1NWZA

Pyp ultra-high resolution structure of a bacterial photoreceptor
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Photoactive yellow protein
publication title Anticipatory active-site motions and chromophore distortions prime photoreceptor PYP for light activation
pubmed doi rcsb
source organism Halorhodospira halophila
total genus 37
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2003-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1nwzA00
1NWZA 4B9OA 1TS6A 4HIAA 3A0VA 4LRXC 1OTEA 3NOTC 5HWWA 1GSXA 5G4YA 3P7NA 5IU1A 1D06A 5DKKA 1P0ZA 4JGPA 4I3AA 2M1CA 3CAXA 1S4RA 2V1BA 1F98A 3UB8A 2QKPA 3B33A 2P7JA 4HQAA 3F1PB 1T19A 4H6JA 1MZUA 2H28A 4EERA 4XT2B 3K3CA 3LI8A 4KUKA 2GJ3A 1Y28A 1DRMA 2YKFA 5HD3A 2OWHA 3A0SA 2QJ7A 4R6LA 3PHYA 4HP4A 3NOPC 1TS8A 1T1AA 3ICYA 1VB6A 4GCZA 4L9FA 3FC7A 1EW0A 4HJ4A 5TBMB 5HZHA 5F6AA 2INWA 1LSWA 2ZOHA 2ZOIA 1KOUA 2VV7A 4WN5A 3UB6A 3HJKA 3H82B 4E04A 2V0UA 5IS1A 1T18A 1OJGA 5HWVA 1XJ4A 5HD5A 1DP6A 3CWFA 5KIZA 2J80A 3F1NB 3EWKA 3LI9A 2QHKA 1WA9A 1F9IA 4F3LA 3H7WB 3LYXA 1DP9A 3NOUC 3RH8B 3D72A 2QWSA 3BY9A 1XFQA 3LIDA 2JN7A 3C2WA 3G6OA 4EXOA 2K7SA 4EETB 1GSWA 3UE6A 5G4ZA 4JGRA 2V9AA 2D01A 1X0OA 3NHQA 3VE3A 2A24A 2PD8A 4BBTA 1S1YA 1OT9A 4WL9A 4EESA 3LIBA 2CMNA 5DJTA 3E4QA 4MN5A 3CLOA 3LIAA 2EA9A 5DKLA 2Z6DA 3UB9A 1V9YA 2I9VA 4I3IA 3UB7A 3H9WA 3MFXA 2B02A 2QJ5A 1N9LA 3VE4A 3ZQ5A 4HOIA 4WLAA 2WKPA 4KQDA 3EEHA 3IS2A 1T1BA 3F1OB 2WKQA 1ODVA 1V9ZA 4HHDA 1OTAA 4L9GA 1OTDA 5HWTA 4WUJA 4I3JA 4HI4A 3GECA 1OTIA 4GW9A 2HV1A 5HDSA 2L1MA 2D02A 3ULFA 4K08A 1D7EA 4I38A 4R70A 1JNUA 2YKHA 3HJIA 4DJ3A 5HDDA 1XJ3A 4JGOA 5EFWA 1N9OA 4YWZA 1S67L 4EEPA 1XJ2A 4HP9A 4WF0A 5J4EA 3VOLA 2R78A 2PHYA 1S4SA 4F3LB 2KDKA 4M4XA 2PR6A 3PYPA 2V0WA 4HNBA 4NXEA 3F1NA 2W0NA 4NXFA 5HDCA 4I5SA 2Z6CA 5HSQA 2OOLA 3LIEA 4KUOA 1DP8A 3KX0X 4EQ1A 3H7WA 3MQQA 3LICA 2VV8A 2KX6A 4HJ6A 4GS9A 1UGUA 4GHIA 2PYPA 2L4RA 4LRYC 2BASA 2OWJA 1G28A 5J3WA 4HH2A 4BBVA 2VV6A 3E4OA 3UMDA 5F68A 4RQ9A 1LSXA 3UMEA 4H6JB 3IS2B 3OLOA 5DJUA 2W27A 1XFNA 1UWNX 4HY8A 4DJ2A 1N9NA 4JGQA 2V1AA 4MN6A 4NXBA 3MXQA 3F1PA 3MR0A 4LRZE 1OJ5A 1OTBA 3GDIA 4NXGA 3IBRA 1BYWA 1OT6A 1TS7A 3RTYA 5J7EA 2PR5A 1GSVA 4XT2A 3C8CA 5F5YA 3F1OA 4EEUA 4LLOB 1T1CA 2L0WA 1LL8A 3T50A 4R3AA 2ZBBA 3K3DA 4I39A 5AVEA 3SW1A 2VLGA 1S66L 4HH3A 2PD7A 3FG8A 2PDRA 5AVFA 4PKYG 5TBMA 1P97A 3LUQA 3BY8A 4R38A 3MJQA 3LIFA 1S1ZA 4HJ3A 3H82A 3E4PA 4PKYA 1TS0A 4BBUA 5A8BA 1LSVA 5F69A 5I5LA 2JHEA 2PYRA 1UWPX 2WKRA 4L9EA 4EW7A 2VEAA 3BWLA 1XJ6A 3A0RA 3NJAA 2A24B 4GS9B 1LT0A 4GHIB 3MQOA 4LPZA
chains in the Genus database with same CATH superfamily
5CTMA 4B9OA 3NULA 3A0VA 5AQ9A 3NOTC 4UEYA 5CGXA 3S1YA 1GSXA 1NXYA 5G4YA 3P7NA 4O0PA 3S7OA 3G31A 1D06A 2ZC3B 4P6ZM 3N4IA 1LL5A 2H10A 3ITBA 3W2ZA 4DXCA 2WGWA 3AGEA 3FZCA 1S4RA 2V1BA 4ZRRA 4EBNA 1YQSA 1DJAA 5FQKA 3NC8A 3KYZA 4CLCE 2P7JA 4HQAA 3IBJA 3F1PB 3IXDA 1F2KA 1MZUA 5HPFA 2H28A 3MKFA 1L0EA 5L2FA 4QPRA 3K3CA 3KSFA 4IVKA 5CHJA 1I5QA 2XK1A 1CF0A 2B95A 2ZM8A 2V1ZA 4BWIA 1KDSA 4O01A 2EX2A 2YKFA 4KZ6A 4R6LA 4DDSA 3EQUA 4GB7A 4HP4A 5KSCA 1HZOA 1T1AA 3BEBA 4H8RA 4L9FA 3LGOA 4GZBA 4E3LA 1EW0A 1EI5A 4LV0A 4ZAMA 4S2LA 1ZG6A 2INWA 1LLBA 2ZOIA 2X71A 3VSLA 5E2FA 4E04A 2ZM0A 1OJGA 2V2FF 3V3RA 1DP6A 3CWFA 2J80A 3LI9A 5EM0A 2QHKA 4LV2A 1F9IA 1K4EA 2HP6A 4FTXA 1Z09A 3OPLA 1K56D 5D3OA 1DP9A 3ZNTA 1A0KA 5KSHA 5FQJA 2QWSA 5FI7A 1XFQA 3OC2A 3LIDA 2JN7A 3G6OA 1GSWA 1ES5A 1FSYA 3CPTA 1BT5A 1PWDA 2V9AA 3WS4A 5AQ7A 5GLDA 2IA2A 2O0YA 3ZG9B 3MXSA 3NDGA 2E8IA 1XA7A 2A24A 1S6RA 4JBFA 4KENB 3HLBA 3R7WA 2XD1A 2O9CA 1P9WA 1HD8A 4CLCA 3EGXC 3LIBA 3T12B 1W63Q 4MN5A 5EVID 3CLOA 3LIAA 4N9LA 1JVJA 3IF6A 1IKGA 3UB5P 2I9VA 1ZC2A 4I3IA 3UB7A 5FQ9A 2AVXA 2B02A 4R0QA 2OAQ1 4WBGA 3EQVA 3GV9A 1TD5A 4HOIA 1LL9A 2XA7M 4X56A 4PM5A 3ZNYA 2Q9MA 3UPOA 1PYYA 2WKQA 5FSRA 1V9ZA 4L9GA 3T4TA 4QHCA 3GVBA 2V20A 3LR4A 4HBUA 3Q1FA 3V67A 3VFFA 3P01A 4WZ5C 2X02A 1OTIA 3NBLA 3N7WA 4GW9A 4HESA 4IEDA 2HDRA 5HDSA 1KE0A 3T4OA 5F1FA 1NYYA 4UQIM 2JBFA 3LCEA 4MEZA 2K2NA 3DBAA 3OZHA 1JNUA 1BLCA 3UO9A 2VJWA 4JGOA 1L3LA 5CHMA 4YWZA 1HVBA 1NYMA 4OQGA 3N6IA 4BJPA 4EUZA 4S2NA 4Y13A 2J3WA 3VOLA 1JWVA 4WELA 1L2SA 1SZVA 1S4SA 2A3UA 4YFMA 2KDKA 4MBHA 4Q0IA 3JVUA 3VP1A 3F1NA 1G6OA 1KVLA 4NXFA 5HSQA 3LIEA 1DP8A 3KX0X 4JXSA 1ZG4A 1K6SA 3W4PA 1JWPA 3T4JA 4R23A 5CXWA 2KX6A 4ME4A 5E2HA 3BFDA 1PFLA 1VQQA 3WRTA 3GQZA 2WGWB 5FI6A 2OWJA 4BENA 5J8XA 1ERMA 5F1GA 5CRFA 1YPRA 4RQ9A 4Y15A 4EBLA 1LSXA 3UMEA 2GZAA 1I2SA 4DE1A 1K57C 2Y2NA 1YLPA 5DJUA 1Q2PA 3ITAA 5DF9A 1TDGA 1XFNA 2WKEA 1UWNX 3SZTA 4DJ2A 3LFVA 5E2GA 4JGQA 5EUAA 5TGFA 3C4OA 4FD8A 3F1PA 4LRZE 1W63M 1BUEA 4OKPA 4O8GA 4PM6A 3RTYA 1IYOA 1GSVA 3C8CA 3PR6A 4OPRA 4KZ7A 3GTCA 4OLDA 1GA9A 2HDSA 2HZ5A 3CZDA 2Y2HA 2W3GA 5EV0A 4R3AA 5MC7A 3HUNA 5GL9A 4I39A 1ONHA 2ZMFA 4N1HA 3IH8A 4IUKA 3N8LA 2JE5A 4MMNA 5DF8A 3DTKA 2FZ0A 4PKYG 4E3OA 3TOIA 1P97A 4ETXA 1K57A 4PM9A 1BLSA 3MJQA 1ESIA 3LIFA 4PMAA 5A90A 4HJ3A 1ZHHB 3NDEA 4PKYA 1K4FA 5A8BA 4GDBA 4RX3A 3S22A 2P08A 4GNUA 1LSVA 3DTMA 3WS5A 2JHEA 2PYRA 