3PHYA

Photoactive yellow protein, dark state (unbleached), solution structure, nmr, 26 structures
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photoreceptor
molecule keywords PHOTOACTIVE YELLOW PROTEIN
publication title Solution structure and backbone dynamics of the photoactive yellow protein.
pubmed doi rcsb
total genus 16
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 1998-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3phyA00
2D02A 3CAXA 1WA9A 4HJ3A 1S1ZA 5DJTA 5HD5A 4HH3A 4GHIB 3LIEA 3FG8A 1UGUA 3GECA 4H6JB 4EERA 5TBMB 4HY8A 3LICA 4XT2B 3A0VA 4I3IA 1T18A 4HP9A 3CWFA 1XJ4A 4HP4A 3RTYA 5HDCA 5DKLA 1DP6A 3H7WB 1OTAA 3MFXA 4I3AA 3LYXA 2OOLA 3A0RA 5EFWA 1T1CA 3F1PA 1GSVA 2R78A 3E4QA 1LSVA 2YKHA 3UE6A 2VV7A 2Z6CA 3C2WA 5F5YA 3LIBA 2EA9A 2L4RA 4R6LA 1LT0A 4HOIA 3K3CA 2WKPA 1GSWA 2VV8A 4NXEA 1UWPX 2H28A 1TS6A 1P0ZA 4HJ6A 3OLOA 3VE3A 5HWVA 3HJIA 4LRZE 2ZBBA 4YWZA 4WF0A 3NOTC 5IU1A 4BBUA 2VLGA 4R70A 5A8BA 2V1AA 3IBRA 1F9IA 4B9OA 1G28A 3UB9A 3MJQA 3VOLA 4HHDA 4BBTA 5HWWA 1D7EA 3LUQA 2D01A 5G4ZA 2A24B 1LSWA 1T19A 3EWKA 2QHKA 1GSXA 3F1NA 5AVFA 1V9ZA 4EQ1A 1N9NA 4HIAA 1OTBA 3IS2A 2INWA 3UB7A 2PR5A 1TS7A 5DJUA 4NXFA 1OTDA 2PD7A 2CMNA 1F98A 1V9YA 4JGPA 2WKQA 2QJ7A 1ODVA 3ICYA 4RQ9A 2P7JA 3FC7A 5G4YA 3EEHA 5AVEA 3H9WA 4DJ2A 4EETB 4BBVA 3UMDA 4HH2A 3ULFA 1OTEA 3SW1A 4EEPA 1XFNA 2HV1A 2I9VA 3BY9A 2KX6A 4EW7A 3BY8A 4MN6A 3MXQA 1KOUA 3HJKA 4GCZA 1S4RA 3KX0X 4I38A 2WKRA 2PR6A 4PKYG 3B33A 4LRYC 4NXGA 2QWSA 1S66L 3RH8B 2K7SA 2PDRA 3H82A 3K3DA 4GHIA 4LPZA 2PYRA 5F69A 4EXOA 3NHQA 1P97A 2PYPA 5HZHA 2M1CA 4L9EA 4WN5A 1LSXA 2QJ5A 4KUKA 5TBMA 2L1MA 1N9LA 3ZQ5A 3UMEA 3E4OA 3P7NA 3T50A 3LI9A 4HNBA 1T1AA 4KQDA 4R38A 2W27A 1Y28A 4PKYA 3PHYA 4I3JA 4F3LA 1VB6A 1T1BA 3D72A 1XJ6A 2JHEA 3LI8A 3G6OA 5J3WA 3LIFA 3F1PB 1OT6A 1BYWA 5HSQA 4L9GA 2JN7A 2BASA 4EEUA 4JGRA 1DP8A 3GDIA 5F6AA 4HQAA 2V0UA 1JNUA 2V0WA 4I5SA 4R3AA 2Z6DA 4NXBA 4EESA 2J80A 4GS9A 3H82B 3UB8A 1OTIA 2GJ3A 2YKFA 5HWTA 1DRMA 5IS1A 5F68A 3F1OA 3A0SA 5I5LA 4WLAA 5J7EA 2PD8A 1DP9A 4HJ4A 2VEAA 4LLOB 4DJ3A 1N9OA 1S67L 2KDKA 2OWJA 3LIAA 3PYPA 5KIZA 3NJAA 2A24A 1LL8A 2ZOIA 4F3LB 1NWZA 5J4EA 5HDSA 3C8CA 1S4SA 1OJ5A 4I39A 2B02A 2L0WA 2V9AA 3UB6A 3F1NB 1X0OA 1EW0A 4L9FA 2ZOHA 3IS2B 4WUJA 4MN5A 2VV6A 3CLOA 4JGOA 4H6JA 3NOUC 3VE4A 3NOPC 4XT2A 1D06A 2PHYA 4GS9B 4LRXC 2V1BA 3BWLA 1XFQA 2OWHA 4HI4A 4M4XA 1UWNX 3H7WA 3F1OB 2W0NA 3MR0A 1TS8A 3LIDA 1S1YA 4GW9A 4WL9A 3E4PA 5HD3A 1XJ3A 1TS0A 1OT9A 2QKPA 4K08A 5HDDA 3MQOA 1OJGA 4JGQA 4KUOA 3MQQA 1MZUA 5DKKA 4E04A 1XJ2A
chains in the Genus database with same CATH superfamily
4JF6A 4Y7PA 4A5RA 1SKFA 1WA9A 3BLSA 2R9WA 3M2KA 3C4PA 1YSQA 3EOIA 3TG9A 4OVDA 3GMWA 4OQIA 3LIEA 3WWXA 4ZJ3A 5F83A 1I5QA 1K38A 3CI6A 4DE0A 1BTLA 4EERA 5BOHA 4N1HA 1SDEA 4YOFA 4XT2B 3Q7ZA 2ZM0A 2H5SA 4I3IA 1CQAA 3BYDA 5CTNA 2W3FA 4ZDXA 1L0GA 3RTYA 2UV0E 5KSHA 5FSRA 1KE4A 3LYXA 4CLCC 1GA0A 1L3LA 1T1CA 1C3BA 1L0FA 3UE0A 4M3KA 2YKHA 2ZL1A 3UDIA 4ETXA 5AQBA 2HDUA 4ZJ2A 4KG2A 5MC7A 4X53A 4HOIA 4IVKA 4X68A 4Z9QA 4E3NA 4NXEA 1Z6FA 1JTGA 4C75A 1TS6A 4ID4A 4GOGA 3Q7VB 3QHYA 1BT5A 4O01A 1KDSA 2OAP1 4ZAMA 3CMZA 2ZBBA 1CEFA 1K25A 4BBUA 5KZHA 4R70A 4OONA 2BG1A 2V1AA 4PHTA 4KG5A 1IOUA 3KYZA 2Y2MA 4HBUA 3VOLA 4S2JA 3VP3A 1D7EA 1DY6A 3LUQA 5HL1A 1ES2A 2D01A 1IEMA 5G4ZA 3VSKA 2X01A 1XA7A 4B88A 3BRMA 4IJGA 3NDGA 1PW1A 2J9OA 3F1NA 3MMHA 5DVAA 4X1LA 3OCLA 4RX2A 1M40A 3IS2A 2INWA 1H5XA 1MWUA 2HJEA 3UB7A 4S2IA 3T4TA 5EUAA 3MBZA 3DTIA 2OLVA 4AFIA 1RCJA 3HL9A 1W8QA 4KZ5A 3MSHA 1V9YA 3A3IA 2WKIA 5E2HA 3K2NA 1BLPA 5AVEA 4Y3IA 4R3BA 4PM8A 2VGJA 4DJ2A 5GHXA 4BBVA 3PBOA 4BENA 3BEBA 1I2WA 3V50A 1K56D 2XA7M 3IX4A 2I9VA 2WK0A 5C5KA 5HPIA 2JKRM 5EE8A 2KX6A 1FQGA 2HP5A 3C7VA 5CECA 4GCZA 1S4RA 2O9AA 4I38A 1ZG6A 1FSWA 3GVBA 3CPTA 3ZG9B 1S66L 4QB8A 4WEKA 4UQIS 1ZTUA 3PAEA 1SCWA 4MBKA 5F1GA 3DAVA 2JKFA 4GHIA 5J8XA 2V8CA 2QZ6A 5F69A 2FFYA 2PT7A 2M1CA 2RL3A 4X1MA 4UA7A 4KUKA 5TBMA 1N9LA 4JXWA 3JYIA 3ZQ5A 1NLYA 4JF5A 4FH2A 2VGKA 2VGLS 3VFHA 3LI9A 4IBRA 2VJWA 4HNBA 2FH5A 4R38A 1LI0A 2NUPC 1XA1A 1Y28A 4PKYA 4BD1A 4Y15A 4BL2A 2XD1A 2EWWA 3BECA 1T1BA 3ZG8B 5HPFA 3M6BA 2JHEA 3VV4A 1ES3A 4NG2A 3F1PB 3IWIA 3L9KA 2XF3A 4GDNA 3VP1A 4LCLA 4MNRA 1NZOA 1NY0A 1YLWA 4Y0TA 5GLCA 3NULA 3OOVA 3O5YA 3R7WA 4EEUA 3SS5A 2DNSA 3ISGA 3G2ZA 4YFMA 2V0WA 3LEQA 1HVBA 4JXVA 4P6BA 3V5MA 5CHUA 1DJBA 2JC7A 4OP5A 4NXBA 3FKVA 4WZ5C 3PTEA 1G68A 4Y0UA 1DRMA 4LFUA 4EWFA 5EV0A 3LR0A 1W5DA 3A0SA 5I5LA 3IX3A 2WYXA 3CJMA 4HJ4A 2B18A 3LY4A 5TFQA 3A3FA 3WS4A 4DE1A 1NZUA 4LLOB 3RXXA 4CPKA 1NRFA 2HP9A 3FZCA 3TOIA 1IYQA 2A2LA 4WEJA 2O9BA 3PYPA 3QP4A 5KIZA 2A24A 3FPWA 4F3LB 1K55C 1ZG4A 4GB7A 5J4EA 2PAVP 1K4FA 1S4SA 2VK3A 4P87A 1OJ5A 3U4LP 1YT4A 1AXBA 2L0WA 2V9AA 3UB6A 4S2NC 5GLAA 1X0OA 4KZ8A 4L9FA 1PRQA 2ZOHA 4WUJA 2C6WB 4H6JA 2XQZA 1XXMA 3DTKA 3GSGA 4S2OA 3NOPC 2J3WA 2EFUA 1CJFA 4EQIA 4QY5A 2PHYA 4DMZA 3A3DA 2XA7S 3HBRA 2GZAA 5HW3A 4GS9B 4LRXC 1VETA 2V1BA 3BWLA 2OWHA 4E3JA 2ZC3B 1YLZA 3QP8A 1MXOA 3H7WA 4LGWA 3FWLA 1MC0A 4LV3A 3PXPA 4DDSA 1N9BA 1MKIA 