1NWZA

Pyp ultra-high resolution structure of a bacterial photoreceptor
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
125
structure length
125
Chain Sequence
b'MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
publication title Anticipatory active-site motions and chromophore distortions prime photoreceptor PYP for light activation
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Signaling protein
total genus 37
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2003-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1nwzA00
4WLAA 4L9EA 4R3AA 3BY9A 4GW9A 2QHKA 5HZHA 3A0SA 1Y28A 4I3AA 4DJ3A 1LL8A 3GDIA 2WKQA 4NXEA 1S1ZA 3F1NB 5AVFA 1V9ZA 2Z6CA 1VB6A 1TS7A 4GS9A 1T1AA 1LSWA 4JGQA 5A8BA 2J80A 3LICA 3UE6A 4HH3A 1XJ2A 3C2WA 1P0ZA 2V0UA 4L9GA 3P7NA 3F1PA 4HQAA 2PYPA 4I39A 5F5YA 5TBMA 4WN5A 1XFQA 3LIAA 4EETB 2PHYA 3PHYA 3B33A 5AVEA 2V1BA 5HDCA 2PR6A 3ULFA 2PYRA 4BBUA 3BY8A 4HY8A 3LIEA 5G4YA 4I38A 3H9WA 4HJ4A 3LI9A 2KDKA 3ICYA 4R6LA 3HJIA 1S66L 3E4PA 4HNBA 1BYWA 4R70A 3F1OB 5HWWA 4I5SA 3RH8B 1DP6A 5I5LA 1S4SA 4HIAA 1GSVA 2GJ3A 3LIFA 1OJ5A 3IS2A 3E4QA 4EXOA 4EEUA 3H82A 1OTIA 3E4OA 1F9IA 3IBRA 2L4RA 2P7JA 4H6JB 5HWTA 4XT2B 2Z6DA 2PR5A 4YWZA 3PYPA 2W0NA 1DP8A 2OWJA 4HOIA 5HDSA 3OLOA 2ZOHA 4GHIA 1F98A 2PDRA 2WKPA 2B02A 2VEAA 4WF0A 5DJTA 2QJ7A 3UB6A 5HWVA 3EWKA 1KOUA 2L0WA 2V1AA 2EA9A 2PD8A 4GS9B 5HD3A 5HSQA 1EW0A 3KX0X 2W27A 1XJ3A 4KQDA 3F1PB 1DP9A 5TBMB 3EEHA 4GCZA 4R38A 3FC7A 4M4XA 3SW1A 1P97A 4DJ2A 4I3JA 3K3CA 4EQ1A 3A0RA 5HD5A 1X0OA 1OTBA 2ZOIA 2CMNA 3ZQ5A 4HJ6A 3CAXA 3NOPC 4RQ9A 5HDDA 5IS1A 1TS6A 3HJKA 1MZUA 1OTDA 4HH2A 4K08A 5KIZA 3G6OA 1XJ6A 1XJ4A 2INWA 2QWSA 4HP9A 5DJUA 1S67L 1TS8A 2JHEA 3LYXA 3MQQA 2D02A 4BBVA 3IS2B 4WUJA 4KUOA 4LLOB 3MXQA 3H82B 4NXGA 3FG8A 4PKYG 4LRZE 2OWHA 3LUQA 3NOTC 3H7WA 4NXFA 2VV7A 4EERA 3CLOA 5J4EA 4HJ3A 4KUKA 4EEPA 3MFXA 4JGOA 4HP4A 1XFNA 1JNUA 4GHIB 3C8CA 2I9VA 2WKRA 1UWPX 2A24A 4MN5A 2YKFA 3CWFA 1T18A 1G28A 5J7EA 1OT9A 3A0VA 1UWNX 2QJ5A 4JGRA 3NJAA 4EESA 1LSXA 4MN6A 4F3LA 1LT0A 2VV8A 1OJGA 4JGPA 2PD7A 4E04A 2D01A 1DRMA 5F6AA 5G4ZA 4WL9A 1TS0A 1NWZA 5IU1A 1D06A 5DKKA 3UB7A 4PKYA 4HI4A 2R78A 2BASA 3F1NA 3MJQA 2KX6A 1S1YA 4LRYC 5J3WA 3LIBA 3D72A 3K3DA 4LRXC 5EFWA 1UGUA 3UB9A 2YKHA 3UMDA 4LPZA 4L9FA 3VE4A 1GSWA 1S4RA 4I3IA 2V0WA 1D7EA 5F69A 2OOLA 2L1MA 1N9OA 1GSXA 4BBTA 1T1BA 2VLGA 5F68A 3GECA 1OTAA 1OT6A 1OTEA 2V9AA 3LI8A 1LSVA 4B9OA 3MR0A 2QKPA 3F1OA 3H7WB 1N9NA 1V9YA 3VOLA 5DKLA 2HV1A 2K7SA 4NXBA 3T50A 3RTYA 1N9LA 2VV6A 3NHQA 3BWLA 1WA9A 1T1CA 1T19A 4EW7A 4HHDA 2A24B 2ZBBA 2M1CA 3LIDA 3UMEA 2JN7A 4H6JA 3VE3A 3NOUC 1ODVA 4XT2A 3MQOA 2H28A 4F3LB 3UB8A
chains in the Genus database with same CATH superfamily
1D1JA 4GW9A 5L2FA 2HJEA 5KSHA 2C5WB 5HZHA 1Y28A 4I3AA 3IF6C 3C30A 1IEMA 3KO6A 3HUOA 4OQGA 3OPHA 1K4FA 4HBUA 3ZVWA 5AVFA 4YNRA 4RVAA 3ITBA 4QHCA 4GS9A 1T1AA 3ZVTA 4Y0UA 2VGJA 1P9RA 4EUVA 1LSWA 4JGQA 2JKFA 3LICA 4PM6A 3UE6A 1BULA 3OCLA 4LFUA 3IXHA 4UEYA 1TDGA 2Y79A 2PYPA 5CEBA 5TBMA 1XFQA 5DTSA 3LIAA 4EETB 1YM1A 3MKEA 1PWGA 4CLCC 3KYEA 1S6RA 3CUEA 1YLTA 3C7VA 3LIEA 3OOVA 4ETZA 2VZWA 1J9MA 5FQQA 3H9WA 3TJZC 3WS2A 3BFFA 4GNUA 4D60A 1ES5A 3TRCA 3Q7VB 4R6LA 3G34A 1G6OA 3NECA 1YAXA 5EECA 2NUPC 2ZM8A 1TEMA 1Z09A 2ACGA 1K55C 4R70A 2XEPA 1KE3A 4LGWA 1FR6A 3ZG5A 1S4SA 2GJ3A 2HP9A 3IF6B 1K38A 4WZ4A 4EXOA 1N4OA 3H82A 3M6BA 3V5MA 4MBFA 2J9PA 3V3SA 1F9IA 1WYCA 3ZHHA 3QNBA 2OAP1 4Y5FA 1HVBA 2XDMA 1BLPA 5FEFA 4H6JB 4L0LA 4OLGA 5A91A 4X1MA 1P9WA 1SKOA 4OKPA 1ALQA 5EOEA 4ZAMA 2IWDA 4N1HA 4HOIA 2ZOHA 4ZJ1A 3UE1A 4O7DA 4CLCB 2WAEA 3A3FA 5E43A 3UPPA 1ZG6A 1NZUA 1M6KA 4KG6A 1IOUA 4B88A 5HWVA 2DNSA 4XUXA 2PU4A 2L0WA 2WADA 2V1AA 2ZC5B 3ZG0A 4BD0A 1ES3A 4PM8A 5AQAA 3IWOA 3QP1A 3HLWA 5CERA 2W3GA 2XRNA 5DF8A 2VJWA 5HAQA 4DMZA 3W4PA 4U0XA 4JKTA 4JPMA 4S2NC 5FQIA 3T1QB 4P6BA 4GCZA 1XX2A 4IUHA 1P97A 4R4RA 5L10A 4DJ2A 4U3TA 3S7OA 3KSIA 4KZ6A 4I3JA 1Q2QA 3K3CA 1KGFA 5HD5A 1G6AA 4JBFA 2P04A 3MZEA 4G3WA 1OTBA 4GB7A 3ZQ5A 1HZOA 4HJ6A 2Y2NA 1K0KA 1MWUA 3ZGAB 1VETA 1BLHA 3NC8A 3QHYA 1OTDA 4K08A 5KIZA 2INWA 4E3MA 4DF6A 3BQ8A 1KDSA 2HP5A 2MJ6A 1DJAA 5E2FA 4OH0A 4KUOA 3MXQA 4ESPA 2C6WB 2WGWB 4RX3A 4NXGA 3GQZA 3RJUA 5FQJA 2OWHA 1K54C 3LUQA 1PFLA 2VV7A 3P09A 3CLOA 4EEPA 2J3TC 3O88A 4E6WA 4HP4A 5CGWA 3L7HA 3CZDA 4MEZA 3N6IA 1SDNA 4KG5A 4ZRRA 2XD1A 4P85A 1W5DA 4GHIB 4Z9QA 4E3LA 5HPIA 3Q81A 4KZ4A 2ZQ7A 4QU3A 4R3BA 4MN5A 2YKFA 1SKFA 1T18A 1G28A 5J7EA 1MXOA 5EV0A 2WAFA 2Y2LA 1LL9A 3A3EA 2XH9A 4LCMA 3PBOA 4JGRA 1I2SA 2ZMFA 3NJAA 2Y91A 4EESA 1LSXA 1LT0A 1OJGA 4JGPA 2HGVA 3D9YA 1JWPA 4EBNA 4GJ4A 3EQUA 2D01A 1FCNA 1D06A 5DKKA 3W8KA 5EVEA 4BQMA 4CQHA 4U0TA 5E2EA 2XR0A 1ZHHB 2Y2OA 3MJQA 1S1YA 5J3WA 4R3JA 2IWCA 1NRFA 3QP4A 2W1TB 4KG2A 4PM9A 1RGZA 1ONHA 2UWXA 4XUZA 1F5MA 3PAEA 3PBNA 4YFMA 1PWCA 4R4SA 5HL1A 3G2YA 3HLCA 1D7EA 2PBDP 3ZCZA 4JF4A 2AVXA 4ARZA 2ZL1A 2L1MA 3VP4A 1G68A 1XGJA 1PZPA 3UY6A 4M3KA 1CJFA 3R4KA 3PBTA 3PR6A 4MBKA 4BBTA 3VV4A 4UA7A 5F68A 1OTAA 2M7VA 1W63Q 1TDLA 2Y2KA 4C75A 1K6SA 3F1OA 4Q0IA 1V9YA 1MKIA 3TSGA 5EE8A 3JYIA 