3PHYA

Photoactive yellow protein, dark state (unbleached), solution structure, nmr, 26 structures
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOTOACTIVE YELLOW PROTEIN
publication title Solution structure and backbone dynamics of the photoactive yellow protein.
pubmed doi rcsb
molecule tags Photoreceptor
total genus 16
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 1998-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3phyA00
1JNUA 2ZOHA 2L0WA 1GSWA 3LIDA 4HJ6A 3UMEA 3MXQA 1X0OA 5J7EA 3UB8A 5HDDA 1GSXA 5J4EA 4F3LA 3LI8A 5DJUA 3G6OA 4I5SA 4EW7A 5F6AA 4L9EA 4I38A 2Z6CA 4NXGA 5HZHA 3GDIA 2D01A 5DKLA 4F3LB 3NJAA 4I3JA 1S1ZA 5HD5A 4HJ4A 3PHYA 4HH2A 1T19A 4BBUA 2QJ7A 4R6LA 4XT2A 3KX0X 5IS1A 2V1BA 3CAXA 5HD3A 1DRMA 1N9LA 1S4SA 1DP6A 2V0WA 1N9NA 1UGUA 4R38A 4JGQA 2VV7A 4I3AA 4KQDA 3IS2A 3FG8A 4PKYA 1MZUA 2OWJA 3UB7A 1KOUA 1ODVA 4JGPA 3NOTC 3D72A 3ZQ5A 1BYWA 4BBTA 2WKPA 3ICYA 4H6JB 4KUKA 3RH8B 4WF0A 2VLGA 3F1PA 3H7WA 2K7SA 1VB6A 3A0SA 1T1CA 2PD7A 2VV8A 3NOPC 1LSWA 5F5YA 2YKHA 2JHEA 3GECA 2A24B 5F68A 4YWZA 1OJGA 2HV1A 2WKQA 4EEUA 4DJ3A 2KDKA 1TS6A 5IU1A 4LRXC 1OTAA 3EWKA 4GW9A 1TS8A 3NHQA 4GCZA 4MN5A 2PYRA 1TS0A 4M4XA 3BWLA 2W27A 2ZBBA 1T1AA 5J3WA 3B33A 3P7NA 5AVEA 3F1OB 3CWFA 5I5LA 1F98A 4EESA 2PHYA 2PR5A 1OJ5A 4BBVA 1DP8A 2R78A 3SW1A 5EFWA 4HP4A 4PKYG 2VEAA 1LSVA 2V9AA 5HSQA 1WA9A 4HHDA 4EQ1A 3LIFA 4GS9B 5HWVA 1GSVA 5HDSA 3MFXA 4B9OA 3BY9A 3FC7A 4WLAA 5G4YA 1N9OA 2QKPA 3UB9A 2D02A 1XFQA 2V1AA 2YKFA 1UWNX 4NXEA 1OTBA 1XJ6A 4WL9A 2J80A 4L9FA 3MQQA 5HDCA 4MN6A 1S4RA 3HJIA 4HQAA 3MQOA 2H28A 4H6JA 4HH3A 3H82B 3NOUC 1LL8A 4NXFA 1XJ4A 2A24A 2OOLA 2QWSA 3CLOA 2V0UA 3F1NB 3LICA 5F69A 3A0RA 3VE3A 4HOIA 1P97A 5DKKA 3F1OA 5DJTA 3EEHA 3H9WA 4JGRA 3VOLA 2KX6A 4DJ2A 1DP9A 4HP9A 1T18A 3LIAA 4GHIB 3LUQA 4WUJA 1S67L 1D7EA 5A8BA 3E4OA 4JGOA 4HI4A 2Z6DA 1OT9A 1OT6A 3A0VA 1LSXA 4LRYC 1F9IA 4GS9A 5KIZA 4HJ3A 3C2WA 3LYXA 1V9ZA 3UE6A 2P7JA 2CMNA 5TBMB 3UMDA 3UB6A 1TS7A 2JN7A 3MR0A 4LPZA 1OTEA 4HIAA 5AVFA 4I39A 2I9VA 3BY8A 2VV6A 2ZOIA 1UWPX 2WKRA 1G28A 2B02A 2L1MA 2PD8A 3K3CA 1Y28A 1XJ2A 2QHKA 1LT0A 1D06A 4K08A 4RQ9A 3E4QA 2PR6A 1P0ZA 2M1CA 4EXOA 3H82A 2BASA 3OLOA 4E04A 5G4ZA 3F1NA 4LRZE 3ULFA 4LLOB 4NXBA 4I3IA 4XT2B 2GJ3A 3LIEA 3IBRA 3PYPA 3LI9A 1V9YA 1EW0A 3RTYA 1OTDA 3C8CA 1XJ3A 4HNBA 4R70A 1T1BA 1XFNA 3MJQA 3LIBA 3HJKA 4EERA 2INWA 3T50A 2L4RA 4GHIA 2EA9A 1OTIA 3E4PA 3IS2B 5HWWA 4EEPA 4WN5A 4HY8A 4KUOA 2OWHA 4L9GA 2PDRA 2QJ5A 4EETB 2W0NA 5TBMA 3F1PB 3H7WB 3VE4A 5HWTA 1NWZA 4R3AA 1S1YA 1S66L 3K3DA 2PYPA
chains in the Genus database with same CATH superfamily
1BULA 1OPXA 3V67A 1X0OA 3IT9A 4M3KA 3DW0A 3UB8A 2VKSA 3U2AA 2Q0OA 1H8MA 2H0YA 5DJUA 5C5KA 1YPRA 4EW7A 4QWOA 1VETB 3IBJA 4JXVA 4WMCD 2HDQA 5HAIA 2AVXA 3BFDA 3GDIA 3BRMA 4K0XA 3MXRA 3BFGA 5EV0A 3UN7A 1IKGA 4O8GA 1YLJA 5HD5A 4KZ3A 5FDSA 1K25A 3PHYA 3QNBA 2Y2MA 4GN2A 3ZG5A 1G5UA 5MC7A 3TG9A 1YSQA 1AWIA 3T1SA 5F1FA 2V1BA 5CXWA 3CAXA 3TOIA 1DRMA 1PI5A 1S4SA 4EBPA 1PNEA 3ZCZA 3O5YA 3RXWA 3E98A 4Z9QA 3PR6A 4R38A 4JGQA 2VV7A 3SH7A 3IS2A 5EE8A 3FG8A 4RA7A 3S4XA 4E3JA 4N92A 2J7VA 1RP5A 4U0XA 4Y2FA 3D72A 4E3NA 1CQAA 4KZ4A 2Y2QA 3UNWA 4PM6A 4GD6A 2DMWA 3UDFA 2XD5A 1T1CA 3NOPC 2A49A 4RX2A 5F5YA 4RX3A 3O88A 2NUTC 2A24B 1OJGA 2WKQA 2OLVA 1TS6A 2Q9NA 1K38A 4FTXA 3ITAA 2OLUA 4GW9A 1TS8A 4MN5A 3W8KA 4KQRA 4HBTA 3BWLA 1JWPA 4S2NC 2IWBA 1KVMA 3O87A 5AVEA 3F1OB 3PTEA 4MBHA 2ZLYA 3PXPA 4MMNA 1K6SA 1F98A 3E2KA 2PR5A 2EFXA 2ZMVA 4OQGA 1DP8A 3VMAA 2J3TD 4CLCE 1LL5A 2I72A 1K6RA 1KE3A 1H8ZA 2KOIA 5EFWA 1NXYA 5HARA 1JWVA 4S2OA 4HHDA 3GV9A 4OPRA 4O0PA 4ZJ3A 2ZC5B 2RL3A 3ZFZA 3AGFA 4KG2A 1STZA 1ES3A 3EOIA 4B9OA 3QP8A 5A93A 1L3LA 4WLAA 1FCOA 2XLNA 1MWRA 3A3DA 5AQAA 2H5SA 4FOFA 4LV2A 1N9OA 1YSPA 2D02A 4R1GA 3SH9A 3KO6A 1K54C 3HLBA 5TFQA 2V1AA 1PZOA 2YKFA 4CJNA 4EU0A 4CLCA 1XJ6A 4OH0A 4WL9A 4RVAA 3QP4A 1KDSA 4QHCA 4L9FA 5GL9A 5HDCA 3SS3A 1S4RA 3RXXA 2JE5A 1IYSA 5EVEA 3MQOA 2H28A 3Q82A 3GQZA 1NYMA 4IUKA 2C6WB 3N4IA 3EQVA 1ESUA 3GMWA 3BEBA 3FZCA 4EUZA 5FAPA 2QYBA 3VOZA 2QWSA 3CLOA 3LEQA 2HZ5A 3LICA 4K0WA 4QD4A 3A0RA 4FH4A 3R7WB 1VEUA 3KSFA 3UE1A 5EECA 5DKKA 3T4OA 1BSGA 5DJTA 3T4TA 3IXBA 2ZM2A 4JGRA 3VOLA 4GNUA 4GOGA 4Q0HA 2Y2IA 4WEJA 3D9YA 2Y2OA 4EUVA 4GHIB 2O0YA 4JPMA 1BLHA 2HP5A 4C6YA 3T1XA 3HUMA 3A3EA 1OT6A 1BLSA 4DE3A 5HX9A 1JWZA 4KZ8A 4DKIA 3A3FA 1D1JA 4OLDA 1CK3A 4IJGA 3FWLA 4HJ3A 2PT7A 5GLDA 2Q9MA 3C38A 3T12B 4OP5A 2G2WA 4ZDXA 1OTEA 3WS4A 1M6KA 2Y79A 4G3KA 2I9VA 1K57C 2ZM0A 1UWPX 2DCFA 4U0TA 2B02A 3ITBA 5EVID 2VGJA 4IVKA 3CHWP 3Q7VA 3A3JA 4ZJ1A 3W4QA 5CHJA 3N8RA 1XJ2A 1D06A 3MZEA 1G6AA 2ZQAA 5BOHA 3E4QA 1BLCA 1DJBA 4LV0A 2DNSA 4HBUA 1XGJA 3ZNTA 5FSRA 3IX8A 2BLSA 3OLOA 3WS2A 4E04A 3NULA 3SS4A 5FASA 3F1NA 3IXHA 4EBNA 5EOEA 1MKMA 1GA9A 2HDUA 1FR6A 2V2FF 4LENA 4E3KA 3NDGA 3LI9A 2PU4A 2Y8HA 4G3WA 4IBXA 4JBFA 1ES5A 2K31A 3D4FA 3KYEA 2O9AA 1H0MA 3ISGA 4HNBA 4JKTA 3MJQA 4BD1A 1YLWA 5FAQA 2CC1A 2INWA 3T50A 1OTIA 3E4PA 4ETXA 1EI5A 3IS2B 4S2KA 2FH5A 4ME4A 3DTMA 4BJPA 4DDYA 1YMSA 4L9GA 5HPIA 4KG6A 2P9VA 1Z09A 