRM A;  3EEA A;  4JXV A;  2WGW A;  2ZC3 B;  3AGF A;  1NYY A;  5AJG A;  4AFI A;  4BBT A;  3G30 A;  2XFT A;  2ZM2 A;  1YLZ A;  4UA7 A;  2JCH A;  3CG5 A;  4OPY A;  2PBD P;  3V50 A;  5L8M A;  3OPP A;  2Q9N A;  1BSG A;  3UPO A;  1ES4 A;  1K55 A;  1S1Z A;  1GHI A;  4WMC D;  1F98 A;  1T18 A;  2Y79 A;  3UE6 A;  3S7O A;  1ESI A;  3M6B A;  3IF6 A;  1LL8 A;  3PAG A;  4BJP A;  5DTK A;  3SS3 A;  1LI0 A;  1PRQ A;  2EA9 A;  3OPR A;  4DE2 A;  2W1T B;  5HD5 A;  3HLB A;  4O7D A;  3UB6 A;  4OOY A;  3C7V A;  1DJC A;  5FL3 A;  3M6H A;  4GOG A;  3V39 A;  2A24 A;  5AVF A;  3UNW A;  4R38 A;  2JBF A;  2E8I A;  5EPH A;  3SZT A;  5G4Y A;  3KSI A;  4QPR A;  4GJ4 A;  5A93 A;  3GMW A;  3CWF A;  3IF6 C;  4WZ5 C;  3E98 A;  1IFQ A;  4PKY G;  5FQQ A;  4C75 A;  5DF9 A;  4R3A A;  2HV1 A;  1K6S A;  1P9R A;  2K31 A;  4PM9 A;  1ESU A;  2PRF A;  3WS1 A;  4X1M A;  3HBR A;  1K0K A;  5J7E A;  4UAA A;  5KMW A;  5A8B A;  3JYI A;  5FQJ A;  3S7Q A;  4KG6 A;  4KZ9 A;  3N7W A;  1VEU A;  3L9K A;  1XPB A;  2WKE A;  4RA7 A;  2WGI A;  1OJG A;  1YAX A;  5CHM A;  4G3K A;  2QHK A;  2XEP A;  3AGD A;  4I3I A;  3LO7 A;  2RL3 A;  3SS4 A;  4WEJ A;  2V2F F;  4LV3 A;  3K3D A;  4GLQ A;  2Y2O A;  4OQI A;  4L9F A;  2Y59 A;  1IEL A;  5TJJ A;  4M3K A;  2ZOH A;  3MXS A;  4ARZ A;  3CPT B;  1P9W A;  4DMZ A;  3DTE A;  2P74 A;  3T12 B;  4L9G A;  4KUK A;  1OTB A;  3SOI A;  1RP5 A;  2XRO A;  2XR0 A;  4HNB A;  1CQA A;  4R3J A;  2C5W B;  1XJ6 A;  2ZBB A;  1YSQ A;  1ZG6 A;  3BY8 A;  2Z2L B;  2W3H A;  3MZD A;  3KYZ A;  4EQ1 A;  1KE4 A;  3LYX A;  3BRM A;  1E25 A;  2XGN A;  3LIE A;  4S2J A;  1F2K A;  3S1Y A;  3BQ8 A;  3IBJ A;  1XFN A;  4BBU A;  3G6O A;  4ZJ1 A;  1BUL A;  3HLD A;  2ZMF A;  4GCZ A;  3LEZ A;  1JWZ A;  3LIA A;  5C5K A;  3Q82 A;  3KSH A;  3LEQ A;  4S2I A;  3T4K A;  4OP8 A;  4IVI A;  4LGW A;  3E0Y A;  4F3L B;  1X0O A;  3BFE A;  4IED A;  1ZC2 A;  1K6R A;  4OH0 A;  5EOE A;  2NUP C;  4KZ4 A;  3FPW A;  1OTE A;  4H6J B;  1JVJ A;  1GSV A;  4KZ6 A;  2KX6 A;  1NLY A;  1VET B;  3C5A A;  1LI9 A;  1BLS A;  3S4X A;  3PXP A;  1H8M A;  2HP9 A;  1NY0 A;  3NOU C;  5FAP A;  1BLH A;  5FAQ A;  2V1A A;  4JXG A;  4OOM A;  3NUL A;  2M7U A;  3CAX A;  4CLC C;  4DE0 A;  1MY8 A;  3T4L A;  1YQS