2BLSA 3FWLA 4S2PA 1IYOA 3B3XA 3E98A 4PAUA 5A90A 4K0WA 4IHQA 3UDXA 3NHQA 3KSGA 5DTKA 4BENA 3T4QA 3HUNA 4OP8A 1YKDA 3GV9A 3ZNTA 3UE0A 5FDSA 3LIDA 3UMEA 2J9OA 1EWZA 2ZQCA 5M1AA 3FPWA 3N4IA 3DTKA 3CITA 3GR2A 5HW3A 2BG1A 4WBGA 4ETXA 1I2WA 5KZHA 4LV0A 1BTLA 3MKFA 5FDHA 1LL8A 1L0GA 2Y4AA 1G5UA 2WKQA 4WELA 4NXEA 1L3LA 1J3WA 2OSUA 3SS5A 4NETA 1V9ZA 2WKHA 1YSQA 1TS7A 4JXWA 3BQAA 3JVVA 2B18A 3BLMA 4LV3A 3O87A 3VP1A 2V0UA 3W4QA 4OOYA 1FCMA 4HQAA 2Z2LB 3M2KA 4I39A 5F5YA 2V8FA 4WN5A 3RXXA 3HLBA 5KSCA 2OAQ1 5EVLA 3B33A 1FIKA 3UB5P 2V1BA 3ULFA 2ZQ8A 2PYRA 3ZNYA 2VGKA 2EX8A 5FI2A 5G4YA 1PYYA 4HJ4A 1JTDA 2WKEA 4S2KA 5FQKA 3EOIA 4Z1WA 3IHAA 1H8ZA 3SH7A 3G35A 4MNRA 3E4PA 3WS4A 4HNBA 1BYWA 2XA7M 2ZJ9A 5FI7A 3VSKA 4DDYA 2XQZA 1IYQA 1W79A 3OPPA 4H8RA 1PNEA 3RH8B 1DP6A 5I5LA 1H0MA 2ZLYA 1GSVA 2ZM0A 1OJ5A 1NYMA 3UNWA 3CUEC 4BLMA 3A3IA 4EEUA 3S7PA 3E4OA 3VOZA 5EM1A 3IBRA 2Y2HA 3IT9A 3PXPA 4JF5A 4R1GA 5CXWA 3VFFA 3B47A 1W8YA 4K91A 5TJJA 3CPTA 4XT2B 2EX6A 3D4FA 3LCEA 3NI9A 2PR5A 4E3NA 4YWZA 3PYPA 1JWVA 2X71A 2W0NA 1XA7A 4OONA 3V50A 1PZOA 1F98A 2B02A 4B4ZA 2VEAA 1BUEA 3R7WA 3NULA 2PT7A 3DTEA 1PIOA 2ZC6B 3FPVA 4N92A 2QJ7A 4G3VA 3OCNA 5HPFA 1LL5A 4Y3IA 1FILA 5K5BA 1JWZA 2PD8A 4GS9B 5G18A 2Q9MA 4IUKA 4IVKA 1EW0A 1XKZA 4QY6A 2FFYA 1XJ3A 2OLUA 4KQDA 5BOHA 2W3EA 2XFTA 1DP9A 5TBMB 5GLAA 3BFDA 3MZDA 5CTNA 4ZJ2A 4R38A 2O99A 1KDWA 4OQHA 2B95A 1OPXA 5EVID 3SW1A 5E2GA 3ZDJA 4LCLA 2XA7S 4B4XA 3HLGA 4JLFA 2H10A 2WKIA 1E3UA 4JXVA 1K57A 4DE2A 2CMNA 3NOPC 4RQ9A 3DWZA 4XXRA 3QP6A 3HJKA 1MZUA 5FAOA 1XJ6A 4FSFA 4GZBA 1S67L 4PM7A 3JVUA 3O5YA 4BJPA 1NRJA 4P87A 4E3JA 4BBVA 1L0FA 2WUQA 4OPZA 3S7QA 4X25A 3BW6A 3H82B 1ZKJA 1YLZA 2EFUA 4WMCD 4LRZE 2H0YA 4HBTA 2J7VA 1PI5A 3H7WA 1MPLA 2GZAA 4KUKA 3Q07A 2E8JA 1SKOB 1PW8A 3LGOA 3Q1FA 1LHYA 2JKTM 5D3OA 4BMWA 4DRTA 1VM1A 2ZC7A 3GRJA 3KSHA 2LB9A 4EWFA 3IXGA 2Y59A 1OMEA 5CEDA 1CQAA 2Y2IA 1YLPA 4BL2A 3CWFA 3A0VA 5MC7A 1UWNX 1Y54A 4GKUA 1WE4A 4MN6A 2UV0E 3DTIA 3T4TA 3OPLA 5GLCA 3M6HA 2DRWA 2WZZA 4X6TA 1VHMA 5F6AA 5G4ZA 4WL9A 1NWZA 5IU1A 4DKIA 3UB7A 1TF1A 5AJGA 5FATA 4PKYA 2J8YA 4HI4A 4PMAA 4UA9A 2KX6A 3F1NA 4KZBA 4LRYC 3K3DA 4LRXC 5FQ9A 5EFWA 2R9WA 4QY5A 4WZ5A 5DF7A 1RCJA 1A0KA 3UMDA 4KZ3A 3K2NA 3VE4A 2IWBA 1GSWA 4I3IA 5CGXA 1MWTA 1VETB 5CX7A 5F69A 3PTEA 2X01A 4DE1A 4LV1A 3SZTA 2Y2QA 1O07A 3T4LA 3OPRA 5CHJA 1N9OA 1T1BA 3HREA 4IJGA 1OTEA 1HTZA 3LFVA 1LSVA 1KVMA 5M19A 4WYYA 2P74A 4KQOA 3DAVA 2JKTI 2CC1A 3HLDA 1K56A 1M40A 4NXBA 3T50A 3PAGA 3U2AA 3E2LA 3RTYA 1N9LA 4OQIA 3C4OA 5JYOA 5CRFA 3EQVA 1ESUA 4UQIM 1T1CA 5GHYA 4FCFA 3DBAA 4X69A 5IHVA 5L8MA 4C3QA 2WZXA 1YSPA 1XA1A 2QPNA 5FQMA 1AWIA 3LR4A 3VE3A 3LY3A 3RFBA 3MQOA 3C38A 5E2HA 3G30A 2E8IA 2H28A 3BFEA 4WLAA 2KLIA 5F82A 3TG9A 4L9EA 2V20A 3BY9A 1K25A 1YLYA 3WS1A 4CPKA 4JXGA 3A0SA 1E25A 4K0XA 4DJ3A 2PRFA 4S2JA 5HL6A 3T1RA 3GDIA 1NY0A 1YPRA 2O9AA 1S1ZA 5EVIA 1GA0A 2Z6CA 4DE3A 3W2ZA 3S4XA 1ESIA 1MC0A 1YMXA 3C2WA 4GD6A 2IA2A 1H8MA 3P7NA 3F1PA 4E3IA 2Y2MA 1VEUA 5L07A 2QZ6A 5EUAA 4ARZB 2ZL1B 5CTMA 1CEFA 5KMWA 3BY8A 4HY8A 2XF3A 4I38A 3U4LP 2ZMVA 5HX9A 1SCWA 4UA6A 3LI9A 2KDKA 3ICYA 1QMEA 4GD8A 5CHMA 4OP5A 4UQIS 1HLUP 4A5RA 2XD5A 2JCHA 4WMCA 3F1OB 3VP0A 5HWWA 1VQQA 1NXYA 4ZTKA 4GN2A 4DXBA 2JC7A 2A2LA 4RA7A 1KVLA 4HIAA 2G2UA 2GDNA 4KZ5A 3OBFA 1PRQA 3T12B 2VGLM 2W1RA 3IS2A 1PWDA 1YQSA 3VP3A 2EWWA 2HDQA 3WRZA 3IQAA 3IH9A 4GDBA 4LENA 3T1XA 2L4RA 3O3VA 2O9CA 3E0YA 3S1YA 1U60A 2P9VA 5GHZA 5HWTA 4ME4A 1CI8A 2EWVA 2Z6DA 1K6RA 3EGXC 5FAPA 2ZD8A 5F83A 1DP8A 3OLOA 1MY8A 2VX8A 2WYXA 2PDRA 2WKPA 3L9KA 4NEED 4Y0OA 1YT4A 3FV7A 4WF0A 4OOMA 4P6ZM 1CK3A 3S22A 3V3RA 1K4EA 2KOIA 4DN0A 2DCFA 4IVIA 3EEAA 2Y55A 3G32A 2EA9A 3MS6A 5A92A 5HSQA 3ZG7B 2W27A 3KSFA 4B93A 4CLCD 3CG5A 4BD1A 4Q0JA 3DTMA 4KZ8A 4O0PA 2ZMAA 5TGFA 4WEKA 4M4XA 3AGDA 2Q0OA 1IKGA 4EQ1A 3MMHA 1X0OA 4DDSA 3N8RA 2ZOIA 3LO7A 3N7WA 4KENB 3CAXA 3G4PA 2Y2JA 4FUWA 1TS6A 3FKVA 3NY4A 4NKPA 4ZDXA 4WM9A 4E3OA 4HH2A 3O86A 3JPUA 1I5QA 3G6OA 4E6XA 2QWSA 1ES4A 3AGEA 4DXCA 1BLSA 3SH8A 3V67A 2WK0A 5DJUA 3CI6A 2JHEA 5JYPA 4FH4A 3BM6A 4OPRA 4X53A 4LLOB 3ZG9B 3GTCA 5FAQA 2V1ZA 2EX2A 1K57C 4PKYG 3T4KA 4P6ZS 3A3DA 2J3WA 3NOTC 1GHPA 3UPOA 3T4SA 4EERA 3TE8A 5J4EA 4KZ7A 3CPTB 4JGOA 2A3UA 2W3DA 5CHUA 4HEFA 3IH8A 1XFNA 3EGDC 1RP5A 4FTXA 2ZC4B 3LEZA 5FA7A 3C8CA 4E3KA 4UHUA 2WKRA 4MLLA 4DE0A 2JBFA 4UAAA 3R7WB 1UWPX 2A24A 4BL3A 1OT9A 5FASA 3BEBA 1XXMA 3MZFA 4G3KA 1TVFA 1DJCA 3BFGA 2FFFB 1Z6FA 4F3LA 2VV8A 3RXWA 3MQ0A 1STZA 4R23A 2PD7A 2OLVA 1GCEA 2QYBA 4E04A 2Y2PA 1EI5A 3QNCA 3VP2A 3BJNA 5AQ7A 3V39A 4KQQA 1WYBA 3UDIA 2BASA 3OC2A 1IYPA 3IHBA 3AGFA 3BLSA 3LIBA 3IXBA 1O7EA 1XPBA 3QP2A 4X1LA 4ZJ3A 1UGUA 3DW0A 3UB9A 2YKHA 2Q9NA 3OZHA 1PW1A 4L9FA 5FSRA 4KQRA 3NDGA 3IX4A 3UPNA 1QMFA 1TD5A 2V8CA 3ZFZA 2OOLA 1C3BA 4O01A 5I94A 3LEQA 4X56A 1YLWA 2Z2MB 4MBHA 3IWIA 4YOFA 3BFCA 3CMZA 1CEGA 4N9LA 1GHMA 2VLGA 1KGEA 2PBYA 1OT6A 3FYZA 2V9AA 3Q7VA 2J3TD 4WZ5C 4Y13A 4Y7PA 2ZQAA 1SDEA 4MDZA 3MR0A 1SZVA 4GOGA 4HESA 3H7WB 4P0MA 2HV1A 2K7SA 3SS3A 2HPBA 1DY6A 5FI6A 3IF6A 3VMAA 2K2NA 2A49A 5L09A 3UDFA 3IWQA 2XLNA 