4EESA

Crystal structure of ilov
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
110
structure length
110
Chain Sequence
IEKNFVITDPRLPDNPIIFASDGFLELTEYSREEILGRNARFLQGPETDQATVQKIRDAIRDQRETTVQLINYTKSGKKFWNLLHLQPVRDQKGELQYFIGVQLDGSDHV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Phototropin-2
publication title Structural Tuning of the Fluorescent Protein iLOV for Improved Photostability.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Signaling protein, flavoprotein
total genus 33
structure length 110
sequence length 110
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4eesA00
1F9IA 1OT6A 1S66L 1ODVA 3ZQ5A 4HY8A 4L9FA 1TS7A 3F1OA 5HD3A 1DRMA 3LYXA 4LRYC 4HQAA 5HDSA 3ICYA 2A24A 3ULFA 1S67L 1OTDA 4HH3A 3MR0A 4HOIA 2HV1A 1TS6A 1GSVA 3E4OA 2W27A 4JGRA 5KIZA 1OJ5A 1GSXA 3F1PB 3H82A 1LT0A 4E04A 4HP9A 1V9ZA 2YKHA 3MXQA 1N9LA 4PKYG 4H6JA 3PYPA 1OTEA 1DP8A 2PDRA 3F1OB 5IS1A 3UB7A 3UMEA 4WLAA 2A24B 3VE4A 3FC7A 2L0WA 2GJ3A 1S1ZA 4I3AA 4KQDA 1S4RA 1V9YA 2ZOIA 4BBVA 1OTAA 3UE6A 4K08A 3UB6A 1XFQA 3H82B 4KUKA 3SW1A 2BASA 1LSVA 2R78A 2YKFA 3LI9A 2D01A 3EEHA 4KUOA 4H6JB 2OWJA 2EA9A 2B02A 1JNUA 1OJGA 2VV8A 5HWTA 2Z6DA 2V1AA 2QJ5A 2V9AA 3MJQA 2INWA 3E4PA 4MN6A 5I5LA 5HWWA 1WA9A 3E4QA 3CWFA 4I38A 1VB6A 2W0NA 2PD7A 3LUQA 5F6AA 5A8BA 4NXEA 1OT9A 4JGOA 1OTBA 5TBMA 2WKPA 3C8CA 3D72A 3UB8A 3RTYA 5G4ZA 2J80A 2PHYA 2M1CA 3HJKA 3UMDA 4MN5A 2OWHA 5AVFA 4HNBA 4EW7A 1TS0A 4HHDA 1D06A 2V0WA 4WL9A 4YWZA 3LIAA 1P97A 1XJ6A 2PD8A 1T19A 2PR6A 4EETB 4LRXC 3LIEA 3H9WA 3P7NA 3VOLA 2JHEA 4HJ4A 2L4RA 1XJ3A 3LIFA 2WKRA 3MQOA 4HH2A 5TBMB 4R6LA 1OTIA 3BY9A 4XT2A 5J4EA 2KDKA 3K3DA 3B33A 1NWZA 4I3JA 3PHYA 3GECA 3IBRA 4GCZA 5HDDA 2V1BA 3HJIA 4EERA 4EEUA 4I5SA 3GDIA 5F69A 4M4XA 3KX0X 3VE3A 2QKPA 4L9GA 3G6OA 4F3LA 2D02A 4HJ6A 1S1YA 1P0ZA 2ZBBA 2ZOHA 4BBTA 5HZHA 2JN7A 3NHQA 4GHIA 4EXOA 4XT2B 3EWKA 4JGPA 1Y28A 3MFXA 4PKYA 5HD5A 4GW9A 4WF0A 1LSWA 4R70A 4BBUA 1MZUA 4B9OA 5HSQA 1TS8A 2VEAA 3CAXA 3IS2A 4EQ1A 2QWSA 5DKKA 3F1NA 4F3LB 2WKQA 4LLOB 3LIDA 2PYPA 3NJAA 4EESA 4GHIB 4WN5A 5J3WA 2I9VA 3A0RA 4NXBA 1F98A 5HDCA 5F5YA 3H7WA 1T1CA 5J7EA 1N9OA 3UB9A 3LICA 1T1BA 3IS2B 1UGUA 2V0UA 2P7JA 1T1AA 2Z6CA 3NOTC 3BWLA 3K3CA 3MQQA 4NXGA 2PYRA 3F1NB 4DJ2A 1N9NA 4L9EA 1XJ2A 1LSXA 3FG8A 5HWVA 2VV7A 4HIAA 3LIBA 1XFNA 4GS9A 4NXFA 1DP9A 4JGQA 2QJ7A 4RQ9A 3LI8A 1UWNX 1D7EA 3H7WB 1T18A 4WUJA 2KX6A 2CMNA 3OLOA 1GSWA 2H28A 1EW0A 2K7SA 1DP6A 1BYWA 3A0VA 5DKLA 3T50A 4LRZE 2VV6A 2OOLA 1KOUA 4I3IA 4HJ3A 4EEPA 2VLGA 5DJTA 1X0OA 3NOPC 1S4SA 4LPZA 4R3AA 1UWPX 1XJ4A 3C2WA 2QHKA 2PR5A 4GS9B 3A0SA 2L1MA 4DJ3A 5F68A 3RH8B 3BY8A 3NOUC 5EFWA 5DJUA 3CLOA 5IU1A 4R38A 4HP4A 5AVEA 1G28A 4HI4A 3F1PA 5G4YA 1LL8A 4I39A
chains in the Genus database with same CATH superfamily
2Y91A 1F9IA 4B88A 3UE0A 1IOUA 5EE8A 3ZQ5A 3CPTB 1E3UA 1XPBA 2P9VB 2BG1A 5TGFA 5I94A 3GSGA 4LRYC 5HDSA 3ICYA 3PBQA 2FFFB 2Q0OA 4ZRRA 4DN0A 4JPMA 4HOIA 5KSHA 1NZOA 3E2LA 2O9CA 5EVID 1CI8A 1GSVA 2W27A 4HBTA 2G7UA 2Y4AA 1LLBA 3W4OA 4A5RA 5KIZA 2EX8A 5U47A 1LT0A 2EXBA 3RXXA 3MZDA 5F1FA 5L09A 2YKHA 1N9LA 1YSPA 4X55A 3NC8A 4KZ8A 3WRTA 1DP8A 4EUVA 3TRCA 2ZQAA 5HL6A 4NG2A 1H8ZA 1S6RA 4ZTKA 1MPLA 4KENB 3SH7A 4YNRA 1VM1A 2WYXA 1V9YA 5CEBA 4BBVA 3N6IA 4P6ZM 2IWBA 3UB6A 3O86A 3CHWP 3Q81A 4KUKA 1L0GA 4XUZA 1YT4A 2BASA 1GHPA 3JYIA 1ONGA 4N9LA 2R78A 3UB5P 3DTIA 3LI9A 2D01A 3EEHA 2OSUA 1NLYA 4CLCA 3FPWA 5HX9A 1JNUA 1K38A 1W63Q 3ISGA 4FSFA 3NDGA 3QP2A 2V1AA 3NULA 3IWOA 2B18A 2QJ5A 4CLCC 3HCYA 4D60A 1K54A 1JTDA 2V9AA 2INWA 3CUEA 3GRJA 5I5LA 5HWWA 3IT9A 4WEKA 3E4QA 2M7VA 1MWSA 4GLQA 1K54C 2NUPC 2V8FA 2CC1A 3CUEC 1W8YA 4XUXA 2JKTI 3V3SA 1L3LA 1YLPA 3DBAA 3DTKA 1W7FA 3R4KA 1BLSA 1OTBA 3W8KA 1ZHHB 3W4PA 3D72A 3O3VA 3P01A 4S2OA 5G4ZA 4CLCB 5DFYA 1Q2QA 3UDXA 3UMDA 1IYOA 3T4QA 3BQAA 3OOVA 4FH2A 1MWTA 5A90A 4HNBA 4Q8IA 4MLLA 3IXBA 1D06A 1YQSA 3DWKA 2X02A 3JVUA 3VP3A 4JF6A 4O7DA 5F83A 5GHYA 4EETB 1SCWA 1IYSA 4O01A 2XDMA 2M7UA 3P7NA 3G2ZA 3LY4A 3VOLA 3G2YA 4OPQA 2JKFA 1STZA 3BY9A 5AQ7A 2G2UA 4OOLA 3TE8A 3CMZA 4Y5FA 5CXWA 3B33A 1NWZA 4I3JA 2Z2MB 3GECA 3IBRA 1CF0A 2V1BA 5HARA 4FH4A 2WGWA 4I5SA 1MBLA 4PAUA 3HLCA 4MMNA 1CK3A 1K25A 1YM1A 3G6OA 4F3LA 2PBDP 2HP9A 2ZOHA 3T4KA 3OC2A 3DTEA 4PMAA 3NHQA 4BMWA 1PFLA 1OMEA 2O0YA 4EXOA 4C3QA 3LR0A 3GQZA 3SH8A 1NLZA 3RFBA 1NYMA 4PKYA 3VMAA 3WS4A 3LY3A 4BBUA 5HSQA 1TS8A 4IBXA 2WGWB 2JKTM 2LB5A 3IBJA 4DE3A 2J8YA 2V8CA 2Y2IA 4EQ1A 4FD8A 2QWSA 4RVAA 3FPVA 1C3BA 4EWFA 2ZQCA 3F1NA 4F3LB 