3CITA 2HDUA 3FV7A 1UWPX 1XP4A 3E2LA 3QP5A 4EW7A 2J9PA 4P6BA 4ZTKA 5EOEA 2XSSA 2A24B 4GS9B 1IYSA 4CLCB 1XGJA 4BL2A 2W1TB 3M6BA 2PU2A 1DJBA 1NWZA 1PIOA 3UY6A 1TS6A 4HIAA 1KGEA 1E4DA 1VETB 1XGIA 1CI8A 4RA7A 4G3WA 1YSQA 1OTEA 4ZBEA 5A93A 5HWWA 3IF6B 4S2PA 1WYBA 2W3HA 4LGWA 4QD4A 4ZDXA 5DKKA 1STZA 3M6HA 3O88A 3PAEA 4DE3A 1MC0A 1PZOA 4JXWA 1D1JA 2M1CA 5EVIA 3CAXA 4U3TA 3IH9A 4C6YA 2DCFA 1H8MA 5L07A 4D60A 3A3FA 3B33A 4Z1WA 3KYEA 4YOFA 1XXMA 2ZC5B 1T19A 4H6JA 3HLWA 4QY5A 4EERA 4XT2B 3LO7A 2OAP1 4G3VA 5L09A 4CQHA 4BL3A 3LI8A 3TRCA 2Q9NA 4GD8A 3IX3A 5I94A 4Q0JA 4QU3A 5DTSA 3O3VA 1QMFA 3E0YA 5BOHA 4OQHA 1JWZA 4XUZA 2Y8HA 3C7UA 1E3UA 1VB6A 3G34A 4GCZA 1MXOA 3HBRA 3A3EA 4P6ZS 2XFTA 2ZC6B 2PBYA 5HARA 5FAQA 5F6AA 2XF3A 3FPVA 3FWLA 5HAPA 2VV7A 1NZUA 1W8YA 4OPQA 4X6TA 2V0UA 3MS6A 4K91A 3EEAA 5M19A 3ZGAB 4Q0HA 4Y17A 2JKTI 3F1NB 2FFFB 1RGYA 1KE3A 3G35A 1WA9A 3JVVA 2W3FA 3HL9A 2HGVA 4ZJ2A 3UE1A 4E3IA 3NOUC 1XPBA 3RH8B 3MZDA 4Y0UA 3C2WA 2K7SA 4IBXA 1CEFA 1FILA 5G4ZA 1FQGA 3G4PA 3JPUA 4LCLA 3BLMA 2R9WA 2Y2PA 3S7PA 2D01A 2WZXA 3IHBA 1KGGA 3NHQA 1OMEA 3VE3A 2BLSA 2PD8A 4R3JA 2VA0A 1S1YA 3OCNA 3MZEA 1OT9A 2P04A 1MWUA 2PAVP 1YLJA 2CMNA 2G2WA 4PHTA 3IX8A 3QP8A 5FAPA 3UPPA 5E43A 1ACFA 1W79A 1S0WA 4DKIA 3H9WA 3MFXA 3E98A 2EFXA 2QJ5A 4WZ4A 3QP2A 1W8QA 5G18A 3PBRA 1YMXA 2ZLYA 4X53A 4OP8A 1ES4A 5CTNA 2E8JA 4JPMA 5F83A 2WK0A 2Y2LA 1WYCA 4HHDA 1BSGA 1OTDA 1ESUA 2QYBA 2V8FA 2Y59A 3ZVWA 4NEED 4BLMA 4BMWA 2XH9A 4UHUA 4D2OA 3BFGA 2QPNA 3G30A 4I3JA 2VGLM 3BJNA 3SH8A 2Z2LB 4OPZA 2LB5A 5LBRA 4OH0A 4FSFA 2O99A 3A3JA 2ZJ9A 2Y2JA 4CLCC 4ARZA 4DJ3A 4B4ZA 3G2YA 5EFWA 2JKTM 1FOFA 1N9OA 4MBKA 3C30A 3VOZA 1S67L 3IF6C 3PTEA 2XA7S 4FOFA 4G3KA 4MDZA 4WF0A 3SOIA 5J4EA 2WGIA 5EOOA 2R78A 5EVEA 4F3LB 3ZCZA 2PT7A 2Y55A 4M3KA 4MLLA 4KG5A 4M4XA 3PYPA 4IJGA 2V0WA 3V5MA 4PM7A 4DN0A 1K38A 4BQMA 4XXRA 5GHYA 5FDSA 2WKIA 3ZG8B 1JTGA 4GDNA 4EQ1A 4WYYA 3LICA 3LR0A 2VGJA 3QP4A 4PM8A 4IUHA 3CG5A 4GS9A 1IFQA 3G32A 4QJGA 1LHYA 2PYPA 3DWKA 2W1TA 2IWCA 3UDXA 4DDYA 2X01A 1G28A 1VETA 5K5BA 4U0TA 5EVIB 1MPLA 4KZ4A 1NRJA 4ESPA 2ZQAA 4HH2A 3ZHHA 2VV6A 5DVAA 3ZFZA 4IVIA 3UMDA 2ZL1B 3BQAA 5KMWA 1K54C 4H6JB 4S2NC 5CGWA 3IS2B 3OLOA 3HLDA 3HUMA 4EUVA 3T4QA 4X55A 5FATA 1KGFA 4MN6A 4NXBA 3VOYA 3MXQA 3MR0A 2XD5A 3UPNA 4NXGA 1BTLA 3IBRA 2M7VA 1OT6A 1TS7A 2QMIA 3WS0A 2PR5A 4KQOA 4XT2A 3TE8A 3F1OA 3CMZA 4LLOB 2V8CA 3ZG5A 4N9KA 3T50A 3G2ZA 4R1GA 4KZAA 4QWOA 2JCHA 1ZTUA 4NK3A 3ZYTA 3K3DA 4KZ3A 2XQZA 5AVEA 2J3TD 5M18A 3MKEA 2H0YA 1SDEA 1S66L 1RP5A 3HLFA 4HH3A 2PD7A 3FG8A 2PDRA 5AVFA 5CX7A 1K54A 1O7EA 2HDQA 3BY8A 5HL6A 3VV4A 3P09A 2A49A 3Q81A 1H5XA 1CI9A 3OOVA 2WAEA 4OPYA 4BBUA 5HPIA 1SKFA 4OLGA 5F69A 1VHMA 1MY8A 3GSGA 3IXBA 2JKGA 2Y2GA 3RXWA 4L9EA 3P98A 5FDHA 2FFYA 4F94A 5C5KA 5EECA 4GD6A 4E6XA 1IELA 2G2UA 1LT0A 2IWDA 2ZQ8A 1FSWA 1G5UA 5JYPA 1BLHA 1QMEA 1WE4A 2PU4A 3BRMA 4LRXC 4B88A 2OLVA 2UV0E 4WEKA 1SHVA 4WMCD 1CEGA 3SS3A 3UNWA 3HUOA 1P0ZA 3BW6A 4JGPA 3QNCA 1NRFA 5FI2A 5GLAA 3UB8A 3QP6A 2QKPA 3Q7VB 2ACGA 1ALQA 2EX6A 2EXAA 3IWQA 5FQIA 5DFYA 1MBLA 4JXGA 3C38A 3BLSA 4RX2A 3A3DA 3T4LA 3D4FA 4S2IA 4YNRA 4KUKA 3V50A 1KVMA 3CUEC 2GJ3A 4E3JA 1Y28A 3SS5A 1PZPA 4AFIA 1DRMA 2Y2KA 2OWHA 3A0SA 5HW3A 2QJ7A 2WYXA 1EROA 4IHQA 3PHYA 4ARZB 4OVDA 5EM1A 1H8ZA 3ICYA 4K0WA 1YLYA 4JKTA 3FC7A 4CPKA 4HJ4A 5TBMB 2W1RA 5HZHA 1LSWA 3PAGA 1CK3A 4LENA 1KOUA 4DRTA 3HLCA 4WN5A 3UB6A 1HLUP 1TEMA 4LV1A 3HJKA 4P87A 3T1SA 1ONGA 5EVIC 4OOMA 3VP3A 1XX2A 4R3BA 3ZG0A 5KIZA 2Y2QA 1Q2QA 3FKWA 1YMSA 4QY6A 2UWXA 1AXBA 4F3LA 1VEUB 2EFUA 2B5RA 3KSHA 1K56A 1NLZA 3CUEA 4B4XA 4ID4A 3O5YA 1JTDA 3BY9A 4ZJ1A 3BYDA 3HLEA 4JGRA 3ZG7B 1YT4A 4Y2FA 2ZQDA 1X0OA 2DMWA 2H5SA 4BBTA 4X1LA 3HREA 3VSKA 3ZVTA 3BQ8A 4WL9A 4EESA 2VZWA 4HBTA 5DJTA 3DTEA 5FEGA 2WGVA 2OV5A 2EA9A 2Z6DA 4S2MA 3UB9A 1V9YA 1Z6FA 3N8SA 2ZL1A 2XFSA 1N9LA 3VE4A 2WKPA 3IS2A 4U0XA 2P9VA 3F1OB 1NZOA 3W8KA 4UAAA 3EOIA 2XGNA 1OTAA 1SKOB 1VM1A 5DTKA 3LEQA 4WUJA 3Q07A 3LR3A 1U60A 1G68A 1M40A 1PI4A 1YM1A 2EX9A 2C5WB 4KQQA 2JC7A 3C7VA 4HI4A 3GECA 3V39A 4MNRA 2ZQ9A 2L1MA 4K08A 4I38A 2DNSA 4E6WA 1K25A 4OP5A 4R70A 1AWIA 1SDNA 3IXGA 1W7FA 4Y0TA 2YKHA 3HJIA 2BTFP 4Y3IA 1GA0A 2XRNA 1Y54A 2Y2MA 3O87A 1FR6A 4Q8IA 1FR1A 2OLUA 2IWBA 4LV3A 1XJ2A 3T4KA 1PRQA 3Q82A 4HP9A 1YKDA 3RFBA 1FCOA 3UDFA 3MMHA 1TVFA 4PPRA 3Q7ZA 5GLBA 4HNBA 4MN7A 5IHVA 2W0NA 5HDCA 4I5SA 4GLQA 1M6KA 2Z6CA 4WEJA 2OOLA 4C3QA 4KUOA 3RXXA 4KG6A 3H7WA 4X25A 3HVFA 3LR5A 2VV8A 5FL3A 4HEFA 3S7NA 2J7VA 1RCJA 1BLPA 5KZHA 4UA9A 4LRYC 3S7QA 3IX4A 2BASA 4DE2A 5FAOA 2GDNA 5HX9A 4E3NA 3DWZA 3WWXA 5J3WA 5AQBA 3PBTA 4BBVA 3W4QA 3E4OA 4WMCA 4KZ9A 5CEBA 4KG2A 2Y2OA 2G7UA 3D9YA 3HLGA 2W27A 4C75A 3UDIA 3BFEA 2C6WB 2ZM2A 3Q7VA 2V1AA 4NG2A 2ZD8A 2I72A 3M2JA 1IYQA 2ZC4B 2FH5A 1LI9A 5HFOA 1IEMA 2EWWA 2XDMA 4BD1A 4P0MA 4FH2A 5F5YA 2XLNA 5TFQA 1T1CA 1ZKJA 1FIKA 4JF5A 1BZAA 1O07A 4S2JA 4E3KA 3JYIA 4DE0A 4RYEA 2W3DA 3NECA 3TW8A 4EU0A 2VLGA 1MWSA 3B3XA 2VK3A 3PBOA 2OSUA 4LCMA 5TBMA 3LUQA 4FUWA 4A5RA 4R38A 1GCEA 4X1MA 2ZQCA 2KOIA 1YSPA 3OPHA 1OPXA 4FCFA 3UE0A 3E4PA 3MSHA 3OPPA 