4R4SA

Crystal structure of chimeric beta-lactamase ctem-19m at 1.1 angstrom resolution
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPLTSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTDFLRQIGDKETRLDRIEPDLNEGKLGDLRDTTTPKAIASTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase TEM,Beta-lactamase PSE-4
publication title Crystal structures of chimeric beta-lactamase cTEM-19m
rcsb
source organism Escherichia coli
total genus 96
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2014-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4r4sA00
4N1XA 1FCMA 1RGZA 2VGJA 2Y2QA 3VFHA 4E3JA 4QJGA 2V20A 4K0WA 2OLUA 2Y59A 3IF6A 4IVKA 4MBFA 1SKFA 2Y2HA 2HP6A 3NY4A 3IF5A 1IYOA 1ALQA 1JWVA 3UE1A 1K56A 3LEZA 4XUXA 3Q7VA 4S2LA 3CG5A 1CEGA 1FCOA 1W7FA 3HLEA 2A49A 4GNUA 3WS0A 4R1GA 3SS3A 5HAQA 3MKEA 1IKGA 4X6TA 3W4QA 2EX6A 2Y55A 1GHMA 4BD0A 3OCLA 5GLCA 4C75A 4F94A 5HL1A 4C3QA 2B5RA 5DF8A 3BM6A 4UHUA 4LV2A 5E2EA 4LV3A 2Y2KA 3ZFZA 4KG5A 4S2JA 4XUZA 5E2FA 4UAAA 5KSCA 4LCLA 2H0TA 4BJPA 3IXHA 4OH0A 4OOMA 5FQ9A 3RJUA 4QY6A 2WKEA 4Y0OA 1K57C 3I7JA 1KDSA 2ZQ7A 3FKWA 1O07A 5EOOA 5EVID 3VOYA 3HLWA 4JXSA 2HP9A 1GHPA 5M18A 1K57A 1FQGA 1SDEA 2PU2A 2R9XA 1YLTA 1PZOA 1CEFA 1NY0A 2DNSA 3P98A 2Y91A 4FCFA 1EI5A 1JTDA 2ZC3B 4OQIA 2H10A 4N9KA 2JC7A 3PBOA 4OLGA 3C7UA 4IBXA 4OPZA 3BLSA 4EQIA 3V5MA 1ES3A 4ZJ3A 3S22A 5D3OA 1DJAA 5FDHA 5FATA 4GN2A 2X71A 3IQAA 1I2SA 2UWXA 5FQIA 2V2FF 2XD5A 4P6BA 3SS4A 1PW1A 4KQOA 1C3BA 5G18A 2Y2NA 3GMWA 3VP4A 4OQGA 4B4ZA 4E3LA 1KE4A 1ES5A 1PI4A 1NYMA 2J8YA 3VFFA 2WZXA 3M6BA 2ZC5B 4HBTA 4BD1A 1L2SA 1JWZA 1JVJA 1MKIA 4KZBA 4CJNA 4FD8A 1CI9A 4A5RA 5CXWA 3WWXA 3NBLA 3MXRA 5DTSA 4RA7A 2Y2JA 4P85A 1K6RA 3MFDA 1PWGA 3LO7A 2C6WB 5HFOA 3O87A 2ZQ8A 2EFUA 1EROA 3EQVA 5GL9A 1YM1A 1W79A 4IBRA 3HVFA 5CEDA 1TEMA 4OOYA 4JLFA 3ZHHA 1SDNA 4KG6A 2G2WA 1NZUA 1PWCA 1ZC2A 2ZQ9A 4H8RA 4OPYA 4DDSA 1NYYA 1BT5A 3IXBA 2V1ZA 1TDLA 4WM9A 1WYCA 3WS2A 2WADA 2WGVA 3S1YA 4XXRA 3UDIA 5KMWA 5KSHA 5KZHA 4GKUA 2OSUA 1I5QA 1RCJA 3Q81A 4QHCA 3RXWA 1QMFA 5EVIB 4GD6A 4S2NC 4DF6A 5E43A 1XGIA 3FYZA 2E8IA 3G35A 4GDNA 1DJCA 5GHXA 1L0EA 5A91A 4E6XA 4S2NA 2WGIA 4QB8A 5JYOA 3W4OA 5JYPA 3TOIA 3WS5A 5BOHA 1FCNA 3Q7ZA 4KG2A 4KZ9A 5CGSA 1HTZA 3O3VA 1PYYA 4KZ8A 4S2MA 4PM9A 4JBFA 5FAQA 2FFFB 1BTLA 3PBTA 1PWDA 2HDSA 4K0XA 4OONA 5DTTA 5EVIC 1W8YA 4R4SA 1G6AA 5TGFA 3LY3A 4U3TA 5EVIA 1LL9A 3PBRA 5FQMA 4R3BA 1YQSA 5FQQA 3V3SA 4Q8IA 2EXAA 3NDGA 3HL9A 2J9OA 4JXVA 1MBLA 5CHMA 3FWLA 1LLBA 5GLDA 2ZQDA 1KGEA 4GOGA 1K55C 3A3IA 1ERQA 3CJMA 3QNBA 5CERA 5TFQA 3CZDA 1L0GA 2JCHA 1Z6FA 3IHBA 3V50A 1K55A 2FFYA 1YLPA 4BQMA 3BYDA 4KQRA 4BL2A 4KENB 2Y2IA 1KVLA 5A92A 1KE3A 1FSWA 2WAFA 3OPRA 4FH2A 1LI9A 2H0YA 3MKFA 3SH9A 3ZVTA 4E3NA 3WS1A 5L2FA 2HDUA 4EV4A 1W8QA 1IYPA 4X56A 5CECA 4MBKA 4QU3A 4PPRA 4PM8A 1E3UD 3NC8A 5AQ9A 3HREA 4OQHA 1ES4A 3GSGA 4HEFA 1YLYA 3Q07A 4R0QA 2WKIA 3N7WA 4ID4A 3ZG0A 5HARA 3BFGA 3SS5A 3E2LA 4YINA 1E4DA 3QNCA 3PBNA 4OPQA 5CGXA 2QZ6A 1E25A 5EVLA 4R3JA 2HDQA 5EPHA 3NDEA 1GA9A 2C5WB 4KZ7A 1MWRA 1NRFA 1QMEA 1XX2A 2Y2GA 4MNRA 4JKTA 4ZJ2A 4UA9A 3WRTA 1KDWA 1KE0A 2OLVA 4DKIA 1ONHA 4WMCD 1XA7A 1MY8A 5FQKA 4EWFA 3DTMA 4OP5A 4RVAA 4DE0A 1ES2A 3G30A 1NXYA 2ZQAA 3BRMA 2WGWB 1BUEA 3IH8A 3IH9A 1YLWA 1AXBA 1J9MA 3N4IA 3WRZA 5IHVA 3IWQA 1IYQA 2I72A 2XK1A 4RX3A 4RYEA 3MZEA 3ZNTA 3HLFA 3EQUA 4NETA 4CPKA 3ITBA 2ZMAA 1FSYA 2JE5A 1VM1A 4N9LA 5F1FA 1YMXA 3C4PA 3OC2A 4LV0A 1ERMA 4JXWA 3UPNA 3C5AA 3JYIA 3ZG8B 2PBYA 2XH9A 5E2GA 4FSFA 4E3IA 2XFSA 3HLBA 4MEZA 2RCXA 1TDGA 4ZTKA 2WGWA 1Y54A 2PU4A 4S2IA 5GLAA 5HX9A 4DXCA 3C4OA 1BLSA 3AGEA 3VP0A 4L0LA 4E3KA 2P74A 1XGJA 4OLDA 4U0TA 1YLZA 4OP8A 4E3OA 1L0FA 5M1AA 4EUZA 1NJ4A 1XXMA 3HLGA 1HZOA 5DTKA 5AQAA 5CEBA 2DCFA 4R4RA 3G2YA 3HUMA 5CHUA 4YFMA 4OPRA 1MWSA 1ONGA 5FSRA 1NZOA 2Y2LA 2Z2LB 2ZD8A 1S6RA 1BLCA 5FI6A 1K38A 1PZPA 1ZG4A 3GVBA 3HBRA 4JF4A 1ESUA 3GTCA 3IF6C 4P0MA 3VP3A 3N8LA 2QPNA 4Z9QA 2EX8A 5CHJA 4X55A 2ZM2A 2X02A 1SHVA 3GV9A 3HLCA 2J7VA 2WYXA 3E2KA 3MXSA 4C6YA 3BFCA 3BFEA 3DWZA 3UE3A 1DY6A 1KVMA 3NCKA 3OPPA 4N92A 4E3MA 1GA0A 4HBUA 3TG9A 1BZAA 3IWIA 4O7DA 3TSGA 3UE0A 4Y0TA 3UPOA 3G31A 5DVAA 5A93A 1N4OA 1E3UA 4S2KA 2XR0A 4M3KA 1JWPA 3FZCA 4OQ0A 4OOLA 1K25A 5F83A 3HUNA 3W4PA 3LCEA 4WEJA 3NIAA 1PI5A 2J9PA 1PIOA 5EOEA 3SOIA 1M6KA 3O86A 5U47A 5FI7A 1HVBA 2HDRA 2XD1A 1W5DA 4JF6A 4E6WA 1FR1A 1O7EA 1BLHA 4GD8A 4WMCA 3HUOA 2XFTA 4WZ5A 2CC1A 3W8KA 3B3XA 5FASA 4PM5A 3HLDA 3FKVA 4X68A 3Q1FA 4B4XA 4GZBA 3UN7A 2XLNA 3FV7A 3G4PA 3M6HA 4IVIA 4U0XA 3PAEA 2A3UA 3BFDA 2XEPA 2QMIA 3OPHA 5FA7A 1FR6A 5F82A 1IKIA 1YLJA 2VGKA 2ZC7A 3ZG5A 4P87A 1L0DA 4QD4A 2WZZA 2WKHA 2Z2MB 2Y2MA 3NI9A 1I2WA 4JXGA 3A3DA 4X53A 2Y2PA 1BLPA 3UY6A 5DF7A 4GDBA 4NK3A 3A3FA 4PMAA 1XA1A 5TR7A 3UNWA 3ZG7B 1VQQA 4BLMA 5FAPA 2H5SA 3M2KA 4D2OA 1ESIA 3IWOA 3VP2A 4EBPA 3PTEA 1ZG6A 1YT4A 4BL3A 1XKZA 2ZM0A 4LENA 5F1GA 4JF5A 1MPLA 3ZCZA 2BG1A 4DXBA 3DWKA 4QY5A 2DRWA 4MLLA 3PBQA 2XDMA 1K4EA 1S0WA 3D4FA 1BULA 3N8RA 1PW8A 4B88A 3CMZA 3O88A 2ZQCA 5EE8A 4ZJ1A 3UO9A 1KGGA 1K54C 4KZ5A 5EUAA 5GHYA 1M40A 1CI8A 3ZVWA 2IWCA 3MZFA 1LL5A 3IT9A 4JPMA 3BFFA 4RX2A 1K54A 4WELA 4KZ4A 2ZM8A 3ISGA 4WEKA 4OVDA 1H8YA 1TVFA 3AGFA 5FAOA 3UDXA 5I94A 2R9WA 4Y0UA 2JBFA 4BENA 1K56D 4UA6A 1XPBA 2Q9MA 1GCEA 3LY4A 4IEDA 4DE3A 1BSGA 1OMEA 2OV5A 3UPPA 3VSLA 1MXOA 5GHZA 2XGNA 1H8ZA 1MWUA 2P9VB 2EX2A 5HAPA 1LHYA 3ZGAB 1H5XA 2G2UA 4KZ3A 1YMSA 2ZJ9A 3QHYA 5CTNA 3ZG9B 5E2HA 4S2PA 1FOFA 4OKPA 3RXXA 2HP5A 3N8SA 4PM6A 3ITAA 1WYBA 3UDFA 3AGDA 3PBSA 3VSKA 1ZKJA 5AQBA 4WBGA 3A3JA 4DE1A 4KQQA 3G32A 2WAEA 3VMAA 4K91A 4ZDXA 1G68A 4DRTA 3PAGA 3G2ZA 4KZAA 1IEMA 1WE4A 3M2JA 3OPLA 3VP1A 1JTGA 5CGWA 4N1HA 4PM7A 4HESA 3ZDJA 2XF3A 3MZDA 2GDNA 4MBHA 1Q2QA 5CTMA 4ZAMA 4DDYA 2P9VA 5M19A 3IXDA 3MBZA 3DW0A 4Y7PA 1Q2PA 3BLMA 4WZ4A 2Q9NA 2ZLYA 4EBLA 5EECA 3N6IA 1MWTA 4ZBEA 3Q82A 3IXGA 5GLBA 2IWDA 3IHAA 4LV1A 5HAIA 4R23A 1K6SA 2EFXA 1HD8A 2ZC6B 5FQJA 1RGYA 2EX9A 3OCNA 3WS4A 2HPBA 1SCWA 1IYSA 1CK3A 3GRJA 3GR2A 2EXBA 3GQZA 3OZHA 5J8XA 3SH8A 1IELA 4GB7A 2WK0A 4KZ6A 3IF6B 4S2OA 3BEBA 4UA7A 1RP5A 2Y2OA 2BLSA 1XP4A 3G34A 3VOZA 3P09A 1N9BA 2Y4AA 4DE2A 1KGFA 3Q7VB 1K4FA 3ZNYA 3C7VA 2ZC4B 4WZ5C 3SH7A 3V39A 2RL3A 5AQ7A 3A3EA 5HW3A 2IWBA 1GHIA 2XQZA 1U60A 4LCMA 1EWZA 4EBNA 4FH4A 4WYYA 2WUQA 5DF9A 5FI2A 3S4XA 3V3RA 5CRFA 5A90A 2X01A 3BECA 4X69A 1LI0A 1DJBA
chains in the Genus database with same CATH superfamily