4ETZA 2GX5A 4BD1A 4LLOB 4Y7PA 3VSLA 3MS6A 5E2GA 1RGZA 3ITAA 1NY0A 1G6OA 2ZC3B 3ZFZA 1YLWA 3L9KA 5GHZA 2BLSA 1HD8A 2ZC5B 4KZ4A 5HFOA 2Y55A 4IUKA 4WELA 4R0QA 5FAPA 3NECA 2PU4A 5CHMA 5FI7A 3LICA 2V0UA 4BENA 1OPXA 1W5DA 3QNBA 2Z6CA 3NOTC 1DJCA 2HPBA 3HREA 5CX7A 3A3FA 4GZBA 2Y8HA 3F1NB 3KSHA 4DJ2A 5MC7A 1CQAA 1XJ2A 4K0XA 1LSXA 4GOGA 4Y3IA 2VV7A 1HLUP 3HUOA 4QWOA 3M2KA 3LIBA 4MDZA 2Y2LA 2HDRA 4JF4A 5JYPA 5JYOA 5AJGA 2H5SA 2Y79A 3B42A 3UE1A 3C7UA 4JGQA 3LI8A 1MWRA 1M6KA 5FATA 4Q0IA 4R4RA 4OP8A 3A3DA 4GD8A 2O9AA 3HUNA 4Q0JA 2KX6A 2CMNA 5L07A 2XROA 5KSCA 4UA9A 2HDQA 1LL9A 1EW0A 1ZG4A 4UQIS 2K7SA 3NIAA 3KSFA 2J3TD 1ZTUA 3T50A 2XFSA 4LRZE 2KLIA 2JC7A 3AGEA 1NRJA 4N9KA 4EEPA 3C4PA 3MKEA 2MJ6A 4WZ4A 5FA7A 1IYPA 1K4FA 1X0OA 1KE4A 3TJZC 4BL3A 2DRWA 1UWPX 1XJ4A 3C2WA 1XGIA 2PR5A 3IF6A 3Q07A 3M2JA 2GNXA 3RJUA 3NOUC 5FQKA 1FILA 2K2NA 5DJUA 3IF6C 5IU1A 2KOIA 1SDEA 1G28A 4ME4A 4OOMA 5G4YA 2OAP1 2XD1A 3BEBA 4KZ3A 1ACFA 1E3UD 4UHUA 1SDNA 4DMZA 3F1OA 2A3UA 4Q0HA 1DRMA 4LENA 3LYXA 3IF6B 4EBPA 1OTDA 4CPKA 5HPFA 4G3KA 4KQRA 2WZXA 4PM6A 3BLMA 1TS6A 3E4OA 4JGRA 4UA6A 1FCOA 3T1SA 2VGLS 2P04A 5K5BA 1OJ5A 5A93A 1Y54A 3H82A 2ZQ7A 4E04A 4HP9A 4ARZA 1Q2PA 3SS4A 3T4LA 4H6JA 2PDRA 3F1OB 3UDIA 3HLWA 4WMCD 2O99A 5F82A 5IS1A 1BT5A 3UMEA 4WLAA 4Y0OA 4S2KA 3G35A 3FC7A 5DF8A 1VEUA 4S2LA 1BTLA 1O07A 3T4SA 1W8QA 3M6HA 3V5MA 5GL9A 2UWXA 2ZOIA 2Z2LB 3UE6A 3AGFA 3IF5A 1YLZA 3H82B 3KYZA 2J3TC 4GDNA 2OAQ1 3S4XA 4ARZB 1JTGA 5HAPA 3B47A 4GB7A 4H6JB 4O8GA 1KVMA 3VP4A 2EA9A 2B02A 4KQQA 3BFDA 2WGVA 2Y2QA 3IWIA 4UA7A 1VEUB 4BL2A 3QNCA 3PXPA 1WA9A 5CTNA 4I38A 2W0NA 3LUQA 5F6AA 5A8BA 1IEMA 4NXEA 1XA1A 3G32A 2GZAA 4KG5A 1TD5A 3OPRA 4Y2FA 2WKPA 3IQAA 3ZG7B 3U2AA 3FZCA 2J80A 2PHYA 3HJKA 1I5QA 4MN5A 2R9WA 5AVFA 4Y0UA 5FQMA 1DY6A 2H0YA 5HAQA 4M3KA 2XA7S 3T1XA 4EW7A 4DE2A 4HHDA 2PRFA 1S0WA 3Q7VA 2H0TA 2XEPA 2PD8A 4P0MA 5HPIA 2EFUA 1T19A 2EWVA 2WAFA 3WS1A 3BYDA 4LV2A 1EWZA 5G18A 4LRXC 4LFUA 2Y2MA 3LIEA 4U0TA 4NK3A 2JE5A 3N8LA 3GV9A 3LIFA 4KZ6A 4WMCA 5FEFA 2VJWA 1AXBA 2E8IA 4Y15A 1KVLA 2WKEA 1MKMA 1W63M 3CJMA 5CTMA 1CEGA 5DTKA 4GCZA 5HDDA 3HJIA 4EERA 1G5UA 4MBFA 3Q7VB 3BFFA 3MXSA 1GCEA 3GDIA 1XGJA 4E3NA 4NEED 1PYYA 3PBRA 3S7NA 4IUHA 4JBFA 3VE3A 3NY4A 2Y2OA 5EOOA 1RCJA 2D02A 1WE4A 1IYQA 1P0ZA 1L0DA 2K31A 3Q1FA 5IHVA 4KQOA 2H10A 4KZ9A 3NCKA 3EWKA 2A49A 3OPPA 5DTTA 4UEYA 1Y28A 1KGFA 1TDGA 3NI9A 4B9OA 4S2MA 2VEAA 3CAXA 4MBKA 1K57A 4DDSA 1Y4OA 3MQ0A 4QB8A 4K0WA 3BFGA 1D1JA 3LIDA 2PYPA 1K57C 2VX8A 2JCHA 2ZJ9A 2J7VA 3BQ8A 2DMWA 4OQ0A 4NXBA 1F98A 2Q9NA 2XQZA 5HDCA 3TSGA 3UN7A 1H3QA 3Q7ZA 4QJGA 3HBRA 3A3IA 2QMIA 1T1CA 1JVJA 4O0PA 4DXBA 1J9MA 4OLDA 2DNSA 1T1BA 2ZMVA 2P7JA 3OBFA 3CZDA 3K3CA 1F2KA 3SOIA 3MQQA 1FIKA 4L9EA 4E3IA 1P9WA 2J9PA 3FG8A 2EX6A 4E3LA 4HIAA 4C75A 4DXCA 5CEDA 3MF0A 4ESPA 2ZMFA 4S2PA 1UWNX 2QYBA 2ZM2A 2XF3A 4X69A 3S7PA 1LI9A 3BM6A 4WUJA 1BULA 3CITA 1HTZA 3OLOA 2OLVA 3KSIA 1PI5A 4QD4A 1A0KA 4UQIM 1DP6A 2EXAA 2Y2HA 3KYQA 2VV6A 4I3IA 1KOUA 4HJ3A 4PM9A 5DF9A 4U0XA 2IWCA 4R3JA 3T4OA 3NOPC 2W3EA 4DF6A 5FQIA 3ZCZA 3HVFA 5LBRA 2PAVP 4LPZA 3V39A 4ZAMA 2QHKA 3VOZA 2L1MA 3HLGA 5F68A 3GMWA 2A2LA 1ES5A 3MXRA 5EFWA 3VP0A 2B95A 3IHAA 4BWIA 1GA0A 4FUWA 4OKPA 5AVEA 3EEAA 3F1PA 4B4ZA 3O88A 3GTCA 1OT6A 4YOFA 3G31A 3IX8A 5EVLA 3ZVWA 1S66L 4WZ5A 3M6BA 4HEFA 4HY8A 4L0LA 4BLMA 3LGOA 4L9FA 1TS7A 3HLFA 5HD3A 4WZ5C 4RA7A 1IFQA 3ULFA 1PNEA 4Y17A 5E2EA 5GHXA 4GDBA 1Z6FA 2HV1A 3TG9A 3FV7A 2QPNA 3T4TA 5L10A 1ZKJA 1LI0A 1H8MA 2P74A 1H5XA 2IA2A 1ES2A 1FSWA 2VGLM 3EQVA 3LFVA 1ERMA 3F1PB 4MN7A 3UY6A 5E2HA 1H8YA 1AWIA 1BSGA 2ZM0A 4MBHA 2JBFA 3PYPA 1OTEA 1MC0A 3LEZA 4GJ4A 1SZVA 4PM5A 3UB7A 3UPPA 3VE4A 1L0FA 3QP6A 2GJ3A 4X68A 1S1ZA 2PBYA 4Z1WA 1PW8A 2WZZA 4I3AA 4IHQA 1S4RA 3S7OA 5DFXA 4K08A 3N4IA 2J3WA 4HBUA 1XFQA 1JWPA 4KUOA 4GKUA 3KSGA 1PWGA 5A91A 4KG6A 1OJGA 2VV8A 3G34A 3Q82A 2W1RA 2Z6DA 3OCLA 1YLYA 2ZQ8A 5GLCA 2QZ6A 3E4PA 4MN6A 2EWWA 4S2IA 3CWFA 2HP5A 3P09A 4JXGA 4N1HA 2PD7A 1KDSA 2UV0E 5BOHA 1BZAA 5F1GA 4JGOA 2WUQA 4BJPA 4C6YA 3WWXA 3RTYA 1K56A 3C7VA 3V67A 4QU3A 3G4PA 2Y2KA 2OWHA 2VGJA 4PM7A 1ERQA 2C5WB 2XFTA 4LGWA 2XA7M 3OZHA 1TS0A 3V3RA 1ES3A 2ZC7A 4AFIA 2V0WA 3HLDA 3ZHHA 4YWZA 3LIAA 1XJ6A 4DE0A 3BECA 3R7WA 4PHTA 2PR6A 4JKTA 3ZG0A 3CI6A 5E43A 3ITBA 3H9WA 2JHEA 5TJJA 1XJ3A 4E3JA 2WKRA 5EM0A 4R6LA 1OTIA 4EV4A 1LL5A 4OVDA 5J4EA 1N4OA 2VA0A 1PIOA 4FCFA 3MKFA 3K3DA 3W2ZA 1XP4A 1PZOA 2ZQDA 5HAIA 3T1QB 5CHUA 3S1YA 4EEUA 1QMFA 2WGIA 2EX2A 2ZC4B 3DW0A 1ZG6A 5F69A 4X56A 