4L0LA 2R9XA 2WADA 2A2LA 1TS0A 5E2EA 3QNBA 3MZFA 5I5LA 3VMAA 3T1RA 3IHAA 2ZMAA 2MJ6A 2RL3A 2Y4AA 3UN7A 1VEUA 2VEAA 3T1XA 3DW0A 2HJ9C 1K55C 3PBSA 4CJNA 1PNEA 3A0RA 4IBRA 1TF1A 2Z2MB 2W3EA 4UQIS 3KYQA 2O9AA 3PBNA 3DTIA 3LY4A 3OCLA 4GN2A 4GHIB 3FKVA 1MWRA 4KZBA 3WRZA 4R4RA 3T4SA 2ZQ7A 3PBQA 2XR0A 2VX8A 3AGFA 3L7HA 5GHZA 1I2WA 5IU1A 5L8MA 4OQ0A 2ZMVA 1IYPA 3MF0A 3C5AA 4KQRA 5CHUA 5AQAA 3NI9A 2EWVA 1E25A 4EQIA 3CJMA 4I3AA 3BFFA 2WUQA 1F5MA 2P9VB 5FEFA 1F98A 3VP2A 2HF6A 4JF4A 3DAVA 5CGSA 2Q0OA 2VKSA 3MFDA 3MBZA 4FH4A 3IWIA 1XKZA 5TJJA 3C4PA 4YINA 1GHPA 1K55A 1SCWA 2EXBA 2LB9A 2B18A 2JKRI 3MXRA 5EE8A 1FCMA 1SKOA 5A91A 5GLCA 4N92A 4DMZA 1RGZA 3SH7A 2JKFA 5HD3A 4ZJ3A 4EWFA 2CC1A 3ISGA 1IOUA 3FPWA 3T1QB 3NOPC 1TS8A 1E3UD 5HAQA 1YLZA 1PW1A 2J8YA 1H0MA 1L0FA 2ZOHA 4WM9A 4X68A 2HP9A 2HPBA 3H82B 3VP0A 3KSGA 2Y2IA 1H8YA 5IS1A 1T18A 5HWVA 1XJ4A 5HD5A 2Y91A 3EWKA 2ZC7A 2NUTC 1EWZA 5FASA 1CJFA 1J3WA 3AGDA 1C3BA 3H7WB 3NIAA 3W4OA 4KZ8A 3LYXA 3D72A 3E2KA 4EXOA 3D3OA 4EETB 3UE6A 1N9BA 2WZZA 1YAXA 1MWTA 3GR2A 4WZ5A 3CHWP 4S2OA 4OQIA 4B93A 5CERA 3FYZA 5A92A 3BFCA 5M1AA 4Y0OA 2NUPC 4RVAA 3GRJA 1H3QA 4GKUA 3BM6A 2RCXA 1LI0A 3E4QA 3NY4A 3NCKA 2XEPA 5DKLA 1DY6A 1YLTA 3EGDC 4E3MA 3IWOA 3S4XA 4EBPA 1ES2A 1HTZA 1PI5A 2KLIA 3ZQ5A 2JKRM 2O9BA 4WLAA 4DXBA 4UA6A 4KQDA 3EEHA 1T1BA 2K31A 2XROA 2J9OA 1ODVA 3L9KA 1MKMA 1N4OA 4NETA 5HWTA 4Y5FA 1G6AA 4LFUA 5JYOA 5F82A 3MQ0A 4GJ4A 4KZ5A 3UE3A 3IT9A 5CECA 1L0GA 4Y7PA 5FA7A 2Y79A 2EX8A 4EV4A 2HV1A 3SH9A 2D02A 3ULFA 4OOLA 1D7EA 1FCNA 4JLFA 5EVLA 4MCWA 2H0TA 3TG9A 1YLWA 5DFXA 3R4KA 1K0KA 1NY0A 5DTTA 2BG1A 1PWGA 5HDDA 3M2KA 1XJ3A 5L10A 4OONA 2DRWA 4EEPA 3CI6A 4JF6A 1P9RA 3BECA 1GHIA 1K6RA 2PHYA 3I7JA 3WS1A 5EPHA 2P74A 2PR6A 4NXEA 5CEDA 5HL1A 4XUXA 3U2AA 4MBFA 3CPTB 1NLYA 3MQQA 3IXHA 2VGKA 4UA7A 2GNXA 4HJ6A 1XA1A 5GHXA 1UGUA 4GHIA 2L4RA 4CLCD 3R7WB 2M7UA 1Y4OA 3V3SA 4GOGA 2QZ6A 2HJEA 4PAUA 4OOYA 5AJGA 3TSGA 2J3TC 3IF5A 1PWCA 1GHMA 4DF6A 5F68A 3O86A 4N1XA 4HY8A 3PXPA 1N9NA 4X69A 2PBDP 1OJ5A 1OTBA 3GDIA 1BYWA 3QP1A 5U47A 5J7EA 3TJZC 4EEUA 5TR7A 2WKHA 4BD0A 1DJCA 2L0WA 1L0DA 3VFHA 5DF7A 1LL8A 1J9MA 4II7A 3OBFA 4ETZA 1TDLA 3ZDJA 2ZBBA 5HAIA 4Z9QA 3WS2A 3SW1A 3K2NA 3QHYA 1IKIA 2PRFA 3RJUA 3LEZA 3OPRA 1CQAA 1S1ZA 1KDWA 1ES3A 3KO6A 1BULA 3B42A 3H82A 4R4SA 2WAFA 5IT5A 4JXVA 3IQAA 1PW8A 3U4LP 4O7DA 5FQQA 5FQMA 4QB8A 2HP5A 1NJ4A 3SS4A 3LY3A 2VGLS 4NKPA 3N8RA 2WKRA 1MKIA 2GX5A 3BWLA 4P85A 3VP4A 4S2KA 1XJ6A 3A3IA 3KSIA 3NJAA 3B47A 1KE4A 1W5DA 4K0XA 3MQOA 1ERQA 3GMWA 3HCYA 4LPZA
chains in the Genus database with same CATH topology
2W1TB 3PBQA 2VX8A 1NWZA 4B9OA 1TS6A 4HIAA 3A0VA 4LRXC 4G3WA 1YSQA 1OTEA 3NOTC 4UEYA 5HWWA 1GSXA 5G4YA 3P7NA 4WEKA 4O0PA 5IU1A 3S7OA 5L8MA 2ZMVA 1D06A 3MF0A 2W3HA 4P6ZM 5DKKA 1STZA 3W2ZA 1P0ZA 3BW6A 1MC0A 4JGPA 2EWVA 4I3AA 2M1CA 3CAXA 1F5MA 1S4RA 2V1BA 4ZRRA 1F98A 2HF6A 3UB8A 1H8MA 2QKPA 2VKSA 3B33A 4Z1WA 3KYZA 5DFYA 2P7JA 4HQAA 3IBJA 3F1PB 4CLCE 5TJJA 4YOFA 1T19A 4H6JA 1MZUA 5HPFA 2LB9A 3C38A 2B18A 2H28A 2JKRI 4EERA 4XT2B 4QPRA 3T4LA 3K3CA 3KSFA 2OAP1 4G3VA 4CQHA 4YNRA 3LI8A 4KUKA 3TRCA 3CUEC 4DMZA 2GJ3A 1Y28A 4AFIA 4Q0JA 4BWIA 1DRMA 4O01A 2YKFA 3E0YA 2OWHA 5HD3A 3A0SA 2QJ7A 4R6LA 3EQUA 1IOUA 3FPWA 4IHQA 3PHYA 4HP4A 3NOPC 2Y8HA 4ARZB 1TS8A 1T1AA 3ICYA 1VB6A 4GCZA 4L9FA 4P6ZS 3FC7A 1EW0A 4HJ4A 5TBMB 2W1RA 5HZHA 5F6AA 2INWA 1LSWA 2ZOHA 2ZOIA 3FPVA 1KOUA 2VV7A 4WN5A 3UB6A 3HJKA 3H82B 4E04A 2V0UA 3KSGA 3EEAA 5IS1A 1T18A 4OOMA 1OJGA 5HWVA 4Q0HA 1XJ4A 5HD5A 1DP6A 2JKTI 3CWFA 2J80A 5KIZA 3F1NB 3EWKA 3LI9A 2NUTC 2QHKA 1WA9A 1F9IA 3JVVA 2W3FA 4F3LA 3H7WB 2HGVA 3LYXA 3KSHA 1DP9A 1NLZA 3NOUC 3CUEA 5KSHA 3O5YA 3RH8B 3D72A 2QWSA 3BY9A 1XFQA 3OC2A 3LIDA 2JN7A 3C2WA 3G6OA 4EXOA 2K7SA 3D3OA 4EETB 1GSWA 3UE6A 1YAXA 5G4ZA 4JGRA 2V9AA 4Y2FA 3S7PA 2D01A 2IA2A 4B93A 2O0YA 1X0OA 2DMWA 3NHQA 2NUPC 3VE3A 2A24A 2PD8A 4BBTA 2VA0A 1S1YA 1H3QA 3OCNA 3BQ8A 3R7WA 2O9CA 1P9WA 1OT9A 2P04A 4CLCA 3EGXC 4WL9A 4EESA 2VZWA 2CMNA 3LIBA 4PHTA 1W63Q 5DJTA 3E4QA 4MN5A 3CLOA 3LIAA 2EA9A 5DKLA 2Z6DA 3UB9A 1V9YA 2I9VA 3EGDC 4I3IA 3UB7A 3H9WA 3MFXA 2B02A 2OAQ1 3E98A 2QJ5A 3EQVA 1N9LA 2KLIA 3VE4A 3ZQ5A 1TD5A 4HOIA 2JKRM 2O9BA 3PBRA 4WLAA 2WKPA 2XA7M 4KQDA 3EEHA 3IS2A 1T1BA 2K31A 3F1OB 2XROA 2WKQA 1ODVA 1MKMA 1V9ZA 3EOIA 4HHDA 1OTAA 4L9GA 3T4TA 1OTDA 5HWTA 2QYBA 4Y5FA 4WUJA 3LR4A 3LR3A 3MQ0A 4NEED 4GJ4A 4BMWA 3UE3A 3V67A 3P01A 4I3JA 2VGLM 3BJNA 4HI4A 3GECA 2Y79A 1OTIA 4GW9A 2HV1A 5HDSA 2LB5A 5LBRA 2L1MA 2D02A 3T4OA 4K08A 3ULFA 4OOLA 4FSFA 4UQIM 1D7EA 4I38A 2O99A 4MCWA 4R70A 2K2NA 3DBAA 5DFXA 3R4KA 1JNUA 4CLCC 2YKHA 3HJIA 4ARZA 4DJ3A 5HDDA 2VJWA 1XJ3A 4JGOA 4Y3IA 5EFWA 2XRNA 2JKTM 1N9OA 4YWZA 3C30A 1S67L 4BJPA 4EEPA 3CI6A 1XJ2A 2XA7S 3T4KA 4FOFA 4G3KA 4MDZA 4HP9A 1P9RA 4WF0A 1YKDA 5J4EA 2J3WA 2R78A 3RFBA 3VOLA 4WELA 2PHYA 1S4SA 4F3LB 3MMHA 2PT7A 2KDKA 4M4XA 2PR6A 3PYPA 4IJGA 4Q0IA 2V0WA 3JVUA 4HNBA 4MN7A 4NXEA 3F1NA 1G6OA 4DN0A 2W0NA 4NXFA 5HDCA 3U2AA 4I5SA 4GLQA 2Z6CA 5HSQA 4WEJA 2OOLA 3LIEA 4KUOA 1NLYA 1DP8A 3KX0X 4EQ1A 3H7WA 3MQQA 3LR5A 