4MCWA 4QPRA 5F1GA 4EW7A 1RGYA 4HHDA 4R0QA 1YLJA 4OQ0A 4NK3A 3NDEA 1W8QA 5GL9A 2PU2A 5A93A 4OOLA 4N1XA 2XGNA 4H6JA 1ODVA 3LR5A 1E4DA 3ZG8B 3CHWP 3G31A 4PHTA 4IEDA 3T1SA 3UB8A 4PPRA 5GHXA 4R3AA 2K31A 2V2FF 2QHKA 4GLQA 3TOIA 2EX9A 4CLCA 4EQIA 5FEGA 2B5RA 2NUTC 2O0YA 2EXAA 1LI9A 3IBJA 4EBPA 3GMWA 3F1NB 4BWIA 4N9KA 3SS4A 4FOFA 3P98A 2Y8HA 4JXSA 4Y17A 1VB6A 4S2LA 3UN7A 5A8BA 2J80A 4HH3A 1XJ2A 1P0ZA 3QP8A 4L9GA 1K55A 1DJBA 1FSWA 1GA9A 3MXRA 1H5XA 2PHYA 3PHYA 1ES2A 3VSLA 3GVBA 3WS0A 1H8YA 2HF6A 5AVEA 3T4OA 5HDCA 2PR6A 1MKMA 4RX2A 5HAPA 2XROA 2VK3A 4BBUA 1S0WA 3UO9A 3QP5A 5EVIC 2M7UA 1L0EA 3C5AA 3WRTA 4EUZA 1FSYA 5FL3A 2RL3A 1L0DA 3DWKA 2HP6A 3I7JA 4Y15A 3HJIA 4S2IA 5DTTA 1S66L 5DF9A 2G2WA 2HJ9C 3D3OA 5GLBA 5GLDA 5J8XA 4I5SA 1IFQA 1BT5A 3ISGA 4QB8A 4LV2A 5IT5A 3LIFA 2JKRM 4S2OA 2XSSA 4Q8IA 2HDRA 3E4QA 1SHVA 1ZTUA 1NJ4A 2LB5A 1OTIA 2WGWA 4IBRA 4NG2A 1MWSA 4QWOA 5HARA 1NZOA 4ZBEA 2VA0A 5DFXA 2ZM2A 4QJGA 3NIAA 2P7JA 2FZ0A 5C5KA 2HDUA 3FKWA 2X02A 3MXSA 4S2NA 4D2OA 1FR1A 3N8SA 4PM5A 2OWJA 1LI0A 5HDSA 3NCKA 4GHIA 1CI9A 4QD4A 5DJTA 1FOFA 3LR3A 4EBLA 2W3HA 2QMIA 3C4PA 3UB6A 3EWKA 1KOUA 5EVIB 1PI4A 2I72A 5HD3A 4FD8A 4GDNA 4Q0HA 3KX0X 1ERQA 3N8LA 3F1PB 3B42A 2EFXA 1XGIA 3SH9A 1VEUB 3EEHA 5LBRA 3M2JA 3KYZA 2RCXA 3FC7A 2VKSA 2HDSA 3PBQA 3T4JA 3Q7ZA 3A0RA 2W3FA 4OLDA 2W1TA 3MF0A 3S7NA 3PBSA 1K54A 5AQBA 2H0TA 5HDDA 5IS1A 1IYSA 3P01A 3IX3A 3HVFA 5CGSA 3KYQA 1JVJA 5TR7A 1H3QA 1ERMA 3MFDA 1XJ4A 1E3UD 4HP9A 4ID4A 2JKRI 2G7UA 4EU0A 1L2SA 1TS8A 3LR0A 1XP4A 2EXBA 2WGVA 5U47A 3LYXA 2JE5A 3MQQA 4MN7A 2D02A 5HFOA 3BYDA 3IS2B 4WUJA 4CLCE 4Y2FA 1F2KA 2XK1A 4KZ9A 3HLFA 4YINA 4AFIA 1EROA 1NLYA 3FG8A 4RYEA 3WWXA 1KGGA 4JF6A 3W4OA 5M18A 2DMWA 5F1FA 4NXFA 5DFYA 3VFHA 4WEJA 4HJ3A 2P9VB 3MFXA 1HD8A 3HUMA 4X55A 1JNUA 3BECA 3VOYA 2OV5A 1IKIA 4EV4A 1YMSA 4MMNA 3BRMA 2I9VA 1MBLA 2R9XA 4O8GA 3G2ZA 1ACFA 2BTFP 2WGIA 2ZQ9A 3A3JA 4CJNA 4F94A 1LLBA 5TFQA 1BZAA 4KZAA 2QJ5A 3MBZA 3HL9A 1AXBA 3Q82A 3ITAA 5HAIA 3FZCA 3HLEA 1DRMA 1IELA 1TS0A 2JKGA 3ZYTA 1GHIA 2HZ5A 1Y4OA 2R78A 2GX5A 2Y2GA 4OVDA 3D72A 1NLZA 5EPHA 1FCOA 4II7A 3CJMA 3WS5A 4LPZA 4Y0TA 1S4RA 2VGLS 3GSGA 1BSGA 2V0WA 2FH5A 4C6YA 3IXDA 1N9BA 1CF0A 1Q2PA 5EOOA 4IBXA 3TW8A 1KE4A 1ONGA 1ZG4A 3SOIA 1GSXA 2XFSA 3IF5A 3GECA 4S2MA 1KE0A 5CECA 1W7FA 3E2KA 3LI8A 4OPYA 1NYYA 3LY4A 3HCYA 1MWRA 4B9OA 5DVAA 2QKPA 5AQ9A 2H5SA 1N9NA 1BLCA 3VOLA 5DKLA 1ZC2A 4OPQA 4FH2A 3UE3A 3HBRA 2O9BA 3IX8A 2VV6A 3BWLA 4X68A 3PBRA 1WA9A 1JTGA 2ZC3B 1T19A 2PAVP 1W63M 2A24B 3MSHA 1K56D 2ZBBA 2M1CA 3C7UA 2GNXA 1FQGA 3NBLA 2P08A 2JN7A 2ZQDA 3NOUC 4XT2A 4F3LB 5EM0A
chains in the Genus database with same CATH topology
4WLAA 2KLIA 3CITA 4L9EA 4R3AA 3BY9A 4GW9A 2K31A 2HJEA 2QHKA 4GLQA 5KSHA 4ETXA 5HZHA 3A0SA 1Y28A 4CLCA 4I3AA 3C30A 1LL8A 4DJ3A 3KO6A 2NUTC 5HL6A 2O0YA 3GDIA 2WKQA 4WELA 4NXEA 3IBJA 2O9AA 1S1ZA 4BWIA 3F1NB 5AVFA 1V9ZA 4FOFA 2Z6CA 4YNRA 2Y8HA 1VB6A 1YSQA 1TS7A 4GS9A 3W2ZA 3BQAA 1T1AA 3JVVA 1P9RA 4EUVA 1LSWA 4JGQA 5A8BA 2J80A 2B18A 3LICA 1MC0A 1XJ2A 4HH3A 3UE6A 3OCLA 3C2WA 1P0ZA 2V0UA 4UEYA 2IA2A 1H8MA 3P7NA 4L9GA 3F1PA 4HQAA 2Y79A 2PYPA 4I39A 5F5YA 5TBMA 4WN5A 1XFQA 3LIAA 4EETB 2PHYA 3PHYA 2OAQ1 3B33A 4ARZB 4CLCC 2HF6A 5AVEA 2V1BA 3T4OA 3CUEA 5HDCA 2PR6A 1MKMA 3ULFA 2XROA 2PYRA 4BBUA 3BY8A 4HY8A 3LIEA 3OOVA 5G4YA 4I38A 4ETZA 2ZMVA 2VZWA 3H9WA 3TJZC 2M7UA 4HJ4A 3LI9A 2KDKA 3ICYA 3EOIA 4Z1WA 5FL3A 3TRCA 4UQIS 4R6LA 3HJIA 1G6OA 1YAXA 2NUPC 1S66L 3E4PA 4HNBA 1BYWA 4R70A 2XA7M 5DF9A 2HJ9C 3D3OA 3F1OB 5HWWA 4I5SA 3RH8B 2A2LA 1DP6A 1IFQA 5I5LA 1S4SA 4HIAA 1GSVA 2GJ3A 5IT5A 3LIFA 3OBFA 1OJ5A 2JKRM 2VGLM 2W1RA 3CUEC 2XSSA 3IS2A 3E4QA 4EXOA 1ZTUA 4EEUA 3H82A 2EWWA 2LB5A 1OTIA 3S7PA 3E4OA 2VA0A 1F9IA 5DFXA 3IBRA 2L4RA 3PXPA 2OAP1 2P7JA 3B47A 4Y5FA 2O9CA 3E0YA 2FZ0A 5C5KA 4H6JB 5TJJA 4L0LA 5HWTA 4XT2B 4ME4A 1P9WA 2EWVA 2Z6DA 2PR5A 4YWZA 3PYPA 3EGXC 2W0NA 1DP8A 2OWJA 4HOIA 5HDSA 3OLOA 2ZOHA 2VX8A 4GHIA 1F98A 2PDRA 2WKPA 2B02A 2VEAA 4NEED 4CLCB 4WF0A 3R7WA 4OOMA 2PT7A 4P6ZM 5DJTA 2KOIA 3LR3A 3FPVA 2QJ7A 2W3HA 4DN0A 4G3VA 3UB6A 3OCNA 1IOUA 3EEAA 5HWVA 5HPFA 3EWKA 1KOUA 2L0WA 4Y3IA 5K5BA 2V1AA 2EA9A 2PD8A 4GS9B 5HD3A 4IUKA 4Q0HA 5HSQA 1EW0A 3KX0X 2W27A 2W3GA 2XRNA 1XJ3A 2VJWA 3KSFA 4B93A 4KQDA 4CLCD 4DMZA 3F1PB 4Q0JA 3B42A 2W3EA 1DP9A 5TBMB 3EEHA 4O0PA 5LBRA 4GCZA 3KYZA 4R38A 2O99A 4IUHA 1OPXA 4WEKA 3FC7A 4M4XA 3SW1A 2VKSA 1P97A 4DJ2A 3S7OA 3PBQA 3T4JA 2XA7S 3KSIA 4I3JA 3K3CA 4EQ1A 3A0RA 2W3FA 5HD5A 3MMHA 2W1TA 2P04A 1X0OA 4G3WA 1OTBA 2ZOIA 2CMNA 3MF0A 3ZQ5A 3S7NA 3PBSA 4HJ6A 3CAXA 3NOPC 4RQ9A 5HDDA 5IS1A 1TS6A 3P01A 4NKPA 3HJKA 1MZUA 3KYQA 1OTDA 4HH2A 4K08A 1H3QA 5KIZA 3G6OA 1XJ6A 1XJ4A 2INWA 2QWSA 4FSFA 4HP9A 2JKRI 2G7UA 4EU0A 3V67A 5DJUA 1S67L 3LR0A 1TS8A 3CI6A 3BQ8A 3JVUA 3O5YA 4BJPA 2JHEA 1NRJA 3LYXA 2MJ6A 3MQQA 4MN7A 2D02A 4BBVA 3IS2B 4WUJA 4CLCE 4Y2FA 4KUOA 4LLOB 3S7QA 3BW6A 3MXQA 3H82B 4AFIA 4NXGA 1NLYA 3FG8A 4PKYG 4LRZE 2OWHA 3T4KA 4P6ZS 2J3WA 3LUQA 3NOTC 2DMWA 3H7WA 3T4SA 4NXFA 2VV7A 5DFYA 4EERA 2GZAA 3TE8A 3CLOA 5J4EA 4WEJA 4HJ3A 4KUKA 4EEPA 3MFXA 2J3TC 