2HP9A 4WZ5C 5TBMA 3WS0A 1YLYA 4N9LA 3CUEC 3D3OA 3LR0A 5HWTA 1NWZA 3VE4A 5FEGA 4R3AA 2BG1A 3K3DA 2JCHA 2ZOHA 1GSWA 3TSGA 3LIDA 4HJ6A 1SDNA 3UMEA 2IWCA 1GCEA 3PBTA 2XSSA 3I7JA 1NYYA 4R3BA 3HUOA 3LI8A 3LO7A 4WZ4A 1PW8A 4I5SA 5TJJA 1J9MA 3WS5A 4L9EA 2M7UA 4DE0A 3T4LA 3V3SA 3E0YA 3AGDA 1ZC2A 4BLMA 1E3UA 4F3LB 3BLSA 4I3JA 1F5MA 4LCLA 1K0KA 5L09A 3HL9A 5G18A 2R9XA 3IF6C 1MBLA 2QJ7A 1K55A 3M2KA 3KX0X 2W3FA 3KSIA 3UB5P 3HLFA 5IS1A 4PM5A 3GR2A 5HD3A 1N9LA 1PWDA 4Y15A 3C30A 3V39A 2V0WA 1N9NA 1UGUA 2WUQA 5CECA 4NKPA 2NUPC 1IKIA 4CLCB 3QHYA 2E8JA 3W4PA 2XFSA 2FFYA 2P04A 1IEMA 2A2LA 3NOTC 2VGKA 1BYWA 3MF0A 4BBTA 2WAEA 5DTSA 4EQIA 1QMFA 4WF0A 3KSGA 4YINA 3F1PA 2K7SA 1KDWA 1VB6A 2VV8A 3A0SA 4UA9A 5F83A 3IX3A 1YMXA 2XDMA 4OONA 3BFFA 3OOVA 2GNXA 3E2LA 3MSHA 3L9KA 3IHAA 4DJ3A 2KDKA 4DDSA 1W8YA 1DJCA 1FCMA 4KZBA 1VEUB 3IXGA 1IOUA 4CPKA 4M4XA 2WGIA 2Y2NA 3EGDC 5FEFA 2EFUA 4N9KA 5J3WA 5CEDA 5FI2A 3CWFA 3ZG9B 2C5WB 5GLCA 4EESA 2PHYA 4UQIM 1OJ5A 4DMZA 3PAGA 4KG5A 3CPTA 4PAUA 4KQOA 1LI0A 3SW1A 4HP4A 4NK3A 4FCFA 3NC8A 3NECA 5HSQA 5GHZA 3VSKA 3ZG7B 3LY4A 1HZOA 5D3OA 4BL2A 1E3UD 4Y0OA 3BY9A 3T1RA 3DBAA 5G4YA 4S2PA 3DTKA 1NRFA 5GHXA 3UB9A 3GVBA 3UDIA 3VP0A 3RFBA 1UWNX 4KZAA 1GHIA 1OTBA 3B47A 3K2NA 1SZVA 3Q7VB 3MQQA 4MN6A 3HJIA 4FSFA 3FYZA 1TDGA 2O9BA 1CI8A 4H6JA 3O3VA 5KSCA 3BQAA 2PRFA 4GB7A 3Q81A 2EX9A 2Y91A 5L07A 3MZDA 5HW3A 4PMAA 5GHYA 4QJGA 1Q2QA 3CZDA 1FR1A 1PYYA 1IYQA 3DWZA 3F1NB 1FIKA 2VGLM 5F69A 3OPRA 4E3MA 3OZHA 4Y5FA 4O7DA 3VE3A 1P97A 3OPPA 4XXRA 3N8SA 3G34A 3G31A 4N1XA 1MWSA 4S2JA 3H9WA 1KGEA 4GDNA 3MFDA 3R4KA 1DP9A 1MKIA 2XF3A 1ZG6A 4IBRA 5IHVA 3OCLA 1BT5A 3JYIA 5A8BA 4ID4A 3E4OA 4KENB 1OT9A 1S6RA 5FA7A 3S7PA 1F9IA 4IVIA 2LB5A 4GS9A 5KIZA 3C2WA 3VP4A 4DXBA 1ONGA 2CMNA 4JXSA 2W3GA 5TBMB 3W2ZA 1ERQA 2FFFB 2GZAA 4OPZA 2JN7A 1ONHA 4KZ5A 5AVFA 1SDEA 3M6HA 3AGEA 5JYPA 4LCMA 3T4SA 4DE1A 5LBRA 2VJWA 2WKRA 5EVIA 1BLPA 1ZG4A 2IA2A 1P9RA 3VOYA 3ZG8B 5EM1A 3A3IA 4K91A 4OLGA 3K3CA 3PBOA 2ZM8A 1YLZA 1LT0A 5L8MA 1TF1A 4K08A 4E3IA 4LGWA 4MCWA 1SKOA 3GSGA 1KGGA 3C7VA 3H82A 3CUEA 1Q2PA 4R0QA 5DTTA 2B95A 2BASA 1W79A 3IH8A 1DY6A 1SHVA 3DWKA 5TR7A 2WAFA 3HUNA 1JTDA 5FI7A 5CGWA 2IWDA 2M7VA 4PHTA 4BWIA 3ULFA 4LLOB 1L0GA 3UDXA 3FKWA 3ZYTA 1V9YA 4MDZA 4OPYA 2VGLS 4WEKA 4AFIA 4QPRA 1RCJA 1XFNA 3ZHHA 3LIBA 3HCYA 3HJKA 3QP5A 2ZL1A 3TRCA 4BQMA 4JXWA 2X02A 3TE8A 2W1TA 1SKFA 4Y13A 4WN5A 3S7QA 4HY8A 4DRTA 3BQ8A 2OWHA 1ACFA 3M6BA 3IF6A 1O07A 4DXCA 3G32A 2QJ5A 2W0NA 2OAP1 3IF5A 5E2EA 5I94A 4OPQA 3F1PB 4D2OA 4GD8A 3UPPA 1L0FA 1S1YA 1XXMA 4QY6A 1S0WA 4X56A 2PYPA 2Y55A 1RGZA 1JNUA 2L0WA 3ZNYA 4LV1A 1C3BA 4GJ4A 3VP2A 4EV4A 3MXQA 3CI6A 5J7EA 2Y2PA 1F2KA 4GDBA 1O7EA 1FSYA 4A5RA 2ZQDA 1Y4OA 4Q8IA 1K56A 2JKTM 2Z6CA 1L0DA 5FQQA 5FQMA 2EX2A 5EOOA 3CPTB 2VK3A 3NJAA 3CITA 3T4JA 1H8YA 3TW8A 1G6OA 4HJ4A 5IT5A 3C4OA 4HH2A 4X69A 2JKTI 1T19A 2RCXA 4BBUA 3LR4A 4XT2A 1TD5A 1XA7A 1NLZA 4GKUA 3S7NA 3VFHA 1L0EA 4MNRA 3HBRA 3WRZA 5A92A 5DFYA 2Y2HA 3Q1FA 2WZXA 4Z1WA 5U47A 1IYOA 2HDRA 4UAAA 4EWFA 2ZJ9A 4KQDA 3P98A 2WGVA 2ZQ7A 3NCKA 5FQ9A 1IELA 2V1ZA 3OBFA 1MZUA 2OWJA 3UB7A 1KOUA 5CEBA 3JVVA 2Z2MB 3IWOA 2EWWA 2QMIA 3ZQ5A 1MWUA 4H6JB 2XA7M 2B5RA 4KUKA 5A90A 5M19A 4F94A 3HLEA 2VLGA 5TGFA 4OOYA 1ZKJA 3H7WA 5JYOA 1MXOA 1LSWA 2JHEA 3ZGAB 1TEMA 2WKIA 3HVFA 5CGXA 1GA0A 4NETA 5F68A 2E8IA 4YWZA 3MZFA 4JF5A 4JLFA 2O99A 1OTAA 1NY0A 3EWKA 4GCZA 1CJFA 2Z2LB 5CHMA 4H8RA 2ZBBA 3EQUA 3P7NA 4X53A 4R3JA 3SOIA 4CLCC 4JF4A 5AQBA 3FPWA 1LL9A 4Y7PA 2OSUA 4U3TA 4GLQA 2W3EA 1RGYA 4WM9A 2R78A 1W8QA 4PKYG 1XX2A 2V8CA 2V9AA 1WA9A 4QY5A 1HVBA 1PFLA 2EXAA 3LIFA 1K56D 3IWQA 2JKRM 2HF6A 4GS9B 5HWVA 4E3OA 2JBFA 5HDSA 5DTKA 1PRQA 2J9OA 3FC7A 4MBFA 1VM1A 3HREA 2WYXA 3IX4A 4HEFA 2ZC7A 2WADA 4OQ0A 5AJGA 2JKRI 4PM7A 3C7UA 2QKPA 4S2NA 2EX6A 5EVIB 5F82A 4NXEA 1E25A 1WYCA 3LFVA 2J80A 1EROA 3MQ0A 4X6TA 3MS6A 1I2SA 2XEPA 5GLAA 2XR0A 2ZC6B 3QP6A 1HTZA 1G68A 5AQ7A 1SKOB 3Q7ZA 3FV7A 1MC0A 2OV5A 3ZVWA 4DE2A 3QNCA 5A91A 3H82B 2ZQ9A 3S1YA 4GZBA 1W7FA 2OOLA 3FPVA 4XUZA 1ES2A 3MKFA 2V0UA 2GDNA 1JVJA 4BL3A 1VQQA 5M1AA 3QP1A 2V20A 4HOIA 3T4QA 4IEDA 4LV3A 5FATA 1YLTA 4BD0A 1BUEA 1K54A 2WZZA 3EEHA 5L2FA 1W63M 2KX6A 2PBYA 3IWIA 4G3VA 4Y0UA 1H3QA 1KVLA 1T18A 1LHYA 4Y17A 2ZL1B 4L0LA 4YFMA 3LUQA 1D7EA 1YLPA 4JGOA 4HI4A 5FI6A 2W1TB 4LRYC 5KSHA 3O86A 4MBKA 2JC7A 2XROA 2ZQ8A 1V9ZA 4IHQA 2P7JA 1ZTUA 2H0TA 4OOMA 4DF6A 5EPHA 1PZPA 3UMDA 3UB6A 4P0MA 1TS7A 3SZTA 1KGFA 4HIAA 2J8YA 2WKHA 1MY8A 2O9CA 3UPOA 2VV6A 3PBSA 5J8XA 4B93A 2L1MA 1XKZA 2VZWA 1YT4A 3BJNA 1Y28A 4X55A 1SCWA 4OQHA 2WK0A 5K5BA 2QHKA 3VP1A 3T1QB 1FSWA 4RQ9A 3FKVA 1BTLA 2MJ6A 1FILA 3CMZA 1GHMA 3C5AA 3BLMA 4P6ZM 5HL1A 2M1CA 4EXOA 4E3LA 3HLDA 5G4ZA 4UHUA 2ZMFA 3BFCA 4OQIA 4I3IA 2JKFA 4XT2B 4BMWA 1PW1A 5DF7A 2OAQ1 1YAXA 1JTGA 3NY4A 1EW0A 1BZAA 3RTYA 4FD8A 3C8CA 5F1GA 1K57A 1M40A 1CEGA 1XJ3A 2GX5A 2XH9A 4ZJ2A 2Y2JA 2WGWA 4R70A 4XUXA 5CTNA 1NZOA 2G7UA 4EERA 1XPBA 2L4RA 3JVUA 2ZQCA 2Y2KA 4C3QA 4E6XA 4EEPA 4QU3A 1W5DA 1OMEA 4KZ9A 3CG5A 4ARZA 4E6WA 3MXSA 3TJZC 2W3HA 4UQIS 3OPLA 2KLIA 1HD8A 3H7WB 