4R4SA

Crystal structure of chimeric beta-lactamase ctem-19m at 1.1 angstrom resolution
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPLTSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTDFLRQIGDKETRLDRIEPDLNEGKLGDLRDTTTPKAIASTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of chimeric beta-lactamase cTEM-19m
rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Beta-lactamase TEM,Beta-lactamase PSE-4
total genus 96
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2014-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4r4sA00
3A3FA 4LCMA 1ONHA 4U3TA 2PU4A 3M6BA 5GLBA 3E2KA 3VMAA 2HP6A 3FWLA 4U0TA 4MEZA 4DDSA 4XXRA 2HP5A 1JTGA 5CGWA 3W4OA 4UHUA 1SDNA 1ZC2A 2ZM0A 4N92A 1PIOA 5A90A 4QB8A 2IWDA 4HBTA 4E6WA 5FAOA 3NI9A 2P9VB 2WGWA 3B3XA 4Y0OA 3A3DA 4DXBA 1PWDA 5EUAA 3W8KA 5FASA 1BLSA 1ESIA 3G2ZA 5GHXA 1ESUA 1CI8A 1J9MA 1XKZA 3N4IA 1Q2PA 5M1AA 2HDQA 3FKVA 3N8SA 1BLCA 5D3OA 5E2FA 5GL9A 4EUZA 3E2LA 1ES2A 4OPRA 4BL2A 2PU2A 1NZOA 3IWIA 4S2NA 3C5AA 3BFEA 5TR7A 4B4XA 3IXDA 1CEFA 3GSGA 1O07A 3WWXA 2QPNA 5HX9A 4OLGA 4K0WA 3SH9A 3BFCA 5CHJA 1IYSA 5DF8A 3UDXA 3DW0A 4XUZA 4F94A 3Q82A 4E3KA 2X01A 4KG6A 4KZ4A 2QMIA 3GR2A 3W4QA 1K56A 3UY6A 2EX6A 1XGIA 2ZC5B 3BFGA 2H0TA 2R9WA 3MZFA 3IQAA 4KZ5A 2IWBA 2HP9A 4N1HA 1W8QA 2V20A 5A91A 4BLMA 5E2HA 2Y2QA 1FR1A 1K6RA 2WUQA 3GQZA 2XK1A 3O87A 4WELA 3WRZA 4QY5A 5JYOA 4KQQA 1FSWA 3VP0A 4KQRA 3ZVTA 1BT5A 5DTKA 5L2FA 1FCMA 4B4ZA 4WM9A 1PZPA 2J7VA 2EX9A 1I5QA 1YT4A 1PYYA 3VOZA 1GCEA 2EFUA 3ZG9B 3TSGA 4KZ8A 1ES5A 1IYOA 2A3UA 4GDBA 5M18A 4C75A 4QY6A 4P87A 4FH4A 4GDNA 4HESA 1JVJA 2EFXA 3PBSA 4GZBA 4S2PA 1K25A 4N9KA 4FCFA 2EXAA 3I7JA 4E3LA 5EVIB 4MNRA 5GLCA 4JF6A 3NIAA 1M40A 5U47A 1K55C 1PW1A 3HL9A 3Q7ZA 1FQGA 2ZQDA 1ERQA 5TGFA 4DF6A 5A93A 4MBKA 1YLZA 3MKFA 3UE1A 1XA1A 5KSCA 3GRJA 3SS3A 3HBRA 2Y2GA 4LV2A 1N9BA 1K38A 4JXGA 4OQGA 1M6KA 2A49A 1ALQA 5A92A 5GHYA 3IWOA 4OQHA 2JE5A 1K4FA 4JXVA 3MFDA 2XR0A 5CGSA 1JWVA 5JYPA 2WYXA 5HAQA 2UWXA 3Q1FA 4OPYA 1K57C 3UDIA 3DWZA 1LHYA 1LI9A 1WYBA 4LV1A 4OKPA 1W5DA 4X69A 5IHVA 2HDRA 4OQIA 5HAIA 4CPKA 5M19A 3OPHA 4R4RA 3PTEA 4R3BA 1I2WA 5FI2A 3MKEA 3GTCA 3OCLA 1MWTA 2FFFB 2IWCA 1HZOA 3EQVA 3LCEA 3MXSA 4L0LA 5E43A 4C6YA 3G30A 3N7WA 1E25A 4UA7A 4DKIA 5FAPA 3IT9A 5FQ9A 3ZNYA 1KE4A 1Y54A 4RVAA 3IHBA 4N1XA 4GN2A 3Q7VB 4IBRA 2WGVA 3OPRA 4YFMA 2EXBA 2C5WB 4DE3A 3NY4A 1GA9A 4OLDA 2Y2LA 3GV9A 4S2LA 5CEBA 3BFDA 1GHMA 2WZXA 3N6IA 3WRTA 2XH9A 3IXHA 1KE0A 3ZG5A 3IXBA 3VP4A 1N4OA 4U0XA 4S2JA 4YINA 3AGFA 2ZC7A 2G2UA 5CTNA 4OVDA 1AXBA 1KVMA 5FQJA 1PZOA 1LLBA 4BL3A 4PM8A 4ZJ1A 3A3EA 2WKHA 4KZ3A 2WK0A 4OP5A 3NDEA 5HARA 3IF6B 2OV5A 5AQ7A 3V50A 4EBNA 4ID4A 1HD8A 3CJMA 4FSFA 1BLPA 5FQIA 1ERMA 2J8YA 3D4FA 4JXSA 4EWFA 1PI4A 4NK3A 1TVFA 4IVIA 4R0QA 5BOHA 2C6WB 3HUMA 3HREA 3OPLA 2ZLYA 3ZG7B 3MBZA 1KGFA 1MY8A 4A5RA 1Z6FA 3O3VA 1VM1A 2XEPA 4R23A 1SHVA 1VQQA 2I72A 3VSKA 5F1FA 1Q2QA 2VGJA 4K0XA 4WBGA 3BEBA 1PWCA 3OC2A 4JF5A 2WAFA 3IF6A 5EVID 4IBXA 3A3JA 3BRMA 3G34A 5FQMA 3M2JA 4FD8A 5TFQA 4B88A 4H8RA 3ISGA 1MBLA 1IELA 1DJAA 1NRFA 1SKFA 5FI6A 1MXOA 3FV7A 3ZVWA 4ZDXA 3PBRA 4Q8IA 1L2SA 4WYYA 2BLSA 3G4PA 1CI9A 1RP5A 4JKTA 1NYYA 1WYCA 2XGNA 1PWGA 1YLJA 5KMWA 5HFOA 2PBYA 3UPNA 2CC1A 3G35A 3UE3A 4LV0A 5CGXA 3ZGAB 5DTTA 5FDHA 1GHPA 1XP4A 2QZ6A 3P09A 3N8RA 4UA9A 4S2KA 3VP2A 3S22A 2X71A 3BM6A 2Q9NA 2G2WA 3Q7VA 5DF7A 1ZG4A 4OP8A 2ZQ7A 4N9LA 1MKIA 3A3IA 4BENA 1LL5A 2Q9MA 4E3IA 4JXWA 2ZM2A 4DRTA 3GVBA 1GA0A 4S2OA 4DXCA 1IKIA 2Y2JA 4WZ5C 2ZM8A 2H10A 4X55A 1K4EA 4D2OA 5FAQA 2B5RA 1MWUA 4DE2A 2Y2NA 1NY0A 1ES3A 4QU3A 5KSHA 1I2SA 1YMSA 4KZBA 3WS2A 1YLYA 4GOGA 1TEMA 1G6AA 4S2IA 4PM5A 1K54A 1H8ZA 2Y2PA 1YLWA 3M2KA 2HDSA 4JLFA 3HLEA 2V2FF 3VSLA 4BD1A 2WADA 5CEDA 1LI0A 4OH0A 5AQBA 3FZCA 3OZHA 3ZG0A 3GMWA 2Y2MA 3EQUA 1JWPA 1YLTA 3PBOA 3V3SA 1NYMA 3JYIA 4LV3A 4X53A 4HEFA 4K91A 3HLDA 5DVAA 3TG9A 5I94A 1RGZA 2H5SA 3C7UA 3PAEA 3AGEA 1EWZA 3HLWA 1QMEA 4OPZA 5HW3A 2Y2HA 4NETA 3HLFA 2WGWB 2XFTA 5CRFA 3SH7A 1MWRA 5EVIA 1MWSA 3VFFA 5CHMA 2WAEA 2Y55A 3C4OA 3BFFA 5EPHA 5FATA 2XD1A 3RXXA 3UPOA 3M6HA 3V3RA 1S6RA 5FI7A 4XUXA 1KGEA 2ZQAA 3C4PA 5CXWA 2ZD8A 4MBHA 4FH2A 3IH8A 1TDLA 4X68A 4PM6A 3CZDA 1FR6A 1ES4A 4JBFA 1JWZA 4X6TA 4HBUA 1ONGA 3V5MA 2ZC6B 1IKGA 1NXYA 2ZC4B 1YQSA 3RXWA 4GNUA 5EE8A 5F1GA 4WEKA 4LCLA 4OOLA 5F83A 1XX2A 3LY4A 4GD6A 3ZDJA 3FYZA 1L0FA 1XGJA 2VGKA 4Y0UA 5EVLA 2P74A 2ZC3B 4RYEA 3NDGA 4PM9A 1DJBA 2OLUA 2Y4AA 1C3BA 2ZQCA 4OOYA 3ZHHA 1ZKJA 5J8XA 3BLMA 4R3JA 3MZDA 3BLSA 4KG2A 3PBTA 3VOYA 1XXMA 4ZAMA 4GKUA 3HLCA 2ZQ9A 1HTZA 3HLGA 2E8IA 4ZJ2A 1K57A 4OPQA 2HPBA 4E3NA 1KDSA 2J9PA 4RA7A 3SH8A 2FFYA 3UPPA 1IYPA 1HVBA 3LO7A 5HAPA 4IEDA 4MBFA 4DE1A 4BD0A 1FOFA 4Y7PA 3P98A 4Z9QA 1KDWA 3SS5A 1K55A 2ZMAA 2Y2OA 3OPPA 4OQ0A 1U60A 4DE0A 1L0DA 4DDYA 1W79A 2ZJ9A 4GD8A 4WZ4A 3NBLA 2XQZA 1YLPA 3IHAA 4PPRA 3IH9A 4RX3A 4ZTKA 1PW8A 1YMXA 2JC7A 4QHCA 5DTSA 3TOIA 4GB7A 4E3JA 4OONA 5CECA 3S1YA 1E4DA 2XF3A 1E3UD 4S2NC 2WZZA 1QMFA 3QNBA 4O7DA 3VP3A 5GLDA 4KZ9A 5FQKA 2DRWA 4RX2A 3S4XA 5KZHA 1KGGA 2XLNA 3CMZA 3BECA 5HL1A 3RJUA 1BLHA 5CTMA 2Y59A 1ZG6A 3WS4A 3DTMA 1SDEA 4KQOA 3ZG8B 3UNWA 1CEGA 1WE4A 4C3QA 3V39A 1JTDA 2JBFA 2OSUA 3SS4A 2J9OA 1XPBA 1EROA 1PI5A 4UAAA 5FA7A 1G68A 4R4SA 3W4PA 4CJNA 4PMAA 3WS1A 4EBPA 4EBLA 3LY3A 1TDGA 3WS5A 3UO9A 5EOEA 3G32A 1BULA 3HUOA 3G31A 4PM7A 2XD5A 2BG1A 1L0EA 3PBNA 1W7FA 2JCHA 1KVLA 3ITAA 5E2EA 4KZAA 1GHIA 2WKEA 1FCOA 3Q81A 4P0MA 3MZEA 4OOMA 1K54C 5FSRA 5EVIC 3AGDA 3MXRA 5CHUA 3CG5A 1BZAA 4BQMA 1XA7A 1K6SA 3G2YA 4LENA 3DWKA 5AQ9A 3VP1A 5GLAA 1FCNA 3O86A 4BJPA 3IF5A 2Z2LB 2Z2MB 5E2GA 5CERA 5EECA 3UE0A 3O88A 1BTLA 2WGIA 5G18A 4E3MA 3PAGA 3QNCA 1IEMA 1YM1A 4WMCA 1OMEA 2GDNA 1L0GA 4WMCD 4MLLA 1KE3A 1S0WA 4KENB 1H8YA 3NCKA 2XFSA 1IYQA 4P6BA 4X56A 3NC8A 4ZBEA 3UDFA 1BSGA 2Y91A 3HLBA 2Y2KA 1DY6A 1DJCA 3N8LA 4IVKA 4ZJ3A 3PBQA 3ITBA 1BUEA 3ZFZA 4E6XA 3Q07A 2EX2A 4QJGA 4QD4A 1MPLA 3ZCZA 2DNSA 3C7VA 2XDMA 1RGYA 3WS0A 4S2MA 4E3OA 3IWQA 3BYDA 3QHYA 4UA6A 5FQQA 4EV4A 2EX8A 1E3UA 5F82A 5GHZA 3HUNA 3LEZA 3SOIA 2HDUA 2V1ZA 1FSYA 3ZNTA 3FKWA 4KZ7A 1CK3A 1SCWA 2H0YA 1W8YA 5AQAA 2Y2IA 2X02A 4R1GA 5EOOA 1H5XA 1LL9A 2RCXA 3UN7A 1NZUA 2OLVA 2WKIA 4WEJA 4KG5A 4Y0TA 1EI5A 4JPMA 1K56D 1O7EA 2ZQ8A 4M3KA 4P85A 4WZ5A 5DF9A 1RCJA 4KZ6A 2RL3A 4JF4A 4EQIA 3VFHA 1NJ4A 3HVFA 3IXGA 2DCFA 3OCNA 3IF6C 2R9XA 2P9VA
chains in the Genus database with same CATH superfamily