4JGOA 2W3DA 4HP4A 2JKTM 1XFNA 3EGDC 1JNUA 4BMWA 4ZRRA 3KSHA 2LB9A 4GHIB 3C8CA 4MMNA 5HPIA 2I9VA 2WKRA 3R7WB 1UWPX 4O8GA 2A24A 4MN5A 2YKFA 3CWFA 1T18A 1G28A 5J7EA 1OT9A 3A0VA 5MC7A 3PBOA 4G3KA 1UWNX 2QJ5A 4JGRA 2ZMFA 3NJAA 4EESA 1LSXA 4MN6A 4F3LA 1LT0A 2VV8A 1OJGA 3T4TA 3MQ0A 4JGPA 1STZA 2PD7A 2HGVA 2QYBA 1VHMA 4GJ4A 3EQUA 4E04A 2D01A 1DRMA 5F6AA 5G4ZA 4WL9A 1TS0A 1NWZA 5IU1A 1D06A 3BJNA 5DKKA 3ZYTA 3UB7A 1TF1A 5AJGA 4PKYA 4HI4A 4CQHA 2R78A 2BASA 2KX6A 3F1NA 1ZHHB 3MJQA 3OC2A 2GX5A 1S1YA 4LRYC 5J3WA 3LIBA 3D72A 1NLZA 3K3DA 4LRXC 4II7A 2W1TB 5EFWA 1UGUA 3UB9A 2YKHA 3UMDA 4LPZA 1F5MA 3K2NA 3PBNA 4L9FA 3VE4A 1GSWA 1S4RA 2VGLS 4I3IA 2V0WA 1D7EA 1TD5A 5CX7A 5F69A 2FH5A 2OOLA 4ARZA 4O01A 2L1MA 3TW8A 3T4LA 4YOFA 1N9OA 3R4KA 3PBTA 3PR6A 1GSXA 4BBTA 1T1BA 3VV4A 2VLGA 5F68A 3GECA 1OTAA 1OT6A 4IJGA 1OTEA 2M7VA 2V9AA 3LFVA 2J3TD 3LI8A 1W63Q 1LSVA 3HCYA 4KQOA 4MDZA 4B9OA 3MR0A 2QKPA 3F1OA 3H7WB 1N9NA 4Q0IA 1V9YA 3VOLA 5DKLA 2JKTI 2HV1A 3UE3A 2K7SA 4NXBA 3T50A 3U2AA 3RTYA 1N9LA 2O9BA 4PAUA 3E98A 2K2NA 2VV6A 4IHQA 3EQVA 3NHQA 3KSGA 3BWLA 3T4QA 4MCWA 4QPRA 4UQIM 3PBRA 1WA9A 1T1CA 1T19A 4EW7A 3DBAA 5L8MA 4HHDA 1W63M 2A24B 1YKDA 2ZBBA 1YSPA 2M1CA 4OOLA 2GNXA 3LR4A 2P08A 3LIDA 2JN7A 3UMEA 4H6JA 3VE3A 3NOUC 1ODVA 3LR5A 4XT2A 3FPWA 3RFBA 3MQOA 3C38A 4PHTA 2H28A 4F3LB 3UB8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WLA A;  4L9E A;  4R3A A;  3BY9 A;  4GW9 A;  2QHK A;  5HZH A;  3A0S A;  1Y28 A;  4I3A A;  4DJ3 A;  1LL8 A;  3GDI A;  2WKQ A;  4NXE A;  1S1Z A;  3F1N B;  5AVF A;  1V9Z A;  2Z6C A;  1VB6 A;  1TS7 A;  4GS9 A;  1T1A A;  1LSW A;  4JGQ A;  5A8B A;  2J80 A;  3LIC A;  3UE6 A;  4HH3 A;  1XJ2 A;  3C2W A;  1P0Z A;  2V0U A;  4L9G A;  3P7N A;  3F1P A;  4HQA A;  2PYP A;  4I39 A;  5F5Y A;  5TBM A;  4WN5 A;  1XFQ A;  3LIA A;  4EET B;  2PHY A;  3PHY A;  3B33 A;  5AVE A;  2V1B A;  5HDC A;  2PR6 A;  3ULF A;  2PYR A;  4BBU A;  3BY8 A;  4HY8 A;  3LIE A;  5G4Y A;  4I38 A;  3H9W A;  4HJ4 A;  3LI9 A;  2KDK A;  3ICY A;  4R6L A;  3HJI A;  1S66 L;  3E4P A;  4HNB A;  1BYW A;  4R70 A;  3F1O B;  5HWW A;  4I5S A;  3RH8 B;  1DP6 A;  5I5L A;  1S4S A;  4HIA A;  1GSV A;  2GJ3 A;  3LIF A;  1OJ5 A;  3IS2 A;  3E4Q A;  4EXO A;  4EEU A;  3H82 A;  1OTI A;  3E4O A;  1F9I A;  3IBR A;  2L4R A;  2P7J A;  4H6J B;  5HWT A;  4XT2 B;  2Z6D A;  2PR5 A;  4YWZ A;  3PYP A;  2W0N A;  1DP8 A;  2OWJ A;  4HOI A;  5HDS A;  3OLO A;  2ZOH A;  4GHI A;  1F98 A;  2PDR A;  2WKP A;  2B02 A;  2VEA A;  4WF0 A;  5DJT A;  2QJ7 A;  3UB6 A;  5HWV A;  3EWK A;  1KOU A;  2L0W A;  2V1A A;  2EA9 A;  2PD8 A;  4GS9 B;  5HD3 A;  5HSQ A;  1EW0 A;  3KX0 X;  2W27 A;  1XJ3 A;  4KQD A;  3F1P B;  1DP9 A;  5TBM B;  3EEH A;  4GCZ A;  4R38 A;  3FC7 A;  4M4X A;  3SW1 A;  1P97 A;  4DJ2 A;  4I3J A;  3K3C A;  4EQ1 A;  3A0R A;  5HD5 A;  1X0O A;  1OTB A;  2ZOI A;  2CMN A;  3ZQ5 A;  4HJ6 A;  3CAX A;  3NOP C;  4RQ9 A;  5HDD A;  5IS1 A;  1TS6 A;  3HJK A;  1MZU A;  1OTD A;  4HH2 A;  4K08 A;  5KIZ A;  3G6O A;  1XJ6 A;  1XJ4 A;  2INW A;  2QWS A;  4HP9 A;  5DJU A;  1S67 L;  1TS8 A;  2JHE A;  3LYX A;  3MQQ A;  2D02 A;  4BBV A;  3IS2 B;  4WUJ A;  4KUO A;  4LLO B;  3MXQ A;  3H82 B;  4NXG A;  3FG8 A;  4PKY G;  4LRZ E;  2OWH A;  3LUQ A;  3NOT C;  3H7W A;  4NXF A;  2VV7 A;  4EER A;  3CLO A;  5J4E A;  4HJ3 A;  4KUK A;  4EEP A;  3MFX A;  4JGO A;  4HP4 A;  1XFN A;  1JNU A;  4GHI B;  3C8C A;  2I9V A;  2WKR A;  1UWP X;  2A24 A;  4MN5 A;  2YKF A;  3CWF A;  1T18 A;  1G28 A;  5J7E A;  1OT9 A;  3A0V A;  1UWN X;  2QJ5 A;  4JGR A;  3NJA A;  4EES A;  1LSX A;  4MN6 A;  4F3L A;  1LT0 A;  2VV8 A;  1OJG A;  4JGP A;  2PD7 A;  4E04 A;  2D01 A;  1DRM A;  5F6A A;  5G4Z A;  4WL9 A;  1TS0 A;  1NWZ A;  5IU1 A;  1D06 A;  5DKK A;  3UB7 A;  4PKY A;  4HI4 A;  2R78 A;  2BAS A;  3F1N A;  3MJQ A;  2KX6 A;  1S1Y A;  4LRY C;  5J3W A;  3LIB A;  3D72 A;  3K3D A;  4LRX C;  5EFW A;  1UGU A;  3UB9 A;  2YKH A;  3UMD A;  4LPZ A;  4L9F A;  3VE4 A;  1GSW A;  1S4R A;  4I3I A;  2V0W A;  1D7E A;  5F69 A;  2OOL A;  2L1M A;  1N9O A;  1GSX A;  4BBT A;  1T1B A;  2VLG A;  5F68 A;  3GEC A;  1OTA A;  1OT6 A;  1OTE A;  2V9A A;  3LI8 A;  1LSV A;  4B9O A;  3MR0 A;  2QKP A;  3F1O A;  3H7W B;  1N9N A;  1V9Y A;  3VOL A;  5DKL A;  2HV1 A;  2K7S A;  4NXB A;  3T50 A;  3RTY A;  1N9L A;  2VV6 A;  3NHQ A;  3BWL A;  1WA9 A;  1T1C A;  1T19 A;  4EW7 A;  4HHD A;  2A24 B;  2ZBB A;  2M1C A;  3LID A;  3UME A;  2JN7 A;  4H6J A;  3VE3 A;  3NOU C;  1ODV A;  4XT2 A;  3MQO A;  2H28 A;  4F3L B;  3UB8 A; 
#chains in the Genus database with same CATH topology