4WLAA 2W1TB 4MDZA 2J80A 3UB5P 1PFLA 4IVKA 1D1JA 4MBFA 1ZHHB 1IYOA 1JWVA 3UE1A 1K56A 3LEZA 4EESA 3Q7VA 4EEUA 3WS0A 5HAQA 1IKGA 4LRZE 1T1BA 3CITA 4F94A 5HL1A 3KSFA 4LV3A 3ZFZA 2W1TA 4FOFA 4XUZA 3JVUA 4UAAA 3IXHA 5F69A 4QY6A 2WKEA 3I7JA 3FKWA 5EOOA 3VOYA 3HLWA 1GHPA 1NLYA 1N9NA 2R78A 3T4KA 4I38A 4FCFA 1EI5A 1JTDA 5HWTA 1MC0A 3DTKA 4EQIA 5D3OA 3LR0A 5FDHA 5HWWA 4I39A 5DFXA 1I2SA 2V2FF 2B95A 2XD5A 1DP9A 4MN5A 2MJ6A 3GMWA 4QWOA 2WZXA 4EQ1A 3M6BA 4HBTA 1CI9A 1OT6A 3MXRA 5DTSA 2Y2JA 1N9OA 3LO7A 2FZ0A 2CMNA 2PR5A 2ZBBA 4IBRA 4DN0A 1T1AA 1TEMA 1HLUP 3KYQA 4OOYA 3ZHHA 1SDNA 4KG6A 5IS1A 2G2WA 1NZUA 4H8RA 2ZQ9A 5KZHA 3S1YA 3JVVA 5KSHA 5AVEA 4EW7A 1RCJA 5AJGA 3RXWA 4ARZA 4GD6A 4GW9A 4DF6A 4ESPA 1XGIA 1XJ4A 1A0KA 3F1OB 3S7NA 1DJCA 2V1BA 1L0EA 5A91A 4YWZA 5JYOA 4DMZA 2WKRA 3TOIA 3Q7ZA 3VV4A 5CGSA 3O3VA 4EETB 4JBFA 3PBTA 2HDSA 3NJAA 2L0WA 1XFNA 1GSWA 3VE3A 1W8YA 1G6AA 4U3TA 5FQMA 5FQQA 2GX5A 3F1OA 2EXAA 3MFXA 1MBLA 4EERA 3FWLA 1LLBA 5TBMB 4GOGA 1K55C 2JKGA 3CJMA 3V50A 2FFYA 4BQMA 5HSQA 4ETXA 4PHTA 4KENB 5A8BA 1T1CA 1KE3A 3K3CA 4FH2A 2W27A 3KSGA 3MKFA 3ZVTA 4E3NA 4AFIA 4MBKA 5AQ9A 1E3UD 4OQHA 3BQ8A 2PYPA 3ZG0A 4ID4A 2GZAA 3SS5A 5TBMA 5L8MA 4R3JA 4I3JA 2C5WB 1QMEA 1NRFA 1BYWA 1KDWA 2OLVA 2QJ5A 1IOUA 5HDSA 3CWFA 5FQKA 3B42A 1ES2A 3G30A 1NXYA 2AVXA 2H28A 5FEGA 3IH9A 1J9MA 3N4IA 3QP6A 5IHVA 1TF1A 3IWQA 4ME4A 4HJ4A 3BY8A 1N9LA 1FSYA 2QHKA 2A2LA 3C4PA 4NXBA 1ERMA 2PBYA 2P7JA 2V9AA 1OJ5A 1TS8A 2PR6A 3ICYA 5EM0A 3A0VA 3VP0A 4L0LA 5HD5A 2VLGA 2P74A 4U0TA 3D9YA 3NOTC 1XXMA 2KDKA 5DTKA 2DCFA 5K5BA 2XRNA 4HIAA 1MWSA 3LIAA 4CLCC 2Z2LB 1OJGA 1K38A 5IU1A 3GVBA 4QPRA 3N8LA 5CHJA 5DJTA 4X55A 2ZM2A 2ZL1B 3H82B 3S7OA 2Y79A 3BFCA 3OPPA 4Y3IA 4HBUA 1LL8A 3UPOA 4MN6A 1E3UA 3LR5A 4M3KA 4OOLA 3S7QA 3LCEA 1PI5A 1M6KA 3MQ0A 2Q0OA 2BASA 1NRJA 4GD8A 2ZL1A 4WZ5A 3H82A 3B3XA 1TS6A 5EFWA 5HWVA 3Q1FA 4GZBA 4EUVA 5FA7A 4R6LA 1YLJA 2VGKA 1VB6A 4JGOA 1I2WA 2Y2PA 3UY6A 4GS9B 2P04A 3UB8A 5FAPA 2H5SA 4EBPA 5L10A 3HCYA 1XKZA 5F1GA 4HP9A 4QY5A 2DRWA 2XDMA 3LUQA 3UMDA 4HOIA 5FL3A 4B88A 2ZQCA 2Y8HA 1LSXA 5GHYA 5EUAA 4GS9A 3MS6A 4WELA 4WEKA 4OVDA 5FAOA 2R9WA 2JBFA 1LSWA 4BBVA 4DE3A 1OMEA 2OV5A 3QP4A 1MXOA 3U2AA 5HAPA 3ZG9B 3QHYA 4MN7A 5E2HA 4OKPA 3N8SA 2GNXA 3ITAA 1WYBA 3UDFA 3VSKA 5AQBA 1WA9A 3G32A 4ZDXA 4KZAA 1IEMA 3OPLA 4N1HA 4HESA 5CTMA 4ZAMA 4MBHA 4Q0IA 1Q2PA 3BLMA 2JKRI 4Q0JA 4EBLA 2L1MA 3QP8A 5HL6A 3IHAA 5HAIA 1K6SA 3OCNA 3WS4A 4CQHA 1IYSA 3GRJA 3LEQA 2Z6CA 3SH8A 4GB7A 4UA7A 2J3TD 2Y2OA 1OTAA 3DBAA 3P09A 1N9BA 3K2NA 4PAUA 3ZNYA 3C7VA 2ZC4B 4Q0HA 2RL3A 5AQ7A 3IX3A 3A3EA 2JKRM 1GHIA 5EV0A 1D06A 1EWZA 4WYYA 5A90A 4O8GA 3LR3A 1LI0A 1DJBA 1FCMA 2Y2QA 2O9AA 5HDCA 2V20A 4K0WA 2OLUA 3OOVA 1ODVA 2HP6A 3IX8A 4Y2FA 4KUOA 4YNRA 4XUXA 3PXPA 3SW1A 1W7FA 3HLEA 4GNUA 4R1GA 3MKEA 4X6TA 3W4QA 2EX6A 4BD0A 3H7WA 4C75A 5DF8A 4UHUA 4LV2A 4OH0A 3E4OA 4Y0OA 2ZQ7A 1O07A 2HP9A 4BBUA 1K57A 4RQ9A 4HP4A 2PU2A 2Z6DA 1PZOA 2DNSA 3S7PA 1XFQA 3SZTA 3OLOA 5EVEA 4N9KA 2JC7A 3PBOA 1T18A 3BLSA 1ES3A 4ZJ3A 1K0KA 4GN2A 2X71A 2UWXA 1G28A 4P6BA 1PW1A 4KQOA 4E3LA 3TE8A 4OQGA 5L09A 1ES5A 2PHYA 3VFFA 1JWZA 4RA7A 1K6RA 3MFDA 1PWGA 4I5SA 2C6WB 5HFOA 3T4LA 2EFUA 3EQVA 2O0YA 3W2ZA 1YKDA 1PWCA 1ZC2A 4H6JB 3E4QA 3IXBA 1TDLA 3WS2A 2WGVA 3UDIA 4XXRA 4GKUA 1I5QA 3Q81A 5HZHA 4MMNA 2E8IA 3TRCA 3W4OA 4I3IA 5JYPA 4HJ6A 2NUTC 1NWZA 2OAP1 2K2NA 4KG2A 1HTZA 1PYYA 5FAQA 1BTLA 4WL9A 4OONA 5DTTA 2WKQA 4GCZA 4R4SA 5TGFA 3C2WA 1OTEA 1OTIA 3OBFA 1YSPA 2KOIA 1P97A 2J3WA 5GLDA 3A3IA 1ERQA 3FPVA 3CZDA 1JNUA 3IHBA 1CF0A 5A92A 3MR0A 3PHYA 3OPRA 1S4SA 1W8QA 2IA2A 1ZTUA 1STZA 4PPRA 3NC8A 3NOPC 1YLYA 4R0QA 3BFGA 2O9BA 3MMHA 4R3AA 5CGXA 5C5KA 5EPHA 3NDEA 1XX2A 2Y2GA 4JKTA 4DKIA 3BRMA 3IH8A 2HGVA 5HPFA 1AXBA 2QWSA 2XK1A 2W1RA 3T12B 3MZEA 3LIFA 4JGRA 4NETA 4DJ2A 2VX8A 4R38A 1PNEA 3KSIA 3LFVA 5F1FA 1YMXA 3OC2A 4LV0A 3EWKA 4ARZB 4Y17A 2PD7A 3ZG8B 2XH9A 5E2GA 2XFSA 3HLBA 4ZTKA 3L7HA 3NULA 3MJQA 2PU4A 4S2IA 2M7VA 4DXCA 3C4OA 4GJ4A 3AGEA 1YLZA 4OP8A 4E3OA 1L0FA 1NJ4A 5AQAA 2D01A 2WKPA 4YFMA 2XA7M 3PYPA 2ZD8A 3UB6A 5FI6A 1ZG4A 1PZPA 4P0MA 3GTCA 4X1LA 2V1AA 2QPNA 3T1QB 5KIZA 2EA9A 3HLCA 2J7VA 2WYXA 3MXSA 4C6YA 3BFEA 5DKLA 4E3MA 3TG9A 1BZAA 3TSGA 5A93A 1N4OA 2ACGA 1S1YA 1T19A 2BTFP 5F83A 2ZOIA 3EEAA 1PIOA 1HVBA 2HDRA 4JF6A 1W5DA 4G3VA 1BLHA 2CC1A 3W8KA 2VKSA 4X68A 4U0XA 3PAEA 1UWPX 4UQIM 1L0DA 1VETB 4QD4A 5DF7A 4NK3A 4PMAA 3UNWA 5TR7A 1W63M 4FTXA 3DTIA 4D2OA 1ESIA 1YT4A 3R4KA 4LENA 4HQAA 1MPLA 2OWHA 4Q8IA 1PW8A 4II7A 2PD8A 3CMZA 3MXQA 1VETA 1KGGA 1YSQA 5HPIA 1M40A 1CI8A 3KSHA 3MZFA 2VEAA 4JPMA 2ZM8A 3ISGA 1TVFA 4BENA 1OT9A 2Q9MA 4IEDA 3VSLA 5GHZA 2XGNA 1MWUA 2P9VB 2EX2A 4S2PA 4JGPA 4PM6A 3IX4A 4HY8A 3AGDA 1ZKJA 2OOLA 4I3AA 2PT7A 2WAEA 5FEFA 4K91A 3P01A 1G68A 4WN5A 3PAGA 1WE4A 3M2JA 5CGWA 4PM7A 3ZDJA 4DDYA 2P9VA 3DW0A 3EEHA 4Y7PA 4O01A 2Q9NA 3TW8A 3UB7A 5EECA 4DJ3A 3BQAA 4PKYG 4NG2A 3IXGA 5GLBA 2LB5A 1S67L 2K7SA 4PKYA 2G7UA 1CK3A 2PRFA 3GR2A 1CJFA 3GQZA 3OZHA 1P0ZA 2WK0A 1MKMA 3IF6B 5J3WA 3BEBA 2BLSA 3LIBA 3QP5A 2Y4AA 4DE2A 3QP1A 3CUEA 5HW3A 4LCMA 5DF9A 3V3RA 2X01A 3H9WA 4NKPA 3IF6A 2VJWA 2Y2HA 3NY4A 3IF5A 4GHIB 1FCOA 2A49A 3SS3A 2W0NA 3C30A 4Y13A 2QJ7A 2Y55A 4B9OA 5GLCA 3BM6A 5E2EA 1F98A 2Y2KA 5E2FA 4LCLA 2H0TA 1XJ2A 4BJPA 3RJUA 1K57C 1KDSA 5EVID 3ZYTA 3MQQA 2R9XA 2JN7A 4GHIA 1CEFA 1NY0A 1S1ZA 1D7EA 3BW6A 2ZC3B 1XJ3A 3BWLA 4OPZA 3IQAA 5FQIA 3T1SA 2PBDP 5G18A 3VP4A 4B4ZA 2J8YA 4FUWA 2VZWA 4KZBA 4A5RA 3LI8A 4B93A 1GSXA 2B18A 3O87A 1YM1A 1W79A 2M1CA 3T1RA 3HVFA 4JLFA 4EXOA 4L9EA 4DDSA 2V1ZA 4WM9A 1WYCA 5KMWA 1F2KA 4IHQA 5EVIB 3FYZA 1YAXA 3G35A 5GHXA 4E6XA 4S2NA 2WGIA 4QB8A 1W63Q 1Z09A 5DJUA 5J7EA 1FCNA 1MZUA 2HV1A 4KZ8A 5CX7A 2FFFB 5TJJA 3B47A 1Y28A 4X25A 3ZQ5A 2K31A 3H7WB 2A24B 4UQIS 3U4LP 5EVIA 1LL9A 1YQSA 3V3SA 3T50A 2J9OA 4LRYC 3L9KA 4HH2A 2ZQDA 1KGEA 4HNBA 3BYDA 4KQRA 4BL2A 2VV8A 1KVLA 4R70A 3EGXC 2A24A 1LI9A 3SH9A 1H0MA 2HDUA 4EV4A 3T4JA 5CECA 1DP8A 4QU3A 4PM8A 3HREA 1ES4A 3GSGA 2PAVP 2WKIA 3HJKA 3RTYA 5HARA 2YKFA 3E2LA 1P9RA 4YINA 2HDQA 3IBJA 1MWRA 4MNRA 4ZJ2A 3LYXA 1H8MA 4WMCD 1MY8A 4EWFA 4OP5A 4DE0A 2ZQAA 4LFUA 3MQOA 4RX3A 2I72A 3R7WB 4RYEA 3HLFA 4F3LA 4CPKA 2ZMAA 4N9LA 3CHWP 5I5LA 4BWIA 4JXWA 4NXEA 3C5AA 3JYIA 3MSHA 3CI6A 4FSFA 4E3IA 4Y5FA 2RCXA 1TDGA 4Y15A 5GLAA 5HX9A 1BLSA 3R7WA 4E3KA 4OLDA 1TS0A 2E8JA 5M1AA 1V9ZA 1HZOA 5CEBA 4R4RA 3G2YA 3HUMA 4OPRA 2QYBA 3FPWA 1NZOA 2Y2LA 3HBRA 1ESUA 3VP3A 2O9CA 4WUJA 2EX8A 1SHVA 3GV9A 3T4SA 3E2KA 2VV7A 3DWZA 3UE3A 3NCKA 3C8CA 3UE0A 4O7DA 3G31A 5DVAA 3DTEA 3NECA 4S2KA 4UEYA 2VK3A 5G4ZA 3FZCA 4OQ0A 1K25A 3W4PA 5EOEA 3SOIA 3O5YA 5U47A 1O7EA 4WMCA 2XFTA 4LPZA 5FASA 4PM5A 3HLDA 2L4RA 1S66L 4B4XA 3FV7A 3M6HA 4LRXC 2A3UA 3BFDA 2ZOHA 4MCWA 5F82A 3ZG5A 1V9YA 2WZZA 2Z2MB 2Y2MA 3NI9A 4JXGA 4X53A 3A3DA 2W3GA 2HJEA 3ZG7B 3A3FA 4BLMA 4HI4A 3IWOA 4BL3A 1F9IA 3DWKA 4MLLA 1K4EA 3D4FA 5EE8A 4ZJ1A 3UO9A 2ZMVA 4KZ5A 4BMWA 2IWCA 1LL5A 1K54A 4KZ4A 3LICA 3AGFA 3UDXA 2PDRA 1KOUA 4UA6A 1XPBA 3LY4A 1BSGA 3UPPA 1YPRA 1LHYA 3ZGAB 2OAQ1 1H5XA 2G2UA 1YMSA 2ZJ9A 1FOFA 3PBSA 3A3JA 4DE1A 3D72A 4KQQA 5L07A 1PRQA 3VMAA 4DRTA 1VEUB 2XF3A 3MZDA 2GDNA 3QP2A 1Q2QA 5M19A 3EGDC 3CAXA 4WZ4A 5HD3A 1L3LA 2ZLYA 3N6IA 4ZBEA 3Q82A 1F5MA 4R23A 1HD8A 2ZC6B 1RGYA 2HPBA 2EXBA 4NXFA 3RH8B 4WF0A 1VEUA 1IELA 2D02A 4KZ6A 