3LICA 3LR0A 2VV8A 3T4JA 2KX6A 2GNXA 4ME4A 4IUHA 4HJ6A 4GS9A 5FL3A 1IFQA 3S7NA 1UGUA 4GHIA 2PYPA 2L4RA 4LRYC 3S7QA 4CLCD 3R7WB 2M7UA 2W1TA 2BASA 2OWJA 1G28A 2HJEA 5K5BA 4PAUA 5AJGA 2J3TC 1NRJA 5J3WA 4HH2A 3PBTA 4BBVA 2VV6A 3E4OA 3UMDA 3BQAA 5F68A 4RQ9A 1LSXA 3UMEA 2GZAA 4H6JB 2G7UA 3IS2B 3OLOA 5DJUA 2W27A 5DF9A 4EUVA 1XFNA 1UWNX 4HY8A 3T4QA 4DJ2A 3PXPA 1N9NA 3LFVA 4JGQA 2V1AA 4MN6A 4NXBA 3MXQA 3F1PA 3MR0A 4LRZE 1W63M 1OJ5A 1OTBA 2FH5A 4O8GA 3GDIA 4NXGA 3IBRA 1BYWA 2M7VA 1OT6A 1TS7A 2EWWA 3RTYA 5J7EA 2PR5A 1GSVA 4KQOA 4XT2A 3TE8A 3C8CA 5F5YA 3F1OA 3TJZC 4EEUA 4LLOB 3PR6A 1T1CA 2L0WA 1LL8A 4II7A 3T50A 3OBFA 4ETZA 2W3GA 4R3AA 5MC7A 2ZBBA 1ZTUA 3ZYTA 3K3DA 2W3DA 4I39A 2ZMFA 5AVEA 2J3TD 3TW8A 4EU0A 3SW1A 3K2NA 4IUKA 2VLGA 1S66L 4MMNA 4HH3A 2PD7A 3FG8A 2PDRA 5AVFA 5CX7A 3PBOA 2FZ0A 4PKYG 5TBMA 1P97A 3LUQA 4ETXA 3BY8A 4R38A 5HL6A 3MJQA 3VV4A 3LIFA 1S1ZA 3KO6A 2KOIA 1YSPA 1OPXA 4HJ3A 3B42A 3H82A 3E4PA 4L0LA 1ZHHB 5IT5A 3OOVA 2A2LA 4PKYA 1TS0A 4BBUA 5A8BA 5HPIA 2P08A 1LSVA 5F69A 1VHMA 5I5LA 2JHEA 2PYRA 3CITA 2MJ6A 2VGLS 4NKPA 1UWPX 2WKRA 4L9EA 4EW7A 2VEAA 2GX5A 2HJ9C 3BWLA 3PBSA 1XJ6A 3KSIA 2XSSA 3A0RA 3NJAA 5C5KA 3B47A 1TF1A 2W3EA 4UQIS 2A24B 4GS9B 3KYQA 1LT0A 2O9AA 3PBNA 3OCLA 4GHIB 3MQOA 4CLCB 3HCYA 3T4SA 4LPZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NWZ A;  4B9O A;  1TS6 A;  4HIA A;  3A0V A;  4LRX C;  1OTE A;  3NOT C;  5HWW A;  1GSX A;  5G4Y A;  3P7N A;  5IU1 A;  1D06 A;  5DKK A;  1P0Z A;  4JGP A;  4I3A A;  2M1C A;  3CAX A;  1S4R A;  2V1B A;  1F98 A;  3UB8 A;  2QKP A;  3B33 A;  2P7J A;  4HQA A;  3F1P B;  1T19 A;  4H6J A;  1MZU A;  2H28 A;  4EER A;  4XT2 B;  3K3C A;  3LI8 A;  4KUK A;  2GJ3 A;  1Y28 A;  1DRM A;  2YKF A;  5HD3 A;  2OWH A;  3A0S A;  2QJ7 A;  4R6L A;  3PHY A;  4HP4 A;  3NOP C;  1TS8 A;  1T1A A;  3ICY A;  1VB6 A;  4GCZ A;  4L9F A;  3FC7 A;  1EW0 A;  4HJ4 A;  5TBM B;  5HZH A;  5F6A A;  2INW A;  1LSW A;  2ZOH A;  2ZOI A;  1KOU A;  2VV7 A;  4WN5 A;  3UB6 A;  3HJK A;  3H82 B;  4E04 A;  2V0U A;  5IS1 A;  1T18 A;  1OJG A;  5HWV A;  1XJ4 A;  5HD5 A;  1DP6 A;  3CWF A;  5KIZ A;  2J80 A;  3F1N B;  3EWK A;  3LI9 A;  2QHK A;  1WA9 A;  1F9I A;  4F3L A;  3H7W B;  3LYX A;  1DP9 A;  3NOU C;  3RH8 B;  3D72 A;  2QWS A;  3BY9 A;  1XFQ A;  3LID A;  2JN7 A;  3C2W A;  3G6O A;  4EXO A;  2K7S A;  4EET B;  1GSW A;  3UE6 A;  5G4Z A;  4JGR A;  2V9A A;  2D01 A;  1X0O A;  3NHQ A;  3VE3 A;  2A24 A;  2PD8 A;  4BBT A;  1S1Y A;  1OT9 A;  4WL9 A;  4EES A;  3LIB A;  2CMN A;  5DJT A;  3E4Q A;  4MN5 A;  3CLO A;  3LIA A;  2EA9 A;  5DKL A;  2Z6D A;  3UB9 A;  1V9Y A;  2I9V A;  4I3I A;  3UB7 A;  3H9W A;  3MFX A;  2B02 A;  2QJ5 A;  1N9L A;  3VE4 A;  3ZQ5 A;  4HOI A;  4WLA A;  2WKP A;  4KQD A;  3EEH A;  3IS2 A;  1T1B A;  3F1O B;  2WKQ A;  1ODV A;  1V9Z A;  4HHD A;  1OTA A;  4L9G A;  1OTD A;  5HWT A;  4WUJ A;  4I3J A;  4HI4 A;  3GEC A;  1OTI A;  4GW9 A;  2HV1 A;  5HDS A;  2L1M A;  2D02 A;  3ULF A;  4K08 A;  1D7E A;  4I38 A;  4R70 A;  1JNU A;  2YKH A;  3HJI A;  4DJ3 A;  5HDD A;  1XJ3 A;  4JGO A;  5EFW A;  1N9O A;  4YWZ A;  1S67 L;  4EEP A;  1XJ2 A;  4HP9 A;  4WF0 A;  5J4E A;  3VOL A;  2R78 A;  2PHY A;  1S4S A;  4F3L B;  2KDK A;  4M4X A;  2PR6 A;  3PYP A;  2V0W A;  4HNB A;  4NXE A;  3F1N A;  2W0N A;  4NXF A;  5HDC A;  4I5S A;  2Z6C A;  5HSQ A;  2OOL A;  3LIE A;  4KUO A;  1DP8 A;  3KX0 X;  4EQ1 A;  3H7W A;  3MQQ A;  3LIC A;  2VV8 A;  2KX6 A;  4HJ6 A;  4GS9 A;  1UGU A;  4GHI A;  2PYP A;  2L4R A;  4LRY C;  2BAS A;  2OWJ A;  1G28 A;  5J3W A;  4HH2 A;  4BBV A;  2VV6 A;  3E4O A;  3UMD A;  5F68 A;  4RQ9 A;  1LSX A;  3UME A;  4H6J B;  3IS2 B;  3OLO A;  5DJU A;  2W27 A;  1XFN A;  1UWN X;  4HY8 A;  4DJ2 A;  1N9N A;  4JGQ A;  2V1A A;  4MN6 A;  4NXB A;  3MXQ A;  3F1P A;  3MR0 A;  4LRZ E;  1OJ5 A;  1OTB A;  3GDI A;  4NXG A;  3IBR A;  1BYW A;  1OT6 A;  1TS7 A;  3RTY A;  5J7E A;  2PR5 A;  1GSV A;  4XT2 A;  3C8C A;  5F5Y A;  3F1O A;  4EEU A;  4LLO B;  1T1C A;  2L0W A;  1LL8 A;  3T50 A;  4R3A A;  2ZBB A;  3K3D A;  4I39 A;  5AVE A;  3SW1 A;  2VLG A;  1S66 L;  4HH3 A;  2PD7 A;  3FG8 A;  2PDR A;  5AVF A;  4PKY G;  5TBM A;  1P97 A;  3LUQ A;  3BY8 A;  4R38 A;  3MJQ A;  3LIF A;  1S1Z A;  4HJ3 A;  3H82 A;  3E4P A;  4PKY A;  1TS0 A;  4BBU A;  5A8B A;  1LSV A;  5F69 A;  5I5L A;  2JHE A;  2PYR A;  1UWP X;  2WKR A;  4L9E A;  4EW7 A;  2VEA A;  3BWL A;  1XJ6 A;  3A0R A;  3NJA A;  2A24 B;  4GS9 B;  1LT0 A;  4GHI B;  3MQO A;  4LPZ A; 
#chains in the Genus database with same CATH topology