A;  3O88 A;  1GA9 A;  5CEC A;  4P87 A;  4B88 A;  1P0Z A;  1MKM A;  1ES3 A;  2WZX A;  3AGE A;  4WN5 A;  1ERO A;  4Z1W A;  4GS9 B;  5EM1 A;  4IBX A;  4UA9 A;  3CLO A;  5HDS A;  4PAU A;  3TE8 A;  4PKY A;  3B47 A;  4NXG A;  2XQZ A;  1N9L A;  1NRF A;  3FKV A;  4WLA A;  1W8Q A;  3VP0 A;  4JKT A;  3FYZ A;  4Y0T A;  2VGJ A;  4K91 A;  4KZA A;  3GV9 A;  3SH7 A;  3VE3 A;  4RX3 A;  3W4P A;  2EFU A;  1N9B A;  5TBM A;  1PW8 A;  1H0M A;  3CZD A;  4LCM A;  2RCX A;  5FDH A;  3E2L A;  1K38 A;  1NXY A;  4PM5 A;  2ZMA A;  1PI4 A;  3HLW A;  3PTE A;  3NIA A;  1PW1 A;  5IU1 A;  2WGV A;  3UMD A;  2BAS A;  3UB8 A;  1MKI A;  1V9Y A;  1CI9 A;  5F83 A;  2INW A;  1UGU A;  4KG5 A;  2VGK A;  4IJG A;  2ZOI A;  1V9Z A;  2PT7 A;  1AWI A;  2QYB A;  3GVB A;  3C30 A;  4P6Z M;  3ZNT A;  5CTN A;  3JVU A;  2G2U A;  4X1L A;  4BEN A;  3EQU A;  2EXA A;  3D3O A;  3IWO A;  2J3W A;  1BLP A;  2V9A A;  1JTG A;  3PBS A;  2Y2K A;  1MWR A;  3G35 A;  3RH8 B;  4MBK A;  1EW0 A;  1PZP A;  3UB7 A;  4KZ3 A;  1XXM A;  1K57 C;  3BWL A;  2O9B A;  1YKD A;  5TFQ A;  2Y2G A;  2BTF P;  3EGD C;  1S66 L;  1L0D A;  2ZJ9 A;  4RYE A;  1FR1 A;  2JE5 A;  2AVX A;  2XD1 A;  2HJ9 C;  3WRZ A;  2B5R A;  4DF6 A;  4E6W A;  3NJA A;  2R9W A;  3IWI A;  4HOI A;  4X25 A;  1MC0 A;  3ITB A;  5EUA A;  4H6J A;  1QME A;  3T1R A;  3ZYT A;  1G6O A;  1ZHH B;  2HJE A;  1VET A;  3FG8 A;  3D9Y A;  3T1Q B;  3MXR A;  4X53 A;  1MWU A;  1N4O A;  4HBU A;  2PD8 A;  4CQH A;  3QP5 A;  2DRW A;  4OLD A;  2VEA A;  1K4F A;  1N9O A;  4N92 A;  1ES5 A;  3VOL A;  4S2L A;  4R4S A;  2G7U A;  2EX2 A;  2QJ7 A;  2O99 A;  3A0S A;  3VSK A;  1FIK A;  4EQI A;  4N9K A;  4UQI M;  1Z09 A;  1ZG4 A;  1U60 A;  5L07 A;  5FQ9 A;  2P08 A;  3G31 A;  3HUM A;  1CJF A;  1TS0 A;  3MQ0 A;  1XX2 A;  2C6W B;  2DNS A;  2Y4A A;  3IX4 A;  4P6Z S;  4GS9 A;  3C8C A;  1IKI A;  4ZRR A;  5F68 A;  2JKF A;  1G6A A;  4GB7 A;  4M4X A;  3H82 B;  5CEB A;  1K56 D;  5KSC A;  3LFV A;  2V0W A;  3LGO A;  3A3D A;  5FA7 A;  1IKG A;  3LR5 A;  3PHY A;  2XRN A;  2HP6 A;  5CHU A;  1F5M A;  4EU0 A;  5GLB A;  2X71 A;  4G3V A;  2ZQ7 A;  2B02 A;  1M6K A;  1DY6 A;  2XH9 A;  3PBR A;  1P97 A;  5MC7 A;  2V20 A;  3ZG8 B;  3TG9 A;  3ZQ5 A;  3EOI A;  2ZQ9 A;  3O87 