4S2OA 3UMEA 3VOZA 3CUEC 2P08A 4KUKA 1KGFA 1SKOB 2O99A 4K08A 4WZ5C 3SH7A 3V39A 3LGOA 3IBRA 1EW0A 4HJ3A 4EBNA 4E04A 2WUQA 3S4XA 2VGLM 3BECA 4X69A 5F68A 3IF6C 3CLOA 4N1XA 4QJGA 1RGZA 2VGJA 4LLOB 3VFHA 4E3JA 5DFYA 2Y59A 1DP6A 3EOIA 1SKFA 5F5YA 3T4TA 1ALQA 4Z1WA 1SKOA 4S2LA 3CG5A 1CEGA 2UV0E 2ZMFA 3RFBA 4X1MA 1GHMA 2KLIA 3OCLA 4IUKA 4C3QA 2B5RA 2XROA 4KG5A 4S2JA 5KSCA 1OTDA 2OWJA 4OOMA 5FQ9A 4KQDA 4JGQA 3ULFA 1J3WA 4JXSA 5M18A 4D60A 4G3KA 1FQGA 1SDEA 1YLTA 3P98A 3MF0A 2Y91A 3T4QA 4OQIA 2H10A 2W3EA 4OLGA 3C7UA 2B02A 4HH3A 4IBXA 3V5MA 1IFQA 3S22A 1DJAA 4NEED 5FATA 3UE6A 3SS4A 1C3BA 4BBTA 2Y2NA 1KE4A 1PI4A 1NYMA 3IS2B 2ZC5B 3LIEA 3CPTB 4BD1A 1L2SA 1SZVA 4G3WA 1JVJA 1MKIA 4CJNA 4FD8A 5CXWA 3WWXA 3NBLA 4P85A 2ZQ8A 1EROA 5GL9A 4O0PA 3E98A 4EEPA 5CEDA 3KYZA 2HF6A 4OPYA 1NYYA 1BT5A 2EWWA 2WADA 3IS2A 2OSUA 4QHCA 3CPTA 1QMFA 4S2NC 2M7UA 5E43A 3C38A 4GDNA 5HDDA 1P9WA 3WS5A 5BOHA 4KZ9A 4S2MA 4PM9A 1PWDA 4K0XA 5EVIC 1NLZA 2GJ3A 1OPXA 3LY3A 3PBRA 3LI9A 4R3BA 3E0YA 3NDGA 3HL9A 4JXVA 5CHMA 3FC7A 3QNBA 5CERA 4P6ZM 5TFQA 3T1XA 1L0GA 2JCHA 1Z6FA 1AWIA 4HHDA 2W3DA 4CLCD 1K55A 1YLPA 2Y2IA 3BY9A 2YKHA 2W3FA 1FSWA 2WAFA 2H0YA 1CQAA 3WS1A 5L2FA 1IYPA 4X56A 1DRMA 4HEFA 3Q07A 5EM1A 1VHMA 3N7WA 4CLCE 1LSVA 1E4DA 3QNCA 3PBNA 4OPQA 5J4EA 1XJ6A 2QZ6A 1E25A 5EVLA 4EU0A 4GLQA 1GA9A 4KZ7A 4UA9A 3WRTA 1KE0A 1ONHA 1XA7A 2JHEA 3DTMA 4RVAA 3K3DA 2WGWB 5FDSA 1BUEA 2XSSA 1YLWA 3WRZA 1OTBA 1IYQA 2V0UA 1TS7A 3ZNTA 4IJGA 3EQUA 3E4PA 3ITBA 2J3TC 1VM1A 2JE5A 3KYEA 1TD5A 2DMWA 2QKPA 3UPNA 2XA7S 4MEZA 4CLCB 2WGWA 1Y54A 4ETZA 5LBRA 2JKTI 1XGJA 3UB9A 4EUZA 3HLGA 2V0WA 1LT0A 5CHUA 2I9VA 5F6AA 1ONGA 5FSRA 4ZRRA 1S6RA 1BLCA 1X0OA 4JF4A 4CLCA 4Z9QA 1H3QA 2X02A 2VV6A 3LR4A 3GECA 1DY6A 1KVMA 4N92A 2VGLS 1GA0A 3LIDA 3IWIA 4Y0TA 2JKTM 2XR0A 3PR6A 4XT2B 1JWPA 4L9GA 3A0RA 3HUNA 1UGUA 1G6OA 4WEJA 3NIAA 2J9PA 3O86A 5FI7A 2XD1A 4E6WA 1FR1A 3KO6A 3HUOA 3D3OA 2HZ5A 3P7NA 3FKVA 3F1PB 3UN7A 2XLNA 3G4PA 4IVIA 3VE4A 2XEPA 2QMIA 3OPHA 1FR6A 3A0SA 4XT2A 1IKIA 2ZC7A 4P87A 2WKHA 1GSVA 4L9FA 1BLPA 4GDBA 1XA1A 1VQQA 2HJ9C 4F3LB 3M2KA 3VP2A 3PTEA 4LGWA 1ZG6A 2ZM0A 4JF5A 4M4XA 3ZCZA 2BG1A 3F1PA 2V8CA 4DXBA 3PBQA 1S0WA 3NOUC 1BULA 3N8RA 3T4OA 3O88A 1K54C 3ZVWA 5DKKA 5G4YA 3IT9A 3BFFA 4RX2A 1H8YA 5I94A 4Y0UA 1K56D 1GCEA 3G6OA 4IUHA 4NXGA 1H8ZA 4KZ3A 5CTNA 2JKFA 2HP5A 3RXXA 4WBGA 1FILA 1G5UA 3TJZC 2FH5A 3G2ZA 2PYRA 3VP1A 5AVFA 3B33A 1JTGA 5MC7A 2EWVA 3IXDA 3MBZA 2LB9A 3F1NB 1MWTA 3GDIA 2VA0A 1FIKA 3JPUA 3V67A 2IWDA 4LV1A 1Y4OA 2EFXA 3FG8A 3HJIA 5FQJA 2EX9A 1SCWA 3VOLA 2NUPC 2W3HA 1S4RA 3DAVA 5J8XA 2INWA 1RP5A 1XP4A 3G34A 4YOFA 3F1NA 3Q7VB 1K4FA 4P6ZS 2V8FA 3NHQA 2IWBA 2XQZA 1U60A 4FH4A 5FI2A 4H6JA 1ACFA 1UWNX 2KX6A 3BJNA 3KX0X 5CRFA 5IT5A
chains in the Genus database with same CATH topology
4N1XA 1FCMA 1RGZA 2VGJA 2Y2QA 3VFHA 4E3JA 4QJGA 2V20A 4K0WA 2OLUA 2Y59A 3IF6A 4IVKA 4MBFA 1SKFA 2Y2HA 2HP6A 3NY4A 3IF5A 1IYOA 1ALQA 1JWVA 3UE1A 1K56A 3LEZA 4XUXA 3Q7VA 4S2LA 3CG5A 1CEGA 1FCOA 1W7FA 3HLEA 2A49A 4GNUA 3WS0A 4R1GA 3SS3A 5HAQA 3MKEA 1IKGA 4X6TA 3W4QA 2EX6A 2Y55A 1GHMA 4BD0A 3OCLA 5GLCA 4C75A 4F94A 5HL1A 4C3QA 2B5RA 5DF8A 3BM6A 4UHUA 4LV2A 5E2EA 4LV3A 2Y2KA 3ZFZA 4KG5A 4S2JA 4XUZA 5E2FA 4UAAA 5KSCA 4LCLA 2H0TA 4BJPA 3IXHA 4OH0A 4OOMA 5FQ9A 3RJUA 4QY6A 2WKEA 4Y0OA 1K57C 3I7JA 1KDSA 2ZQ7A 3FKWA 1O07A 5EOOA 5EVID 3VOYA 3HLWA 4JXSA 2HP9A 1GHPA 5M18A 1K57A 1FQGA 1SDEA 2PU2A 2R9XA 1YLTA 1PZOA 1CEFA 1NY0A 2DNSA 3P98A 2Y91A 4FCFA 1EI5A 1JTDA 2ZC3B 4OQIA 2H10A 4N9KA 2JC7A 3PBOA 4OLGA 3C7UA 4IBXA 4OPZA 3BLSA 4EQIA 3V5MA 1ES3A 4ZJ3A 3S22A 5D3OA 1DJAA 5FDHA 5FATA 4GN2A 2X71A 3IQAA 1I2SA 2UWXA 5FQIA 2V2FF 2XD5A 4P6BA 3SS4A 1PW1A 4KQOA 1C3BA 5G18A 2Y2NA 3GMWA 3VP4A 4OQGA 4B4ZA 4E3LA 1KE4A 1ES5A 1PI4A 1NYMA 2J8YA 3VFFA 2WZXA 3M6BA 2ZC5B 4HBTA 4BD1A 1L2SA 1JWZA 1JVJA 1MKIA 4KZBA 4CJNA 4FD8A 1CI9A 4A5RA 5CXWA 3WWXA 3NBLA 3MXRA 5DTSA 4RA7A 2Y2JA 4P85A 1K6RA 3MFDA 1PWGA 3LO7A 2C6WB 5HFOA 3O87A 2ZQ8A 2EFUA 1EROA 3EQVA 5GL9A 1YM1A 1W79A 4IBRA 3HVFA 5CEDA 1TEMA 4OOYA 4JLFA 3ZHHA 1SDNA 4KG6A 2G2WA 1NZUA 1PWCA 1ZC2A 2ZQ9A 4H8RA 4OPYA 4DDSA 1NYYA 1BT5A 3IXBA 2V1ZA 1TDLA 4WM9A 1WYCA 3WS2A 2WADA 2WGVA 3S1YA 4XXRA 3UDIA 5KMWA 5KSHA 5KZHA 4GKUA 2OSUA 1I5QA 1RCJA 3Q81A 4QHCA 3RXWA 1QMFA 5EVIB 4GD6A 4S2NC 4DF6A 5E43A 1XGIA 3FYZA 2E8IA 3G35A 4GDNA 1DJCA 5GHXA 1L0EA 5A91A 4E6XA 4S2NA 2WGIA 4QB8A 5JYOA 3W4OA 5JYPA 3TOIA 3WS5A 5BOHA 1FCNA 3Q7ZA 4KG2A 4KZ9A 5CGSA 1HTZA 3O3VA 1PYYA 4KZ8A 4S2MA 4PM9A 4JBFA 5FAQA 2FFFB 1BTLA 3PBTA 1PWDA 2HDSA 4K0XA 4OONA 5DTTA 5EVIC 1W8YA 4R4SA 1G6AA 5TGFA 3LY3A 4U3TA 5EVIA 1LL9A 3PBRA 5FQMA 4R3BA 1YQSA 5FQQA 3V3SA 4Q8IA 2EXAA 3NDGA 3HL9A 2J9OA 4JXVA 1MBLA 5CHMA 3FWLA 1LLBA 5GLDA 2ZQDA 1KGEA 4GOGA 1K55C 3A3IA 1ERQA 3CJMA 3QNBA 5CERA 5TFQA 3CZDA 1L0GA 2JCHA 1Z6FA 3IHBA 3V50A 1K55A 2FFYA 1YLPA 4BQMA 3BYDA 4KQRA 4BL2A 4KENB 2Y2IA 1KVLA 5A92A 1KE3A 1FSWA 2WAFA 3OPRA 4FH2A 1LI9A 2H0YA 3MKFA 3SH9A 3ZVTA 4E3NA 3WS1A 5L2FA 2HDUA 4EV4A 1W8QA 1IYPA 4X56A 5CECA 4MBKA 4QU3A 4PPRA 4PM8A 1E3UD 3NC8A 5AQ9A 3HREA 4OQHA 1ES4A 3GSGA 4HEFA 1YLYA 3Q07A 4R0QA 2WKIA 3N7WA 4ID4A 3ZG0A 5HARA 3BFGA 3SS5A 3E2LA 4YINA 1E4DA 3QNCA 3PBNA 4OPQA 5CGXA 2QZ6A 1E25A 5EVLA 4R3JA 2HDQA 5EPHA 3NDEA 1GA9A 2C5WB 4KZ7A 1MWRA 1NRFA 1QMEA 1XX2A 2Y2GA 4MNRA 4JKTA 4ZJ2A 4UA9A 3WRTA 1KDWA 1KE0A 2OLVA 4DKIA 1ONHA 4WMCD 1XA7A 1MY8A 5FQKA 4EWFA 3DTMA 4OP5A 4RVAA 4DE0A 1ES2A 3G30A 1NXYA 2ZQAA 3BRMA 2WGWB 1BUEA 3IH8A 3IH9A 1YLWA 1AXBA 1J9MA 3N4IA 3WRZA 5IHVA 3IWQA 1IYQA 2I72A 2XK1A 4RX3A 4RYEA 3MZEA 3ZNTA 3HLFA 3EQUA 4NETA 4CPKA 3ITBA 2ZMAA 1FSYA 2JE5A 1VM1A 4N9LA 5F1FA 1YMXA 3C4PA 3OC2A 4LV0A 1ERMA 4JXWA 3UPNA 3C5AA 3JYIA 3ZG8B 2PBYA 2XH9A 5E2GA 4FSFA 4E3IA 2XFSA 3HLBA 4MEZA 2RCXA 1TDGA 4ZTKA 2WGWA 1Y54A 2PU4A 4S2IA 5GLAA 5HX9A 4DXCA 3C4OA 1BLSA 3AGEA 3VP0A 4L0LA 4E3KA 2P74A 1XGJA 4OLDA 4U0TA 1YLZA 4OP8A 4E3OA 1L0FA 5M1AA 4EUZA 1NJ4A 1XXMA 3HLGA 1HZOA 5DTKA 5AQAA 5CEBA 2DCFA 4R4RA 3G2YA 3HUMA 5CHUA 4YFMA 4OPRA 1MWSA 1ONGA 5FSRA 1NZOA 2Y2LA 2Z2LB 2ZD8A 1S6RA 1BLCA 5FI6A 1K38A 1PZPA 1ZG4A 3GVBA 3HBRA 4JF4A 1ESUA 3GTCA 3IF6C 4P0MA 3VP3A 3N8LA 2QPNA 4Z9QA 2EX8A 5CHJA 4X55A 2ZM2A 2X02A 1SHVA 3GV9A 3HLCA 2J7VA 2WYXA 3E2KA 3MXSA 4C6YA 3BFCA 3BFEA 3DWZA 3UE3A 1DY6A 1KVMA 3NCKA 3OPPA 4N92A 4E3MA 1GA0A 4HBUA 3TG9A 1BZAA 3IWIA 4O7DA 3TSGA 3UE0A 4Y0TA 3UPOA 3G31A 5DVAA 5A93A 1N4OA 1E3UA 4S2KA 2XR0A 4M3KA 1JWPA 3FZCA 4OQ0A 4OOLA 1K25A 5F83A 3HUNA 3W4PA 3LCEA 4WEJA 3NIAA 1PI5A 2J9PA 1PIOA 5EOEA 3SOIA 1M6KA 3O86A 5U47A 5FI7A 1HVBA 2HDRA 2XD1A 1W5DA 4JF6A 4E6WA 1FR1A 1O7EA 1BLHA 4GD8A 4WMCA 3HUOA 2XFTA 4WZ5A 2CC1A 3W8KA 3B3XA 5FASA 4PM5A 3HLDA 3FKVA 4X68A 3Q1FA 4B4XA 4GZBA 3UN7A 2XLNA 3FV7A 3G4PA 3M6HA 4IVIA 4U0XA 3PAEA 2A3UA 3BFDA 2XEPA 2QMIA 3OPHA 5FA7A 1FR6A 5F82A 1IKIA 1YLJA 2VGKA 2ZC7A 3ZG5A 4P87A 1L0DA 4QD4A 2WZZA 