 5CTM A;  4B9O A;  3NUL A;  3A0V A;  5AQ9 A;  3NOT C;  4UEY A;  5CGX A;  3S1Y A;  1GSX A;  1NXY A;  5G4Y A;  3P7N A;  4O0P A;  3S7O A;  3G31 A;  1D06 A;  2ZC3 B;  4P6Z M;  3N4I A;  1LL5 A;  2H10 A;  3ITB A;  3W2Z A;  4DXC A;  2WGW A;  3AGE A;  3FZC A;  1S4R A;  2V1B A;  4ZRR A;  4EBN A;  1YQS A;  1DJA A;  5FQK A;  3NC8 A;  3KYZ A;  4CLC E;  2P7J A;  4HQA A;  3IBJ A;  3F1P B;  3IXD A;  1F2K A;  1MZU A;  5HPF A;  2H28 A;  3MKF A;  1L0E A;  5L2F A;  4QPR A;  3K3C A;  3KSF A;  4IVK A;  5CHJ A;  1I5Q A;  2XK1 A;  1CF0 A;  2B95 A;  2ZM8 A;  2V1Z A;  4BWI A;  1KDS A;  4O01 A;  2EX2 A;  2YKF A;  4KZ6 A;  4R6L A;  4DDS A;  3EQU A;  4GB7 A;  4HP4 A;  5KSC A;  1HZO A;  1T1A A;  3BEB A;  4H8R A;  4L9F A;  3LGO A;  4GZB A;  4E3L A;  1EW0 A;  1EI5 A;  4LV0 A;  4ZAM A;  4S2L A;  1ZG6 A;  2INW A;  1LLB A;  2ZOI A;  2X71 A;  3VSL A;  5E2F A;  4E04 A;  2ZM0 A;  1OJG A;  2V2F F;  3V3R A;  1DP6 A;  3CWF A;  2J80 A;  3LI9 A;  5EM0 A;  2QHK A;  4LV2 A;  1F9I A;  1K4E A;  2HP6 A;  4FTX A;  1Z09 A;  3OPL A;  1K56 D;  5D3O A;  1DP9 A;  3ZNT A;  1A0K A;  5KSH A;  5FQJ A;  2QWS A;  5FI7 A;  1XFQ A;  3OC2 A;  3LID A;  2JN7 A;  3G6O A;  1GSW A;  1ES5 A;  1FSY A;  3CPT A;  1BT5 A;  1PWD A;  2V9A A;  3WS4 A;  5AQ7 A;  5GLD A;  2IA2 A;  2O0Y A;  3ZG9 B;  3MXS A;  3NDG A;  2E8I A;  1XA7 A;  2A24 A;  1S6R A;  4JBF A;  4KEN B;  3HLB A;  3R7W A;  2XD1 A;  2O9C A;  1P9W A;  1HD8 A;  4CLC A;  3EGX C;  3LIB A;  3T12 B;  1W63 Q;  4MN5 A;  5EVI D;  3CLO A;  3LIA A;  4N9L A;  1JVJ A;  3IF6 A;  1IKG A;  3UB5 P;  2I9V A;  1ZC2 A;  4I3I A;  3UB7 A;  5FQ9 A;  2AVX A;  2B02 A;  4R0Q A;  2OAQ 1;  4WBG A;  3EQV A;  3GV9 A;  1TD5 A;  4HOI A;  1LL9 A;  2XA7 M;  4X56 A;  4PM5 A;  3ZNY A;  2Q9M A;  3UPO A;  1PYY A;  2WKQ A;  5FSR A;  1V9Z A;  4L9G A;  3T4T A;  4QHC A;  3GVB A;  2V20 A;  3LR4 A;  4HBU A;  3Q1F A;  3V67 A;  3VFF A;  3P01 A;  4WZ5 C;  2X02 A;  1OTI A;  3NBL A;  3N7W A;  4GW9 A;  4HES A;  4IED A;  2HDR A;  5HDS A;  1KE0 A;  3T4O A;  5F1F A;  1NYY A;  4UQI M;  2JBF A;  3LCE A;  4MEZ A;  2K2N A;  3DBA A;  3OZH A;  1JNU A;  1BLC A;  3UO9 A;  2VJW A;  4JGO A;  1L3L A;  5CHM A;  4YWZ A;  1HVB A;  1NYM A;  4OQG A;  3N6I A;  4BJP A;  4EUZ A;  4S2N A;  4Y13 A;  2J3W A;  3VOL A;  1JWV A;  4WEL A;  1L2S A;  1SZV A;  1S4S A;  2A3U A;  4YFM A;  2KDK A;  4MBH A;  4Q0I A;  3JVU A;  3VP1 A;  3F1N A;  1G6O A;  1KVL A;  4NXF A;  5HSQ A;  3LIE A;  1DP8 A;  3KX0 X;  4JXS A;  1ZG4 A;  1K6S A;  3W4P A;  1JWP A;  3T4J A;  4R23 A;  5CXW A;  2KX6 A;  4ME4 A;  5E2H A;  3BFD A;  1PFL A;  1VQQ A;  3WRT A;  3GQZ A;  2WGW B;  5FI6 A;  2OWJ A;  4BEN A;  5J8X A;  1ERM A;  5F1G A;  5CRF A;  1YPR A;  4RQ9 A;  4Y15 A;  4EBL A;  1LSX A;  3UME A;  2GZA A;  1I2S A;  4DE1 A;  1K57 C;  2Y2N A;  1YLP A;  5DJU A;  1Q2P A;  3ITA A;  5DF9 A;  1TDG A;  1XFN A;  2WKE A;  1UWN X;  3SZT A;  4DJ2 A;  3LFV A;  5E2G A;  4JGQ A;  5EUA A;  5TGF A;  3C4O A;  4FD8 A;  3F1P A;  4LRZ E;  1W63 M;  1BUE A;  4OKP A;  4O8G A;  4PM6 A;  3RTY A;  1IYO A;  1GSV A;  3C8C A;  3PR6 A;  4OPR A;  4KZ7 A;  3GTC A;  4OLD A;  1GA9 A;  2HDS A;  2HZ5 A;  3CZD A;  2Y2H A;  2W3G A;  5EV0 A;  4R3A A;  5MC7 A;  3HUN A;  5GL9 A;  4I39 A;  1ONH A;  2ZMF A;  4N1H A;  3IH8 A;  4IUK A;  3N8L A;  2JE5 A;  4MMN A;  5DF8 A;  3DTK A;  2FZ0 A;  4PKY G;  4E3O A;  3TOI A;  1P97 A;  4ETX A;  1K57 A;  4PM9 A;  1BLS A;  3MJQ A;  1ESI A;  3LIF A;  4PMA A;  5A90 A;  4HJ3 A;  1ZHH B;  3NDE A;  4PKY A;  1K4F A;  5A8B A;  4GDB A;  4RX3 A;  3S22 A;  2P08 A;  4GNU A;  1LSV A;  3DTM A;  3WS5 A;  2JHE A;  2PYR A;  3CIT A;  2HDU A;  3FV7 A;  1UWP X;  1XP4 A;  3E2L A;  3QP5 A;  4EW7 A;  2J9P A;  4P6B A;  4ZTK A;  5EOE A;  2XSS A;  2A24 B;  4GS9 B;  1IYS A;  4CLC B;  1XGJ A;  4BL2 A;  2W1T B;  3M6B A;  2PU2 A;  1DJB A;  1NWZ A;  1PIO A;  3UY6 A;  1TS6 A;  4HIA A;  1KGE A;  1E4D A;  1VET B;  1XGI A;  1CI8 A;  4RA7 A;  4G3W A;  1YSQ A;  1OTE A;  4ZBE A;  5A93 A;  5HWW A;  3IF6 B;  4S2P A;  1WYB A;  2W3H A;  4LGW A;  4QD4 A;  4ZDX A;  5DKK A;  1STZ A;  3M6H A;  3O88 A;  3PAE A;  4DE3 A;  1MC0 A;  1PZO A;  4JXW A;  1D1J A;  2M1C A;  5EVI A;  3CAX A;  4U3T A;  3IH9 A;  4C6Y A;  2DCF A;  1H8M A;  5L07 A;  4D60 A;  3A3F A;  3B33 A;  4Z1W A;  3KYE A;  4YOF A;  1XXM A;  2ZC5 B;  1T19 A;  4H6J A;  3HLW A;  4QY5 A;  4EER A;  4XT2 B;  3LO7 A;  2OAP 1;  4G3V A;  5L09 A;  4CQH A;  4BL3 A;  3LI8 A;  3TRC A;  2Q9N A;  4GD8 A;  3IX3 A;  5I94 A;  4Q0J A;  4QU3 A;  5DTS A;  3O3V A;  1QMF A;  3E0Y A;  5BOH A;  4OQH A;  1JWZ A;  4XUZ A;  2Y8H A;  3C7U A;  1E3U A;  1VB6 A;  3G34 A;  4GCZ A;  1MXO A;  3HBR A;  3A3E A;  4P6Z S;  2XFT A;  2ZC6 B;  2PBY A;  5HAR A;  5FAQ A;  5F6A A;  2XF3 A;  3FPV A;  3FWL A;  5HAP A;  2VV7 A;  1NZU A;  1W8Y A;  4OPQ A;  4X6T A;  2V0U A;  3MS6 A;  4K91 A;  3EEA A;  5M19 A;  3ZGA B;  4Q0H A;  4Y17 A;  2JKT I;  3F1N B;  2FFF B;  1RGY A;  1KE3 A;  3G35 A;  1WA9 A;  3JVV A;  2W3F A;  3HL9 A;  2HGV A;  4ZJ2 A;  3UE1 A;  4E3I A;  3NOU C;  1XPB A;  3RH8 B;  3MZD A;  4Y0U A;  3C2W A;  2K7S A;  4IBX A;  1CEF A;  1FIL A;  5G4Z A;  1FQG A;  3G4P A;  3JPU A;  4LCL A;  3BLM A;  2R9W A;  2Y2P A;  3S7P A;  2D01 A;  2WZX A;  3IHB A;  1KGG A;  3NHQ A;  1OME A;  3VE3 A;  2BLS A;  2PD8 A;  4R3J A;  2VA0 A;  1S1Y A;  3OCN A;  3MZE A;  1OT9 A;  2P04 A;  1MWU A;  2PAV P;  1YLJ A;  2CMN A;  2G2W A;  4PHT A;  3IX8 A;  3QP8 A;  5FAP A;  3UPP A;  5E43 A;  1ACF A;  1W79 A;  1S0W A;  4DKI A;  3H9W A;  3MFX A;  3E98 A;  2EFX A;  2QJ5 A;  4WZ4 A;  3QP2 A;  1W8Q A;  