4R4SA

Crystal structure of chimeric beta-lactamase ctem-19m at 1.1 angstrom resolution
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPLTSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTDFLRQIGDKETRLDRIEPDLNEGKLGDLRDTTTPKAIASTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase TEM,Beta-lactamase PSE-4
publication title Crystal structures of chimeric beta-lactamase cTEM-19m
rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 96
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2014-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4r4sA00
4C75A 1HVBA 4MBHA 3E2LA 1K54C 5TFQA 3OPRA 3A3JA 1LL9A 3ZVTA 4RYEA 1H8YA 4OQIA 4LV2A 1L0DA 1KGFA 3GQZA 3GRJA 5CXWA 3WS1A 1ES5A 4U3TA 4DE0A 2WK0A 1KDSA 4RVAA 1G6AA 4JPMA 5GLDA 5CEDA 4KZ3A 4IVIA 5HAPA 4XXRA 1ES3A 4OOMA 2QPNA 1BLPA 4GDBA 4KZBA 5M1AA 5FA7A 2WKIA 2Z2LB 2V20A 4UA9A 4Y0UA 5FQQA 1FSWA 1EI5A 3MXSA 5A91A 4E3MA 2XF3A 5GLAA 1ESIA 3ZCZA 3S22A 2ZC3B 3IHBA 3OCLA 4KZ8A 1IKIA 3FKVA 3N4IA 1K6RA 2QMIA 4GN2A 5EECA 3UE3A 3NY4A 1YLPA 4OQHA 4KZ7A 1MWUA 2A3UA 2Y2HA 1BSGA 3HVFA 4IBXA 3VSKA 3C4OA 1YM1A 2Q9MA 3SH7A 4A5RA 2HDSA 2Q9NA 5HARA 3V3RA 2P9VA 3A3IA 3S1YA 3ITAA 1I5QA 2WADA 3FKWA 4QY6A 1J9MA 4UHUA 5E2GA 1Q2QA 2XEPA 4KQOA 2EFUA 4KZAA 3CZDA 3QHYA 5GHXA 1KVLA 4E3JA 1CI8A 2WZZA 2C6WB 2PU2A 1RGZA 4KZ9A 3FZCA 1FOFA 4K91A 1K4FA 3IF6C 2XLNA 3B3XA 3MKEA 1KGEA 1FCNA 1EROA 3NI9A 4WYYA 1K25A 1FCOA 3OZHA 4GB7A 5CTNA 5A92A 2FFYA 5FAOA 3HREA 3Q81A 5AQBA 1KVMA 4Z9QA 3V3SA 1NZOA 3DWZA 1GHPA 4EQIA 5TR7A 4KQQA 2DRWA 1WYBA 4IEDA 1K57A 5E43A 3CJMA 4GZBA 4O7DA 3Q7ZA 1JWVA 2XFSA 5DTTA 3UE1A 3IWQA 3IXBA 5DVAA 3DW0A 5AQ9A 2X02A 4S2OA 4JF4A 4S2NC 5EVIA 4S2IA 3TOIA 3ZGAB 3G2YA 3IF6B 4KZ5A 4KG2A 4K0WA 4S2MA 4BQMA 3LCEA 2Y59A 4DXCA 4OOLA 4K0XA 3ZNYA 4X69A 4IVKA 5BOHA 1XPBA 5CECA 4XUZA 5EOOA 1E3UA 3UPPA 3ZNTA 3ZG0A 2ZD8A 1W8YA 1VQQA 3UDXA 3AGDA 1C3BA 3C7VA 2ZQAA 1SKFA 4QU3A 2JCHA 4L0LA 2DCFA 4F94A 2ZQ9A 3W4QA 5KSCA 1PI5A 4LV0A 4QD4A 5F1GA 4GNUA 1HD8A 2HDRA 1H8ZA 2ZC7A 4GD6A 3SH8A 1L0EA 1PZOA 4IBRA 4PM9A 5HW3A 1L0FA 5F1FA 4NETA 5FAPA 3BFCA 5CEBA 1MKIA 2HPBA 4P87A 4ZTKA 2ZM0A 5FATA 2WGWB 1ONHA 3IWOA 1XGJA 4N9LA 4B4ZA 4FH2A 3A3DA 1PZPA 3NDGA 5AQAA 2J9OA 3C4PA 3JYIA 4MBKA 5KMWA 3WS2A 4JF6A 3VP4A 5GHZA 2PBYA 5FQKA 2Y2GA 4CPKA 5FAQA 2X71A 1SDEA 1SDNA 4DXBA 2HDUA 1SHVA 1BUEA 4FCFA 1GA0A 1TDGA 4ZBEA 4Y0OA 4WZ5A 1BLCA 4EBLA 5GLCA 4DKIA 3MBZA 3HUMA 3MZFA 4ZJ2A 3TG9A 4BENA 3ZG7B 3VFFA 5JYOA 1ONGA 2HP6A 3D4FA 3VP2A 3VP1A 4FD8A 1L0GA 3MFDA 3DTMA 1PI4A 1ES2A 5FI6A 1O7EA 2R9WA 1AXBA 1YLTA 1BT5A 1KDWA 2G2WA 5CTMA 3PTEA 4P6BA 4D2OA 1Q2PA 3PAGA 4JF5A 4N92A 4R3BA 1CK3A 4RA7A 1W7FA 1ZG6A 2WAFA 2EX2A 2J7VA 4EBNA 2IWCA 4QHCA 5EPHA 2XFTA 3M2JA 3UO9A 4Y7PA 1BLSA 3WS0A 1PW1A 4WZ4A 3IT9A 4KG5A 4YFMA 4E3LA 1N4OA 3I7JA 2Y2NA 5GHYA 2I72A 3HUNA 1LI9A 1JWZA 4X68A 5FI2A 1XP4A 4WEJA 3BFDA 4XUXA 1S0WA 2OLVA 2Y2KA 5E2HA 2A49A 2H0TA 2VGKA 3Q82A 3N8SA 4JLFA 3UPNA 1IEMA 3BM6A 4N9KA 4B88A 4KENB 1JWPA 4RX3A 3RXXA 1LLBA 2WZXA 1RGYA 3OCNA 4OVDA 1EWZA 2CC1A 2RCXA 4FH4A 3FV7A 2XGNA 3N8LA 1YLWA 3IXGA 3ZFZA 3BFGA 3DWKA 4X53A 5DF7A 3WS5A 4U0TA 2JC7A 5F83A 1K54A 5G18A 3WRZA 3VSLA 1QMFA 3GVBA 3IF5A 4HBTA 4LCLA 3C5AA 4R1GA 3LY4A 3NCKA 3IHAA 3GV9A 3HLGA 3Q07A 2B5RA 3OPHA 2WGIA 2GDNA 2H5SA 3G35A 5CERA 5TGFA 1DJAA 1NJ4A 4OKPA 1O07A 5L2FA 1E3UD 2EXBA 1TDLA 3O88A 3PAEA 4JXVA 4OONA 4BD1A 1MWSA 3LO7A 5EVLA 1LI0A 1YMXA 4HBUA 4UA6A 1W8QA 1ZC2A 5KSHA 1K6SA 4OP5A 3ITBA 2Y2QA 3P09A 4S2PA 3EQUA 4LV1A 5FSRA 3SH9A 1BULA 3AGEA 1K56A 3WS4A 5HFOA 4X55A 4BL2A 3VMAA 2Y2MA 4QY5A 5JYPA 2H10A 1DJBA 2HP5A 3LEZA 3N8RA 4JBFA 2C5WB 1YLZA 4PMAA 3HLCA 2IWBA 1K55C 1ZKJA 3ZG8B 4EBPA 5DF9A 3NIAA 4OP8A 3QNBA 1YQSA 3UY6A 1MWTA 3V50A 5CHUA 3SOIA 2XQZA 3IXHA 4RX2A 3G32A 3HLDA 3QNCA 3W8KA 1ALQA 2BG1A 4JXGA 2WUQA 3GR2A 1U60A 4JKTA 3IH8A 4S2KA 3ZHHA 3HLEA 4MLLA 4C6YA 3Q1FA 4WMCA 1PIOA 5DF8A 4HESA 1IYSA 4ID4A 3E2KA 2H0YA 1PWCA 3GMWA 4PPRA 1GCEA 1YMSA 2ZQ7A 4JXWA 5E2EA 5GLBA 2FFFB 4DF6A 5A93A 2ZC4B 2EFXA 2OV5A 5D3OA 1CEFA 1K4EA 1W79A 3PBRA 1KE3A 3SS5A 3Q7VA 1SCWA 4CJNA 4KQRA 4ZJ1A 4U0XA 4OPZA 5HAIA 5CHMA 4BLMA 4P0MA 4R0QA 1GA9A 1G68A 4M3KA 4DDYA 3PBSA 3UN7A 4OQ0A 4QJGA 1RP5A 4R4RA 2ZQDA 2WYXA 1OMEA 3FYZA 2P74A 3UE0A 1IYPA 2XD5A 1NZUA 3O87A 1XGIA 4ZJ3A 3O3VA 1PWGA 2WGWA 3BYDA 4EUZA 4ZAMA 2EXAA 3M6BA 3ZDJA 1KE4A 2V2FF 3PBNA 1XA7A 3C7UA 3OPLA 3SS3A 2BLSA 3V39A 3HLWA 1NYMA 4DDSA 5GL9A 2EX6A 5FQJA 5AQ7A 1W5DA 5EUAA 2ZC6B 4S2LA 3SS4A 1FSYA 1ERMA 1NYYA 3BLMA 1NRFA 3W4PA 4BJPA 1E4DA 4YINA 3IH9A 2ZMAA 4KG6A 4OH0A 2ZJ9A 3HLBA 4OPRA 2ZQCA 3AGFA 3IWIA 2JBFA 4X56A 1ERQA 2ZM2A 4KZ6A 2P9VB 2DNSA 3NBLA 2ZLYA 3HBRA 2E8IA 1K57C 2XD1A 1DJCA 2V1ZA 4MNRA 4OOYA 5IHVA 4R23A 3GTCA 2OSUA 3HLFA 4OPYA 1YT4A 4R4SA 2EX8A 5EVIC 5F82A 3IXDA 3UDIA 1NXYA 4PM5A 5EOEA 4E3OA 4OQGA 1BLHA 2Y2LA 3BRMA 4UAAA 3RJUA 1PWDA 1WE4A 2R9XA 5E2FA 1JTDA 4N1XA 3A3EA 5HX9A 4GOGA 2EX9A 3VOYA 3ZVWA 1KE0A 1MXOA 3BLSA 3CG5A 5KZHA 3P98A 2WAEA 2Y91A 4WBGA 2ZC5B 4E3IA 4EV4A 1I2WA 5EVID 3TSGA 3VFHA 5EVIB 2XK1A 2XDMA 5FI7A 3LY3A 4UA7A 1L2SA 2X01A 3V5MA 5HL1A 4E3NA 1IELA 5CGSA 1Z6FA 3PBQA 5FQIA 3WWXA 1IYQA 1Y54A 1MWRA 3S4XA 4DE2A 1XKZA 1K56D 4X6TA 3O86A 5FQMA 2XR0A 3MKFA 5U47A 1IYOA 4R3JA 4B4XA 4BD0A 2Z2MB 2ZQ8A 1HTZA 3G34A 1MY8A 4PM8A 5DTSA 2ZM8A 4MEZA 1FR1A 3BFEA 4E6XA 4Y0TA 4S2JA 4QB8A 5FQ9A 3PBOA 5CGWA 4BL3A 4DRTA 1MPLA 2JE5A 2XH9A 4LV3A 3ZG5A 3N6IA 5M19A 1YLYA 4OLDA 4WM9A 1TEMA 4LCMA 3N7WA 4WMCD 4JXSA 4GDNA 1VM1A 4WZ5C 3VP3A 5M18A 1CEGA 1S6RA 3HUOA 4GKUA 3UNWA 1ES4A 1N9BA 3G2ZA 3MZEA 3W4OA 2WKEA 1H5XA 2J8YA 1FCMA 1CI9A 3GSGA 3MXRA 4HEFA 4LENA 4OLGA 5CGXA 4DE1A 1KGGA 1ESUA 2HP9A 1LHYA 4DE3A 3M2KA 4PM7A 5I94A 1TVFA 3Q7VB 2IWDA 3RXWA 3IF6A 3OPPA 1MBLA 4PM6A 3VOZA 1M40A 4E3KA 3NDEA 4WEKA 4WELA 2WKHA 3G31A 4N1HA 3VP0A 4EWFA 2G2UA 1XA1A 5FDHA 2VGJA 4OPQA 1IKGA 2WGVA 5DTKA 1FQGA 2Y2PA 3WRTA 1E25A 4MBFA 4KZ4A 3UPOA 5EE8A 1BTLA 4C3QA 4S2NA 3G30A 3OC2A 1K38A 3FWLA 4ZDXA 1ZG4A 1I2SA 4GD8A 3PBTA 4NK3A 2J9PA 3A3FA 3BECA 3NC8A 2QZ6A 2OLUA 5CHJA 2UWXA 5HAQA 3EQVA 5CRFA 5FASA 1WYCA 3MZDA 5A90A 4P85A 1HZOA 1PW8A 1JVJA 1XXMA 3HL9A 1DY6A 1JTGA 1QMEA 2PU4A 3UDFA 4H8RA 1K55A 2Y2IA 2Y2JA 3IQAA 3ISGA 3ZG9B 5J8XA 2HDQA 2RL3A 3BFFA 1GHMA 1RCJA 1PYYA 1NY0A 1GHIA 2Y55A 4Q8IA 4E6WA 3M6HA 3BEBA 1XX2A 2Y2OA 3CMZA 4FSFA 1M6KA 3G4PA 2Y4AA 1LL5A 1YLJA 1BZAA 1FR6A
chains in the Genus database with same CATH superfamily