2WKHA 2Z2MB 2Y2MA 3NI9A 1I2WA 4JXGA 3A3DA 4X53A 2Y2PA 1BLPA 3UY6A 5DF7A 4GDBA 4NK3A 3A3FA 4PMAA 1XA1A 5TR7A 3UNWA 3ZG7B 1VQQA 4BLMA 5FAPA 2H5SA 3M2KA 4D2OA 1ESIA 3IWOA 3VP2A 4EBPA 3PTEA 1ZG6A 1YT4A 4BL3A 1XKZA 2ZM0A 4LENA 5F1GA 4JF5A 1MPLA 3ZCZA 2BG1A 4DXBA 3DWKA 4QY5A 2DRWA 4MLLA 3PBQA 2XDMA 1K4EA 1S0WA 3D4FA 1BULA 3N8RA 1PW8A 4B88A 3CMZA 3O88A 2ZQCA 5EE8A 4ZJ1A 3UO9A 1KGGA 1K54C 4KZ5A 5EUAA 5GHYA 1M40A 1CI8A 3ZVWA 2IWCA 3MZFA 1LL5A 3IT9A 4JPMA 3BFFA 4RX2A 1K54A 4WELA 4KZ4A 2ZM8A 3ISGA 4WEKA 4OVDA 1H8YA 1TVFA 3AGFA 5FAOA 3UDXA 5I94A 2R9WA 4Y0UA 2JBFA 4BENA 1K56D 4UA6A 1XPBA 2Q9MA 1GCEA 3LY4A 4IEDA 4DE3A 1BSGA 1OMEA 2OV5A 3UPPA 3VSLA 1MXOA 5GHZA 2XGNA 1H8ZA 1MWUA 2P9VB 2EX2A 5HAPA 1LHYA 3ZGAB 1H5XA 2G2UA 4KZ3A 1YMSA 2ZJ9A 3QHYA 5CTNA 3ZG9B 5E2HA 4S2PA 1FOFA 4OKPA 3RXXA 2HP5A 3N8SA 4PM6A 3ITAA 1WYBA 3UDFA 3AGDA 3PBSA 3VSKA 1ZKJA 5AQBA 4WBGA 3A3JA 4DE1A 4KQQA 3G32A 2WAEA 3VMAA 4K91A 4ZDXA 1G68A 4DRTA 3PAGA 3G2ZA 4KZAA 1IEMA 1WE4A 3M2JA 3OPLA 3VP1A 1JTGA 5CGWA 4N1HA 4PM7A 4HESA 3ZDJA 2XF3A 3MZDA 2GDNA 4MBHA 1Q2QA 5CTMA 4ZAMA 4DDYA 2P9VA 5M19A 3IXDA 3MBZA 3DW0A 4Y7PA 1Q2PA 3BLMA 4WZ4A 2Q9NA 2ZLYA 4EBLA 5EECA 3N6IA 1MWTA 4ZBEA 3Q82A 3IXGA 5GLBA 2IWDA 3IHAA 4LV1A 5HAIA 4R23A 1K6SA 2EFXA 1HD8A 2ZC6B 5FQJA 1RGYA 2EX9A 3OCNA 3WS4A 2HPBA 1SCWA 1IYSA 1CK3A 3GRJA 3GR2A 2EXBA 3GQZA 3OZHA 5J8XA 3SH8A 1IELA 4GB7A 2WK0A 4KZ6A 3IF6B 4S2OA 3BEBA 4UA7A 1RP5A 2Y2OA 2BLSA 1XP4A 3G34A 3VOZA 3P09A 1N9BA 2Y4AA 4DE2A 1KGFA 3Q7VB 1K4FA 3ZNYA 3C7VA 2ZC4B 4WZ5C 3SH7A 3V39A 2RL3A 5AQ7A 3A3EA 5HW3A 2IWBA 1GHIA 2XQZA 1U60A 4LCMA 1EWZA 4EBNA 4FH4A 4WYYA 2WUQA 5DF9A 5FI2A 3S4XA 3V3RA 5CRFA 5A90A 2X01A 3BECA 4X69A 1LI0A 1DJBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N1X A;  1FCM A;  1RGZ A;  2VGJ A;  2Y2Q A;  3VFH A;  4E3J A;  4QJG A;  2V20 A;  4K0W A;  2OLU A;  2Y59 A;  3IF6 A;  4IVK A;  4MBF A;  1SKF A;  2Y2H A;  2HP6 A;  3NY4 A;  3IF5 A;  1IYO A;  1ALQ A;  1JWV A;  3UE1 A;  1K56 A;  3LEZ A;  4XUX A;  3Q7V A;  4S2L A;  3CG5 A;  1CEG A;  1FCO A;  1W7F A;  3HLE A;  2A49 A;  4GNU A;  3WS0 A;  4R1G A;  3SS3 A;  5HAQ A;  3MKE A;  1IKG A;  4X6T A;  3W4Q A;  2EX6 A;  2Y55 A;  1GHM A;  4BD0 A;  3OCL A;  5GLC A;  4C75 A;  4F94 A;  5HL1 A;  4C3Q A;  2B5R A;  5DF8 A;  3BM6 A;  4UHU A;  4LV2 A;  5E2E A;  4LV3 A;  2Y2K A;  3ZFZ A;  4KG5 A;  4S2J A;  4XUZ A;  5E2F A;  4UAA A;  5KSC A;  4LCL A;  2H0T A;  4BJP A;  3IXH A;  4OH0 A;  4OOM A;  5FQ9 A;  3RJU A;  4QY6 A;  2WKE A;  4Y0O A;  1K57 C;  3I7J A;  1KDS A;  2ZQ7 A;  3FKW A;  1O07 A;  5EOO A;  5EVI D;  3VOY A;  3HLW A;  4JXS A;  2HP9 A;  1GHP A;  5M18 A;  1K57 A;  1FQG A;  1SDE A;  2PU2 A;  2R9X A;  1YLT A;  1PZO A;  1CEF A;  1NY0 A;  2DNS A;  3P98 A;  2Y91 A;  4FCF A;  1EI5 A;  1JTD A;  2ZC3 B;  4OQI A;  2H10 A;  4N9K A;  2JC7 A;  3PBO A;  4OLG A;  3C7U A;  4IBX A;  4OPZ A;  3BLS A;  4EQI A;  3V5M A;  1ES3 A;  4ZJ3 A;  3S22 A;  5D3O A;  1DJA A;  5FDH A;  5FAT A;  4GN2 A;  2X71 A;  3IQA A;  1I2S A;  2UWX A;  5FQI A;  2V2F F;  2XD5 A;  4P6B A;  3SS4 A;  1PW1 A;  4KQO A;  1C3B A;  5G18 A;  2Y2N A;  3GMW A;  3VP4 A;  4OQG A;  4B4Z A;  4E3L A;  1KE4 A;  1ES5 A;  1PI4 A;  1NYM A;  2J8Y A;  3VFF A;  2WZX A;  3M6B A;  2ZC5 B;  4HBT A;  4BD1 A;  1L2S A;  1JWZ A;  1JVJ A;  1MKI A;  4KZB A;  4CJN A;  4FD8 A;  1CI9 A;  4A5R A;  5CXW A;  3WWX A;  3NBL A;  3MXR A;  5DTS A;  4RA7 A;  2Y2J A;  4P85 A;  1K6R A;  3MFD A;  1PWG A;  3LO7 A;  2C6W B;  5HFO A;  3O87 A;  2ZQ8 A;  2EFU A;  1ERO A;  3EQV A;  5GL9 A;  1YM1 A;  1W79 A;  4IBR A;  3HVF A;  5CED A;  1TEM A;  4OOY A;  4JLF A;  3ZHH A;  1SDN A;  4KG6 A;  2G2W A;  1NZU A;  1PWC A;  1ZC2 A;  2ZQ9 A;  4H8R A;  4OPY A;  4DDS A;  1NYY A;  1BT5 A;  3IXB A;  2V1Z A;  1TDL A;  4WM9 A;  1WYC A;  3WS2 A;  2WAD A;  2WGV A;  3S1Y A;  4XXR A;  3UDI A;  5KMW A;  5KSH A;  5KZH A;  4GKU A;  2OSU A;  1I5Q A;  1RCJ A;  3Q81 A;  4QHC A;  3RXW A;  1QMF A;  5EVI B;  4GD6 A;  4S2N C;  4DF6 A;  5E43 A;  1XGI A;  3FYZ A;  2E8I A;  3G35 A;  4GDN A;  1DJC A;  5GHX A;  1L0E A;  5A91 A;  4E6X A;  4S2N A;  2WGI A;  4QB8 A;  5JYO A;  3W4O A;  5JYP A;  3TOI A;  3WS5 A;  5BOH A;  1FCN A;  3Q7Z A;  4KG2 A;  4KZ9 A;  5CGS A;  1HTZ A;  3O3V A;  1PYY A;  4KZ8 A;  4S2M A;  4PM9 A;  4JBF A;  5FAQ A;  2FFF B;  1BTL A;  3PBT A;  1PWD A;  2HDS A;  4K0X A;  4OON A;  5DTT A;  5EVI C;  1W8Y A;  4R4S A;  1G6A A;  5TGF A;  3LY3 A;  4U3T A;  5EVI A;  1LL9 A;  3PBR A;  5FQM A;  4R3B A;  1YQS A;  5FQQ A;  3V3S A;  4Q8I A;  2EXA A;  3NDG A;  3HL9 A;  2J9O A;  4JXV A;  1MBL A;  5CHM A;  3FWL A;  1LLB A;  5GLD A;  2ZQD A;  1KGE A;  4GOG A;  1K55 C;  3A3I A;  1ERQ A;  3CJM A;  3QNB A;  5CER A;  5TFQ A;  3CZD A;  1L0G A;  2JCH A;  1Z6F A;  3IHB A;  3V50 A;  1K55 A;  2FFY A;  1YLP A;  4BQM A;  3BYD A;  4KQR A;  4BL2 A;  4KEN B;  2Y2I A;  1KVL A;  5A92 A;  1KE3 A;  1FSW A;  2WAF A;  3OPR A;  4FH2 A;  1LI9 A;  2H0Y A;  3MKF A;  3SH9 A;  3ZVT A;  4E3N A;  3WS1 A;  5L2F A;  2HDU A;  4EV4 A;  1W8Q A;  1IYP A;  4X56 A;  5CEC A;  4MBK A;  4QU3 A;  4PPR A;  4PM8 A;  1E3U D;  3NC8 A;  5AQ9 A;  3HRE A;  4OQH A;  1ES4 A;  3GSG A;  4HEF A;  1YLY A;  3Q07 A;  4R0Q A;  2WKI A;  3N7W A;  4ID4 A;  3ZG0 A;  5HAR A;  3BFG A;  3SS5 A;  3E2L A;  4YIN A;  1E4D A;  3QNC A;  3PBN A;  4OPQ A;  5CGX A;  2QZ6 A;  1E25 A;  5EVL A;  4R3J A;  2HDQ A;  5EPH A;  3NDE A;  1GA9 A;  2C5W B;  4KZ7 A;  1MWR A;  1NRF A;  1QME A;  1XX2 A;  2Y2G A;  4MNR A;  4JKT A;  4ZJ2 A;  4UA9 A;  3WRT A;  1KDW A;  1KE0 A;  2OLV A;  4DKI A;  1ONH A;  4WMC D;  1XA7 A;  1MY8 A;  5FQK A;  4EWF A;  3DTM A;  4OP5 A;  4RVA A;  4DE0 A;  1ES2 A;  3G30 A;  1NXY A;  2ZQA A;  3BRM A;  2WGW B;  1BUE A;  3IH8 A;  3IH9 A;  1YLW A;  1AXB A;  1J9M A;  3N4I A;  3WRZ A;  5IHV A;  3IWQ A;  1IYQ A;  2I72 A;  2XK1 A;  4RX3 A;  4RYE A;  3MZE A;  3ZNT A;  3HLF A;  3EQU A;  4NET A;  4CPK A;  3ITB A;  2ZMA A;  1FSY A;  2JE5 A;  1VM1 A;  4N9L A;  5F1F A;  1YMX A;  3C4P A;  3OC2 A;  4LV0 A;  1ERM A;  4JXW A;  3UPN A;  3C5A A;  3JYI A;  3ZG8 B;  2PBY A;  2XH9 A;  5E2G A;  4FSF A;  4E3I A;  2XFS A;  3HLB A;  4MEZ A;  2RCX A;  1TDG A;  4ZTK A;  2WGW A;  1Y54 A;  2PU4 A;  4S2I A;  5GLA A;  5HX9 A;  4DXC A;  3C4O A;  1BLS A;  3AGE A;  3VP0 A;  4L0L A;  4E3K A;  2P74 A;  1XGJ A;  4OLD A;  4U0T A;  1YLZ A;  4OP8 A;  4E3O A;  1L0F A;  5M1A A;  4EUZ A;  1NJ4 A;  1XXM A;  3HLG A;  1HZO A;  5DTK A;  5AQA A;  5CEB A;  2DCF A;  4R4R A;  3G2Y A;  3HUM A;  5CHU A;  4YFM A;  4OPR A;  1MWS A;  1ONG A;  5FSR A;  1NZO A;  2Y2L A;  2Z2L B;  2ZD8 A;  1S6R A;  1BLC A;  5FI6 A;  1K38 A;  1PZP A;  1ZG4 A;  3GVB A;  3HBR A;  4JF4 A;  1ESU A;  3GTC A;  3IF6 C;  4P0M A;  3VP3 A;  3N8L A;  2QPN A;  4Z9Q A;  2EX8 A;  5CHJ A;  4X55 A;  2ZM2 A;  2X02 A;  1SHV A;  3GV9 A;  3HLC A;  