2OWJA 3VMAA 2HP6A 4MEZA 5FEGA 5HSQA 4JGPA 3MQ0A 2QKPA 1PIOA 4E6WA 3LIEA 4YNRA 1DP8A 1T1CA 4EW7A 4FTXA 3G2ZA 5TBMA 2A24A 1ESUA 1XKZA 2HDQA 3FKVA 5D3OA 5HZHA 2VK3A 3MF0A 3C30A 4OPRA 3F1PA 3C5AA 3P7NA 5TR7A 3IXDA 2W3EA 1O07A 2QPNA 5CHJA 1IYSA 2B02A 4XUZA 4F94A 1P9WA 2IA2A 2X01A 1K56A 2R9WA 2PYRA 3MZFA 3EGDC 3JVUA 2HP9A 4N1HA 4ARZB 5E2HA 2PT7A 3DTEA 2WUQA 2XK1A 5JYOA 2JN7A 1LSWA 4NEED 4HQAA 4WM9A 2J7VA 5A8BA 1YT4A 1GCEA 2EFUA 5DJTA 2OAP1 4WL9A 3TSGA 4GDBA 4QY6A 2B18A 4FH4A 4GDNA 1JVJA 2EFXA 3PBSA 4GZBA 4S2PA 2P08A 4E3LA 3QP4A 3VE4A 1PW1A 2ZQDA 4DF6A 1S67L 2EA9A 3HBRA 2Y2GA 2QYBA 2VGLS 3MFDA 1JWVA 3T1RA 2UWXA 4OPYA 2MJ6A 2VX8A 1WYBA 4OKPA 3MQQA 5M19A 3R4KA 1VETB 3R7WB 1I2WA 4L9EA 4L0LA 1V9ZA 2YKFA 5FAPA 1KE4A 1Y54A 4N1XA 4GN2A 3OPRA 4GW9A 4YFMA 2EXBA 3NY4A 1GA9A 2Y2LA 1ZTUA 1VEUA 4S2LA 3WRTA 2Y8HA 1MC0A 3ZG5A 2HF6A 3VP4A 2Z6DA 3AGFA 1TF1A 5J3WA 1D06A 1KVMA 5FQJA 4MN6A 3A3EA 5AJGA 2WK0A 5HARA 5K5BA 3IF6B 2OV5A 4WLAA 4H6JA 3CJMA 1BLPA 1ERMA 2J8YA 4EWFA 4NK3A 3HUMA 3HREA 3OPLA 1Z6FA 5F1FA 1Q2QA 3FPVA 4JF5A 3LIFA 3G34A 4JGOA 3MXQA 2L0WA 1IELA 1DJAA 1NRFA 4Y2FA 3CAXA 4LGWA 5HL6A 3PBRA 1L2SA 5HDSA 4K08A 4JKTA 1WYCA 2XGNA 4Y13A 1YLJA 4MDZA 3UPNA 2CC1A 4Y15A 1W63Q 3G35A 1YKDA 2XSSA 5CGXA 5DTTA 5HWVA 2VZWA 3N8RA 1F2KA 1LSVA 2Q9NA 2G2WA 5LBRA 3QP2A 3A3IA 1LL5A 3U4LP 3UB7A 2ZM2A 2VKSA 2PAVP 3GVBA 4S2OA 1IKIA 4WZ5C 3KSGA 2JKGA 3WS2A 4S2IA 4PM5A 3M2KA 2HDSA 3MS6A 3VSLA 2WADA 3L9KA 4MCWA 3B33A 3GMWA 2Y2MA 5HWTA 3EQUA 3PBOA 3JYIA 3S7PA 3C7UA 3PAEA 3HLWA 5HW3A 2VLGA 3KSIA 2ZL1B 3BFFA 5EPHA 5FI7A 1KGEA 4GS9B 3C4PA 2BTFP 4I5SA 4FH2A 3D3OA 1TDLA 1ES4A 2LB5A 4EU0A 1ONGA 2ZC6B 2KDKA 3LY4A 3ZDJA 2P74A 3NDGA 2OLUA 4R3JA 5G4ZA 1TS8A 3T4SA 5KIZA 2L1MA 4GKUA 3HLGA 3B47A 3L7HA 1KDSA 3SH8A 3G6OA 4DE1A 3SS5A 1K55A 5DJUA 3QP5A 1W79A 3VOLA 4ZTKA 5DTSA 1PW8A 1YMXA 4GHIB 4QHCA 5FL3A 4GB7A 4LRXC 4B9OA 1E3UD 2WZZA 1AWIA 3CUEC 5GLDA 2CMNA 3MJQA 3T4JA 5CTMA 5DKKA 4X25A 4C3QA 3O5YA 1OTDA 4CLCC 3BY8A 4CJNA 2W1TA 3LR4A 3G31A 4PM7A 2XD5A 1W7FA 2JCHA 5E2EA 4P0MA 4BBUA 3G2YA 4LENA 3O86A 4BJPA 3IF5A 2GNXA 5CERA 2PR6A 2INWA 1YM1A 4QWOA 4EESA 4WMCD 2XA7M 4EERA 2OAQ1 3LIBA 3HLBA 2Y2KA 4ZJ3A 4G3WA 4QJGA 3Q07A 2EX2A 2HV1A 2GX5A 4ZRRA 3QHYA 4EV4A 4RQ9A 1E3UA 5F82A 5FDSA 4LLOB 3ZNTA 3S7QA 2WKQA 4KZ7A 2H0YA 1W8YA 2X02A 1NZUA 2OLVA 4Y0TA 2PR5A 1K56D 1GSXA 2ZQ8A 4M3KA 4P6ZS 3IXGA 2DCFA 2LB9A 3IF6C 2P9VA 4U3TA 2PU4A 3UB9A 3FWLA 2HP5A 3MMHA 3E4PA 2ZM0A 2PHYA 1STZA 5FAOA 3NI9A 2WGWA 4DXBA 1MKMA 3W8KA 5FASA 1BLSA 1ESIA 4F3LA 1MZUA 1J9MA 3N4IA 1Q2PA 5GL9A 3H82A 4EUZA 3E2LA 2D02A 4BL2A 3IWIA 4S2NA 3BFEA 3IS2B 4K0WA 3SH9A 3BFCA 4QPRA 2W1TB 3Q82A 3GR2A 2ZC5B 3QP6A 4MN7A 1P0ZA 1K6RA 3KSHA 3WRZA 3O87A 1FSWA 4CLCA 1TD5A 3BWLA 3ZG9B 4BBTA 2NUTC 1IYOA 5L8MA 4Q0IA 5HPFA 4NG2A 2EXAA 1OTIA 5EVIB 4MNRA 4JF6A 3NIAA 1M40A 5U47A 1K55C 1XJ3A 5HDCA 2AVXA 1YLZA 1XA1A 4UEYA 4LV2A 1N9BA 1K38A 2W3DA 4JXGA 4OQGA 4I3IA 1VHMA 3LYXA 3RFBA 4EXOA 3Q1FA 4G3KA 4EETB 5L07A 4LV1A 1W5DA 5IHVA 2HDRA 3T12B 5HAIA 2PBDP 3PTEA 3R7WA 4IHQA 4AFIA 3IX4A 2FFFB 3EQVA 3LCEA 3MXSA 5E43A 3TRCA 4UA7A 1S1YA 4R6LA 3IT9A 3ZNYA 1SKOA 3IHBA 4RVAA 4IBRA 3IX3A 3PXPA 5DFXA 4NXGA 5CEBA 2UV0E 3BFDA 4YOFA 1GHMA 2WZXA 4I38A 1YPRA 3IXBA 1KOUA 1AXBA 1LLBA 3KYEA 3BY9A 4JXSA 1PI4A 1N9OA 3UB8A 2ZLYA 1KGFA 1NLYA 3C2WA 1VQQA 2I72A 2WKRA 2XROA 4KQDA 3T50A 5EVID 4B88A 5FQMA 3M2JA 4FD8A 4L9FA 5FI6A 1MXOA 3ZVWA 4ZDXA 5EM1A 1XFNA 4Q8IA 2BLSA 2JKFA 3G4PA 1N9NA 1PFLA 2PBYA 4JGRA 1GHPA 3MFXA 3VP2A 2X71A 4HH3A 2O9CA 1ZG4A 4BBVA 3RTYA 1MKIA 2Q9MA 4E3IA 5EVEA 3LI9A 1PNEA 2H10A 4UQIM 5EFWA 5FAQA 1MWUA 4DE2A 5KSHA 1NY0A 1I2SA 1YLYA 4WUJA 1G6AA 2Y2PA 1YLWA 1S66L 3K3DA 4H6JB 1YAXA 3CI6A 3ZG0A 2J80A 3CPTB 3V3SA 4K91A 2KX6A 5L09A 3HLDA 3LR3A 3TG9A 5I94A 1RGZA 1ACFA 5HDDA 3MSHA 1Y28A 1N9LA 1H0MA 4NETA 4R38A 2WGWB 5CRFA 3EOIA 1VEUB 3H9WA 3RXXA 3M6HA 1NWZA 5CXWA 4PM6A 4JBFA 4E04A 5TJJA 2O9BA 5EE8A 4OOLA 1XX2A 1T19A 4GD6A 3FYZA 4Y0UA 5EVLA 2ZQCA 1ZKJA 4FUWA 1XXMA 2FZ0A 4ZAMA 2ZQ9A 1HTZA 4CLCD 3ZQ5A 2FFYA 3UPPA 1HVBA 5HAPA 4BD0A 2ZMAA 3OPPA 4OQ0A 4DE0A 4NXEA 1L0DA 4DDYA 4LRYC 2ZJ9A 4GD8A 1YLPA 3IHAA 4PPRA 4RX3A 2JC7A 1S4RA 3TOIA 4E3JA 2PD7A 3QNBA 5FQKA 2DRWA 4RX2A 3S4XA 5KZHA 3BECA 1SDEA 4I3AA 1H8MA 5J7EA 1WE4A 1JTDA 3E4QA 5L10A 1OJ5A 1A0KA 3F1NB 2M7UA 2O99A 3NOPC 5FSRA 5EVIC 3A0VA 3CG5A 1BZAA 1P97A 1WA9A 1XA7A 3VP1A 1FCNA 2A24B 2Z2LB 3UE0A 1VB6A 1BTLA 5G18A 2P04A 4WMCA 1OMEA 2GDNA 4MLLA 3UB6A 3NCKA 1IYQA 4X56A 4ZBEA 2Y91A 3N8LA 3ITBA 3ZFZA 4QD4A 1J3WA 1RGYA 4PKYG 3WS0A 4S2MA 4E3OA 3UMDA 3IWQA 4UA6A 4GLQA 2W3HA 2VA0A 3HUNA 3SOIA 4GJ4A 3FKWA 1OTAA 2DMWA 4DMZA 2ZOIA 4R1GA 2KLIA 2RCXA 3UN7A 4WEJA 4KG5A 1EI5A 4WZ5A 3KYZA 4EEUA 3C8CA 3LICA 1RCJA 3BJNA 1NJ4A 3NECA 4Z1WA 4UQIS 4MN5A 4LCMA 3P01A 3M6BA 3E2KA 4U0TA 1LL8A 4P6ZM 4DDSA 4XXRA 2FH5A 5AVFA 5CGWA 3W4OA 1ZC2A 4II7A 5A90A 4QB8A 4HBTA 2P9VB 3B3XA 4R3AA 4Y0OA 4DN0A 1G28A 1CI8A 1EW0A 3N8SA 1BLCA 5E2FA 3DTKA 3IBRA 4GS9A 1FILA 1NZOA 2OOLA 2BASA 1CEFA 3GSGA 4HJ6A 4O8GA 3WWXA 1UWNX 5DF8A 3DW0A 3F1NA 4KZ4A 1NLZA 2HJ9C 3UY6A 2EX6A 3BFGA 1V9YA 2H0TA 3IQAA 1W8QA 2V20A 5F6AA 4BLMA 1DP9A 2W0NA 1FR1A 3GQZA 3FC7A 4WELA 4KQQA 3EGXC 3VP0A 1XFQA 3ZVTA 5L2FA 4O0PA 1FCMA 4B4ZA 1S4SA 4CLCE 1PZPA 1I5QA 1PYYA 4HH2A 1G6OA 2A3UA 4C75A 2K2NA 2QJ7A 3LIAA 3I7JA 2JKRM 5GLCA 1XJ2A 3Q7ZA 1FQGA 5TGFA 1PRQA 3MKFA 5IU1A 3T4QA 3GRJA 3SS3A 5GHYA 3IWOA 4OQHA 2JE5A 4JXVA 5JYPA 4WN5A 5TBMB 2WYXA 5EM0A 3UDIA 1K57C 3H7WB 1LI9A 2XRNA 4OQIA 5FI2A 2PRFA 3OCLA 1HZOA 4C6YA 3N7WA 3HJKA 3Q7VB 5F69A 2WGVA 4DE3A 4PHTA 4OLDA 3T4TA 4I39A 3N6IA 2B95A 3IXHA 1KE0A 4NKPA 1N4OA 4YINA 4S2JA 5CTNA 2ZOHA 1PZOA 1YSPA 4PM8A 2WKHA 2ACGA 4OP5A 3H82B 3KSFA 2JHEA 4ME4A 2EWWA 4EBNA 1TVFA 3ZG7B 3MBZA 3O3VA 2XEPA 2VGJA 4WBGA 4HY8A 1PWCA 4KUKA 2WAFA 3IF6A 4IBXA 3BRMA 5TFQA 4H8RA 3RH8B 1MBLA 3KX0X 3FPWA 3DTIA 3NHQA 4GCZA 3T1XA 1UWPX 2H28A 4BMWA 3OLOA 3JPUA 3TW8A 5KMWA 2L4RA 5HFOA 3NJAA 3E0YA 5FDHA 4XT2A 3LEQA 5C5KA 1XP4A 3S22A 3BM6A 2I9VA 3DAVA 3LUQA 4N9LA 3S7NA 4O01A 4DXCA 4HIAA 2Y2JA 2ZM8A 4X55A 2XA7S 2B5RA 2Y2NA 1ES3A 4JLFA 1D7EA 4BD1A 1OT6A 1LI0A 5AQBA 3FZCA 3LR0A 1YLTA 4LV3A 4HEFA 4EQ1A 5MC7A 2H5SA 3AGEA 2G7UA 1OTBA 1QMEA 2Y2HA 4HJ4A 3HLFA 2XFTA 5EVIA 5HPIA 1MWSA 5CHMA 2WAEA 2Y55A 4I3JA 2NUPC 5FEFA 3UPOA 1S6RA 2ZQAA 4HP9A 4IJGA 4MBHA 1GSWA 3IH8A 1FR6A 2PYPA 3IBJA 5EV0A 4X6TA 4HBUA 2V1AA 1NXYA 2M1CA 2ZC4B 4GNUA 4WEKA 4LCLA 4X1LA 3LFVA 2VGKA 3HJIA 3U2AA 4RYEA 4HNBA 2V8CA 2Y4AA 1C3BA 3ZHHA 3NOTC 3MZDA 3PBTA 3VOYA 3GECA 3E4OA 3T1SA 4ZJ2A 2HPBA 3TJZC 2J9PA 3IX8A 4MMNA 3LO7A 1OTEA 4MBFA 1DRMA 4Y7PA 1KDWA 1H3QA 3PYPA 3UMEA 4M4XA 3S1YA 1E4DA 3PR6A 3D72A 4BWIA 3LIDA 3VV4A 1KGGA 2XLNA 3RJUA 5CX7A 1BLHA 3T4KA 1ZG6A 3WS4A 3DTMA 3ZG8B 1CEGA 3K3CA 2JBFA 2OSUA 5FA7A 1G68A 4R4SA 3W4PA 4D60A 4EBPA 4EBLA 3EWKA 2M7VA 3WS5A 5EOEA 3G32A 4HHDA 2BG1A 3PBNA 2GJ3A 1KVLA 1T1BA 1GHIA 2WKEA 1FCOA 3Q81A 3MZEA 5J4EA 3SW1A 4OOMA 3AGDA 3TE8A 4FOFA 3T4LA 1X0OA 1K6SA 5AQ9A 3DWKA 2YKHA 5E2GA 2Z2MB 3O88A 2WGIA 4LRZE 1IEMA 4NXBA 4ETXA 2PD8A 4R70A 3A0RA 4P6BA 3UDFA 1HLUP 4IVKA 3ZCZA 4LPZA 2XDMA 2OWHA 4JGQA 3BYDA 5FQQA 4XT2B 1TS7A 2ZBBA 2HDUA 2V1ZA 1FSYA 2V9AA 3VE3A 1CK3A 5IS1A 3S7OA 1SCWA 2Y2IA 5EOOA 3F1PB 1H5XA 1LL9A 3OBFA 5DF9A 4JF4A 4EQIA 2R9XA 3A3FA 1ONHA 5HD3A 5GLBA 2JKRI 4ARZA 