2W0NA 4MN6A 3E2LA 1UWNX 1K54C 3C2WA 4LV2A 3GQZA 5CXWA 1ES5A 2W1TA 5J4EA 3F1NA 4RVAA 1G6AA 1EW0A 4XXRA 2QPNA 1BLPA 5G4YA 2WKIA 1YKDA 2V0WA 5GLAA 3UB9A 3NY4A 4OQHA 3SH7A 2Q9NA 5HARA 2QYBA 3A3IA 2WADA 3FKWA 1T1BA 5HSQA 4KQOA 1KVLA 1SKOB 1CI8A 1Z09A 3FZCA 3IX8A 4BBTA 2UV0E 1K25A 2O9CA 3H82B 3V3SA 3DWZA 4KQDA 3PHYA 4IEDA 5E43A 2KOIA 1JWVA 3UE1A 4Q0HA 1G5UA 3LIFA 4HI4A 3IF6B 4K0WA 2Y59A 3QP6A 5AJGA 4DXCA 2P08A 4OOLA 1FILA 4YNRA 5BOHA 3MMHA 4XUZA 5EOOA 2PBDP 1E3UA 3ZNTA 2ZD8A 1VQQA 3AGDA 1C3BA 2HZ5A 5F69A 2JCHA 5EV0A 2NUTC 2DCFA 3W4QA 1PI5A 3TE8A 4P6ZM 3LIDA 4ME4A 4IUKA 1VETB 1L0EA 4IBRA 1L0FA 4NETA 5FAPA 1XJ6A 4P87A 4ZTKA 3ULFA 1XGJA 4B4ZA 5AQAA 4L9GA 3JYIA 4MBKA 4WN5A 4CPKA 4GHIB 4DXBA 2P04A 1SHVA 4ZBEA 3T4LA 4WZ5A 1BLCA 2OWHA 1LSXA 3ZG7B 2HF6A 3VP2A 1X0OA 1L0GA 5L09A 1P97A 3S7NA 4HP9A 4P6BA 1Q2PA 4R3BA 2WAFA 2IWCA 3VOLA 3IS2B 5IU1A 1PW1A 4WZ4A 4YFMA 3I7JA 2JKTI 1J3WA 1LI9A 4X68A 5FI2A 1H3QA 1XP4A 3DTEA 5FL3A 2ZL1B 2Y2KA 3MS6A 3UE6A 3Q82A 2E8JA 4JLFA 1IEMA 4KENB 1UGUA 4OVDA 4FH4A 2XGNA 3ZFZA 4LFUA 4JGQA 5G18A 3GVBA 2VV8A 4HBTA 4LCLA 1T19A 4BWIA 3GV9A 2B5RA 2QHKA 4O8GA 2GDNA 3G35A 5TGFA 2Y8HA 1O07A 4EERA 1MWSA 2W3FA 2PR5A 1OT6A 3EQUA 5FSRA 1SKOA 3SH9A 3AGEA 2J3TC 5HFOA 3LEZA 3N8RA 4JBFA 1YLZA 4EBPA 5DF9A 4LLOB 1OTEA 3H82A 3K3DA 2XQZA 3G32A 3GR2A 3IH8A 4S2KA 4MLLA 4WMCA 4ID4A 3E2KA 2GJ3A 3IBJA 5E2EA 4DF6A 5A93A 3FC7A 3PBRA 3SS5A 4KQRA 4UQIS 1UWPX 4U0XA 4YWZA 1SZVA 4LPZA 2VV7A 4E04A 5J3WA 3ZYTA 2AVXA 3PBSA 5AVEA 1RP5A 3KSGA 2VJWA 4H6JB 1VETA 4I3JA 3FYZA 2P74A 3UE0A 3O87A 4ZJ3A 3O3VA 4EUZA 4ZAMA 3M6BA 2V2FF 4HJ4A 5AQ7A 5EUAA 4LRZE 1FSYA 4GCZA 3BY9A 2HJ9C 2ZJ9A 2Z6DA 2PD7A 1ERQA 2ZM2A 2DNSA 4HHDA 3NBLA 2XD1A 2V1ZA 4MNRA 4OOYA 3CWFA 3HLFA 1YT4A 5EVIC 2K2NA 4PM5A 1NXYA 3L9KA 4OQGA 3RJUA 1TD5A 5E2FA 1WE4A 2JKFA 3F1OB 4LRXC 2M7VA 2A24B 2XRNA 1MXOA 4CLCA 2WAEA 3LY3A 3T1QB 5HL1A 2ZOIA 1Z6FA 1Y54A 4DE2A 4WL9A 1K56D 1H8MA 3O86A 5FQMA 3UB5P 2Z2MB 2ZL1A 3BJNA 3QP1A 2ZQ8A 3F1PB 4MEZA 4MCWA 5HWVA 4QB8A 3PBOA 1MPLA 2JE5A 4LV3A 3ZG5A 3N6IA 4WM9A 1TEMA 1LSVA 2B95A 4GDNA 1NRJA 1S6RA 3HUOA 1ES4A 3MZEA 3W4OA 2WKEA 3HCYA 3MXRA 5KIZA 1ESUA 4DE3A 4Y13A 5FEFA 2IWDA 4PM6A 2XA7S 4HNBA 3NDEA 3KSHA 4WELA 2WKHA 3G31A 4N1HA 3VE3A 2G2UA 3K2NA 5DFYA 2WGVA 3HJIA 1FQGA 2MJ6A 3WRTA 1E25A 4KZ4A 5CX7A 4F3LB 4ZDXA 1Y4OA 4GD8A 2J9PA 3NC8A 3LFVA 5CHJA 2UWXA 2ZOHA 3EOIA 1PW8A 1XXMA 3C30A 1DY6A 2PU4A 1K55A 4B9OA 5J8XA 5HWWA 2RL3A 3MSHA 4Q8IA 1GHIA 1CF0A 3KSFA 3BEBA 2Y2OA 5LBRA 4C75A 5HDSA 3OPRA 3A3JA 5EFWA 3P7NA 3GRJA 4IUHA 4U3TA 2PYRA 4H6JA 5GLDA 1OTAA 4KZ3A 5DJUA 3T4TA 3A0VA 5HAPA 1ES3A 4XT2B 4KZBA 5M1AA 3MFXA 4UA9A 5FQQA 2VEAA 2HV1A 4E3MA 2XF3A 3S22A 4KZ8A 1K6RA 2QMIA 4FTXA 4UQIM 4EU0A 1BSGA 3HVFA 4BBUA 2Q9MA 1JNUA 3V3RA 5A8BA 3S1YA 1I5QA 4QY6A 5E2GA 3T4KA 4KZAA 3CZDA 3QHYA 5GHXA 2WKRA 2C6WB 1P9WA 1RGZA 4KZ9A 3BWLA 2XLNA 1KGEA 3NI9A 3F1OA 5A92A 2A24A 2FFYA 5AQBA 1KOUA 2DRWA 1WYBA 1K57A 3L7HA 3GECA 3IXBA 5DVAA 5AQ9A 3TOIA 3ZGAB 4JF4A 4S2NC 4KZ5A 4I3AA 4BQMA 3LCEA 4K0XA 4IVKA 5J7EA 5CECA 1CQAA 3UPPA 3ZG0A 1W8YA 3UDXA 3C7VA 2ZQAA 3F1PA 1GSVA 1F98A 4L0LA 4F94A 5KSCA 2ZQ9A 4DJ2A 4GD6A 1PZOA 4PM9A 5HW3A 4I39A 5F1FA 5CEBA 2LB5A 3CPTB 2PYPA 2ZM0A 3B33A 1PFLA 1PZPA 2J9OA 2PD8A 1T18A 2PBYA 3NOPC 2X71A 3T1RA 1SDNA 2HDUA 4PAUA 4DKIA 1NWZA 2O9AA 4PKYA 4BENA 5K5BA 4HQAA 3MFDA 3DTMA 1PI4A 4F3LA 1ES2A 5FI6A 2OWJA 2R9WA 3E4PA 2G2WA 2VGLS 5F68A 4WUJA 3PTEA 4D2OA 3PAGA 4JF5A 4RA7A 2D02A 2XA7M 4G3VA 2EX2A 1P0ZA 2DMWA 1XFQA 3WS0A 4Y17A 4E3LA 2G7UA 2Y2NA 3MR0A 4NXBA 1V9ZA 2EWVA 2CMNA 3DBAA 4O01A 1S0WA 4X1LA 4EXOA 2A49A 2H0TA 3UPNA 3BM6A 4N9KA 1RGYA 1EWZA 2RCXA 4Y2FA 1DRMA 3OBFA 3U2AA 1K54A 3WRZA 3LR3A 3VSLA 3IF5A 3HJKA 4O0PA 4R38A 3IHAA 3Q07A 4MN7A 1VEUB 2Y79A 3PAEA 3LO7A 1YPRA 5EVLA 4HBUA 5KSHA 4S2PA 3ITBA 4LV1A 3LYXA 4BL2A 1D06A 1IFQA 3VMAA 4FUWA 5JYPA 3O5YA 2H10A 1DJBA 2FH5A 1W63M 2HP5A 4PMAA 4X1MA 4PKYG 3UY6A 1MWTA 3V50A 4GLQA 3IXHA 3W8KA 4MMNA 2BG1A 2WUQA 4JKTA 3ZHHA 3HLEA 2J3TD 4C6YA 5DF8A 5FEGA 2WKPA 4HESA 2H0YA 1PWCA 4PPRA 2FFFB 2EFXA 4MDZA 1CEFA 1W79A 3SW1A 3Q7VA 2VA0A 3LUQA 4CJNA 4Y15A 3LEQA 2M1CA 4ZRRA 4PHTA 4R0QA 3UB7A 1G68A 4M3KA 3UN7A 2EWWA 3D9YA 4QJGA 3G6OA 1IYPA 3EGXC 1IOUA 1ZHHB 3E0YA 1PWGA 1S1ZA 3BYDA 3D3OA 2EXAA 3ZDJA 3SS3A 3C7UA 4ETZA 1W5DA 4S2LA 1XJ3A 1NYYA 1NRFA 3W4PA 3IH9A 2ZMAA 4OPRA 2ZQCA 3UB6A 3AGFA 3E4QA 2P9VB 2HJEA 2ZLYA 2E8IA 2V8FA 3NOUC 3T4QA 5F82A 1BLHA 2Y2LA 3BRMA 1OT9A 4UAAA 1PWDA 2R9XA 4GOGA 2EX9A 4IHQA 3BLSA 3CG5A 5KZHA 3P98A 4EV4A 4R6LA 5EVID 5EM0A 5EVIB 2XK1A 2XDMA 3PXPA 3VE4A 4UA7A 2X01A 2VX8A 3PBQA 3KX0X 1OJ5A 2XR0A 3UB8A 2LB9A 3B42A 1OPXA 1HTZA 2ZMFA 1OTDA 4EUVA 3T4SA 3BFEA 4E6XA 4ARZB 4S2JA 1LT0A 3CITA 2VGLM 3R7WB 1F2KA 1WA9A 4JXSA 1VM1A 3CHWP 5M18A 4GKUA 1BYWA 4HEFA 3GSGA 4DE1A 4LENA 1VEUA 1TVFA 3IX3A 3IF6A 3OPPA 1M40A 4G3KA 1YAXA 2V0UA 5FDHA 2VGJA 2KX6A 5DTKA 3UPOA 3G30A 4JGRA 1K38A 4NK3A 3PBTA 3A3FA 1YSQA 3GDIA 5CRFA 1CJFA 1S4RA 1TF1A 3MF0A 1XFNA 3ZG9B 2Y2IA 3IQAA 1VHMA 1GHMA 1PYYA 1NY0A 2Y55A 4E6WA 3CMZA 1XX2A 4GHIA 4CLCC 2Y4AA 1FR6A 4M4XA 4MBHA 2ZMVA 3RH8B 4RYEA 1H8YA 4OQIA 3LR5A 1KGFA 3UMEA 2QKPA 2WK0A 1KDSA 2VLGA 3PYPA 2VK3A 4JPMA 4EESA 2OOLA 3FPVA 5FA7A 2L1MA 3RTYA 2V20A 1EI5A 4D60A 3ZCZA 3JVVA 4GS9B 2ZC3B 1NLZA 3UE3A 2JKGA 4KZ7A 3IS2A 2A3UA 4IBXA 3VSKA 2KDKA 3C4OA 4A5RA 2HDSA 4NG2A 3B47A 2P9VA 3ITAA 1J9MA 4UHUA 1Q2QA 2XEPA 2EFUA 1T1AA 4E3JA 2PU2A 2WZZA 3U4LP 1FOFA 1K4FA 5HDCA 3B3XA 3MKEA 3TRCA 1FCNA 1EROA 1MC0A 4WYYA 1FCOA 3LI9A 3OZHA 4I3IA 2YKFA 5FAOA 3HREA 3Q81A 2OAP1 4Z9QA 4I38A 1GHPA 4EQIA 5TR7A 4KQQA 3CJMA 4GZBA 3Q7ZA 5EVIA 2X02A 2PRFA 4S2IA 1GSWA 3G2YA 4S2MA 3S7QA 2K7SA 3ZNYA 4X69A 1XPBA 3T50A 4R3AA 1DP9A 2W27A 1SKFA 3H9WA 1YSPA 3T12B 3QP2A 4ARZA 4LV0A 4GNUA 3R7WA 1H8ZA 2HDRA 1OTBA 4L9EA 2ZBBA 3BFCA 2J80A 5FATA 3IWOA 4FH2A 1V9YA 3A3DA 3NDGA 5KMWA 3WS2A 4HH3A 4JF6A 5GHZA 3JPUA 3EWKA 5FAQA 1SDEA 2OAQ1 1BUEA 1TDGA 4Y0OA 4EBLA 5GLCA 3MBZA 3HUMA 2B18A 4LGWA 2W1TB 3F1NB 3VP1A 3D4FA 5HD5A 5EVEA 1O7EA 1YLTA 3JVUA 4KUKA 1BT5A 1A0KA 1KDWA 5HD3A 3EEHA 1TS0A 1FIKA 3EEAA 4N92A 1CK3A 4EBNA 5F5YA 5EPHA 2XFTA 2V1BA 3M2JA 3UO9A 4Y7PA 1K0KA 3BQ8A 4Y5FA 4WEJA 4XUXA 2OLVA 1JWPA 4RX3A 1F9IA 1LLBA 2VKSA 3N8LA 3IXGA 3CLOA 3BFGA 3DWKA 3WS5A 4U0TA 3TJZC 2JC7A 5HPFA 1D7EA 1DP8A 4R1GA 4GS9A 3IBRA 3OPHA 4JGPA 4EETB 3LIEA 2H5SA 5CERA 3KSIA 3DTIA 5L2FA 1E3UD 4JXVA 1TDLA 3T4JA 1STZA 1N9OA 1TS8A 5L07A 1LI0A 1YMXA 4KUOA 4OP5A 2Y2QA 1BULA 1K56A 4X55A 2IA2A 2Y2MA 3UMDA 4QY5A 2IWBA 2C5WB 3HLCA 5TBMB 3NIAA 4OP8A 3QNBA 1YQSA 5CHUA 4RX2A 3QNCA 4L9FA 4JXGA 1U60A 2O99A 1GCEA 2GX5A 1YMSA 2OV5A 1K4EA 5HDDA 2FZ0A 1KE3A 5FDSA 5EM1A 2KLIA 3CUEA 1XJ4A 4ZJ1A 3MQQA 5HAIA 5CHMA 4BMWA 4P0MA 1GA9A 4OQ0A 3E4OA 5HZHA 2Z6CA 5I5LA 2WYXA 1S67L 4GJ4A 1G6OA 2VV6A 1KE4A 3PBNA 4NEED 1XA7A 3OPLA 2BLSA 3A0SA 3V39A 3HLWA 1NYMA 1ERMA 4JGOA 4YINA 3HLBA 3LICA 2JBFA 4X56A 3HBRA 1DJCA 4IJGA 2OSUA 4OPYA 4R4SA 3UDIA 2L4RA 3IXDA 4E3OA 3KYZA 1JTDA 4N1XA 3A3EA 5L8MA 1KE0A 4XT2A 2Y91A 4WBGA 2ZC5B 4HJ3A 4E3IA 1I2WA 3TSGA 3K3CA 4HH2A 1MKMA 2JKTM 5FQIA 3S4XA 3MKFA 5AVFA 3NJAA 5DTSA 2ZM8A 1FR1A 2XH9A 3NOTC 3QP8A 5M19A 4OLDA 3N7WA 4WMCD 3OLOA 1HLUP 4WZ5C 3VP3A 1CEGA 1N9BA 1VB6A 3D72A 5CGXA 1CI9A 1KGGA 1LHYA 4NKPA 3CAXA 1PRQA 3QP4A 2QWSA 4EWFA 4WF0A 1XA1A 2JKRM 