2J7V A;  2WYX A;  3E2K A;  3MXS A;  4C6Y A;  3BFC A;  3BFE A;  3DWZ A;  3UE3 A;  1DY6 A;  1KVM A;  3NCK A;  3OPP A;  4N92 A;  4E3M A;  1GA0 A;  4HBU A;  3TG9 A;  1BZA A;  3IWI A;  4O7D A;  3TSG A;  3UE0 A;  4Y0T A;  3UPO A;  3G31 A;  5DVA A;  5A93 A;  1N4O A;  1E3U A;  4S2K A;  2XR0 A;  4M3K A;  1JWP A;  3FZC A;  4OQ0 A;  4OOL A;  1K25 A;  5F83 A;  3HUN A;  3W4P A;  3LCE A;  4WEJ A;  3NIA A;  1PI5 A;  2J9P A;  1PIO A;  5EOE A;  3SOI A;  1M6K A;  3O86 A;  5U47 A;  5FI7 A;  1HVB A;  2HDR A;  2XD1 A;  1W5D A;  4JF6 A;  4E6W A;  1FR1 A;  1O7E A;  1BLH A;  4GD8 A;  4WMC A;  3HUO A;  2XFT A;  4WZ5 A;  2CC1 A;  3W8K A;  3B3X A;  5FAS A;  4PM5 A;  3HLD A;  3FKV A;  4X68 A;  3Q1F A;  4B4X A;  4GZB A;  3UN7 A;  2XLN A;  3FV7 A;  3G4P A;  3M6H A;  4IVI A;  4U0X A;  3PAE A;  2A3U A;  3BFD A;  2XEP A;  2QMI A;  3OPH A;  5FA7 A;  1FR6 A;  5F82 A;  1IKI A;  1YLJ A;  2VGK A;  2ZC7 A;  3ZG5 A;  4P87 A;  1L0D A;  4QD4 A;  2WZZ A;  2WKH A;  2Z2M B;  2Y2M A;  3NI9 A;  1I2W A;  4JXG A;  3A3D A;  4X53 A;  2Y2P A;  1BLP A;  3UY6 A;  5DF7 A;  4GDB A;  4NK3 A;  3A3F A;  4PMA A;  1XA1 A;  5TR7 A;  3UNW A;  3ZG7 B;  1VQQ A;  4BLM A;  5FAP A;  2H5S A;  3M2K A;  4D2O A;  1ESI A;  3IWO A;  3VP2 A;  4EBP A;  3PTE A;  1ZG6 A;  1YT4 A;  4BL3 A;  1XKZ A;  2ZM0 A;  4LEN A;  5F1G A;  4JF5 A;  1MPL A;  3ZCZ A;  2BG1 A;  4DXB A;  3DWK A;  4QY5 A;  2DRW A;  4MLL A;  3PBQ A;  2XDM A;  1K4E A;  1S0W A;  3D4F A;  1BUL A;  3N8R A;  1PW8 A;  4B88 A;  3CMZ A;  3O88 A;  2ZQC A;  5EE8 A;  4ZJ1 A;  3UO9 A;  1KGG A;  1K54 C;  4KZ5 A;  5EUA A;  5GHY A;  1M40 A;  1CI8 A;  3ZVW A;  2IWC A;  3MZF A;  1LL5 A;  3IT9 A;  4JPM A;  3BFF A;  4RX2 A;  1K54 A;  4WEL A;  4KZ4 A;  2ZM8 A;  3ISG A;  4WEK A;  4OVD A;  1H8Y A;  1TVF A;  3AGF A;  5FAO A;  3UDX A;  5I94 A;  2R9W A;  4Y0U A;  2JBF A;  4BEN A;  1K56 D;  4UA6 A;  1XPB A;  2Q9M A;  1GCE A;  3LY4 A;  4IED A;  4DE3 A;  1BSG A;  1OME A;  2OV5 A;  3UPP A;  3VSL A;  1MXO A;  5GHZ A;  2XGN A;  1H8Z A;  1MWU A;  2P9V B;  2EX2 A;  5HAP A;  1LHY A;  3ZGA B;  1H5X A;  2G2U A;  4KZ3 A;  1YMS A;  2ZJ9 A;  3QHY A;  5CTN A;  3ZG9 B;  5E2H A;  4S2P A;  1FOF A;  4OKP A;  3RXX A;  2HP5 A;  3N8S A;  4PM6 A;  3ITA A;  1WYB A;  3UDF A;  3AGD A;  3PBS A;  3VSK A;  1ZKJ A;  5AQB A;  4WBG A;  3A3J A;  4DE1 A;  4KQQ A;  3G32 A;  2WAE A;  3VMA A;  4K91 A;  4ZDX A;  1G68 A;  4DRT A;  3PAG A;  3G2Z A;  4KZA A;  1IEM A;  1WE4 A;  3M2J A;  3OPL A;  3VP1 A;  1JTG A;  5CGW A;  4N1H A;  4PM7 A;  4HES A;  3ZDJ A;  2XF3 A;  3MZD A;  2GDN A;  4MBH A;  1Q2Q A;  5CTM A;  4ZAM A;  4DDY A;  2P9V A;  5M19 A;  3IXD A;  3MBZ A;  3DW0 A;  4Y7P A;  1Q2P A;  3BLM A;  4WZ4 A;  2Q9N A;  2ZLY A;  4EBL A;  5EEC A;  3N6I A;  1MWT A;  4ZBE A;  3Q82 A;  3IXG A;  5GLB A;  2IWD A;  3IHA A;  4LV1 A;  5HAI A;  4R23 A;  1K6S A;  2EFX A;  1HD8 A;  2ZC6 B;  5FQJ A;  1RGY A;  2EX9 A;  3OCN A;  3WS4 A;  2HPB A;  1SCW A;  1IYS A;  1CK3 A;  3GRJ A;  3GR2 A;  2EXB A;  3GQZ A;  3OZH A;  5J8X A;  3SH8 A;  1IEL A;  4GB7 A;  2WK0 A;  4KZ6 A;  3IF6 B;  4S2O A;  3BEB A;  4UA7 A;  1RP5 A;  2Y2O A;  2BLS A;  1XP4 A;  3G34 A;  3VOZ A;  3P09 A;  1N9B A;  2Y4A A;  4DE2 A;  1KGF A;  3Q7V B;  1K4F A;  3ZNY A;  3C7V A;  2ZC4 B;  4WZ5 C;  3SH7 A;  3V39 A;  2RL3 A;  5AQ7 A;  3A3E A;  5HW3 A;  2IWB A;  1GHI A;  2XQZ A;  1U60 A;  4LCM A;  1EWZ A;  4EBN A;  4FH4 A;  4WYY A;  2WUQ A;  5DF9 A;  5FI2 A;  3S4X A;  3V3R A;  5CRF A;  5A90 A;  2X01 A;  3BEC A;  4X69 A;  1LI0 A;  1DJB A; 
#chains in the Genus database with same CATH topology
 4WLA A;  2W1T B;  4MDZ A;  2J80 A;  3UB5 P;  1PFL A;  4IVK A;  1D1J A;  4MBF A;  1ZHH B;  1IYO A;  1JWV A;  3UE1 A;  1K56 A;  3LEZ A;  4EES A;  3Q7V A;  4EEU A;  3WS0 A;  5HAQ A;  1IKG A;  4LRZ E;  1T1B A;  3CIT A;  4F94 A;  5HL1 A;  3KSF A;  4LV3 A;  3ZFZ A;  2W1T A;  4FOF A;  4XUZ A;  3JVU A;  4UAA A;  3IXH A;  5F69 A;  4QY6 A;  2WKE A;  3I7J A;  3FKW A;  5EOO A;  3VOY A;  3HLW A;  1GHP A;  1NLY A;  1N9N A;  2R78 A;  3T4K A;  4I38 A;  4FCF A;  1EI5 A;  1JTD A;  5HWT A;  1MC0 A;  3DTK A;  4EQI A;  5D3O A;  3LR0 A;  5FDH A;  5HWW A;  4I39 A;  5DFX A;  1I2S A;  2V2F F;  2B95 A;  2XD5 A;  1DP9 A;  4MN5 A;  2MJ6 A;  3GMW A;  4QWO A;  2WZX A;  4EQ1 A;  3M6B A;  4HBT A;  1CI9 A;  1OT6 A;  3MXR A;  5DTS A;  2Y2J A;  1N9O A;  3LO7 A;  2FZ0 A;  2CMN A;  2PR5 A;  2ZBB A;  4IBR A;  4DN0 A;  1T1A A;  1TEM A;  1HLU P;  3KYQ A;  4OOY A;  3ZHH A;  1SDN A;  4KG6 A;  5IS1 A;  2G2W A;  1NZU A;  4H8R A;  2ZQ9 A;  5KZH A;  3S1Y A;  3JVV A;  5KSH A;  5AVE A;  4EW7 A;  1RCJ A;  5AJG A;  3RXW A;  4ARZ A;  4GD6 A;  4GW9 A;  4DF6 A;  4ESP A;  1XGI A;  1XJ4 A;  1A0K A;  3F1O B;  3S7N A;  1DJC A;  2V1B A;  1L0E A;  5A91 A;  4YWZ A;  5JYO A;  4DMZ A;  2WKR A;  3TOI A;  3Q7Z A;  3VV4 A;  5CGS A;  3O3V A;  4EET B;  4JBF A;  3PBT A;  2HDS A;  3NJA A;  2L0W A;  1XFN A;  1GSW A;  3VE3 A;  1W8Y A;  1G6A A;  4U3T A;  5FQM A;  5FQQ A;  2GX5 A;  3F1O A;  2EXA A;  3MFX A;  1MBL A;  4EER A;  3FWL A;  1LLB A;  5TBM B;  4GOG A;  1K55 C;  2JKG A;  3CJM A;  3V50 A;  2FFY A;  4BQM A;  5HSQ A;  4ETX A;  4PHT A;  4KEN B;  5A8B A;  1T1C A;  1KE3 A;  3K3C A;  4FH2 A;  2W27 A;  3KSG A;  3MKF A;  3ZVT A;  4E3N A;  4AFI A;  4MBK A;  5AQ9 A;  1E3U D;  4OQH A;  3BQ8 A;  2PYP A;  3ZG0 A;  4ID4 A;  2GZA A;  3SS5 A;  5TBM A;  5L8M A;  4R3J A;  4I3J A;  2C5W B;  1QME A;  1NRF A;  1BYW A;  1KDW A;  2OLV A;  2QJ5 A;  1IOU A;  5HDS A;  3CWF A;  5FQK A;  3B42 A;  1ES2 A;  3G30 A;  1NXY A;  2AVX A;  2H28 A;  5FEG A;  3IH9 A;  1J9M A;  3N4I A;  3QP6 A;  5IHV A;  1TF1 A;  3IWQ A;  4ME4 A;  4HJ4 A;  3BY8 A;  1N9L A;  1FSY A;  2QHK A;  2A2L A;  3C4P A;  4NXB A;  1ERM A;  2PBY A;  2P7J A;  2V9A A;  1OJ5 A;  1TS8 A;  2PR6 A;  3ICY A;  5EM0 A;  3A0V A;  3VP0 A;  4L0L A;  5HD5 A;  2VLG A;  2P74 A;  4U0T A;  3D9Y A;  3NOT C;  1XXM A;  2KDK A;  5DTK A;  2DCF A;  5K5B A;  2XRN A;  4HIA A;  1MWS A;  3LIA A;  4CLC C;  2Z2L B;  1OJG A;  1K38 A;  5IU1 A;  3GVB A;  4QPR A;  3N8L A;  5CHJ A;  5DJT A;  4X55 A;  2ZM2 A;  2ZL1 B;  3H82 B;  3S7O A;  2Y79 A;  3BFC A;  3OPP A;  4Y3I A;  4HBU A;  1LL8 A;  3UPO A;  4MN6 A;  1E3U A;  3LR5 A;  4M3K A;  4OOL A;  3S7Q A;  3LCE A;  1PI5 A;  1M6K A;  3MQ0 A;  2Q0O A;  2BAS A;  1NRJ A;  4GD8 A;  2ZL1 A;  4WZ5 A;  3H82 A;  3B3X A;  1TS6 A;  5EFW A;  5HWV A;  3Q1F A;  4GZB A;  4EUV A;  5FA7 A;  4R6L A;  1YLJ A;  2VGK A;  1VB6 A;  4JGO A;  1I2W A;  2Y2P A;  3UY6 A;  4GS9 B;  2P04 A;  3UB8 A;  5FAP A;  2H5S A;  4EBP A;  5L10 A;  3HCY A;  1XKZ A;  5F1G A;  4HP9 A;  4QY5 A;  2DRW A;  2XDM A;  3LUQ A;  3UMD A;  4HOI A;  5FL3 A;  4B88 A;  2ZQC A;  2Y8H A;  1LSX A;  5GHY A;  5EUA A;  4GS9 A;  3MS6 A;  4WEL A;  4WEK A;  4OVD A;  5FAO A;  2R9W A;  2JBF A;  1LSW A;  4BBV A;  4DE3 A;  1OME A;  2OV5 A;  3QP4 A;  1MXO A;  3U2A A;  5HAP A;  3ZG9 B;  3QHY A;  4MN7 A;  5E2H A;  4OKP A;  3N8S A;  2GNX A;  3ITA A;  1WYB A;  3UDF A;  3VSK A;  5AQB A;  1WA9 A;  3G32 A;  4ZDX A;  4KZA A;  1IEM A;  3OPL A;  4N1H A;  4HES A;  5CTM A;  4ZAM A;  4MBH A;  4Q0I A;  1Q2P A;  3BLM A;  2JKR I;  4Q0J A;  4EBL A;  2L1M A;  3QP8 A;  5HL6 A;  3IHA A;  5HAI A;  1K6S A;  3OCN A;  3WS4 A;  4CQH A;  1IYS A;  3GRJ A;  3LEQ A;  2Z6C A;  3SH8 A;  4GB7 A;  4UA7 A;  2J3T D;  2Y2O A;  1OTA A;  3DBA A;  3P09 A;  1N9B A;  3K2N A;  4PAU A;  3ZNY A;  3C7V A;  2ZC4 B;  4Q0H A;  2RL3 A;  5AQ7 A;  3IX3 A;  3A3E A;  2JKR M;  1GHI A;  5EV0 A;  1D06 A;  1EWZ A;  4WYY A;  5A90 A;  4O8G A;  3LR3 A;  1LI0 A;  1DJB A;  1FCM A;  2Y2Q A;  2O9A A;  5HDC A;  2V20 A;  4K0W A;  2OLU A;  3OOV A;  1ODV A;  2HP6 A;  3IX8 A;  4Y2F A;  4KUO A;  4YNR A;  4XUX A;  3PXP A;  3SW1 A;  1W7F A;  3HLE A;  4GNU A;  4R1G A;  3MKE A;  4X6T A;  3W4Q A;  2EX6 A;  4BD0 A;  3H7W A;  4C75 A;  5DF8 A;  4UHU A;  4LV2 A;  4OH0 A;  3E4O A;  4Y0O A;  2ZQ7 A;  1O07 A;  2HP9 A;  4BBU A;  1K57 A;  4RQ9 A;  4HP4 A;  2PU2 A;  2Z6D A;  1PZO A;  2DNS A;  3S7P A;  1XFQ A;  3SZT A;  3OLO A;  5EVE A;  4N9K A;  2JC7 A;  3PBO A;  1T18 A;  3BLS A;  1ES3 A;  4ZJ3 A;  1K0K A;  4GN2 A;  2X71 A;  2UWX A;  1G28 A;  4P6B A;  1PW1 A;  4KQO A;  4E3L A;  3TE8 A;  4OQG A;  5L09 A;  1ES5 A;  2PHY A;  3VFF A;  1JWZ A;  4RA7 A;  1K6R A;  3MFD A;  1PWG A;  4I5S A;  2C6W B;  5HFO A;  3T4L A;  2EFU A;  3EQV A;  2O0Y A;  3W2Z A;  1YKD A;  1PWC A;  1ZC2 A;  4H6J B;  3E4Q A;  3IXB A;  1TDL A;  3WS2 A;  2WGV A;  3UDI A;  4XXR A;  4GKU A;  1I5Q A;  3Q81 A;  5HZH A;  4MMN A;  2E8I A;  3TRC A;  3W4O A;  4I3I A;  5JYP A;  4HJ6 A;  2NUT C;  1NWZ A;  2OAP 1;  2K2N A;  4KG2 A;  1HTZ A;  1PYY A;  5FAQ A;  1BTL A;  4WL9 A;  4OON A;  5DTT A;  2WKQ A;  4GCZ A;  4R4S A;  5TGF A;  3C2W A;  1OTE A;  1OTI A;  3OBF A;  1YSP A;  2KOI A;  1P97 A;  2J3W A;  5GLD A;  3A3I A;  1ERQ A;  3FPV A;  3CZD A;  1JNU A;  3IHB A;  1CF0 A;  5A92 A;  3MR0 A;  3PHY A;  3OPR A;  1S4S A;  1W8Q A;  2IA2 A;  1ZTU A;  1STZ A;  4PPR A;  3NC8 A;  3NOP C;  1YLY A;  4R0Q A;  3BFG A;  2O9B A;  3MMH A;  4R3A A;  5CGX A;  5C5K A;  5EPH A;  3NDE A;  1XX2 A;  2Y2G A;  4JKT A;  4DKI A;  3BRM A;  3IH8 A;  2HGV A;  5HPF A;  1AXB A;  2QWS A;  2XK1 A;  2W1R A;  3T12 B;  3MZE A;  3LIF A;  4JGR A;  4NET A;  4DJ2 A;  2VX8 A;  4R38 A;  1PNE A;  3KSI A;  3LFV A;  5F1F A;  1YMX A;  3OC2 A;  4LV0 A;  3EWK A;  4ARZ B;  4Y17 A;  2PD7 A;  3ZG8 B;  2XH9 A;  5E2G A;  2XFS A;  3HLB A;  4ZTK A;  3L7H A;  3NUL A;  3MJQ A;  2PU4 A;  4S2I A;  2M7V A;  4DXC A;  3C4O A;  4GJ4 A;  3AGE A;  1YLZ A;  4OP8 A;  4E3O A;  1L0F A;  1NJ4 A;  5AQA A;  2D01 A;  2WKP A;  4YFM A;  2XA7 M;  3PYP A;  2ZD8 A;  3UB6 A;  5FI6 A;  1ZG4 A;  1PZP A;  4P0M A;  3GTC A;  4X1L A;  2V1A A;  2QPN A;  3T1Q B;  5KIZ A;  2EA9 A;  3HLC A;  2J7V A;  2WYX A;  3MXS A;  4C6Y A;  3BFE A;  5DKL A;  4E3M A;  3TG9 A;  1BZA A;  3TSG A;  5A93 A;  1N4O A;  2ACG A;  1S1Y A;  1T19 A;  2BTF P;  5F83 A;  2ZOI A;  3EEA A;  1PIO A;  1HVB A;  2HDR A;  4JF6 A;  1W5D A;  4G3V A;  1BLH A;  2CC1 A;  3W8K A;  2VKS A;  4X68 A;  4U0X A;  3PAE A;  1UWP X;  4UQI M;  1L0D A;  1VET B;  4QD4 A;  5DF7 A;  4NK3 A;  4PMA A;  3UNW A;  5TR7 A;  1W63 M;  4FTX A;  3DTI A;  4D2O A;  1ESI A;  1YT4 A;  3R4K A;  4LEN A;  4HQA A;  1MPL A;  2OWH A;  4Q8I A;  1PW8 A;  4II7 A;  2PD8 A;  3CMZ A;  3MXQ A;  1VET A;  1KGG A;  1YSQ A;  5HPI A;  1M40 A;  1CI8 A;  3KSH A;  3MZF A;  2VEA A;  4JPM A;  2ZM8 A;  3ISG A;  1TVF A;  4BEN A;  1OT9 A;  2Q9M A;  4IED A;  3VSL A;  5GHZ A;  2XGN A;  1MWU A;  2P9V B;  2EX2 A;  4S2P A;  4JGP A;  4PM6 A;  3IX4 A;  4HY8 A;  3AGD A;  1ZKJ A;  2OOL A;  4I3A A;  2PT7 A;  2WAE A;  5FEF A;  4K91 A;  3P01 A;  1G68 A;  4WN5 A;  3PAG A;  1WE4 A;  3M2J A;  5CGW A;  4PM7 A;  3ZDJ A;  4DDY A;  2P9V A;  3DW0 A;  3EEH A;  4Y7P A;  4O01 A;  2Q9N A;  3TW8 A;  3UB7 A;  5EEC A;  4DJ3 A;  3BQA A;  4PKY G;  4NG2 A;  3IXG A;  5GLB A;  2LB5 A;  1S67 L;  2K7S A;  4PKY A;  2G7U A;  1CK3 A;  2PRF A;  3GR2 A;  1CJF A;  3GQZ A;  3OZH A;  1P0Z A;  2WK0 A;  1MKM A;  3IF6 B;  5J3W A;  3BEB A;  2BLS A;  3LIB A;  3QP5 A;  2Y4A A;  4DE2 A;  3QP1 A;  3CUE A;  5HW3 A;  4LCM A;  5DF9 A;  3V3R A;  2X01 A;  3H9W A;  4NKP A;  3IF6 A;  2VJW A;  2Y2H A;  3NY4 A;  3IF5 A;  4GHI B;  1FCO A;  2A49 A;  3SS3 A;  2W0N A;  3C30 A;  4Y13 A;  2QJ7 A;  2Y55 A;  4B9O A;  5GLC A;  3BM6 A;  5E2E A;  1F98 A;  2Y2K A;  5E2F A;  4LCL A;  2H0T A;  1XJ2 A;  4BJP A;  3RJU A;  1K57 C;  1KDS A;  5EVI D;  3ZYT A;  3MQQ A;  2R9X A;  2JN7 A;  4GHI A;  1CEF A;  1NY0 A;  1S1Z A;  1D7E A;  3BW6 A;  2ZC3 B;  1XJ3 A;  3BWL A;  4OPZ A;  3IQA A;  5FQI A;  3T1S A;  2PBD P;  5G18 A;  3VP4 A;  4B4Z A;  2J8Y A;  4FUW A;  2VZW A;  4KZB A;  4A5R A;  3LI8 A;  4B93 A;  1GSX A;  2B18 A;  3O87 A;  1YM1 A;  1W79 A;  2M1C A;  3T1R A;  3HVF A;  4JLF A;  4EXO A;  4L9E A;  4DDS A;  2V1Z A;  4WM9 A;  1WYC A;  5KMW A;  1F2K A;  4IHQ A;  5EVI B;  3FYZ A;  1YAX A;  3G35 A;  5GHX A;  4E6X A;  4S2N A;  2WGI A;  4QB8 A;  1W63 Q;  1Z09 A;  5DJU A;  5J7E A;  1FCN A;  1MZU A;  2HV1 A;  4KZ8 A;  5CX7 A;  2FFF B;  5TJJ A;  3B47 A;  1Y28 A;  4X25 A;  3ZQ5 A;  2K31 A;  3H7W B;  2A24 B;  4UQI S;  3U4L P;  5EVI A;  1LL9 A;  1YQS A;  3V3S A;  3T50 A;  2J9O A;  4LRY C;  3L9K A;  4HH2 A;  2ZQD A;  1KGE A;  4HNB A;  3BYD A;  4KQR A;  4BL2 A;  2VV8 A;  1KVL A;  4R70 A;  3EGX C;  2A24 A;  1LI9 A;  3SH9 A;  1H0M A;  2HDU A;  4EV4 A;  3T4J A;  5CEC A;  1DP8 A;  4QU3 A;  4PM8 A;  3HRE A;  1ES4 A;  3GSG A;  2PAV P;  2WKI A;  3HJK A;  3RTY A;  5HAR A;  2YKF A;  3E2L A;  1P9R A;  4YIN A;  2HDQ A;  3IBJ A;  1MWR A;  4MNR A;  4ZJ2 A;  3LYX A;  1H8M A;  4WMC D;  1MY8 A;  4EWF A;  4OP5 A;  4DE0 A;  2ZQA A;  4LFU A;  3MQO A;  4RX3 A;  2I72 A;  3R7W B;  4RYE A;  3HLF A;  4F3L A;  4CPK A;  2ZMA A;  4N9L A;  3CHW P;  5I5L A;  4BWI A;  4JXW A;  4NXE A;  3C5A A;  3JYI A;  3MSH A;  3CI6 A;  4FSF A;  4E3I A;  4Y5F A;  2RCX A;  1TDG A;  4Y15 A;  5GLA A;  5HX9 A;  1BLS A;  3R7W A;  4E3K A;  4OLD A;  1TS0 A;  2E8J A;  5M1A A;  1V9Z A;  1HZO A;  5CEB A;  4R4R A;  3G2Y A;  3HUM A;  4OPR A;  2QYB A;  3FPW A;  1NZO A;  2Y2L A;  3HBR A;  1ESU A;  3VP3 A;  2O9C A;  4WUJ A;  2EX8 A;  1SHV A;  3GV9 A;  3T4S A;  3E2K A;  2VV7 A;  3DWZ A;  3UE3 A;  3NCK A;  3C8C A;  3UE0 A;  4O7D A;  3G31 A;  5DVA A;  3DTE A;  3NEC A;  4S2K A;  4UEY A;  2VK3 A;  5G4Z A;  3FZC A;  4OQ0 A;  1K25 A;  3W4P A;  5EOE A;  3SOI A;  3O5Y A;  5U47 A;  1O7E A;  4WMC A;  2XFT A;  4LPZ A;  5FAS A;  4PM5 A;  3HLD A;  2L4R A;  1S66 L;  4B4X A;  3FV7 A;  3M6H A;  4LRX C;  2A3U A;  3BFD A;  2ZOH A;  4MCW A;  5F82 A;  3ZG5 A;  1V9Y A;  