 1D1J A;  4GW9 A;  5L2F A;  2HJE A;  5KSH A;  2C5W B;  5HZH A;  1Y28 A;  4I3A A;  3IF6 C;  3C30 A;  1IEM A;  3KO6 A;  3HUO A;  4OQG A;  3OPH A;  1K4F A;  4HBU A;  3ZVW A;  5AVF A;  4YNR A;  4RVA A;  3ITB A;  4QHC A;  4GS9 A;  1T1A A;  3ZVT A;  4Y0U A;  2VGJ A;  1P9R A;  4EUV A;  1LSW A;  4JGQ A;  2JKF A;  3LIC A;  4PM6 A;  3UE6 A;  1BUL A;  3OCL A;  4LFU A;  3IXH A;  4UEY A;  1TDG A;  2Y79 A;  2PYP A;  5CEB A;  5TBM A;  1XFQ A;  5DTS A;  3LIA A;  4EET B;  1YM1 A;  3MKE A;  1PWG A;  4CLC C;  3KYE A;  1S6R A;  3CUE A;  1YLT A;  3C7V A;  3LIE A;  3OOV A;  4ETZ A;  2VZW A;  1J9M A;  5FQQ A;  3H9W A;  3TJZ C;  3WS2 A;  3BFF A;  4GNU A;  4D60 A;  1ES5 A;  3TRC A;  3Q7V B;  4R6L A;  3G34 A;  1G6O A;  3NEC A;  1YAX A;  5EEC A;  2NUP C;  2ZM8 A;  1TEM A;  1Z09 A;  2ACG A;  1K55 C;  4R70 A;  2XEP A;  1KE3 A;  4LGW A;  1FR6 A;  3ZG5 A;  1S4S A;  2GJ3 A;  2HP9 A;  3IF6 B;  1K38 A;  4WZ4 A;  4EXO A;  1N4O A;  3H82 A;  3M6B A;  3V5M A;  4MBF A;  2J9P A;  3V3S A;  1F9I A;  1WYC A;  3ZHH A;  3QNB A;  2OAP 1;  4Y5F A;  1HVB A;  2XDM A;  1BLP A;  5FEF A;  4H6J B;  4L0L A;  4OLG A;  5A91 A;  4X1M A;  1P9W A;  1SKO A;  4OKP A;  1ALQ A;  5EOE A;  4ZAM A;  2IWD A;  4N1H A;  4HOI A;  2ZOH A;  4ZJ1 A;  3UE1 A;  4O7D A;  4CLC B;  2WAE A;  3A3F A;  5E43 A;  3UPP A;  1ZG6 A;  1NZU A;  1M6K A;  4KG6 A;  1IOU A;  4B88 A;  5HWV A;  2DNS A;  4XUX A;  2PU4 A;  2L0W A;  2WAD A;  2V1A A;  2ZC5 B;  3ZG0 A;  4BD0 A;  1ES3 A;  4PM8 A;  5AQA A;  3IWO A;  3QP1 A;  3HLW A;  5CER A;  2W3G A;  2XRN A;  5DF8 A;  2VJW A;  5HAQ A;  4DMZ A;  3W4P A;  4U0X A;  4JKT A;  4JPM A;  4S2N C;  5FQI A;  3T1Q B;  4P6B A;  4GCZ A;  1XX2 A;  4IUH A;  1P97 A;  4R4R A;  5L10 A;  4DJ2 A;  4U3T A;  3S7O A;  3KSI A;  4KZ6 A;  4I3J A;  1Q2Q A;  3K3C A;  1KGF A;  5HD5 A;  1G6A A;  4JBF A;  2P04 A;  3MZE A;  4G3W A;  1OTB A;  4GB7 A;  3ZQ5 A;  1HZO A;  4HJ6 A;  2Y2N A;  1K0K A;  1MWU A;  3ZGA B;  1VET A;  1BLH A;  3NC8 A;  3QHY A;  1OTD A;  4K08 A;  5KIZ A;  2INW A;  4E3M A;  4DF6 A;  3BQ8 A;  1KDS A;  2HP5 A;  2MJ6 A;  1DJA A;  5E2F A;  4OH0 A;  4KUO A;  3MXQ A;  4ESP A;  2C6W B;  2WGW B;  4RX3 A;  4NXG A;  3GQZ A;  3RJU A;  5FQJ A;  2OWH A;  1K54 C;  3LUQ A;  1PFL A;  2VV7 A;  3P09 A;  3CLO A;  4EEP A;  2J3T C;  3O88 A;  4E6W A;  4HP4 A;  5CGW A;  3L7H A;  3CZD A;  4MEZ A;  3N6I A;  1SDN A;  4KG5 A;  4ZRR A;  2XD1 A;  4P85 A;  1W5D A;  4GHI B;  4Z9Q A;  4E3L A;  5HPI A;  3Q81 A;  4KZ4 A;  2ZQ7 A;  4QU3 A;  4R3B A;  4MN5 A;  2YKF A;  1SKF A;  1T18 A;  1G28 A;  5J7E A;  1MXO A;  5EV0 A;  2WAF A;  2Y2L A;  1LL9 A;  3A3E A;  2XH9 A;  4LCM A;  3PBO A;  4JGR A;  1I2S A;  2ZMF A;  3NJA A;  2Y91 A;  4EES A;  1LSX A;  1LT0 A;  1OJG A;  4JGP A;  2HGV A;  3D9Y A;  1JWP A;  4EBN A;  4GJ4 A;  3EQU A;  2D01 A;  1FCN A;  1D06 A;  5DKK A;  3W8K A;  5EVE A;  4BQM A;  4CQH A;  4U0T A;  5E2E A;  2XR0 A;  1ZHH B;  2Y2O A;  3MJQ A;  1S1Y A;  5J3W A;  4R3J A;  2IWC A;  1NRF A;  3QP4 A;  2W1T B;  4KG2 A;  4PM9 A;  1RGZ A;  1ONH A;  2UWX A;  4XUZ A;  1F5M A;  3PAE A;  3PBN A;  4YFM A;  1PWC A;  4R4S A;  5HL1 A;  3G2Y A;  3HLC A;  1D7E A;  2PBD P;  3ZCZ A;  4JF4 A;  2AVX A;  4ARZ A;  2ZL1 A;  2L1M A;  3VP4 A;  1G68 A;  1XGJ A;  1PZP A;  3UY6 A;  4M3K A;  1CJF A;  3R4K A;  3PBT A;  3PR6 A;  4MBK A;  4BBT A;  3VV4 A;  4UA7 A;  5F68 A;  1OTA A;  2M7V A;  1W63 Q;  1TDL A;  2Y2K A;  4C75 A;  1K6S A;  3F1O A;  4Q0I A;  1V9Y A;  1MKI A;  3TSG A;  5EE8 A;  3JYI A;  2BLS A;  3FWL A;  4S2P A;  1IYO A;  3B3X A;  3E98 A;  4PAU A;  5A90 A;  4K0W A;  4IHQ A;  3UDX A;  3NHQ A;  3KSG A;  5DTK A;  4BEN A;  3T4Q A;  3HUN A;  4OP8 A;  1YKD A;  3GV9 A;  3ZNT A;  3UE0 A;  5FDS A;  3LID A;  3UME A;  2J9O A;  1EWZ A;  2ZQC A;  5M1A A;  3FPW A;  3N4I A;  3DTK A;  3CIT A;  3GR2 A;  5HW3 A;  2BG1 A;  4WBG A;  4ETX A;  1I2W A;  5KZH A;  4LV0 A;  1BTL A;  3MKF A;  5FDH A;  1LL8 A;  1L0G A;  2Y4A A;  1G5U A;  2WKQ A;  4WEL A;  4NXE A;  1L3L A;  1J3W A;  2OSU A;  3SS5 A;  4NET A;  1V9Z A;  2WKH A;  1YSQ A;  1TS7 A;  4JXW A;  3BQA A;  3JVV A;  2B18 A;  3BLM A;  4LV3 A;  3O87 A;  3VP1 A;  2V0U A;  3W4Q A;  4OOY A;  1FCM A;  4HQA A;  2Z2L B;  3M2K A;  4I39 A;  5F5Y A;  2V8F A;  4WN5 A;  3RXX A;  3HLB A;  5KSC A;  2OAQ 1;  5EVL A;  3B33 A;  1FIK A;  3UB5 P;  2V1B A;  3ULF A;  2ZQ8 A;  2PYR A;  3ZNY A;  2VGK A;  2EX8 A;  5FI2 A;  5G4Y A;  1PYY A;  4HJ4 A;  1JTD A;  2WKE A;  4S2K A;  5FQK A;  3EOI A;  4Z1W A;  3IHA A;  1H8Z A;  3SH7 A;  3G35 A;  4MNR A;  3E4P A;  3WS4 A;  4HNB A;  1BYW A;  2XA7 M;  2ZJ9 A;  5FI7 A;  3VSK A;  4DDY A;  2XQZ A;  1IYQ A;  1W79 A;  3OPP A;  4H8R A;  1PNE A;  3RH8 B;  1DP6 A;  5I5L A;  1H0M A;  2ZLY A;  1GSV A;  2ZM0 A;  1OJ5 A;  1NYM A;  3UNW A;  3CUE C;  4BLM A;  3A3I A;  4EEU A;  3S7P A;  3E4O A;  3VOZ A;  5EM1 A;  3IBR A;  2Y2H A;  3IT9 A;  3PXP A;  4JF5 A;  4R1G A;  5CXW A;  3VFF A;  3B47 A;  1W8Y A;  4K91 A;  5TJJ A;  3CPT A;  4XT2 B;  2EX6 A;  3D4F A;  3LCE A;  3NI9 A;  2PR5 A;  4E3N A;  4YWZ A;  3PYP A;  1JWV A;  2X71 A;  2W0N A;  1XA7 A;  4OON A;  3V50 A;  1PZO A;  1F98 A;  2B02 A;  4B4Z A;  2VEA A;  1BUE A;  3R7W A;  3NUL A;  2PT7 A;  3DTE A;  1PIO A;  2ZC6 B;  3FPV A;  4N92 A;  2QJ7 A;  4G3V A;  3OCN A;  5HPF A;  1LL5 A;  4Y3I A;  1FIL A;  5K5B A;  1JWZ A;  2PD8 A;  4GS9 B;  5G18 A;  2Q9M A;  4IUK A;  4IVK A;  1EW0 A;  1XKZ A;  4QY6 A;  2FFY A;  1XJ3 A;  2OLU A;  4KQD A;  5BOH A;  2W3E A;  2XFT A;  1DP9 A;  5TBM B;  5GLA A;  3BFD A;  3MZD A;  5CTN A;  4ZJ2 