5G18 A;  3PBR A;  1YMX A;  2ZLY A;  4X53 A;  4OP8 A;  1ES4 A;  5CTN A;  2E8J A;  4JPM A;  5F83 A;  2WK0 A;  2Y2L A;  1WYC A;  4HHD A;  1BSG A;  1OTD A;  1ESU A;  2QYB A;  2V8F A;  2Y59 A;  3ZVW A;  4NEE D;  4BLM A;  4BMW A;  2XH9 A;  4UHU A;  4D2O A;  3BFG A;  2QPN A;  3G30 A;  4I3J A;  2VGL M;  3BJN A;  3SH8 A;  2Z2L B;  4OPZ A;  2LB5 A;  5LBR A;  4OH0 A;  4FSF A;  2O99 A;  3A3J A;  2ZJ9 A;  2Y2J A;  4CLC C;  4ARZ A;  4DJ3 A;  4B4Z A;  3G2Y A;  5EFW A;  2JKT M;  1FOF A;  1N9O A;  4MBK A;  3C30 A;  3VOZ A;  1S67 L;  3IF6 C;  3PTE A;  2XA7 S;  4FOF A;  4G3K A;  4MDZ A;  4WF0 A;  3SOI A;  5J4E A;  2WGI A;  5EOO A;  2R78 A;  5EVE A;  4F3L B;  3ZCZ A;  2PT7 A;  2Y55 A;  4M3K A;  4MLL A;  4KG5 A;  4M4X A;  3PYP A;  4IJG A;  2V0W A;  3V5M A;  4PM7 A;  4DN0 A;  1K38 A;  4BQM A;  4XXR A;  5GHY A;  5FDS A;  2WKI A;  3ZG8 B;  1JTG A;  4GDN A;  4EQ1 A;  4WYY A;  3LIC A;  3LR0 A;  2VGJ A;  3QP4 A;  4PM8 A;  4IUH A;  3CG5 A;  4GS9 A;  1IFQ A;  3G32 A;  4QJG A;  1LHY A;  2PYP A;  3DWK A;  2W1T A;  2IWC A;  3UDX A;  4DDY A;  2X01 A;  1G28 A;  1VET A;  5K5B A;  4U0T A;  5EVI B;  1MPL A;  4KZ4 A;  1NRJ A;  4ESP A;  2ZQA A;  4HH2 A;  3ZHH A;  2VV6 A;  5DVA A;  3ZFZ A;  4IVI A;  3UMD A;  2ZL1 B;  3BQA A;  5KMW A;  1K54 C;  4H6J B;  4S2N C;  5CGW A;  3IS2 B;  3OLO A;  3HLD A;  3HUM A;  4EUV A;  3T4Q A;  4X55 A;  5FAT A;  1KGF A;  4MN6 A;  4NXB A;  3VOY A;  3MXQ A;  3MR0 A;  2XD5 A;  3UPN A;  4NXG A;  1BTL A;  3IBR A;  2M7V A;  1OT6 A;  1TS7 A;  2QMI A;  3WS0 A;  2PR5 A;  4KQO A;  4XT2 A;  3TE8 A;  3F1O A;  3CMZ A;  4LLO B;  2V8C A;  3ZG5 A;  4N9K A;  3T50 A;  3G2Z A;  4R1G A;  4KZA A;  4QWO A;  2JCH A;  1ZTU A;  4NK3 A;  3ZYT A;  3K3D A;  4KZ3 A;  2XQZ A;  5AVE A;  2J3T D;  5M18 A;  3MKE A;  2H0Y A;  1SDE A;  1S66 L;  1RP5 A;  3HLF A;  4HH3 A;  2PD7 A;  3FG8 A;  2PDR A;  5AVF A;  5CX7 A;  1K54 A;  1O7E A;  2HDQ A;  3BY8 A;  5HL6 A;  3VV4 A;  3P09 A;  2A49 A;  3Q81 A;  1H5X A;  1CI9 A;  3OOV A;  2WAE A;  4OPY A;  4BBU A;  5HPI A;  1SKF A;  4OLG A;  5F69 A;  1VHM A;  1MY8 A;  3GSG A;  3IXB A;  2JKG A;  2Y2G A;  3RXW A;  4L9E A;  3P98 A;  5FDH A;  2FFY A;  4F94 A;  5C5K A;  5EEC A;  4GD6 A;  4E6X A;  1IEL A;  2G2U A;  1LT0 A;  2IWD A;  2ZQ8 A;  1FSW A;  1G5U A;  5JYP A;  1BLH A;  1QME A;  1WE4 A;  2PU4 A;  3BRM A;  4LRX C;  4B88 A;  2OLV A;  2UV0 E;  4WEK A;  1SHV A;  4WMC D;  1CEG A;  3SS3 A;  3UNW A;  3HUO A;  1P0Z A;  3BW6 A;  4JGP A;  3QNC A;  1NRF A;  5FI2 A;  5GLA A;  3UB8 A;  3QP6 A;  2QKP A;  3Q7V B;  2ACG A;  1ALQ A;  2EX6 A;  2EXA A;  3IWQ A;  5FQI A;  5DFY A;  1MBL A;  4JXG A;  3C38 A;  3BLS A;  4RX2 A;  3A3D A;  3T4L A;  3D4F A;  4S2I A;  4YNR A;  4KUK A;  3V50 A;  1KVM A;  3CUE C;  2GJ3 A;  4E3J A;  1Y28 A;  3SS5 A;  1PZP A;  4AFI A;  1DRM A;  2Y2K A;  2OWH A;  3A0S A;  5HW3 A;  2QJ7 A;  2WYX A;  1ERO A;  4IHQ A;  3PHY A;  4ARZ B;  4OVD A;  5EM1 A;  1H8Z A;  3ICY A;  4K0W A;  1YLY A;  4JKT A;  3FC7 A;  4CPK A;  4HJ4 A;  5TBM B;  2W1R A;  5HZH A;  1LSW A;  3PAG A;  1CK3 A;  4LEN A;  1KOU A;  4DRT A;  3HLC A;  4WN5 A;  3UB6 A;  1HLU P;  1TEM A;  4LV1 A;  3HJK A;  4P87 A;  3T1S A;  1ONG A;  5EVI C;  4OOM A;  3VP3 A;  1XX2 A;  4R3B A;  3ZG0 A;  5KIZ A;  2Y2Q A;  1Q2Q A;  3FKW A;  1YMS A;  4QY6 A;  2UWX A;  1AXB A;  4F3L A;  1VEU B;  2EFU A;  2B5R A;  3KSH A;  1K56 A;  1NLZ A;  3CUE A;  4B4X A;  4ID4 A;  3O5Y A;  1JTD A;  3BY9 A;  4ZJ1 A;  3BYD A;  3HLE A;  4JGR A;  3ZG7 B;  1YT4 A;  4Y2F A;  2ZQD A;  1X0O A;  2DMW A;  2H5S A;  4BBT A;  4X1L A;  3HRE A;  3VSK A;  3ZVT A;  3BQ8 A;  4WL9 A;  4EES A;  2VZW A;  4HBT A;  5DJT A;  3DTE A;  5FEG A;  2WGV A;  2OV5 A;  2EA9 A;  2Z6D A;  4S2M A;  3UB9 A;  1V9Y A;  1Z6F A;  3N8S A;  2ZL1 A;  2XFS A;  1N9L A;  3VE4 A;  2WKP A;  3IS2 A;  4U0X A;  2P9V A;  3F1O B;  1NZO A;  3W8K A;  4UAA A;  3EOI A;  2XGN A;  1OTA A;  1SKO B;  1VM1 A;  5DTK A;  3LEQ A;  4WUJ A;  3Q07 A;  3LR3 A;  1U60 A;  1G68 A;  1M40 A;  1PI4 A;  1YM1 A;  2EX9 A;  2C5W B;  4KQQ A;  2JC7 A;  3C7V A;  4HI4 A;  3GEC A;  3V39 A;  4MNR A;  2ZQ9 A;  2L1M A;  4K08 A;  4I38 A;  2DNS A;  4E6W A;  1K25 A;  4OP5 A;  4R70 A;  1AWI A;  1SDN A;  3IXG A;  1W7F A;  4Y0T A;  2YKH A;  3HJI A;  2BTF P;  4Y3I A;  1GA0 A;  2XRN A;  1Y54 A;  2Y2M A;  3O87 A;  1FR6 A;  4Q8I A;  1FR1 A;  2OLU A;  2IWB A;  4LV3 A;  1XJ2 A;  3T4K A;  1PRQ A;  3Q82 A;  4HP9 A;  1YKD A;  3RFB A;  1FCO A;  3UDF A;  3MMH A;  1TVF A;  4PPR A;  3Q7Z A;  5GLB A;  4HNB A;  4MN7 A;  5IHV A;  2W0N A;  5HDC A;  4I5S A;  4GLQ A;  1M6K A;  2Z6C A;  4WEJ A;  2OOL A;  4C3Q A;  4KUO A;  3RXX A;  4KG6 A;  3H7W A;  4X25 A;  3HVF A;  3LR5 A;  2VV8 A;  5FL3 A;  4HEF A;  3S7N A;  2J7V A;  1RCJ A;  1BLP A;  5KZH A;  4UA9 A;  4LRY C;  3S7Q A;  3IX4 A;  2BAS A;  4DE2 A;  5FAO A;  2GDN A;  5HX9 A;  4E3N A;  3DWZ A;  3WWX A;  5J3W A;  5AQB A;  3PBT A;  4BBV A;  3W4Q A;  3E4O A;  4WMC A;  4KZ9 A;  5CEB A;  4KG2 A;  2Y2O A;  2G7U A;  3D9Y A;  3HLG A;  2W27 A;  4C75 A;  3UDI A;  3BFE A;  2C6W B;  2ZM2 A;  3Q7V A;  2V1A A;  4NG2 A;  2ZD8 A;  2I72 A;  3M2J A;  1IYQ A;  2ZC4 B;  2FH5 A;  1LI9 A;  5HFO A;  1IEM A;  2EWW A;  2XDM A;  4BD1 A;  4P0M A;  4FH2 A;  5F5Y A;  2XLN A;  5TFQ A;  1T1C A;  1ZKJ A;  1FIK A;  4JF5 A;  1BZA A;  1O07 A;  4S2J A;  4E3K A;  3JYI A;  4DE0 A;  4RYE A;  2W3D A;  3NEC A;  3TW8 A;  4EU0 A;  2VLG A;  1MWS A;  3B3X A;  2VK3 A;  3PBO A;  2OSU A;  4LCM A;  5TBM A;  3LUQ A;  4FUW A;  4A5R A;  4R38 A;  1GCE A;  4X1M A;  2ZQC A;  2KOI A;  1YSP A;  3OPH A;  1OPX A;  4FCF A;  3UE0 A;  3E4P A;  3MSH A;  3OPP A;  4L0L A;  2R9X A;  2WAD A;  2A2L A;  1TS0 A;  5E2E A;  3QNB A;  3MZF A;  5I5L A;  3VMA A;  3T1R A;  3IHA A;  2ZMA A;  2MJ6 A;  2RL3 A;  2Y4A A;  3UN7 A;  1VEU A;  2VEA A;  3T1X A;  3DW0 A;  2HJ9 C;  1K55 C;  3PBS A;  4CJN A;  1PNE A;  3A0R A;  4IBR A;  1TF1 A;  2Z2M B;  2W3E A;  4UQI S;  3KYQ A;  2O9A A;  3PBN A;  3DTI A;  3LY4 A;  3OCL A;  4GN2 A;  4GHI B;  3FKV A;  1MWR A;  4KZB A;  3WRZ A;  4R4R A;  3T4S A;  2ZQ7 A;  3PBQ A;  2XR0 A;  2VX8 A;  3AGF A;  3L7H A;  5GHZ A;  1I2W A;  5IU1 A;  5L8M A;  4OQ0 A;  2ZMV A;  1IYP A;  3MF0 A;  3C5A A;  4KQR A;  5CHU A;  5AQA A;  3NI9 A;  2EWV A;  1E25 A;  4EQI A;  3CJM A;  4I3A A;  3BFF A;  2WUQ A;  1F5M A;  2P9V B;  5FEF A;  1F98 A;  3VP2 A;  2HF6 A;  4JF4 A;  3DAV A;  5CGS A;  2Q0O A;  2VKS A;  3MFD A;  3MBZ A;  4FH4 A;  3IWI A;  1XKZ A;  5TJJ A;  3C4P A;  4YIN A;  1GHP A;  1K55 A;  1SCW A;  2EXB A;  2LB9 A;  2B18 A;  2JKR I;  3MXR A;  5EE8 A;  1FCM A;  1SKO A;  5A91 A;  5GLC A;  4N92 A;  4DMZ A;  1RGZ A;  3SH7 A;  2JKF A;  5HD3 A;  4ZJ3 A;  4EWF A;  2CC1 A;  3ISG A;  1IOU A;  3FPW A;  3T1Q B;  3NOP C;  1TS8 A;  1E3U D;  5HAQ A;  1YLZ A;  1PW1 A;  2J8Y A;  1H0M A;  1L0F A;  2ZOH A;  4WM9 A;  4X68 A;  2HP9 A;  2HPB A;  3H82 B;  3VP0 A;  3KSG A;  2Y2I A;  1H8Y A;  5IS1 A;  1T18 A;  5HWV A;  1XJ4 A;  5HD5 A;  2Y91 A;  3EWK A;  2ZC7 A;  2NUT C;  1EWZ A;  5FAS A;  1CJF A;  1J3W A;  3AGD A;  1C3B A;  3H7W B;  3NIA A;  3W4O A;  4KZ8 A;  3LYX A;  3D72 A;  3E2K A;  4EXO A;  3D3O A;  4EET B;  3UE6 A;  1N9B A;  2WZZ A;  1YAX A;  1MWT A;  3GR2 A;  4WZ5 A;  3CHW P;  4S2O A;  4OQI A;  4B93 A;  5CER A;  3FYZ A;  5A92 A;  3BFC A;  5M1A A;  4Y0O A;  2NUP C;  4RVA A;  3GRJ A;  1H3Q A;  4GKU A;  3BM6 A;  2RCX A;  1LI0 A;  3E4Q A;  3NY4 A;  3NCK A;  2XEP A;  5DKL A;  1DY6 A;  1YLT A;  3EGD C;  4E3M A;  3IWO A;  3S4X A;  4EBP A;  1ES2 A;  1HTZ A;  1PI5 A;  2KLI A;  3ZQ5 A;  2JKR M;  2O9B A;  4WLA A;  4DXB A;  4UA6 A;  4KQD A;  3EEH A;  1T1B A;  2K31 A;  2XRO A;  2J9O A;  1ODV A;  3L9K A;  1MKM A;  1N4O A;  4NET A;  5HWT A;  4Y5F A;  1G6A A;  4LFU A;  5JYO A;  5F82 A;  3MQ0 A;  4GJ4 A;  4KZ5 A;  3UE3 A;  3IT9 A;  5CEC A;  1L0G A;  4Y7P A;  5FA7 A;  2Y79 A;  2EX8 A;  4EV4 A;  2HV1 A;  3SH9 A;  2D02 A;  3ULF A;  4OOL A;  1D7E A;  1FCN A;  4JLF A;  5EVL A;  4MCW A;  2H0T A;  3TG9 A;  1YLW A;  5DFX A;  3R4K A;  1K0K A;  1NY0 A;  5DTT A;  2BG1 A;  1PWG A;  5HDD A;  3M2K A;  1XJ3 A;  5L10 A;  4OON A;  2DRW A;  4EEP A;  3CI6 A;  4JF6 A;  1P9R A;  3BEC A;  1GHI A;  1K6R A;  2PHY A;  3I7J A;  3WS1 A;  5EPH A;  2P74 A;  2PR6 A;  4NXE A;  5CED A;  5HL1 A;  4XUX A;  3U2A A;  4MBF A;  3CPT B;  1NLY A;  3MQQ A;  3IXH A;  2VGK A;  4UA7 A;  2GNX A;  4HJ6 A;  1XA1 A;  5GHX A;  1UGU A;  4GHI A;  2L4R A;  4CLC D;  3R7W B;  2M7U A;  1Y4O A;  3V3S A;  4GOG A;  2QZ6 A;  2HJE A;  4PAU A;  4OOY A;  5AJG A;  3TSG A;  2J3T C;  3IF5 A;  1PWC A;  1GHM A;  4DF6 A;  5F68 A;  3O86 A;  4N1X A;  4HY8 A;  3PXP A;  1N9N A;  4X69 A;  2PBD P;  1OJ5 A;  1OTB A;  3GDI A;  1BYW A;  3QP1 A;  5U47 A;  5J7E A;  3TJZ C;  4EEU A;  5TR7 A;  2WKH A;  4BD0 A;  1DJC A;  2L0W A;  1L0D A;  3VFH A;  5DF7 A;  1LL8 A;  1J9M A;  4II7 A;  3OBF A;  4ETZ A;  1TDL A;  3ZDJ A;  2ZBB A;  5HAI A;  4Z9Q A;  3WS2 A;  3SW1 A;  3K2N A;  3QHY A;  1IKI A;  2PRF A;  3RJU A;  3LEZ A;  3OPR A;  1CQA A;  1S1Z A;  1KDW A;  1ES3 A;  3KO6 A;  1BUL A;  3B42 A;  3H82 A;  4R4S A;  2WAF A;  5IT5 A;  4JXV A;  3IQA A;  1PW8 A;  3U4L P;  4O7D A;  5FQQ A;  5FQM A;  4QB8 A;  2HP5 A;  1NJ4 A;  3SS4 A;  3LY3 A;  2VGL S;  4NKP A;  3N8R A;  2WKR A;  1MKI A;  2GX5 A;  3BWL A;  4P85 A;  3VP4 A;  4S2K A;  1XJ6 A;  3A3I A;  3KSI A;  3NJA A;  3B47 A;  1KE4 A;  1W5D A;  4K0X A;  3MQO A;  1ERQ A;  3GMW A;  3HCY A;  4LPZ A; 
#chains in the Genus database with same CATH homology