4I5SA 1IKGA 2Y2PA 4MBFA 5TBMA 3OC2A 4Q0JA 5HPIA 1I2SA 4Q0IA 3T4OA 2QZ6A 1N9LA 2W3DA 2K31A 5HAQA 4HIAA 1WYCA 3MZDA 3CPTA 4P85A 1HZOA 1JVJA 4WLAA 4H8RA 2Y2JA 3DAVA 1M6KA 3G4PA 2PHYA 1YLJA 1BZAA 1HVBA 1L3LA 5TFQA 2W3GA 3QP5A 1LL9A 5DKKA 3ZVTA 1ZTUA 1L0DA 3WS1A 4DE0A 5CEDA 4IVIA 4BBVA 3LIAA 4OOMA 4CLCD 4CLCB 3MJQA 4GDBA 1S4SA 2Z2LB 2GZAA 4X25A 2EA9A 4Y0UA 1FSWA 3MXSA 5A91A 1ESIA 3IHBA 3OCLA 1IKIA 3FKVA 3N4IA 3SZTA 4GN2A 5EECA 1YLPA 2BASA 2WKQA 1MWUA 3S7PA 2Y2HA 1YM1A 5DFXA 4DMZA 3C38A 1ODVA 3A0RA 2I9VA 4K91A 3IF6C 5HL6A 1DP6A 4YOFA 4GB7A 5CTNA 1KVMA 1NZOA 1LSWA 4O7DA 2XFSA 2XSSA 5DTTA 3IWQA 3DW0A 4S2OA 1XJ2A 1TS7A 4KG2A 2JKRI 3H7WB 1TS6A 4QU3A 1P9RA 4QD4A 5F1GA 1HD8A 2ZC7A 3IX4A 3SH8A 2W3EA 1MKIA 2HPBA 2WGWB 1ONHA 1MZUA 4N9LA 3MXQA 3C4PA 3LR0A 4II7A 3VP4A 5FQKA 2Y2GA 2ACGA 4FCFA 1GA0A 3MZFA 4ZJ2A 3P01A 3TG9A 3BW6A 4DN0A 3VFFA 5JYOA 3KYQA 1ONGA 4AFIA 2HP6A 4FD8A 3LGOA 2W1RA 1S1YA 1AXBA 2V9AA 3ZQ5A 1NLYA 2O9BA 5CTMA 1AWIA 3LIBA 2QJ7A 2J3WA 1W7FA 1ZG6A 3BY8A 1D1JA 4CQHA 2J7VA 1W63Q 3LI8A 2XROA 3VV4A 4QHCA 1BLSA 3IT9A 4KG5A 4HP4A 1N4OA 5GHYA 1OJGA 2I72A 2R78A 3HUNA 2PAVP 1JWZA 4Z1WA 3BFDA 5E2HA 2VGKA 2M7UA 3N8SA 1LL8A 4B88A 3W2ZA 2P7JA 3RXXA 2WZXA 3OCNA 2CC1A 4UEYA 3FV7A 1YLWA 4ETXA 4X53A 5DF7A 1OTIA 5F83A 1QMFA 2BTFP 3T1SA 3NULA 3C5AA 3LY4A 3NCKA 3HLGA 2WGIA 4NXGA 1DJAA 1NJ4A 4OKPA 2Q0OA 2EXBA 3O88A 4OONA 4BD1A 4UA6A 3T1XA 1W8QA 1ZC2A 1K6SA 4LRYC 3P09A 4R70A 2H28A 3WS4A 4HY8A 1G28A 4EW7A 1K55C 1ZKJA 3ZG8B 3KYEA 3MQ0A 4NXEA 3SOIA 3HLDA 2L0WA 1ALQA 5MC7A 2JN7A 2NUPC 1H0MA 3Q1FA 1PIOA 5IT5A 1IYSA 5TJJA 3GMWA 2ZQ7A 4JXWA 5GLBA 3TW8A 2ZC4B 4NXFA 5D3OA 3BQAA 4RQ9A 4EEPA 1SCWA 3LR4A 3H7WA 3FPWA 4OPZA 4BLMA 4DDYA 5DJTA 4R4RA 2ZQDA 1OMEA 1S66L 2XD5A 1NZUA 1XGIA 2WGWA 2D01A 4DDSA 3NHQA 5GL9A 2EX6A 5FQJA 2QJ5A 2ZC6B 3SS4A 3BLMA 4EQ1A 4BJPA 1E4DA 1Y28A 4KG6A 4OH0A 3IWIA 2GNXA 2W3HA 4KZ6A 3FG8A 3MQOA 1K57C 5IHVA 4R23A 3GTCA 2EX8A 5EOEA 5DKLA 2V8CA 3DTKA 4QWOA 5HX9A 4P6ZS 3VOYA 3ZVWA 1ACFA 2O0YA 3KO6A 3VFHA 5FI7A 2PT7A 3R4KA 4DJ3A 1L2SA 4HJ6A 3V5MA 3V67A 4E3NA 1IELA 5CGSA 3WWXA 4FOFA 1IYQA 1MWRA 5C5KA 1XKZA 4ESPA 4X6TA 2INWA 3EGDC 1IYOA 5U47A 4R3JA 4B4XA 4BD0A 4MN5A 3G34A 1MY8A 1GSXA 4PM8A 4Y0TA 5FQ9A 5CGWA 4BL3A 4DRTA 4G3WA 3CUEC 5HWTA 1YLYA 2YKHA 4HOIA 3PR6A 4LCMA 2B02A 5IS1A 3UNWA 3G2ZA 3ICYA 1H5XA 2PR6A 4B93A 2J8YA 1FCMA 2HGVA 4OLGA 3RFBA 2HP9A 3M2KA 4PM7A 5I94A 3Q7VB 1F5MA 3RXWA 1MBLA 2VZWA 3VOZA 3C8CA 4E3KA 4WEKA 4EEUA 4K08A 3VP0A 5G4ZA 4QPRA 3NECA 4OPQA 3OOVA 5EE8A 1BTLA 4C3QA 4S2NA 4GW9A 4Y3IA 3FWLA 1N9NA 1ZG4A 5L10A 3E98A 3BECA 1T1CA 2OLUA 3CI6A 4CLCE 3EQVA 5FASA 5A90A 2V1AA 2A2LA 2PDRA 3HL9A 1JTGA 1QMEA 3UDFA 5F6AA 3ISGA 2HDQA 3BFFA 1RCJA 3S7OA 3M6HA 4FSFA 2JHEA 1PNEA 1LL5A
chains in the Genus database with same CATH topology
4C75A 1HVBA 4MBHA 3E2LA 1K54C 5TFQA 3OPRA 3A3JA 1LL9A 3ZVTA 4RYEA 1H8YA 4OQIA 4LV2A 1L0DA 1KGFA 3GQZA 3GRJA 5CXWA 3WS1A 1ES5A 4U3TA 4DE0A 2WK0A 1KDSA 4RVAA 1G6AA 4JPMA 5GLDA 5CEDA 4KZ3A 4IVIA 5HAPA 4XXRA 1ES3A 4OOMA 2QPNA 1BLPA 4GDBA 4KZBA 5M1AA 5FA7A 2WKIA 2Z2LB 2V20A 4UA9A 4Y0UA 5FQQA 1FSWA 1EI5A 3MXSA 5A91A 4E3MA 2XF3A 5GLAA 1ESIA 3ZCZA 3S22A 2ZC3B 3IHBA 3OCLA 4KZ8A 1IKIA 3FKVA 3N4IA 1K6RA 2QMIA 4GN2A 5EECA 3UE3A 3NY4A 1YLPA 4OQHA 4KZ7A 1MWUA 2A3UA 2Y2HA 1BSGA 3HVFA 4IBXA 3VSKA 3C4OA 1YM1A 2Q9MA 3SH7A 4A5RA 2HDSA 2Q9NA 5HARA 3V3RA 2P9VA 3A3IA 3S1YA 3ITAA 1I5QA 2WADA 3FKWA 4QY6A 1J9MA 4UHUA 5E2GA 1Q2QA 2XEPA 4KQOA 2EFUA 4KZAA 3CZDA 3QHYA 5GHXA 1KVLA 4E3JA 1CI8A 2WZZA 2C6WB 2PU2A 1RGZA 4KZ9A 3FZCA 1FOFA 4K91A 1K4FA 3IF6C 2XLNA 3B3XA 3MKEA 1KGEA 1FCNA 1EROA 3NI9A 4WYYA 1K25A 1FCOA 3OZHA 4GB7A 5CTNA 5A92A 2FFYA 5FAOA 3HREA 3Q81A 5AQBA 1KVMA 4Z9QA 3V3SA 1NZOA 3DWZA 1GHPA 4EQIA 5TR7A 4KQQA 2DRWA 1WYBA 4IEDA 1K57A 5E43A 3CJMA 4GZBA 4O7DA 3Q7ZA 1JWVA 2XFSA 5DTTA 3UE1A 3IWQA 3IXBA 5DVAA 3DW0A 5AQ9A 2X02A 4S2OA 4JF4A 4S2NC 5EVIA 4S2IA 3TOIA 3ZGAB 3G2YA 3IF6B 4KZ5A 4KG2A 4K0WA 4S2MA 4BQMA 3LCEA 2Y59A 4DXCA 4OOLA 4K0XA 3ZNYA 4X69A 4IVKA 5BOHA 1XPBA 5CECA 4XUZA 5EOOA 1E3UA 3UPPA 3ZNTA 3ZG0A 2ZD8A 1W8YA 1VQQA 3UDXA 3AGDA 1C3BA 3C7VA 2ZQAA 1SKFA 4QU3A 2JCHA 4L0LA 2DCFA 4F94A 2ZQ9A 3W4QA 5KSCA 1PI5A 4LV0A 4QD4A 5F1GA 4GNUA 1HD8A 2HDRA 1H8ZA 2ZC7A 4GD6A 3SH8A 1L0EA 1PZOA 4IBRA 4PM9A 5HW3A 1L0FA 5F1FA 4NETA 5FAPA 3BFCA 5CEBA 1MKIA 2HPBA 4P87A 4ZTKA 2ZM0A 5FATA 2WGWB 1ONHA 3IWOA 1XGJA 4N9LA 4B4ZA 4FH2A 3A3DA 1PZPA 3NDGA 5AQAA 2J9OA 3C4PA 3JYIA 4MBKA 5KMWA 3WS2A 4JF6A 3VP4A 5GHZA 2PBYA 5FQKA 2Y2GA 4CPKA 5FAQA 2X71A 1SDEA 1SDNA 4DXBA 2HDUA 1SHVA 1BUEA 4FCFA 1GA0A 1TDGA 4ZBEA 4Y0OA 4WZ5A 1BLCA 4EBLA 5GLCA 4DKIA 3MBZA 3HUMA 3MZFA 4ZJ2A 3TG9A 4BENA 3ZG7B 3VFFA 5JYOA 1ONGA 2HP6A 3D4FA 3VP2A 3VP1A 4FD8A 1L0GA 3MFDA 3DTMA 1PI4A 1ES2A 5FI6A 1O7EA 2R9WA 1AXBA 1YLTA 1BT5A 1KDWA 2G2WA 5CTMA 3PTEA 4P6BA 4D2OA 1Q2PA 3PAGA 4JF5A 4N92A 4R3BA 1CK3A 4RA7A 1W7FA 1ZG6A 2WAFA 2EX2A 2J7VA 4EBNA 2IWCA 4QHCA 5EPHA 2XFTA 3M2JA 3UO9A 4Y7PA 1BLSA 3WS0A 1PW1A 4WZ4A 3IT9A 4KG5A 4YFMA 4E3LA 1N4OA 3I7JA 2Y2NA 5GHYA 2I72A 3HUNA 1LI9A 1JWZA 4X68A 5FI2A 1XP4A 4WEJA 3BFDA 4XUXA 1S0WA 2OLVA 2Y2KA 5E2HA 2A49A 2H0TA 2VGKA 3Q82A 3N8SA 4JLFA 3UPNA 1IEMA 3BM6A 4N9KA 4B88A 4KENB 1JWPA 4RX3A 3RXXA 1LLBA 2WZXA 1RGYA 3OCNA 4OVDA 1EWZA 2CC1A 2RCXA 4FH4A 3FV7A 2XGNA 3N8LA 1YLWA 3IXGA 3ZFZA 3BFGA 3DWKA 4X53A 5DF7A 3WS5A 4U0TA 2JC7A 5F83A 1K54A 5G18A 3WRZA 3VSLA 1QMFA 3GVBA 3IF5A 4HBTA 4LCLA 3C5AA 4R1GA 3LY4A 3NCKA 3IHAA 3GV9A 3HLGA 3Q07A 2B5RA 3OPHA 2WGIA 2GDNA 2H5SA 3G35A 5CERA 5TGFA 1DJAA 1NJ4A 4OKPA 1O07A 5L2FA 1E3UD 2EXBA 1TDLA 3O88A 3PAEA 4JXVA 4OONA 4BD1A 1MWSA 3LO7A 5EVLA 1LI0A 1YMXA 4HBUA 4UA6A 1W8QA 1ZC2A 5KSHA 1K6SA 4OP5A 3ITBA 2Y2QA 3P09A 4S2PA 3EQUA 4LV1A 5FSRA 3SH9A 1BULA 3AGEA 1K56A 3WS4A 5HFOA 4X55A 4BL2A 3VMAA 2Y2MA 4QY5A 5JYPA 2H10A 1DJBA 2HP5A 3LEZA 3N8RA 4JBFA 2C5WB 1YLZA 4PMAA 3HLCA 2IWBA 1K55C 1ZKJA 3ZG8B 4EBPA 5DF9A 3NIAA 4OP8A 3QNBA 1YQSA 3UY6A 1MWTA 3V50A 5CHUA 3SOIA 2XQZA 3IXHA 4RX2A 3G32A 3HLDA 3QNCA 3W8KA 1ALQA 2BG1A 4JXGA 2WUQA 3GR2A 1U60A 4JKTA 3IH8A 4S2KA 3ZHHA 3HLEA 4MLLA 4C6YA 3Q1FA 4WMCA 1PIOA 5DF8A 4HESA 1IYSA 4ID4A 3E2KA 2H0YA 1PWCA 3GMWA 4PPRA 1GCEA 1YMSA 2ZQ7A 4JXWA 5E2EA 5GLBA 2FFFB 4DF6A 5A93A 2ZC4B 2EFXA 2OV5A 5D3OA 1CEFA 1K4EA 1W79A 3PBRA 1KE3A 3SS5A 3Q7VA 1SCWA 4CJNA 4KQRA 4ZJ1A 4U0XA 4OPZA 5HAIA 5CHMA 4BLMA 4P0MA 4R0QA 1GA9A 1G68A 4M3KA 4DDYA 3PBSA 3UN7A 4OQ0A 4QJGA 1RP5A 4R4RA 2ZQDA 2WYXA 1OMEA 3FYZA 2P74A 3UE0A 1IYPA 2XD5A 1NZUA 3O87A 1XGIA 4ZJ3A 3O3VA 1PWGA 2WGWA 3BYDA 4EUZA 4ZAMA 2EXAA 3M6BA 3ZDJA 1KE4A 2V2FF 3PBNA 1XA7A 3C7UA 3OPLA 3SS3A 2BLSA 3V39A 3HLWA 1NYMA 4DDSA 5GL9A 2EX6A 5FQJA 5AQ7A 1W5DA 5EUAA 2ZC6B 4S2LA 3SS4A 1FSYA 1ERMA 1NYYA 3BLMA 1NRFA 3W4PA 4BJPA 1E4DA 4YINA 3IH9A 2ZMAA 4KG6A 4OH0A 2ZJ9A 3HLBA 4OPRA 2ZQCA 3AGFA 3IWIA 2JBFA 4X56A 1ERQA 2ZM2A 4KZ6A 2P9VB 2DNSA 3NBLA 