4K91A 4K0XA 4ETZA 4WMCD 2VKSA 2JE5A 3CUEC 1IYPA 1HLUP 3N8SA 1JWZA 2XH9A 1PWGA 4KUOA 2W1RA 1YMSA 5DKKA 1XJ2A 1KE3A 4XUXA 5GLDA 3B3XA 1WE4A 4HJ3A 1E3UD 5L10A 1HZOA 1DJAA 5DJTA 4HH3A 5FA7A 4Y2FA 1EI5A 3BFGA 4FH4A 3HLBA 3NC8A 1YLPA 4DE3A 3FG8A 5FQJA 4Q0HA 3PBQA 2P9VB 1PZOA 1PW8A 4HY8A 5HAQA 3LICA 1GHIA 2ZQAA 4NK3A 3A0VA 1SKOB 5GLBA 3AGEA 4BWIA 3DTEA 5A93A 1MWRA 1XJ4A 2Q9MA 3O87A 5HDCA 4DXBA 5EOOA 2LB9A 4R0QA 1DP6A 3A0RA 5AQ7A 5HARA 1IKGA 3P09A 4ZJ1A 5A91A 2R78A 2Z2LB 4HBTA 2ZD8A 3KO6A 1TDLA 3KSIA 3B47A 1FIKA 5F5YA 3LIBA 4KQOA 2EA9A 4EUZA 2W3EA 2Y55A 3QP1A 4R6LA 1LT0A 3WS1A 2RCXA 2X71A 3QNCA 2WKPA 4QWOA 1I2SA 4YINA 5E2GA 2FZ0A 3P01A 2Y2OA 3IHAA 3LR5A 2H28A 4OLDA 1P0ZA 2HPBA 4U3TA 3OLOA 3VE3A 3HJIA 4RYEA 3NDEA 4YWZA 4WF0A 3SH7A 3M6HA 5JYPA 2QYBA 1O7EA 4LV2A 5FAPA 3KSGA 1IYOA 4MMNA 3C7UA 2K2NA 3V3SA 1G28A 1L2SA 4Y17A 1P9WA 4FTXA 4GLQA 4ZBEA 3BFCA 3JPUA 1ERMA 1YPRA 3VP0A 1H3QA 4DDYA 3NY4A 3T1RA 4ARZA 5EVID 3RXWA 3WS5A 2V1ZA 3DTMA 3EWKA 3IXBA 1YLJA 3IF6C 4BD0A 5EVIB 2WGIA 1GSXA 1TEMA 1E4DA 4HIAA 1GHMA 1Y4OA 2Y8HA 1NYMA 5A90A 5GHYA 3OC2A 4UAAA 5EECA 3VOZA 5L2FA 1OMEA 2Y2PA 4U0TA 4DN0A 1OTDA 2I72A 3KYEA 2PD7A 2VA0A 3HLGA 4PMAA 4QU3A 2CMNA 5CEDA 4IBXA 2G7UA 5DTTA 1ODVA 4RQ9A 2VX8A 1YKDA 4FSFA 2HDSA 4EETB 3UMDA 4HESA 4HH2A 1OTEA 2QMIA 3T1SA 1JTDA 3N7WA 4WZ4A 1K54C 5FI2A 4EW7A 4QY6A 1K6RA 3IWQA 3MXQA 1Y54A 5CRFA 5FQQA 3KX0X 4WBGA 4QPRA 1YSPA 3KSFA 2PR6A 1GA9A 3IF6B 3PR6A 1H0MA 1LHYA 5A92A 2HGVA 1JWVA 4IEDA 4P0MA 4GJ4A 3H82A 4L0LA 2OLUA 5FAQA 1PFLA 1P97A 1LL9A 3DW0A 4L9EA 4WN5A 2HZ5A 3TRCA 4KZ3A 3T4KA 3ZFZA 4KENB 1XGIA 3GTCA 3BFDA 2W3HA 3MXRA 3E98A 3EQVA 4OPQA 2ZC7A 1YLYA 3HUNA 4MEZA 4FD8A 5K5BA 1XKZA 5L8MA 1MKMA 2PBYA 1YLTA 1XJ6A 3LI8A 3N8LA 3UPOA 5J3WA 1PIOA 3OPRA 5M19A 4X56A 1G6OA 3IX8A 4L9GA 3HLFA 4DF6A 2JN7A 2BASA 3S7QA 5TJJA 3EGXC 1S0WA 3IH9A 4JXGA 1FCMA 2WGVA 4I5SA 1ERQA 4HEFA 4DKIA 2Z6DA 3IXHA 2W3DA 5L09A 2IA2A 3MFDA 2ZQ7A 3Q7VA 3UB8A 3WS2A 3W4PA 1OTIA 1CEGA 3HCYA 3T12B 3VP4A 1ZHHB 5EVEA 3KSHA 4JKTA 5IS1A 1G6AA 2Y2LA 1K57C 5F68A 2GDNA 1P9RA 1KGFA 3OBFA 1KGGA 3P98A 1BLSA 3FKWA 3T4SA 2Y59A 3GRJA 1YQSA 2XR0A 4LV1A 1FCOA 3C30A 1N9OA 4OH0A 5EPHA 3Q1FA 2KLIA 1S67L 4CLCA 3LIAA 5EOEA 2WZZA 3NJAA 3EEAA 4OKPA 5F82A 5HDSA 1J3WA 5JYOA 5DF7A 2JBFA 2B02A 2EXAA 1FR6A 2MJ6A 2Z2MB 5FDSA 5DFXA 3T4LA 3FPVA 1NJ4A 3QP2A 3VOYA 3ZVTA 4EUVA 3D9YA 5DFYA 2VV6A 3CLOA 4PM5A 3NOUC 3DWZA 5CXWA 5L07A 1ONGA 1KDWA 2ZM8A 3MXSA 4ZTKA 2XRNA 4C6YA 2VZWA 1XFQA 4KG6A 2PU2A 3S7NA 2XDMA 3E2KA 2Y2KA 1NRJA 4CLCE 3T1XA 3MR0A 4KZBA 3LIDA 1ESIA 4GW9A 4WL9A 5HAPA 5HD3A 1IFQA 4MN7A 5E2EA 2Y2NA 1TS0A 3RFBA 2QKPA 3MQOA 1W63M 2IWDA 2WAFA 3HREA 5FASA 4JPMA 3T1QB 4R4SA 5E43A 4E04A 4C3QA 4QHCA 2ZC5B 4KZ6A 4CJNA 2D02A 2HP6A 2XD5A 2ZMFA 1FCNA 2XROA 1ACFA 3G2YA 4OOMA 4N9KA 4OOLA 2DMWA 5FI6A 5CX7A 4H6JB 3G4PA 3S7PA 1VEUB 1ONHA 1T18A 1YMXA 4RA7A 1BZAA 4ESPA 1RP5A 1SHVA 1ZKJA 5G18A 4P6ZM 3NI9A 4N92A 4Y0OA 4GD8A 3VMAA 3H7WB 1OTAA 3MFXA 1CI8A 1IELA 3F1PA 4Q8IA 4OP8A 3AGFA 4B93A 1KVMA 2W1TA 1LSVA 3Q81A 2VV7A 2Z6CA 3IXDA 2BTFP 3BFFA 2L4RA 2PU4A 3A3JA 1W63Q 3LR3A 1FILA 4K0WA 3K3CA 1GSWA 2VV8A 3W4QA 2EFXA 3BM6A 3MZEA 5U47A 5D3OA 3MZFA 1Q2QA 3ZG5A 3LEZA 2H0YA 4Y13A 5HWVA 2B5RA 3O86A 4Y5FA 4XUZA 4LRZE 1H8YA 3NOTC 5IU1A 2VLGA 5FEFA 1W79A 2ZQ8A 3IBRA 4GKUA 1TVFA 3MZDA 3IBJA 5HL6A 3HVFA 1LL5A 5KMWA 4HHDA 2KOIA 4Z1WA 3ZGAB 3E0YA 3IH8A 3C4OA 1LSWA 3GQZA 4JLFA 4LCMA 3NCKA 3QP5A 1WYCA 4PPRA 1HTZA 1YAXA 3ZNTA 2QHKA 2WZXA 1L0DA 4EBNA 3JVVA 4GD6A 1V9ZA 1N9NA 2WGWB 1OTBA 3T4OA 2HJ9C 1XP4A 5IHVA 1TS7A 4WZ5A 3MQ0A 1F5MA 4NXFA 2EXBA 3G35A 1IYSA 4FUWA 3PBNA 1F98A 3CZDA 2LB5A 4JGPA 2WKQA 1ZC2A 4YNRA 3ICYA 2P7JA 3FC7A 3NECA 5G4YA 3D4FA 1FSYA 3MKEA 3ULFA 5FAOA 4EEPA 1XFNA 2HV1A 3PBRA 4LV0A 1ES5A 3BY9A 4OPRA 1AWIA 2H10A 1K55A 4RVAA 5EVIC 3BY8A 2JKGA 1KOUA 3HLWA 4PKYG 5CGXA 1QMEA 4E3MA 3CG5A 4S2NA 2K7SA 5TR7A 5FQKA 2PDRA 1BLCA 1JVJA 3QP6A 1E3UA 2PYRA 2J3TD 1E25A 3LO7A 3UB5P 5CGWA 3G32A 1LSXA 4P6ZS 2L1MA 4X55A 1NLZA 2JKTM 2XEPA 3UMEA 1SKOA 2ACGA 3P7NA 2HDQA 3NIAA 2Y2JA 4BJPA 3HLEA 2OV5A 3PHYA 4I3JA 2WADA 5EVLA 5E2FA 3LIFA 3CUEA 1A0KA 3PAGA 5DF9A 1BYWA 3S22A 1LLBA 1ALQA 2ZL1B 5CERA 3W2ZA 2O99A 1DP8A 3GDIA 5F6AA 1RGZA 2DRWA 4HQAA 4H8RA 1JNUA 4R3AA 2V8FA 1Q2PA 5AJGA 4U0XA 3C5AA 4EESA 1MWSA 3SH8A 3H82B 4OQGA 2GJ3A 2YKFA 2ZMAA 1J9MA 4MCWA 4PM6A 3SS4A 1RGYA 4MBFA 1VHMA 3F1OA 3S7OA 1S6RA 4WLAA 3NBLA 5J7EA 2PD8A 4UQIM 4NETA 4OPZA 3QNBA 3C38A 2VEAA 3PBSA 4ZRRA 4DJ3A 1XGJA 5HAIA 5DTSA 4S2KA 3BQ8A 3G34A 2EX2A 1CI9A 1CF0A 1LL8A 3Q07A 5M18A 4O7DA 3DBAA 4WYYA 2HF6A 5FDHA 2VGLM 5EVIA 2EX8A 3ZCZA 4KZ7A 2M7VA 3S1YA 3F1NB 3HUMA 1EW0A 2IWCA 4KZAA 2P74A 3IS2B 1H8ZA 4MN5A 4JGOA 2Y91A 5FATA 1PI5A 4N1XA 4KZ9A 1VQQA 5DTKA 1KVLA 4XT2A 4EBPA 4RX3A 4B4XA 4NKPA 1XX2A 2Y4AA 5CTMA 4E3KA 2ZJ9A 4HI4A 3CITA 1UWNX 4G3WA 3ITAA 5FEGA 4G3VA 3BW6A 1TS8A 5FQ9A 3MKFA 4OPYA 1MBLA 2WUQA 3HUOA 3PBTA 4S2MA 4CLCD 3O3VA 2GNXA 2B95A 1OT9A 5HDDA 4UHUA 1OJGA 4JGQA 4CLCB 3R4KA 5CHMA 3JVUA 3V39A 4E6XA 3UN7A 1F2KA 3IF6A 2NUTC 4EBLA 4BMWA 3CAXA 3WS0A 3LGOA 