A;  4ESP A;  1SKO B;  2Y55 A;  4NG2 A;  3UO9 A;  2MJ6 A;  1LL9 A;  2JKG A;  4GZB A;  3OZH A;  4KZB A;  3VSL A;  1KVL A;  3MSH A;  4E3O A;  4DRT A;  1ES2 A;  4D2O A;  5DFX A;  4S2P A;  2ZD8 A;  3GQZ A;  4N1H A;  1L0E A;  4U0T A;  4NEE D;  3MJQ A;  5CRF A;  4S2N A;  3LR4 A;  4MEZ A;  2W27 A;  1KGG A;  1S67 L;  4DE3 A;  5EFW A;  5LBR A;  4BBV A;  1ONH A;  4CJN A;  3ZG7 B;  1GHM A;  4KUO A;  5HWW A;  4UQI S;  3JPU A;  2JKT M;  4JF6 A;  4U0X A;  5CXW A;  1JTD A;  3H7W B;  2A49 A;  5L10 A;  1RGY A;  4BLM A;  2KLI A;  4GD6 A;  5DTS A;  2X01 A;  2P9V B;  2PBY A;  5EM0 A;  5HSQ A;  4N1X A;  3C4O A;  5J3W A;  2ZM0 A;  3GDI A;  4Q0I A;  3FKW A;  3CI6 A;  3DTK A;  2WKI A;  3HL9 A;  3UDF A;  4P6B A;  3MQQ A;  4ETX A;  4OPQ A;  3RTY A;  2Q0O A;  3KSF A;  5FAS A;  1WA9 A;  4QU3 A;  2DCF A;  2OWH A;  1K4E A;  4DJ3 A;  3BYD A;  3F1N B;  1TDG A;  4I39 A;  3LY4 A;  4RVA A;  2IA2 A;  2ACG A;  4IVK A;  3BLM A;  4DDS A;  4KG2 A;  5HPI A;  1GA0 A;  3MKF A;  2EX9 A;  1T19 A;  4CLC E;  2I9V A;  4LLO B;  3T1X A;  3ZVW A;  4DDY A;  3UPN A;  3N8R A;  3OOV A;  4FUW A;  1E3U A;  3HRE A;  1CI8 A;  5AQA A;  3LR0 A;  2PDR A;  3E2K A;  3F1P B;  4CLC D;  3IXG A;  4NET A;  2JHE A;  4X6T A;  4K0W A;  3PAE A;  4R23 A;  1K55 C;  1Y4O A;  4OOL A;  2Y2N A;  5CGW A;  4MBF A;  4ID4 A;  3TW8 A;  1KE0 A;  2J80 A;  1J3W A;  3NC8 A;  2Y2J A;  3NEC A;  4JGP A;  2EX6 A;  1I2W A;  3H82 A;  4DXC A;  2V0U A;  3N8S A;  2HGV A;  1FCO A;  5FAO A;  5F1F A;  1KGF A;  3ITA A;  2XA7 M;  1KVM A;  5K5B A;  2H0T A;  4KQD A;  1S4S A;  5E2E A;  4EUZ A;  2Y2I A;  2ZMV A;  4EWF A;  4DKI A;  2OWJ A;  3TOI A;  1VM1 A;  1SKO A;  4S2O A;  3CIT A;  5M1A A;  5DTT A;  1KOU A;  4QD4 A;  3FPV A;  3RJU A;  4FTX A;  2JKR M;  3BW6 A;  4IUH A;  1TVF A;  1CEG A;  2Y2Q A;  4GNU A;  2GX5 A;  5EVI A;  1Z6F A;  2PAV P;  4FSF A;  4LCL A;  2M7V A;  1ALQ A;  4Y0U A;  4OQG A;  2VLG A;  2WUQ A;  3CUE A;  4ZDX A;  3IXH A;  4UHU A;  3UDX A;  2J3T C;  5HZH A;  1MWS A;  1XP4 A;  4IUK A;  3P98 A;  4RX2 A;  4DJ2 A;  2FFF B;  2FH5 A;  4KQR A;  4YIN A;  4PM7 A;  1FQG A;  1L0F A;  3V3R A;  3H7W A;  2DMW A;  4WMC A;  4F94 A;  2WKQ A;  1PYY A;  2P9V A;  1L2S A;  1SDN A;  4QB8 A;  3A3E A;  1HTZ A;  3Q1F A;  5FI2 A;  5A90 A;  3BFF A;  4HH2 A;  4R1G A;  1H3Q A;  3FV7 A;  5E43 A;  1SHV A;  5CHJ A;  5EVI C;  4O01 A;  2VA0 A;  4Y17 A;  2JKT I;  4JBF A;  4JGQ A;  3F1N A;  1OTD A;  5HFO A;  1VHM A;  1LT0 A;  2XA7 S;  4IHQ A;  3FC7 A;  1OPX A;  1YMX A;  3IF5 A;  4MN5 A;  3VV4 A;  2W1T A;  2IWD A;  2WKH A;  2Z2M B;  4HP4 A;  5DFY A;  2PYR A;  3T4T A;  2YKF A;  3CHW P;  3P01 A;  2UV0 E;  2CMN A;  3IXD A;  1S4R A;  2V1B A;  4FH4 A;  1NWZ A;  3TJZ C;  4B93 A;  1WYB A;  3T4J A;  2VV7 A;  3KO6 A;  1XFQ A;  3DAV A;  3QP8 A;  3HUN A;  5DJT A;  4OKP A;  3BY9 A;  1T1C A;  5M19 A;  1W8Y A;  4I3J A;  4LRY C;  4BL3 A;  5HW3 A;  4JF5 A;  3C4P A;  4WEK A;  3BQA A;  4QHC A;  3E4O A;  4HY8 A;  4KZ8 A;  3EEH A;  4WM9 A;  3A3I A;  5GLA A;  4R6L A;  3K2N A;  3DWZ A;  4NXE A;  1C3B A;  4PM8 A;  5F1G A;  4I38 A;  3ZGA B;  4LV0 A;  3G34 A;  1D06 A;  4JGR A;  2W3G A;  3Q7Z A;  4HI4 A;  4R3B A;  5EE8 A;  2CC1 A;  1IYO A;  2OOL A;  3LIC A;  3OLO A;  5L09 A;  1FCM A;  3CMZ A;  4BMW A;  2XSS A;  2YKH A;  2X02 A;  1A0K A;  2VGL M;  2XK1 A;  1T1A A;  3CPT A;  1FSY A;  3PR6 A;  5CER A;  3UE3 A;  5BOH A;  4IBR A;  1ACF A;  3O86 A;  1PFL A;  4ZAM A;  5DKL A;  4QY5 A;  5KIZ A;  3EGX C;  4G3W A;  3D4F A;  4LRZ E;  2PR5 A;  2W3D A;  2G2W A;  3LUQ A;  1SDE A;  4WBG A;  3Q7V B;  3ISG A;  3W2Z A;  4BL2 A;  4NKP A;  3OC2 A;  3G2Z A;  3Q81 A;  4LFU A;  4EXO A;  2Q9M A;  1BYW A;  2JKR I;  2ZC6 B;  5HAI A;  4EET B;  4EER A;  4Q0J A;  2J8Y A;  4I3A A;  2HPB A;  4X55 A;  1D7E A;  3ZG0 A;  1OT6 A;  1ERQ A;  3W4Q A;  3VFH A;  3L7H A;  1EWZ A;  2ZC7 A;  1YSP A;  1K54 A;  1O7E A;  1KDS A;  3QP1 A;  2VX8 A;  3UB9 A;  3A0V A;  4F3L A;  4Q8I A;  1DJA A;  1LSW A;  2IWC A;  4OPR A;  5HWV A;  4FD8 A;  3MFD A;  4Y0O A;  3D72 A;  1FCN A;  1IEM A;  3QP6 A;  3GSG A;  1S0W A;  3UE1 A;  1S1Y A;  1HVB A;  1GCE A;  3IS2 B;  5D3O A;  4EUV A;  4B4X A;  2VJW A;  5G18 A;  2J7V A;  3S7N A;  1OT9 A;  5HL6 A;  4E3J A;  1YMS A;  3G32 A;  1Y54 A;  4HES A;  2VGL S;  3T1S A;  2V8C A;  2P04 A;  2VKS A;  4MNR A;  2Z6D A;  3IF6 B;  4NK3 A;  5FQK A;  4N9L A;  3HJI A;  4MLL A;  2HDR A;  2OV5 A;  1FSW A;  3IT9 A;  1TS7 A;  1EI5 A;  4DN0 A;  4Y15 A;  2QKP A;  3G4P A;  3LI9 