1K55C 2UWXA 3G4PA 2H10A 3VFFA 3PAEA 2JKGA 3IH9A 1S66L 4R4SA 2VA0A 5FAOA 1Z6FA 2HJEA 5AQ9A 2P9VB 3SH8A 5FQJA 4DN0A 2J9PA 2XGNA 4PM9A 3T4KA 2A3UA 3HLGA 2HPBA 3M2JA 2ACGA 5CERA 5EVLA 5HDDA 1MPLA 1GSXA 5J4EA 4F3LA 4OOLA 3G6OA 4YNRA 1PIOA 3EGXC 2EWVA 1YKDA 5F6AA 1U60A 4I38A 5EUAA 4NXGA 5HZHA 2Y4AA 3PBRA 1K4FA 2D01A 5DKLA 3V3RA 3EEAA 1LI9A 4UA6A 3CJMA 1CI9A 5FDHA 1KE0A 1CEFA 1S1ZA 2XK1A 5M18A 4P6ZS 2XQZA 4WZ5A 1ESIA 2WKEA 1LLBA 1N4OA 4R6LA 3G30A 4R23A 4Q0JA 2X01A 1YM1A 1AXBA 5E2FA 1EWZA 2XRNA 1DP6A 5FQKA 3BM6A 2FZ0A 3N6IA 3QP2A 1YQSA 5HAPA 4B4ZA 2X71A 2ZD8A 4WYYA 3G35A 4I3AA 4R4RA 4CQHA 2J3TC 1WE4A 3UO9A 4PKYA 1ODVA 4JGPA 5CRFA 2EXBA 3LR5A 4II7A 4PPRA 3IHBA 4P85A 3IXDA 2WKPA 3ICYA 3RH8B 3OC2A 1Y54A 1FCNA 2PD7A 4EBLA 2YKHA 2BTFP 3V50A 3LGOA 3GECA 3OPHA 3RJUA 4EEUA 2HV1A 2G2UA 2B18A 5HAQA 3C4PA 5IU1A 4LRXC 3N8LA 3DTIA 3NI9A 3NHQA 1L2SA 2PYRA 2PAVP 1TS0A 3G2ZA 2W27A 3KYZA 1T1AA 3B33A 3WRTA 3LR3A 2Y2GA 2VX8A 5I5LA 3N7WA 1VETA 1PWGA 2W1RA 3KSHA 4BENA 3LY3A 5E43A 4BBVA 4X1MA 2EX8A 4UEYA 3BECA 1FQGA 4C75A 4Q0IA 2XFTA 3LCEA 5CGSA 3NDEA 4ZBEA 3KYQA 2VEAA 5DVAA 2ZC4B 1LSVA 3WWXA 1IFQA 3S22A 4EQ1A 4ESPA 3MBZA 1XA1A 1GSVA 1NRJA 1HLUP 5HPFA 4QB8A 3PBNA 3MFXA 2QPNA 2P74A 3PBQA 5KZHA 4ZRRA 1E4DA 4JXGA 4NG2A 3ZG0A 1IYPA 4B4XA 1FOFA 1XFQA 5E2HA 3GRJA 2K2NA 5CTMA 4CLCD 4YOFA 4KQQA 2HJ9C 2HDSA 4HQAA 3DAVA 1PI4A 4WELA 1I5QA 4MN7A 4X1LA 3IQAA 3VV4A 4HH3A 3S7OA 2LB9A 4LFUA 1TVFA 4NEED 1W63Q 1A0KA 4FUWA 3LEZA 3P01A 4S2LA 3NOUC 1LL8A 4NXFA 5GLBA 1K4EA 1XJ4A 1MWTA 3ZDJA 2A24A 2PU2A 4P6BA 3MKEA 3NBLA 4P87A 1DJAA 1J3WA 3UE3A 4MEZA 5EVIC 2UV0E 5HFOA 3F1OA 2WGWB 4DJ2A 5EM0A 4HP9A 1NJ4A 5HL6A 3G2YA 3UY6A 3LIAA 4WUJA 1S67L 5DFXA 1ES4A 2Z6DA 3WS1A 2W3DA 1N9BA 1PWCA 4ZTKA 3A0VA 1LSXA 4ARZB 3NIAA 4D60A 4WBGA 5CHUA 5CX7A 4ETZA 1XGIA 2HP6A 3LYXA 4HESA 3UE6A 4OP8A 5E2GA 4OKPA 1KE4A 2XD1A 3MR0A 4LPZA 4I39A 5DF9A 4B88A 1NZUA 3BY8A 2ZOIA 1VHMA 4WMCA 3JPUA 1CF0A 5DF8A 1G28A 3BW6A 3UE0A 4KZ6A 2PD8A 2DRWA 2PBDP 4PM8A 1P9WA 4ZAMA 4X25A 4IUHA 2Y2LA 3BYDA 2V8FA 1XP4A 3P09A 3B42A 2PR6A 1P0ZA 1ALQA 1GHPA 5FL3A 3ZVTA 4S2MA 3BFEA 4UA7A 3U4LP 3V5MA 2ZMAA 3GTCA 1H5XA 2P08A 4LRZE 4NXBA 3R7WA 2GJ3A 3LIEA 3IBRA 1WYBA 3PYPA 1ERMA 2XA7S 5L10A 4FH2A 4Y3IA 1OTDA 4Y0TA 5KMWA 3VSLA 4MLLA 3L7HA 4S2IA 1T1BA 2HGVA 3OCNA 3W4OA 3MMHA 3Q07A 4GHIA 2EA9A 1I2WA 5HWWA 1ZHHB 2ZC3B 1NLYA 1TDLA 2Y59A 4N1HA 4KUOA 3B3XA 3VP3A 3SS5A 4OVDA 2QZ6A 3DTEA 3UPNA 2PDRA 4EETB 1QMEA 4KZ7A 4X68A 5FQIA 2J3WA 4RYEA 4JF6A 2R9WA 3IF6B 3HLWA 4O01A 3HLCA
chains in the Genus database with same CATH topology
1JNUA 2ZOHA 2L0WA 1GSWA 4DN0A 3LIDA 4HJ6A 1OPXA 3V67A 4GJ4A 3T4KA 3UMEA 3MXQA 3CI6A 1X0OA 3PBTA 2XSSA 5J7EA 3UB8A 2VKSA 3U2AA 5HDDA 1GSXA 5J4EA 4F3LA 3LI8A 4OOLA 1H8MA 5DJUA 5C5KA 3G6OA 4YNRA 4I5SA 5TJJA 4EW7A 3EGXC 2EWVA 1YKDA 3IBJA 5F6AA 4L9EA 2M7UA 2JKTM 4I38A 2Z6CA 4NXGA 5HZHA 3T4LA 3PBRA 3GDIA 3E0YA 2D01A 5DKLA 4F3LB 3EEAA 3NJAA 3CITA 4I3JA 3T4JA 4O8GA 3TW8A 1G6OA 1F5MA 1S1ZA 5HD5A 4HJ4A 5IT5A 4P6ZS 3PHYA 4HH2A 2JKTI 1T19A 4BBUA 5MC7A 3LR4A 2QJ7A 4R6LA 4XT2A 3KX0X 4Q0JA 1YSQA 1TD5A 2W3FA 3KSIA 5IS1A 1NLZA 3S7NA 2V1BA 3CAXA 5HD3A 1DRMA 1N9LA 1S4SA 2XRNA 1DP6A 5DFYA 4Z1WA 3C30A 2V0WA 1N9NA 1UGUA 2FZ0A 3O5YA 3E98A 3PR6A 4R38A 4JGQA 2VV7A 4NKPA 4I3AA 4KQDA 3IS2A 2NUPC 4CLCB 4CQHA 2J3TC 3FG8A 4PKYA 3OBFA 1MZUA 2OWJA 3UB7A 1KOUA 1ODVA 4JGPA 3JVVA 2P04A 4Y2FA 3LR5A 2A2LA 3NOTC 3D72A 4II7A 2EWWA 3ZQ5A 1BYWA 3MF0A 4BBTA 2WKPA 3ICYA 2XA7M 4H6JB 4KUKA 3RH8B 4WF0A 3KSGA 2VLGA 3OC2A 3F1PA 2DMWA 3H7WA 2K7SA 1VB6A 3A0SA 1T1CA 2PD7A 2VV8A 3NOPC 1LSWA 5F5YA 2YKHA 2JHEA 3OOVA 2GNXA 3GECA 2NUTC 2A24B 5F68A 4YWZA 1OJGA 2HV1A 2WKQA 4EEUA 2B18A 4DJ3A 2KDKA 1TS6A 5IU1A 4LRXC 2O99A 1OTAA 3EWKA 4GW9A 1TS8A 3NHQA 4GCZA 4MN5A 2PYRA 1IOUA 1TS0A 4M4XA 3BWLA 3KYZA 2W27A 2ZBBA 3EGDC 1T1AA 5J3WA 3B33A 3EQUA 3P7NA 4CLCC 3LR3A 5AVEA 3F1OB 3CWFA 3PXPA 4MMNA 2VX8A 3FPWA 5I5LA 1F98A 4EESA 2PHYA 2W1RA 3KSHA 4UQIM 2PR5A 2ZMVA 1OJ5A 4DMZA 4GLQA 4BBVA 2W3EA 1DP8A 4CLCE 2J3TD 4UEYA 4PAUA 4Q0IA 4KQOA 2R78A 3SW1A 5EFWA 2KOIA 4HP4A 4PKYG 3KYQA 2VEAA 1LSVA 2V9AA 5HSQA 1IFQA 1WA9A 4HHDA 4EQ1A 3LIFA 2JKRM 2HF6A 4GS9B 4O0PA 5HWVA 1GSVA 1NRJA 5HDSA 1STZA 5HPFA 3PBNA 3MFXA 3EOIA 4B9OA 3PBQA 3BY9A 3FC7A 4ZRRA 4WLAA 3DBAA 5G4YA 5AJGA 4FOFA 2JKRI 1N9OA 1YSPA 2QKPA 3UB9A 2D02A 3KO6A 3RFBA 1XFQA 2V1AA 2YKFA 1UWNX 2K2NA 4EU0A 4CLCA 4NXEA 1OTBA 1XJ6A 4WL9A 3B47A 3K2NA 3LFVA 2J80A 3MQ0A 4CLCD 4YOFA 4L9FA 3MQQA 5HDCA 4MN6A 2HJ9C 1S4RA 3HJIA 4FSFA 4HQAA 4WELA 4O01A 3MQOA 2H28A 4MN7A 2O9BA 4H6JA 3VV4A 3BQAA 4IUKA 4HH3A 3S7OA 2LB9A 3EQVA 1MC0A 4NEED 1W63Q 3H82B 3P01A 3NOUC 1LL8A 4NXFA 1XJ4A 2A24A 2QYBA 2OOLA 3FPVA 2QWSA 3CLOA 2V0UA 3F1NB 2VGLM 3LICA 5F69A 3A0RA 3R7WB 4Y5FA 3VE3A 3KSFA 4HOIA 3T4QA 1P97A 3UE3A 5DKKA 3T4OA 3F1OA 5DJTA 3T4TA 3EEHA 3H9WA 4JGRA 1W63M 3VOLA 2KX6A 4G3VA 3R4KA 4DJ2A 4Q0HA 1DP9A 1H3QA 4HP9A 4WEJA 1T18A 5HL6A 4L0LA 4EUVA 3LIAA 3OCLA 4GHIB 3LUQA 4WUJA 2O0YA 1S67L 1D7EA 5DFXA 5A8BA 3E4OA 4JGOA 4HI4A 2W1TB 2Z6DA 1OT9A 2W3DA 1OT6A 3A0VA 1LSXA 