1ESUA 3CPTB 1S1ZA 2O9CA 3VP2A 2QPNA 4E3OA 5HD5A 3IT9A 3WRZA 3ZVWA 3TJZC 4GHIB 4MLLA 5FI7A 2Y2GA 3SS3A 2WKHA 1UGUA 3GECA 1W8YA 2IWBA 2A49A 5FQMA 5TBMB 3CHWP 2V20A 1PZPA 4MBHA 2P08A 2CC1A 2J7VA 3A3EA 3V67A 3VSLA 4HP9A 1GCEA 2J9PA 3CWFA 2X02A 2WKEA 4GN2A 4DRTA 4HP4A 2XSSA 1PNEA 4S2PA 5DKLA 4I3AA 2OOLA 3OPHA 5EFWA 5TGFA 3UDFA 3UE3A 3UPPA 4Q0JA 2R9XA 1PWCA 2JCHA 4IUKA 4BLMA 1GSVA 3O88A 1K54A 3E4QA 3GR2A 3UE6A 3C2WA 4R3JA 2EWVA 3OZHA 4E3IA 1CK3A 2HDRA 3R7WB 3T4QA 4XXRA 3UY6A 2JKRI 3GV9A 2Y79A 1UWPX 5FQIA 5GL9A 1L0EA 3N6IA 4X25A 4KQQA 4HJ6A 5I94A 1BLHA 3T4JA 3LR4A 3EGDC 1MPLA 2OSUA 2Q0OA 4IVIA 3SH9A 4PAUA 5A8BA 1F9IA 4B9OA 1GHPA 4MDZA 3OPLA 4OLGA 4R4RA 3UB9A 3MJQA 1FR1A 4DXCA 4LENA 1K56A 2P04A 4BBTA 2GX5A 5HWWA 1MY8A 2ZM2A 4KZ4A 5CEBA 2UWXA 2ZQCA 4BL3A 2FFFB 3SOIA 1STZA 2A24B 3DWKA 3I7JA 2PRFA 1T19A 3FYZA 5FL3A 4E3LA 1SDNA 4D2OA 4WM9A 4ME4A 2W1TB 5AVFA 4F94A 4EQ1A 1EWZA 1QMFA 3UDXA 4R1GA 4PM7A 2PR5A 5GHZA 4QD4A 5DJUA 4Q0IA 1H8MA 3HLDA 3MF0A 3N8RA 3UE1A 3BQAA 3D3OA 5EM0A 1K57A 3W4OA 2QJ7A 1U60A 4X6TA 1VETB 1K0KA 3SZTA 1BUEA 1XPBA 5CGSA 3EEHA 1TD5A 4CQHA 2V2FF 3H9WA 1BSGA 1PWDA 1DJCA 2Y2HA 3SW1A 5LBRA 2EX9A 4X69A 1MWTA 1Z09A 3UNWA 4BQMA 5AQ9A 1G5UA 3RJUA 4D60A 4O8GA 2E8IA 1PI4A 4MN6A 2BLSA 3HJKA 1KGEA 3LFVA 2W3GA 3IHBA 2WKRA 2XK1A 2AVXA 1NYYA 1ES4A 3B33A 1TDGA 4LRYC 4NXGA 2QWSA 3RH8B 3K3DA 5F1FA 4IUHA 1HD8A 4LPZA 4G3KA 4EXOA 2OAQ1 3NHQA 3ZG7B 4B4ZA 2PYPA 5HZHA 2Y2QA 4GNUA 1TF1A 3LY3A 1BULA 2QJ5A 2ZMVA 3IXGA 3ZG0A 4GZBA 1VEUA 2ZC6B 4P85A 5M1AA 5KSCA 2K31A 3E4OA 2XGNA 3T50A 3UPNA 4OOYA 1T1AA 4KQDA 3E2LA 3G30A 2W27A 4EU0A 3B42A 3OCNA 4F3LA 2XLNA 1VB6A 4KQRA 3D72A 3G6OA 2ZQ9A 2O0YA 3ZHHA 1OT6A 4IHQA 3BLMA 5HSQA 3WRTA 4JXSA 4DE2A 3EQUA 5HX9A 1FOFA 1OPXA 4QJGA 2ZQDA 4JGRA 3FV7A 5CHJA 3AGDA 3BJNA 4EV4A 2V0UA 1PYYA 4UA9A 2Q9NA 2A3UA 1LI9A 4E6WA 1IKIA 2J3TC 3OPPA 3G31A 2J80A 5AQAA 4GS9A 1YM1A 3Q82A 1W7FA 5HWTA 1K6SA 1NXYA 1D1JA 1JWPA 2PBDP 3BFEA 4WELA 2DCFA 4UA6A 4FCFA 4FOFA 1DP9A 1SZVA 1VM1A 4JF4A 3V3RA 3U2AA 1M6KA 3KYQA 5HFOA 4NEED 2KDKA 1EROA 2OWJA 3HLCA 2C5WB 2WAEA 3IQAA 4WMCA 2G2WA 1KE0A 2ZOIA 3ZYTA 4O0PA 5IT5A 1NWZA 4UEYA 3C8CA 2ZC4B 4JBFA 4ARZB 2EX6A 3S4XA 4I39A 2J8YA 2WGWA 4OQHA 3W8KA 3UO9A 1K4EA 4R23A 3VFFA 2ZLYA 2M7UA 1WYBA 3MS6A 2P9VA 3VE4A 3N4IA 2H0TA 2XFTA 2G2UA 5EM1A 1D06A 3ZDJA 3TSGA 3LCEA 4S2LA 4M4XA 2E8JA 3F1OB 2W0NA 3IWOA 4OQ0A 1S1YA 3M2JA 3E4PA 3IF5A 4PM9A 1N4OA 1XJ3A 3L7HA 2Y2IA 2JKTI 4K08A 3ITBA 2XFSA 4II7A 3TE8A 4N9LA 4GDBA 3MQQA 5DF8A 3ZNYA 1O07A 3TW8A 1MZUA
chains in the Genus database with same CATH topology
2NUTC 2D02A 4BMWA 3CAXA 1WA9A 2ZMFA 4HJ3A 1S1ZA 2O9CA 1YSQA 2XROA 5DJTA 3EOIA 5HD5A 4HH3A 4Y2FA 3TJZC 4GHIB 4OOMA 3LIEA 3FG8A 2DMWA 3CI6A 4OOLA 1UGUA 3GECA 5CX7A 4H6JB 4EERA 4Q0HA 3PBQA 5TBMB 3S7PA 4HY8A 3LICA 4YOFA 4XT2B 2P08A 3A0VA 3V67A 4I3IA 1T18A 4HP9A 2W3FA 3CWFA 4BWIA 1XJ4A 4HP4A 4P6ZM 3RTYA 5HDCA 2XSSA 5KSHA 2LB9A 5DKLA 1DP6A 3H7WB 1OTAA 3MFXA 4I3AA 3LYXA 2OOLA 3A0RA 5EFWA 4CLCC 3UE3A 4Q0JA 1T1CA 3F1PA 4IUKA 1GSVA 2R78A 3E4QA 4B93A 2W1TA 1LSVA 2YKHA 3UE6A 3KO6A 2VV7A 2Z6CA 3C2WA 3KSIA 2EWVA 3B47A 5F5YA 4ETXA 3LIBA 4KQOA 2EA9A 2W3EA 2L4RA 3R7WB 1W63Q 3T4QA 4R6LA 1LT0A 5MC7A 3LR3A 4HOIA 2JKRI 3K3CA 2WKPA 1GSWA 2VV8A 2FZ0A 4NXEA 2Y79A 1UWPX 3P01A 3LR5A 2H28A 1TS6A 1P0ZA 4HJ6A 3OLOA 3VE3A 5HWVA 3HJIA 4O01A 2OAP1 4Y5FA 3T4JA 3LR4A 4LRZE 3EGDC 2ZBBA 4YWZA 4WF0A 3NOTC 5IU1A 4BBUA 2VLGA 4PAUA 4R70A 2QYBA 5A8BA 2V1AA 4PHTA 1IOUA 3KSGA 3IBRA 1F9IA 4B9OA 4MMNA 3KYZA 4MDZA 2K2NA 1G28A 3IBJA 5HL6A 3UB9A 3MJQA 3VOLA 1P9WA 4HHDA 2KOIA 4Z1WA 2P04A 4BBTA 2GX5A 5HWWA 4GLQA 1D7EA 3LUQA 3E0YA 2D01A 5G4ZA 1H3QA 1STZA 1LSWA 2A24B 4ARZA 1T19A 4IJGA 5FL3A 1YAXA 3EWKA 2QHKA 1GSXA 4ME4A 2W1TB 3JVVA 3F1NA 3MMHA 5AVFA 1V9ZA 4EQ1A 1N9NA 4HIAA 1OTBA 3OCLA 3T4OA 3IS2A 2HJ9C 2INWA 2HJEA 3UB7A 2Y8HA 2PR5A 3OC2A 3T4TA 1TS7A 5DJUA 3MQ0A 4DN0A 4Q0IA 1F5MA 1H8MA 4NXFA 1OTDA 4AFIA 2PD7A 2VA0A 3MF0A 2CMNA 3BQAA 3PBNA 3D3OA 1F98A 1V9YA 2LB5A 4JGPA 2G7UA 2WKQA 2QJ7A 1ODVA 4YNRA 3ICYA 4RQ9A 2VX8A 3K2NA 2P7JA 3FC7A 5G4YA 3EEHA 1TD5A 4CQHA 5AVEA 4Y3IA 1YKDA 4FSFA 3H9WA 4DJ2A 4EETB 4BBVA 3UMDA 4HH2A 3PBOA 3ULFA 1OTEA 3SW1A 5LBRA 4EEPA 1XFNA 2HV1A 3PBRA 2XA7M 2I9VA 3BY9A 5C5KA 5HPIA 2JKRM 4O8GA 2KX6A 4EW7A 3BY8A 4MN6A 3MXQA 1KOUA 3HJKA 4GCZA 3LFVA 2W3GA 1S4RA 2O9AA 3KX0X 4QPRA 4I38A 2WKRA 1YSPA 3KSFA 2PR6A 4PKYG 3PR6A 3B33A 4LRYC 4NXGA 2QWSA 1S66L 3RH8B 4WEKA 2K7SA 4UQIS 1ZTUA 2HGVA 2PDRA 4GJ4A 3H82A 3K3DA 4IUHA 4GHIA 4L0LA 4LPZA 2PYRA 4G3KA 2J3TD 5F69A 4EXOA 2OAQ1 3NHQA 1P97A 2PYPA 5HZHA 2PT7A 2M1CA 4L9EA 4WN5A 1LSXA 1TF1A 4P6ZS 3TRCA 2QJ5A 2ZMVA 4KUKA 5TBMA 2L1MA 3T4KA 1N9LA 1NLZA 2JKTM 2W3HA 3ZQ5A 3UMEA 1NLYA 2K31A 3E4OA 3P7NA 3E98A 3EQVA 3T50A 2VGLS 4BJPA 3LI9A 2VJWA 4HNBA 1T1AA 2FH5A 4KQDA 4R38A 2W27A 4EU0A 3B42A 2NUPC 3OCNA 5K5BA 1Y28A 4PKYA 3PHYA 4I3JA 4F3LA 5L8MA 2EWWA 1VB6A 1MKMA 1T1BA 5HPFA 3D72A 1XJ6A 2JHEA 3LI8A 3G6OA 3VV4A 5J3WA 2O0YA 3LIFA 3F1PB 3CUEA 1G6OA 1OT6A 4IHQA 5DF9A 1BYWA 5HSQA 3EQUA 3OOVA 4L9GA 3O5YA 3W2ZA 2JN7A 