2ZLYA 3HBRA 2E8IA 1K57C 2XD1A 1DJCA 2V1ZA 4MNRA 4OOYA 5IHVA 4R23A 3GTCA 2OSUA 3HLFA 4OPYA 1YT4A 4R4SA 2EX8A 5EVIC 5F82A 3IXDA 3UDIA 1NXYA 4PM5A 5EOEA 4E3OA 4OQGA 1BLHA 2Y2LA 3BRMA 4UAAA 3RJUA 1PWDA 1WE4A 2R9XA 5E2FA 1JTDA 4N1XA 3A3EA 5HX9A 4GOGA 2EX9A 3VOYA 3ZVWA 1KE0A 1MXOA 3BLSA 3CG5A 5KZHA 3P98A 2WAEA 2Y91A 4WBGA 2ZC5B 4E3IA 4EV4A 1I2WA 5EVID 3TSGA 3VFHA 5EVIB 2XK1A 2XDMA 5FI7A 3LY3A 4UA7A 1L2SA 2X01A 3V5MA 5HL1A 4E3NA 1IELA 5CGSA 1Z6FA 3PBQA 5FQIA 3WWXA 1IYQA 1Y54A 1MWRA 3S4XA 4DE2A 1XKZA 1K56D 4X6TA 3O86A 5FQMA 2XR0A 3MKFA 5U47A 1IYOA 4R3JA 4B4XA 4BD0A 2Z2MB 2ZQ8A 1HTZA 3G34A 1MY8A 4PM8A 5DTSA 2ZM8A 4MEZA 1FR1A 3BFEA 4E6XA 4Y0TA 4S2JA 4QB8A 5FQ9A 3PBOA 5CGWA 4BL3A 4DRTA 1MPLA 2JE5A 2XH9A 4LV3A 3ZG5A 3N6IA 5M19A 1YLYA 4OLDA 4WM9A 1TEMA 4LCMA 3N7WA 4WMCD 4JXSA 4GDNA 1VM1A 4WZ5C 3VP3A 5M18A 1CEGA 1S6RA 3HUOA 4GKUA 3UNWA 1ES4A 1N9BA 3G2ZA 3MZEA 3W4OA 2WKEA 1H5XA 2J8YA 1FCMA 1CI9A 3GSGA 3MXRA 4HEFA 4LENA 4OLGA 5CGXA 4DE1A 1KGGA 1ESUA 2HP9A 1LHYA 4DE3A 3M2KA 4PM7A 5I94A 1TVFA 3Q7VB 2IWDA 3RXWA 3IF6A 3OPPA 1MBLA 4PM6A 3VOZA 1M40A 4E3KA 3NDEA 4WEKA 4WELA 2WKHA 3G31A 4N1HA 3VP0A 4EWFA 2G2UA 1XA1A 5FDHA 2VGJA 4OPQA 1IKGA 2WGVA 5DTKA 1FQGA 2Y2PA 3WRTA 1E25A 4MBFA 4KZ4A 3UPOA 5EE8A 1BTLA 4C3QA 4S2NA 3G30A 3OC2A 1K38A 3FWLA 4ZDXA 1ZG4A 1I2SA 4GD8A 3PBTA 4NK3A 2J9PA 3A3FA 3BECA 3NC8A 2QZ6A 2OLUA 5CHJA 2UWXA 5HAQA 3EQVA 5CRFA 5FASA 1WYCA 3MZDA 5A90A 4P85A 1HZOA 1PW8A 1JVJA 1XXMA 3HL9A 1DY6A 1JTGA 1QMEA 2PU4A 3UDFA 4H8RA 1K55A 2Y2IA 2Y2JA 3IQAA 3ISGA 3ZG9B 5J8XA 2HDQA 2RL3A 3BFFA 1GHMA 1RCJA 1PYYA 1NY0A 1GHIA 2Y55A 4Q8IA 4E6WA 3M6HA 3BEBA 1XX2A 2Y2OA 3CMZA 4FSFA 1M6KA 3G4PA 2Y4AA 1LL5A 1YLJA 1BZAA 1FR6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C75 A;  1HVB A;  4MBH A;  3E2L A;  1K54 C;  5TFQ A;  3OPR A;  3A3J A;  1LL9 A;  3ZVT A;  4RYE A;  1H8Y A;  4OQI A;  4LV2 A;  1L0D A;  1KGF A;  3GQZ A;  3GRJ A;  5CXW A;  3WS1 A;  1ES5 A;  4U3T A;  4DE0 A;  2WK0 A;  1KDS A;  4RVA A;  1G6A A;  4JPM A;  5GLD A;  5CED A;  4KZ3 A;  4IVI A;  5HAP A;  4XXR A;  1ES3 A;  4OOM A;  2QPN A;  1BLP A;  4GDB A;  4KZB A;  5M1A A;  5FA7 A;  2WKI A;  2Z2L B;  2V20 A;  4UA9 A;  4Y0U A;  5FQQ A;  1FSW A;  1EI5 A;  3MXS A;  5A91 A;  4E3M A;  2XF3 A;  5GLA A;  1ESI A;  3ZCZ A;  3S22 A;  2ZC3 B;  3IHB A;  3OCL A;  4KZ8 A;  1IKI A;  3FKV A;  3N4I A;  1K6R A;  2QMI A;  4GN2 A;  5EEC A;  3UE3 A;  3NY4 A;  1YLP A;  4OQH A;  4KZ7 A;  1MWU A;  2A3U A;  2Y2H A;  1BSG A;  3HVF A;  4IBX A;  3VSK A;  3C4O A;  1YM1 A;  2Q9M A;  3SH7 A;  4A5R A;  2HDS A;  2Q9N A;  5HAR A;  3V3R A;  2P9V A;  3A3I A;  3S1Y A;  3ITA A;  1I5Q A;  2WAD A;  3FKW A;  4QY6 A;  1J9M A;  4UHU A;  5E2G A;  1Q2Q A;  2XEP A;  4KQO A;  2EFU A;  4KZA A;  3CZD A;  3QHY A;  5GHX A;  1KVL A;  4E3J A;  1CI8 A;  2WZZ A;  2C6W B;  2PU2 A;  1RGZ A;  4KZ9 A;  3FZC A;  1FOF A;  4K91 A;  1K4F A;  3IF6 C;  2XLN A;  3B3X A;  3MKE A;  1KGE A;  1FCN A;  1ERO A;  3NI9 A;  4WYY A;  1K25 A;  1FCO A;  3OZH A;  4GB7 A;  5CTN A;  5A92 A;  2FFY A;  5FAO A;  3HRE A;  3Q81 A;  5AQB A;  1KVM A;  4Z9Q A;  3V3S A;  1NZO A;  3DWZ A;  1GHP A;  4EQI A;  5TR7 A;  4KQQ A;  2DRW A;  1WYB A;  4IED A;  1K57 A;  5E43 A;  3CJM A;  4GZB A;  4O7D A;  3Q7Z A;  1JWV A;  2XFS A;  5DTT A;  3UE1 A;  3IWQ A;  3IXB A;  5DVA A;  3DW0 A;  5AQ9 A;  2X02 A;  4S2O A;  4JF4 A;  4S2N C;  5EVI A;  4S2I A;  3TOI A;  3ZGA B;  3G2Y A;  3IF6 B;  4KZ5 A;  4KG2 A;  4K0W A;  4S2M A;  4BQM A;  3LCE A;  2Y59 A;  4DXC A;  4OOL A;  4K0X A;  3ZNY A;  4X69 A;  4IVK A;  5BOH A;  1XPB A;  5CEC A;  4XUZ A;  5EOO A;  1E3U A;  3UPP A;  3ZNT A;  3ZG0 A;  2ZD8 A;  1W8Y A;  1VQQ A;  3UDX A;  3AGD A;  1C3B A;  3C7V A;  2ZQA A;  1SKF A;  4QU3 A;  2JCH A;  4L0L A;  2DCF A;  4F94 A;  2ZQ9 A;  3W4Q A;  5KSC A;  1PI5 A;  4LV0 A;  4QD4 A;  5F1G A;  4GNU A;  1HD8 A;  2HDR A;  1H8Z A;  2ZC7 A;  4GD6 A;  3SH8 A;  1L0E A;  1PZO A;  4IBR A;  4PM9 A;  5HW3 A;  1L0F A;  5F1F A;  4NET A;  5FAP A;  3BFC A;  5CEB A;  1MKI A;  2HPB A;  4P87 A;  4ZTK A;  2ZM0 A;  5FAT A;  2WGW B;  1ONH A;  3IWO A;  1XGJ A;  4N9L A;  4B4Z A;  4FH2 A;  3A3D A;  1PZP A;  3NDG A;  5AQA A;  2J9O A;  3C4P A;  3JYI A;  4MBK A;  5KMW A;  3WS2 A;  4JF6 A;  3VP4 A;  5GHZ A;  2PBY A;  5FQK A;  2Y2G A;  4CPK A;  5FAQ A;  2X71 A;  1SDE A;  1SDN A;  4DXB A;  2HDU A;  1SHV A;  1BUE A;  4FCF A;  1GA0 A;  1TDG A;  4ZBE A;  4Y0O A;  4WZ5 A;  1BLC A;  4EBL A;  5GLC A;  4DKI A;  3MBZ A;  3HUM A;  3MZF A;  4ZJ2 A;  3TG9 A;  4BEN A;  3ZG7 B;  3VFF A;  5JYO A;  1ONG A;  2HP6 A;  3D4F A;  3VP2 A;  3VP1 A;  4FD8 A;  1L0G A;  3MFD A;  3DTM A;  1PI4 A;  1ES2 A;  5FI6 A;  1O7E A;  2R9W A;  1AXB A;  1YLT A;  1BT5 A;  1KDW A;  2G2W A;  5CTM A;  3PTE A;  4P6B A;  4D2O A;  1Q2P A;  3PAG A;  4JF5 A;  4N92 A;  4R3B A;  1CK3 A;  4RA7 A;  1W7F A;  1ZG6 A;  2WAF A;  2EX2 A;  2J7V A;  4EBN A;  2IWC A;  4QHC A;  5EPH A;  2XFT A;  3M2J A;  3UO9 A;  4Y7P A;  1BLS A;  3WS0 A;  1PW1 A;  4WZ4 A;  3IT9 A;  4KG5 A;  4YFM A;  4E3L A;  1N4O A;  3I7J A;  2Y2N A;  5GHY A;  2I72 A;  3HUN A;  1LI9 A;  1JWZ A;  4X68 A;  5FI2 A;  1XP4 A;  4WEJ A;  3BFD A;  4XUX A;  1S0W A;  2OLV A;  2Y2K A;  5E2H A;  2A49 A;  2H0T A;  2VGK A;  3Q82 A;  3N8S A;  4JLF A;  3UPN A;  1IEM A;  3BM6 A;  4N9K A;  4B88 A;  4KEN B;  1JWP A;  4RX3 A;  3RXX A;  1LLB A;  2WZX A;  1RGY A;  3OCN A;  4OVD A;  1EWZ A;  2CC1 A;  2RCX A;  4FH4 A;  3FV7 A;  2XGN A;  3N8L A;  1YLW A;  3IXG A;  3ZFZ A;  3BFG A;  3DWK A;  4X53 A;  5DF7 A;  3WS5 A;  4U0T A;  2JC7 A;  5F83 A;  1K54 A;  5G18 A;  3WRZ A;  3VSL A;  1QMF A;  3GVB A;  3IF5 A;  4HBT A;  4LCL A;  3C5A A;  4R1G A;  3LY4 A;  3NCK A;  3IHA A;  3GV9 A;  3HLG A;  3Q07 A;  2B5R A;  3OPH A;  2WGI A;  2GDN A;  2H5S A;  3G35 A;  5CER A;  5TGF A;  1DJA A;  1NJ4 A;  4OKP A;  1O07 A;  5L2F A;  1E3U D;  2EXB A;  1TDL A;  3O88 A;  3PAE A;  4JXV A;  4OON A;  4BD1 A;  1MWS A;  3LO7 A;  5EVL A;  1LI0 A;  1YMX A;  4HBU A;  4UA6 A;  1W8Q A;  1ZC2 A;  5KSH A;  1K6S A;  4OP5 A;  3ITB A;  2Y2Q A;  3P09 A;  4S2P A;  3EQU A;  4LV1 A;  5FSR A;  3SH9 A;  1BUL A;  3AGE A;  1K56 A;  3WS4 A;  5HFO A;  4X55 A;  4BL2 A;  3VMA A;  2Y2M A;  4QY5 A;  5JYP A;  2H10 A;  1DJB A;  2HP5 A;  3LEZ A;  3N8R A;  4JBF A;  2C5W B;  1YLZ A;  4PMA A;  3HLC A;  2IWB A;  1K55 C;  1ZKJ A;  3ZG8 B;  4EBP A;  5DF9 A;  3NIA A;  4OP8 A;  3QNB A;  1YQS A;  3UY6 A;  1MWT A;  3V50 A;  5CHU A;  3SOI A;  2XQZ A;  3IXH A;  4RX2 A;  3G32 A;  3HLD A;  3QNC A;  3W8K A;  1ALQ A;  2BG1 A;  4JXG A;  2WUQ A;  3GR2 A;  1U60 A;  4JKT A;  3IH8 A;  4S2K A;  3ZHH A;  3HLE A;  4MLL A;  4C6Y A;  3Q1F A;  4WMC A;  1PIO A;  5DF8 A;  4HES A;  1IYS A;  4ID4 A;  3E2K A;  2H0Y A;  1PWC A;  3GMW A;  4PPR A;  1GCE A;  1YMS A;  2ZQ7 A;  4JXW A;  5E2E A;  5GLB A;  2FFF B;  4DF6 A;  5A93 A;  2ZC4 B;  2EFX A;  2OV5 A;  5D3O A;  1CEF A;  1K4E A;  1W79 A;  3PBR A;  1KE3 A;  3SS5 A;  3Q7V A;  1SCW A;  4CJN A;  4KQR A;  4ZJ1 A;  4U0X A;  4OPZ A;  5HAI A;  5CHM A;  4BLM A;  4P0M A;  4R0Q A;  1GA9 A;  1G68 A;  4M3K A;  4DDY A;  3PBS A;  3UN7 A;  4OQ0 A;  4QJG A;  1RP5 A;  4R4R A;  2ZQD A;  2WYX A;  1OME A;  3FYZ A;  2P74 A;  3UE0 A;  1IYP A;  2XD5 A;  1NZU A;  3O87 A;  1XGI A;  4ZJ3 A;  3O3V A;  1PWG A;  2WGW A;  3BYD A;  4EUZ A;  4ZAM A;  2EXA A;  3M6B A;  3ZDJ A;  1KE4 A;  2V2F F;  3PBN A;  1XA7 A;  3C7U A;  3OPL A;  3SS3 A;  2BLS A;  3V39 A;  3HLW A;  1NYM A;  4DDS A;  5GL9 A;  2EX6 A;  5FQJ A;  5AQ7 A;  1W5D A;  5EUA A;  2ZC6 B;  4S2L A;  3SS4 A;  1FSY A;  1ERM A;  1NYY A;  3BLM A;  1NRF A;  3W4P A;  4BJP A;  1E4D A;  4YIN A;  3IH9 A;  2ZMA A;  4KG6 A;  4OH0 A;  2ZJ9 A;  3HLB A;  4OPR A;  2ZQC A;  3AGF A;  3IWI A;  2JBF A;  4X56 A;  1ERQ A;  2ZM2 A;  4KZ6 A;  2P9V B;  2DNS A;  3NBL A;  2ZLY A;  3HBR A;  2E8I A;  1K57 C;  2XD1 A;  1DJC A;  2V1Z A;  4MNR A;  4OOY A;  5IHV A;  4R23 A;  3GTC A;  2OSU A;  3HLF A;  4OPY A;  1YT4 A;  4R4S A;  2EX8 A;  5EVI C;  5F82 A;  3IXD A;  3UDI A;  1NXY A;  4PM5 A;  5EOE A;  4E3O A;  4OQG A;  1BLH A;  2Y2L A;  3BRM A;  4UAA A;  3RJU A;  1PWD A;  1WE4 A;  2R9X A;  5E2F A;  1JTD A;  4N1X A;  3A3E A;  5HX9 A;  4GOG A;  2EX9 A;  3VOY A;  3ZVW A;  1KE0 A;  1MXO A;  3BLS A;  3CG5 A;  5KZH A;  3P98 A;  2WAE A;  2Y91 A;  4WBG A;  2ZC5 B;  4E3I A;  4EV4 A;  1I2W A;  5EVI D;  3TSG A;  3VFH A;  5EVI B;  2XK1 A;  2XDM A;  5FI7 A;  3LY3 A;  4UA7 A;  1L2S A;  2X01 A;  3V5M A;  5HL1 A;  4E3N A;  1IEL A;  5CGS A;  1Z6F A;  3PBQ A;  5FQI A;  3WWX A;  1IYQ A;  1Y54 A;  1MWR A;  3S4X A;  4DE2 A;  1XKZ A;  1K56 D;  4X6T A;  3O86 A;  5FQM A;  2XR0 A;  3MKF A;  5U47 A;  1IYO A;  4R3J A;  4B4X A;  4BD0 A;  2Z2M B;  2ZQ8 A;  1HTZ A;  3G34 A;  1MY8 A;  4PM8 A;  5DTS A;  2ZM8 A;  4MEZ A;  1FR1 A;  3BFE A;  4E6X A;  4Y0T A;  4S2J A;  4QB8 A;  5FQ9 A;  3PBO A;  5CGW A;  4BL3 A;  4DRT A;  1MPL A;  2JE5 A;  2XH9 A;  4LV3 A;  3ZG5 A;  3N6I A;  5M19 A;  1YLY A;  4OLD A;  4WM9 A;  1TEM A;  4LCM A;  3N7W A;  4WMC D;  4JXS A;  4GDN A;  1VM1 A;  4WZ5 C;  3VP3 A;  5M18 A;  1CEG A;  1S6R A;  3HUO A;  4GKU A;  3UNW A;  1ES4 A;  1N9B A;  3G2Z A;  3MZE A;  3W4O A;  2WKE A;  1H5X A;  2J8Y A;  1FCM A;  1CI9 A;  3GSG A;  3MXR A;  4HEF A;  4LEN A;  4OLG A;  5CGX A;  4DE1 A;  1KGG A;  1ESU A;  2HP9 A;  1LHY A;  4DE3 A;  3M2K A;  4PM7 A;  5I94 A;  1TVF A;  3Q7V B;  2IWD A;  3RXW A;  3IF6 A;  3OPP A;  1MBL A;  4PM6 A;  3VOZ A;  1M40 A;  4E3K A;  3NDE A;  4WEK A;  4WEL A;  2WKH A;  3G31 A;  4N1H A;  3VP0 A;  4EWF A;  2G2U A;  1XA1 A;  5FDH A;  2VGJ A;  4OPQ A;  1IKG A;  2WGV A;  5DTK A;  1FQG A;  2Y2P A;  3WRT A;  1E25 A;  4MBF A;  4KZ4 A;  3UPO A;  5EE8 A;  1BTL A;  4C3Q A;  4S2N A;  3G30 A;  3OC2 A;  1K38 A;  3FWL A;  4ZDX A;  1ZG4 A;  1I2S A;  4GD8 A;  3PBT A;  4NK3 A;  2J9P A;  3A3F A;  3BEC A;  3NC8 A;  2QZ6 A;  2OLU A;  5CHJ A;  2UWX A;  5HAQ A;  3EQV A;  5CRF A;  5FAS A;  1WYC A;  3MZD A;  5A90 A;  4P85 A;  1HZO A;  1PW8 A;  1JVJ A;  1XXM A;  3HL9 A;  1DY6 A;  1JTG A;  1QME A;  2PU4 A;  3UDF A;  4H8R A;  1K55 A;  2Y2I A;  2Y2J A;  3IQA A;  3ISG A;  3ZG9 B;  5J8X A;  2HDQ A;  2RL3 A;  3BFF A;  1GHM A;  1RCJ A;  1PYY A;  1NY0 A;  1GHI A;  2Y55 A;  4Q8I A;  4E6W A;  3M6H A;  3BEB A;  1XX2 A;  2Y2O A;  3CMZ A;  4FSF A;  1M6K A;  3G4P A;  2Y4A A;  1LL5 A;  1YLJ A;  1BZA A;  1FR6 A; 
#chains in the Genus database with same CATH topology
 2W0N A;  4MN6 A;  3E2L A;  1UWN X;  1K54 C;  3C2W A;  4LV2 A;  3GQZ A;  5CXW A;  1ES5 A;  2W1T A;  5J4E A;  3F1N A;  4RVA A;  1G6A A;  1EW0 A;  4XXR A;  2QPN A;  1BLP A;  5G4Y A;  2WKI A;  1YKD A;  2V0W A;  5GLA A;  3UB9 A;  3NY4 A;  4OQH A;  3SH7 A;  2Q9N A;  5HAR A;  2QYB A;  3A3I A;  2WAD A;  3FKW A;  1T1B A;  5HSQ A;  4KQO A;  1KVL A;  1SKO B;  1CI8 A;  1Z09 A;  3FZC A;  3IX8 A;  4BBT A;  2UV0 E;  1K25 A;  2O9C A;  3H82 B;  3V3S A;  3DWZ A;  4KQD A;  3PHY A;  4IED A;  5E43 A;  2KOI A;  1JWV A;  3UE1 A;  4Q0H A;  1G5U A;  3LIF A;  4HI4 A;  3IF6 B;  4K0W A;  2Y59 A;  3QP6 A;  5AJG A;  4DXC A;  2P08 A;  4OOL A;  1FIL A;  4YNR A;  5BOH A;  3MMH A;  4XUZ A;  5EOO A;  2PBD P;  1E3U A;  3ZNT A;  2ZD8 A;  1VQQ A;  3AGD A;  1C3B A;  2HZ5 A;  5F69 A;  2JCH A;  5EV0 A;  2NUT C;  2DCF A;  3W4Q A;  1PI5 A;  3TE8 A;  4P6Z M;  3LID A;  4ME4 A;  4IUK A;  1VET B;  1L0E A;  4IBR A;  1L0F A;  4NET A;  5FAP A;  1XJ6 A;  4P87 A;  4ZTK A;  3ULF A;  1XGJ A;  4B4Z A;  5AQA A;  4L9G A;  3JYI A;  4MBK A;  4WN5 A;  4CPK A;  4GHI B;  4DXB A;  2P04 A;  1SHV A;  4ZBE A;  3T4L A;  4WZ5 A;  1BLC A;  2OWH A;  1LSX A;  3ZG7 B;  2HF6 A;  3VP2 A;  1X0O A;  1L0G A;  5L09 A;  1P97 A;  3S7N A;  4HP9 A;  4P6B A;  1Q2P A;  4R3B A;  2WAF A;  2IWC A;  3VOL A;  3IS2 B;  5IU1 A;  1PW1 A;  4WZ4 A;  4YFM A;  3I7J A;  2JKT I;  1J3W A;  1LI9 A;  4X68 A;  5FI2 A;  1H3Q A;  1XP4 A;  3DTE A;  5FL3 A;  2ZL1 B;  2Y2K A;  3MS6 A;  3UE6 A;  3Q82 A;  2E8J A;  4JLF A;  1IEM A;  4KEN B;  1UGU A;  4OVD A;  4FH4 A;  2XGN A;  3ZFZ A;  4LFU A;  4JGQ A;  5G18 A;  3GVB A;  2VV8 A;  4HBT A;  4LCL A;  1T19 A;  4BWI A;  3GV9 A;  2B5R A;  2QHK A;  4O8G A;  2GDN A;  3G35 A;  5TGF A;  2Y8H A;  1O07 A;  4EER A;  1MWS A;  2W3F A;  2PR5 A;  1OT6 A;  3EQU A;  5FSR A;  1SKO A;  3SH9 A;  3AGE A;  2J3T C;  5HFO A;  3LEZ A;  3N8R A;  4JBF A;  1YLZ A;  4EBP A;  5DF9 A;  4LLO B;  1OTE A;  3H82 A;  3K3D A;  2XQZ A;  3G32 A;  3GR2 A;  3IH8 A;  4S2K A;  4MLL A;  4WMC A;  4ID4 A;  3E2K A;  2GJ3 A;  3IBJ A;  5E2E A;  4DF6 A;  5A93 A;  3FC7 A;  3PBR A;  3SS5 A;  4KQR A;  4UQI S;  1UWP X;  4U0X A;  4YWZ A;  1SZV A;  4LPZ A;  2VV7 A;  4E04 A;  5J3W A;  3ZYT A;  2AVX A;  3PBS A;  5AVE A;  1RP5 A;  3KSG A;  2VJW A;  4H6J B;  1VET A;  4I3J A;  3FYZ A;  2P74 A;  3UE0 A;  3O87 A;  4ZJ3 A;  3O3V A;  4EUZ A;  4ZAM A;  3M6B A;  2V2F F;  4HJ4 A;  5AQ7 A;  5EUA A;  4LRZ E;  1FSY A;  4GCZ A;  3BY9 A;  2HJ9 C;  2ZJ9 A;  2Z6D A;  2PD7 A;  1ERQ A;  2ZM2 A;  2DNS A;  4HHD A;  3NBL A;  2XD1 A;  2V1Z A;  4MNR A;  4OOY A;  3CWF A;  3HLF A;  1YT4 A;  5EVI C;  2K2N A;  4PM5 A;  1NXY A;  3L9K A;  4OQG A;  3RJU A;  1TD5 A;  5E2F A;  1WE4 A;  2JKF A;  3F1O B;  4LRX C;  2M7V A;  2A24 B;  2XRN A;  1MXO A;  4CLC A;  2WAE A;  3LY3 A;  3T1Q B;  5HL1 A;  2ZOI A;  1Z6F A;  1Y54 A;  4DE2 A;  4WL9 A;  1K56 D;  1H8M A;  3O86 A;  5FQM A;  3UB5 P;  2Z2M B;  2ZL1 A;  3BJN A;  3QP1 A;  2ZQ8 A;  3F1P B;  4MEZ A;  4MCW A;  5HWV A;  4QB8 A;  3PBO A;  1MPL A;  2JE5 A;  4LV3 A;  3ZG5 A;  3N6I A;  4WM9 A;  1TEM A;  1LSV A;  2B95 A;  4GDN A;  1NRJ A;  1S6R A;  3HUO A;  1ES4 A;  3MZE A;  3W4O A;  2WKE A;  3HCY A;  3MXR A;  5KIZ A;  1ESU A;  4DE3 