4ARZB 4LRYC 3S7PA 5KSHA 1F9IA 2LB5A 4GS9A 4IJGA 5CX7A 4ETZA 5KIZA 4HJ3A 2XROA 3C2WA 3LYXA 1V9ZA 4IHQA 3UE6A 2P7JA 1ZTUA 2PT7A 4OOMA 2CMNA 2W3GA 5TBMB 3W2ZA 3UMDA 2GZAA 3C38A 3UB6A 1TS7A 2JN7A 3MR0A 4LPZA 1OTEA 4HIAA 5AVFA 2Y79A 4I39A 5DF9A 4G3KA 2I9VA 2O9CA 3BY8A 3T4SA 2VV6A 5LBRA 2VJWA 2ZOIA 3PBSA 1VHMA 1UWPX 2WKRA 4B93A 1G28A 3BW6A 2B02A 2L1MA 2IA2A 1P9RA 2VZWA 2PD8A 3BJNA 3K3CA 1P9WA 1Y28A 4IUHA 3PBOA 1XJ2A 5K5BA 2QHKA 5L8MA 1LT0A 1D06A 1TF1A 4K08A 3B42A 4RQ9A 4MCWA 3E4QA 2MJ6A 2PR6A 1P0ZA 5FL3A 4P6ZM 2M1CA 4EXOA 3H82A 3CUEA 2BASA 3OLOA 4E04A 2P08A 5G4ZA 3F1NA 4LRZE 2ZMFA 2M7VA 4PHTA 4BWIA 3ULFA 4LLOB 4NXBA 3R7WA 4I3IA 4XT2B 1MKMA 2GJ3A 3LIEA 4BMWA 3IBRA 2OAQ1 1YAXA 3PYPA 3ZYTA 3LI9A 1V9YA 2Y8HA 4G3WA 2XA7S 1EW0A 4MDZA 3RTYA 4Y3IA 2K31A 1OTDA 3C8CA 2VGLS 4WEKA 1XJ3A 4AFIA 2O9AA 2GX5A 4QPRA 4HNBA 4R70A 1T1BA 1XFNA 3MJQA 3LIBA 3HCYA 2HGVA 3HJKA 2G7UA 3OCNA 4EERA 3TRCA 2INWA 3MMHA 3T50A 2L4RA 4GHIA 2EA9A 1OTIA 3E4PA 4ETXA 3TE8A 3IS2B 3JVUA 5HWWA 2FH5A 2W1TA 1ZHHB 4ME4A 4BJPA 4EEPA 1NLYA 4WN5A 3S7QA 4ARZA 4HY8A 3BQ8A 4KUOA 2OWHA 3TJZC 4L9GA 5HPIA 2W3HA 2PDRA 2QJ5A 4EETB 2W0NA 4UQIS 2OAP1 5TBMA 2KLIA 3CUEC 3D3OA 3F1PB 3H7WB 3LR0A 5HWTA 1NWZA 3VE4A 2J3WA 4R3AA 1S1YA 1S66L 2VA0A 3K3DA 2PYPA 2HJEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JNU A;  2ZOH A;  2L0W A;  1GSW A;  3LID A;  4HJ6 A;  3UME A;  3MXQ A;  1X0O A;  5J7E A;  3UB8 A;  5HDD A;  1GSX A;  5J4E A;  4F3L A;  3LI8 A;  5DJU A;  3G6O A;  4I5S A;  4EW7 A;  5F6A A;  4L9E A;  4I38 A;  2Z6C A;  4NXG A;  5HZH A;  3GDI A;  2D01 A;  5DKL A;  4F3L B;  3NJA A;  4I3J A;  1S1Z A;  5HD5 A;  4HJ4 A;  3PHY A;  4HH2 A;  1T19 A;  4BBU A;  2QJ7 A;  4R6L A;  4XT2 A;  3KX0 X;  5IS1 A;  2V1B A;  3CAX A;  5HD3 A;  1DRM A;  1N9L A;  1S4S A;  1DP6 A;  2V0W A;  1N9N A;  1UGU A;  4R38 A;  4JGQ A;  2VV7 A;  4I3A A;  4KQD A;  3IS2 A;  3FG8 A;  4PKY A;  1MZU A;  2OWJ A;  3UB7 A;  1KOU A;  1ODV A;  4JGP A;  3NOT C;  3D72 A;  3ZQ5 A;  1BYW A;  4BBT A;  2WKP A;  3ICY A;  4H6J B;  4KUK A;  3RH8 B;  4WF0 A;  2VLG A;  3F1P A;  3H7W A;  2K7S A;  1VB6 A;  3A0S A;  1T1C A;  2PD7 A;  2VV8 A;  3NOP C;  1LSW A;  5F5Y A;  2YKH A;  2JHE A;  3GEC A;  2A24 B;  5F68 A;  4YWZ A;  1OJG A;  2HV1 A;  2WKQ A;  4EEU A;  4DJ3 A;  2KDK A;  1TS6 A;  5IU1 A;  4LRX C;  1OTA A;  3EWK A;  4GW9 A;  1TS8 A;  3NHQ A;  4GCZ A;  4MN5 A;  2PYR A;  1TS0 A;  4M4X A;  3BWL A;  2W27 A;  2ZBB A;  1T1A A;  5J3W A;  3B33 A;  3P7N A;  5AVE A;  3F1O B;  3CWF A;  5I5L A;  1F98 A;  4EES A;  2PHY A;  2PR5 A;  1OJ5 A;  4BBV A;  1DP8 A;  2R78 A;  3SW1 A;  5EFW A;  4HP4 A;  4PKY G;  2VEA A;  1LSV A;  2V9A A;  5HSQ A;  1WA9 A;  4HHD A;  4EQ1 A;  3LIF A;  4GS9 B;  5HWV A;  1GSV A;  5HDS A;  3MFX A;  4B9O A;  3BY9 A;  3FC7 A;  4WLA A;  5G4Y A;  1N9O A;  2QKP A;  3UB9 A;  2D02 A;  1XFQ A;  2V1A A;  2YKF A;  1UWN X;  4NXE A;  1OTB A;  1XJ6 A;  4WL9 A;  2J80 A;  4L9F A;  3MQQ A;  5HDC A;  4MN6 A;  1S4R A;  3HJI A;  4HQA A;  3MQO A;  2H28 A;  4H6J A;  4HH3 A;  3H82 B;  3NOU C;  1LL8 A;  4NXF A;  1XJ4 A;  2A24 A;  2OOL A;  2QWS A;  3CLO A;  2V0U A;  3F1N B;  3LIC A;  5F69 A;  3A0R A;  3VE3 A;  4HOI A;  1P97 A;  5DKK A;  3F1O A;  5DJT A;  3EEH A;  3H9W A;  4JGR A;  3VOL A;  2KX6 A;  4DJ2 A;  1DP9 A;  4HP9 A;  1T18 A;  3LIA A;  4GHI B;  3LUQ A;  4WUJ A;  1S67 L;  1D7E A;  5A8B A;  3E4O A;  4JGO A;  4HI4 A;  2Z6D A;  1OT9 A;  1OT6 A;  3A0V A;  1LSX A;  4LRY C;  1F9I A;  4GS9 A;  5KIZ A;  4HJ3 A;  3C2W A;  3LYX A;  1V9Z A;  3UE6 A;  2P7J A;  2CMN A;  5TBM B;  3UMD A;  3UB6 A;  1TS7 A;  2JN7 A;  3MR0 A;  4LPZ A;  1OTE A;  4HIA A;  5AVF A;  4I39 A;  2I9V A;  3BY8 A;  2VV6 A;  2ZOI A;  1UWP X;  2WKR A;  1G28 A;  2B02 A;  2L1M A;  2PD8 A;  3K3C A;  1Y28 A;  1XJ2 A;  2QHK A;  1LT0 A;  1D06 A;  4K08 A;  4RQ9 A;  3E4Q A;  2PR6 A;  1P0Z A;  2M1C A;  4EXO A;  3H82 A;  2BAS A;  3OLO A;  4E04 A;  5G4Z A;  3F1N A;  4LRZ E;  3ULF A;  4LLO B;  4NXB A;  4I3I A;  4XT2 B;  2GJ3 A;  3LIE A;  3IBR A;  3PYP A;  3LI9 A;  1V9Y A;  1EW0 A;  3RTY A;  1OTD A;  3C8C A;  1XJ3 A;  4HNB A;  4R70 A;  1T1B A;  1XFN A;  3MJQ A;  3LIB A;  3HJK A;  4EER A;  2INW A;  3T50 A;  2L4R A;  4GHI A;  2EA9 A;  1OTI A;  3E4P A;  3IS2 B;  5HWW A;  4EEP A;  4WN5 A;  4HY8 A;  4KUO A;  2OWH A;  4L9G A;  2PDR A;  2QJ5 A;  4EET B;  2W0N A;  5TBM A;  3F1P B;  3H7W B;  3VE4 A;  5HWT A;  1NWZ A;  4R3A A;  1S1Y A;  1S66 L;  3K3D A;  2PYP A; 
#chains in the Genus database with same CATH topology