4M4XA 2XH9A 3R7WB 3KX0X 1BLPA 4OQHA 2QKPA 2E8JA 1ONHA 4L9GA 1NYYA 4QPRA 5DF7A 1NXYA 5EOEA 1S1YA 3TOIA 1JWVA 4BBTA 3HUMA 3SS3A 4JF5A 4GHIA 1P9RA 3CPTA 5EUAA 2Y2NA 4JGPA 1FSYA 3O5YA 2P08A 1DJBA 4P87A 4RX3A 5CECA 1XXMA 2BTFP 5HD5A 4WF0A 1I2WA 2V20A 5DVAA 4R70A 3T4JA 3IX4A 5FAQA 1JWZA 5EV0A 4R3BA 4EUZA 4E3KA 1KE0A 1NZUA 4DE1A 2EX9A 1G68A 1MXOA 3QP5A 5GLAA 3OPHA 4CQHA 4GHIB 5CGSA 1E4DA 4X6TA 3EGDC 2I9VA 4E6XA 3LO7A 4GN2A 4LCLA 1MY8A 2HDSA 3W4QA 1K55A 3VFFA 5F5YA 3GVBA 3H7WA 1NRFA 4LV3A 5J7EA 3DAVA 2W1TA 3PBNA 2EFXA 4XXRA 1K55C 3LR3A 1SKOA 1YSQA 1TVFA 1UGUA 4R23A 1T1AA 2VK3A 2WAEA 5FSRA 5KMWA 4NXGA 3MFDA 4II7A 2ZD8A 4F94A 5EECA 3SH9A 2HF6A 2W3HA 4X53A 5EM1A 1QMEA 5HWVA 1VETA 3TW8A 1TEMA 3E98A 3E0YA 1XFNA 1BLCA 2XD5A 2QJ7A 4RQ9A 3O87A 4PPRA 4RX2A 3NBLA 3C5AA 4B93A 3H7WB 3IX3A 2W1TB 3WS2A 5FDSA 2I72A 1YMSA 2JKRI 3P98A 1EROA 1HZOA 1L2SA 1GSWA 3NDEA 1SKOB 3RXWA 1FOFA 2WKIA 4ZJ2A 2HJEA 5DKLA 2JKGA 1RP5A 2OOLA 1TF1A 4G3WA 5EVEA 4KZ7A 5TR7A 4LV1A 3ZYTA 5DJTA 1PZPA 4QY5A 3VV4A 1XX2A 1VETB 5FQQA 1KDWA 1YAXA 1KGEA 4OPRA 5EPHA 1PRQA 5KZHA 5FAOA 4NETA 1ALQA 4YFMA 2PT7A 3FKWA 3MMHA 5AQ9A 1WYCA 3MSHA 3WS0A 2V1ZA 4R38A 4PM8A 5AQAA 3VFHA 3D9YA 1ESUA 2W3DA 3UPOA 3KO6A 2WADA 4I39A 1SHVA 2C6WB 3IWQA 1ODVA 3CG5A 4H8RA 2ZC6B 2ZLYA 1L0EA 4HQAA 3PBOA 3ZG5A 2A24A 2Y2PA 4OQGA 1S67L 1PI4A 2FFYA 3QHYA 5FL3A 4HH3A 3MR0A 4GD6A 1H0MA 5GLDA 2FH5A 4DKIA 5EVIA 3U4LP 4E3OA 4X25A 3MZFA 3BW6A 1GSXA 3HLBA 3N7WA 2R9XA 3UE3A 5AQBA 2AVXA 5EVIC 2Y2GA 1V9ZA 3QP1A 1FR1A 3D3OA 3MXQA 4OPYA 5FI2A 4PKYG 4EQIA 1F5MA 2IWDA 2ZMAA 5FEGA 2XSSA 3VP2A 3A3EA 3LEQA 2A24B 1FCMA 2JKRM 4LV0A 5A92A 3ZNYA 2L0WA 1BUEA 3S22A 1CI9A 3QP8A 5D3OA 4KQDA 1IKIA 5EVIB 4OLGA 5CGWA 3FKVA 2OLUA 3T12B 1OTAA 4P6ZS 1M40A 1TDLA 4IBRA 4IVIA 3SW1A 1LSVA 3PAEA 2YKFA 2HJ9C 3EGXC 3HL9A 2OWJA 1PWCA 2VKSA 4QHCA 3OCNA 2RL3A 5FQJA 2RCXA 2XR0A 5HWTA 3VOYA 4GNUA 1YKDA 2V2FF 4YINA 5HL1A 1BLHA 3JVVA 3MJQA 3G30A 1YLTA 2Y59A 4HESA 1NJ4A 1VB6A 4B4XA 4MCWA 3DWZA 4EBNA 3C4OA 2XRNA 1OT9A 3T1RA 3A3JA 4IVKA 4U3TA 3C38A 3ZG8B 4FTXA 1I2SA 3EOIA 2Y2JA 5J8XA 2XLNA 2HP6A 3LCEA 3PTEA 5TBMA 1GHIA 4EU0A 3EQUA 1EI5A 3C8CA 3UB8A 1K56D 2LB9A 1VQQA 4NKPA 2M1CA 1J3WA 2G2WA 4S2NA 1KE3A 5CHJA 4ZJ1A 5FASA 4G3VA 2J9OA 4N92A 4WL9A 4S2NC 1P97A 2VGKA 5M1AA 4P6BA 5C5KA 3B3XA 1O7EA 4WM9A 3C30A 2X01A 4HJ4A 2L4RA 5HW3A 4HH2A 3MQOA 5FDHA 3IXDA 5TBMB 2OV5A 2PU2A 4XT2A 5L8MA 2Q9MA 1G6AA 2KDKA 3FYZA 3PHYA 1GA9A 3OPLA 3UNWA 3IXHA 4CLCE 1PWDA 2ZL1A 4IJGA 4KZAA 2ZQ9A 2XK1A 5E2FA 5TFQA 4WYYA 2VZWA 4N1XA 4UAAA 3BRMA 3ZGAB 4CJNA 4HJ6A 1IELA 2ZBBA 4OH0A 1N9BA 1K4EA 4R1GA 4IEDA 2JN7A 4OP5A 5HZHA 4KZBA 1ZC2A 1YPRA 4ZBEA 3WS5A 4DDYA 3ZG9B 4XT2B 3K2NA 1YLJA 2WK0A 3GR2A 3QP4A 3IH8A 3MFXA 3WRZA 2DCFA 3BLSA 4GW9A 3AGDA 3V50A 1LSWA 1WYBA 4OPZA 1MZUA 3ZDJA 2B5RA 4OOYA 1U60A 3IXGA 3IS2A 3IH9A 2W3FA 2ZL1B 4ZJ3A 3PBSA 1FR6A 5DKKA 1Z09A 1K6SA 2WKQA 3SZTA 3ZNTA 4OQIA 1XA7A 3DTMA 1CJFA 3NJAA 4RYEA 4FOFA 4EESA 4KG2A 2FZ0A 5M18A 1XKZA 5L2FA 4WN5A 5J3WA 3A0RA 2WKHA 5DTSA 2HGVA 4LCMA 2GDNA 3BFEA 4WEJA 3LR4A 2W3GA 3I7JA 5GLBA 4QY6A 3BFCA 1N9OA 3UB9A 3BJNA 3IS2B 4D2OA 1K6RA 1FCNA 2ACGA 2X71A 5M19A 3VSKA 3BWLA 3PR6A 2PYRA 3KYEA 4E3MA 1N9NA 3E2KA 1HVBA 2O9BA 4ETXA 4Y0TA 3VP1A 4P85A 1FQGA 4E6WA 4Z9QA 1GHMA 3PAGA 4GS9A 4X1LA 4K91A 4NXFA 4X1MA 1DP9A 5FI6A 3LR5A 5CGXA 2NUTC 1E25A 4BD0A 1D7EA 1PW1A 5CERA 3N8RA 1ES4A 1T18A 3JPUA 4JXSA 1W79A 3D4FA 2H28A 2HZ5A 1CEFA 1BYWA 3A0VA 4MNRA 1VHMA 3HLEA 1MWUA 4BQMA 1LHYA 2XGNA 4Y13A 1RGYA 1YMXA 4MEZA 3PBTA 2HDUA 1IKGA 4DRTA 3UDFA 2ZM8A 3S7QA 2VLGA 4JXVA 3UO9A 1S4SA 2P9VA 1SKFA 1KGGA 4R3AA 4R4SA 4JLFA 3ZVTA 4KZ5A 3SS5A 3MBZA 4GS9B 3A0SA 4CLCD 4OONA 4ID4A 4EBLA 4DJ3A 4WBGA 1MKIA 3RH8B 3BY8A 4S2JA 5FQ9A 1DJAA 3MZEA 4ZDXA 5CRFA 3CLOA 3FWLA 4HP4A 5IT5A 1ESIA 1K0KA 3L7HA 4HI4A 3N8SA 3UPNA 3IHBA 1LL8A 4JXWA
chains in the Genus database with same CATH topology