 2W1T B;  3PBQ A;  2VX8 A;  1NWZ A;  4B9O A;  1TS6 A;  4HIA A;  3A0V A;  4LRX C;  4G3W A;  1YSQ A;  1OTE A;  3NOT C;  4UEY A;  5HWW A;  1GSX A;  5G4Y A;  3P7N A;  4WEK A;  4O0P A;  5IU1 A;  3S7O A;  5L8M A;  2ZMV A;  1D06 A;  3MF0 A;  2W3H A;  4P6Z M;  5DKK A;  1STZ A;  3W2Z A;  1P0Z A;  3BW6 A;  1MC0 A;  4JGP A;  2EWV A;  4I3A A;  2M1C A;  3CAX A;  1F5M A;  1S4R A;  2V1B A;  4ZRR A;  1F98 A;  2HF6 A;  3UB8 A;  1H8M A;  2QKP A;  2VKS A;  3B33 A;  4Z1W A;  3KYZ A;  5DFY A;  2P7J A;  4HQA A;  3IBJ A;  3F1P B;  4CLC E;  5TJJ A;  4YOF A;  1T19 A;  4H6J A;  1MZU A;  5HPF A;  2LB9 A;  3C38 A;  2B18 A;  2H28 A;  2JKR I;  4EER A;  4XT2 B;  4QPR A;  3T4L A;  3K3C A;  3KSF A;  2OAP 1;  4G3V A;  4CQH A;  4YNR A;  3LI8 A;  4KUK A;  3TRC A;  3CUE C;  4DMZ A;  2GJ3 A;  1Y28 A;  4AFI A;  4Q0J A;  4BWI A;  1DRM A;  4O01 A;  2YKF A;  3E0Y A;  2OWH A;  5HD3 A;  3A0S A;  2QJ7 A;  4R6L A;  3EQU A;  1IOU A;  3FPW A;  4IHQ A;  3PHY A;  4HP4 A;  3NOP C;  2Y8H A;  4ARZ B;  1TS8 A;  1T1A A;  3ICY A;  1VB6 A;  4GCZ A;  4L9F A;  4P6Z S;  3FC7 A;  1EW0 A;  4HJ4 A;  5TBM B;  2W1R A;  5HZH A;  5F6A A;  2INW A;  1LSW A;  2ZOH A;  2ZOI A;  3FPV A;  1KOU A;  2VV7 A;  4WN5 A;  3UB6 A;  3HJK A;  3H82 B;  4E04 A;  2V0U A;  3KSG A;  3EEA A;  5IS1 A;  1T18 A;  4OOM A;  1OJG A;  5HWV A;  4Q0H A;  1XJ4 A;  5HD5 A;  1DP6 A;  2JKT I;  3CWF A;  2J80 A;  5KIZ A;  3F1N B;  3EWK A;  3LI9 A;  2NUT C;  2QHK A;  1WA9 A;  1F9I A;  3JVV A;  2W3F A;  4F3L A;  3H7W B;  2HGV A;  3LYX A;  3KSH A;  1DP9 A;  1NLZ A;  3NOU C;  3CUE A;  5KSH A;  3O5Y A;  3RH8 B;  3D72 A;  2QWS A;  3BY9 A;  1XFQ A;  3OC2 A;  3LID A;  2JN7 A;  3C2W A;  3G6O A;  4EXO A;  2K7S A;  3D3O A;  4EET B;  1GSW A;  3UE6 A;  1YAX A;  5G4Z A;  4JGR A;  2V9A A;  4Y2F A;  3S7P A;  2D01 A;  2IA2 A;  4B93 A;  2O0Y A;  1X0O A;  2DMW A;  3NHQ A;  2NUP C;  3VE3 A;  2A24 A;  2PD8 A;  4BBT A;  2VA0 A;  1S1Y A;  1H3Q A;  3OCN A;  3BQ8 A;  3R7W A;  2O9C A;  1P9W A;  1OT9 A;  2P04 A;  4CLC A;  3EGX C;  4WL9 A;  4EES A;  2VZW A;  2CMN A;  3LIB A;  4PHT A;  1W63 Q;  5DJT A;  3E4Q A;  4MN5 A;  3CLO A;  3LIA A;  2EA9 A;  5DKL A;  2Z6D A;  3UB9 A;  1V9Y A;  2I9V A;  3EGD C;  4I3I A;  3UB7 A;  3H9W A;  3MFX A;  2B02 A;  2OAQ 1;  3E98 A;  2QJ5 A;  3EQV A;  1N9L A;  2KLI A;  3VE4 A;  3ZQ5 A;  1TD5 A;  4HOI A;  2JKR M;  2O9B A;  3PBR A;  4WLA A;  2WKP A;  2XA7 M;  4KQD A;  3EEH A;  3IS2 A;  1T1B A;  2K31 A;  3F1O B;  2XRO A;  2WKQ A;  1ODV A;  1MKM A;  1V9Z A;  3EOI A;  4HHD A;  1OTA A;  4L9G A;  3T4T A;  1OTD A;  5HWT A;  2QYB A;  4Y5F A;  4WUJ A;  3LR4 A;  3LR3 A;  3MQ0 A;  4NEE D;  4GJ4 A;  4BMW A;  3UE3 A;  3V67 A;  3P01 A;  4I3J A;  2VGL M;  3BJN A;  4HI4 A;  3GEC A;  2Y79 A;  1OTI A;  4GW9 A;  2HV1 A;  5HDS A;  2LB5 A;  5LBR A;  2L1M A;  2D02 A;  3T4O A;  4K08 A;  3ULF A;  4OOL A;  4FSF A;  4UQI M;  1D7E A;  4I38 A;  2O99 A;  4MCW A;  4R70 A;  2K2N A;  3DBA A;  5DFX A;  3R4K A;  1JNU A;  4CLC C;  2YKH A;  3HJI A;  4ARZ A;  4DJ3 A;  5HDD A;  2VJW A;  1XJ3 A;  4JGO A;  4Y3I A;  5EFW A;  2XRN A;  2JKT M;  1N9O A;  4YWZ A;  3C30 A;  1S67 L;  4BJP A;  4EEP A;  3CI6 A;  1XJ2 A;  2XA7 S;  3T4K A;  4FOF A;  4G3K A;  4MDZ A;  4HP9 A;  1P9R A;  4WF0 A;  1YKD A;  5J4E A;  2J3W A;  2R78 A;  3RFB A;  3VOL A;  4WEL A;  2PHY A;  1S4S A;  4F3L B;  3MMH A;  2PT7 A;  2KDK A;  4M4X A;  2PR6 A;  3PYP A;  4IJG A;  4Q0I A;  2V0W A;  3JVU A;  4HNB A;  4MN7 A;  4NXE A;  3F1N A;  1G6O A;  4DN0 A;  2W0N A;  4NXF A;  5HDC A;  3U2A A;  4I5S A;  4GLQ A;  2Z6C A;  5HSQ A;  4WEJ A;  2OOL A;  3LIE A;  4KUO A;  1NLY A;  1DP8 A;  3KX0 X;  4EQ1 A;  3H7W A;  3MQQ A;  3LR5 A;  3LIC A;  3LR0 A;  2VV8 A;  3T4J A;  2KX6 A;  2GNX A;  4ME4 A;  4IUH A;  4HJ6 A;  4GS9 A;  5FL3 A;  1IFQ A;  3S7N A;  1UGU A;  4GHI A;  2PYP A;  2L4R A;  4LRY C;  3S7Q A;  4CLC D;  3R7W B;  2M7U A;  2W1T A;  2BAS A;  2OWJ A;  1G28 A;  2HJE A;  5K5B A;  4PAU A;  5AJG A;  2J3T C;  1NRJ A;  5J3W A;  4HH2 A;  3PBT A;  4BBV A;  2VV6 A;  3E4O A;  3UMD A;  3BQA A;  5F68 A;  4RQ9 A;  1LSX A;  3UME A;  2GZA A;  4H6J B;  2G7U A;  3IS2 B;  3OLO A;  5DJU A;  2W27 A;  5DF9 A;  4EUV A;  1XFN A;  1UWN X;  4HY8 A;  3T4Q A;  4DJ2 A;  3PXP A;  1N9N A;  3LFV A;  4JGQ A;  2V1A A;  4MN6 A;  4NXB A;  3MXQ A;  3F1P A;  3MR0 A;  4LRZ E;  1W63 M;  1OJ5 A;  1OTB A;  2FH5 A;  4O8G A;  3GDI A;  4NXG A;  3IBR A;  1BYW A;  2M7V A;  1OT6 A;  1TS7 A;  2EWW A;  3RTY A;  5J7E A;  2PR5 A;  1GSV A;  4KQO A;  4XT2 A;  3TE8 A;  3C8C A;  5F5Y A;  3F1O A;  3TJZ C;  4EEU A;  4LLO B;  3PR6 A;  1T1C A;  2L0W A;  1LL8 A;  4II7 A;  3T50 A;  3OBF A;  4ETZ A;  2W3G A;  4R3A A;  5MC7 A;  2ZBB A;  1ZTU A;  3ZYT A;  3K3D A;  2W3D A;  4I39 A;  2ZMF A;  5AVE A;  2J3T D;  3TW8 A;  4EU0 A;  3SW1 A;  3K2N A;  4IUK A;  2VLG A;  1S66 L;  4MMN A;  4HH3 A;  2PD7 A;  3FG8 A;  2PDR A;  5AVF A;  5CX7 A;  3PBO A;  2FZ0 A;  4PKY G;  5TBM A;  1P97 A;  3LUQ A;  4ETX A;  3BY8 A;  4R38 A;  5HL6 A;  3MJQ A;  3VV4 A;  3LIF A;  1S1Z A;  3KO6 A;  2KOI A;  1YSP A;  1OPX A;  4HJ3 A;  3B42 A;  3H82 A;  3E4P A;  4L0L A;  1ZHH B;  5IT5 A;  3OOV A;  2A2L A;  4PKY A;  1TS0 A;  4BBU A;  5A8B A;  5HPI A;  2P08 A;  1LSV A;  5F69 A;  1VHM A;  5I5L A;  2JHE A;  2PYR A;  3CIT A;  2MJ6 A;  2VGL S;  4NKP A;  1UWP X;  2WKR A;  4L9E A;  4EW7 A;  2VEA A;  2GX5 A;  2HJ9 C;  3BWL A;  3PBS A;  1XJ6 A;  3KSI A;  2XSS A;  3A0R A;  3NJA A;  5C5K A;  3B47 A;  1TF1 A;  2W3E A;  4UQI S;  2A24 B;  4GS9 B;  3KYQ A;  1LT0 A;  2O9A A;  3PBN A;  3OCL A;  4GHI B;  3MQO A;  4CLC B;  3HCY A;  3T4S A;  4LPZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...