 1BUL A;  1OPX A;  3V67 A;  1X0O A;  3IT9 A;  4M3K A;  3DW0 A;  3UB8 A;  2VKS A;  3U2A A;  2Q0O A;  1H8M A;  2H0Y A;  5DJU A;  5C5K A;  1YPR A;  4EW7 A;  4QWO A;  1VET B;  3IBJ A;  4JXV A;  4WMC D;  2HDQ A;  5HAI A;  2AVX A;  3BFD A;  3GDI A;  3BRM A;  4K0X A;  3MXR A;  3BFG A;  5EV0 A;  3UN7 A;  1IKG A;  4O8G A;  1YLJ A;  5HD5 A;  4KZ3 A;  5FDS A;  1K25 A;  3PHY A;  3QNB A;  2Y2M A;  4GN2 A;  3ZG5 A;  1G5U A;  5MC7 A;  3TG9 A;  1YSQ A;  1AWI A;  3T1S A;  5F1F A;  2V1B A;  5CXW A;  3CAX A;  3TOI A;  1DRM A;  1PI5 A;  1S4S A;  4EBP A;  1PNE A;  3ZCZ A;  3O5Y A;  3RXW A;  3E98 A;  4Z9Q A;  3PR6 A;  4R38 A;  4JGQ A;  2VV7 A;  3SH7 A;  3IS2 A;  5EE8 A;  3FG8 A;  4RA7 A;  3S4X A;  4E3J A;  4N92 A;  2J7V A;  1RP5 A;  4U0X A;  4Y2F A;  3D72 A;  4E3N A;  1CQA A;  4KZ4 A;  2Y2Q A;  3UNW A;  4PM6 A;  4GD6 A;  2DMW A;  3UDF A;  2XD5 A;  1T1C A;  3NOP C;  2A49 A;  4RX2 A;  5F5Y A;  4RX3 A;  3O88 A;  2NUT C;  2A24 B;  1OJG A;  2WKQ A;  2OLV A;  1TS6 A;  2Q9N A;  1K38 A;  4FTX A;  3ITA A;  2OLU A;  4GW9 A;  1TS8 A;  4MN5 A;  3W8K A;  4KQR A;  4HBT A;  3BWL A;  1JWP A;  4S2N C;  2IWB A;  1KVM A;  3O87 A;  5AVE A;  3F1O B;  3PTE A;  4MBH A;  2ZLY A;  3PXP A;  4MMN A;  1K6S A;  1F98 A;  3E2K A;  2PR5 A;  2EFX A;  2ZMV A;  4OQG A;  1DP8 A;  3VMA A;  2J3T D;  4CLC E;  1LL5 A;  2I72 A;  1K6R A;  1KE3 A;  1H8Z A;  2KOI A;  5EFW A;  1NXY A;  5HAR A;  1JWV A;  4S2O A;  4HHD A;  3GV9 A;  4OPR A;  4O0P A;  4ZJ3 A;  2ZC5 B;  2RL3 A;  3ZFZ A;  3AGF A;  4KG2 A;  1STZ A;  1ES3 A;  3EOI A;  4B9O A;  3QP8 A;  5A93 A;  1L3L A;  4WLA A;  1FCO A;  2XLN A;  1MWR A;  3A3D A;  5AQA A;  2H5S A;  4FOF A;  4LV2 A;  1N9O A;  1YSP A;  2D02 A;  4R1G A;  3SH9 A;  3KO6 A;  1K54 C;  3HLB A;  5TFQ A;  2V1A A;  1PZO A;  2YKF A;  4CJN A;  4EU0 A;  4CLC A;  1XJ6 A;  4OH0 A;  4WL9 A;  4RVA A;  3QP4 A;  1KDS A;  4QHC A;  4L9F A;  5GL9 A;  5HDC A;  3SS3 A;  1S4R A;  3RXX A;  2JE5 A;  1IYS A;  5EVE A;  3MQO A;  2H28 A;  3Q82 A;  3GQZ A;  1NYM A;  4IUK A;  2C6W B;  3N4I A;  3EQV A;  1ESU A;  3GMW A;  3BEB A;  3FZC A;  4EUZ A;  5FAP A;  2QYB A;  3VOZ A;  2QWS A;  3CLO A;  3LEQ A;  2HZ5 A;  3LIC A;  4K0W A;  4QD4 A;  3A0R A;  4FH4 A;  3R7W B;  1VEU A;  3KSF A;  3UE1 A;  5EEC A;  5DKK A;  3T4O A;  1BSG A;  5DJT A;  3T4T A;  3IXB A;  2ZM2 A;  4JGR A;  3VOL A;  4GNU A;  4GOG A;  4Q0H A;  2Y2I A;  4WEJ A;  3D9Y A;  2Y2O A;  4EUV A;  4GHI B;  2O0Y A;  4JPM A;  1BLH A;  2HP5 A;  4C6Y A;  3T1X A;  3HUM A;  3A3E A;  1OT6 A;  1BLS A;  4DE3 A;  5HX9 A;  1JWZ A;  4KZ8 A;  4DKI A;  3A3F A;  1D1J A;  4OLD A;  1CK3 A;  4IJG A;  3FWL A;  4HJ3 A;  2PT7 A;  5GLD A;  2Q9M A;  3C38 A;  3T12 B;  4OP5 A;  2G2W A;  4ZDX A;  1OTE A;  3WS4 A;  1M6K A;  2Y79 A;  4G3K A;  2I9V A;  1K57 C;  2ZM0 A;  1UWP X;  2DCF A;  4U0T A;  2B02 A;  3ITB A;  5EVI D;  2VGJ A;  4IVK A;  3CHW P;  3Q7V A;  3A3J A;  4ZJ1 A;  3W4Q A;  5CHJ A;  3N8R A;  1XJ2 A;  1D06 A;  3MZE A;  1G6A A;  2ZQA A;  5BOH A;  3E4Q A;  1BLC A;  1DJB A;  4LV0 A;  2DNS A;  4HBU A;  1XGJ A;  3ZNT A;  5FSR A;  3IX8 A;  2BLS A;  3OLO A;  3WS2 A;  4E04 A;  3NUL A;  3SS4 A;  5FAS A;  3F1N A;  3IXH A;  4EBN A;  5EOE A;  1MKM A;  1GA9 A;  2HDU A;  1FR6 A;  2V2F F;  4LEN A;  4E3K A;  3NDG A;  3LI9 A;  2PU4 A;  2Y8H A;  4G3W A;  4IBX A;  4JBF A;  1ES5 A;  2K31 A;  3D4F A;  3KYE A;  2O9A A;  1H0M A;  3ISG A;  4HNB A;  4JKT A;  3MJQ A;  4BD1 A;  1YLW A;  5FAQ A;  2CC1 A;  2INW A;  3T50 A;  1OTI A;  3E4P A;  4ETX A;  1EI5 A;  3IS2 B;  4S2K A;  2FH5 A;  4ME4 A;  3DTM A;  4BJP A;  4DDY A;  1YMS A;  4L9G A;  5HPI A;  4KG6 A;  2P9V A;  1Z09 A;  2HP9 A;  4WZ5 C;  5TBM A;  3WS0 A;  1YLY A;  4N9L A;  3CUE C;  3D3O A;  3LR0 A;  5HWT A;  1NWZ A;  3VE4 A;  5FEG A;  4R3A A;  2BG1 A;  3K3D A;  2JCH A;  2ZOH A;  1GSW A;  3TSG A;  3LID A;  4HJ6 A;  1SDN A;  3UME A;  2IWC A;  1GCE A;  3PBT A;  2XSS A;  3I7J A;  1NYY A;  4R3B A;  3HUO A;  3LI8 A;  3LO7 A;  4WZ4 A;  1PW8 A;  4I5S A;  5TJJ A;  1J9M A;  3WS5 A;  4L9E A;  2M7U A;  4DE0 A;  3T4L A;  3V3S A;  3E0Y A;  3AGD A;  1ZC2 A;  4BLM A;  1E3U A;  4F3L B;  3BLS A;  4I3J A;  1F5M A;  4LCL A;  1K0K A;  5L09 A;  3HL9 A;  5G18 A;  2R9X A;  3IF6 C;  1MBL A;  2QJ7 A;  1K55 A;  3M2K A;  3KX0 X;  2W3F A;  3KSI A;  3UB5 P;  3HLF A;  5IS1 A;  4PM5 A;  3GR2 A;  5HD3 A;  1N9L A;  1PWD A;  4Y15 A;  3C30 A;  3V39 A;  2V0W A;  1N9N A;  1UGU A;  2WUQ A;  5CEC A;  4NKP A;  2NUP C;  1IKI A;  4CLC B;  3QHY A;  2E8J A;  3W4P A;  2XFS A;  2FFY A;  2P04 A;  1IEM A;  2A2L A;  3NOT C;  2VGK A;  1BYW A;  3MF0 A;  4BBT A;  2WAE A;  5DTS A;  4EQI A;  1QMF A;  4WF0 A;  3KSG A;  4YIN A;  3F1P A;  2K7S A;  1KDW A;  1VB6 A;  2VV8 A;  3A0S A;  4UA9 A;  5F83 A;  3IX3 A;  1YMX A;  2XDM A;  4OON A;  3BFF A;  3OOV A;  2GNX A;  3E2L A;  3MSH A;  3L9K A;  3IHA A;  4DJ3 A;  2KDK A;  4DDS A;  1W8Y A;  1DJC A;  1FCM A;  4KZB A;  1VEU B;  3IXG A;  1IOU A;  4CPK A;  4M4X A;  2WGI A;  2Y2N A;  3EGD C;  5FEF A;  2EFU A;  4N9K A;  5J3W A;  5CED A;  5FI2 A;  3CWF A;  3ZG9 B;  2C5W B;  5GLC A;  4EES A;  2PHY A;  4UQI M;  1OJ5 A;  4DMZ A;  3PAG A;  4KG5 A;  3CPT A;  4PAU A;  4KQO A;  1LI0 A;  3SW1 A;  4HP4 A;  4NK3 A;  4FCF A;  3NC8 A;  3NEC A;  5HSQ A;  5GHZ A;  3VSK A;  3ZG7 B;  3LY4 A;  1HZO A;  5D3O A;  4BL2 A;  1E3U D;  4Y0O A;  3BY9 A;  3T1R A;  3DBA A;  5G4Y A;  4S2P A;  3DTK A;  1NRF A;  5GHX A;  3UB9 A;  3GVB A;  3UDI A;  3VP0 A;  3RFB A;  1UWN X;  4KZA A;  1GHI A;  1OTB A;  3B47 A;  3K2N A;  1SZV A;  3Q7V B;  3MQQ A;  4MN6 A;  3HJI A;  4FSF A;  3FYZ A;  1TDG A;  2O9B A;  1CI8 A;  4H6J A;  3O3V A;  5KSC A;  3BQA A;  2PRF A;  4GB7 A;  3Q81 A;  2EX9 A;  2Y91 A;  5L07 A;  3MZD A;  5HW3 A;  4PMA A;  5GHY A;  4QJG A;  1Q2Q A;  3CZD A;  1FR1 A;  1PYY A;  1IYQ A;  3DWZ A;  3F1N B;  1FIK A;  2VGL M;  5F69 A;  3OPR A;  4E3M A;  3OZH A;  4Y5F A;  4O7D A;  3VE3 A;  1P97 A;  3OPP A;  4XXR A;  3N8S A;  3G34 A;  3G31 A;  4N1X A;  1MWS A;  4S2J A;  3H9W A;  1KGE A;  4GDN A;  3MFD A;  3R4K A;  1DP9 A;  1MKI A;  2XF3 A;  1ZG6 A;  4IBR A;  5IHV A;  3OCL A;  1BT5 A;  3JYI A;  5A8B A;  4ID4 A;  3E4O A;  4KEN B;  1OT9 A;  1S6R A;  5FA7 A;  3S7P A;  1F9I A;  4IVI A;  2LB5 A;  4GS9 A;  5KIZ A;  3C2W A;  3VP4 A;  4DXB A;  1ONG A;  2CMN A;  4JXS A;  2W3G A;  5TBM B;  3W2Z A;  1ERQ A;  2FFF B;  2GZA A;  4OPZ A;  2JN7 A;  1ONH A;  4KZ5 A;  5AVF A;  1SDE A;  3M6H A;  3AGE A;  5JYP A;  4LCM A;  3T4S A;  4DE1 A;  5LBR A;  2VJW A;  2WKR A;  5EVI A;  1BLP A;  1ZG4 A;  2IA2 A;  1P9R A;  3VOY A;  3ZG8 B;  5EM1 A;  3A3I A;  4K91 A;  4OLG A;  3K3C A;  3PBO A;  2ZM8 A;  1YLZ A;  1LT0 A;  5L8M A;  1TF1 A;  4K08 A;  4E3I A;  4LGW A;  4MCW A;  1SKO A;  3GSG A;  1KGG A;  3C7V A;  3H82 A;  3CUE A;  1Q2P A;  4R0Q A;  5DTT A;  2B95 A;  2BAS A;  1W79 A;  3IH8 A;  1DY6 A;  1SHV A;  3DWK A;  5TR7 A;  2WAF A;  3HUN A;  1JTD A;  5FI7 A;  5CGW A;  2IWD A;  2M7V A;  4PHT A;  4BWI A;  3ULF A;  4LLO B;  1L0G A;  3UDX A;  3FKW A;  3ZYT A;  1V9Y A;  4MDZ A;  4OPY A;  2VGL S;  4WEK A;  4AFI A;  4QPR A;  1RCJ A;  1XFN A;  3ZHH A;  3LIB A;  3HCY A;  3HJK A;  3QP5 A;  2ZL1 A;  3TRC A;  4BQM A;  4JXW A;  2X02 A;  3TE8 A;  2W1T A;  1SKF A;  4Y13 A;  4WN5 A;  3S7Q A;  4HY8 A;  4DRT A;  3BQ8 A;  2OWH A;  1ACF A;  3M6B A;  3IF6 A;  1O07 A;  4DXC A;  3G32 A;  2QJ5 A;  2W0N A;  2OAP 1;  3IF5 A;  5E2E A;  5I94 A;  4OPQ A;  3F1P B;  4D2O A;  4GD8 A;  3UPP A;  1L0F A;  1S1Y A;  1XXM A;  4QY6 A;  1S0W A;  4X56 A;  2PYP A;  2Y55 A;  1RGZ A;  1JNU A;  2L0W A;  3ZNY A;  4LV1 A;  1C3B A;  4GJ4 A;  3VP2 A;  4EV4 A;  3MXQ A;  3CI6 A;  5J7E A;  2Y2P A;  1F2K A;  4GDB A;  1O7E A;  1FSY A;  4A5R A;  2ZQD A;  1Y4O A;  4Q8I A;  1K56 A;  2JKT M;  2Z6C A;  1L0D A;  5FQQ A;  5FQM A;  2EX2 A;  5EOO A;  3CPT B;  2VK3 A;  3NJA A;  3CIT A;  3T4J A;  1H8Y A;  3TW8 A;  1G6O A;  4HJ4 A;  5IT5 A;  3C4O A;  4HH2 A;  4X69 A;  2JKT I;  1T19 A;  2RCX A;  4BBU A;  3LR4 A;  4XT2 A;  1TD5 A;  1XA7 A;  1NLZ A;  4GKU A;  3S7N A;  3VFH A;  1L0E A;  4MNR A;  3HBR A;  3WRZ A;  5A92 A;  5DFY A;  2Y2H A;  3Q1F A;  2WZX A;  4Z1W A;  5U47 A;  1IYO A;  2HDR A;  4UAA A;  4EWF A;  2ZJ9 A;  4KQD A;  3P98 A;  2WGV A;  2ZQ7 A;  3NCK A;  5FQ9 A;  1IEL A;  2V1Z A;  3OBF A;  1MZU A;  2OWJ A;  3UB7 A;  1KOU A;  5CEB A;  3JVV A;  2Z2M B;  3IWO A;  2EWW A;  2QMI A;  3ZQ5 A;  1MWU A;  4H6J B;  2XA7 M;  2B5R A;  4KUK A;  5A90 A;  5M19 A;  4F94 A;  3HLE A;  2VLG A;  5TGF A;  4OOY A;  1ZKJ A;  3H7W A;  5JYO A;  1MXO A;  1LSW A;  2JHE A;  3ZGA B;  1TEM A;  2WKI A;  3HVF A;  5CGX A;  1GA0 A;  4NET A;  5F68 A;  2E8I A;  4YWZ A;  3MZF A;  4JF5 A;  4JLF A;  2O99 A;  1OTA A;  1NY0 A;  3EWK A;  4GCZ A;  1CJF A;  2Z2L B;  5CHM A;  4H8R A;  2ZBB A;  3EQU A;  3P7N A;  4X53 A;  4R3J A;  3SOI A;  4CLC C;  4JF4 A;  5AQB A;  3FPW A;  1LL9 A;  4Y7P A;  2OSU A;  4U3T A;  4GLQ A;  2W3E A;  1RGY A;  4WM9 A;  2R78 A;  1W8Q A;  4PKY G;  1XX2 A;  2V8C A;  2V9A A;  1WA9 A;  4QY5 A;  1HVB A;  1PFL A;  2EXA A;  3LIF A;  1K56 D;  3IWQ A;  2JKR M;  2HF6 A;  4GS9 B;  5HWV A;  4E3O A;  2JBF A;  5HDS A;  5DTK A;  1PRQ A;  2J9O A;  3FC7 A;  4MBF A;  1VM1 A;  3HRE A;  2WYX A;  3IX4 A;  4HEF A;  2ZC7 A;  2WAD A;  4OQ0 A;  5AJG A;  2JKR I;  4PM7 A;  3C7U A;  2QKP A;  4S2N A;  2EX6 A;  5EVI B;  5F82 A;  4NXE A;  1E25 A;  1WYC A;  3LFV A;  2J80 A;  1ERO A;  3MQ0 A;  4X6T A;  3MS6 A;  1I2S A;  2XEP A;  5GLA A;  2XR0 A;  2ZC6 B;  3QP6 A;  1HTZ A;  1G68 A;  5AQ7 A;  1SKO B;  3Q7Z A;  3FV7 A;  1MC0 A;  2OV5 A;  3ZVW A;  4DE2 A;  3QNC A;  5A91 A;  3H82 B;  2ZQ9 A;  3S1Y A;  4GZB A;  1W7F A;  2OOL A;  3FPV A;  4XUZ A;  1ES2 A;  3MKF A;  2V0U A;  2GDN A;  1JVJ A;  4BL3 A;  1VQQ A;  5M1A A;  3QP1 A;  2V20 A;  4HOI A;  3T4Q A;  4IED A;  4LV3 A;  5FAT A;  1YLT A;  4BD0 A;  1BUE A;  1K54 A;  2WZZ A;  3EEH A;  5L2F A;  1W63 M;  2KX6 A;  2PBY A;  3IWI A;  4G3V A;  4Y0U A;  1H3Q A;  1KVL A;  1T18 A;  1LHY A;  4Y17 A;  2ZL1 B;  4L0L A;  4YFM A;  3LUQ A;  1D7E A;  1YLP A;  4JGO A;  4HI4 A;  5FI6 A;  2W1T B;  4LRY C;  5KSH A;  3O86 A;  4MBK A;  2JC7 A;  2XRO A;  2ZQ8 A;  1V9Z A;  4IHQ A;  2P7J A;  1ZTU A;  2H0T A;  4OOM A;  4DF6 A;  5EPH A;  1PZP A;  3UMD A;  3UB6 A;  4P0M A;  1TS7 A;  3SZT A;  1KGF A;  4HIA A;  2J8Y A;  2WKH A;  1MY8 A;  2O9C A;  3UPO A;  2VV6 A;  3PBS A;  5J8X A;  4B93 A;  2L1M A;  1XKZ A;  2VZW A;  1YT4 A;  3BJN A;  1Y28 A;  4X55 A;  1SCW A;  4OQH A;  2WK0 A;  5K5B A;  2QHK A;  3VP1 A;  3T1Q B;  1FSW A;  4RQ9 A;  3FKV A;  1BTL A;  2MJ6 A;  1FIL A;  3CMZ A;  1GHM A;  3C5A A;  3BLM A;  4P6Z M;  5HL1 A;  2M1C A;  