2WZZ A;  2Z2M B;  2Y2M A;  3NI9 A;  4JXG A;  4X53 A;  3A3D A;  2W3G A;  2HJE A;  3ZG7 B;  3A3F A;  4BLM A;  4HI4 A;  3IWO A;  4BL3 A;  1F9I A;  3DWK A;  4MLL A;  1K4E A;  3D4F A;  5EE8 A;  4ZJ1 A;  3UO9 A;  2ZMV A;  4KZ5 A;  4BMW A;  2IWC A;  1LL5 A;  1K54 A;  4KZ4 A;  3LIC A;  3AGF A;  3UDX A;  2PDR A;  1KOU A;  4UA6 A;  1XPB A;  3LY4 A;  1BSG A;  3UPP A;  1YPR A;  1LHY A;  3ZGA B;  2OAQ 1;  1H5X A;  2G2U A;  1YMS A;  2ZJ9 A;  1FOF A;  3PBS A;  3A3J A;  4DE1 A;  3D72 A;  4KQQ A;  5L07 A;  1PRQ A;  3VMA A;  4DRT A;  1VEU B;  2XF3 A;  3MZD A;  2GDN A;  3QP2 A;  1Q2Q A;  5M19 A;  3EGD C;  3CAX A;  4WZ4 A;  5HD3 A;  1L3L A;  2ZLY A;  3N6I A;  4ZBE A;  3Q82 A;  1F5M A;  4R23 A;  1HD8 A;  2ZC6 B;  1RGY A;  2HPB A;  2EXB A;  4NXF A;  3RH8 B;  4WF0 A;  1VEU A;  1IEL A;  2D02 A;  4KZ6 A;  4S2O A;  3UME A;  3VOZ A;  3CUE C;  2P08 A;  4KUK A;  1KGF A;  1SKO B;  2O99 A;  4K08 A;  4WZ5 C;  3SH7 A;  3V39 A;  3LGO A;  3IBR A;  1EW0 A;  4HJ3 A;  4EBN A;  4E04 A;  2WUQ A;  3S4X A;  2VGL M;  3BEC A;  4X69 A;  5F68 A;  3IF6 C;  3CLO A;  4N1X A;  4QJG A;  1RGZ A;  2VGJ A;  4LLO B;  3VFH A;  4E3J A;  5DFY A;  2Y59 A;  1DP6 A;  3EOI A;  1SKF A;  5F5Y A;  3T4T A;  1ALQ A;  4Z1W A;  1SKO A;  4S2L A;  3CG5 A;  1CEG A;  2UV0 E;  2ZMF A;  3RFB A;  4X1M A;  1GHM A;  2KLI A;  3OCL A;  4IUK A;  4C3Q A;  2B5R A;  2XRO A;  4KG5 A;  4S2J A;  5KSC A;  1OTD A;  2OWJ A;  4OOM A;  5FQ9 A;  4KQD A;  4JGQ A;  3ULF A;  1J3W A;  4JXS A;  5M18 A;  4D60 A;  4G3K A;  1FQG A;  1SDE A;  1YLT A;  3P98 A;  3MF0 A;  2Y91 A;  3T4Q A;  4OQI A;  2H10 A;  2W3E A;  4OLG A;  3C7U A;  2B02 A;  4HH3 A;  4IBX A;  3V5M A;  1IFQ A;  3S22 A;  1DJA A;  4NEE D;  5FAT A;  3UE6 A;  3SS4 A;  1C3B A;  4BBT A;  2Y2N A;  1KE4 A;  1PI4 A;  1NYM A;  3IS2 B;  2ZC5 B;  3LIE A;  3CPT B;  4BD1 A;  1L2S A;  1SZV A;  4G3W A;  1JVJ A;  1MKI A;  4CJN A;  4FD8 A;  5CXW A;  3WWX A;  3NBL A;  4P85 A;  2ZQ8 A;  1ERO A;  5GL9 A;  4O0P A;  3E98 A;  4EEP A;  5CED A;  3KYZ A;  2HF6 A;  4OPY A;  1NYY A;  1BT5 A;  2EWW A;  2WAD A;  3IS2 A;  2OSU A;  4QHC A;  3CPT A;  1QMF A;  4S2N C;  2M7U A;  5E43 A;  3C38 A;  4GDN A;  5HDD A;  1P9W A;  3WS5 A;  5BOH A;  4KZ9 A;  4S2M A;  4PM9 A;  1PWD A;  4K0X A;  5EVI C;  1NLZ A;  2GJ3 A;  1OPX A;  3LY3 A;  3PBR A;  3LI9 A;  4R3B A;  3E0Y A;  3NDG A;  3HL9 A;  4JXV A;  5CHM A;  3FC7 A;  3QNB A;  5CER A;  4P6Z M;  5TFQ A;  3T1X A;  1L0G A;  2JCH A;  1Z6F A;  1AWI A;  4HHD A;  2W3D A;  4CLC D;  1K55 A;  1YLP A;  2Y2I A;  3BY9 A;  2YKH A;  2W3F A;  1FSW A;  2WAF A;  2H0Y A;  1CQA A;  3WS1 A;  5L2F A;  1IYP A;  4X56 A;  1DRM A;  4HEF A;  3Q07 A;  5EM1 A;  1VHM A;  3N7W A;  4CLC E;  1LSV A;  1E4D A;  3QNC A;  3PBN A;  4OPQ A;  5J4E A;  1XJ6 A;  2QZ6 A;  1E25 A;  5EVL A;  4EU0 A;  4GLQ A;  1GA9 A;  4KZ7 A;  4UA9 A;  3WRT A;  1KE0 A;  1ONH A;  1XA7 A;  2JHE A;  3DTM A;  4RVA A;  3K3D A;  2WGW B;  5FDS A;  1BUE A;  2XSS A;  1YLW A;  3WRZ A;  1OTB A;  1IYQ A;  2V0U A;  1TS7 A;  3ZNT A;  4IJG A;  3EQU A;  3E4P A;  3ITB A;  2J3T C;  1VM1 A;  2JE5 A;  3KYE A;  1TD5 A;  2DMW A;  2QKP A;  3UPN A;  2XA7 S;  4MEZ A;  4CLC B;  2WGW A;  1Y54 A;  4ETZ A;  5LBR A;  2JKT I;  1XGJ A;  3UB9 A;  4EUZ A;  3HLG A;  2V0W A;  1LT0 A;  5CHU A;  2I9V A;  5F6A A;  1ONG A;  5FSR A;  4ZRR A;  1S6R A;  1BLC A;  1X0O A;  4JF4 A;  4CLC A;  4Z9Q A;  1H3Q A;  2X02 A;  2VV6 A;  3LR4 A;  3GEC A;  1DY6 A;  1KVM A;  4N92 A;  2VGL S;  1GA0 A;  3LID A;  3IWI A;  4Y0T A;  2JKT M;  2XR0 A;  3PR6 A;  4XT2 B;  1JWP A;  4L9G A;  3A0R A;  3HUN A;  1UGU A;  1G6O A;  4WEJ A;  3NIA A;  2J9P A;  3O86 A;  5FI7 A;  2XD1 A;  4E6W A;  1FR1 A;  3KO6 A;  3HUO A;  3D3O A;  2HZ5 A;  3P7N A;  3FKV A;  3F1P B;  3UN7 A;  2XLN A;  3G4P A;  4IVI A;  3VE4 A;  2XEP A;  2QMI A;  3OPH A;  1FR6 A;  3A0S A;  4XT2 A;  1IKI A;  2ZC7 A;  4P87 A;  2WKH A;  1GSV A;  4L9F A;  1BLP A;  4GDB A;  1XA1 A;  1VQQ A;  2HJ9 C;  4F3L B;  3M2K A;  3VP2 A;  3PTE A;  4LGW A;  1ZG6 A;  2ZM0 A;  4JF5 A;  4M4X A;  3ZCZ A;  2BG1 A;  3F1P A;  2V8C A;  4DXB A;  3PBQ A;  1S0W A;  3NOU C;  1BUL A;  3N8R A;  3T4O A;  3O88 A;  1K54 C;  3ZVW A;  5DKK A;  5G4Y A;  3IT9 A;  3BFF A;  4RX2 A;  1H8Y A;  5I94 A;  4Y0U A;  1K56 D;  1GCE A;  3G6O A;  4IUH A;  4NXG A;  1H8Z A;  4KZ3 A;  5CTN A;  2JKF A;  2HP5 A;  3RXX A;  4WBG A;  1FIL A;  1G5U A;  3TJZ C;  2FH5 A;  3G2Z A;  2PYR A;  3VP1 A;  5AVF A;  3B33 A;  1JTG A;  5MC7 A;  2EWV A;  3IXD A;  3MBZ A;  2LB9 A;  3F1N B;  1MWT A;  3GDI A;  2VA0 A;  1FIK A;  3JPU A;  3V67 A;  2IWD A;  4LV1 A;  1Y4O A;  2EFX A;  3FG8 A;  3HJI A;  5FQJ A;  2EX9 A;  1SCW A;  3VOL A;  2NUP C;  2W3H A;  1S4R A;  3DAV A;  5J8X A;  2INW A;  1RP5 A;  1XP4 A;  3G34 A;  4YOF A;  3F1N A;  3Q7V B;  1K4F A;  4P6Z S;  2V8F A;  3NHQ A;  2IWB A;  2XQZ A;  1U60 A;  4FH4 A;  5FI2 A;  4H6J A;  1ACF A;  1UWN X;  2KX6 A;  3BJN A;  3KX0 X;  5CRF A;  5IT5 A; 
#chains in the Genus database with same CATH homology
 4N1X A;  1FCM A;  1RGZ A;  2VGJ A;  2Y2Q A;  3VFH A;  4E3J A;  4QJG A;  2V20 A;  4K0W A;  2OLU A;  2Y59 A;  3IF6 A;  4IVK A;  4MBF A;  1SKF A;  2Y2H A;  2HP6 A;  3NY4 A;  3IF5 A;  1IYO A;  1ALQ A;  1JWV A;  3UE1 A;  1K56 A;  3LEZ A;  4XUX A;  3Q7V A;  4S2L A;  3CG5 A;  1CEG A;  1FCO A;  1W7F A;  3HLE A;  2A49 A;  4GNU A;  3WS0 A;  4R1G A;  3SS3 A;  5HAQ A;  3MKE A;  1IKG A;  4X6T A;  3W4Q A;  2EX6 A;  2Y55 A;  1GHM A;  4BD0 A;  3OCL A;  5GLC A;  4C75 A;  4F94 A;  5HL1 A;  4C3Q A;  2B5R A;  5DF8 A;  3BM6 A;  4UHU A;  4LV2 A;  5E2E A;  4LV3 A;  2Y2K A;  3ZFZ A;  4KG5 A;  4S2J A;  4XUZ A;  5E2F A;  4UAA A;  5KSC A;  4LCL A;  2H0T A;  4BJP A;  3IXH A;  4OH0 A;  4OOM A;  5FQ9 A;  3RJU A;  4QY6 A;  2WKE A;  4Y0O A;  1K57 C;  3I7J A;  1KDS A;  2ZQ7 A;  3FKW A;  1O07 A;  5EOO A;  5EVI D;  3VOY A;  3HLW A;  4JXS A;  2HP9 A;  1GHP A;  5M18 A;  1K57 A;  1FQG A;  1SDE A;  2PU2 A;  2R9X A;  1YLT A;  1PZO A;  1CEF A;  1NY0 A;  2DNS A;  3P98 A;  2Y91 A;  4FCF A;  1EI5 A;  1JTD A;  2ZC3 B;  4OQI A;  2H10 A;  4N9K A;  2JC7 A;  3PBO A;  4OLG A;  3C7U A;  4IBX A;  4OPZ A;  3BLS A;  4EQI A;  3V5M A;  1ES3 A;  4ZJ3 A;  3S22 A;  5D3O A;  1DJA A;  5FDH A;  5FAT A;  4GN2 A;  2X71 A;  3IQA A;  1I2S A;  2UWX A;  5FQI A;  2V2F F;  2XD5 A;  4P6B A;  3SS4 A;  1PW1 A;  4KQO A;  1C3B A;  5G18 A;  2Y2N A;  3GMW A;  3VP4 A;  4OQG A;  4B4Z A;  4E3L A;  1KE4 A;  1ES5 A;  1PI4 A;  1NYM A;  2J8Y A;  3VFF A;  2WZX A;  3M6B A;  2ZC5 B;  4HBT A;  4BD1 A;  1L2S A;  1JWZ A;  1JVJ A;  1MKI A;  4KZB A;  4CJN A;  4FD8 A;  1CI9 A;  4A5R A;  5CXW A;  3WWX A;  3NBL A;  3MXR A;  5DTS A;  4RA7 A;  2Y2J A;  4P85 A;  1K6R A;  3MFD A;  1PWG A;  3LO7 A;  2C6W B;  5HFO A;  3O87 A;  2ZQ8 A;  2EFU A;  1ERO A;  3EQV A;  5GL9 A;  1YM1 A;  1W79 A;  4IBR A;  3HVF A;  5CED