A;  2XFS A;  4HH3 A;  5CED A;  2FZ0 A;  4GDN A;  2A24 B;  5FI6 A;  1TD5 A;  1BT5 A;  1MZU A;  2HDQ A;  1FOF A;  1FIL A;  3BM6 A;  1NYM A;  4ZBE A;  5I5L A;  5HL1 A;  1MXO A;  1WYC A;  3DBA A;  2W1R A;  3A3J A;  2A3U A;  5E2H A;  4MN6 A;  3MR0 A;  2V1Z A;  2K2N A;  3BEC A;  2M1C A;  1E3U D;  1XKZ A;  2UWX A;  3WRT A;  5DF7 A;  5KZH A;  4HJ4 A;  2ZQC A;  3E4Q A;  3ZFZ A;  1DP6 A;  4OQH A;  3B42 A;  2HDU A;  5GHY A;  3S7P A;  1LSX A;  5HAP A;  4R4R A;  4MCW A;  4GD8 A;  3BFC A;  2PYP A;  4E3M A;  4C3Q A;  3H9W A;  1Y28 A;  4YWZ A;  5HAR A;  3MZF A;  1PWC A;  4NXB A;  4OON A;  2HF6 A;  3HLC A;  1W5D A;  4JGO A;  4ZTK A;  4EBP A;  5CTM A;  5AQ7 A;  1H8Z A;  2B95 A;  3V3S A;  1PWD A;  3WWX A;  5FEF A;  3SW1 A;  1W79 A;  4Y2F A;  3IBR A;  1XGJ A;  2V8F A;  2OLV A;  5E2F A;  1KE3 A;  2ZQ8 A;  2J3T D;  2Y2M A;  5F82 A;  3EQV A;  5HWT A;  2ZLY A;  3HJK A;  3R7W B;  3WS2 A;  3VFF A;  5GLD A;  3BJN A;  2ZQD A;  2NUT C;  4HEF A;  2VK3 A;  2O9C A;  5F5Y A;  4EBL A;  1K25 A;  4OPZ A;  2Y8H A;  1TF1 A;  2XLN A;  1I2S A;  3HLF A;  2GZA A;  2L1M A;  4S2N C;  5EVI D;  2FFY A;  4JF4 A;  3MBZ A;  1YPR A;  2QPN A;  1Q2Q A;  3OPL A;  2J9P A;  3IH9 A;  4CLC B;  3UPP A;  3IS2 A;  3KSG A;  3Q07 A;  1BTL A;  2GNX A;  1YM1 A;  3QNC A;  3LIF A;  3MKE A;  1XA7 A;  1HD8 A;  4GN2 A;  4JXS A;  4WZ5 A;  2ZM8 A;  3KYE A;  2I72 A;  1BLC A;  4MBH A;  1K56 A;  4JPM A;  1GSX A;  3IXB A;  3DTI A;  2WK0 A;  3LI8 A;  3E4P A;  3EWK A;  3N6I A;  3VP3 A;  4HJ3 A;  4OLG A;  3LIB A;  4QJG A;  4LPZ A;  2GJ3 A;  5TGF A;  1KDW A;  4HQA A;  4EW7 A;  1YLP A;  4XUZ A;  1XJ2 A;  5EEC A;  5FAT A;  4FCF A;  5J8X A;  4GKU A;  1TS6 A;  3QNB A;  5FEG A;  3IWQ A;  4ETZ A;  3T4Q A;  2OLU A;  3N4I A;  3OCL A;  3UME A;  3HCY A;  2R9X A;  1MWT A;  4JLF A;  1SCW A;  5DVA A;  5AQ9 A;  5JYP A;  3ULF A;  3LY3 A;  3ZHH A;  5EV0 A;  1F9I A;  3RFB A;  4KEN B;  1NJ4 A;  2ZC4 B;  1TDL A;  1IYS A;  2KDK A;  5GHX A;  3MZE A;  2HDS A;  2H10 A;  1QMF A;  1ERM A;  2L4R A;  4PPR A;  2QWS A;  3SH8 A;  5TR7 A;  3NY4 A;  3C7U A;  3A0R A;  5DJU A;  5G4Z A;  5I94 A;  1ODV A;  1XGI A;  5TBM B;  3S22 A;  5DKK A;  2OAP 1;  2PHY A;  5AQB A;  3VP1 A;  4ZJ3 A;  4MDZ A;  1OTI A;  3KX0 