4EXO A;  4E3L A;  3HLD A;  5G4Z A;  4UHU A;  2ZMF A;  3BFC A;  4OQI A;  4I3I A;  2JKF A;  4XT2 B;  4BMW A;  1PW1 A;  5DF7 A;  2OAQ 1;  1YAX A;  1JTG A;  3NY4 A;  1EW0 A;  1BZA A;  3RTY A;  4FD8 A;  3C8C A;  5F1G A;  1K57 A;  1M40 A;  1CEG A;  1XJ3 A;  2GX5 A;  2XH9 A;  4ZJ2 A;  2Y2J A;  2WGW A;  4R70 A;  4XUX A;  5CTN A;  1NZO A;  2G7U A;  4EER A;  1XPB A;  2L4R A;  3JVU A;  2ZQC A;  2Y2K A;  4C3Q A;  4E6X A;  4EEP A;  4QU3 A;  1W5D A;  1OME A;  4KZ9 A;  3CG5 A;  4ARZ A;  4E6W A;  3MXS A;  3TJZ C;  2W3H A;  4UQI S;  3OPL A;  2KLI A;  1HD8 A;  3H7W B;  1K55 C;  2UWX A;  3G4P A;  2H10 A;  3VFF A;  3PAE A;  2JKG A;  3IH9 A;  1S66 L;  4R4S A;  2VA0 A;  5FAO A;  1Z6F A;  2HJE A;  5AQ9 A;  2P9V B;  3SH8 A;  5FQJ A;  4DN0 A;  2J9P A;  2XGN A;  4PM9 A;  3T4K A;  2A3U A;  3HLG A;  2HPB A;  3M2J A;  2ACG A;  5CER A;  5EVL A;  5HDD A;  1MPL A;  1GSX A;  5J4E A;  4F3L A;  4OOL A;  3G6O A;  4YNR A;  1PIO A;  3EGX C;  2EWV A;  1YKD A;  5F6A A;  1U60 A;  4I38 A;  5EUA A;  4NXG A;  5HZH A;  2Y4A A;  3PBR A;  1K4F A;  2D01 A;  5DKL A;  3V3R A;  3EEA A;  1LI9 A;  4UA6 A;  3CJM A;  1CI9 A;  5FDH A;  1KE0 A;  1CEF A;  1S1Z A;  2XK1 A;  5M18 A;  4P6Z S;  2XQZ A;  4WZ5 A;  1ESI A;  2WKE A;  1LLB A;  1N4O A;  4R6L A;  3G30 A;  4R23 A;  4Q0J A;  2X01 A;  1YM1 A;  1AXB A;  5E2F A;  1EWZ A;  2XRN A;  1DP6 A;  5FQK A;  3BM6 A;  2FZ0 A;  3N6I A;  3QP2 A;  1YQS A;  5HAP A;  4B4Z A;  2X71 A;  2ZD8 A;  4WYY A;  3G35 A;  4I3A A;  4R4R A;  4CQH A;  2J3T C;  1WE4 A;  3UO9 A;  4PKY A;  1ODV A;  4JGP A;  5CRF A;  2EXB A;  3LR5 A;  4II7 A;  4PPR A;  3IHB A;  4P85 A;  3IXD A;  2WKP A;  3ICY A;  3RH8 B;  3OC2 A;  1Y54 A;  1FCN A;  2PD7 A;  4EBL A;  2YKH A;  2BTF P;  3V50 A;  3LGO A;  3GEC A;  3OPH A;  3RJU A;  4EEU A;  2HV1 A;  2G2U A;  2B18 A;  5HAQ A;  3C4P A;  5IU1 A;  4LRX C;  3N8L A;  3DTI A;  3NI9 A;  3NHQ A;  1L2S A;  2PYR A;  2PAV P;  1TS0 A;  3G2Z A;  2W27 A;  3KYZ A;  1T1A A;  3B33 A;  3WRT A;  3LR3 A;  2Y2G A;  2VX8 A;  5I5L A;  3N7W A;  1VET A;  1PWG A;  2W1R A;  3KSH A;  4BEN A;  3LY3 A;  5E43 A;  4BBV A;  4X1M A;  2EX8 A;  4UEY A;  3BEC A;  1FQG A;  4C75 A;  4Q0I A;  2XFT A;  3LCE A;  5CGS A;  3NDE A;  4ZBE A;  3KYQ A;  2VEA A;  5DVA A;  2ZC4 B;  1LSV A;  3WWX A;  1IFQ A;  3S22 A;  4EQ1 A;  4ESP A;  3MBZ A;  1XA1 A;  1GSV A;  1NRJ A;  1HLU P;  5HPF A;  4QB8 A;  3PBN A;  3MFX A;  2QPN A;  2P74 A;  3PBQ A;  5KZH A;  4ZRR A;  1E4D A;  4JXG A;  4NG2 A;  3ZG0 A;  1IYP A;  4B4X A;  1FOF A;  1XFQ A;  5E2H A;  3GRJ A;  2K2N A;  5CTM A;  4CLC D;  4YOF A;  4KQQ A;  2HJ9 C;  2HDS A;  4HQA A;  3DAV A;  1PI4 A;  4WEL A;  1I5Q A;  4MN7 A;  4X1L A;  3IQA A;  3VV4 A;  4HH3 A;  3S7O A;  2LB9 A;  4LFU A;  1TVF A;  4NEE D;  1W63 Q;  1A0K A;  4FUW A;  3LEZ A;  3P01 A;  4S2L A;  3NOU C;  1LL8 A;  4NXF A;  5GLB A;  1K4E A;  1XJ4 A;  1MWT A;  3ZDJ A;  2A24 A;  2PU2 A;  4P6B A;  3MKE A;  3NBL A;  4P87 A;  1DJA A;  1J3W A;  3UE3 A;  4MEZ A;  5EVI C;  2UV0 E;  5HFO A;  3F1O A;  2WGW B;  4DJ2 A;  5EM0 A;  4HP9 A;  1NJ4 A;  5HL6 A;  3G2Y A;  3UY6 A;  3LIA A;  4WUJ A;  1S67 L;  5DFX A;  1ES4 A;  2Z6D A;  3WS1 A;  2W3D A;  1N9B A;  1PWC A;  4ZTK A;  3A0V A;  1LSX A;  4ARZ B;  3NIA A;  4D60 A;  4WBG A;  5CHU A;  5CX7 A;  4ETZ A;  1XGI A;  2HP6 A;  3LYX A;  4HES A;  3UE6 A;  4OP8 A;  5E2G A;  4OKP A;  1KE4 A;  2XD1 A;  3MR0 A;  4LPZ A;  4I39 A;  5DF9 A;  4B88 A;  1NZU A;  3BY8 A;  2ZOI A;  1VHM A;  4WMC A;  3JPU A;  1CF0 A;  5DF8 A;  1G28 A;  3BW6 A;  3UE0 A;  4KZ6 A;  2PD8 A;  2DRW A;  2PBD P;  4PM8 A;  1P9W A;  4ZAM A;  4X25 A;  4IUH A;  2Y2L A;  3BYD A;  2V8F A;  1XP4 A;  3P09 A;  3B42 A;  2PR6 A;  1P0Z A;  1ALQ A;  1GHP A;  5FL3 A;  3ZVT A;  4S2M A;  3BFE A;  4UA7 A;  3U4L P;  3V5M A;  2ZMA A;  3GTC A;  1H5X A;  2P08 A;  4LRZ E;  4NXB A;  3R7W A;  2GJ3 A;  3LIE A;  3IBR A;  1WYB A;  3PYP A;  1ERM A;  2XA7 S;  5L10 A;  4FH2 A;  4Y3I A;  1OTD A;  4Y0T A;  5KMW A;  3VSL A;  4MLL A;  3L7H A;  4S2I A;  1T1B A;  2HGV A;  3OCN A;  3W4O A;  3MMH A;  3Q07 A;  4GHI A;  2EA9 A;  1I2W A;  5HWW A;  1ZHH B;  2ZC3 B;  1NLY A;  1TDL A;  2Y59 A;  4N1H A;  4KUO A;  3B3X A;  3VP3 A;  3SS5 A;  4OVD A;  2QZ6 A;  3DTE A;  3UPN A;  2PDR A;  4EET B;  1QME A;  4KZ7 A;  4X68 A;  5FQI A;  2J3W A;  4RYE A;  4JF6 A;  2R9W A;  3IF6 B;  3HLW A;  4O01 A;  3HLC A; 
#chains in the Genus database with same CATH homology