1F9IA 1OT6A 4YOFA 1S66L 1IOUA 1ODVA 3ZQ5A 4HY8A 4L0LA 4DMZA 4L9FA 1TS7A 3F1OA 4Q0HA 5HD3A 1DRMA 3LYXA 4LRYC 4HQAA 5HDSA 3ICYA 3PBOA 3PBQA 2A24A 1IFQA 3ULFA 1S67L 5FL3A 1OTDA 4ZRRA 4DN0A 4HH3A 5HPFA 3MR0A 4G3KA 4HOIA 2HV1A 5KSHA 2FH5A 3T4TA 2O9CA 1TS6A 1H8MA 1GSVA 3E4OA 2W27A 4JGRA 2G7UA 2IA2A 2VGLS 2VGLM 2P04A 5K5BA 5KIZA 3EQVA 1OJ5A 3BW6A 1GSXA 3LFVA 3F1PB 3H82A 1LT0A 3UE3A 4MN7A 4E04A 4HP9A 1V9ZA 2YKHA 3D3OA 3MXQA 4ARZA 1N9LA 1YSPA 3T4LA 4PKYG 4H6JA 3PYPA 1OTEA 1F5MA 1DP8A 2PDRA 4EUVA 3F1OB 3TRCA 1MC0A 2O99A 5IS1A 4GJ4A 2XSSA 3UB7A 3UMEA 4WLAA 2A24B 2JKRM 3VE4A 3FC7A 5HL6A 2L0WA 2GJ3A 4Z1WA 1S1ZA 3T4SA 4I3AA 4YNRA 4KQDA 4IHQA 1S4RA 1V9YA 3S7OA 2ZOIA 4BBVA 1OTAA 5DFXA 4P6ZS 4P6ZM 3UE6A 4K08A 3UB6A 2J3WA 1XFQA 3H82B 3KYZA 4KUKA 3SW1A 2BASA 2J3TC 1LSVA 2R78A 2YKFA 2OAQ1 3LI9A 2D01A 3EEHA 4ARZB 2HJ9C 4KUOA 3EGXC 3B47A 1NLYA 4H6JB 4O8GA 3KSGA 2OWJA 4CLCA 2EA9A 3FPWA 2VKSA 2B02A 3OCNA 1JNUA 1OJGA 2VV8A 1W63Q 5HWTA 2W1RA 2Z6DA 3OCLA 4FSFA 1YKDA 2V1AA 3JVVA 2B18A 2QJ5A 4CLCC 3HCYA 2V9AA 3MJQA 2INWA 3CUEA 3E4PA 4MN6A 5I5LA 3PXPA 5HWWA 1WA9A 2EWWA 4WEKA 3E4QA 3CWFA 2M7VA 4I38A 1VB6A 2W0NA 4GLQA 4MCWA 2PD7A 3LUQA 2NUPC 5F6AA 5A8BA 3CUEC 2XRNA 4NXEA 1OT9A 2JKTI 2GZAA 3C38A 3DBAA 1TD5A 3EOIA 3R4KA 4JGOA 1OTBA 1ZHHB 5TBMA 4BJPA 4Y2FA 2WKPA 4EU0A 3EQUA 3C8CA 3D72A 3UB8A 3RTYA 3P01A 2LB9A 5G4ZA 3U2AA 4CLCB 5DFYA 3V67A 2J80A 2PHYA 2M1CA 3HJKA 4NKPA 3UMDA 3T4QA 3BQAA 3OOVA 4MN5A 2OWHA 5AVFA 4HNBA 2XA7S 2XA7M 4EW7A 4G3VA 1TS0A 4HHDA 1D06A 2V0WA 4WL9A 4AFIA 3JVUA 4YWZA 3LIAA 1P97A 1XJ6A 2PD8A 5HPIA 3R7WA 1T19A 2EWVA 4PHTA 2PR6A 4EETB 4O01A 5C5KA 4LRXC 3LIEA 3C30A 3CI6A 2M7UA 3H9WA 3P7NA 3VOLA 2JHEA 4HJ4A 2L4RA 5TJJA 1XJ3A 3LIFA 2WKRA 3MQOA 4HH2A 5TBMB 4R6LA 1STZA 1OTIA 3BY9A 4XT2A 5J4EA 5L8MA 2VJWA 2VA0A 4OOLA 2KDKA 3K3DA 3TE8A 1MKMA 1W63M 4Y5FA 3W2ZA 3B33A 1NWZA 4I3JA 3PHYA 3GECA 3IBRA 4GCZA 5HDDA 2V1BA 3HJIA 4EERA 4EEUA 4CLCE 4I5SA 4PAUA 3GDIA 4IJGA 4NEED 5F69A 4M4XA 3PBRA 3R7WB 4IUHA 3KX0X 3S7NA 3VE3A 2QKPA 4MMNA 4L9GA 3G6OA 2VZWA 4QPRA 4F3LA 2D02A 4HJ6A 1S1YA 1P0ZA 2ZBBA 2ZOHA 4BBTA 3T4KA 2K31A 3OC2A 5HZHA 2JN7A 3NHQA 4BMWA 4GHIA 2O0YA 4EXOA 4KQOA 1P9RA 4XT2B 3K2NA 3EWKA 4JGPA 3LR0A 3O5YA 2P08A 4UEYA 1Y28A 1NLZA 3MFXA 4PKYA 3RFBA 5HD5A 4GW9A 4WF0A 1LSWA 4R70A 4BBUA 1MZUA 4B9OA 5HSQA 1TS8A 2VEAA 2JKTM 3CAXA 3T4JA 3IS2A 2LB5A 2W3FA 3IBJA 4EQ1A 2QWSA 3FPVA 3PBSA 3MQ0A 5DKKA 3F1NA 4F3LB 2WKQA 4ETZA 2GX5A 4LLOB 3LIDA 2PYPA 2VX8A 3NJAA 4FOFA 4EESA 4CQHA 4GHIB 1G6OA 2FZ0A 4WN5A 3BQ8A 2I9VA 3EGDC 5J3WA 2DMWA 3A0RA 4NXBA 1F98A 5HDCA 2HGVA 1H3QA 5F5YA 4WEJA 4IUKA 3H7WA 3LR4A 2W3GA 4WELA 1T1CA 5J7EA 2W1TA 3PBNA 1N9OA 4O0PA 3UB9A 3LR3A 3LICA 3BJNA 1YSQA 1T1BA 3IS2B 1UGUA 2V0UA 2ZMVA 2P7JA 1OPXA 1T1AA 2Z6CA 3NOTC 3OBFA 3BWLA 3PR6A 3K3CA 3MQQA 4NXGA 2PYRA 5CX7A 2Y8HA 3F1NB 3KSHA 4DJ2A 4II7A 5MC7A 1N9NA 4L9EA 1XJ2A 1P9WA 1LSXA 2HF6A 2W3HA 4Y3IA 3FG8A 2O9BA 4ETXA 5HWVA 2VV7A 4HIAA 3TW8A 3E98A 3E0YA 3LIBA 4MDZA 1XFNA 3MF0A 4GS9A 2ZMFA 5AJGA 2Y79A 3B42A 4NXFA 1DP9A 4JGQA 2QJ7A 4RQ9A 3LI8A 3LR5A 1UWNX 2QYBA 2NUTC 1D7EA 4B93A 3S7PA 3H7WB 1T18A 4Q0IA 4WUJA 2O9AA 3CITA 4Q0JA 2KX6A 2CMNA 2W1TB 2JKRI 2XROA 3KSIA 3OLOA 1GSWA 2H28A 1EW0A 2K7SA 4UQIS 1DP6A 1BYWA 4UQIM 3A0VA 1VHMA 3KSFA 2HJEA 5DKLA 2J3TD 1ZTUA 3KYQA 4LRZE 2VV6A 2KLIA 3T50A 2OOLA 1KOUA 1TF1A 4I3IA 3PBTA 1NRJA 4G3WA 4HJ3A 4EEPA 2MJ6A 3S7QA 5DF9A 2VLGA 3ZYTA 3T4OA 5DJTA 1X0OA 3NOPC 3VV4A 1S4SA 2W3EA 3TJZC 5LBRA 4LPZA 4R3AA 1UWPX 1XJ4A 1YAXA 3C2WA 2QHKA 2PR5A 4GS9B 3A0SA 4CLCD 2L1MA 4DJ3A 5F68A 2GNXA 2A2LA 3RH8B 3BY8A 3NOUC 5EFWA 2K2NA 2PT7A 5DJUA 4BWIA 3MMHA 3CLOA 5IU1A 4R38A 4HP4A 5IT5A 2KOIA 5AVEA 1G28A 3EEAA 4HI4A 4ME4A 4OOMA 3F1PA 2W3DA 5G4YA 3KO6A 2OAP1 1LL8A 4I39A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F9I A;  1OT6 A;  1S66 L;  1ODV A;  3ZQ5 A;  4HY8 A;  4L9F A;  1TS7 A;  3F1O A;  5HD3 A;  1DRM A;  3LYX A;  4LRY C;  4HQA A;  5HDS A;  3ICY A;  2A24 A;  3ULF A;  1S67 L;  1OTD A;  4HH3 A;  3MR0 A;  4HOI A;  2HV1 A;  1TS6 A;  1GSV A;  3E4O A;  2W27 A;  4JGR A;  5KIZ A;  1OJ5 A;  1GSX A;  3F1P B;  3H82 A;  1LT0 A;  4E04 A;  4HP9 A;  1V9Z A;  2YKH A;  3MXQ A;  1N9L A;  4PKY G;  4H6J A;  3PYP A;  1OTE A;  1DP8 A;  2PDR A;  3F1O B;  5IS1 A;  3UB7 A;  3UME A;  4WLA A;  2A24 B;  3VE4 A;  3FC7 A;  2L0W A;  2GJ3 A;  1S1Z A;  4I3A A;  4KQD A;  1S4R A;  1V9Y A;  2ZOI A;  4BBV A;  1OTA A;  3UE6 A;  4K08 A;  3UB6 A;  1XFQ A;  3H82 B;  4KUK A;  3SW1 A;  2BAS A;  1LSV A;  2R78 A;  2YKF A;  3LI9 A;  2D01 A;  3EEH A;  4KUO A;  4H6J B;  2OWJ A;  2EA9 A;  2B02 A;  1JNU A;  1OJG A;  2VV8 A;  5HWT A;  2Z6D A;  2V1A A;  2QJ5 A;  2V9A A;  3MJQ A;  2INW A;  3E4P A;  4MN6 A;  5I5L A;  5HWW A;  1WA9 A;  3E4Q A;  3CWF A;  4I38 A;  1VB6 A;  2W0N A;  2PD7 A;  3LUQ A;  5F6A A;  5A8B A;  4NXE A;  1OT9 A;  4JGO A;  1OTB A;  5TBM A;  2WKP A;  3C8C A;  3D72 A;  3UB8 A;  3RTY A;  5G4Z A;  2J80 A;  2PHY A;  2M1C A;  3HJK A;  3UMD A;  4MN5 A;  2OWH A;  5AVF A;  4HNB A;  4EW7 A;  1TS0 A;  4HHD A;  1D06 A;  2V0W A;  4WL9 A;  4YWZ A;  3LIA A;  1P97 A;  1XJ6 A;  2PD8 A;  1T19 A;  2PR6 A;  4EET B;  4LRX C;  3LIE A;  3H9W A;  3P7N A;  3VOL A;  2JHE A;  4HJ4 A;  2L4R A;  1XJ3 A;  3LIF A;  2WKR A;  3MQO A;  4HH2 A;  5TBM B;  4R6L A;  1OTI A;  3BY9 A;  4XT2 A;  5J4E A;  2KDK A;  3K3D A;  3B33 A;  1NWZ A;  4I3J A;  3PHY A;  3GEC A;  3IBR A;  4GCZ A;  5HDD A;  2V1B A;  3HJI A;  4EER A;  4EEU A;  4I5S A;  3GDI A;  5F69 A;  4M4X A;  3KX0 X;  3VE3 A;  2QKP A;  4L9G A;  3G6O A;  4F3L A;  2D02 A;  4HJ6 A;  1S1Y A;  1P0Z A;  2ZBB A;  2ZOH A;  4BBT A;  5HZH A;  2JN7 A;  3NHQ A;  4GHI A;  4EXO A;  4XT2 B;  3EWK A;  4JGP A;  1Y28 A;  3MFX A;  4PKY A;  5HD5 A;  4GW9 A;  4WF0 A;  1LSW A;  4R70 A;  4BBU A;  1MZU A;  4B9O A;  5HSQ A;  1TS8 A;  2VEA A;  3CAX A;  3IS2 A;  4EQ1 A;  2QWS A;  5DKK A;  3F1N A;  4F3L B;  2WKQ A;  4LLO B;  3LID A;  2PYP A;  3NJA A;  4EES A;  4GHI B;  4WN5 A;  5J3W A;  2I9V A;  3A0R A;  4NXB A;  1F98 A;  5HDC A;  5F5Y A;  3H7W A;  1T1C A;  5J7E A;  1N9O A;  3UB9 A;  3LIC A;  1T1B A;  3IS2 B;  1UGU A;  2V0U A;  2P7J A;  1T1A A;  2Z6C A;  3NOT C;  3BWL A;  3K3C A;  3MQQ A;  4NXG A;  2PYR A;  3F1N B;  4DJ2 A;  1N9N A;  4L9E A;  1XJ2 A;  1LSX A;  3FG8 A;  5HWV A;  2VV7 A;  4HIA A;  3LIB A;  1XFN A;  4GS9 A;  4NXF A;  1DP9 A;  4JGQ A;  2QJ7 A;  4RQ9 A;  3LI8 A;  1UWN X;  1D7E A;  3H7W B;  1T18 A;  4WUJ A;  2KX6 A;  2CMN A;  3OLO A;  1GSW A;  2H28 A;  1EW0 A;  2K7S A;  1DP6 A;  1BYW A;  3A0V A;  5DKL A;  3T50 A;  4LRZ E;  2VV6 A;  2OOL A;  1KOU A;  4I3I A;  4HJ3 A;  4EEP A;  2VLG A;  5DJT A;  1X0O A;  3NOP C;  1S4S A;  4LPZ A;  4R3A A;  1UWP X;  1XJ4 A;  3C2W A;  2QHK A;  2PR5 A;  4GS9 B;  3A0S A;  2L1M A;  4DJ3 A;  5F68 A;  3RH8 B;  3BY8 A;  3NOU C;  5EFW A;  5DJU A;  3CLO A;  5IU1 A;  4R38 A;  4HP4 A;  5AVE A;  1G28 A;  4HI4 A;  3F1P A;  5G4Y A;  1LL8 A;  4I39 A; 
#chains in the Genus database with same CATH topology
 2Y91 A;  1F9I A;  4B88 A;  3UE0 A;  1IOU A;  5EE8 A;  3ZQ5 A;  3CPT B;  1E3U A;  1XPB A;  2P9V B;  2BG1 A;  5TGF A;  5I94 A;  3GSG A;  4LRY C;  5HDS A;  3ICY A;  3PBQ A;  2FFF B;  2Q0O A;  4ZRR A;  4DN0 A;  4JPM A;  4HOI A;  5KSH A;  1NZO A;  3E2L A;  2O9C A;  5EVI D;  1CI8 A;  1GSV A;  2W27 A;  4HBT A;  2G7U A;  2Y4A A;  1LLB A;  3W4O A;  4A5R A;  5KIZ A;  2EX8 A;  5U47 A;  1LT0 A;  2EXB A;  3RXX A;  3MZD A;  5F1F A;  5L09 A;  2YKH A;  1N9L A;  1YSP A;  4X55 A;  3NC8 A;  4KZ8 A;  3WRT A;  1DP8 A;  4EUV A;  3TRC A;  2ZQA A;  5HL6 A;  4NG2 A;  1H8Z A;  1S6R A;  4ZTK A;  1MPL A;  4KEN B;  3SH7 A;  4YNR A;  1VM1 A;  2WYX A;  1V9Y A;  5CEB A;  4BBV A;  3N6I A;  4P6Z M;  2IWB A;  3UB6 A;  3O86 A;  3CHW P;  3Q81 A;  4KUK A;  1L0G A;  4XUZ A;  1YT4 A;  2BAS A;  1GHP A;  3JYI A;  1ONG A;  4N9L A;  2R78 A;  3UB5 P;  3DTI A;  3LI9 A;  2D01 A;  3EEH A;  2OSU A;  1NLY A;  4CLC A;  3FPW A;  5HX9 A;  1JNU A;  1K38 A;  1W63 Q;  3ISG A;  4FSF A;  3NDG A;  3QP2 A;  2V1A A;  3NUL A;  3IWO A;  2B18 A;  2QJ5 A;  4CLC C;  3HCY A;  4D60 A;  1K54 A;  1JTD A;  2V9A A;  2INW A;  3CUE A;  3GRJ A;  5I5L A;  5HWW A;  3IT9 A;  4WEK A;  3E4Q A;  2M7V A;  1MWS A;  4GLQ A;  1K54 C;  2NUP C;  2V8F A;  2CC1 A;  3CUE C;  1W8Y A;  4XUX A;  2JKT I;  3V3S A;  1L3L A;  1YLP A;  3DBA A;  3DTK A;  1W7F A;  3R4K A;  1BLS A;  1OTB A;  3W8K A;  1ZHH B;  3W4P A;  3D72 A;  3O3V A;  3P01 A;  4S2O A;  5G4Z A;  4CLC B;  5DFY A;  1Q2Q A;  3UDX A;  3UMD A;  1IYO A;  3T4Q A;  3BQA A;  3OOV A;  4FH2 A;  1MWT A;  5A90 A;  4HNB A;  4Q8I A;  4MLL A;  3IXB A;  1D06 A;  1YQS A;  3DWK A;  2X02 A;  3JVU A;  3VP3 A;  4JF6 A;  4O7D A;  5F83 A;  5GHY A;  4EET B;  1SCW A;  1IYS A;  4O01 A;  2XDM A;  2M7U A;  3P7N A;  3G2Z A;  3LY4 A;  3VOL A;  3G2Y A;  4OPQ A;  2JKF A;  1STZ A;  3BY9 A;  5AQ7 A;  2G2U A;  4OOL A;  3TE8 A;  3CMZ A;  4Y5F A;  5CXW A;  3B33 A;  1NWZ A;  4I3J A;  2Z2M B;  3GEC A;  3IBR A;  1CF0 A;  2V1B A;  5HAR A;  4FH4 A;  2WGW A;  4I5S A;  1MBL A;  4PAU A;  3HLC A;  4MMN A;  1CK3 A;  1K25 A;  1YM1 A;  3G6O A;  4F3L A;  2PBD P;  2HP9 A;  2ZOH A;  3T4K A;  3OC2 A;  3DTE A;  4PMA A;  3NHQ A;  4BMW A;  1PFL A;  1OME A;  2O0Y A;  4EXO A;  4C3Q A;  3LR0 A;  3GQZ A;  3SH8 A;  1NLZ A;  3RFB A;  1NYM A;  4PKY A;  3VMA A;  3WS4 A;  3LY3 A;  4BBU A;  5HSQ A;  1TS8 A;  4IBX A;  2WGW B;  2JKT M;  2LB5 A;  3IBJ A;  4DE3 A;  2J8Y A;  2V8C A;  2Y2I A;  4EQ1 A;  4FD8 A;  2QWS A;  4RVA A;  3FPV A;  1C3B A;  4EWF A;  2ZQC A;  3F1N A;  4F3L B;  4ETZ A;  2GX5 