1JTGA 4UHUA 3UB5P 1SDNA 3SZTA 3PHYA 1S1ZA 4N92A 2IWDA 3A0SA 3A3DA 1PWDA 5EUAA 5GHXA 3OOVA 3T4OA 4HI4A 5M1AA 2D01A 4B93A 1ES2A 2PU2A 2Y79A 3BQ8A 4B4XA 2V1BA 3LGOA 5HX9A 4OLGA 4ESPA 4Y17A 1JNUA 3UDXA 4E3KA 4KG6A 2QMIA 3W4QA 1XGIA 4KZ5A 2IWBA 5A91A 2J3TD 2Y2QA 1FIKA 4QY5A 3GDIA 3F1OB 4KQRA 1BT5A 5DTKA 3CWFA 2HZ5A 2EX9A 4L9GA 3VOZA 1XJ4A 4KZ8A 1ES5A 2EWVA 5M18A 4P87A 4HESA 3IS2A 5AVEA 1K25A 4N9KA 4FCFA 3HL9A 1ERQA 5A93A 4MBKA 3UE1A 5KSCA 4Q0HA 4F3LB 1ODVA 1M6KA 2J3WA 2A49A 1ALQA 1CJFA 5A92A 2R78A 1IFQA 1L3LA 1K4FA 2XR0A 5CGSA 1D1JA 1OT9A 2GZAA 5HAQA 2P7JA 3DWZA 1LHYA 4X69A 2VGLM 4CPKA 3QP8A 3OPHA 4ETZA 5G4YA 3CHWP 4R4RA 4R3BA 1VETA 4EUVA 3MKEA 3GTCA 1MWTA 2IWCA 3G30A 1E25A 4DKIA 5FQ9A 2W1RA 3NOUC 2ZL1A 2C5WB 2JKTM 3GV9A 2XH9A 1XJ6A 3ZYTA 4U0XA 4DJ3A 5DFYA 2ZC7A 2G2UA 2V0WA 4OVDA 3B42A 4BL3A 4ZJ1A 4KZ3A 1NRJA 3NDEA 5AQ7A 3V50A 4ID4A 1HD8A 4FSFA 5FQIA 3D4FA 3DBAA 4IVIA 4R0QA 5F5YA 1Y4OA 5BOHA 2C6WB 1MY8A 4A5RA 1VM1A 4G3VA 4R23A 1SHVA 3VSKA 4K0XA 3LI8A 3BEBA 3T1QB 3OC2A 3A3JA 3ISGA 1SKFA 2V8FA 3FV7A 3EEHA 2VV7A 3V67A 1Z09A 4WYYA 1CI9A 4GHIA 1RP5A 3BW6A 1NYYA 1PWGA 1DP6A 3MR0A 2QHKA 5I5LA 4PKYA 4LV0A 3UE3A 3ZGAB 4Q0JA 2Z6CA 3P09A 2QZ6A 4UA9A 3UE6A 4Y3IA 4S2KA 3Q7VA 5DF7A 3F1OA 4HJ3A 2ZQ7A 1GSVA 4BENA 4JXWA 4DRTA 3E98A 1GA0A 2WKPA 3CUEA 3NULA 1K4EA 4D2OA 3K2NA 4QU3A 1YMSA 4KZBA 2PDRA 4GOGA 1TEMA 1K54A 1H8ZA 2JKTI 2W3GA 4CQHA 3H7WA 3MQOA 3HLEA 2V2FF 5CEDA 4OH0A 2Q0OA 1F5MA 3OZHA 2VJWA 1BYWA 4X1MA 1JWPA 1NYMA 2J3TC 4X53A 2QWSA 5DVAA 3CPTA 1IOUA 3ICYA 3QP1A 3W2ZA 1EWZA 4OPZA 1W63M 2QJ5A 3SH7A 1MWRA 2O9AA 3VFFA 3C4OA 4DJ2A 5FATA 2XD1A 4EEPA 3V3RA 3D9YA 4XUXA 2ZD8A 4IUHA 4X68A 1ZHHB 2K7SA 3CZDA 1F9IA 2W27A 5HWWA 1JWZA 3V5MA 1IKGA 1OPXA 1SZVA 1YQSA 3RXWA 5F1GA 5F83A 1L0FA 1XGJA 2ZC3B 1T18A 4PM9A 1DJBA 5DKLA 4OOYA 1F98A 3KYQA 5J8XA 3BLMA 4KG2A 3BLSA 4PAUA 2VV8A 3HLCA 4LFUA 3BQAA 2E8IA 1K57A 4OPQA 3EEAA 4E3NA 4RA7A 2KOIA 1IYPA 1LT0A 4IEDA 1FOFA 3P98A 4Z9QA 2Y2OA 2A2LA 1U60A 2E8JA 1SKOB 4WZ4A 3NBLA 2XQZA 3IH9A 2V0UA 4OONA 5CECA 2XF3A 2K31A 4S2NC 1QMFA 2VV6A 4O7DA 3VP3A 4KZ9A 3CMZA 2HGVA 5HL1A 2Y59A 4KQOA 1CF0A 3UNWA 1OJGA 2O0YA 3V39A 3SS4A 2J9OA 1XPBA 1EROA 1PI5A 4UAAA 1G5UA 4PMAA 3WS1A 3LY3A 1TDGA 3CITA 4KUOA 3UO9A 2HJEA 1BULA 3HUOA 5F68A 5HD5A 1L0EA 1P9RA 1YSQA 5IT5A 3ITAA 3LR5A 4HP4A 4KZAA 4WF0A 2ZMVA 1K54C 3MXRA 5CHUA 3CLOA 4BQMA 2W3FA 3FG8A 5GLAA 1TS6A 3JVVA 5EECA 4Y5FA 2VEAA 4E3MA 1K0KA 3HCYA 3PAGA 3QNCA 4YWZA 3KO6A 4IUKA 1L0GA 1KE3A 1S0WA 4KENB 1H8YA 2XFSA 3NC8A 1BSGA 1DY6A 1DJCA 3PBQA 1T1AA 1BUEA 4E6XA 1MPLA 1TS0A 2DNSA 3C7VA 1CQAA 4NXFA 4HOIA 2ZMFA 2EX8A 1LSXA 5GHZA 3LEZA 5AQAA 3C38A 3ULFA 2WKIA 4JPMA 1O7EA 1UGUA 4P85A 4KZ6A 2RL3A 3VFHA 3HVFA 4CLCB 3OCNA 4OP8A
chains in the Genus database with same CATH topology
3A3FA 4LCMA 1ONHA 4U3TA 2PU4A 3M6BA 5GLBA 3E2KA 3VMAA 2HP6A 3FWLA 4U0TA 4MEZA 4DDSA 4XXRA 2HP5A 1JTGA 5CGWA 3W4OA 4UHUA 1SDNA 1ZC2A 2ZM0A 4N92A 1PIOA 5A90A 4QB8A 2IWDA 4HBTA 4E6WA 5FAOA 3NI9A 2P9VB 2WGWA 3B3XA 4Y0OA 3A3DA 4DXBA 1PWDA 5EUAA 3W8KA 5FASA 1BLSA 1ESIA 3G2ZA 5GHXA 1ESUA 1CI8A 1J9MA 1XKZA 3N4IA 1Q2PA 5M1AA 2HDQA 3FKVA 3N8SA 1BLCA 5D3OA 5E2FA 5GL9A 4EUZA 3E2LA 1ES2A 4OPRA 4BL2A 2PU2A 1NZOA 3IWIA 4S2NA 3C5AA 3BFEA 5TR7A 4B4XA 3IXDA 1CEFA 3GSGA 1O07A 3WWXA 2QPNA 5HX9A 4OLGA 4K0WA 3SH9A 3BFCA 5CHJA 1IYSA 5DF8A 3UDXA 3DW0A 4XUZA 4F94A 3Q82A 4E3KA 2X01A 4KG6A 4KZ4A 2QMIA 3GR2A 3W4QA 1K56A 3UY6A 2EX6A 1XGIA 2ZC5B 3BFGA 2H0TA 2R9WA 3MZFA 3IQAA 4KZ5A 2IWBA 2HP9A 4N1HA 1W8QA 2V20A 5A91A 4BLMA 5E2HA 2Y2QA 1FR1A 1K6RA 2WUQA 3GQZA 2XK1A 3O87A 4WELA 3WRZA 4QY5A 5JYOA 4KQQA 1FSWA 3VP0A 4KQRA 3ZVTA 1BT5A 5DTKA 5L2FA 1FCMA 4B4ZA 4WM9A 1PZPA 2J7VA 2EX9A 1I5QA 1YT4A 1PYYA 3VOZA 1GCEA 2EFUA 3ZG9B 3TSGA 4KZ8A 1ES5A 1IYOA 2A3UA 4GDBA 5M18A 4C75A 4QY6A 4P87A 4FH4A 4GDNA 4HESA 1JVJA 2EFXA 3PBSA 4GZBA 4S2PA 1K25A 4N9KA 4FCFA 2EXAA 3I7JA 4E3LA 5EVIB 4MNRA 5GLCA 4JF6A 3NIAA 1M40A 5U47A 1K55C 1PW1A 3HL9A 3Q7ZA 1FQGA 2ZQDA 1ERQA 5TGFA 4DF6A 5A93A 4MBKA 1YLZA 3MKFA 3UE1A 1XA1A 5KSCA 3GRJA 3SS3A 3HBRA 2Y2GA 4LV2A 1N9BA 1K38A 4JXGA 4OQGA 1M6KA 2A49A 1ALQA 5A92A 5GHYA 3IWOA 4OQHA 2JE5A 1K4FA 4JXVA 3MFDA 2XR0A 5CGSA 1JWVA 5JYPA 2WYXA 5HAQA 2UWXA 3Q1FA 4OPYA 1K57C 3UDIA 3DWZA 1LHYA 1LI9A 1WYBA 4LV1A 4OKPA 1W5DA 4X69A 5IHVA 2HDRA 4OQIA 5HAIA 4CPKA 5M19A 3OPHA 4R4RA 3PTEA 4R3BA 1I2WA 5FI2A 3MKEA 3GTCA 3OCLA 1MWTA 2FFFB 2IWCA 1HZOA 3EQVA 3LCEA 3MXSA 4L0LA 5E43A 4C6YA 3G30A 3N7WA 1E25A 4UA7A 4DKIA 5FAPA 3IT9A 5FQ9A 3ZNYA 1KE4A 1Y54A 4RVAA 3IHBA 4N1XA 4GN2A 3Q7VB 4IBRA 2WGVA 3OPRA 4YFMA 2EXBA 2C5WB 4DE3A 3NY4A 1GA9A 4OLDA 2Y2LA 3GV9A 4S2LA 5CEBA 3BFDA 1GHMA 2WZXA 3N6IA 3WRTA 2XH9A 3IXHA 1KE0A 3ZG5A 3IXBA 3VP4A 1N4OA 4U0XA 4S2JA 4YINA 3AGFA 2ZC7A 2G2UA 5CTNA 4OVDA 1AXBA 1KVMA 5FQJA 1PZOA 1LLBA 4BL3A 4PM8A 4ZJ1A 3A3EA 2WKHA 4KZ3A 2WK0A 4OP5A 3NDEA 5HARA 3IF6B 2OV5A 5AQ7A 3V50A 4EBNA 4ID4A 1HD8A 3CJMA 4FSFA 1BLPA 5FQIA 1ERMA 2J8YA 3D4FA 4JXSA 4EWFA 1PI4A 4NK3A 1TVFA 4IVIA 4R0QA 5BOHA 2C6WB 3HUMA 3HREA 3OPLA 2ZLYA 3ZG7B 3MBZA 1KGFA 1MY8A 4A5RA 1Z6FA 3O3VA 1VM1A 2XEPA 4R23A 1SHVA 1VQQA 2I72A 3VSKA 5F1FA 1Q2QA 2VGJA 4K0XA 4WBGA 3BEBA 1PWCA 3OC2A 4JF5A 2WAFA 3IF6A 5EVID 4IBXA 3A3JA 3BRMA 3G34A 5FQMA 3M2JA 4FD8A 5TFQA 4B88A 4H8RA 3ISGA 1MBLA 1IELA 1DJAA 1NRFA 1SKFA 5FI6A 1MXOA 3FV7A 3ZVWA 4ZDXA 3PBRA 4Q8IA 1L2SA 4WYYA 2BLSA 3G4PA 1CI9A 1RP5A 4JKTA 1NYYA 1WYCA 2XGNA 1PWGA 1YLJA 5KMWA 5HFOA 2PBYA 3UPNA 2CC1A 3G35A 3UE3A 4LV0A 5CGXA 3ZGAB 5DTTA 5FDHA 1GHPA 1XP4A 2QZ6A 3P09A 3N8RA 4UA9A 4S2KA 3VP2A 3S22A 2X71A 3BM6A 2Q9NA 2G2WA 3Q7VA 5DF7A 1ZG4A 4OP8A 2ZQ7A 4N9LA 1MKIA 3A3IA 4BENA 1LL5A 2Q9MA 4E3IA 4JXWA 2ZM2A 4DRTA 3GVBA 1GA0A 4S2OA 4DXCA 1IKIA 2Y2JA 4WZ5C 2ZM8A 2H10A 4X55A 1K4EA 4D2OA 5FAQA 2B5RA 1MWUA 4DE2A 2Y2NA 1NY0A 1ES3A 4QU3A 5KSHA 1I2SA 1YMSA 4KZBA 3WS2A 1YLYA 4GOGA 1TEMA 1G6AA 4S2IA 4PM5A 1K54A 1H8ZA 2Y2PA 1YLWA 3M2KA 2HDSA 4JLFA 3HLEA 2V2FF 3VSLA 4BD1A 2WADA 5CEDA 1LI0A 4OH0A 5AQBA 3FZCA 3OZHA 3ZG0A 3GMWA 2Y2MA 3EQUA 1JWPA 1YLTA 3PBOA 3V3SA 1NYMA 3JYIA 4LV3A 4X53A 4HEFA 4K91A 3HLDA 5DVAA 3TG9A 5I94A 1RGZA 2H5SA 3C7UA 3PAEA 3AGEA 1EWZA 3HLWA 1QMEA 4OPZA 5HW3A 2Y2HA 4NETA 3HLFA 2WGWB 2XFTA 5CRFA 3SH7A 1MWRA 5EVIA 1MWSA 3VFFA 5CHMA 2WAEA 2Y55A 3C4OA 3BFFA 5EPHA 5FATA 2XD1A 3RXXA 3UPOA 3M6HA 3V3RA 1S6RA 5FI7A 4XUXA 1KGEA 2ZQAA 3C4PA 5CXWA 2ZD8A 4MBHA 4FH2A 3IH8A 1TDLA 4X68A 4PM6A 3CZDA 1FR6A 1ES4A 4JBFA 1JWZA 4X6TA 4HBUA 1ONGA 3V5MA 2ZC6B 1IKGA 1NXYA 2ZC4B 1YQSA 3RXWA 4GNUA 5EE8A 5F1GA 4WEKA 4LCLA 4OOLA 5F83A 1XX2A 3LY4A 4GD6A 3ZDJA 3FYZA 1L0FA 1XGJA 2VGKA 4Y0UA 5EVLA 2P74A 2ZC3B 4RYEA 3NDGA 4PM9A 1DJBA 2OLUA 2Y4AA 1C3BA 2ZQCA 4OOYA 3ZHHA 1ZKJA 5J8XA 3BLMA 4R3JA 3MZDA 3BLSA 4KG2A 3PBTA 3VOYA 1XXMA 4ZAMA 4GKUA 3HLCA 2ZQ9A 1HTZA 3HLGA 2E8IA 4ZJ2A 1K57A 4OPQA 2HPBA 4E3NA 1KDSA 2J9PA 4RA7A 3SH8A 2FFYA 3UPPA 