A;  4R38 A;  2O99 A;  1KDW A;  4OQH A;  2B95 A;  1OPX A;  5EVI D;  3SW1 A;  5E2G A;  3ZDJ A;  4LCL A;  2XA7 S;  4B4X A;  3HLG A;  4JLF A;  2H10 A;  2WKI A;  1E3U A;  4JXV A;  1K57 A;  4DE2 A;  2CMN A;  3NOP C;  4RQ9 A;  3DWZ A;  4XXR A;  3QP6 A;  3HJK A;  1MZU A;  5FAO A;  1XJ6 A;  4FSF A;  4GZB A;  1S67 L;  4PM7 A;  3JVU A;  3O5Y A;  4BJP A;  1NRJ A;  4P87 A;  4E3J A;  4BBV A;  1L0F A;  2WUQ A;  4OPZ A;  3S7Q A;  4X25 A;  3BW6 A;  3H82 B;  1ZKJ A;  1YLZ A;  2EFU A;  4WMC D;  4LRZ E;  2H0Y A;  4HBT A;  2J7V A;  1PI5 A;  3H7W A;  1MPL A;  2GZA A;  4KUK A;  3Q07 A;  2E8J A;  1SKO B;  1PW8 A;  3LGO A;  3Q1F A;  1LHY A;  2JKT M;  5D3O A;  4BMW A;  4DRT A;  1VM1 A;  2ZC7 A;  3GRJ A;  3KSH A;  2LB9 A;  4EWF A;  3IXG A;  2Y59 A;  1OME A;  5CED A;  1CQA A;  2Y2I A;  1YLP A;  4BL2 A;  3CWF A;  3A0V A;  5MC7 A;  1UWN X;  1Y54 A;  4GKU A;  1WE4 A;  4MN6 A;  2UV0 E;  3DTI A;  3T4T A;  3OPL A;  5GLC A;  3M6H A;  2DRW A;  2WZZ A;  4X6T A;  1VHM A;  5F6A A;  5G4Z A;  4WL9 A;  1NWZ A;  5IU1 A;  4DKI A;  3UB7 A;  1TF1 A;  5AJG A;  5FAT A;  4PKY A;  2J8Y A;  4HI4 A;  4PMA A;  4UA9 A;  2KX6 A;  3F1N A;  4KZB A;  4LRY C;  3K3D A;  4LRX C;  5FQ9 A;  5EFW A;  2R9W A;  4QY5 A;  4WZ5 A;  5DF7 A;  1RCJ A;  1A0K A;  3UMD A;  4KZ3 A;  3K2N A;  3VE4 A;  2IWB A;  1GSW A;  4I3I A;  5CGX A;  1MWT A;  1VET B;  5CX7 A;  5F69 A;  3PTE A;  2X01 A;  4DE1 A;  4LV1 A;  3SZT A;  2Y2Q A;  1O07 A;  3T4L A;  3OPR A;  5CHJ A;  1N9O A;  1T1B A;  3HRE A;  4IJG A;  1OTE A;  1HTZ A;  3LFV A;  1LSV A;  1KVM A;  5M19 A;  4WYY A;  2P74 A;  4KQO A;  3DAV A;  2JKT I;  2CC1 A;  3HLD A;  1K56 A;  1M40 A;  4NXB A;  3T50 A;  3PAG A;  3U2A A;  3E2L A;  3RTY A;  1N9L A;  4OQI A;  3C4O A;  5JYO A;  5CRF A;  3EQV A;  1ESU A;  4UQI M;  1T1C A;  5GHY A;  4FCF A;  3DBA A;  4X69 A;  5IHV A;  5L8M A;  4C3Q A;  2WZX A;  1YSP A;  1XA1 A;  2QPN A;  5FQM A;  1AWI A;  3LR4 A;  3VE3 A;  3LY3 A;  3RFB A;  3MQO A;  3C38 A;  5E2H A;  3G30 A;  2E8I A;  2H28 A;  3BFE A;  4WLA A;  2KLI A;  5F82 A;  3TG9 A;  4L9E A;  2V20 A;  3BY9 A;  1K25 A;  1YLY A;  3WS1 A;  4CPK A;  4JXG A;  3A0S A;  1E25 A;  4K0X A;  4DJ3 A;  2PRF A;  4S2J A;  5HL6 A;  3T1R A;  3GDI A;  1NY0 A;  1YPR A;  2O9A A;  1S1Z A;  5EVI A;  1GA0 A;  2Z6C A;  4DE3 A;  3W2Z A;  3S4X A;  1ESI A;  1MC0 A;  1YMX A;  3C2W A;  4GD6 A;  2IA2 A;  1H8M A;  3P7N A;  3F1P A;  4E3I A;  2Y2M A;  1VEU A;  5L07 A;  2QZ6 A;  5EUA A;  4ARZ B;  2ZL1 B;  5CTM A;  1CEF A;  5KMW A;  3BY8 A;  4HY8 A;  2XF3 A;  4I38 A;  3U4L P;  2ZMV A;  5HX9 A;  1SCW A;  4UA6 A;  3LI9 A;  2KDK A;  3ICY A;  1QME A;  4GD8 A;  5CHM A;  4OP5 A;  4UQI S;  1HLU P;  4A5R A;  2XD5 A;  2JCH A;  4WMC A;  3F1O B;  3VP0 A;  5HWW A;  1VQQ A;  1NXY A;  4ZTK A;  4GN2 A;  4DXB A;  2JC7 A;  2A2L A;  4RA7 A;  1KVL A;  4HIA A;  2G2U A;  2GDN A;  4KZ5 A;  3OBF A;  1PRQ A;  3T12 B;  2VGL M;  2W1R A;  3IS2 A;  1PWD A;  1YQS A;  3VP3 A;  2EWW A;  2HDQ A;  3WRZ A;  3IQA A;  3IH9 A;  4GDB A;  4LEN A;  3T1X A;  2L4R A;  3O3V A;  2O9C A;  3E0Y A;  3S1Y A;  1U60 A;  2P9V A;  5GHZ A;  5HWT A;  4ME4 A;  1CI8 A;  2EWV A;  2Z6D A;  1K6R A;  3EGX C;  5FAP A;  2ZD8 A;  5F83 A;  1DP8 A;  3OLO A;  1MY8 A;  2VX8 A;  2WYX A;  2PDR A;  2WKP A;  3L9K A;  4NEE D;  4Y0O A;  1YT4 A;  3FV7 A;  4WF0 A;  4OOM A;  4P6Z M;  1CK3 A;  3S22 A;  3V3R A;  1K4E A;  2KOI A;  4DN0 A;  2DCF A;  4IVI A;  3EEA A;  2Y55 A;  3G32 A;  2EA9 A;  3MS6 A;  5A92 A;  5HSQ A;  3ZG7 B;  2W27 A;  3KSF A;  4B93 A;  4CLC D;  3CG5 A;  4BD1 A;  4Q0J A;  3DTM A;  4KZ8 A;  4O0P A;  2ZMA A;  5TGF A;  4WEK A;  4M4X A;  3AGD A;  2Q0O A;  1IKG A;  4EQ1 A;  3MMH A;  1X0O A;  4DDS A;  3N8R A;  2ZOI A;  3LO7 A;  3N7W A;  4KEN B;  3CAX A;  3G4P A;  2Y2J A;  4FUW A;  1TS6 A;  3FKV A;  3NY4 A;  4NKP A;  4ZDX A;  4WM9 A;  4E3O A;  4HH2 A;  3O86 A;  3JPU A;  1I5Q A;  3G6O A;  4E6X A;  2QWS A;  1ES4 A;  3AGE A;  4DXC A;  1BLS A;  3SH8 A;  3V67 A;  2WK0 A;  5DJU A;  3CI6 A;  2JHE A;  5JYP A;  4FH4 A;  3BM6 A;  4OPR A;  4X53 A;  4LLO B;  3ZG9 B;  3GTC A;  5FAQ A;  2V1Z A;  2EX2 A;  1K57 C;  4PKY G;  3T4K A;  4P6Z S;  3A3D A;  2J3W A;  3NOT C;  1GHP A;  3UPO A;  3T4S A;  4EER A;  3TE8 A;  5J4E A;  4KZ7 A;  3CPT B;  4JGO A;  2A3U A;  2W3D A;  5CHU A;  4HEF A;  3IH8 A;  1XFN A;  3EGD C;  1RP5 A;  4FTX A;  2ZC4 B;  3LEZ A;  5FA7 A;  3C8C A;  4E3K A;  4UHU A;  2WKR A;  4MLL A;  4DE0 A;  2JBF A;  4UAA A;  3R7W B;  1UWP X;  2A24 A;  4BL3 A;  1OT9 A;  5FAS A;  3BEB A;  1XXM A;  3MZF A;  4G3K A;  1TVF A;  1DJC A;  3BFG A;  2FFF B;  1Z6F A;  4F3L A;  2VV8 A;  3RXW A;  3MQ0 A;  1STZ A;  4R23 A;  2PD7 A;  2OLV A;  1GCE A;  2QYB A;  4E04 A;  2Y2P A;  1EI5 A;  3QNC A;  3VP2 A;  3BJN A;  5AQ7 A;  3V39 A;  4KQQ A;  1WYB A;  3UDI A;  2BAS A;  3OC2 A;  1IYP A;  3IHB A;  3AGF A;  3BLS A;  3LIB A;  3IXB A;  1O7E A;  1XPB A;  3QP2 A;  4X1L A;  4ZJ3 A;  1UGU A;  3DW0 A;  3UB9 A;  2YKH A;  2Q9N A;  3OZH A;  1PW1 A;  4L9F A;  5FSR A;  4KQR A;  3NDG A;  3IX4 A;  3UPN A;  1QMF A;  1TD5 A;  