A;  4BD1 A;  4LLO B;  4Y7P A;  3VSL A;  3MS6 A;  5E2G A;  1RGZ A;  3ITA A;  1NY0 A;  1G6O A;  2ZC3 B;  3ZFZ A;  1YLW A;  3L9K A;  5GHZ A;  2BLS A;  1HD8 A;  2ZC5 B;  4KZ4 A;  5HFO A;  2Y55 A;  4IUK A;  4WEL A;  4R0Q A;  5FAP A;  3NEC A;  2PU4 A;  5CHM A;  5FI7 A;  3LIC A;  2V0U A;  4BEN A;  1OPX A;  1W5D A;  3QNB A;  2Z6C A;  3NOT C;  1DJC A;  2HPB A;  3HRE A;  5CX7 A;  3A3F A;  4GZB A;  2Y8H A;  3F1N B;  3KSH A;  4DJ2 A;  5MC7 A;  1CQA A;  1XJ2 A;  4K0X A;  1LSX A;  4GOG A;  4Y3I A;  2VV7 A;  1HLU P;  3HUO A;  4QWO A;  3M2K A;  3LIB A;  4MDZ A;  2Y2L A;  2HDR A;  4JF4 A;  5JYP A;  5JYO A;  5AJG A;  2H5S A;  2Y79 A;  3B42 A;  3UE1 A;  3C7U A;  4JGQ A;  3LI8 A;  1MWR A;  1M6K A;  5FAT A;  4Q0I A;  4R4R A;  4OP8 A;  3A3D A;  4GD8 A;  2O9A A;  3HUN A;  4Q0J A;  2KX6 A;  2CMN A;  5L07 A;  2XRO A;  5KSC A;  4UA9 A;  2HDQ A;  1LL9 A;  1EW0 A;  1ZG4 A;  4UQI S;  2K7S A;  3NIA A;  3KSF A;  2J3T D;  1ZTU A;  3T50 A;  2XFS A;  4LRZ E;  2KLI A;  2JC7 A;  3AGE A;  1NRJ A;  4N9K A;  4EEP A;  3C4P A;  3MKE A;  2MJ6 A;  4WZ4 A;  5FA7 A;  1IYP A;  1K4F A;  1X0O A;  1KE4 A;  3TJZ C;  4BL3 A;  2DRW A;  1UWP X;  1XJ4 A;  3C2W A;  1XGI A;  2PR5 A;  3IF6 A;  3Q07 A;  3M2J A;  2GNX A;  3RJU A;  3NOU C;  5FQK A;  1FIL A;  2K2N A;  5DJU A;  3IF6 C;  5IU1 A;  2KOI A;  1SDE A;  1G28 A;  4ME4 A;  4OOM A;  5G4Y A;  2OAP 1;  2XD1 A;  3BEB A;  4KZ3 A;  1ACF A;  1E3U D;  4UHU A;  1SDN A;  4DMZ A;  3F1O A;  2A3U A;  4Q0H A;  1DRM A;  4LEN A;  3LYX A;  3IF6 B;  4EBP A;  1OTD A;  4CPK A;  5HPF A;  4G3K A;  4KQR A;  2WZX A;  4PM6 A;  3BLM A;  1TS6 A;  3E4O A;  4JGR A;  4UA6 A;  1FCO A;  3T1S A;  2VGL S;  2P04 A;  5K5B A;  1OJ5 A;  5A93 A;  1Y54 A;  3H82 A;  2ZQ7 A;  4E04 A;  4HP9 A;  4ARZ A;  1Q2P A;  3SS4 A;  3T4L A;  4H6J A;  2PDR A;  3F1O B;  3UDI A;  3HLW A;  4WMC D;  2O99 A;  5F82 A;  5IS1 A;  1BT5 A;  3UME A;  4WLA A;  4Y0O A;  4S2K A;  3G35 A;  3FC7 A;  5DF8 A;  1VEU A;  4S2L A;  1BTL A;  1O07 A;  3T4S A;  1W8Q A;  3M6H A;  3V5M A;  5GL9 A;  2UWX A;  2ZOI A;  2Z2L B;  3UE6 A;  3AGF A;  3IF5 A;  1YLZ A;  3H82 B;  3KYZ A;  2J3T C;  4GDN A;  2OAQ 1;  3S4X A;  4ARZ B;  1JTG A;  5HAP A;  3B47 A;  4GB7 A;  4H6J B;  4O8G A;  1KVM A;  3VP4 A;  2EA9 A;  2B02 A;  4KQQ A;  3BFD A;  2WGV A;  2Y2Q A;  3IWI A;  4UA7 A;  1VEU B;  4BL2 A;  3QNC A;  3PXP A;  1WA9 A;  5CTN A;  4I38 A;  2W0N A;  3LUQ A;  5F6A A;  5A8B A;  1IEM A;  4NXE A;  1XA1 A;  3G32 A;  2GZA A;  4KG5 A;  1TD5 A;  3OPR A;  4Y2F A;  2WKP A;  3IQA A;  3ZG7 B;  3U2A A;  3FZC A;  2J80 A;  2PHY A;  3HJK A;  1I5Q A;  4MN5 A;  2R9W A;  5AVF A;  4Y0U A;  5FQM A;  1DY6 A;  2H0Y A;  5HAQ A;  4M3K A;  2XA7 S;  3T1X A;  4EW7 A;  4DE2 A;  4HHD A;  2PRF A;  1S0W A;  3Q7V A;  2H0T A;  2XEP A;  2PD8 A;  4P0M A;  5HPI A;  2EFU A;  1T19 A;  2EWV A;  2WAF A;  3WS1 A;  3BYD A;  4LV2 A;  1EWZ A;  5G18 A;  4LRX C;  4LFU A;  2Y2M A;  3LIE A;  4U0T A;  4NK3 A;  2JE5 A;  3N8L A;  3GV9 A;  3LIF A;  4KZ6 A;  4WMC A;  5FEF A;  2VJW A;  1AXB A;  2E8I A;  4Y15 A;  1KVL A;  2WKE A;  1MKM A;  1W63 M;  3CJM A;  5CTM A;  1CEG A;  5DTK A;  4GCZ A;  5HDD A;  3HJI A;  4EER A;  1G5U A;  4MBF A;  3Q7V B;  3BFF A;  3MXS A;  1GCE A;  3GDI A;  1XGJ A;  4E3N A;  4NEE D;  1PYY A;  3PBR A;  3S7N A;  4IUH A;  4JBF A;  3VE3 A;  3NY4 A;  2Y2O A;  5EOO A;  1RCJ A;  2D02 A;  1WE4 A;  1IYQ A;  1P0Z A;  1L0D A;  2K31 A;  3Q1F A;  5IHV A;  4KQO A;  2H10 A;  4KZ9 A;  3NCK A;  3EWK A;  2A49 A;  3OPP A;  5DTT A;  4UEY A;  1Y28 A;  1KGF A;  1TDG A;  3NI9 A;  4B9O A;  4S2M A;  2VEA A;  3CAX A;  4MBK A;  1K57 A;  4DDS A;  1Y4O A;  3MQ0 A;  4QB8 A;  4K0W A;  3BFG A;  1D1J A;  3LID A;  2PYP A;  1K57 C;  2VX8 A;  2JCH A;  2ZJ9 A;  2J7V A;  3BQ8 A;  2DMW A;  4OQ0 A;  4NXB A;  1F98 A;  2Q9N A;  2XQZ A;  5HDC A;  3TSG A;  3UN7 A;  1H3Q A;  3Q7Z A;  4QJG A;  3HBR A;  3A3I A;  2QMI A;  1T1C A;  1JVJ A;  4O0P A;  4DXB A;  1J9M A;  4OLD A;  2DNS A;  1T1B A;  2ZMV A;  2P7J A;  3OBF A;  3CZD A;  3K3C A;  1F2K A;  3SOI A;  3MQQ A;  1FIK A;  4L9E A;  4E3I A;  1P9W A;  2J9P A;  3FG8 A;  2EX6 A;  4E3L A;  4HIA A;  4C75 A;  4DXC A;  5CED A;  3MF0 A;  4ESP A;  2ZMF A;  4S2P A;  1UWN X;  2QYB A;  2ZM2 A;  2XF3 A;  4X69 A;  3S7P A;  1LI9 A;  3BM6 A;  4WUJ A;  1BUL A;  3CIT A;  1HTZ A;  3OLO A;  2OLV A;  3KSI A;  1PI5 A;  4QD4 A;  1A0K A;  4UQI M;  1DP6 A;  2EXA A;  2Y2H A;  3KYQ A;  2VV6 A;  4I3I A;  1KOU A;  4HJ3 A;  4PM9 A;  5DF9 