3R7WA 2O99A 2BASA 4EEUA 3S7QA 1OPXA 5TJJA 4JGRA 1DP8A 3EGXC 3GDIA 5F6AA 3BJNA 4HQAA 2V0UA 1JNUA 2V0WA 4I5SA 4R3AA 5AJGA 2Z6DA 2J3TC 2W3DA 4NXBA 2IA2A 4EESA 2J80A 4GS9A 3H82B 3UB8A 1OTIA 2GJ3A 2YKFA 4MCWA 5HWTA 1DRMA 3HCYA 1VHMA 1ZHHB 3KSHA 3LR0A 5IS1A 4WELA 5F68A 3F1OA 3S7OA 1P9RA 3A0SA 5I5LA 4WLAA 4FOFA 3OBFA 5J7EA 2PD8A 1DP9A 2B18A 4HJ4A 4UQIM 3T4SA 3C38A 2VEAA 4LLOB 3PBSA 3U2AA 4ZRRA 4DJ3A 3KYQA 3C30A 1N9OA 4NEED 2KLIA 1S67L 3BQ8A 2A2LA 2KDKA 2OWJA 2O9BA 4WEJA 4CLCA 3LIAA 3PYPA 5KIZA 3NJAA 2A24A 1LL8A 2ZOIA 3EEAA 3ZYTA 3FPWA 4F3LB 4O0PA 5IT5A 1NWZA 3DBAA 4UEYA 5HDSA 5J4EA 3C8CA 4ARZB 2HF6A 1S4SA 2VGLM 1OJ5A 4I39A 2B02A 2MJ6A 2L0WA 2M7VA 2V9AA 5DFXA 3T4LA 3FPVA 3UB6A 3F1NB 1X0OA 1EW0A 4EUVA 5DFYA 4L9FA 2ZOHA 3IS2B 4WUJA 4MN5A 2VV6A 3CLOA 2M7UA 4JGOA 4H6JA 3NOUC 3VE4A 3NOPC 2J3WA 4XT2A 4NKPA 1D06A 2PHYA 4DMZA 2XA7S 2GZAA 2XRNA 2VZWA 4GS9B 4LRXC 2V1BA 3BWLA 1XFQA 2OWHA 4HI4A 4M4XA 3S7NA 3CITA 1UWNX 4G3WA 1NRJA 3H7WA 3F1OB 4G3VA 4CLCE 3BW6A 2W0NA 3MR0A 1TS8A 3LIDA 1S1YA 4GW9A 4WL9A 3E4PA 1MC0A 3PXPA 5HD3A 3PBTA 1XJ3A 1IFQA 4MN7A 4CLCD 1TS0A 3RFBA 2GNXA 4ETZA 1OT9A 2QKPA 2JKTI 2VKSA 4K08A 5HDDA 3MQOA 1W63M 3CUEC 1OJGA 4JGQA 4II7A 3TE8A 4CLCB 3R4KA 4KUOA 3MQQA 2W1RA 3JVUA 3TW8A 1MZUA 5DKKA 4E04A 1XJ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D02 A;  3CAX A;  1WA9 A;  4HJ3 A;  1S1Z A;  5DJT A;  5HD5 A;  4HH3 A;  4GHI B;  3LIE A;  3FG8 A;  1UGU A;  3GEC A;  4H6J B;  4EER A;  5TBM B;  4HY8 A;  3LIC A;  4XT2 B;  3A0V A;  4I3I A;  1T18 A;  4HP9 A;  3CWF A;  1XJ4 A;  4HP4 A;  3RTY A;  5HDC A;  5DKL A;  1DP6 A;  3H7W B;  1OTA A;  3MFX A;  4I3A A;  3LYX A;  2OOL A;  3A0R A;  5EFW A;  1T1C A;  3F1P A;  1GSV A;  2R78 A;  3E4Q A;  1LSV A;  2YKH A;  3UE6 A;  2VV7 A;  2Z6C A;  3C2W A;  5F5Y A;  3LIB A;  2EA9 A;  2L4R A;  4R6L A;  1LT0 A;  4HOI A;  3K3C A;  2WKP A;  1GSW A;  2VV8 A;  4NXE A;  1UWP X;  2H28 A;  1TS6 A;  1P0Z A;  4HJ6 A;  3OLO A;  3VE3 A;  5HWV A;  3HJI A;  4LRZ E;  2ZBB A;  4YWZ A;  4WF0 A;  3NOT C;  5IU1 A;  4BBU A;  2VLG A;  4R70 A;  5A8B A;  2V1A A;  3IBR A;  1F9I A;  4B9O A;  1G28 A;  3UB9 A;  3MJQ A;  3VOL A;  4HHD A;  4BBT A;  5HWW A;  1D7E A;  3LUQ A;  2D01 A;  5G4Z A;  2A24 B;  1LSW A;  1T19 A;  3EWK A;  2QHK A;  1GSX A;  3F1N A;  5AVF A;  1V9Z A;  4EQ1 A;  1N9N A;  4HIA A;  1OTB A;  3IS2 A;  2INW A;  3UB7 A;  2PR5 A;  1TS7 A;  5DJU A;  4NXF A;  1OTD A;  2PD7 A;  2CMN A;  1F98 A;  1V9Y A;  4JGP A;  2WKQ A;  2QJ7 A;  1ODV A;  3ICY A;  4RQ9 A;  2P7J A;  3FC7 A;  5G4Y A;  3EEH A;  5AVE A;  3H9W A;  4DJ2 A;  4EET B;  4BBV A;  3UMD A;  4HH2 A;  3ULF A;  1OTE A;  3SW1 A;  4EEP A;  1XFN A;  2HV1 A;  2I9V A;  3BY9 A;  2KX6 A;  4EW7 A;  3BY8 A;  4MN6 A;  3MXQ A;  1KOU A;  3HJK A;  4GCZ A;  1S4R A;  3KX0 X;  4I38 A;  2WKR A;  2PR6 A;  4PKY G;  3B33 A;  4LRY C;  4NXG A;  2QWS A;  1S66 L;  3RH8 B;  2K7S A;  2PDR A;  3H82 A;  3K3D A;  4GHI A;  4LPZ A;  2PYR A;  5F69 A;  4EXO A;  3NHQ A;  1P97 A;  2PYP A;  5HZH A;  2M1C A;  4L9E A;  4WN5 A;  1LSX A;  2QJ5 A;  4KUK A;  5TBM A;  2L1M A;  1N9L A;  3ZQ5 A;  3UME A;  3E4O A;  3P7N A;  3T50 A;  3LI9 A;  4HNB A;  1T1A A;  4KQD A;  4R38 A;  2W27 A;  1Y28 A;  4PKY A;  3PHY A;  4I3J A;  4F3L A;  1VB6 A;  1T1B A;  3D72 A;  1XJ6 A;  2JHE A;  3LI8 A;  3G6O A;  5J3W A;  3LIF A;  3F1P B;  1OT6 A;  1BYW A;  5HSQ A;  4L9G A;  2JN7 A;  2BAS A;  4EEU A;  4JGR A;  1DP8 A;  3GDI A;  5F6A A;  4HQA A;  2V0U A;  1JNU A;  2V0W A;  4I5S A;  4R3A A;  2Z6D A;  4NXB A;  4EES A;  2J80 A;  4GS9 A;  3H82 B;  3UB8 A;  1OTI A;  2GJ3 A;  2YKF A;  5HWT A;  1DRM A;  5IS1 A;  5F68 A;  3F1O A;  3A0S A;  5I5L A;  4WLA A;  5J7E A;  2PD8 A;  1DP9 A;  4HJ4 A;  2VEA A;  4LLO B;  4DJ3 A;  1N9O A;  1S67 L;  2KDK A;  2OWJ A;  3LIA A;  3PYP A;  5KIZ A;  3NJA A;  2A24 A;  1LL8 A;  2ZOI A;  4F3L B;  1NWZ A;  5J4E A;  5HDS A;  3C8C A;  1S4S A;  1OJ5 A;  4I39 A;  2B02 A;  2L0W A;  2V9A A;  3UB6 A;  3F1N B;  1X0O A;  1EW0 A;  4L9F A;  2ZOH A;  3IS2 B;  4WUJ A;  4MN5 A;  2VV6 A;  3CLO A;  4JGO A;  4H6J A;  3NOU C;  3VE4 A;  3NOP C;  4XT2 A;  1D06 A;  2PHY A;  4GS9 B;  4LRX C;  2V1B A;  3BWL A;  1XFQ A;  2OWH A;  4HI4 A;  4M4X A;  1UWN X;  3H7W A;  3F1O B;  2W0N A;  3MR0 A;  1TS8 A;  3LID A;  1S1Y A;  4GW9 A;  4WL9 A;  3E4P A;  5HD3 A;  1XJ3 A;  1TS0 A;  1OT9 A;  2QKP A;  4K08 A;  5HDD A;  3MQO A;  1OJG A;  4JGQ A;  4KUO A;  3MQQ A;  1MZU A;  5DKK A;  4E04 A;  1XJ2 A; 
#chains in the Genus database with same CATH topology