1IYPA 1HVBA 3LO7A 5HAPA 4IEDA 4MBFA 4DE1A 4BD0A 1FOFA 4Y7PA 3P98A 4Z9QA 1KDWA 3SS5A 1K55A 2ZMAA 2Y2OA 3OPPA 4OQ0A 1U60A 4DE0A 1L0DA 4DDYA 1W79A 2ZJ9A 4GD8A 4WZ4A 3NBLA 2XQZA 1YLPA 3IHAA 4PPRA 3IH9A 4RX3A 4ZTKA 1PW8A 1YMXA 2JC7A 4QHCA 5DTSA 3TOIA 4GB7A 4E3JA 4OONA 5CECA 3S1YA 1E4DA 2XF3A 1E3UD 4S2NC 2WZZA 1QMFA 3QNBA 4O7DA 3VP3A 5GLDA 4KZ9A 5FQKA 2DRWA 4RX2A 3S4XA 5KZHA 1KGGA 2XLNA 3CMZA 3BECA 5HL1A 3RJUA 1BLHA 5CTMA 2Y59A 1ZG6A 3WS4A 3DTMA 1SDEA 4KQOA 3ZG8B 3UNWA 1CEGA 1WE4A 4C3QA 3V39A 1JTDA 2JBFA 2OSUA 3SS4A 2J9OA 1XPBA 1EROA 1PI5A 4UAAA 5FA7A 1G68A 4R4SA 3W4PA 4CJNA 4PMAA 3WS1A 4EBPA 4EBLA 3LY3A 1TDGA 3WS5A 3UO9A 5EOEA 3G32A 1BULA 3HUOA 3G31A 4PM7A 2XD5A 2BG1A 1L0EA 3PBNA 1W7FA 2JCHA 1KVLA 3ITAA 5E2EA 4KZAA 1GHIA 2WKEA 1FCOA 3Q81A 4P0MA 3MZEA 4OOMA 1K54C 5FSRA 5EVIC 3AGDA 3MXRA 5CHUA 3CG5A 1BZAA 4BQMA 1XA7A 1K6SA 3G2YA 4LENA 3DWKA 5AQ9A 3VP1A 5GLAA 1FCNA 3O86A 4BJPA 3IF5A 2Z2LB 2Z2MB 5E2GA 5CERA 5EECA 3UE0A 3O88A 1BTLA 2WGIA 5G18A 4E3MA 3PAGA 3QNCA 1IEMA 1YM1A 4WMCA 1OMEA 2GDNA 1L0GA 4WMCD 4MLLA 1KE3A 1S0WA 4KENB 1H8YA 3NCKA 2XFSA 1IYQA 4P6BA 4X56A 3NC8A 4ZBEA 3UDFA 1BSGA 2Y91A 3HLBA 2Y2KA 1DY6A 1DJCA 3N8LA 4IVKA 4ZJ3A 3PBQA 3ITBA 1BUEA 3ZFZA 4E6XA 3Q07A 2EX2A 4QJGA 4QD4A 1MPLA 3ZCZA 2DNSA 3C7VA 2XDMA 1RGYA 3WS0A 4S2MA 4E3OA 3IWQA 3BYDA 3QHYA 4UA6A 5FQQA 4EV4A 2EX8A 1E3UA 5F82A 5GHZA 3HUNA 3LEZA 3SOIA 2HDUA 2V1ZA 1FSYA 3ZNTA 3FKWA 4KZ7A 1CK3A 1SCWA 2H0YA 1W8YA 5AQAA 2Y2IA 2X02A 4R1GA 5EOOA 1H5XA 1LL9A 2RCXA 3UN7A 1NZUA 2OLVA 2WKIA 4WEJA 4KG5A 4Y0TA 1EI5A 4JPMA 1K56D 1O7EA 2ZQ8A 4M3KA 4P85A 4WZ5A 5DF9A 1RCJA 4KZ6A 2RL3A 4JF4A 4EQIA 3VFHA 1NJ4A 3HVFA 3IXGA 2DCFA 3OCNA 3IF6C 2R9XA 2P9VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A3F A;  4LCM A;  1ONH A;  4U3T A;  2PU4 A;  3M6B A;  5GLB A;  3E2K A;  3VMA A;  2HP6 A;  3FWL A;  4U0T A;  4MEZ A;  4DDS A;  4XXR A;  2HP5 A;  1JTG A;  5CGW A;  3W4O A;  4UHU A;  1SDN A;  1ZC2 A;  2ZM0 A;  4N92 A;  1PIO A;  5A90 A;  4QB8 A;  2IWD A;  4HBT A;  4E6W A;  5FAO A;  3NI9 A;  2P9V B;  2WGW A;  3B3X A;  4Y0O A;  3A3D A;  4DXB A;  1PWD A;  5EUA A;  3W8K A;  5FAS A;  1BLS A;  1ESI A;  3G2Z A;  5GHX A;  1ESU A;  1CI8 A;  1J9M A;  1XKZ A;  3N4I A;  1Q2P A;  5M1A A;  2HDQ A;  3FKV A;  3N8S A;  1BLC A;  5D3O A;  5E2F A;  5GL9 A;  4EUZ A;  3E2L A;  1ES2 A;  4OPR A;  4BL2 A;  2PU2 A;  1NZO A;  3IWI A;  4S2N A;  3C5A A;  3BFE A;  5TR7 A;  4B4X A;  3IXD A;  1CEF A;  3GSG A;  1O07 A;  3WWX A;  2QPN A;  5HX9 A;  4OLG A;  4K0W A;  3SH9 A;  3BFC A;  5CHJ A;  1IYS A;  5DF8 A;  3UDX A;  3DW0 A;  4XUZ A;  4F94 A;  3Q82 A;  4E3K A;  2X01 A;  4KG6 A;  4KZ4 A;  2QMI A;  3GR2 A;  3W4Q A;  1K56 A;  3UY6 A;  2EX6 A;  1XGI A;  2ZC5 B;  3BFG A;  2H0T A;  2R9W A;  3MZF A;  3IQA A;  4KZ5 A;  2IWB A;  2HP9 A;  4N1H A;  1W8Q A;  2V20 A;  5A91 A;  4BLM A;  5E2H A;  2Y2Q A;  1FR1 A;  1K6R A;  2WUQ A;  3GQZ A;  2XK1 A;  3O87 A;  4WEL A;  3WRZ A;  4QY5 A;  5JYO A;  4KQQ A;  1FSW A;  3VP0 A;  4KQR A;  3ZVT A;  1BT5 A;  5DTK A;  5L2F A;  1FCM A;  4B4Z A;  4WM9 A;  1PZP A;  2J7V A;  2EX9 A;  1I5Q A;  1YT4 A;  1PYY A;  3VOZ A;  1GCE A;  2EFU A;  3ZG9 B;  3TSG A;  4KZ8 A;  1ES5 A;  1IYO A;  2A3U A;  4GDB A;  5M18 A;  4C75 A;  4QY6 A;  4P87 A;  4FH4 A;  4GDN A;  4HES A;  1JVJ A;  2EFX A;  3PBS A;  4GZB A;  4S2P A;  1K25 A;  4N9K A;  4FCF A;  2EXA A;  3I7J A;  4E3L A;  5EVI B;  4MNR A;  5GLC A;  4JF6 A;  3NIA A;  1M40 A;  5U47 A;  1K55 C;  1PW1 A;  3HL9 A;  3Q7Z A;  1FQG A;  2ZQD A;  1ERQ A;  5TGF A;  4DF6 A;  5A93 A;  4MBK A;  1YLZ A;  3MKF A;  3UE1 A;  1XA1 A;  5KSC A;  3GRJ A;  3SS3 A;  3HBR A;  2Y2G A;  4LV2 A;  1N9B A;  1K38 A;  4JXG A;  4OQG A;  1M6K A;  2A49 A;  1ALQ A;  5A92 A;  5GHY A;  3IWO A;  4OQH A;  2JE5 A;  1K4F A;  4JXV A;  3MFD A;  2XR0 A;  5CGS A;  1JWV A;  5JYP A;  2WYX A;  5HAQ A;  2UWX A;  3Q1F A;  4OPY A;  1K57 C;  3UDI A;  3DWZ A;  1LHY A;  1LI9 A;  1WYB A;  4LV1 A;  4OKP A;  1W5D A;  4X69 A;  5IHV A;  2HDR A;  4OQI A;  5HAI A;  4CPK A;  5M19 A;  3OPH A;  4R4R A;  3PTE A;  4R3B A;  1I2W A;  5FI2 A;  3MKE A;  3GTC A;  3OCL A;  1MWT A;  2FFF B;  2IWC A;  1HZO A;  3EQV A;  3LCE A;  3MXS A;  4L0L A;  5E43 A;  4C6Y A;  3G30 A;  3N7W A;  1E25 A;  4UA7 A;  4DKI A;  5FAP A;  3IT9 A;  5FQ9 A;  3ZNY A;  1KE4 A;  1Y54 A;  4RVA A;  3IHB A;  4N1X A;  4GN2 A;  3Q7V B;  4IBR A;  2WGV A;  3OPR A;  4YFM A;  2EXB A;  2C5W B;  4DE3 A;  3NY4 A;  1GA9 A;  4OLD A;  2Y2L A;  3GV9 A;  4S2L A;  5CEB A;  3BFD A;  1GHM A;  2WZX A;  3N6I A;  3WRT A;  2XH9 A;  3IXH A;  1KE0 A;  3ZG5 A;  3IXB A;  3VP4 A;  1N4O A;  4U0X A;  4S2J A;  4YIN A;  3AGF A;  2ZC7 A;  2G2U A;  5CTN A;  4OVD A;  1AXB A;  1KVM A;  5FQJ A;  1PZO A;  1LLB A;  4BL3 A;  4PM8 A;  4ZJ1 A;  3A3E A;  2WKH A;  4KZ3 A;  2WK0 A;  4OP5 A;  3NDE A;  5HAR A;  3IF6 B;  2OV5 A;  5AQ7 A;  3V50 A;  4EBN A;  4ID4 A;  1HD8 A;  3CJM A;  4FSF A;  1BLP A;  5FQI A;  1ERM A;  2J8Y A;  3D4F A;  4JXS A;  4EWF A;  1PI4 A;  4NK3 A;  1TVF A;  4IVI A;  4R0Q A;  5BOH A;  2C6W B;  3HUM A;  3HRE A;  3OPL A;  2ZLY A;  3ZG7 B;  3MBZ A;  1KGF A;  1MY8 A;  4A5R A;  1Z6F A;  3O3V A;  1VM1 A;  2XEP A;  4R23 A;  1SHV A;  1VQQ A;  2I72 A;  3VSK A;  5F1F A;  1Q2Q A;  2VGJ A;  4K0X A;  4WBG A;  3BEB A;  1PWC A;  3OC2 A;  4JF5 A;  2WAF A;  3IF6 A;  5EVI D;  4IBX A;  3A3J A;  3BRM A;  3G34 A;  5FQM A;  3M2J A;  4FD8 A;  5TFQ A;  4B88 A;  4H8R A;  3ISG A;  1MBL A;  1IEL A;  1DJA A;  1NRF A;  1SKF A;  5FI6 A;  1MXO A;  3FV7 A;  3ZVW A;  4ZDX A;  3PBR A;  4Q8I A;  1L2S A;  4WYY A;  2BLS A;  3G4P A;  1CI9 A;  1RP5 A;  4JKT A;  1NYY A;  1WYC A;  2XGN A;  1PWG A;  1YLJ A;  5KMW A;  5HFO A;  2PBY A;  3UPN A;  2CC1 A;  3G35 A;  3UE3 A;  4LV0 A;  5CGX A;  3ZGA B;  5DTT A;  5FDH A;  1GHP A;  1XP4 A;  2QZ6 A;  3P09 A;  3N8R A;  4UA9 A;  4S2K A;  3VP2 A;  3S22 A;  2X71 A;  3BM6 A;  2Q9N A;  2G2W A;  3Q7V A;  5DF7 A;  1ZG4 A;  4OP8 A;  2ZQ7 A;  4N9L A;  1MKI A;  3A3I A;  4BEN A;  1LL5 A;  2Q9M A;  4E3I A;  4JXW A;  2ZM2 A;  4DRT A;  3GVB A;  1GA0 A;  4S2O A;  4DXC A;  1IKI A;  2Y2J A;  4WZ5 C;  2ZM8 A;  2H10 A;  4X55 A;  1K4E A;  4D2O A;  5FAQ A;  2B5R A;  1MWU A;  4DE2 A;  2Y2N A;  1NY0 A;  1ES3 A;  4QU3 A;  5KSH A;  1I2S A;  1YMS A;  4KZB A;  3WS2 A;  1YLY A;  4GOG A;  1TEM A;  1G6A A;  4S2I A;  4PM5 A;  1K54 A;  1H8Z A;  2Y2P A;  1YLW A;  3M2K A;  2HDS A;  4JLF A;  3HLE A;  2V2F F;  3VSL A;  4BD1 A;  2WAD A;  5CED A;  1LI0 A;  4OH0 A;  5AQB A;  3FZC A;  3OZH A;  3ZG0 A;  3GMW A;  2Y2M A;  3EQU A;  1JWP A;  1YLT A;  3PBO A;  3V3S A;  1NYM A;  3JYI A;  4LV3 A;  4X53 A;  4HEF A;  4K91 A;  3HLD A;  5DVA A;  3TG9 A;  5I94 A;  1RGZ A;  2H5S A;  3C7U A;  3PAE A;  3AGE A;  1EWZ A;  3HLW A;  1QME A;  4OPZ A;  5HW3 A;  2Y2H A;  4NET A;  3HLF A;  2WGW B;  2XFT A;  5CRF