 1JNU A;  2ZOH A;  2L0W A;  1GSW A;  4DN0 A;  3LID A;  4HJ6 A;  1OPX A;  3V67 A;  4GJ4 A;  3T4K A;  3UME A;  3MXQ A;  3CI6 A;  1X0O A;  3PBT A;  2XSS A;  5J7E A;  3UB8 A;  2VKS A;  3U2A A;  5HDD A;  1GSX A;  5J4E A;  4F3L A;  3LI8 A;  4OOL A;  1H8M A;  5DJU A;  5C5K A;  3G6O A;  4YNR A;  4I5S A;  5TJJ A;  4EW7 A;  3EGX C;  2EWV A;  1YKD A;  3IBJ A;  5F6A A;  4L9E A;  2M7U A;  2JKT M;  4I38 A;  2Z6C A;  4NXG A;  5HZH A;  3T4L A;  3PBR A;  3GDI A;  3E0Y A;  2D01 A;  5DKL A;  4F3L B;  3EEA A;  3NJA A;  3CIT A;  4I3J A;  3T4J A;  4O8G A;  3TW8 A;  1G6O A;  1F5M A;  1S1Z A;  5HD5 A;  4HJ4 A;  5IT5 A;  4P6Z S;  3PHY A;  4HH2 A;  2JKT I;  1T19 A;  4BBU A;  5MC7 A;  3LR4 A;  2QJ7 A;  4R6L A;  4XT2 A;  3KX0 X;  4Q0J A;  1YSQ A;  1TD5 A;  2W3F A;  3KSI A;  5IS1 A;  1NLZ A;  3S7N A;  2V1B A;  3CAX A;  5HD3 A;  1DRM A;  1N9L A;  1S4S A;  2XRN A;  1DP6 A;  5DFY A;  4Z1W A;  3C30 A;  2V0W A;  1N9N A;  1UGU A;  2FZ0 A;  3O5Y A;  3E98 A;  3PR6 A;  4R38 A;  4JGQ A;  2VV7 A;  4NKP A;  4I3A A;  4KQD A;  3IS2 A;  2NUP C;  4CLC B;  4CQH A;  2J3T C;  3FG8 A;  4PKY A;  3OBF A;  1MZU A;  2OWJ A;  3UB7 A;  1KOU A;  1ODV A;  4JGP A;  3JVV A;  2P04 A;  4Y2F A;  3LR5 A;  2A2L A;  3NOT C;  3D72 A;  4II7 A;  2EWW A;  3ZQ5 A;  1BYW A;  3MF0 A;  4BBT A;  2WKP A;  3ICY A;  2XA7 M;  4H6J B;  4KUK A;  3RH8 B;  4WF0 A;  3KSG A;  2VLG A;  3OC2 A;  3F1P A;  2DMW A;  3H7W A;  2K7S A;  1VB6 A;  3A0S A;  1T1C A;  2PD7 A;  2VV8 A;  3NOP C;  1LSW A;  5F5Y A;  2YKH A;  2JHE A;  3OOV A;  2GNX A;  3GEC A;  2NUT C;  2A24 B;  5F68 A;  4YWZ A;  1OJG A;  2HV1 A;  2WKQ A;  4EEU A;  2B18 A;  4DJ3 A;  2KDK A;  1TS6 A;  5IU1 A;  4LRX C;  2O99 A;  1OTA A;  3EWK A;  4GW9 A;  1TS8 A;  3NHQ A;  4GCZ A;  4MN5 A;  2PYR A;  1IOU A;  1TS0 A;  4M4X A;  3BWL A;  3KYZ A;  2W27 A;  2ZBB A;  3EGD C;  1T1A A;  5J3W A;  3B33 A;  3EQU A;  3P7N A;  4CLC C;  3LR3 A;  5AVE A;  3F1O B;  3CWF A;  3PXP A;  4MMN A;  2VX8 A;  3FPW A;  5I5L A;  1F98 A;  4EES A;  2PHY A;  2W1R A;  3KSH A;  4UQI M;  2PR5 A;  2ZMV A;  1OJ5 A;  4DMZ A;  4GLQ A;  4BBV A;  2W3E A;  1DP8 A;  4CLC E;  2J3T D;  4UEY A;  4PAU A;  4Q0I A;  4KQO A;  2R78 A;  3SW1 A;  5EFW A;  2KOI A;  4HP4 A;  4PKY G;  3KYQ A;  2VEA A;  1LSV A;  2V9A A;  5HSQ A;  1IFQ A;  1WA9 A;  4HHD A;  4EQ1 A;  3LIF A;  2JKR M;  2HF6 A;  4GS9 B;  4O0P A;  5HWV A;  1GSV A;  1NRJ A;  5HDS A;  1STZ A;  5HPF A;  3PBN A;  3MFX A;  3EOI A;  4B9O A;  3PBQ A;  3BY9 A;  3FC7 A;  4ZRR A;  4WLA A;  3DBA A;  5G4Y A;  5AJG A;  4FOF A;  2JKR I;  1N9O A;  1YSP A;  2QKP A;  3UB9 A;  2D02 A;  3KO6 A;  3RFB A;  1XFQ A;  2V1A A;  2YKF A;  1UWN X;  2K2N A;  4EU0 A;  4CLC A;  4NXE A;  1OTB A;  1XJ6 A;  4WL9 A;  3B47 A;  3K2N A;  3LFV A;  2J80 A;  3MQ0 A;  4CLC D;  4YOF A;  4L9F A;  3MQQ A;  5HDC A;  4MN6 A;  2HJ9 C;  1S4R A;  3HJI A;  4FSF A;  4HQA A;  4WEL A;  4O01 A;  3MQO A;  2H28 A;  4MN7 A;  2O9B A;  4H6J A;  3VV4 A;  3BQA A;  4IUK A;  4HH3 A;  3S7O A;  2LB9 A;  3EQV A;  1MC0 A;  4NEE D;  1W63 Q;  3H82 B;  3P01 A;  3NOU C;  1LL8 A;  4NXF A;  1XJ4 A;  2A24 A;  2QYB A;  2OOL A;  3FPV A;  2QWS A;  3CLO A;  2V0U A;  3F1N B;  2VGL M;  3LIC A;  5F69 A;  3A0R A;  3R7W B;  4Y5F A;  3VE3 A;  3KSF A;  4HOI A;  3T4Q A;  1P97 A;  3UE3 A;  5DKK A;  3T4O A;  3F1O A;  5DJT A;  3T4T A;  3EEH A;  3H9W A;  4JGR A;  1W63 M;  3VOL A;  2KX6 A;  4G3V A;  3R4K A;  4DJ2 A;  4Q0H A;  1DP9 A;  1H3Q A;  4HP9 A;  4WEJ A;  1T18 A;  5HL6 A;  4L0L A;  4EUV A;  3LIA A;  3OCL A;  4GHI B;  3LUQ A;  4WUJ A;  2O0Y A;  1S67 L;  1D7E A;  5DFX A;  5A8B A;  3E4O A;  4JGO A;  4HI4 A;  2W1T B;  2Z6D A;  1OT9 A;  2W3D A;  1OT6 A;  3A0V A;  1LSX A;  4ARZ B;  4LRY C;  3S7P A;  5KSH A;  1F9I A;  2LB5 A;  4GS9 A;  4IJG A;  5CX7 A;  4ETZ A;  5KIZ A;  4HJ3 A;  2XRO A;  3C2W A;  3LYX A;  1V9Z A;  4IHQ A;  3UE6 A;  2P7J A;  1ZTU A;  2PT7 A;  4OOM A;  2CMN A;  2W3G A;  5TBM B;  3W2Z A;  3UMD A;  2GZA A;  3C38 A;  3UB6 A;  1TS7 A;  2JN7 A;  3MR0 A;  4LPZ A;  1OTE A;  4HIA A;  5AVF A;  2Y79 A;  4I39 A;  5DF9 A;  4G3K A;  2I9V A;  2O9C A;  3BY8 A;  3T4S A;  2VV6 A;  5LBR A;  2VJW A;  2ZOI A;  3PBS A;  1VHM A;  1UWP X;  2WKR A;  4B93 A;  1G28 A;  3BW6 A;  2B02 A;  2L1M A;  2IA2 A;  1P9R A;  2VZW A;  2PD8 A;  3BJN A;  3K3C A;  1P9W A;  1Y28 A;  4IUH A;  3PBO A;  1XJ2 A;  5K5B A;  2QHK A;  5L8M A;  1LT0 A;  1D06 A;  1TF1 A;  4K08 A;  3B42 A;  4RQ9 A;  4MCW A;  3E4Q A;  2MJ6 A;  2PR6 A;  1P0Z A;  5FL3 A;  4P6Z M;  2M1C A;  4EXO A;  3H82 A;  3CUE A;  2BAS A;  3OLO A;  4E04 A;  2P08 A;  5G4Z A;  3F1N A;  4LRZ E;  2ZMF A;  2M7V A;  4PHT A;  4BWI A;  3ULF A;  4LLO B;  4NXB A;  3R7W A;  4I3I A;  4XT2 B;  1MKM A;  2GJ3 A;  3LIE A;  4BMW A;  3IBR A;  2OAQ 1;  1YAX A;  3PYP A;  3ZYT A;  3LI9 A;  1V9Y A;  2Y8H A;  4G3W A;  2XA7 S;  1EW0 A;  4MDZ A;  3RTY A;  4Y3I A;  2K31 A;  1OTD A;  3C8C A;  2VGL S;  4WEK A;  1XJ3 A;  4AFI A;  2O9A A;  2GX5 A;  4QPR A;  4HNB A;  4R70 A;  1T1B A;  1XFN A;  3MJQ A;  3LIB A;  3HCY A;  2HGV A;  3HJK A;  2G7U A;  3OCN A;  4EER A;  3TRC A;  2INW A;  3MMH A;  3T50 A;  2L4R A;  4GHI A;  2EA9 A;  1OTI A;  3E4P A;  4ETX A;  3TE8 A;  3IS2 B;  3JVU A;  5HWW A;  2FH5 A;  2W1T A;  1ZHH B;  4ME4 A;  4BJP A;  4EEP A;  1NLY A;  4WN5 A;  3S7Q A;  4ARZ A;  4HY8 A;  3BQ8 A;  4KUO A;  2OWH A;  3TJZ C;  4L9G A;  5HPI A;  2W3H A;  2PDR A;  2QJ5 A;  4EET B;  2W0N A;  4UQI S;  2OAP 1;  5TBM A;  2KLI A;  3CUE C;  3D3O A;  3F1P B;  3H7W B;  3LR0 A;  5HWT A;  1NWZ A;  3VE4 A;  2J3W A;  4R3A A;  1S1Y A;  1S66 L;  2VA0 A;  3K3D A;  2PYP A;  2HJE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...