 4JF6 A;  4Y7P A;  4A5R A;  1SKF A;  1WA9 A;  3BLS A;  2R9W A;  3M2K A;  3C4P A;  1YSQ A;  3EOI A;  3TG9 A;  4OVD A;  3GMW A;  4OQI A;  3LIE A;  3WWX A;  4ZJ3 A;  5F83 A;  1I5Q A;  1K38 A;  3CI6 A;  4DE0 A;  1BTL A;  4EER A;  5BOH A;  4N1H A;  1SDE A;  4YOF A;  4XT2 B;  3Q7Z A;  2ZM0 A;  2H5S A;  4I3I A;  1CQA A;  3BYD A;  5CTN A;  2W3F A;  4ZDX A;  1L0G A;  3RTY A;  2UV0 E;  5KSH A;  5FSR A;  1KE4 A;  3LYX A;  4CLC C;  1GA0 A;  1L3L A;  1T1C A;  1C3B A;  1L0F A;  3UE0 A;  4M3K A;  2YKH A;  2ZL1 A;  3UDI A;  4ETX A;  5AQB A;  2HDU A;  4ZJ2 A;  4KG2 A;  5MC7 A;  4X53 A;  4HOI A;  4IVK A;  4X68 A;  4Z9Q A;  4E3N A;  4NXE A;  1Z6F A;  1JTG A;  4C75 A;  1TS6 A;  4ID4 A;  4GOG A;  3Q7V B;  3QHY A;  1BT5 A;  4O01 A;  1KDS A;  2OAP 1;  4ZAM A;  3CMZ A;  2ZBB A;  1CEF A;  1K25 A;  4BBU A;  5KZH A;  4R70 A;  4OON A;  2BG1 A;  2V1A A;  4PHT A;  4KG5 A;  1IOU A;  3KYZ A;  2Y2M A;  4HBU A;  3VOL A;  4S2J A;  3VP3 A;  1D7E A;  1DY6 A;  3LUQ A;  5HL1 A;  1ES2 A;  2D01 A;  1IEM A;  5G4Z A;  3VSK A;  2X01 A;  1XA7 A;  4B88 A;  3BRM A;  4IJG A;  3NDG A;  1PW1 A;  2J9O A;  3F1N A;  3MMH A;  5DVA A;  4X1L A;  3OCL A;  4RX2 A;  1M40 A;  3IS2 A;  2INW A;  1H5X A;  1MWU A;  2HJE A;  3UB7 A;  4S2I A;  3T4T A;  5EUA A;  3MBZ A;  3DTI A;  2OLV A;  4AFI A;  1RCJ A;  3HL9 A;  1W8Q A;  4KZ5 A;  3MSH A;  1V9Y A;  3A3I A;  2WKI A;  5E2H A;  3K2N A;  1BLP A;  5AVE A;  4Y3I A;  4R3B A;  4PM8 A;  2VGJ A;  4DJ2 A;  5GHX A;  4BBV A;  3PBO A;  4BEN A;  3BEB A;  1I2W A;  3V50 A;  1K56 D;  2XA7 M;  3IX4 A;  2I9V A;  2WK0 A;  5C5K A;  5HPI A;  2JKR M;  5EE8 A;  2KX6 A;  1FQG A;  2HP5 A;  3C7V A;  5CEC A;  4GCZ A;  1S4R A;  2O9A A;  4I38 A;  1ZG6 A;  1FSW A;  3GVB A;  3CPT A;  3ZG9 B;  1S66 L;  4QB8 A;  4WEK A;  4UQI S;  1ZTU A;  3PAE A;  1SCW A;  4MBK A;  5F1G A;  3DAV A;  2JKF A;  4GHI A;  5J8X A;  2V8C A;  2QZ6 A;  5F69 A;  2FFY A;  2PT7 A;  2M1C A;  2RL3 A;  4X1M A;  4UA7 A;  4KUK A;  5TBM A;  1N9L A;  4JXW A;  3JYI A;  3ZQ5 A;  1NLY A;  4JF5 A;  4FH2 A;  2VGK A;  2VGL S;  3VFH A;  3LI9 A;  4IBR A;  2VJW A;  4HNB A;  2FH5 A;  4R38 A;  1LI0 A;  2NUP C;  1XA1 A;  1Y28 A;  4PKY A;  4BD1 A;  4Y15 A;  4BL2 A;  2XD1 A;  2EWW A;  3BEC A;  1T1B A;  3ZG8 B;  5HPF A;  3M6B A;  2JHE A;  3VV4 A;  1ES3 A;  4NG2 A;  3F1P B;  3IWI A;  3L9K A;  2XF3 A;  4GDN A;  3VP1 A;  4LCL A;  4MNR A;  1NZO A;  1NY0 A;  1YLW A;  4Y0T A;  5GLC A;  3NUL A;  3OOV A;  3O5Y A;  3R7W A;  4EEU A;  3SS5 A;  2DNS A;  3ISG A;  3G2Z A;  4YFM A;  2V0W A;  3LEQ A;  1HVB A;  4JXV A;  4P6B A;  3V5M A;  5CHU A;  1DJB A;  2JC7 A;  4OP5 A;  4NXB A;  3FKV A;  4WZ5 C;  3PTE A;  1G68 A;  4Y0U A;  1DRM A;  4LFU A;  4EWF A;  5EV0 A;  3LR0 A;  1W5D A;  3A0S A;  5I5L A;  3IX3 A;  2WYX A;  3CJM A;  4HJ4 A;  2B18 A;  3LY4 A;  5TFQ A;  3A3F A;  3WS4 A;  4DE1 A;  1NZU A;  4LLO B;  3RXX A;  4CPK A;  1NRF A;  2HP9 A;  3FZC A;  3TOI A;  1IYQ A;  2A2L A;  4WEJ A;  2O9B A;  3PYP A;  3QP4 A;  5KIZ A;  2A24 A;  3FPW A;  4F3L B;  1K55 C;  1ZG4 A;  4GB7 A;  5J4E A;  2PAV P;  1K4F A;  1S4S A;  2VK3 A;  4P87 A;  1OJ5 A;  3U4L P;  1YT4 A;  1AXB A;  2L0W A;  2V9A A;  3UB6 A;  4S2N C;  5GLA A;  1X0O A;  4KZ8 A;  4L9F A;  1PRQ A;  2ZOH A;  4WUJ A;  2C6W B;  4H6J A;  2XQZ A;  1XXM A;  3DTK A;  3GSG A;  4S2O A;  3NOP C;  2J3W A;  2EFU A;  1CJF A;  4EQI A;  4QY5 A;  2PHY A;  4DMZ A;  3A3D A;  2XA7 S;  3HBR A;  2GZA A;  5HW3 A;  4GS9 B;  4LRX C;  1VET A;  2V1B A;  3BWL A;  2OWH A;  4E3J A;  2ZC3 B;  1YLZ A;  3QP8 A;  1MXO A;  3H7W A;  4LGW A;  3FWL A;  1MC0 A;  4LV3 A;  3PXP A;  4DDS A;  1N9B A;  1MKI A;  4K91 A;  4K0X A;  4ETZ A;  4WMC D;  2VKS A;  2JE5 A;  3CUE C;  1IYP A;  1HLU P;  3N8S A;  1JWZ A;  2XH9 A;  1PWG A;  4KUO A;  2W1R A;  1YMS A;  5DKK A;  1XJ2 A;  1KE3 A;  4XUX A;  5GLD A;  3B3X A;  1WE4 A;  4HJ3 A;  1E3U D;  5L10 A;  1HZO A;  1DJA A;  5DJT A;  4HH3 A;  5FA7 A;  4Y2F A;  1EI5 A;  3BFG A;  4FH4 A;  3HLB A;  3NC8 A;  1YLP A;  4DE3 A;  3FG8 A;  5FQJ A;  4Q0H A;  3PBQ A;  2P9V B;  1PZO A;  1PW8 A;  4HY8 A;  5HAQ A;  3LIC A;  1GHI A;  2ZQA A;  4NK3 A;  3A0V A;  1SKO B;  5GLB A;  3AGE A;  4BWI A;  3DTE A;  5A93 A;  1MWR A;  1XJ4 A;  2Q9M A;  3O87 A;  5HDC A;  4DXB A;  5EOO A;  2LB9 A;  4R0Q A;  1DP6 A;  3A0R A;  5AQ7 A;  5HAR A;  1IKG A;  3P09 A;  4ZJ1 A;  5A91 A;  2R78 A;  2Z2L B;  4HBT A;  2ZD8 A;  3KO6 A;  1TDL A;  3KSI A;  3B47 A;  1FIK A;  5F5Y A;  3LIB A;  4KQO A;  2EA9 A;  4EUZ A;  2W3E A;  2Y55 A;  3QP1 A;  4R6L A;  1LT0 A;  3WS1 A;  2RCX A;  2X71 A;  3QNC A;  2WKP A;  4QWO A;  1I2S A;  4YIN A;  5E2G A;  2FZ0 A;  3P01 A;  2Y2O A;  3IHA A;  3LR5 A;  2H28 A;  4OLD A;  1P0Z A;  2HPB A;  4U3T A;  3OLO A;  3VE3 A;  3HJI A;  4RYE A;  3NDE A;  4YWZ A;  4WF0 A;  3SH7 A;  3M6H A;  5JYP A;  2QYB A;  1O7E A;  4LV2 A;  5FAP A;  3KSG A;  1IYO A;  4MMN A;  3C7U A;  2K2N A;  3V3S A;  1G28 A;  1L2S A;  4Y17 A;  1P9W A;  4FTX A;  4GLQ A;  4ZBE A;  3BFC A;  3JPU A;  1ERM A;  1YPR A;  3VP0 A;  1H3Q A;  4DDY A;  3NY4 A;  3T1R A;  4ARZ A;  5EVI D;  3RXW A;  3WS5 A;  2V1Z A;  3DTM A;  3EWK A;  3IXB A;  1YLJ A;  3IF6 C;  4BD0 A;  5EVI B;  2WGI A;  1GSX A;  1TEM A;  1E4D A;  4HIA A;  1GHM A;  1Y4O A;  2Y8H A;  1NYM A;  5A90 A;  5GHY A;  3OC2 A;  4UAA A;  5EEC A;  3VOZ A;  5L2F A;  1OME A;  2Y2P A;  4U0T A;  4DN0 A;  1OTD A;  2I72 A;  3KYE A;  2PD7 A;  2VA0 A;  3HLG A;  4PMA A;  4QU3 A;  2CMN A;  5CED A;  4IBX A;  2G7U A;  5DTT A;  1ODV A;  4RQ9 A;  2VX8 A;  1YKD A;  4FSF A;  2HDS A;  4EET B;  3UMD A;  4HES A;  4HH2 A;  1OTE