A;  3SH7 A;  1MWR A;  5EVI A;  1MWS A;  3VFF A;  5CHM A;  2WAE A;  2Y55 A;  3C4O A;  3BFF A;  5EPH A;  5FAT A;  2XD1 A;  3RXX A;  3UPO A;  3M6H A;  3V3R A;  1S6R A;  5FI7 A;  4XUX A;  1KGE A;  2ZQA A;  3C4P A;  5CXW A;  2ZD8 A;  4MBH A;  4FH2 A;  3IH8 A;  1TDL A;  4X68 A;  4PM6 A;  3CZD A;  1FR6 A;  1ES4 A;  4JBF A;  1JWZ A;  4X6T A;  4HBU A;  1ONG A;  3V5M A;  2ZC6 B;  1IKG A;  1NXY A;  2ZC4 B;  1YQS A;  3RXW A;  4GNU A;  5EE8 A;  5F1G A;  4WEK A;  4LCL A;  4OOL A;  5F83 A;  1XX2 A;  3LY4 A;  4GD6 A;  3ZDJ A;  3FYZ A;  1L0F A;  1XGJ A;  2VGK A;  4Y0U A;  5EVL A;  2P74 A;  2ZC3 B;  4RYE A;  3NDG A;  4PM9 A;  1DJB A;  2OLU A;  2Y4A A;  1C3B A;  2ZQC A;  4OOY A;  3ZHH A;  1ZKJ A;  5J8X A;  3BLM A;  4R3J A;  3MZD A;  3BLS A;  4KG2 A;  3PBT A;  3VOY A;  1XXM A;  4ZAM A;  4GKU A;  3HLC A;  2ZQ9 A;  1HTZ A;  3HLG A;  2E8I A;  4ZJ2 A;  1K57 A;  4OPQ A;  2HPB A;  4E3N A;  1KDS A;  2J9P A;  4RA7 A;  3SH8 A;  2FFY A;  3UPP A;  1IYP A;  1HVB A;  3LO7 A;  5HAP A;  4IED A;  4MBF A;  4DE1 A;  4BD0 A;  1FOF A;  4Y7P A;  3P98 A;  4Z9Q A;  1KDW A;  3SS5 A;  1K55 A;  2ZMA A;  2Y2O A;  3OPP A;  4OQ0 A;  1U60 A;  4DE0 A;  1L0D A;  4DDY A;  1W79 A;  2ZJ9 A;  4GD8 A;  4WZ4 A;  3NBL A;  2XQZ A;  1YLP A;  3IHA A;  4PPR A;  3IH9 A;  4RX3 A;  4ZTK A;  1PW8 A;  1YMX A;  2JC7 A;  4QHC A;  5DTS A;  3TOI A;  4GB7 A;  4E3J A;  4OON A;  5CEC A;  3S1Y A;  1E4D A;  2XF3 A;  1E3U D;  4S2N C;  2WZZ A;  1QMF A;  3QNB A;  4O7D A;  3VP3 A;  5GLD A;  4KZ9 A;  5FQK A;  2DRW A;  4RX2 A;  3S4X A;  5KZH A;  1KGG A;  2XLN A;  3CMZ A;  3BEC A;  5HL1 A;  3RJU A;  1BLH A;  5CTM A;  2Y59 A;  1ZG6 A;  3WS4 A;  3DTM A;  1SDE A;  4KQO A;  3ZG8 B;  3UNW A;  1CEG A;  1WE4 A;  4C3Q A;  3V39 A;  1JTD A;  2JBF A;  2OSU A;  3SS4 A;  2J9O A;  1XPB A;  1ERO A;  1PI5 A;  4UAA A;  5FA7 A;  1G68 A;  4R4S A;  3W4P A;  4CJN A;  4PMA A;  3WS1 A;  4EBP A;  4EBL A;  3LY3 A;  1TDG A;  3WS5 A;  3UO9 A;  5EOE A;  3G32 A;  1BUL A;  3HUO A;  3G31 A;  4PM7 A;  2XD5 A;  2BG1 A;  1L0E A;  3PBN A;  1W7F A;  2JCH A;  1KVL A;  3ITA A;  5E2E A;  4KZA A;  1GHI A;  2WKE A;  1FCO A;  3Q81 A;  4P0M A;  3MZE A;  4OOM A;  1K54 C;  5FSR A;  5EVI C;  3AGD A;  3MXR A;  5CHU A;  3CG5 A;  1BZA A;  4BQM A;  1XA7 A;  1K6S A;  3G2Y A;  4LEN A;  3DWK A;  5AQ9 A;  3VP1 A;  5GLA A;  1FCN A;  3O86 A;  4BJP A;  3IF5 A;  2Z2L B;  2Z2M B;  5E2G A;  5CER A;  5EEC A;  3UE0 A;  3O88 A;  1BTL A;  2WGI A;  5G18 A;  4E3M A;  3PAG A;  3QNC A;  1IEM A;  1YM1 A;  4WMC A;  1OME A;  2GDN A;  1L0G A;  4WMC D;  4MLL A;  1KE3 A;  1S0W A;  4KEN B;  1H8Y A;  3NCK A;  2XFS A;  1IYQ A;  4P6B A;  4X56 A;  3NC8 A;  4ZBE A;  3UDF A;  1BSG A;  2Y91 A;  3HLB A;  2Y2K A;  1DY6 A;  1DJC A;  3N8L A;  4IVK A;  4ZJ3 A;  3PBQ A;  3ITB A;  1BUE A;  3ZFZ A;  4E6X A;  3Q07 A;  2EX2 A;  4QJG A;  4QD4 A;  1MPL A;  3ZCZ A;  2DNS A;  3C7V A;  2XDM A;  1RGY A;  3WS0 A;  4S2M A;  4E3O A;  3IWQ A;  3BYD A;  3QHY A;  4UA6 A;  5FQQ A;  4EV4 A;  2EX8 A;  1E3U A;  5F82 A;  5GHZ A;  3HUN A;  3LEZ A;  3SOI A;  2HDU A;  2V1Z A;  1FSY A;  3ZNT A;  3FKW A;  4KZ7 A;  1CK3 A;  1SCW A;  2H0Y A;  1W8Y A;  5AQA A;  2Y2I A;  2X02 A;  4R1G A;  5EOO A;  1H5X A;  1LL9 A;  2RCX A;  3UN7 A;  1NZU A;  2OLV A;  2WKI A;  4WEJ A;  4KG5 A;  4Y0T A;  1EI5 A;  4JPM A;  1K56 D;  1O7E A;  2ZQ8 A;  4M3K A;  4P85 A;  4WZ5 A;  5DF9 A;  1RCJ A;  4KZ6 A;  2RL3 A;  4JF4 A;  4EQI A;  3VFH A;  1NJ4 A;  3HVF A;  3IXG A;  2DCF A;  3OCN A;  3IF6 C;  2R9X A;  2P9V A; 
#chains in the Genus database with same CATH topology
 2OWJ A;  3VMA A;  2HP6 A;  4MEZ A;  5FEG A;  5HSQ A;  4JGP A;  3MQ0 A;  2QKP A;  1PIO A;  4E6W A;  3LIE A;  4YNR A;  1DP8 A;  1T1C A;  4EW7 A;  4FTX A;  3G2Z A;  5TBM A;  2A24 A;  1ESU A;  1XKZ A;  2HDQ A;  3FKV A;  5D3O A;  5HZH A;  2VK3 A;  3MF0 A;  3C30 A;  4OPR A;  3F1P A;  3C5A A;  3P7N A;  5TR7 A;  3IXD A;  2W3E A;  1O07 A;  2QPN A;  5CHJ A;  1IYS A;  2B02 A;  4XUZ A;  4F94 A;  1P9W A;  2IA2 A;  2X01 A;  1K56 A;  2R9W A;  2PYR A;  3MZF A;  3EGD C;  3JVU A;  2HP9 A;  4N1H A;  4ARZ B;  5E2H A;  2PT7 A;  3DTE A;  2WUQ A;  2XK1 A;  5JYO A;  2JN7 A;  1LSW A;  4NEE D;  4HQA A;  4WM9 A;  2J7V A;  5A8B A;  1YT4 A;  1GCE A;  2EFU A;  5DJT A;  2OAP 1;  4WL9 A;  3TSG A;  4GDB A;  4QY6 A;  2B18 A;  4FH4 A;  4GDN A;  1JVJ A;  2EFX A;  3PBS A;  4GZB A;  4S2P A;  2P08 A;  4E3L A;  3QP4 A;  3VE4 A;  1PW1 A;  2ZQD A;  4DF6 A;  1S67 L;  2EA9 A;  3HBR A;  2Y2G A;  2QYB A;  2VGL S;  3MFD A;  1JWV A;  3T1R A;  2UWX A;  4OPY A;  2MJ6 A;  2VX8 A;  1WYB A;  4OKP A;  3MQQ A;  5M19 A;  3R4K A;  1VET B;  3R7W B;  1I2W A;  4L9E A;  4L0L A;  1V9Z A;  2YKF A;  5FAP A;  1KE4 A;  1Y54 A;  4N1X A;  4GN2 A;  3OPR A;  4GW9 A;  4YFM A;  2EXB A;  3NY4 A;  1GA9 A;  2Y2L A;  1ZTU A;  1VEU A;  4S2L A;  3WRT A;  2Y8H A;  1MC0 A;  3ZG5 A;  2HF6 A;  3VP4 A;  2Z6D A;  3AGF A;  1TF1 A;  5J3W A;  1D06 A;  1KVM A;  5FQJ A;  4MN6 A;  3A3E A;  5AJG A;  2WK0 A;  5HAR A;  5K5B A;  3IF6 B;  2OV5 A;  4WLA A;  4H6J A;  3CJM A;  1BLP A;  1ERM A;  2J8Y A;  4EWF A;  4NK3 A;  3HUM A;  3HRE A;  3OPL A;  1Z6F A;  5F1F A;  1Q2Q A;  3FPV A;  4JF5 A;  3LIF A;  3G34 A;  4JGO A;  3MXQ A;  2L0W A;  1IEL A;  1DJA A;  1NRF A;  4Y2F A;  3CAX A;  4LGW A;  5HL6 A;  3PBR A;  1L2S A;  5HDS A;  4K08 A;  4JKT A;  1WYC A;  2XGN A;  4Y13 A;  1YLJ A;  4MDZ A;  3UPN A;  2CC1 A;  4Y15 A;  1W63 Q;  3G35 A;  1YKD A;  2XSS A;  5CGX A;  5DTT A;  5HWV A;  2VZW A;  3N8R A;  1F2K A;  1LSV A;  2Q9N A;  2G2W A;  5LBR A;  3QP2 A;  3A3I A;  1LL5 A;  3U4L P;  3UB7 A;  2ZM2 A;  2VKS A;  2PAV P;  3GVB A;  4S2O A;  1IKI A;  4WZ5 C;  3KSG A;  2JKG A;  3WS2 A;  4S2I A;  4PM5 A;  3M2K A;  2HDS A;  3MS6 A;  3VSL A;  2WAD A;  3L9K A;  4MCW A;  3B33 A;  3GMW A;  2Y2M A;  5HWT A;  3EQU A;  3PBO A;  3JYI A;  3S7P A;  3C7U A;  3PAE A;  3HLW A;  5HW3 A;  2VLG A;  3KSI A;  2ZL1 B;  3BFF A;  5EPH A;  5FI7 A;  1KGE A;  4GS9 B;  3C4P A;  2BTF P;  4I5S A;  4FH2 A;  3D3O A;  1TDL A;  1ES4 A;  2LB5 A;  4EU0 A;  1ONG A;  2ZC6 B;  2KDK A;  3LY4 A;  3ZDJ A;  2P74 A;  3NDG A;  2OLU A;  4R3J A;  5G4Z A;  1TS8 A;  3T4S A;  5KIZ A;  2L1M A;  4GKU A;  3HLG A;  3B47 A;  3L7H A;  1KDS A;  3SH8 A;  3G6O A;  4DE1 A;  3SS5 A;  1K55 A;  5DJU A;  3QP5 A;  1W79 A;  3VOL A;  4ZTK A;  5DTS A;  1PW8 A;  1YMX A;  4GHI B;  4QHC A;  5FL3 A;  4GB7 A;  4LRX C;  4B9O A;  1E3U D;  2WZZ A;  1AWI A;  3CUE C;  5GLD A;  2CMN A;  3MJQ A;  3T4J A;  5CTM A;  5DKK A;  4X25 A;  4C3Q A;  3O5Y A;  1OTD A;  4CLC C;  3BY8 A;  4CJN A;  2W1T A;  3LR4 A;  3G31 A;  4PM7 A;  2XD5 A;  1W7F A;  2JCH A;  5E2E A;  4P0M A;  4BBU A;  3G2Y A;  4LEN A;  3O86 A;  4BJP A;  3IF5 A;  2GNX A;  5CER A;  2PR6 A;  2INW A;  1YM1 A;  4QWO A;  4EES A;  4WMC D;  2XA7 M;  4EER A;  2OAQ 1;  3LIB