A;  4U0X A;  2IWC A;  4R3J A;  3T4O A;  3NOP C;  2W3E A;  4DF6 A;  5FQI A;  3ZCZ A;  3HVF A;  5LBR A;  2PAV P;  4LPZ A;  3V39 A;  4ZAM A;  2QHK A;  3VOZ A;  2L1M A;  3HLG A;  5F68 A;  3GMW A;  2A2L A;  1ES5 A;  3MXR A;  5EFW A;  3VP0 A;  2B95 A;  3IHA A;  4BWI A;  1GA0 A;  4FUW A;  4OKP A;  5AVE A;  3EEA A;  3F1P A;  4B4Z A;  3O88 A;  3GTC A;  1OT6 A;  4YOF A;  3G31 A;  3IX8 A;  5EVL A;  3ZVW A;  1S66 L;  4WZ5 A;  3M6B A;  4HEF A;  4HY8 A;  4L0L A;  4BLM A;  3LGO A;  4L9F A;  1TS7 A;  3HLF A;  5HD3 A;  4WZ5 C;  4RA7 A;  1IFQ A;  3ULF A;  1PNE A;  4Y17 A;  5E2E A;  5GHX A;  4GDB A;  1Z6F A;  2HV1 A;  3TG9 A;  3FV7 A;  2QPN A;  3T4T A;  5L10 A;  1ZKJ A;  1LI0 A;  1H8M A;  2P74 A;  1H5X A;  2IA2 A;  1ES2 A;  1FSW A;  2VGL M;  3EQV A;  3LFV A;  1ERM A;  3F1P B;  4MN7 A;  3UY6 A;  5E2H A;  1H8Y A;  1AWI A;  1BSG A;  2ZM0 A;  4MBH A;  2JBF A;  3PYP A;  1OTE A;  1MC0 A;  3LEZ A;  4GJ4 A;  1SZV A;  4PM5 A;  3UB7 A;  3UPP A;  3VE4 A;  1L0F A;  3QP6 A;  2GJ3 A;  4X68 A;  1S1Z A;  2PBY A;  4Z1W A;  1PW8 A;  2WZZ A;  4I3A A;  4IHQ A;  1S4R A;  3S7O A;  5DFX A;  4K08 A;  3N4I A;  2J3W A;  4HBU A;  1XFQ A;  1JWP A;  4KUO A;  4GKU A;  3KSG A;  1PWG A;  5A91 A;  4KG6 A;  1OJG A;  2VV8 A;  3G34 A;  3Q82 A;  2W1R A;  2Z6D A;  3OCL A;  1YLY A;  2ZQ8 A;  5GLC A;  2QZ6 A;  3E4P A;  4MN6 A;  2EWW A;  4S2I A;  3CWF A;  2HP5 A;  3P09 A;  4JXG A;  4N1H A;  2PD7 A;  1KDS A;  2UV0 E;  5BOH A;  1BZA A;  5F1G A;  4JGO A;  2WUQ A;  4BJP A;  4C6Y A;  3WWX A;  3RTY A;  1K56 A;  3C7V A;  3V67 A;  4QU3 A;  3G4P A;  2Y2K A;  2OWH A;  2VGJ A;  4PM7 A;  1ERQ A;  2C5W B;  2XFT A;  4LGW A;  2XA7 M;  3OZH A;  1TS0 A;  3V3R A;  1ES3 A;  2ZC7 A;  4AFI A;  2V0W A;  3HLD A;  3ZHH A;  4YWZ A;  3LIA A;  1XJ6 A;  4DE0 A;  3BEC A;  3R7W A;  4PHT A;  2PR6 A;  4JKT A;  3ZG0 A;  3CI6 A;  5E43 A;  3ITB A;  3H9W A;  2JHE A;  5TJJ A;  1XJ3 A;  4E3J A;  2WKR A;  5EM0 A;  4R6L A;  1OTI A;  4EV4 A;  1LL5 A;  4OVD A;  5J4E A;  1N4O A;  2VA0 A;  1PIO A;  4FCF A;  3MKF A;  3K3D A;  3W2Z A;  1XP4 A;  1PZO A;  2ZQD A;  5HAI A;  3T1Q B;  5CHU A;  3S1Y A;  4EEU A;  1QMF A;  2WGI A;  2EX2 A;  2ZC4 B;  3DW0 A;  1ZG6 A;  5F69 A;  4X56 A;  4M4X A;  2XH9 A;  3R7W B;  3KX0 X;  1BLP A;  4OQH A;  2QKP A;  2E8J A;  1ONH A;  4L9G A;  1NYY A;  4QPR A;  5DF7 A;  1NXY A;  5EOE A;  1S1Y A;  3TOI A;  1JWV A;  4BBT A;  3HUM A;  3SS3 A;  4JF5 A;  4GHI A;  1P9R A;  3CPT A;  5EUA A;  2Y2N A;  4JGP A;  1FSY A;  3O5Y A;  2P08 A;  1DJB A;  4P87 A;  4RX3 A;  5CEC A;  1XXM A;  2BTF P;  5HD5 A;  4WF0 A;  1I2W A;  2V20 A;  5DVA A;  4R70 A;  3T4J A;  3IX4 A;  5FAQ A;  1JWZ A;  5EV0 A;  4R3B A;  4EUZ A;  4E3K A;  1KE0 A;  1NZU A;  4DE1 A;  2EX9 A;  1G68 A;  1MXO A;  3QP5 A;  5GLA A;  3OPH A;  4CQH A;  4GHI B;  5CGS A;  1E4D A;  4X6T A;  3EGD C;  2I9V A;  4E6X A;  3LO7 A;  4GN2 A;  4LCL A;  1MY8 A;  2HDS A;  3W4Q A;  1K55 A;  3VFF A;  5F5Y A;  3GVB A;  3H7W A;  1NRF A;  4LV3 A;  5J7E A;  3DAV A;  2W1T A;  3PBN A;  2EFX A;  4XXR A;  1K55 C;  3LR3 A;  1SKO A;  1YSQ A;  1TVF A;  1UGU A;  4R23 A;  1T1A A;  2VK3 A;  2WAE A;  5FSR A;  5KMW A;  4NXG A;  3MFD A;  4II7 A;  2ZD8 A;  4F94 A;  5EEC A;  3SH9 A;  2HF6 A;  2W3H A;  4X53 A;  5EM1 A;  1QME A;  5HWV A;  1VET A;  3TW8 A;  1TEM A;  3E98 A;  3E0Y A;  1XFN A;  1BLC A;  2XD5 A;  2QJ7 A;  4RQ9 A;  3O87 A;  4PPR A;  4RX2 A;  3NBL A;  3C5A A;  4B93 A;  3H7W B;  3IX3 A;  2W1T B;  3WS2 A;  5FDS A;  2I72 A;  1YMS A;  2JKR I;  3P98 A;  1ERO A;  1HZO A;  1L2S A;  1GSW A;  3NDE A;  1SKO B;  3RXW A;  1FOF A;  2WKI A;  4ZJ2 A;  2HJE A;  5DKL A;  2JKG A;  1RP5 A;  2OOL A;  1TF1 A;  4G3W A;  5EVE A;  4KZ7 A;  5TR7 A;  4LV1 A;  3ZYT A;  5DJT A;  1PZP A;  4QY5 A;  3VV4 A;  1XX2 A;  1VET B;  5FQQ A;  1KDW A;  1YAX A;  1KGE A;  4OPR A;  5EPH A;  1PRQ A;  5KZH A;  5FAO A;  4NET A;  1ALQ A;  4YFM A;  2PT7 A;  3FKW A;  3MMH A;  5AQ9 A;  1WYC A;  3MSH A;  3WS0 A;  2V1Z A;  4R38 A;  4PM8 A;  5AQA A;  3VFH A;  3D9Y A;  1ESU A;  2W3D A;  3UPO A;  3KO6 A;  2WAD A;  4I39 A;  1SHV A;  2C6W B;  3IWQ A;  1ODV A;  3CG5 A;  4H8R A;  2ZC6 B;  2ZLY A;  1L0E A;  4HQA A;  3PBO A;  3ZG5 A;  2A24 A;  2Y2P A;  4OQG A;  1S67 L;  1PI4 A;  2FFY A;  3QHY A;  5FL3 A;  4HH3 A;  3MR0 A;  4GD6 A;  1H0M A;  5GLD A;  2FH5 A;  4DKI A;  5EVI A;  3U4L P;  4E3O A;  4X25 A;  3MZF A;  3BW6 A;  1GSX A;  3HLB A;  3N7W A;  2R9X A;  3UE3 A;  5AQB A;  2AVX A;  5EVI C;  2Y2G A;  1V9Z