A;  4Y13 A;  5FEF A;  2IWD A;  4PM6 A;  2XA7 S;  4HNB A;  3NDE A;  3KSH A;  4WEL A;  2WKH A;  3G31 A;  4N1H A;  3VE3 A;  2G2U A;  3K2N A;  5DFY A;  2WGV A;  3HJI A;  1FQG A;  2MJ6 A;  3WRT A;  1E25 A;  4KZ4 A;  5CX7 A;  4F3L B;  4ZDX A;  1Y4O A;  4GD8 A;  2J9P A;  3NC8 A;  3LFV A;  5CHJ A;  2UWX A;  2ZOH A;  3EOI A;  1PW8 A;  1XXM A;  3C30 A;  1DY6 A;  2PU4 A;  1K55 A;  4B9O A;  5J8X A;  5HWW A;  2RL3 A;  3MSH A;  4Q8I A;  1GHI A;  1CF0 A;  3KSF A;  3BEB A;  2Y2O A;  5LBR A;  4C75 A;  5HDS A;  3OPR A;  3A3J A;  5EFW A;  3P7N A;  3GRJ A;  4IUH A;  4U3T A;  2PYR A;  4H6J A;  5GLD A;  1OTA A;  4KZ3 A;  5DJU A;  3T4T A;  3A0V A;  5HAP A;  1ES3 A;  4XT2 B;  4KZB A;  5M1A A;  3MFX A;  4UA9 A;  5FQQ A;  2VEA A;  2HV1 A;  4E3M A;  2XF3 A;  3S22 A;  4KZ8 A;  1K6R A;  2QMI A;  4FTX A;  4UQI M;  4EU0 A;  1BSG A;  3HVF A;  4BBU A;  2Q9M A;  1JNU A;  3V3R A;  5A8B A;  3S1Y A;  1I5Q A;  4QY6 A;  5E2G A;  3T4K A;  4KZA A;  3CZD A;  3QHY A;  5GHX A;  2WKR A;  2C6W B;  1P9W A;  1RGZ A;  4KZ9 A;  3BWL A;  2XLN A;  1KGE A;  3NI9 A;  3F1O A;  5A92 A;  2A24 A;  2FFY A;  5AQB A;  1KOU A;  2DRW A;  1WYB A;  1K57 A;  3L7H A;  3GEC A;  3IXB A;  5DVA A;  5AQ9 A;  3TOI A;  3ZGA B;  4JF4 A;  4S2N C;  4KZ5 A;  4I3A A;  4BQM A;  3LCE A;  4K0X A;  4IVK A;  5J7E A;  5CEC A;  1CQA A;  3UPP A;  3ZG0 A;  1W8Y A;  3UDX A;  3C7V A;  2ZQA A;  3F1P A;  1GSV A;  1F98 A;  4L0L A;  4F94 A;  5KSC A;  2ZQ9 A;  4DJ2 A;  4GD6 A;  1PZO A;  4PM9 A;  5HW3 A;  4I39 A;  5F1F A;  5CEB A;  2LB5 A;  3CPT B;  2PYP A;  2ZM0 A;  3B33 A;  1PFL A;  1PZP A;  2J9O A;  2PD8 A;  1T18 A;  2PBY A;  3NOP C;  2X71 A;  3T1R A;  1SDN A;  2HDU A;  4PAU A;  4DKI A;  1NWZ A;  2O9A A;  4PKY A;  4BEN A;  5K5B A;  4HQA A;  3MFD A;  3DTM A;  1PI4 A;  4F3L A;  1ES2 A;  5FI6 A;  2OWJ A;  2R9W A;  3E4P A;  2G2W A;  2VGL S;  5F68 A;  4WUJ A;  3PTE A;  4D2O A;  3PAG A;  4JF5 A;  4RA7 A;  2D02 A;  2XA7 M;  4G3V A;  2EX2 A;  1P0Z A;  2DMW A;  1XFQ A;  3WS0 A;  4Y17 A;  4E3L A;  2G7U A;  2Y2N A;  3MR0 A;  4NXB A;  1V9Z A;  2EWV A;  2CMN A;  3DBA A;  4O01 A;  1S0W A;  4X1L A;  4EXO A;  2A49 A;  2H0T A;  3UPN A;  3BM6 A;  4N9K A;  1RGY A;  1EWZ A;  2RCX A;  4Y2F A;  1DRM A;  3OBF A;  3U2A A;  1K54 A;  3WRZ A;  3LR3 A;  3VSL A;  3IF5 A;  3HJK A;  4O0P A;  4R38 A;  3IHA A;  3Q07 A;  4MN7 A;  1VEU B;  2Y79 A;  3PAE A;  3LO7 A;  1YPR A;  5EVL A;  4HBU A;  5KSH A;  4S2P A;  3ITB A;  4LV1 A;  3LYX A;  4BL2 A;  1D06 A;  1IFQ A;  3VMA A;  4FUW A;  5JYP A;  3O5Y A;  2H10 A;  1DJB A;  2FH5 A;  1W63 M;  2HP5 A;  4PMA A;  4X1M A;  4PKY G;  3UY6 A;  1MWT A;  3V50 A;  4GLQ A;  3IXH A;  3W8K A;  4MMN A;  2BG1 A;  2WUQ A;  4JKT A;  3ZHH A;  3HLE A;  2J3T D;  4C6Y A;  5DF8 A;  5FEG A;  2WKP A;  4HES A;  2H0Y A;  1PWC A;  4PPR A;  2FFF B;  2EFX A;  4MDZ A;  1CEF A;  1W79 A;  3SW1 A;  3Q7V A;  2VA0 A;  3LUQ A;  4CJN A;  4Y15 A;  3LEQ A;  2M1C A;  4ZRR A;  4PHT A;  4R0Q A;  3UB7 A;  1G68 A;  4M3K A;  3UN7 A;  2EWW A;  3D9Y A;  4QJG A;  3G6O A;  1IYP A;  3EGX C;  1IOU A;  1ZHH B;  3E0Y A;  1PWG A;  1S1Z A;  3BYD A;  3D3O A;  2EXA A;  3ZDJ A;  3SS3 A;  3C7U A;  4ETZ A;  1W5D A;  4S2L A;  1XJ3 A;  1NYY A;  1NRF A;  3W4P A;  3IH9 A;  2ZMA A;  4OPR A;  2ZQC A;  3UB6 A;  3AGF A;  3E4Q A;  2P9V B;  2HJE A;  2ZLY A;  2E8I A;  2V8F A;  3NOU C;  3T4Q A;  5F82 A;  1BLH A;  2Y2L A;  3BRM A;  1OT9 A;  4UAA A;  1PWD A;  2R9X A;  4GOG A;  2EX9 A;  4IHQ A;  3BLS A;  3CG5 A;  5KZH A;  3P98 A;  4EV4 A;  4R6L A;  5EVI D;  5EM0 A;  5EVI B;  2XK1 A;  2XDM A;  3PXP A;  3VE4 A;  4UA7 A;  2X01 A;  2VX8 A;  3PBQ A;  3KX0 X;  1OJ5 A;  2XR0 A;  3UB8 A;  2LB9 A;  3B42 A;  1OPX A;  1HTZ A;  2ZMF A;  1OTD A;  4EUV A;  3T4S A;  3BFE A;  4E6X A;  4ARZ B;  4S2J A;  1LT0 A;  3CIT A;  2VGL M;  3R7W B;  1F2K A;  1WA9 A;  4JXS A;  1VM1 A;  3CHW P;  5M18 A;  4GKU A;  1BYW A;  4HEF A;  3GSG A;  4DE1 A;  4LEN A;  1VEU A;  1TVF A;  3IX3 A;  3IF6 A;  3OPP A;  1M40 A;  4G3K A;  1YAX A;  2V0U A;  5FDH A;  2VGJ A;  2KX6 A;  5DTK A;  3UPO A;  3G30 A;  4JGR A;  1K38 A;  4NK3 A;  3PBT A;  3A3F A;  1YSQ A;  3GDI A;  5CRF A;  1CJF A;  1S4R A;  1TF1 A;  3MF0 A;  1XFN A;  3ZG9 B;  2Y2I A;  3IQA A;  1VHM A;  1GHM A;  1PYY A;  1NY0 A;  2Y55 A;  4E6W A;  3CMZ A;  1XX2 A;  4GHI A;  4CLC C;  2Y4A A;  1FR6 A;  4M4X A;  4MBH A;  2ZMV A;  3RH8 B;  4RYE A;  1H8Y A;  4OQI A;  3LR5 A;  1KGF A;  3UME A;  2QKP A;  2WK0 A;  1KDS A;  2VLG A;  3PYP A;  2VK3 A;  4JPM A;  4EES A;  2OOL A;  3FPV A;  5FA7 A;  2L1M A;  3RTY A;  2V20 A;  1EI5 A;  4D60 A;  3ZCZ A;  3JVV A;  4GS9 B;  2ZC3 B;  1NLZ A;  3UE3 A;  2JKG A;  4KZ7 A;  3IS2 A;  2A3U A;  4IBX A;  3VSK A;  2KDK A;  3C4O A;  4A5R A;  2HDS A;  4NG2 A;  3B47 A;  2P9V A;  3ITA A;  1J9M A;  4UHU A;  1Q2Q A;  2XEP A;  2EFU A;  1T1A A;  4E3J A;  2PU2 A;  2WZZ A;  3U4L P;  1FOF A;  1K4F A;  5HDC A;  3B3X A;  3MKE A;  3TRC A;  1FCN A;  1ERO A;  1MC0 A;  4WYY A;  1FCO A;  3LI9 A;  3OZH A;  4I3I A;  2YKF A;  5FAO A;  3HRE A;  3Q81 A;  2OAP 1;  4Z9Q A;  4I38 A;  1GHP A;  4EQI A;  5TR7 A;  4KQQ A;  3CJM A;  4GZB A;  3Q7Z A;  5EVI A;  2X02 A;  2PRF A;  4S2I A;  1GSW A;  3G2Y A;  4S2M A;  3S7Q A;  2K7S A;  3ZNY A;  4X69 A;  1XPB A;  3T50 A;  4R3A A;  1DP9 A;  2W27 A;  1SKF A;  3H9W A;  1YSP A;  3T12 B;  3QP2 A;  4ARZ A;  4LV0 A;  4GNU A;  3R7W A;  1H8Z A;  2HDR A;  1OTB A;  4L9E A;  2ZBB A;  3BFC A;  2J80 A;  5FAT A;  3IWO A;  4FH2 A;  1V9Y A;  3A3D A;  3NDG A;  5KMW A;  3WS2 A;  4HH3 A;  4JF6 A;  5GHZ A;  3JPU A;  3EWK A;  5FAQ A;  1SDE A;  2OAQ 1;  1BUE A;  1TDG A;  4Y0O A;  4EBL A;  5GLC A;  3MBZ A;  3HUM A;  2B18 A;  4LGW A;  2W1T B;  3F1N B;  3VP1 A;  3D4F A;  5HD5 A;  5EVE A;  1O7E A;  1YLT A;  3JVU A;  4KUK A;  1BT5 A;  1A0K A;  1KDW A;  5HD3 A;  3EEH A;  1TS0 A;  1FIK A;  3EEA A;  4N92 A;  1CK3 A;  4EBN A;  5F5Y A;  5EPH A;  2XFT A;  2V1B A;  3M2J A;  3UO9 A;  4Y7P A;  1K0K A;  3BQ8 A;  4Y5F A;  4WEJ A;  4XUX A;  2OLV A;  1JWP A;  4RX3 A;  1F9I A;  1LLB A;  2VKS A;  3N8L A;  3IXG A;  3CLO A;  3BFG A;  3DWK A;  3WS5 A;  4U0T A;  3TJZ C;  2JC7 A;  5HPF A;  1D7E A;  1DP8 A;  4R1G A;  4GS9 A;  3IBR A;  3OPH A;  4JGP A;  4EET B;  3LIE A;  2H5S A;  5CER A;  3KSI A;  3DTI A;  5L2F A;  1E3U D;  4JXV A;  1TDL A;  3T4J A;  1STZ A;  1N9O A;  1TS8 A;  5L07 A;  1LI0 A;  1YMX A;  4KUO A;  4OP5 A;  2Y2Q A;  1BUL A;  1K56 A;  4X55 A;  2IA2 A;  2Y2M A;  3UMD A;  4QY5 A;  2IWB A;  2C5W B;  3HLC A;  5TBM B;  3NIA A;  4OP8 A;  3QNB A;  1YQS A;  5CHU A;  4RX2 A;  3QNC A;  4L9F A;  4JXG A;  1U60 A;  2O99 A;  1GCE A;  2GX5 A;  1YMS A;  2OV5 A;  1K4E A;  5HDD A;  2FZ0 A;  1KE3 A;  5FDS A;  5EM1 A;  2KLI A;  3CUE A;  1XJ4 A;  4ZJ1 A;  3MQQ A;  5HAI A;  5CHM A;  4BMW A;  4P0M A;  1GA9 A;  4OQ0 A;  3E4O A;  5HZH A;  2Z6C A;  