A;  3HLB A;  2Y2K A;  4ZJ3 A;  4G3W A;  4QJG A;  3Q07 A;  2EX2 A;  2HV1 A;  2GX5 A;  4ZRR A;  3QHY A;  4EV4 A;  4RQ9 A;  1E3U A;  5F82 A;  5FDS A;  4LLO B;  3ZNT A;  3S7Q A;  2WKQ A;  4KZ7 A;  2H0Y A;  1W8Y A;  2X02 A;  1NZU A;  2OLV A;  4Y0T A;  2PR5 A;  1K56 D;  1GSX A;  2ZQ8 A;  4M3K A;  4P6Z S;  3IXG A;  2DCF A;  2LB9 A;  3IF6 C;  2P9V A;  4U3T A;  2PU4 A;  3UB9 A;  3FWL A;  2HP5 A;  3MMH A;  3E4P A;  2ZM0 A;  2PHY A;  1STZ A;  5FAO A;  3NI9 A;  2WGW A;  4DXB A;  1MKM A;  3W8K A;  5FAS A;  1BLS A;  1ESI A;  4F3L A;  1MZU A;  1J9M A;  3N4I A;  1Q2P A;  5GL9 A;  3H82 A;  4EUZ A;  3E2L A;  2D02 A;  4BL2 A;  3IWI A;  4S2N A;  3BFE A;  3IS2 B;  4K0W A;  3SH9 A;  3BFC A;  4QPR A;  2W1T B;  3Q82 A;  3GR2 A;  2ZC5 B;  3QP6 A;  4MN7 A;  1P0Z A;  1K6R A;  3KSH A;  3WRZ A;  3O87 A;  1FSW A;  4CLC A;  1TD5 A;  3BWL A;  3ZG9 B;  4BBT A;  2NUT C;  1IYO A;  5L8M A;  4Q0I A;  5HPF A;  4NG2 A;  2EXA A;  1OTI A;  5EVI B;  4MNR A;  4JF6 A;  3NIA A;  1M40 A;  5U47 A;  1K55 C;  1XJ3 A;  5HDC A;  2AVX A;  1YLZ A;  1XA1 A;  4UEY A;  4LV2 A;  1N9B A;  1K38 A;  2W3D A;  4JXG A;  4OQG A;  4I3I A;  1VHM A;  3LYX A;  3RFB A;  4EXO A;  3Q1F A;  4G3K A;  4EET B;  5L07 A;  4LV1 A;  1W5D A;  5IHV A;  2HDR A;  3T12 B;  5HAI A;  2PBD P;  3PTE A;  3R7W A;  4IHQ A;  4AFI A;  3IX4 A;  2FFF B;  3EQV A;  3LCE A;  3MXS A;  5E43 A;  3TRC A;  4UA7 A;  1S1Y A;  4R6L A;  3IT9 A;  3ZNY A;  1SKO A;  3IHB A;  4RVA A;  4IBR A;  3IX3 A;  3PXP A;  5DFX A;  4NXG A;  5CEB A;  2UV0 E;  3BFD A;  4YOF A;  1GHM A;  2WZX A;  4I38 A;  1YPR A;  3IXB A;  1KOU A;  1AXB A;  1LLB A;  3KYE A;  3BY9 A;  4JXS A;  1PI4 A;  1N9O A;  3UB8 A;  2ZLY A;  1KGF A;  1NLY A;  3C2W A;  1VQQ A;  2I72 A;  2WKR A;  2XRO A;  4KQD A;  3T50 A;  5EVI D;  4B88 A;  5FQM A;  3M2J A;  4FD8 A;  4L9F A;  5FI6 A;  1MXO A;  3ZVW A;  4ZDX A;  5EM1 A;  1XFN A;  4Q8I A;  2BLS A;  2JKF A;  3G4P A;  1N9N A;  1PFL A;  2PBY A;  4JGR A;  1GHP A;  3MFX A;  3VP2 A;  2X71 A;  4HH3 A;  2O9C A;  1ZG4 A;  4BBV A;  3RTY A;  1MKI A;  2Q9M A;  4E3I A;  5EVE A;  3LI9 A;  1PNE A;  2H10 A;  4UQI M;  5EFW A;  5FAQ A;  1MWU A;  4DE2 A;  5KSH A;  1NY0 A;  1I2S A;  1YLY A;  4WUJ A;  1G6A A;  2Y2P A;  1YLW A;  1S66 L;  3K3D A;  4H6J B;  1YAX A;  3CI6 A;  3ZG0 A;  2J80 A;  3CPT B;  3V3S A;  4K91 A;  2KX6 A;  5L09 A;  3HLD A;  3LR3 A;  3TG9 A;  5I94 A;  1RGZ A;  1ACF A;  5HDD A;  3MSH A;  1Y28 A;  1N9L A;  1H0M A;  4NET A;  4R38 A;  2WGW B;  5CRF A;  3EOI A;  1VEU B;  3H9W A;  3RXX A;  3M6H A;  1NWZ A;  5CXW A;  4PM6 A;  4JBF A;  4E04 A;  5TJJ A;  2O9B A;  5EE8 A;  4OOL A;  1XX2 A;  1T19 A;  4GD6 A;  3FYZ A;  4Y0U A;  5EVL A;  2ZQC A;  1ZKJ A;  4FUW A;  1XXM A;  2FZ0 A;  4ZAM A;  2ZQ9 A;  1HTZ A;  4CLC D;  3ZQ5 A;  2FFY A;  3UPP A;  1HVB A;  5HAP A;  4BD0 A;  2ZMA A;  3OPP A;  4OQ0 A;  4DE0 A;  4NXE A;  1L0D A;  4DDY A;  4LRY C;  2ZJ9 A;  4GD8 A;  1YLP A;  3IHA A;  4PPR A;  4RX3 A;  2JC7 A;  1S4R A;  3TOI A;  4E3J A;  2PD7 A;  3QNB A;  5FQK A;  2DRW A;  4RX2 A;  3S4X A;  5KZH A;  3BEC A;  1SDE A;  4I3A A;  1H8M A;  5J7E A;  1WE4 A;  1JTD A;  3E4Q A;  5L10 A;  1OJ5 A;  1A0K A;  3F1N B;  2M7U A;  2O99 A;  3NOP C;  5FSR A;  5EVI C;  3A0V A;  3CG5 A;  1BZA A;  1P97 A;  1WA9 A;  1XA7 A;  3VP1 A;  1FCN A;  2A24 B;  2Z2L B;  3UE0 A;  1VB6 A;  1BTL A;  5G18 A;  2P04 A;  4WMC A;  1OME A;  2GDN A;  4MLL A;  3UB6 A;  3NCK A;  1IYQ A;  4X56 A;  4ZBE A;  2Y91 A;  3N8L A;  3ITB A;  3ZFZ A;  4QD4 A;  1J3W A;  1RGY A;  4PKY G;  3WS0 A;  4S2M A;  4E3O A;  3UMD A;  3IWQ A;  4UA6 A;  4GLQ A;  2W3H A;  2VA0 A;  3HUN A;  3SOI A;  4GJ4 A;  3FKW A;  1OTA A;  2DMW A;  4DMZ A;  2ZOI A;  4R1G A;  2KLI A;  2RCX A;  3UN7 A;  4WEJ A;  4KG5 A;  1EI5 A;  4WZ5 A;  3KYZ A;  4EEU A;  3C8C A;  3LIC A;  1RCJ A;  3BJN A;  1NJ4 A;  3NEC A;  4Z1W A;  4UQI S;  4MN5 A;  4LCM A;  3P01 A;  3M6B A;  3E2K A;  4U0T A;  1LL8 A;  4P6Z M;  4DDS A;  4XXR A;  2FH5 A;  5AVF A;  5CGW A;  3W4O A;  1ZC2 A;  4II7 A;  5A90 A;  4QB8 A;  4HBT A;  2P9V B;  3B3X A;  4R3A A;  4Y0O A;  4DN0 A;  1G28 A;  1CI8 A;  1EW0 A;  3N8S A;  1BLC A;  5E2F A;  3DTK A;  3IBR A;  4GS9 A;  1FIL A;  1NZO A;  2OOL A;  2BAS A;  1CEF A;  3GSG A;  4HJ6 A;  4O8G A;  3WWX A;  1UWN X;  5DF8 A;  3DW0 A;  3F1N A;  4KZ4 A;  1NLZ A;  2HJ9 C;  3UY6 A;  2EX6 A;  3BFG A;  1V9Y A;  2H0T A;  3IQA A;  1W8Q A;  2V20 A;  5F6A A;  4BLM A;  1DP9 A;  2W0N A;  1FR1 A;  3GQZ A;  3FC7 A;  4WEL A;  4KQQ A;  3EGX C;  3VP0 A;  1XFQ A;  3ZVT A;  5L2F A;  4O0P A;  1FCM A;  4B4Z A;  1S4S A;  4CLC E;  1PZP A;  1I5Q A;  1PYY A;  4HH2 A;  1G6O A;  2A3U A;  4C75 A;  2K2N A;  2QJ7 A;  3LIA A;  3I7J A;  2JKR M;  5GLC A;  1XJ2 A;  3Q7Z A;  1FQG A;  5TGF A;  1PRQ A;  3MKF A;  5IU1 A;  3T4Q A;  3GRJ A;  3SS3 A;  5GHY A;  3IWO A;  4OQH A;  2JE5 A;  4JXV A;  5JYP A;  4WN5 A;  5TBM B;  2WYX A;  5EM0 A;  3UDI A;  1K57 C;  3H7W B;  1LI9 A;  2XRN A;  4OQI A;  5FI2 A;  2PRF A;  3OCL A;  1HZO A;  4C6Y A;  3N7W A;  3HJK A;  3Q7V B;  5F69 A;  2WGV A;  4DE3 A;  4PHT A;  4OLD A;  3T4T A;  4I39 A;  3N6I A;  2B95 A;  3IXH A;  1KE0 A;  4NKP A;  1N4O A;  4YIN A;  4S2J A;  5CTN A;  2ZOH A;  1PZO A;  1YSP A;  4PM8 A;  2WKH A;  2ACG A;  4OP5 A;  3H82 B;  3KSF A;  2JHE A;  4ME4 A;  2EWW A;  4EBN A;  1TVF A;  3ZG7 B;  3MBZ A;  3O3V A;  2XEP A;  2VGJ A;  4WBG A;  4HY8 A;  1PWC A;  4KUK A;  2WAF A;  3IF6 A;  4IBX A;  3BRM A;  5TFQ A;  4H8R A;  3RH8 B;  1MBL A;  3KX0 X;  3FPW A;  3DTI A;  3NHQ A;  4GCZ A;  3T1X A;  1UWP X;  2H28 A;  4BMW A;  3OLO A;  3JPU A;  3TW8 A;  5KMW A;  2L4R A;  5HFO A;  3NJA A;  3E0Y A;  5FDH A;  4XT2 A;  3LEQ A;  5C5K A;  1XP4 A;  3S22 A;  3BM6 A;  2I9V A;  3DAV A;  3LUQ A;  4N9L A;  3S7N A;  4O01 A;  4DXC A;  4HIA A;  2Y2J A;  2ZM8 A;  4X55 A;  2XA7 S;  2B5R A;  2Y2N A;  1ES3 A;  4JLF A;  1D7E A;  4BD1 A;  1OT6 A;  1LI0 A;  5AQB A;  3FZC A;  3LR0 A;  1YLT A;  4LV3 A;  4HEF A;  4EQ1 A;  5MC7 A;  2H5S A;  3AGE A;  2G7U A;  1OTB A;  1QME A;  2Y2H A;  4HJ4 A;  3HLF A;  2XFT A;  5EVI A;  5HPI A;  1MWS A;  5CHM A;  2WAE A;  2Y55 A;  4I3J A;  2NUP C;  5FEF A;  3UPO A;  1S6R A;  2ZQA A;  4HP9 A;  4IJG A;  4MBH A;  1GSW A;  3IH8 A;  1FR6 A;  2PYP A;  3IBJ A;  5EV0 A;  4X6T A;  4HBU A;  2V1A A;  1NXY A;  2M1C A;  2ZC4 B;  4GNU A;  4WEK A;  4LCL A;  4X1L A;  3LFV A;  2VGK A;  3HJI A;  3U2A A;  4RYE A;  4HNB A;  2V8C A;  2Y4A A;  1C3B A;  3ZHH A;  3NOT C;  3MZD A;  3PBT A;  3VOY A;  3GEC A;  3E4O A;  3T1S A;  4ZJ2 A;  2HPB A;  3TJZ C;  2J9P A;  3IX8 A;  4MMN A;  3LO7 A;  1OTE A;  4MBF A;  1DRM A;  4Y7P A;  1KDW A;  1H3Q A;  3PYP A;  3UME A;  4M4X A;  3S1Y A;  1E4D A;  3PR6 A;  3D72 A;  4BWI A;  3LID A;  3VV4 A;  1KGG A;  2XLN A;  3RJU A;  5CX7 A;  1BLH A;  3T4K A;  1ZG6 A;  3WS4 A;  3DTM A;  3ZG8 B;  1CEG