A;  2QMI A;  3T1S A;  1JTD A;  3N7W A;  4WZ4 A;  1K54 C;  5FI2 A;  4EW7 A;  4QY6 A;  1K6R A;  3IWQ A;  3MXQ A;  1Y54 A;  5CRF A;  5FQQ A;  3KX0 X;  4WBG A;  4QPR A;  1YSP A;  3KSF A;  2PR6 A;  1GA9 A;  3IF6 B;  3PR6 A;  1H0M A;  1LHY A;  5A92 A;  2HGV A;  1JWV A;  4IED A;  4P0M A;  4GJ4 A;  3H82 A;  4L0L A;  2OLU A;  5FAQ A;  1PFL A;  1P97 A;  1LL9 A;  3DW0 A;  4L9E A;  4WN5 A;  2HZ5 A;  3TRC A;  4KZ3 A;  3T4K A;  3ZFZ A;  4KEN B;  1XGI A;  3GTC A;  3BFD A;  2W3H A;  3MXR A;  3E98 A;  3EQV A;  4OPQ A;  2ZC7 A;  1YLY A;  3HUN A;  4MEZ A;  4FD8 A;  5K5B A;  1XKZ A;  5L8M A;  1MKM A;  2PBY A;  1YLT A;  1XJ6 A;  3LI8 A;  3N8L A;  3UPO A;  5J3W A;  1PIO A;  3OPR A;  5M19 A;  4X56 A;  1G6O A;  3IX8 A;  4L9G A;  3HLF A;  4DF6 A;  2JN7 A;  2BAS A;  3S7Q A;  5TJJ A;  3EGX C;  1S0W A;  3IH9 A;  4JXG A;  1FCM A;  2WGV A;  4I5S A;  1ERQ A;  4HEF A;  4DKI A;  2Z6D A;  3IXH A;  2W3D A;  5L09 A;  2IA2 A;  3MFD A;  2ZQ7 A;  3Q7V A;  3UB8 A;  3WS2 A;  3W4P A;  1OTI A;  1CEG A;  3HCY A;  3T12 B;  3VP4 A;  1ZHH B;  5EVE A;  3KSH A;  4JKT A;  5IS1 A;  1G6A A;  2Y2L A;  1K57 C;  5F68 A;  2GDN A;  1P9R A;  1KGF A;  3OBF A;  1KGG A;  3P98 A;  1BLS A;  3FKW A;  3T4S A;  2Y59 A;  3GRJ A;  1YQS A;  2XR0 A;  4LV1 A;  1FCO A;  3C30 A;  1N9O A;  4OH0 A;  5EPH A;  3Q1F A;  2KLI A;  1S67 L;  4CLC A;  3LIA A;  5EOE A;  2WZZ A;  3NJA A;  3EEA A;  4OKP A;  5F82 A;  5HDS A;  1J3W A;  5JYO A;  5DF7 A;  2JBF A;  2B02 A;  2EXA A;  1FR6 A;  2MJ6 A;  2Z2M B;  5FDS A;  5DFX A;  3T4L A;  3FPV A;  1NJ4 A;  3QP2 A;  3VOY A;  3ZVT A;  4EUV A;  3D9Y A;  5DFY A;  2VV6 A;  3CLO A;  4PM5 A;  3NOU C;  3DWZ A;  5CXW A;  5L07 A;  1ONG A;  1KDW A;  2ZM8 A;  3MXS A;  4ZTK A;  2XRN A;  4C6Y A;  2VZW A;  1XFQ A;  4KG6 A;  2PU2 A;  3S7N A;  2XDM A;  3E2K A;  2Y2K A;  1NRJ A;  4CLC E;  3T1X A;  3MR0 A;  4KZB A;  3LID A;  1ESI A;  4GW9 A;  4WL9 A;  5HAP A;  5HD3 A;  1IFQ A;  4MN7 A;  5E2E A;  2Y2N A;  1TS0 A;  3RFB A;  2QKP A;  3MQO A;  1W63 M;  2IWD A;  2WAF A;  3HRE A;  5FAS A;  4JPM A;  3T1Q B;  4R4S A;  5E43 A;  4E04 A;  4C3Q A;  4QHC A;  2ZC5 B;  4KZ6 A;  4CJN A;  2D02 A;  2HP6 A;  2XD5 A;  2ZMF A;  1FCN A;  2XRO A;  1ACF A;  3G2Y A;  4OOM A;  4N9K A;  4OOL A;  2DMW A;  5FI6 A;  5CX7 A;  4H6J B;  3G4P A;  3S7P A;  1VEU B;  1ONH A;  1T18 A;  1YMX A;  4RA7 A;  1BZA A;  4ESP A;  1RP5 A;  1SHV A;  1ZKJ A;  5G18 A;  4P6Z M;  3NI9 A;  4N92 A;  4Y0O A;  4GD8 A;  3VMA A;  3H7W B;  1OTA A;  3MFX A;  1CI8 A;  1IEL A;  3F1P A;  4Q8I A;  4OP8 A;  3AGF A;  4B93 A;  1KVM A;  2W1T A;  1LSV A;  3Q81 A;  2VV7 A;  2Z6C A;  3IXD A;  2BTF P;  3BFF A;  2L4R A;  2PU4 A;  3A3J A;  1W63 Q;  3LR3 A;  1FIL A;  4K0W A;  3K3C A;  1GSW A;  2VV8 A;  3W4Q A;  2EFX A;  3BM6 A;  3MZE A;  5U47 A;  5D3O A;  3MZF A;  1Q2Q A;  3ZG5 A;  3LEZ A;  2H0Y A;  4Y13 A;  5HWV A;  2B5R A;  3O86 A;  4Y5F A;  4XUZ A;  4LRZ E;  1H8Y A;  3NOT C;  5IU1 A;  2VLG A;  5FEF A;  1W79 A;  2ZQ8 A;  3IBR A;  4GKU A;  1TVF A;  3MZD A;  3IBJ A;  5HL6 A;  3HVF A;  1LL5 A;  5KMW A;  4HHD A;  2KOI A;  4Z1W A;  3ZGA B;  3E0Y A;  3IH8 A;  3C4O A;  1LSW A;  3GQZ A;  4JLF A;  4LCM A;  3NCK A;  3QP5 A;  1WYC A;  4PPR A;  1HTZ A;  1YAX A;  3ZNT A;  2QHK A;  2WZX A;  1L0D A;  4EBN A;  3JVV A;  4GD6 A;  1V9Z A;  1N9N A;  2WGW B;  1OTB A;  3T4O A;  2HJ9 C;  1XP4 A;  5IHV A;  1TS7 A;  4WZ5 A;  3MQ0 A;  1F5M A;  4NXF A;  2EXB A;  3G35 A;  1IYS A;  4FUW A;  3PBN A;  1F98 A;  3CZD A;  2LB5 A;  4JGP A;  2WKQ A;  1ZC2 A;  4YNR A;  3ICY A;  2P7J A;  3FC7 A;  3NEC A;  5G4Y A;  3D4F A;  1FSY A;  3MKE A;  3ULF A;  5FAO A;  4EEP A;  1XFN A;  2HV1 A;  3PBR A;  4LV0 A;  1ES5 A;  3BY9 A;  4OPR A;  1AWI A;  2H10 A;  1K55 A;  4RVA A;  5EVI C;  3BY8 A;  2JKG A;  1KOU A;  3HLW A;  4PKY G;  5CGX A;  1QME A;  4E3M A;  3CG5 A;  4S2N A;  2K7S A;  5TR7 A;  5FQK A;  2PDR A;  1BLC A;  1JVJ A;  3QP6 A;  1E3U A;  2PYR A;  2J3T D;  1E25 A;  3LO7 A;  3UB5 P;  5CGW A;  3G32 A;  1LSX A;  4P6Z S;  2L1M A;  4X55 A;  1NLZ A;  2JKT M;  2XEP A;  3UME A;  1SKO A;  2ACG A;  3P7N A;  2HDQ A;  3NIA A;  2Y2J A;  4BJP A;  3HLE A;  2OV5 A;  3PHY A;  4I3J A;  2WAD A;  5EVL A;  5E2F A;  3LIF A;  3CUE A;  1A0K A;  3PAG A;  5DF9 A;  1BYW A;  3S22 A;  1LLB A;  1ALQ A;  2ZL1 B;  5CER A;  3W2Z A;  2O99 A;  1DP8 A;  3GDI A;  5F6A A;  1RGZ A;  2DRW A;  4HQA A;  4H8R A;  1JNU A;  4R3A A;  2V8F A;  1Q2P A;  5AJG A;  4U0X A;  3C5A A;  4EES A;  1MWS A;  3SH8 A;  3H82 B;  4OQG A;  2GJ3 A;  2YKF A;  2ZMA A;  1J9M A;  4MCW A;  4PM6 A;  3SS4 A;  1RGY A;  4MBF A;  1VHM A;  3F1O A;  3S7O A;  1S6R A;  4WLA A;  3NBL A;  5J7E A;  2PD8 A;  4UQI M;  4NET A;  4OPZ A;  3QNB A;  3C38 A;  2VEA A;  3PBS A;  4ZRR A;  4DJ3 A;  1XGJ A;  5HAI A;  5DTS A;  4S2K A;  3BQ8 A;  3G34 A;  2EX2 A;  1CI9 A;  1CF0 A;  1LL8 A;  3Q07 A;  5M18 A;  4O7D A;  3DBA A;  4WYY A;  2HF6 A;  5FDH A;  2VGL M;  5EVI A;  2EX8 A;  3ZCZ A;  4KZ7 A;  2M7V A;  3S1Y A;  3F1N B;  3HUM A;  1EW0 A;  2IWC A;  4KZA A;  2P74 A;  3IS2 B;  1H8Z