X;  3RXW A;  4JXW A;  2EWW A;  5FI7 A;  4GHI B;  2EX8 A;  4WL9 A;  5FDS A;  1LSV A;  3WS5 A;  4WYY A;  4E3L A;  3T50 A;  2BG1 A;  1GSW A;  5EVL A;  3M2J A;  3R7W A;  3IX8 A;  4YFM A;  2VZW A;  3T4S A;  3VE4 A;  3UDI A;  1NZO A;  3OCN A;  3V67 A;  3IQA A;  2R78 A;  1ZKJ A;  2HZ5 A;  3QHY A;  4HBT A;  4DE1 A;  4XT2 B;  1Q2P A;  4Y5F A;  2JN7 A;  3NBL A;  1YLJ A;  3VOY A;  1LHY A;  3NI9 A;  3IHB A;  2OAQ 1;  1G5U A;  3CUE C;  1PIO A;  3ZG5 A;  1IYP A;  2ZL1 B;  2A2L A;  3IH8 A;  1W7F A;  4CLC A;  2Y2L A;  1YT4 A;  5E2G A;  1VQQ A;  2IWB A;  3LR3 A;  1G68 A;  3VOZ A;  1ONG A;  2OSU A;  3VP2 A;  3BFG A;  3NOT C;  3GEC A;  1CEF A;  4QWO A;  1GHP A;  1H8Y A;  2ZQA A;  3U2A A;  2WKP A;  2PR6 A;  2J9O A;  4D60 A;  5A92 A;  5IS1 A;  2JC7 A;  3MQO A;  2H0Y A;  1VB6 A;  5DF8 A;  2K7S A;  4FH2 A;  4NXF A;  1IOU A;  4HJ6 A;  4HIA A;  4UA6 A;  5J4E A;  2VV8 A;  1IYQ A;  2ZC5 B;  2GDN A;  3F1P A;  5HD3 A;  4Z9Q A;  3PBT A;  2D02 A;  1W63 M;  2E8J A;  4XUX A; 
#chains in the Genus database with same CATH homology
 5EFW A;  5LBR A;  4BBV A;  2B18 A;  3KYQ A;  2D01 A;  1OJG A;  1S1Y A;  1YAX A;  4G3K A;  3IS2 B;  4KUO A;  4EUV A;  2QHK A;  5HWW A;  1OJ5 A;  2VJW A;  4UQI S;  4I3I A;  3O5Y A;  2JKT M;  1OT9 A;  4WEJ A;  5HL6 A;  3S7N A;  3H7W B;  3K3D A;  4GLQ A;  4MN7 A;  4L9F A;  2LB5 A;  5TJJ A;  2KLI A;  2VGL S;  2P04 A;  2VKS A;  2ZOH A;  4ARZ A;  5HSQ A;  3PBO A;  1P9W A;  2Z6D A;  4EES A;  5J3W A;  4DMZ A;  3GDI A;  4L9G A;  4KUK A;  1OTB A;  3HJI A;  3NOP C;  4Q0I A;  2XRO A;  3CI6 A;  4HNB A;  3C2W A;  1XJ6 A;  2ZBB A;  4ETX A;  3MQQ A;  1NLZ A;  1YSQ A;  1TS7 A;  3BY8 A;  3RTY A;  4DN0 A;  3KSF A;  3F1O B;  1WA9 A;  2W3H A;  2QKP A;  3KYZ A;  4KQO A;  4EQ1 A;  2OWH A;  3LI9 A;  4HH3 A;  4DJ3 A;  3LYX A;  3F1N B;  2FZ0 A;  2VV6 A;  4I39 A;  2A24 B;  2L0W A;  1TD5 A;  3LIE A;  4HP9 A;  4L0L A;  1MZU A;  4UEY A;  2IA2 A;  3BQ8 A;  2LB9 A;  4WUJ A;  4YOF A;  3IBJ A;  5HDD A;  5I5L A;  3ICY A;  1XFN A;  3B33 A;  5HPI A;  4BBU A;  3G6O A;  3PBN A;  1XJ4 A;  4EEP A;  1OTA A;  1T19 A;  3DBA A;  4CLC E;  2W1R A;  2ZMF A;  2I9V A;  4GCZ A;  4LLO B;  2H28 A;  3T4O A;  2Z6C A;  4WEL A;  4MN6 A;  3MR0 A;  3OOV A;  3LIA