5I5L A;  2WYX A;  1S67 L;  4GJ4 A;  1G6O A;  2VV6 A;  1KE4 A;  3PBN A;  4NEE D;  1XA7 A;  3OPL A;  2BLS A;  3A0S A;  3V39 A;  3HLW A;  1NYM A;  1ERM A;  4JGO A;  4YIN A;  3HLB A;  3LIC A;  2JBF A;  4X56 A;  3HBR A;  1DJC A;  4IJG A;  2OSU A;  4OPY A;  4R4S A;  3UDI A;  2L4R A;  3IXD A;  4E3O A;  3KYZ A;  1JTD A;  4N1X A;  3A3E A;  5L8M A;  1KE0 A;  4XT2 A;  2Y91 A;  4WBG A;  2ZC5 B;  4HJ3 A;  4E3I A;  1I2W A;  3TSG A;  3K3C A;  4HH2 A;  1MKM A;  2JKT M;  5FQI A;  3S4X A;  3MKF A;  5AVF A;  3NJA A;  5DTS A;  2ZM8 A;  1FR1 A;  2XH9 A;  3NOT C;  3QP8 A;  5M19 A;  4OLD A;  3N7W A;  4WMC D;  3OLO A;  1HLU P;  4WZ5 C;  3VP3 A;  1CEG A;  1N9B A;  1VB6 A;  3D72 A;  5CGX A;  1CI9 A;  1KGG A;  1LHY A;  4NKP A;  3CAX A;  1PRQ A;  3QP4 A;  2QWS A;  4EWF A;  4WF0 A;  1XA1 A;  2JKR M;  4I5S A;  1IKG A;  2Y2P A;  4MBF A;  5TBM A;  3OC2 A;  4Q0J A;  5HPI A;  1I2S A;  4Q0I A;  3T4O A;  2QZ6 A;  1N9L A;  2W3D A;  2K31 A;  5HAQ A;  4HIA A;  1WYC A;  3MZD A;  3CPT A;  4P85 A;  1HZO A;  1JVJ A;  4WLA A;  4H8R A;  2Y2J A;  3DAV A;  1M6K A;  3G4P A;  2PHY A;  1YLJ A;  1BZA A;  1HVB A;  1L3L A;  5TFQ A;  2W3G A;  3QP5 A;  1LL9 A;  5DKK A;  3ZVT A;  1ZTU A;  1L0D A;  3WS1 A;  4DE0 A;  5CED A;  4IVI A;  4BBV A;  3LIA A;  4OOM A;  4CLC D;  4CLC B;  3MJQ A;  4GDB A;  1S4S A;  2Z2L B;  2GZA A;  4X25 A;  2EA9 A;  4Y0U A;  1FSW A;  3MXS A;  5A91 A;  1ESI A;  3IHB A;  3OCL A;  1IKI A;  3FKV A;  3N4I A;  3SZT A;  4GN2 A;  5EEC A;  1YLP A;  2BAS A;  2WKQ A;  1MWU A;  3S7P A;  2Y2H A;  1YM1 A;  5DFX A;  4DMZ A;  3C38 A;  1ODV A;  3A0R A;  2I9V A;  4K91 A;  3IF6 C;  5HL6 A;  1DP6 A;  4YOF A;  4GB7 A;  5CTN A;  1KVM A;  1NZO A;  1LSW A;  4O7D A;  2XFS A;  2XSS A;  5DTT A;  3IWQ A;  3DW0 A;  4S2O A;  1XJ2 A;  1TS7 A;  4KG2 A;  2JKR I;  3H7W B;  1TS6 A;  4QU3 A;  1P9R A;  4QD4 A;  5F1G A;  1HD8 A;  2ZC7 A;  3IX4 A;  3SH8 A;  2W3E A;  1MKI A;  2HPB A;  2WGW B;  1ONH A;  1MZU A;  4N9L A;  3MXQ A;  3C4P A;  3LR0 A;  4II7 A;  3VP4 A;  5FQK A;  2Y2G A;  2ACG A;  4FCF A;  1GA0 A;  3MZF A;  4ZJ2 A;  3P01 A;  3TG9 A;  3BW6 A;  4DN0 A;  3VFF A;  5JYO A;  3KYQ A;  1ONG A;  4AFI A;  2HP6 A;  4FD8 A;  3LGO A;  2W1R A;  1S1Y A;  1AXB A;  2V9A A;  3ZQ5 A;  1NLY A;  2O9B A;  5CTM A;  1AWI A;  3LIB A;  2QJ7 A;  2J3W A;  1W7F A;  1ZG6 A;  3BY8 A;  1D1J A;  4CQH A;  2J7V A;  1W63 Q;  3LI8 A;  2XRO A;  3VV4 A;  4QHC A;  1BLS A;  3IT9 A;  4KG5 A;  4HP4 A;  1N4O A;  5GHY A;  1OJG A;  2I72 A;  2R78 A;  3HUN A;  2PAV P;  1JWZ A;  4Z1W A;  3BFD A;  5E2H A;  2VGK A;  2M7U A;  3N8S A;  1LL8 A;  4B88 A;  3W2Z A;  2P7J A;  3RXX A;  2WZX A;  3OCN A;  2CC1 A;  4UEY A;  3FV7 A;  1YLW A;  4ETX A;  4X53 A;  5DF7 A;  1OTI A;  5F83 A;  1QMF A;  2BTF P;  3T1S A;  3NUL A;  3C5A A;  3LY4 A;  3NCK A;  3HLG A;  2WGI A;  4NXG A;  1DJA A;  1NJ4 A;  4OKP A;  2Q0O A;  2EXB A;  3O88 A;  4OON A;  4BD1 A;  4UA6 A;  3T1X A;  1W8Q A;  1ZC2 A;  1K6S A;  4LRY C;  3P09 A;  4R70 A;  2H28 A;  3WS4 A;  4HY8 A;  1G28 A;  4EW7 A;  1K55 C;  1ZKJ A;  3ZG8 B;  3KYE A;  3MQ0 A;  4NXE A;  3SOI A;  3HLD A;  2L0W A;  1ALQ A;  5MC7 A;  2JN7 A;  2NUP C;  1H0M A;  3Q1F A;  1PIO A;  5IT5 A;  1IYS A;  5TJJ A;  3GMW A;  2ZQ7 A;  4JXW A;  5GLB A;  3TW8 A;  2ZC4 B;  4NXF A;  5D3O A;  3BQA A;  4RQ9 A;  4EEP A;  1SCW A;  3LR4 A;  3H7W A;  3FPW A;  4OPZ A;  4BLM A;  4DDY A;  5DJT A;  4R4R A;  2ZQD A;  1OME A;  1S66 L;  2XD5 A;  1NZU A;  1XGI A;  2WGW A;  2D01 A;  4DDS A;  3NHQ A;  5GL9 A;  2EX6 A;  5FQJ A;  2QJ5 A;  2ZC6 B;  3SS4 A;  3BLM A;  4EQ1 A;  4BJP A;  1E4D A;  1Y28 A;  4KG6 A;  4OH0 A;  3IWI A;  2GNX A;  2W3H A;  4KZ6 A;  3FG8 A;  3MQO A;  1K57 C;  5IHV A;  4R23 A;  3GTC A;  2EX8 A;  5EOE A;  5DKL A;  2V8C A;  3DTK A;  4QWO A;  5HX9 A;  4P6Z S;  3VOY A;  3ZVW A;  1ACF A;  2O0Y A;  3KO6 A;  3VFH A;  5FI7 A;  2PT7 A;  3R4K A;  4DJ3 A;  1L2S A;  4HJ6 A;  3V5M A;  3V67 A;  4E3N A;  1IEL A;  5CGS A;  3WWX A;  4FOF A;  1IYQ A;  1MWR A;  5C5K A;  1XKZ A;  4ESP A;  4X6T A;  2INW A;  3EGD C;  1IYO A;  5U47 A;  4R3J A;  4B4X A;  4BD0 A;  4MN5 A;  3G34 A;  1MY8 A;  1GSX A;  4PM8 A;  4Y0T A;  5FQ9 A;  5CGW A;  4BL3 A;  4DRT A;  4G3W A;  3CUE C;  5HWT A;  1YLY A;  2YKH A;  4HOI A;  3PR6 A;  4LCM A;  2B02 A;  5IS1 A;  3UNW A;  3G2Z A;  3ICY A;  1H5X A;  2PR6 A;  4B93 A;  2J8Y A;  1FCM A;  2HGV A;  4OLG A;  3RFB A;  2HP9 A;  3M2K A;  4PM7 A;  5I94 A;  3Q7V B;  1F5M A;  3RXW A;  1MBL A;  2VZW A;  3VOZ A;  3C8C A;  4E3K A;  4WEK A;  4EEU A;  4K08 A;  3VP0 A;  5G4Z A;  4QPR A;  3NEC A;  4OPQ A;  3OOV A;  5EE8 A;  1BTL A;  4C3Q A;  4S2N A;  4GW9 A;  4Y3I A;  3FWL A;  1N9N A;  1ZG4 A;  5L10 A;  3E98 A;  3BEC A;  1T1C A;  2OLU A;  3CI6 A;  4CLC E;  3EQV A;  5FAS A;  5A90 A;  2V1A A;  2A2L A;  2PDR A;  3HL9 A;  1JTG A;  1QME A;  3UDF A;  5F6A A;  3ISG A;  2HDQ A;  3BFF A;  1RCJ A;  3S7O A;  3M6H A;  4FSF A;  2JHE A;  1PNE A;  1LL5 A; 
#chains in the Genus database with same CATH homology
 4C75 A;  1HVB A;  4MBH A;  3E2L A;  1K54 C;  5TFQ A;  3OPR A;  3A3J A;  1LL9 A;  3ZVT A;  4RYE A;  1H8Y A;  4OQI A;  4LV2 A;  1L0D A;  1KGF A;  3GQZ A;  3GRJ A;  5CXW A;  3WS1 A;  1ES5 A;  4U3T A;  4DE0 A;  2WK0 A;  1KDS A;  4RVA A;  1G6A A;  4JPM A;  5GLD A;  5CED A;  4KZ3 A;  4IVI A;  5HAP A;  4XXR A;  1ES3 A;  4OOM A;  2QPN A;  1BLP A;  4GDB A;  4KZB A;  5M1A A;  5FA7 A;  2WKI A;  2Z2L B;  2V20 A;  4UA9 A;  4Y0U A;  5FQQ A;  1FSW A;  1EI5 A;  3MXS A;  5A91 A;  4E3M A;  2XF3 A;  5GLA A;  1ESI A;  3ZCZ A;  3S22 A;  2ZC3 B;  3IHB A;  3OCL A;  4KZ8 A;  1IKI A;  3FKV A;  3N4I A;  1K6R A;  2QMI A;  4GN2 A;  5EEC A;  3UE3 A;  3NY4 A;  1YLP A;  4OQH A;  4KZ7 A;  1MWU A;  2A3U A;  2Y2H A;  1BSG A;  3HVF A;  4IBX A;  3VSK A;  3C4O A;  1YM1 A;  2Q9M A;  3SH7 A;  4A5R A;  2HDS A;  2Q9N A;  5HAR A;  3V3R A;  2P9V A;  3A3I A;  3S1Y A;  3ITA A;  1I5Q A;  2WAD A;  3FKW A;  4QY6 A;  1J9M A;  4UHU A;  5E2G A;  1Q2Q A;  2XEP A;  4KQO A;  2EFU A;  4KZA A;  3CZD A;  3QHY A;  5GHX A;  1KVL A;  4E3J A;  1CI8 A;  2WZZ A;  2C6W B;  2PU2 A;  1RGZ A;  4KZ9 A;  3FZC A;  1FOF A;  4K91 A;  1K4F A;  3IF6 C;  2XLN A;  3B3X A;  3MKE A;  1KGE A;  1FCN A;  1ERO A;  3NI9 A;  4WYY A;  1K25 A;  1FCO A;  3OZH A;  4GB7 A;  5CTN A;  5A92 A;  2FFY A;  5FAO A;  3HRE A;  3Q81 A;  5AQB A;  1KVM A;  4Z9Q A;  3V3S A;  1NZO A;  3DWZ A;  1GHP A;  4EQI A;  5TR7 A;  4KQQ A;  2DRW A;  1WYB A;  4IED A;  1K57 A;  5E43 A;  3CJM A;  4GZB A;  4O7D A;  3Q7Z A;  1JWV A;  2XFS A;  5DTT A;  3UE1 A;  3IWQ A;  3IXB A;  5DVA A;  3DW0 A;  5AQ9 A;  2X02 A;  4S2O A;  4JF4 A;  4S2N C;  5EVI A;  4S2I A;  3TOI A;  3ZGA B;  3G2Y A;  3IF6 B;  4KZ5 A;  4KG2 A;  4K0W A;  4S2M A;  4BQM A;  3LCE A;  2Y59 A;  4DXC A;  4OOL A;  4K0X A;  3ZNY A;  4X69 A;  4IVK A;  5BOH A;  1XPB A;  5CEC