A;  4MN5 A;  4JGO A;  2Y91 A;  5FAT A;  1PI5 A;  4N1X A;  4KZ9 A;  1VQQ A;  5DTK A;  1KVL A;  4XT2 A;  4EBP A;  4RX3 A;  4B4X A;  4NKP A;  1XX2 A;  2Y4A A;  5CTM A;  4E3K A;  2ZJ9 A;  4HI4 A;  3CIT A;  1UWN X;  4G3W A;  3ITA A;  5FEG A;  4G3V A;  3BW6 A;  1TS8 A;  5FQ9 A;  3MKF A;  4OPY A;  1MBL A;  2WUQ A;  3HUO A;  3PBT A;  4S2M A;  4CLC D;  3O3V A;  2GNX A;  2B95 A;  1OT9 A;  5HDD A;  4UHU A;  1OJG A;  4JGQ A;  4CLC B;  3R4K A;  5CHM A;  3JVU A;  3V39 A;  4E6X A;  3UN7 A;  1F2K A;  3IF6 A;  2NUT C;  4EBL A;  4BMW A;  3CAX A;  3WS0 A;  3LGO A;  1ESU A;  3CPT B;  1S1Z A;  2O9C A;  3VP2 A;  2QPN A;  4E3O A;  5HD5 A;  3IT9 A;  3WRZ A;  3ZVW A;  3TJZ C;  4GHI B;  4MLL A;  5FI7 A;  2Y2G A;  3SS3 A;  2WKH A;  1UGU A;  3GEC A;  1W8Y A;  2IWB A;  2A49 A;  5FQM A;  5TBM B;  3CHW P;  2V20 A;  1PZP A;  4MBH A;  2P08 A;  2CC1 A;  2J7V A;  3A3E A;  3V67 A;  3VSL A;  4HP9 A;  1GCE A;  2J9P A;  3CWF A;  2X02 A;  2WKE A;  4GN2 A;  4DRT A;  4HP4 A;  2XSS A;  1PNE A;  4S2P A;  5DKL A;  4I3A A;  2OOL A;  3OPH A;  5EFW A;  5TGF A;  3UDF A;  3UE3 A;  3UPP A;  4Q0J A;  2R9X A;  1PWC A;  2JCH A;  4IUK A;  4BLM A;  1GSV A;  3O88 A;  1K54 A;  3E4Q A;  3GR2 A;  3UE6 A;  3C2W A;  4R3J A;  2EWV A;  3OZH A;  4E3I A;  1CK3 A;  2HDR A;  3R7W B;  3T4Q A;  4XXR A;  3UY6 A;  2JKR I;  3GV9 A;  2Y79 A;  1UWP X;  5FQI A;  5GL9 A;  1L0E A;  3N6I A;  4X25 A;  4KQQ A;  4HJ6 A;  5I94 A;  1BLH A;  3T4J A;  3LR4 A;  3EGD C;  1MPL A;  2OSU A;  2Q0O A;  4IVI A;  3SH9 A;  4PAU A;  5A8B A;  1F9I A;  4B9O A;  1GHP A;  4MDZ A;  3OPL A;  4OLG A;  4R4R A;  3UB9 A;  3MJQ A;  1FR1 A;  4DXC A;  4LEN A;  1K56 A;  2P04 A;  4BBT A;  2GX5 A;  5HWW A;  1MY8 A;  2ZM2 A;  4KZ4 A;  5CEB A;  2UWX A;  2ZQC A;  4BL3 A;  2FFF B;  3SOI A;  1STZ A;  2A24 B;  3DWK A;  3I7J A;  2PRF A;  1T19 A;  3FYZ A;  5FL3 A;  4E3L A;  1SDN A;  4D2O A;  4WM9 A;  4ME4 A;  2W1T B;  5AVF A;  4F94 A;  4EQ1 A;  1EWZ A;  1QMF A;  3UDX A;  4R1G A;  4PM7 A;  2PR5 A;  5GHZ A;  4QD4 A;  5DJU A;  4Q0I A;  1H8M A;  3HLD A;  3MF0 A;  3N8R A;  3UE1 A;  3BQA A;  3D3O A;  5EM0 A;  1K57 A;  3W4O A;  2QJ7 A;  1U60 A;  4X6T A;  1VET B;  1K0K A;  3SZT A;  1BUE A;  1XPB A;  5CGS A;  3EEH A;  1TD5 A;  4CQH A;  2V2F F;  3H9W A;  1BSG A;  1PWD A;  1DJC A;  2Y2H A;  3SW1 A;  5LBR A;  2EX9 A;  4X69 A;  1MWT A;  1Z09 A;  3UNW A;  4BQM A;  5AQ9 A;  1G5U A;  3RJU A;  4D60 A;  4O8G A;  2E8I A;  1PI4 A;  4MN6 A;  2BLS A;  3HJK A;  1KGE A;  3LFV A;  2W3G A;  3IHB A;  2WKR A;  2XK1 A;  2AVX A;  1NYY A;  1ES4 A;  3B33 A;  1TDG A;  4LRY C;  4NXG A;  2QWS A;  3RH8 B;  3K3D A;  5F1F A;  4IUH A;  1HD8 A;  4LPZ A;  4G3K A;  4EXO A;  2OAQ 1;  3NHQ A;  3ZG7 B;  4B4Z A;  2PYP A;  5HZH A;  2Y2Q A;  4GNU A;  1TF1 A;  3LY3 A;  1BUL A;  2QJ5 A;  2ZMV A;  3IXG A;  3ZG0 A;  4GZB A;  1VEU A;  2ZC6 B;  4P85 A;  5M1A A;  5KSC A;  2K31 A;  3E4O A;  2XGN A;  3T50 A;  3UPN A;  4OOY A;  1T1A A;  4KQD A;  3E2L A;  3G30 A;  2W27 A;  4EU0 A;  3B42 A;  3OCN A;  4F3L A;  2XLN A;  1VB6 A;  4KQR A;  3D72 A;  3G6O A;  2ZQ9 A;  2O0Y A;  3ZHH A;  1OT6 A;  4IHQ A;  3BLM A;  5HSQ A;  3WRT A;  4JXS A;  4DE2 A;  3EQU A;  5HX9 A;  1FOF A;  1OPX A;  4QJG A;  2ZQD A;  4JGR A;  3FV7 A;  5CHJ A;  3AGD A;  3BJN A;  4EV4 A;  2V0U A;  1PYY A;  4UA9 A;  2Q9N A;  2A3U A;  1LI9 A;  4E6W A;  1IKI A;  2J3T C;  3OPP A;  3G31 A;  2J80 A;  5AQA A;  4GS9 A;  1YM1 A;  3Q82 A;  1W7F A;  5HWT A;  1K6S A;  1NXY A;  1D1J A;  1JWP A;  2PBD P;  3BFE A;  4WEL A;  2DCF A;  4UA6 A;  4FCF A;  4FOF A;  1DP9 A;  1SZV A;  1VM1 A;  4JF4 A;  3V3R A;  3U2A A;  1M6K A;  3KYQ A;  5HFO A;  4NEE D;  2KDK A;  1ERO A;  2OWJ A;  3HLC A;  2C5W B;  2WAE A;  3IQA A;  4WMC A;  2G2W A;  1KE0 A;  2ZOI A;  3ZYT A;  4O0P A;  5IT5 A;  1NWZ A;  4UEY A;  3C8C A;  2ZC4 B;  4JBF A;  4ARZ B;  2EX6 A;  3S4X A;  4I39 A;  2J8Y A;  2WGW A;  4OQH A;  3W8K A;  3UO9 A;  1K4E A;  4R23 A;  3VFF A;  2ZLY A;  2M7U A;  1WYB A;  3MS6 A;  2P9V A;  3VE4 A;  3N4I A;  2H0T A;  2XFT A;  2G2U A;  5EM1 A;  1D06 A;  3ZDJ A;  3TSG A;  3LCE A;  4S2L A;  4M4X A;  2E8J A;  3F1O B;  2W0N A;  3IWO A;  4OQ0 A;  1S1Y A;  3M2J A;  3E4P A;  3IF5 A;  4PM9 A;  1N4O A;  1XJ3 A;  3L7H A;  2Y2I A;  2JKT I;  4K08 A;  3ITB A;  2XFS A;  4II7 A;  3TE8 A;  4N9L A;  4GDB A;  3MQQ A;  5DF8 A;  3ZNY A;  1O07 A;  3TW8 A;  1MZU A; 
#chains in the Genus database with same CATH homology