2V8C A;  3ZFZ A;  2OOL A;  1C3B A;  4O01 A;  5I94 A;  3LEQ A;  4X56 A;  1YLW A;  2Z2M B;  4MBH A;  3IWI A;  4YOF A;  3BFC A;  3CMZ A;  1CEG A;  4N9L A;  1GHM A;  2VLG A;  1KGE A;  2PBY A;  1OT6 A;  3FYZ A;  2V9A A;  3Q7V A;  2J3T D;  4WZ5 C;  4Y13 A;  4Y7P A;  2ZQA A;  1SDE A;  4MDZ A;  3MR0 A;  1SZV A;  4GOG A;  4HES A;  3H7W B;  4P0M A;  2HV1 A;  2K7S A;  3SS3 A;  2HPB A;  1DY6 A;  5FI6 A;  3IF6 A;  3VMA A;  2K2N A;  2A49 A;  5L09 A;  3UDF A;  3IWQ A;  2XLN A;  4MCW A;  4QPR A;  5F1G A;  4EW7 A;  1RGY A;  4HHD A;  4R0Q A;  1YLJ A;  4OQ0 A;  4NK3 A;  3NDE A;  1W8Q A;  5GL9 A;  2PU2 A;  5A93 A;  4OOL A;  4N1X A;  2XGN A;  4H6J A;  1ODV A;  3LR5 A;  1E4D A;  3ZG8 B;  3CHW P;  3G31 A;  4PHT A;  4IED A;  3T1S A;  3UB8 A;  4PPR A;  5GHX A;  4R3A A;  2K31 A;  2V2F F;  2QHK A;  4GLQ A;  3TOI A;  2EX9 A;  4CLC A;  4EQI A;  5FEG A;  2B5R A;  2NUT C;  2O0Y A;  2EXA A;  1LI9 A;  3IBJ A;  4EBP A;  3GMW A;  3F1N B;  4BWI A;  4N9K A;  3SS4 A;  4FOF A;  3P98 A;  2Y8H A;  4JXS A;  4Y17 A;  1VB6 A;  4S2L A;  3UN7 A;  5A8B A;  2J80 A;  4HH3 A;  1XJ2 A;  1P0Z A;  3QP8 A;  4L9G A;  1K55 A;  1DJB A;  1FSW A;  1GA9 A;  3MXR A;  1H5X A;  2PHY A;  3PHY A;  1ES2 A;  3VSL A;  3GVB A;  3WS0 A;  1H8Y A;  2HF6 A;  5AVE A;  3T4O A;  5HDC A;  2PR6 A;  1MKM A;  4RX2 A;  5HAP A;  2XRO A;  2VK3 A;  4BBU A;  1S0W A;  3UO9 A;  3QP5 A;  5EVI C;  2M7U A;  1L0E A;  3C5A A;  3WRT A;  4EUZ A;  1FSY A;  5FL3 A;  2RL3 A;  1L0D A;  3DWK A;  2HP6 A;  3I7J A;  4Y15 A;  3HJI A;  4S2I A;  5DTT A;  1S66 L;  5DF9 A;  2G2W A;  2HJ9 C;  3D3O A;  5GLB A;  5GLD A;  5J8X A;  4I5S A;  1IFQ A;  1BT5 A;  3ISG A;  4QB8 A;  4LV2 A;  5IT5 A;  3LIF A;  2JKR M;  4S2O A;  2XSS A;  4Q8I A;  2HDR A;  3E4Q A;  1SHV A;  1ZTU A;  1NJ4 A;  2LB5 A;  1OTI A;  2WGW A;  4IBR A;  4NG2 A;  1MWS A;  4QWO A;  5HAR A;  1NZO A;  4ZBE A;  2VA0 A;  5DFX A;  2ZM2 A;  4QJG A;  3NIA A;  2P7J A;  2FZ0 A;  5C5K A;  2HDU A;  3FKW A;  2X02 A;  3MXS A;  4S2N A;  4D2O A;  1FR1 A;  3N8S A;  4PM5 A;  2OWJ A;  1LI0 A;  5HDS A;  3NCK A;  4GHI A;  1CI9 A;  4QD4 A;  5DJT A;  1FOF A;  3LR3 A;  4EBL A;  2W3H A;  2QMI A;  3C4P A;  3UB6 A;  3EWK A;  1KOU A;  5EVI B;  1PI4 A;  2I72 A;  5HD3 A;  4FD8 A;  4GDN A;  4Q0H A;  3KX0 X;  1ERQ A;  3N8L A;  3F1P B;  3B42 A;  2EFX A;  1XGI A;  3SH9 A;  1VEU B;  3EEH A;  5LBR A;  3M2J A;  3KYZ A;  2RCX A;  3FC7 A;  2VKS A;  2HDS A;  3PBQ A;  3T4J A;  3Q7Z A;  3A0R A;  2W3F A;  4OLD A;  2W1T A;  3MF0 A;  3S7N A;  3PBS A;  1K54 A;  5AQB A;  2H0T A;  5HDD A;  5IS1 A;  1IYS A;  3P01 A;  3IX3 A;  3HVF A;  5CGS A;  3KYQ A;  1JVJ A;  5TR7 A;  1H3Q A;  1ERM A;  3MFD A;  1XJ4 A;  1E3U D;  4HP9 A;  4ID4 A;  2JKR I;  2G7U A;  4EU0 A;  1L2S A;  1TS8 A;  3LR0 A;  1XP4 A;  2EXB A;  2WGV A;  5U47 A;  3LYX A;  2JE5 A;  3MQQ A;  4MN7 A;  2D02 A;  5HFO A;  3BYD A;  3IS2 B;  4WUJ A;  4CLC E;  4Y2F A;  1F2K A;  2XK1 A;  4KZ9 A;  3HLF A;  4YIN A;  4AFI A;  1ERO A;  1NLY A;  3FG8 A;  4RYE A;  3WWX A;  1KGG A;  4JF6 A;  3W4O A;  5M18 A;  2DMW A;  5F1F A;  4NXF A;  5DFY A;  3VFH A;  4WEJ A;  4HJ3 A;  2P9V B;  3MFX A;  1HD8 A;  3HUM A;  4X55 A;  1JNU A;  3BEC A;  3VOY A;  2OV5 A;  1IKI A;  4EV4 A;  1YMS A;  4MMN A;  3BRM A;  2I9V A;  1MBL A;  2R9X A;  4O8G A;  3G2Z A;  1ACF A;  2BTF P;  2WGI A;  2ZQ9 A;  3A3J A;  4CJN A;  4F94 A;  1LLB A;  5TFQ A;  1BZA A;  4KZA A;  2QJ5 A;  3MBZ A;  3HL9 A;  1AXB A;  3Q82 A;  3ITA A;  5HAI A;  3FZC A;  3HLE A;  1DRM A;  1IEL A;  1TS0 A;  2JKG A;  3ZYT A;  1GHI A;  2HZ5 A;  1Y4O A;  2R78 A;  2GX5 A;  2Y2G A;  4OVD A;  3D72 A;  1NLZ A;  5EPH A;  1FCO A;  4II7 A;  3CJM A;  3WS5 A;  4LPZ A;  4Y0T A;  1S4R A;  2VGL S;  3GSG A;  1BSG A;  2V0W A;  2FH5 A;  4C6Y A;  3IXD A;  1N9B A;  1CF0 A;  1Q2P A;  5EOO A;  4IBX A;  3TW8 A;  1KE4 A;  1ONG A;  1ZG4 A;  3SOI A;  1GSX A;  2XFS A;  3IF5 A;  3GEC A;  4S2M A;  1KE0 A;  5CEC A;  1W7F A;  3E2K A;  3LI8 A;  4OPY A;  1NYY A;  3LY4 A;  3HCY A;  1MWR A;  4B9O A;  5DVA A;  2QKP A;  5AQ9 A;  2H5S A;  1N9N A;  1BLC A;  3VOL A;  5DKL A;  1ZC2 A;  4OPQ A;  4FH2 A;  3UE3 A;  3HBR A;  2O9B A;  3IX8 A;  2VV6 A;  3BWL A;  4X68 A;  3PBR A;  1WA9 A;  1JTG A;  2ZC3 B;  1T19 A;  2PAV P;  1W63 M;  2A24 B;  3MSH A;  1K56 D;  2ZBB A;  2M1C A;  3C7U A;  2GNX A;  1FQG A;  3NBL A;  2P08 A;  2JN7 A;  2ZQD A;  3NOU C;  4XT2 A;  4F3L B;  5EM0 A; 
#chains in the Genus database with same CATH homology