A;  5C5K A;  2K2N A;  2M1C A;  3KSH A;  3LR0 A;  2PDR A;  3T4K A;  1NRJ A;  4GW9 A;  4GHI A;  3F1P B;  4CLC D;  3E0Y A;  4HJ4 A;  4F3L B;  2JHE A;  1X0O A;  3E4Q A;  1W63 Q;  1DP6 A;  3R4K A;  2NUP C;  3B42 A;  3FPW A;  3S7P A;  1LSX A;  4OOL A;  1OTE A;  4E04 A;  4MCW A;  4H6J B;  3TW8 A;  2PYP A;  3OBF A;  1GSV A;  1UWP X;  2J80 A;  3H9W A;  4L9E A;  1Y28 A;  4YWZ A;  2KX6 A;  4JGP A;  1NLY A;  1DP9 A;  4XT2 A;  4NXB A;  1G28 A;  3H82 A;  3K3C A;  2HF6 A;  2V0U A;  2P7J A;  4Y3I A;  3PXP A;  4JGO A;  1H8M A;  3NOU C;  2HGV A;  3SW1 A;  2V1A A;  4Y2F A;  3IBR A;  5HPF A;  4OOM A;  2M7U A;  2PD7 A;  2W3E A;  3CAX A;  2XA7 M;  4CLC C;  2J3T D;  5AVE A;  3T4L A;  5K5B A;  4KQD A;  1S4S A;  3EQV A;  5HWT A;  4K08 A;  3HJK A;  2ZMV A;  3R7W B;  1P0Z A;  1TS8 A;  1MKM A;  3BJN A;  2OWJ A;  4O8G A;  2NUT C;  2W0N A;  4WN5 A;  5F5Y A;  2O9C A;  3CIT A;  4Z1W A;  4GS9 B;  1KOU A;  2Y8H A;  3CLO A;  5HDS A;  3FPV A;  1DP8 A;  2JKR M;  3BW6 A;  4IUH A;  4RQ9 A;  4I5S A;  1TF1 A;  2WKR A;  4PAU A;  3TE8 A;  4PKY A;  3B47 A;  4NXG A;  1N9L A;  5F6A A;  2GX5 A;  2GZA A;  4PHT A;  2L1M A;  5F69 A;  4BWI A;  4FSF A;  4WLA A;  3LID A;  3PBQ A;  3PYP A;  1JNU A;  2M7V A;  2VLG A;  3CUE A;  4O0P A;  4EEU A;  2J3T C;  4LRX C;  5HZH A;  4Q0H A;  4IUK A;  4CLC B;  4DJ2 A;  3VE3 A;  2FH5 A;  3IS2 A;  3KSG A;  1ZTU A;  5TBM A;  3MMH A;  3H7W A;  2DMW A;  2GNX A;  3LIF A;  1STZ A;  2WKQ A;  1UWN X;  4WF0 A;  5CX7 A;  5IU1 A;  4HH2 A;  1H3Q A;  4ME4 A;  3UMD A;  1GSX A;  2BAS A;  3UB8 A;  2O9A A;  3JVV A;  1N9N A;  1V9Y A;  3LI8 A;  3E4P A;  3EWK A;  3F1O A;  4O01 A;  2VA0 A;  4HJ3 A;  2INW A;  3LIB A;  1UGU A;  4LPZ A;  2GJ3 A;  2JKT I;  4JGQ A;  3F1N A;  1OTD A;  4HQA A;  4IJG A;  2ZOI A;  1V9Z A;  2PT7 A;  2QYB A;  4EW7 A;  3C30 A;  1VHM A;  4P6Z M;  3MFX A;  1LT0 A;  2XA7 S;  1XJ2 A;  4IHQ A;  3FC7 A;  1OPX A;  2O0Y A;  3C38 A;  1TS6 A;  1XJ3 A;  3JVU A;  3EQU A;  3P7N A;  4MN5 A;  3VV4 A;  4ETZ A;  2EWV A;  3D3O A;  2W1T A;  2J3W A;  3T4Q A;  3OCL A;  2V9A A;  4HP4 A;  5DFY A;  3UME A;  2PYR A;  3HCY A;  3PBS A;  2YKF A;  3MXQ A;  3T4T A;  3P01 A;  2QJ5 A;  4ARZ B;  3RH8 B;  2CMN A;  1EW0 A;  3UB7 A;  1S4R A;  2V1B