A;  1TEM A;  4OOY A;  4JLF A;  3ZHH A;  1SDN A;  4KG6 A;  2G2W A;  1NZU A;  1PWC A;  1ZC2 A;  2ZQ9 A;  4H8R A;  4OPY A;  4DDS A;  1NYY A;  1BT5 A;  3IXB A;  2V1Z A;  1TDL A;  4WM9 A;  1WYC A;  3WS2 A;  2WAD A;  2WGV A;  3S1Y A;  4XXR A;  3UDI A;  5KMW A;  5KSH A;  5KZH A;  4GKU A;  2OSU A;  1I5Q A;  1RCJ A;  3Q81 A;  4QHC A;  3RXW A;  1QMF A;  5EVI B;  4GD6 A;  4S2N C;  4DF6 A;  5E43 A;  1XGI A;  3FYZ A;  2E8I A;  3G35 A;  4GDN A;  1DJC A;  5GHX A;  1L0E A;  5A91 A;  4E6X A;  4S2N A;  2WGI A;  4QB8 A;  5JYO A;  3W4O A;  5JYP A;  3TOI A;  3WS5 A;  5BOH A;  1FCN A;  3Q7Z A;  4KG2 A;  4KZ9 A;  5CGS A;  1HTZ A;  3O3V A;  1PYY A;  4KZ8 A;  4S2M A;  4PM9 A;  4JBF A;  5FAQ A;  2FFF B;  1BTL A;  3PBT A;  1PWD A;  2HDS A;  4K0X A;  4OON A;  5DTT A;  5EVI C;  1W8Y A;  4R4S A;  1G6A A;  5TGF A;  3LY3 A;  4U3T A;  5EVI A;  1LL9 A;  3PBR A;  5FQM A;  4R3B A;  1YQS A;  5FQQ A;  3V3S A;  4Q8I A;  2EXA A;  3NDG A;  3HL9 A;  2J9O A;  4JXV A;  1MBL A;  5CHM A;  3FWL A;  1LLB A;  5GLD A;  2ZQD A;  1KGE A;  4GOG A;  1K55 C;  3A3I A;  1ERQ A;  3CJM A;  3QNB A;  5CER A;  5TFQ A;  3CZD A;  1L0G A;  2JCH A;  1Z6F A;  3IHB A;  3V50 A;  1K55 A;  2FFY A;  1YLP A;  4BQM A;  3BYD A;  4KQR A;  4BL2 A;  4KEN B;  2Y2I A;  1KVL A;  5A92 A;  1KE3 A;  1FSW A;  2WAF A;  3OPR A;  4FH2 A;  1LI9 A;  2H0Y A;  3MKF A;  3SH9 A;  3ZVT A;  4E3N A;  3WS1 A;  5L2F A;  2HDU A;  4EV4 A;  1W8Q A;  1IYP A;  4X56 A;  5CEC A;  4MBK A;  4QU3 A;  4PPR A;  4PM8 A;  1E3U D;  3NC8 A;  5AQ9 A;  3HRE A;  4OQH A;  1ES4 A;  3GSG A;  4HEF A;  1YLY A;  3Q07 A;  4R0Q A;  2WKI A;  3N7W A;  4ID4 A;  3ZG0 A;  5HAR A;  3BFG A;  3SS5 A;  3E2L A;  4YIN A;  1E4D A;  3QNC A;  3PBN A;  4OPQ A;  5CGX A;  2QZ6 A;  1E25 A;  5EVL A;  4R3J A;  2HDQ A;  5EPH A;  3NDE A;  1GA9 A;  2C5W B;  4KZ7 A;  1MWR A;  1NRF A;  1QME A;  1XX2 A;  2Y2G A;  4MNR A;  4JKT A;  4ZJ2 A;  4UA9 A;  3WRT A;  1KDW A;  1KE0 A;  2OLV A;  4DKI A;  1ONH A;  4WMC D;  1XA7 A;  1MY8 A;  5FQK A;  4EWF A;  3DTM A;  4OP5 A;  4RVA A;  4DE0 A;  1ES2 A;  3G30 A;  1NXY A;  2ZQA A;  3BRM A;  2WGW B;  1BUE A;  3IH8 A;  3IH9 A;  1YLW A;  1AXB A;  1J9M A;  3N4I A;  3WRZ A;  5IHV A;  3IWQ A;  1IYQ A;  2I72 A;  2XK1 A;  4RX3 A;  4RYE A;  3MZE A;  3ZNT A;  3HLF A;  3EQU A;  4NET A;  4CPK A;  3ITB A;  2ZMA A;  1FSY A;  2JE5 A;  1VM1 A;  4N9L A;  5F1F A;  1YMX A;  3C4P A;  3OC2 A;  4LV0 A;  1ERM A;  4JXW A;  3UPN A;  3C5A A;  3JYI A;  3ZG8 B;  2PBY A;  2XH9 A;  5E2G A;  4FSF A;  4E3I A;  2XFS A;  3HLB A;  4MEZ A;  2RCX A;  1TDG A;  4ZTK A;  2WGW A;  1Y54 A;  2PU4 A;  4S2I A;  5GLA A;  5HX9 A;  4DXC A;  3C4O A;  1BLS A;  3AGE A;  3VP0 A;  4L0L A;  4E3K A;  2P74 A;  1XGJ A;  4OLD A;  4U0T A;  1YLZ A;  4OP8 A;  4E3O A;  1L0F A;  5M1A A;  4EUZ A;  1NJ4 A;  1XXM A;  3HLG A;  1HZO A;  5DTK A;  5AQA A;  5CEB A;  2DCF A;  4R4R A;  3G2Y A;  3HUM A;  5CHU A;  4YFM A;  4OPR A;  1MWS A;  1ONG A;  5FSR A;  1NZO A;  2Y2L A;  2Z2L B;  2ZD8 A;  1S6R A;  1BLC A;  5FI6 A;  1K38 A;  1PZP A;  1ZG4 A;  3GVB A;  3HBR A;  4JF4 A;  1ESU A;  3GTC A;  3IF6 C;  4P0M A;  3VP3 A;  3N8L A;  2QPN A;  4Z9Q A;  2EX8 A;  5CHJ A;  4X55 A;  2ZM2 A;  2X02 A;  1SHV A;  3GV9 A;  3HLC A;  2J7V A;  2WYX A;  3E2K A;  3MXS A;  4C6Y A;  3BFC A;  3BFE A;  3DWZ A;  3UE3 A;  1DY6 A;  1KVM A;  3NCK A;  3OPP A;  4N92 A;  4E3M A;  1GA0 A;  4HBU A;  3TG9 A;  1BZA A;  3IWI A;  4O7D A;  3TSG A;  3UE0 A;  4Y0T A;  3UPO A;  3G31 A;  5DVA A;  5A93 A;  1N4O A;  1E3U A;  4S2K A;  2XR0 A;  4M3K A;  1JWP A;  3FZC A;  4OQ0 A;  4OOL A;  1K25 A;  5F83 A;  3HUN A;  3W4P A;  3LCE A;  4WEJ A;  3NIA A;  1PI5 A;  2J9P A;  1PIO A;  5EOE A;  3SOI A;  1M6K A;  3O86 A;  5U47 A;  5FI7 A;  1HVB A;  2HDR A;  2XD1 A;  1W5D A;  4JF6 A;  4E6W A;  1FR1 A;  1O7E A;  1BLH A;  4GD8 A;  4WMC A;  3HUO A;  2XFT A;  4WZ5 A;  2CC1 A;  3W8K A;  3B3X A;  5FAS A;  4PM5 A;  3HLD A;  3FKV A;  4X68 A;  3Q1F A;  4B4X A;  4GZB A;  3UN7 A;  2XLN A;  3FV7 A;  3G4P A;  3M6H A;  4IVI A;  4U0X A;  3PAE A;  2A3U A;  3BFD A;  2XEP A;  2QMI A;  3OPH A;  5FA7 A;  1FR6 A;  5F82 A;  1IKI A;  1YLJ A;  2VGK A;  2ZC7 A;  3ZG5 A;  4P87 A;  1L0D A;  4QD4 A;  2WZZ A;  2WKH A;  2Z2M B;  2Y2M A;  3NI9 A;  1I2W A;  4JXG A;  3A3D A;  4X53 A;  2Y2P A;  1BLP A;  3UY6 A;  5DF7 A;  4GDB A;  4NK3 A;  3A3F A;  4PMA A;  1XA1 A;  5TR7 A;  3UNW A;  3ZG7 B;  1VQQ A;  4BLM A;  5FAP A;  2H5S A;  3M2K A;  4D2O A;  1ESI A;  3IWO A;  3VP2 A;  4EBP A;  3PTE A;  1ZG6 A;  1YT4 A;  4BL3 A;  1XKZ A;  2ZM0 A;  4LEN A;  5F1G A;  4JF5 A;  1MPL A;  3ZCZ A;  2BG1 A;  4DXB A;  3DWK A;  4QY5 A;  2DRW A;  4MLL A;  3PBQ A;  2XDM A;  1K4E A;  1S0W A;  3D4F A;  1BUL A;  3N8R A;  1PW8 A;  4B88 A;  3CMZ A;  3O88 A;  2ZQC A;  5EE8 A;  4ZJ1 A;  3UO9 A;  1KGG A;  1K54 C;  4KZ5 A;  5EUA A;  5GHY A;  1M40 A;  1CI8 A;  3ZVW A;  2IWC A;  3MZF A;  1LL5 A;  3IT9 A;  4JPM A;  3BFF A;  4RX2 A;  1K54 A;  4WEL A;  4KZ4 A;  2ZM8 A;  3ISG A;  4WEK A;  4OVD A;  1H8Y A;  1TVF A;  3AGF A;  5FAO A;  3UDX A;  5I94 A;  2R9W A;  4Y0U A;  2JBF A;  4BEN A;  1K56 D;  4UA6 A;  1XPB A;  2Q9M A;  1GCE A;  3LY4 A;  4IED A;  4DE3 A;  1BSG A;  1OME A;  2OV5 A;  3UPP A;  3VSL A;  1MXO A;  5GHZ A;  2XGN A;  1H8Z A;  1MWU A;  2P9V B;  2EX2 A;  5HAP A;  1LHY A;  3ZGA B;  1H5X A;  2G2U A;  4KZ3 A;  1YMS A;  2ZJ9 A;  3QHY A;  5CTN A;  3ZG9 B;  5E2H A;  4S2P A;  1FOF A;  4OKP A;  3RXX A;  2HP5 A;  3N8S A;  4PM6 A;  3ITA A;  1WYB A;  3UDF A;  3AGD A;  3PBS A;  3VSK A;  1ZKJ A;  5AQB A;  4WBG A;  3A3J A;  4DE1 A;  4KQQ A;  3G32 A;  2WAE A;  3VMA A;  4K91 A;  4ZDX A;  1G68 A;  4DRT A;  3PAG A;  3G2Z A;  4KZA A;  1IEM A;  1WE4 A;  3M2J A;  3OPL A;  3VP1 A;  1JTG A;  5CGW A;  4N1H A;  4PM7 A;  4HES A;  3ZDJ A;  2XF3 A;  3MZD A;  2GDN A;  4MBH A;  1Q2Q A;  5CTM A;  4ZAM A;  4DDY A;  2P9V A;  5M19 A;  3IXD A;  3MBZ A;  3DW0 A;  4Y7P A;  1Q2P A;  3BLM A;  4WZ4 A;  2Q9N A;  2ZLY A;  4EBL A;  5EEC A;  3N6I A;  1MWT A;  4ZBE A;  3Q82 A;  3IXG A;  5GLB A;  2IWD A;  3IHA A;  4LV1 A;  5HAI A;  4R23 A;  1K6S A;  2EFX A;  1HD8 A;  2ZC6 B;  5FQJ A;  1RGY A;  2EX9 A;  3OCN A;  3WS4 A;  2HPB A;  1SCW A;  1IYS A;  1CK3 A;  3GRJ A;  3GR2 A;  2EXB A;  3GQZ A;  3OZH A;  5J8X A;  3SH8 A;  1IEL A;  4GB7 A;  2WK0 A;  4KZ6 A;  3IF6 B;  4S2O A;  3BEB A;  4UA7 A;  1RP5 A;  2Y2O A;  2BLS A;  1XP4 A;  3G34 A;  3VOZ A;  3P09 A;  1N9B A;  2Y4A A;  4DE2 A;  1KGF A;  3Q7V B;  1K4F A;  3ZNY A;  3C7V A;  2ZC4 B;  4WZ5 C;  3SH7 A;  3V39 A;  2RL3 A;  5AQ7 A;  3A3E A;  5HW3 A;  2IWB A;  1GHI A;  2XQZ A;  1U60 A;  4LCM A;  1EWZ A;  4EBN A;  4FH4 A;  4WYY A;  2WUQ A;  5DF9 A;  5FI2 A;  3S4X A;  3V3R A;  5CRF A;  5A90 A;  2X01 A;  3BEC A;  4X69 A;  1LI0 A;  1DJB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...