A;  3K3C A;  2JBF A;  2OSU A;  5FA7 A;  1G68 A;  4R4S A;  3W4P A;  4D60 A;  4EBP A;  4EBL A;  3EWK A;  2M7V A;  3WS5 A;  5EOE A;  3G32 A;  4HHD A;  2BG1 A;  3PBN A;  2GJ3 A;  1KVL A;  1T1B A;  1GHI A;  2WKE A;  1FCO A;  3Q81 A;  3MZE A;  5J4E A;  3SW1 A;  4OOM A;  3AGD A;  3TE8 A;  4FOF A;  3T4L A;  1X0O A;  1K6S A;  5AQ9 A;  3DWK A;  2YKH A;  5E2G A;  2Z2M B;  3O88 A;  2WGI A;  4LRZ E;  1IEM A;  4NXB A;  4ETX A;  2PD8 A;  4R70 A;  3A0R A;  4P6B A;  3UDF A;  1HLU P;  4IVK A;  3ZCZ A;  4LPZ A;  2XDM A;  2OWH A;  4JGQ A;  3BYD A;  5FQQ A;  4XT2 B;  1TS7 A;  2ZBB A;  2HDU A;  2V1Z A;  1FSY A;  2V9A A;  3VE3 A;  1CK3 A;  5IS1 A;  3S7O A;  1SCW A;  2Y2I A;  5EOO A;  3F1P B;  1H5X A;  1LL9 A;  3OBF A;  5DF9 A;  4JF4 A;  4EQI A;  2R9X A;  3A3F A;  1ONH A;  5HD3 A;  5GLB A;  2JKR I;  4ARZ A;  1JTG A;  4UHU A;  3UB5 P;  1SDN A;  3SZT A;  3PHY A;  1S1Z A;  4N92 A;  2IWD A;  3A0S A;  3A3D A;  1PWD A;  5EUA A;  5GHX A;  3OOV A;  3T4O A;  4HI4 A;  5M1A A;  2D01 A;  4B93 A;  1ES2 A;  2PU2 A;  2Y79 A;  3BQ8 A;  4B4X A;  2V1B A;  3LGO A;  5HX9 A;  4OLG A;  4ESP A;  4Y17 A;  1JNU A;  3UDX A;  4E3K A;  4KG6 A;  2QMI A;  3W4Q A;  1XGI A;  4KZ5 A;  2IWB A;  5A91 A;  2J3T D;  2Y2Q A;  1FIK A;  4QY5 A;  3GDI A;  3F1O B;  4KQR A;  1BT5 A;  5DTK A;  3CWF A;  2HZ5 A;  2EX9 A;  4L9G A;  3VOZ A;  1XJ4 A;  4KZ8 A;  1ES5 A;  2EWV A;  5M18 A;  4P87 A;  4HES A;  3IS2 A;  5AVE A;  1K25 A;  4N9K A;  4FCF A;  3HL9 A;  1ERQ A;  5A93 A;  4MBK A;  3UE1 A;  5KSC A;  4Q0H A;  4F3L B;  1ODV A;  1M6K A;  2J3W A;  2A49 A;  1ALQ A;  1CJF A;  5A92 A;  2R78 A;  1IFQ A;  1L3L A;  1K4F A;  2XR0 A;  5CGS A;  1D1J A;  1OT9 A;  2GZA A;  5HAQ A;  2P7J A;  3DWZ A;  1LHY A;  4X69 A;  2VGL M;  4CPK A;  3QP8 A;  3OPH A;  4ETZ A;  5G4Y A;  3CHW P;  4R4R A;  4R3B A;  1VET A;  4EUV A;  3MKE A;  3GTC A;  1MWT A;  2IWC A;  3G30 A;  1E25 A;  4DKI A;  5FQ9 A;  2W1R A;  3NOU C;  2ZL1 A;  2C5W B;  2JKT M;  3GV9 A;  2XH9 A;  1XJ6 A;  3ZYT A;  4U0X A;  4DJ3 A;  5DFY A;  2ZC7 A;  2G2U A;  2V0W A;  4OVD A;  3B42 A;  4BL3 A;  4ZJ1 A;  4KZ3 A;  1NRJ A;  3NDE A;  5AQ7 A;  3V50 A;  4ID4 A;  1HD8 A;  4FSF A;  5FQI A;  3D4F A;  3DBA A;  4IVI A;  4R0Q A;  5F5Y A;  1Y4O A;  5BOH A;  2C6W B;  1MY8 A;  4A5R A;  1VM1 A;  4G3V A;  4R23 A;  1SHV A;  3VSK A;  4K0X A;  3LI8 A;  3BEB A;  3T1Q B;  3OC2 A;  3A3J A;  3ISG A;  1SKF A;  2V8F A;  3FV7 A;  3EEH A;  2VV7 A;  3V67 A;  1Z09 A;  4WYY A;  1CI9 A;  4GHI A;  1RP5 A;  3BW6 A;  1NYY A;  1PWG A;  1DP6 A;  3MR0 A;  2QHK A;  5I5L A;  4PKY A;  4LV0 A;  3UE3 A;  3ZGA B;  4Q0J A;  2Z6C A;  3P09 A;  2QZ6 A;  4UA9 A;  3UE6 A;  4Y3I A;  4S2K A;  3Q7V A;  5DF7 A;  3F1O A;  4HJ3 A;  2ZQ7 A;  1GSV A;  4BEN A;  4JXW A;  4DRT A;  3E98 A;  1GA0 A;  2WKP A;  3CUE A;  3NUL A;  1K4E A;  4D2O A;  3K2N A;  4QU3 A;  1YMS A;  4KZB A;  2PDR A;  4GOG A;  1TEM A;  1K54 A;  1H8Z A;  2JKT I;  2W3G A;  4CQH A;  3H7W A;  3MQO A;  3HLE A;  2V2F F;  5CED A;  4OH0 A;  2Q0O A;  1F5M A;  3OZH A;  2VJW A;  1BYW A;  4X1M A;  1JWP A;  1NYM A;  2J3T C;  4X53 A;  2QWS A;  5DVA A;  3CPT A;  1IOU A;  3ICY A;  3QP1 A;  3W2Z A;  1EWZ A;  4OPZ A;  1W63 M;  2QJ5 A;  3SH7 A;  1MWR A;  2O9A A;  3VFF A;  3C4O A;  4DJ2 A;  5FAT A;  2XD1 A;  4EEP A;  3V3R A;  3D9Y A;  4XUX A;  2ZD8 A;  4IUH A;  4X68 A;  1ZHH B;  2K7S A;  3CZD A;  1F9I A;  2W27 A;  5HWW A;  1JWZ A;  3V5M A;  1IKG A;  1OPX A;  1SZV A;  1YQS A;  3RXW A;  5F1G A;  5F83 A;  1L0F A;  1XGJ A;  2ZC3 B;  1T18 A;  4PM9 A;  1DJB A;  5DKL A;  4OOY A;  1F98 A;  3KYQ A;  5J8X A;  3BLM A;  4KG2 A;  3BLS A;  4PAU A;  2VV8 A;  3HLC A;  4LFU A;  3BQA A;  2E8I A;  1K57 A;  4OPQ A;  3EEA A;  4E3N A;  4RA7 A;  2KOI A;  1IYP A;  1LT0 A;  4IED A;  1FOF A;  3P98 A;  4Z9Q A;  2Y2O A;  2A2L A;  1U60 A;  2E8J A;  1SKO B;  4WZ4 A;  3NBL A;  2XQZ A;  3IH9 A;  2V0U A;  4OON A;  5CEC A;  2XF3 A;  2K31 A;  4S2N C;  1QMF A;  2VV6 A;  4O7D A;  3VP3 A;  4KZ9 A;  3CMZ A;  2HGV A;  5HL1 A;  2Y59 A;  4KQO A;  1CF0 A;  3UNW A;  1OJG A;  2O0Y A;  3V39 A;  3SS4 A;  2J9O A;  1XPB A;  1ERO A;  1PI5 A;  4UAA A;  1G5U A;  4PMA A;  3WS1 A;  3LY3 A;  1TDG A;  3CIT A;  4KUO A;  3UO9 A;  2HJE A;  1BUL A;  3HUO A;  5F68 A;  5HD5 A;  1L0E A;  1P9R A;  1YSQ A;  5IT5 A;  3ITA A;  3LR5 A;  4HP4 A;  4KZA A;  4WF0 A;  2ZMV A;  1K54 C;  3MXR A;  5CHU A;  3CLO A;  4BQM A;  2W3F A;  3FG8 A;  5GLA A;  1TS6 A;  3JVV A;  5EEC A;  4Y5F A;  2VEA A;  4E3M A;  1K0K A;  3HCY A;  3PAG A;  3QNC A;  4YWZ A;  3KO6 A;  4IUK A;  1L0G A;  1KE3 A;  1S0W A;  4KEN B;  1H8Y A;  2XFS A;  3NC8 A;  1BSG A;  1DY6 A;  1DJC A;  3PBQ A;  1T1A A;  1BUE A;  4E6X A;  1MPL A;  1TS0 A;  2DNS A;  3C7V A;  1CQA A;  4NXF A;  4HOI A;  2ZMF A;  2EX8 A;  1LSX A;  5GHZ A;  3LEZ A;  5AQA A;  3C38 A;  3ULF A;  2WKI A;  4JPM A;  1O7E A;  1UGU A;  4P85 A;  4KZ6 A;  2RL3 A;  3VFH A;  3HVF A;  4CLC B;  3OCN A;  4OP8 A; 
#chains in the Genus database with same CATH homology
 3A3F A;  4LCM A;  1ONH A;  4U3T A;  2PU4 A;  3M6B A;  5GLB A;  3E2K A;  3VMA A;  2HP6 A;  3FWL A;  4U0T A;  4MEZ A;  4DDS A;  4XXR A;  2HP5 A;  1JTG A;  5CGW A;  3W4O A;  4UHU A;  1SDN A;  1ZC2 A;  2ZM0 A;  4N92 A;  1PIO A;  5A90 A;  4QB8 A;  2IWD A;  4HBT A;  4E6W A;  5FAO A;  3NI9 A;  2P9V B;  2WGW A;  3B3X A;  4Y0O A;  3A3D A;  4DXB A;  1PWD A;  5EUA A;  3W8K A;  5FAS A;  1BLS A;  1ESI A;  3G2Z A;  5GHX A;  1ESU A;  1CI8 A;  1J9M A;  1XKZ A;  3N4I A;  1Q2P A;  5M1A A;  2HDQ A;  3FKV A;  3N8S A;  1BLC A;  5D3O A;  5E2F A;  5GL9 A;  4EUZ A;  3E2L A;  1ES2 A;  4OPR A;  4BL2 A;  2PU2 A;  1NZO A;  3IWI A;  4S2N A;  3C5A A;  3BFE A;  5TR7 A;  4B4X A;  3IXD A;  1CEF A;  3GSG A;  1O07 A;  3WWX A;  2QPN A;  5HX9 A;  4OLG A;  4K0W A;  3SH9 A;  3BFC A;  5CHJ A;  1IYS A;  5DF8 A;  3UDX A;  3DW0 A;  4XUZ A;  4F94 A;  3Q82 A;  4E3K A;  2X01 A;  4KG6 A;  4KZ4 A;  2QMI A;  3GR2 A;  3W4Q A;  1K56 A;  3UY6 A;  2EX6 A;  1XGI A;  2ZC5 B;  3BFG A;  2H0T A;  2R9W A;  3MZF A;  3IQA A;  4KZ5 A;  2IWB A;  2HP9 A;  4N1H A;  1W8Q A;  2V20 A;  5A91 A;  4BLM A;  5E2H A;  2Y2Q A;  1FR1 A;  1K6R A;  2WUQ A;  3GQZ A;  2XK1 A;  3O87 A;  4WEL A;  3WRZ A;  4QY5 A;  5JYO A;  4KQQ A;  1FSW A;  3VP0 A;  4KQR A;  3ZVT A;  1BT5 A;  5DTK A;  5L2F A;  1FCM A;  4B4Z A;  4WM9 A;  1PZP A;  2J7V A;  2EX9 A;  1I5Q A;  1YT4 A;  1PYY A;  3VOZ A;  1GCE A;  2EFU A;  3ZG9 B;  3TSG A;  4KZ8 A;  1ES5 A;  1IYO A;  2A3U A;  4GDB A;  5M18 A;  4C75 A;  4QY6 A;  4P87 A;  4FH4 A;  4GDN A;  4HES A;  1JVJ A;  2EFX A;  3PBS A;  4GZB A;  4S2P A;  1K25 A;  4N9K A;  4FCF A;  2EXA A;  3I7J A;  4E3L A;  5EVI B;  4MNR A;  5GLC A;  4JF6 A;  3NIA A;  1M40 A;  5U47 A;  1K55 C;  1PW1 A;  3HL9 A;  3Q7Z A;  1FQG A;  2ZQD A;  1ERQ A;  5TGF A;  4DF6 A;  5A93 A;  4MBK A;  1YLZ A;  3MKF