 2NUT C;  2D02 A;  4BMW A;  3CAX A;  1WA9 A;  2ZMF A;  4HJ3 A;  1S1Z A;  2O9C A;  1YSQ A;  2XRO A;  5DJT A;  3EOI A;  5HD5 A;  4HH3 A;  4Y2F A;  3TJZ C;  4GHI B;  4OOM A;  3LIE A;  3FG8 A;  2DMW A;  3CI6 A;  4OOL A;  1UGU A;  3GEC A;  5CX7 A;  4H6J B;  4EER A;  4Q0H A;  3PBQ A;  5TBM B;  3S7P A;  4HY8 A;  3LIC A;  4YOF A;  4XT2 B;  2P08 A;  3A0V A;  3V67 A;  4I3I A;  1T18 A;  4HP9 A;  2W3F A;  3CWF A;  4BWI A;  1XJ4 A;  4HP4 A;  4P6Z M;  3RTY A;  5HDC A;  2XSS A;  5KSH A;  2LB9 A;  5DKL A;  1DP6 A;  3H7W B;  1OTA A;  3MFX A;  4I3A A;  3LYX A;  2OOL A;  3A0R A;  5EFW A;  4CLC C;  3UE3 A;  4Q0J A;  1T1C A;  3F1P A;  4IUK A;  1GSV A;  2R78 A;  3E4Q A;  4B93 A;  2W1T A;  1LSV A;  2YKH A;  3UE6 A;  3KO6 A;  2VV7 A;  2Z6C A;  3C2W A;  3KSI A;  2EWV A;  3B47 A;  5F5Y A;  4ETX A;  3LIB A;  4KQO A;  2EA9 A;  2W3E A;  2L4R A;  3R7W B;  1W63 Q;  3T4Q A;  4R6L A;  1LT0 A;  5MC7 A;  3LR3 A;  4HOI A;  2JKR I;  3K3C A;  2WKP A;  1GSW A;  2VV8 A;  2FZ0 A;  4NXE A;  2Y79 A;  1UWP X;  3P01 A;  3LR5 A;  2H28 A;  1TS6 A;  1P0Z A;  4HJ6 A;  3OLO A;  3VE3 A;  5HWV A;  3HJI A;  4O01 A;  2OAP 1;  4Y5F A;  3T4J A;  3LR4 A;  4LRZ E;  3EGD C;  2ZBB A;  4YWZ A;  4WF0 A;  3NOT C;  5IU1 A;  4BBU A;  2VLG A;  4PAU A;  4R70 A;  2QYB A;  5A8B A;  2V1A A;  4PHT A;  1IOU A;  3KSG A;  3IBR A;  1F9I A;  4B9O A;  4MMN A;  3KYZ A;  4MDZ A;  2K2N A;  1G28 A;  3IBJ A;  5HL6 A;  3UB9 A;  3MJQ A;  3VOL A;  1P9W A;  4HHD A;  2KOI A;  4Z1W A;  2P04 A;  4BBT A;  2GX5 A;  5HWW A;  4GLQ A;  1D7E A;  3LUQ A;  3E0Y A;  2D01 A;  5G4Z A;  1H3Q A;  1STZ A;  1LSW A;  2A24 B;  4ARZ A;  1T19 A;  4IJG A;  5FL3 A;  1YAX A;  3EWK A;  2QHK A;  1GSX A;  4ME4 A;  2W1T B;  3JVV A;  3F1N A;  3MMH A;  5AVF A;  1V9Z A;  4EQ1 A;  1N9N A;  4HIA A;  1OTB A;  3OCL A;  3T4O A;  3IS2 A;  2HJ9 C;  2INW A;  2HJE A;  3UB7 A;  2Y8H A;  2PR5 A;  3OC2 A;  3T4T A;  1TS7 A;  5DJU A;  3MQ0 A;  4DN0 A;  4Q0I A;  1F5M A;  1H8M A;  4NXF A;  1OTD A;  4AFI A;  2PD7 A;  2VA0 A;  3MF0 A;  2CMN A;  3BQA A;  3PBN A;  3D3O A;  1F98 A;  1V9Y A;  2LB5 A;  4JGP A;  2G7U A;  2WKQ A;  2QJ7 A;  1ODV A;  4YNR A;  3ICY A;  4RQ9 A;  2VX8 A;  3K2N A;  2P7J A;  3FC7 A;  5G4Y A;  3EEH A;  1TD5 A;  4CQH A;  5AVE A;  4Y3I A;  1YKD A;  4FSF A;  3H9W A;  4DJ2 A;  4EET B;  4BBV A;  3UMD A;  4HH2 A;  3PBO A;  3ULF A;  1OTE A;  3SW1 A;  5LBR A;  4EEP A;  1XFN A;  2HV1 A;  3PBR A;  2XA7 M;  2I9V A;  3BY9 A;  5C5K A;  5HPI A;  2JKR M;  4O8G A;  2KX6 A;  4EW7 A;  3BY8 A;  4MN6 A;  3MXQ A;  1KOU A;  3HJK A;  4GCZ A;  3LFV A;  2W3G A;  1S4R A;  2O9A A;  3KX0 X;  4QPR A;  4I38 A;  2WKR A;  1YSP A;  3KSF A;  2PR6 A;  4PKY G;  3PR6 A;  3B33 A;  4LRY C;  4NXG A;  2QWS A;  1S66 L;  3RH8 B;  4WEK A;  2K7S A;  4UQI S;  1ZTU A;  2HGV A;  2PDR A;  4GJ4 A;  3H82 A;  3K3D A;  4IUH A;  4GHI A;  4L0L A;  4LPZ A;  2PYR A;  4G3K A;  2J3T D;  5F69 A;  4EXO A;  2OAQ 1;  3NHQ A;  1P97 A;  2PYP A;  5HZH A;  2PT7 A;  2M1C A;  4L9E A;  4WN5 A;  1LSX A;  1TF1 A;  4P6Z S;  3TRC A;  2QJ5 A;  2ZMV A;  4KUK A;  5TBM A;  2L1M A;  3T4K A;  1N9L A;  1NLZ A;  2JKT M;  2W3H A;  3ZQ5 A;  3UME A;  1NLY A;  2K31 A;  3E4O A;  3P7N A;  3E98 A;  3EQV A;  3T50 A;  2VGL S;  4BJP A;  3LI9 A;  2VJW A;  4HNB A;  1T1A A;  2FH5 A;  4KQD A;  4R38 A;  2W27 A;  4EU0 A;  3B42 A;  2NUP C;  3OCN A;  5K5B A;  1Y28 A;  4PKY A;  3PHY A;  4I3J A;  4F3L A;  5L8M A;  2EWW A;  1VB6 A;  1MKM A;  1T1B A;  5HPF A;  3D72 A;  1XJ6 A;  2JHE A;  3LI8 A;  3G6O A;  3VV4 A;  5J3W A;  2O0Y A;  3LIF A;  3F1P B;  3CUE A;  1G6O A;  1OT6 A;  4IHQ A;  5DF9 A;  1BYW A;  5HSQ A;  3EQU A;  3OOV A;  4L9G A;  3O5Y A;  3W2Z A;  2JN7 A;  3R7W A;  2O99 A;  2BAS A;  4EEU A;  3S7Q A;  1OPX A;  5TJJ A;  4JGR A;  1DP8 A;  3EGX C;  3GDI A;  5F6A A;  3BJN A;  4HQA A;  2V0U A;  1JNU A;  2V0W A;  4I5S A;  4R3A A;  5AJG A;  2Z6D A;  2J3T C;  2W3D A;  4NXB A;  2IA2 A;  4EES A;  2J80 A;  4GS9 A;  3H82 B;  3UB8 A;  1OTI A;  2GJ3 A;  2YKF A;  4MCW A;  5HWT A;  1DRM A;  3HCY A;  1VHM A;  1ZHH B;  3KSH A;  3LR0 A;  5IS1 A;  4WEL A;  5F68 A;  3F1O A;  3S7O A;  1P9R A;  3A0S A;  5I5L A;  4WLA A;  4FOF A;  3OBF A;  5J7E A;  2PD8 A;  1DP9 A;  2B18 A;  4HJ4 A;  4UQI M;  3T4S A;  3C38 A;  2VEA A;  4LLO B;  3PBS A;  3U2A A;  4ZRR A;  4DJ3 A;  3KYQ A;  3C30 A;  1N9O A;  4NEE D;  2KLI A;  1S67 L;  3BQ8 A;  2A2L A;  2KDK A;  2OWJ A;  2O9B A;  4WEJ A;  4CLC A;  3LIA A;  3PYP A;  5KIZ A;  3NJA A;  2A24 A;  1LL8 A;  2ZOI A;  3EEA A;  3ZYT A;  3FPW A;  4F3L B;  4O0P A;  5IT5 A;  1NWZ A;  3DBA A;  4UEY A;  5HDS A;  5J4E A;  3C8C A;  4ARZ B;  2HF6 A;  1S4S A;  2VGL M;  1OJ5 A;  4I39 A;  2B02 A;  2MJ6 A;  2L0W A;  2M7V A;  2V9A A;  5DFX A;  3T4L A;  3FPV A;  3UB6 A;  3F1N B;  1X0O A;  1EW0 A;  4EUV A;  5DFY A;  4L9F A;  2ZOH A;  3IS2 B;  4WUJ A;  4MN5 A;  2VV6 A;  3CLO A;  2M7U A;  4JGO A;  4H6J A;  3NOU C;  3VE4 A;  3NOP C;  2J3W A;  4XT2 A;  4NKP A;  1D06 A;  2PHY A;  4DMZ A;  2XA7 S;  2GZA A;  2XRN A;  2VZW A;  4GS9 B;  4LRX C;  2V1B A;  3BWL A;  1XFQ A;  2OWH A;  4HI4 A;  4M4X A;  3S7N A;  3CIT A;  1UWN X;  4G3W A;  1NRJ A;  3H7W A;  3F1O B;  4G3V A;  4CLC E;  3BW6 A;  2W0N A;  3MR0 A;  1TS8 A;  3LID A;  1S1Y A;  4GW9 A;  4WL9 A;  3E4P A;  1MC0 A;  3PXP A;  5HD3 A;  3PBT A;  1XJ3 A;  1IFQ A;  4MN7 A;  4CLC D;  1TS0 A;  3RFB A;  2GNX A;  4ETZ A;  1OT9 A;  2QKP A;  2JKT I;  2VKS A;  4K08 A;  5HDD A;  3MQO A;  1W63 M;  3CUE C;  1OJG A;  4JGQ A;  4II7 A;  3TE8 A;  4CLC B;  3R4K A;  4KUO A;  3MQQ A;  2W1R A;  3JVU A;  3TW8 A;  1MZU A;  5DKK A;  4E04 A;  1XJ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...