 4WLA A;  2KLI A;  3CIT A;  4L9E A;  4R3A A;  3BY9 A;  4GW9 A;  2K31 A;  2HJE A;  2QHK A;  4GLQ A;  5KSH A;  4ETX A;  5HZH A;  3A0S A;  1Y28 A;  4CLC A;  4I3A A;  3C30 A;  1LL8 A;  4DJ3 A;  3KO6 A;  2NUT C;  5HL6 A;  2O0Y A;  3GDI A;  2WKQ A;  4WEL A;  4NXE A;  3IBJ A;  2O9A A;  1S1Z A;  4BWI A;  3F1N B;  5AVF A;  1V9Z A;  4FOF A;  2Z6C A;  4YNR A;  2Y8H A;  1VB6 A;  1YSQ A;  1TS7 A;  4GS9 A;  3W2Z A;  3BQA A;  1T1A A;  3JVV A;  1P9R A;  4EUV A;  1LSW A;  4JGQ A;  5A8B A;  2J80 A;  2B18 A;  3LIC A;  1MC0 A;  1XJ2 A;  4HH3 A;  3UE6 A;  3OCL A;  3C2W A;  1P0Z A;  2V0U A;  4UEY A;  2IA2 A;  1H8M A;  3P7N A;  4L9G A;  3F1P A;  4HQA A;  2Y79 A;  2PYP A;  4I39 A;  5F5Y A;  5TBM A;  4WN5 A;  1XFQ A;  3LIA A;  4EET B;  2PHY A;  3PHY A;  2OAQ 1;  3B33 A;  4ARZ B;  4CLC C;  2HF6 A;  5AVE A;  2V1B A;  3T4O A;  3CUE A;  5HDC A;  2PR6 A;  1MKM A;  3ULF A;  2XRO A;  2PYR A;  4BBU A;  3BY8 A;  4HY8 A;  3LIE A;  3OOV A;  5G4Y A;  4I38 A;  4ETZ A;  2ZMV A;  2VZW A;  3H9W A;  3TJZ C;  2M7U A;  4HJ4 A;  3LI9 A;  2KDK A;  3ICY A;  3EOI A;  4Z1W A;  5FL3 A;  3TRC A;  4UQI S;  4R6L A;  3HJI A;  1G6O A;  1YAX A;  2NUP C;  1S66 L;  3E4P A;  4HNB A;  1BYW A;  4R70 A;  2XA7 M;  5DF9 A;  2HJ9 C;  3D3O A;  3F1O B;  5HWW A;  4I5S A;  3RH8 B;  2A2L A;  1DP6 A;  1IFQ A;  5I5L A;  1S4S A;  4HIA A;  1GSV A;  2GJ3 A;  5IT5 A;  3LIF A;  3OBF A;  1OJ5 A;  2JKR M;  2VGL M;  2W1R A;  3CUE C;  2XSS A;  3IS2 A;  3E4Q A;  4EXO A;  1ZTU A;  4EEU A;  3H82 A;  2EWW A;  2LB5 A;  1OTI A;  3S7P A;  3E4O A;  2VA0 A;  1F9I A;  5DFX A;  3IBR A;  2L4R A;  3PXP A;  2OAP 1;  2P7J A;  3B47 A;  4Y5F A;  2O9C A;  3E0Y A;  2FZ0 A;  5C5K A;  4H6J B;  5TJJ A;  4L0L A;  5HWT A;  4XT2 B;  4ME4 A;  1P9W A;  2EWV A;  2Z6D A;  2PR5 A;  4YWZ A;  3PYP A;  3EGX C;  2W0N A;  1DP8 A;  2OWJ A;  4HOI A;  5HDS A;  3OLO A;  2ZOH A;  2VX8 A;  4GHI A;  1F98 A;  2PDR A;  2WKP A;  2B02 A;  2VEA A;  4NEE D;  4CLC B;  4WF0 A;  3R7W A;  4OOM A;  2PT7 A;  4P6Z M;  5DJT A;  2KOI A;  3LR3 A;  3FPV A;  2QJ7 A;  2W3H A;  4DN0 A;  4G3V A;  3UB6 A;  3OCN A;  1IOU A;  3EEA A;  5HWV A;  5HPF A;  3EWK A;  1KOU A;  2L0W A;  4Y3I A;  5K5B A;  2V1A A;  2EA9 A;  2PD8 A;  4GS9 B;  5HD3 A;  4IUK A;  4Q0H A;  5HSQ A;  1EW0 A;  3KX0 X;  2W27 A;  2W3G A;  2XRN A;  1XJ3 A;  2VJW A;  3KSF A;  4B93 A;  4KQD A;  4CLC D;  4DMZ A;  3F1P B;  4Q0J A;  3B42 A;  2W3E A;  1DP9 A;  5TBM B;  3EEH A;  4O0P A;  5LBR A;  4GCZ A;  3KYZ A;  4R38 A;  2O99 A;  4IUH A;  1OPX A;  4WEK A;  3FC7 A;  4M4X A;  3SW1 A;  2VKS A;  1P97 A;  4DJ2 A;  3S7O A;  3PBQ A;  3T4J A;  2XA7 S;  3KSI A;  4I3J A;  3K3C A;  4EQ1 A;  3A0R A;  2W3F A;  5HD5 A;  3MMH A;  2W1T A;  2P04 A;  1X0O A;  4G3W A;  1OTB A;  2ZOI A;  2CMN A;  3MF0 A;  3ZQ5 A;  3S7N A;  3PBS A;  4HJ6 A;  3CAX A;  3NOP C;  4RQ9 A;  5HDD A;  5IS1 A;  1TS6 A;  3P01 A;  4NKP A;  3HJK A;  1MZU A;  3KYQ A;  1OTD A;  4HH2 A;  4K08 A;  1H3Q A;  5KIZ A;  3G6O A;  1XJ6 A;  1XJ4 A;  2INW A;  2QWS A;  4FSF A;  4HP9 A;  2JKR I;  2G7U A;  4EU0 A;  3V67 A;  5DJU A;  1S67 L;  3LR0 A;  1TS8 A;  3CI6 A;  3BQ8 A;  3JVU A;  3O5Y A;  4BJP A;  2JHE A;  1NRJ A;  3LYX A;  2MJ6 A;  3MQQ A;  4MN7 A;  2D02 A;  4BBV A;  3IS2 B;  4WUJ A;  4CLC E;  4Y2F A;  4KUO A;  4LLO B;  3S7Q A;  3BW6 A;  3MXQ A;  3H82 B;  4AFI A;  4NXG A;  1NLY A;  3FG8 A;  4PKY G;  4LRZ E;  2OWH A;  3T4K A;  4P6Z S;  2J3W A;  3LUQ A;  3NOT C;  2DMW A;  3H7W A;  3T4S A;  4NXF A;  2VV7 A;  5DFY A;  4EER A;  2GZA A;  3TE8 A;  3CLO A;  5J4E A;  4WEJ A;  4HJ3 A;  4KUK A;  4EEP A;  3MFX A;  2J3T C;  4JGO A;  2W3D A;  4HP4 A;  2JKT M;  1XFN A;  3EGD C;  1JNU A;  4BMW A;  4ZRR A;  3KSH A;  2LB9 A;  4GHI B;  3C8C A;  4MMN A;  5HPI A;  2I9V A;  2WKR A;  3R7W B;  1UWP X;  4O8G A;  2A24 A;  4MN5 A;  2YKF A;  3CWF A;  1T18 A;  1G28 A;  5J7E A;  1OT9 A;  3A0V A;  5MC7 A;  3PBO A;  4G3K A;  1UWN X;  2QJ5 A;  4JGR A;  2ZMF A;  3NJA A;  4EES A;  1LSX A;  4MN6 A;  4F3L A;  1LT0 A;  2VV8 A;  1OJG A;  3T4T A;  3MQ0 A;  4JGP A;  1STZ A;  2PD7 A;  2HGV A;  2QYB A;  1VHM A;  4GJ4 A;  3EQU A;  4E04 A;  2D01 A;  1DRM A;  5F6A A;  5G4Z A;  4WL9 A;  1TS0 A;  1NWZ A;  5IU1 A;  1D06 A;  3BJN A;  5DKK A;  3ZYT A;  3UB7 A;  1TF1 A;  5AJG A;  4PKY A;  4HI4 A;  4CQH A;  2R78 A;  2BAS A;  2KX6 A;  3F1N A;  1ZHH B;  3MJQ A;  3OC2 A;  2GX5 A;  1S1Y A;  4LRY C;  5J3W A;  3LIB A;  3D72 A;  1NLZ A;  3K3D A;  4LRX C;  4II7 A;  2W1T B;  5EFW A;  1UGU A;  3UB9 A;  2YKH A;  3UMD A;  4LPZ A;  1F5M A;  3K2N A;  3PBN A;  4L9F A;  3VE4 A;  1GSW A;  1S4R A;  2VGL S;  4I3I A;  2V0W A;  1D7E A;  1TD5 A;  5CX7 A;  5F69 A;  2FH5 A;  2OOL A;  4ARZ A;  4O01 A;  2L1M A;  3TW8 A;  3T4L A;  4YOF A;  1N9O A;  3R4K A;  3PBT A;  3PR6 A;  1GSX A;  4BBT A;  1T1B A;  3VV4 A;  2VLG A;  5F68 A;  3GEC A;  1OTA A;  1OT6 A;  4IJG A;  1OTE A;  2M7V A;  2V9A A;  3LFV A;  2J3T D;  3LI8 A;  1W63 Q;  1LSV A;  3HCY A;  4KQO A;  4MDZ A;  4B9O A;  3MR0 A;  2QKP A;  3F1O A;  3H7W B;  1N9N A;  4Q0I A;  1V9Y A;  3VOL A;  5DKL A;  2JKT I;  2HV1 A;  3UE3 A;  2K7S A;  4NXB A;  3T50 A;  3U2A A;  3RTY A;  1N9L A;  2O9B A;  4PAU A;  3E98 A;  2K2N A;  2VV6 A;  4IHQ A;  3EQV A;  3NHQ A;  3KSG A;  3BWL A;  3T4Q A;  4MCW A;  4QPR A;  4UQI M;  3PBR A;  1WA9 A;  1T1C A;  1T19 A;  4EW7 A;  3DBA A;  5L8M A;  4HHD A;  1W63 M;  2A24 B;  1YKD A;  2ZBB A;  1YSP A;  2M1C A;  4OOL A;  2GNX A;  3LR4 A;  2P08 A;  3LID A;  2JN7 A;  3UME A;  4H6J A;  3VE3 A;  3NOU C;  1ODV A;  3LR5 A;  4XT2 A;  3FPW A;  3RFB A;  3MQO A;  3C38 A;  4PHT A;  2H28 A;  4F3L B;  3UB8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...