A;  2W3F A;  4II7 A;  3ULF A;  3BWL A;  1F9I A;  2O9B A;  1NWZ A;  3TJZ C;  4B93 A;  1YKD A;  3RFB A;  3EGD C;  3T4J A;  1S66 L;  2VV7 A;  1XFQ A;  3KO6 A;  2KDK A;  4HHD A;  3TRC A;  1T1B A;  5DJT A;  3BY9 A;  1T1C A;  5HDC A;  2HJ9 C;  3NHQ A;  5IT5 A;  4I3J A;  4LRY C;  3NJA A;  4WEK A;  2L4R A;  3BQA A;  4HOI A;  4FOF A;  1MC0 A;  2QWS A;  3E4O A;  4HY8 A;  4H6J A;  3EEH A;  4YNR A;  3ZYT A;  3A0R A;  4B9O A;  3MF0 A;  4R70 A;  5DJU A;  5G4Z A;  1G6O A;  1ODV A;  1ZHH B;  2HJE A;  4MMN A;  3FG8 A;  4R6L A;  5TBM B;  5DKK A;  2PD8 A;  4CQH A;  2OAP 1;  2KOI A;  3K2N A;  5KSH A;  2PHY A;  1DRM A;  4NXE A;  2VEA A;  1N9O A;  3EEA A;  3VOL A;  4I38 A;  4MDZ A;  5AJG A;  2G7U A;  4AFI A;  4BBT A;  1D06 A;  4JGR A;  1OTI A;  3KX0 X;  2W3G A;  2QJ7 A;  4HI4 A;  2O99 A;  2EWW A;  3A0S A;  4GHI B;  4WL9 A;  1LSV A;  2OOL A;  5L8M A;  4UQI M;  3T50 A;  1GSW A;  3LIC A;  3OLO A;  3R7W A;  4BMW A;  2P08 A;  1S1Z A;  2XSS A;  1F98 A;  1TS0 A;  1T18 A;  2VZW A;  2YKH A;  3MQ0 A;  3T4S A;  2VGL M;  1T1A A;  2Y79 A;  3UE6 A;  3S7O A;  3VE4 A;  3PR6 A;  4P6Z S;  3V67 A;  3OCN A;  4GS9 A;  1LL8 A;  2R78 A;  3C8C A;  4BJP A;  4ZRR A;  5F68 A;  3UE3 A;  4XT2 B;  5DKL A;  4M4X A;  3H82 B;  2EA9 A;  2W1T B;  5KIZ A;  4Y5F A;  5HD5 A;  2JN7 A;  3EGX C;  4G3W A;  3LFV A;  4LRZ E;  2PR5 A;  2W3D A;  3UB6 A;  3LUQ A;  2V0W A;  2OAQ 1;  5FL3 A;  3W2Z A;  3LR5 A;  3CUE C;  4NKP A;  3PHY A;  2A24 A;  2XRN A;  3OC2 A;  5AVF A;  2A2L A;  1F5M A;  4EU0 A;  4G3V A;  4CLC A;  2B02 A;  3LR3 A;  3PBR A;  4R38 A;  1P97 A;  4EXO A;  5MC7 A;  3NOT C;  3ZQ5 A;  1BYW A;  2JKR I;  3EOI A;  3GEC A;  4EET B;  5G4Y A;  3KSI A;  4EER A;  4Q0J A;  4QPR A;  4GJ4 A;  4I3A A;  3U2A A;  2WKP A;  1D7E A;  3CWF A;  2PR6 A;  2MJ6 A;  3E98 A;  1IFQ A;  1OT6 A;  5IS1 A;  3MQO A;  4PKY G;  1VB6 A;  2K7S A;  4NXF A;  1IOU A;  1YSP A;  4HJ6 A;  4HIA A;  5DF9 A;  4R3A A;  2VX8 A;  5DFX A;  5J4E A;  2VV8 A;  3UB9 A;  2HV1 A;  1P9R A;  3F1P A;  5HD3 A;  3A0V A;  2K31 A;  4F3L A;  4NEE D;  3PBT A;  3MJQ A;  1LSW A;  5J7E A;  2D02 A;  5A8B A;  5HWV A;  1W63 M;  3LR4 A;  3S7Q A;  3D72 A;  2W27 A;  1S67 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...