A;  4XUZ A;  5EOO A;  1E3U A;  3UPP A;  3ZNT A;  3ZG0 A;  2ZD8 A;  1W8Y A;  1VQQ A;  3UDX A;  3AGD A;  1C3B A;  3C7V A;  2ZQA A;  1SKF A;  4QU3 A;  2JCH A;  4L0L A;  2DCF A;  4F94 A;  2ZQ9 A;  3W4Q A;  5KSC A;  1PI5 A;  4LV0 A;  4QD4 A;  5F1G A;  4GNU A;  1HD8 A;  2HDR A;  1H8Z A;  2ZC7 A;  4GD6 A;  3SH8 A;  1L0E A;  1PZO A;  4IBR A;  4PM9 A;  5HW3 A;  1L0F A;  5F1F A;  4NET A;  5FAP A;  3BFC A;  5CEB A;  1MKI A;  2HPB A;  4P87 A;  4ZTK A;  2ZM0 A;  5FAT A;  2WGW B;  1ONH A;  3IWO A;  1XGJ A;  4N9L A;  4B4Z A;  4FH2 A;  3A3D A;  1PZP A;  3NDG A;  5AQA A;  2J9O A;  3C4P A;  3JYI A;  4MBK A;  5KMW A;  3WS2 A;  4JF6 A;  3VP4 A;  5GHZ A;  2PBY A;  5FQK A;  2Y2G A;  4CPK A;  5FAQ A;  2X71 A;  1SDE A;  1SDN A;  4DXB A;  2HDU A;  1SHV A;  1BUE A;  4FCF A;  1GA0 A;  1TDG A;  4ZBE A;  4Y0O A;  4WZ5 A;  1BLC A;  4EBL A;  5GLC A;  4DKI A;  3MBZ A;  3HUM A;  3MZF A;  4ZJ2 A;  3TG9 A;  4BEN A;  3ZG7 B;  3VFF A;  5JYO A;  1ONG A;  2HP6 A;  3D4F A;  3VP2 A;  3VP1 A;  4FD8 A;  1L0G A;  3MFD A;  3DTM A;  1PI4 A;  1ES2 A;  5FI6 A;  1O7E A;  2R9W A;  1AXB A;  1YLT A;  1BT5 A;  1KDW A;  2G2W A;  5CTM A;  3PTE A;  4P6B A;  4D2O A;  1Q2P A;  3PAG A;  4JF5 A;  4N92 A;  4R3B A;  1CK3 A;  4RA7 A;  1W7F A;  1ZG6 A;  2WAF A;  2EX2 A;  2J7V A;  4EBN A;  2IWC A;  4QHC A;  5EPH A;  2XFT A;  3M2J A;  3UO9 A;  4Y7P A;  1BLS A;  3WS0 A;  1PW1 A;  4WZ4 A;  3IT9 A;  4KG5 A;  4YFM A;  4E3L A;  1N4O A;  3I7J A;  2Y2N A;  5GHY A;  2I72 A;  3HUN A;  1LI9 A;  1JWZ A;  4X68 A;  5FI2 A;  1XP4 A;  4WEJ A;  3BFD A;  4XUX A;  1S0W A;  2OLV A;  2Y2K A;  5E2H A;  2A49 A;  2H0T A;  2VGK A;  3Q82 A;  3N8S A;  4JLF A;  3UPN A;  1IEM A;  3BM6 A;  4N9K A;  4B88 A;  4KEN B;  1JWP A;  4RX3 A;  3RXX A;  1LLB A;  2WZX A;  1RGY A;  3OCN A;  4OVD A;  1EWZ A;  2CC1 A;  2RCX A;  4FH4 A;  3FV7 A;  2XGN A;  3N8L A;  1YLW A;  3IXG A;  3ZFZ A;  3BFG A;  3DWK A;  4X53 A;  5DF7 A;  3WS5 A;  4U0T A;  2JC7 A;  5F83 A;  1K54 A;  5G18 A;  3WRZ A;  3VSL A;  1QMF A;  3GVB A;  3IF5 A;  4HBT A;  4LCL A;  3C5A A;  4R1G A;  3LY4 A;  3NCK A;  3IHA A;  3GV9 A;  3HLG A;  3Q07 A;  2B5R A;  3OPH A;  2WGI A;  2GDN A;  2H5S A;  3G35 A;  5CER A;  5TGF A;  1DJA A;  1NJ4 A;  4OKP A;  1O07 A;  5L2F A;  1E3U D;  2EXB A;  1TDL A;  3O88 A;  3PAE A;  4JXV A;  4OON A;  4BD1 A;  1MWS A;  3LO7 A;  5EVL A;  1LI0 A;  1YMX A;  4HBU A;  4UA6 A;  1W8Q A;  1ZC2 A;  5KSH A;  1K6S A;  4OP5 A;  3ITB A;  2Y2Q A;  3P09 A;  4S2P A;  3EQU A;  4LV1 A;  5FSR A;  3SH9 A;  1BUL A;  3AGE A;  1K56 A;  3WS4 A;  5HFO A;  4X55 A;  4BL2 A;  3VMA A;  2Y2M A;  4QY5 A;  5JYP A;  2H10 A;  1DJB A;  2HP5 A;  3LEZ A;  3N8R A;  4JBF A;  2C5W B;  1YLZ A;  4PMA A;  3HLC A;  2IWB A;  1K55 C;  1ZKJ A;  3ZG8 B;  4EBP A;  5DF9 A;  3NIA A;  4OP8 A;  3QNB A;  1YQS A;  3UY6 A;  1MWT A;  3V50 A;  5CHU A;  3SOI A;  2XQZ A;  3IXH A;  4RX2 A;  3G32 A;  3HLD A;  3QNC A;  3W8K A;  1ALQ A;  2BG1 A;  4JXG A;  2WUQ A;  3GR2 A;  1U60 A;  4JKT A;  3IH8 A;  4S2K A;  3ZHH A;  3HLE A;  4MLL A;  4C6Y A;  3Q1F A;  4WMC A;  1PIO A;  5DF8 A;  4HES A;  1IYS A;  4ID4 A;  3E2K A;  2H0Y A;  1PWC A;  3GMW A;  4PPR A;  1GCE A;  1YMS A;  2ZQ7 A;  4JXW A;  5E2E A;  5GLB A;  2FFF B;  4DF6 A;  5A93 A;  2ZC4 B;  2EFX A;  2OV5 A;  5D3O A;  1CEF A;  1K4E A;  1W79 A;  3PBR A;  1KE3 A;  3SS5 A;  3Q7V A;  1SCW A;  4CJN A;  4KQR A;  4ZJ1 A;  4U0X A;  4OPZ A;  5HAI A;  5CHM A;  4BLM A;  4P0M A;  4R0Q A;  1GA9 A;  1G68 A;  4M3K A;  4DDY A;  3PBS A;  3UN7 A;  4OQ0 A;  4QJG A;  1RP5 A;  4R4R A;  2ZQD A;  2WYX A;  1OME A;  3FYZ A;  2P74 A;  3UE0 A;  1IYP A;  2XD5 A;  1NZU A;  3O87 A;  1XGI A;  4ZJ3 A;  3O3V A;  1PWG A;  2WGW A;  3BYD A;  4EUZ A;  4ZAM A;  2EXA A;  3M6B A;  3ZDJ A;  1KE4 A;  2V2F F;  3PBN A;  1XA7 A;  3C7U A;  3OPL A;  3SS3 A;  2BLS A;  3V39 A;  3HLW A;  1NYM A;  4DDS A;  5GL9 A;  2EX6 A;  5FQJ A;  5AQ7 A;  1W5D A;  5EUA A;  2ZC6 B;  4S2L A;  3SS4 A;  1FSY A;  1ERM A;  1NYY A;  3BLM A;  1NRF A;  3W4P A;  4BJP A;  1E4D A;  4YIN A;  3IH9 A;  2ZMA A;  4KG6 A;  4OH0 A;  2ZJ9 A;  3HLB A;  4OPR A;  2ZQC A;  3AGF A;  3IWI A;  2JBF A;  4X56 A;  1ERQ A;  2ZM2 A;  4KZ6 A;  2P9V B;  2DNS A;  3NBL A;  2ZLY A;  3HBR A;  2E8I A;  1K57 C;  2XD1 A;  1DJC A;  2V1Z A;  4MNR A;  4OOY A;  5IHV A;  4R23 A;  3GTC A;  2OSU A;  3HLF A;  4OPY A;  1YT4 A;  4R4S A;  2EX8 A;  5EVI C;  5F82 A;  3IXD A;  3UDI A;  1NXY A;  4PM5 A;  5EOE A;  4E3O A;  4OQG A;  1BLH A;  2Y2L A;  3BRM A;  4UAA A;  3RJU A;  1PWD A;  1WE4 A;  2R9X A;  5E2F A;  1JTD A;  4N1X A;  3A3E A;  5HX9 A;  4GOG A;  2EX9 A;  3VOY A;  3ZVW A;  1KE0 A;  1MXO A;  3BLS A;  3CG5 A;  5KZH A;  3P98 A;  2WAE A;  2Y91 A;  4WBG A;  2ZC5 B;  4E3I A;  4EV4 A;  1I2W A;  5EVI D;  3TSG A;  3VFH A;  5EVI B;  2XK1 A;  2XDM A;  5FI7 A;  3LY3 A;  4UA7 A;  1L2S A;  2X01 A;  3V5M A;  5HL1 A;  4E3N A;  1IEL A;  5CGS A;  1Z6F A;  3PBQ A;  5FQI A;  3WWX A;  1IYQ A;  1Y54 A;  1MWR A;  3S4X A;  4DE2 A;  1XKZ A;  1K56 D;  4X6T A;  3O86 A;  5FQM A;  2XR0 A;  3MKF A;  5U47 A;  1IYO A;  4R3J A;  4B4X A;  4BD0 A;  2Z2M B;  2ZQ8 A;  1HTZ A;  3G34 A;  1MY8 A;  4PM8 A;  5DTS A;  2ZM8 A;  4MEZ A;  1FR1 A;  3BFE A;  4E6X A;  4Y0T A;  4S2J A;  4QB8 A;  5FQ9 A;  3PBO A;  5CGW A;  4BL3 A;  4DRT A;  1MPL A;  2JE5 A;  2XH9 A;  4LV3 A;  3ZG5 A;  3N6I A;  5M19 A;  1YLY A;  4OLD A;  4WM9 A;  1TEM A;  4LCM A;  3N7W A;  4WMC D;  4JXS A;  4GDN A;  1VM1 A;  4WZ5 C;  3VP3 A;  5M18 A;  1CEG A;  1S6R A;  3HUO A;  4GKU A;  3UNW A;  1ES4 A;  1N9B A;  3G2Z A;  3MZE A;  3W4O A;  2WKE A;  1H5X A;  2J8Y A;  1FCM A;  1CI9 A;  3GSG A;  3MXR A;  4HEF A;  4LEN A;  4OLG A;  5CGX A;  4DE1 A;  1KGG A;  1ESU A;  2HP9 A;  1LHY A;  4DE3 A;  3M2K A;  4PM7 A;  5I94 A;  1TVF A;  3Q7V B;  2IWD A;  3RXW A;  3IF6 A;  3OPP A;  1MBL A;  4PM6 A;  3VOZ A;  1M40 A;  4E3K A;  3NDE A;  4WEK A;  4WEL A;  2WKH A;  3G31 A;  4N1H A;  3VP0 A;  4EWF A;  2G2U A;  1XA1 A;  5FDH A;  2VGJ A;  4OPQ A;  1IKG A;  2WGV A;  5DTK A;  1FQG A;  2Y2P A;  3WRT A;  1E25 A;  4MBF A;  4KZ4 A;  3UPO A;  5EE8 A;  1BTL A;  4C3Q A;  4S2N A;  3G30 A;  3OC2 A;  1K38 A;  3FWL A;  4ZDX A;  1ZG4 A;  1I2S A;  4GD8 A;  3PBT A;  4NK3 A;  2J9P A;  3A3F A;  3BEC A;  3NC8 A;  2QZ6 A;  2OLU A;  5CHJ A;  2UWX A;  5HAQ A;  3EQV A;  5CRF A;  5FAS A;  1WYC A;  3MZD A;  5A90 A;  4P85 A;  1HZO A;  1PW8 A;  1JVJ A;  1XXM A;  3HL9 A;  1DY6 A;  1JTG A;  1QME A;  2PU4 A;  3UDF A;  4H8R A;  1K55 A;  2Y2I A;  2Y2J A;  3IQA A;  3ISG A;  3ZG9 B;  5J8X A;  2HDQ A;  2RL3 A;  3BFF A;  1GHM A;  1RCJ A;  1PYY A;  1NY0 A;  1GHI A;  2Y55 A;  4Q8I A;  4E6W A;  3M6H A;  3BEB A;  1XX2 A;  2Y2O A;  3CMZ A;  4FSF A;  1M6K A;  3G4P A;  2Y4A A;  1LL5 A;  1YLJ A;  1BZA A;  1FR6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...