A;  3UE1 A;  1XA1 A;  5KSC A;  3GRJ A;  3SS3 A;  3HBR A;  2Y2G A;  4LV2 A;  1N9B A;  1K38 A;  4JXG A;  4OQG A;  1M6K A;  2A49 A;  1ALQ A;  5A92 A;  5GHY A;  3IWO A;  4OQH A;  2JE5 A;  1K4F A;  4JXV A;  3MFD A;  2XR0 A;  5CGS A;  1JWV A;  5JYP A;  2WYX A;  5HAQ A;  2UWX A;  3Q1F A;  4OPY A;  1K57 C;  3UDI A;  3DWZ A;  1LHY A;  1LI9 A;  1WYB A;  4LV1 A;  4OKP A;  1W5D A;  4X69 A;  5IHV A;  2HDR A;  4OQI A;  5HAI A;  4CPK A;  5M19 A;  3OPH A;  4R4R A;  3PTE A;  4R3B A;  1I2W A;  5FI2 A;  3MKE A;  3GTC A;  3OCL A;  1MWT A;  2FFF B;  2IWC A;  1HZO A;  3EQV A;  3LCE A;  3MXS A;  4L0L A;  5E43 A;  4C6Y A;  3G30 A;  3N7W A;  1E25 A;  4UA7 A;  4DKI A;  5FAP A;  3IT9 A;  5FQ9 A;  3ZNY A;  1KE4 A;  1Y54 A;  4RVA A;  3IHB A;  4N1X A;  4GN2 A;  3Q7V B;  4IBR A;  2WGV A;  3OPR A;  4YFM A;  2EXB A;  2C5W B;  4DE3 A;  3NY4 A;  1GA9 A;  4OLD A;  2Y2L A;  3GV9 A;  4S2L A;  5CEB A;  3BFD A;  1GHM A;  2WZX A;  3N6I A;  3WRT A;  2XH9 A;  3IXH A;  1KE0 A;  3ZG5 A;  3IXB A;  3VP4 A;  1N4O A;  4U0X A;  4S2J A;  4YIN A;  3AGF A;  2ZC7 A;  2G2U A;  5CTN A;  4OVD A;  1AXB A;  1KVM A;  5FQJ A;  1PZO A;  1LLB A;  4BL3 A;  4PM8 A;  4ZJ1 A;  3A3E A;  2WKH A;  4KZ3 A;  2WK0 A;  4OP5 A;  3NDE A;  5HAR A;  3IF6 B;  2OV5 A;  5AQ7 A;  3V50 A;  4EBN A;  4ID4 A;  1HD8 A;  3CJM A;  4FSF A;  1BLP A;  5FQI A;  1ERM A;  2J8Y A;  3D4F A;  4JXS A;  4EWF A;  1PI4 A;  4NK3 A;  1TVF A;  4IVI A;  4R0Q A;  5BOH A;  2C6W B;  3HUM A;  3HRE A;  3OPL A;  2ZLY A;  3ZG7 B;  3MBZ A;  1KGF A;  1MY8 A;  4A5R A;  1Z6F A;  3O3V A;  1VM1 A;  2XEP A;  4R23 A;  1SHV A;  1VQQ A;  2I72 A;  3VSK A;  5F1F A;  1Q2Q A;  2VGJ A;  4K0X A;  4WBG A;  3BEB A;  1PWC A;  3OC2 A;  4JF5 A;  2WAF A;  3IF6 A;  5EVI D;  4IBX A;  3A3J A;  3BRM A;  3G34 A;  5FQM A;  3M2J A;  4FD8 A;  5TFQ A;  4B88 A;  4H8R A;  3ISG A;  1MBL A;  1IEL A;  1DJA A;  1NRF A;  1SKF A;  5FI6 A;  1MXO A;  3FV7 A;  3ZVW A;  4ZDX A;  3PBR A;  4Q8I A;  1L2S A;  4WYY A;  2BLS A;  3G4P A;  1CI9 A;  1RP5 A;  4JKT A;  1NYY A;  1WYC A;  2XGN A;  1PWG A;  1YLJ A;  5KMW A;  5HFO A;  2PBY A;  3UPN A;  2CC1 A;  3G35 A;  3UE3 A;  4LV0 A;  5CGX A;  3ZGA B;  5DTT A;  5FDH A;  1GHP A;  1XP4 A;  2QZ6 A;  3P09 A;  3N8R A;  4UA9 A;  4S2K A;  3VP2 A;  3S22 A;  2X71 A;  3BM6 A;  2Q9N A;  2G2W A;  3Q7V A;  5DF7 A;  1ZG4 A;  4OP8 A;  2ZQ7 A;  4N9L A;  1MKI A;  3A3I A;  4BEN A;  1LL5 A;  2Q9M A;  4E3I A;  4JXW A;  2ZM2 A;  4DRT A;  3GVB A;  1GA0 A;  4S2O A;  4DXC A;  1IKI A;  2Y2J A;  4WZ5 C;  2ZM8 A;  2H10 A;  4X55 A;  1K4E A;  4D2O A;  5FAQ A;  2B5R A;  1MWU A;  4DE2 A;  2Y2N A;  1NY0 A;  1ES3 A;  4QU3 A;  5KSH A;  1I2S A;  1YMS A;  4KZB A;  3WS2 A;  1YLY A;  4GOG A;  1TEM A;  1G6A A;  4S2I A;  4PM5 A;  1K54 A;  1H8Z A;  2Y2P A;  1YLW A;  3M2K A;  2HDS A;  4JLF A;  3HLE A;  2V2F F;  3VSL A;  4BD1 A;  2WAD A;  5CED A;  1LI0 A;  4OH0 A;  5AQB A;  3FZC A;  3OZH A;  3ZG0 A;  3GMW A;  2Y2M A;  3EQU A;  1JWP A;  1YLT A;  3PBO A;  3V3S A;  1NYM A;  3JYI A;  4LV3 A;  4X53 A;  4HEF A;  4K91 A;  3HLD A;  5DVA A;  3TG9 A;  5I94 A;  1RGZ A;  2H5S A;  3C7U A;  3PAE A;  3AGE A;  1EWZ A;  3HLW A;  1QME A;  4OPZ A;  5HW3 A;  2Y2H A;  4NET A;  3HLF A;  2WGW B;  2XFT A;  5CRF A;  3SH7 A;  1MWR A;  5EVI A;  1MWS A;  3VFF A;  5CHM A;  2WAE A;  2Y55 A;  3C4O A;  3BFF A;  5EPH A;  5FAT A;  2XD1 A;  3RXX A;  3UPO A;  3M6H A;  3V3R A;  1S6R A;  5FI7 A;  4XUX A;  1KGE A;  2ZQA A;  3C4P A;  5CXW A;  2ZD8 A;  4MBH A;  4FH2 A;  3IH8 A;  1TDL A;  4X68 A;  4PM6 A;  3CZD A;  1FR6 A;  1ES4 A;  4JBF A;  1JWZ A;  4X6T A;  4HBU A;  1ONG A;  3V5M A;  2ZC6 B;  1IKG A;  1NXY A;  2ZC4 B;  1YQS A;  3RXW A;  4GNU A;  5EE8 A;  5F1G A;  4WEK A;  4LCL A;  4OOL A;  5F83 A;  1XX2 A;  3LY4 A;  4GD6 A;  3ZDJ A;  3FYZ A;  1L0F A;  1XGJ A;  2VGK A;  4Y0U A;  5EVL A;  2P74 A;  2ZC3 B;  4RYE A;  3NDG A;  4PM9 A;  1DJB A;  2OLU A;  2Y4A A;  1C3B A;  2ZQC A;  4OOY A;  3ZHH A;  1ZKJ A;  5J8X A;  3BLM A;  4R3J A;  3MZD A;  3BLS A;  4KG2 A;  3PBT A;  3VOY A;  1XXM A;  4ZAM A;  4GKU A;  3HLC A;  2ZQ9 A;  1HTZ A;  3HLG A;  2E8I A;  4ZJ2 A;  1K57 A;  4OPQ A;  2HPB A;  4E3N A;  1KDS A;  2J9P A;  4RA7 A;  3SH8 A;  2FFY A;  3UPP A;  1IYP A;  1HVB A;  3LO7 A;  5HAP A;  4IED A;  4MBF A;  4DE1 A;  4BD0 A;  1FOF A;  4Y7P A;  3P98 A;  4Z9Q A;  1KDW A;  3SS5 A;  1K55 A;  2ZMA A;  2Y2O A;  3OPP A;  4OQ0 A;  1U60 A;  4DE0 A;  1L0D A;  4DDY A;  1W79 A;  2ZJ9 A;  4GD8 A;  4WZ4 A;  3NBL A;  2XQZ A;  1YLP A;  3IHA A;  4PPR A;  3IH9 A;  4RX3 A;  4ZTK A;  1PW8 A;  1YMX A;  2JC7 A;  4QHC A;  5DTS A;  3TOI A;  4GB7 A;  4E3J A;  4OON A;  5CEC A;  3S1Y A;  1E4D A;  2XF3 A;  1E3U D;  4S2N C;  2WZZ A;  1QMF A;  3QNB A;  4O7D A;  3VP3 A;  5GLD A;  4KZ9 A;  5FQK A;  2DRW A;  4RX2 A;  3S4X A;  5KZH A;  1KGG A;  2XLN A;  3CMZ A;  3BEC A;  5HL1 A;  3RJU A;  1BLH A;  5CTM A;  2Y59 A;  1ZG6 A;  3WS4 A;  3DTM A;  1SDE A;  4KQO A;  3ZG8 B;  3UNW A;  1CEG A;  1WE4 A;  4C3Q A;  3V39 A;  1JTD A;  2JBF A;  2OSU A;  3SS4 A;  2J9O A;  1XPB A;  1ERO A;  1PI5 A;  4UAA A;  5FA7 A;  1G68 A;  4R4S A;  3W4P A;  4CJN A;  4PMA A;  3WS1 A;  4EBP A;  4EBL A;  3LY3 A;  1TDG A;  3WS5 A;  3UO9 A;  5EOE A;  3G32 A;  1BUL A;  3HUO A;  3G31 A;  4PM7 A;  2XD5 A;  2BG1 A;  1L0E A;  3PBN A;  1W7F A;  2JCH A;  1KVL A;  3ITA A;  5E2E A;  4KZA A;  1GHI A;  2WKE A;  1FCO A;  3Q81 A;  4P0M A;  3MZE A;  4OOM A;  1K54 C;  5FSR A;  5EVI C;  3AGD A;  3MXR A;  5CHU A;  3CG5 A;  1BZA A;  4BQM A;  1XA7 A;  1K6S A;  3G2Y A;  4LEN A;  3DWK A;  5AQ9 A;  3VP1 A;  5GLA A;  1FCN A;  3O86 A;  4BJP A;  3IF5 A;  2Z2L B;  2Z2M B;  5E2G A;  5CER A;  5EEC A;  3UE0 A;  3O88 A;  1BTL A;  2WGI A;  5G18 A;  4E3M A;  3PAG A;  3QNC A;  1IEM A;  1YM1 A;  4WMC A;  1OME A;  2GDN A;  1L0G A;  4WMC D;  4MLL A;  1KE3 A;  1S0W A;  4KEN B;  1H8Y A;  3NCK A;  2XFS A;  1IYQ A;  4P6B A;  4X56 A;  3NC8 A;  4ZBE A;  3UDF A;  1BSG A;  2Y91 A;  3HLB A;  2Y2K A;  1DY6 A;  1DJC A;  3N8L A;  4IVK A;  4ZJ3 A;  3PBQ A;  3ITB A;  1BUE A;  3ZFZ A;  4E6X A;  3Q07 A;  2EX2 A;  4QJG A;  4QD4 A;  1MPL A;  3ZCZ A;  2DNS A;  3C7V A;  2XDM A;  1RGY A;  3WS0 A;  4S2M A;  4E3O A;  3IWQ A;  3BYD A;  3QHY A;  4UA6 A;  5FQQ A;  4EV4 A;  2EX8 A;  1E3U A;  5F82 A;  5GHZ A;  3HUN A;  3LEZ A;  3SOI A;  2HDU A;  2V1Z A;  1FSY A;  3ZNT A;  3FKW A;  4KZ7 A;  1CK3 A;  1SCW A;  2H0Y A;  1W8Y A;  5AQA A;  2Y2I A;  2X02 A;  4R1G A;  5EOO A;  1H5X A;  1LL9 A;  2RCX A;  3UN7 A;  1NZU A;  2OLV A;  2WKI A;  4WEJ A;  4KG5 A;  4Y0T A;  1EI5 A;  4JPM A;  1K56 D;  1O7E A;  2ZQ8 A;  4M3K A;  4P85 A;  4WZ5 A;  5DF9 A;  1RCJ A;  4KZ6 A;  2RL3 A;  4JF4 A;  4EQI A;  3VFH A;  1NJ4 A;  3HVF A;  3IXG A;  2DCF A;  3OCN A;  3IF6 C;  2R9X A;  2P9V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...