A;  3QP1 A;  1FR1 A;  3D3O A;  3MXQ A;  4OPY A;  5FI2 A;  4PKY G;  4EQI A;  1F5M A;  2IWD A;  2ZMA A;  5FEG A;  2XSS A;  3VP2 A;  3A3E A;  3LEQ A;  2A24 B;  1FCM A;  2JKR M;  4LV0 A;  5A92 A;  3ZNY A;  2L0W A;  1BUE A;  3S22 A;  1CI9 A;  3QP8 A;  5D3O A;  4KQD A;  1IKI A;  5EVI B;  4OLG A;  5CGW A;  3FKV A;  2OLU A;  3T12 B;  1OTA A;  4P6Z S;  1M40 A;  1TDL A;  4IBR A;  4IVI A;  3SW1 A;  1LSV A;  3PAE A;  2YKF A;  2HJ9 C;  3EGX C;  3HL9 A;  2OWJ A;  1PWC A;  2VKS A;  4QHC A;  3OCN A;  2RL3 A;  5FQJ A;  2RCX A;  2XR0 A;  5HWT A;  3VOY A;  4GNU A;  1YKD A;  2V2F F;  4YIN A;  5HL1 A;  1BLH A;  3JVV A;  3MJQ A;  3G30 A;  1YLT A;  2Y59 A;  4HES A;  1NJ4 A;  1VB6 A;  4B4X A;  4MCW A;  3DWZ A;  4EBN A;  3C4O A;  2XRN A;  1OT9 A;  3T1R A;  3A3J A;  4IVK A;  4U3T A;  3C38 A;  3ZG8 B;  4FTX A;  1I2S A;  3EOI A;  2Y2J A;  5J8X A;  2XLN A;  2HP6 A;  3LCE A;  3PTE A;  5TBM A;  1GHI A;  4EU0 A;  3EQU A;  1EI5 A;  3C8C A;  3UB8 A;  1K56 D;  2LB9 A;  1VQQ A;  4NKP A;  2M1C A;  1J3W A;  2G2W A;  4S2N A;  1KE3 A;  5CHJ A;  4ZJ1 A;  5FAS A;  4G3V A;  2J9O A;  4N92 A;  4WL9 A;  4S2N C;  1P97 A;  2VGK A;  5M1A A;  4P6B A;  5C5K A;  3B3X A;  1O7E A;  4WM9 A;  3C30 A;  2X01 A;  4HJ4 A;  2L4R A;  5HW3 A;  4HH2 A;  3MQO A;  5FDH A;  3IXD A;  5TBM B;  2OV5 A;  2PU2 A;  4XT2 A;  5L8M A;  2Q9M A;  1G6A A;  2KDK A;  3FYZ A;  3PHY A;  1GA9 A;  3OPL A;  3UNW A;  3IXH A;  4CLC E;  1PWD A;  2ZL1 A;  4IJG A;  4KZA A;  2ZQ9 A;  2XK1 A;  5E2F A;  5TFQ A;  4WYY A;  2VZW A;  4N1X A;  4UAA A;  3BRM A;  3ZGA B;  4CJN A;  4HJ6 A;  1IEL A;  2ZBB A;  4OH0 A;  1N9B A;  1K4E A;  4R1G A;  4IED A;  2JN7 A;  4OP5 A;  5HZH A;  4KZB A;  1ZC2 A;  1YPR A;  4ZBE A;  3WS5 A;  4DDY A;  3ZG9 B;  4XT2 B;  3K2N A;  1YLJ A;  2WK0 A;  3GR2 A;  3QP4 A;  3IH8 A;  3MFX A;  3WRZ A;  2DCF A;  3BLS A;  4GW9 A;  3AGD A;  3V50 A;  1LSW A;  1WYB A;  4OPZ A;  1MZU A;  3ZDJ A;  2B5R A;  4OOY A;  1U60 A;  3IXG A;  3IS2 A;  3IH9 A;  2W3F A;  2ZL1 B;  4ZJ3 A;  3PBS A;  1FR6 A;  5DKK A;  1Z09 A;  1K6S A;  2WKQ A;  3SZT A;  3ZNT A;  4OQI A;  1XA7 A;  3DTM A;  1CJF A;  3NJA A;  4RYE A;  4FOF A;  4EES A;  4KG2 A;  2FZ0 A;  5M18 A;  1XKZ A;  5L2F A;  4WN5 A;  5J3W A;  3A0R A;  2WKH A;  5DTS A;  2HGV A;  4LCM A;  2GDN A;  3BFE A;  4WEJ A;  3LR4 A;  2W3G A;  3I7J A;  5GLB A;  4QY6 A;  3BFC A;  1N9O A;  3UB9 A;  3BJN A;  3IS2 B;  4D2O A;  1K6R A;  1FCN A;  2ACG A;  2X71 A;  5M19 A;  3VSK A;  3BWL A;  3PR6 A;  2PYR A;  3KYE A;  4E3M A;  1N9N A;  3E2K A;  1HVB A;  2O9B A;  4ETX A;  4Y0T A;  3VP1 A;  4P85 A;  1FQG A;  4E6W A;  4Z9Q A;  1GHM A;  3PAG A;  4GS9 A;  4X1L A;  4K91 A;  4NXF A;  4X1M A;  1DP9 A;  5FI6 A;  3LR5 A;  5CGX A;  2NUT C;  1E25 A;  4BD0 A;  1D7E A;  1PW1 A;  5CER A;  3N8R A;  1ES4 A;  1T18 A;  3JPU A;  4JXS A;  1W79 A;  3D4F A;  2H28 A;  2HZ5 A;  1CEF A;  1BYW A;  3A0V A;  4MNR A;  1VHM A;  3HLE A;  1MWU A;  4BQM A;  1LHY A;  2XGN A;  4Y13 A;  1RGY A;  1YMX A;  4MEZ A;  3PBT A;  2HDU A;  1IKG A;  4DRT A;  3UDF A;  2ZM8 A;  3S7Q A;  2VLG A;  4JXV A;  3UO9 A;  1S4S A;  2P9V A;  1SKF A;  1KGG A;  4R3A A;  4R4S A;  4JLF A;  3ZVT A;  4KZ5 A;  3SS5 A;  3MBZ A;  4GS9 B;  3A0S A;  4CLC D;  4OON A;  4ID4 A;  4EBL A;  4DJ3 A;  4WBG A;  1MKI A;  3RH8 B;  3BY8 A;  4S2J A;  5FQ9 A;  1DJA A;  3MZE A;  4ZDX A;  5CRF A;  3CLO A;  3FWL A;  4HP4 A;  5IT5 A;  1ESI A;  1K0K A;  3L7H A;  4HI4 A;  3N8S A;  3UPN A;  3IHB A;  1LL8 A;  4JXW A; 
#chains in the Genus database with same CATH homology
 1F9I A;  1OT6 A;  4YOF A;  1S66 L;  1IOU A;  1ODV A;  3ZQ5 A;  4HY8 A;  4L0L A;  4DMZ A;  4L9F A;  1TS7 A;  3F1O A;  4Q0H A;  5HD3 A;  1DRM A;  3LYX A;  4LRY C;  4HQA A;  5HDS A;  3ICY A;  3PBO A;  3PBQ A;  2A24 A;  1IFQ A;  3ULF A;  1S67 L;  5FL3 A;  1OTD A;  4ZRR A;  4DN0 A;  4HH3 A;  5HPF A;  3MR0 A;  4G3K A;  4HOI A;  2HV1 A;  5KSH A;  2FH5 A;  3T4T A;  2O9C A;  1TS6 A;  1H8M A;  1GSV A;  3E4O A;  2W27 A;  4JGR A;  2G7U A;  2IA2 A;  2VGL S;  2VGL M;  2P04 A;  5K5B A;  5KIZ A;  3EQV A;  1OJ5 A;  3BW6 A;  1GSX A;  3LFV A;  3F1P B;  3H82 A;  1LT0 A;  3UE3 A;  4MN7 A;  4E04 A;  4HP9 A;  1V9Z A;  2YKH A;  3D3O A;  3MXQ A;  4ARZ A;  1N9L A;  1YSP A;  3T4L A;  4PKY G;  4H6J A;  3PYP A;  1OTE A;  1F5M A;  1DP8 A;  2PDR A;  4EUV A;  3F1O B;  3TRC A;  1MC0 A;  2O99 A;  5IS1 A;  4GJ4 A;  2XSS A;  3UB7 A;  3UME A;  4WLA A;  2A24 B;  2JKR M;  3VE4 A;  3FC7 A;  5HL6 A;  2L0W A;  2GJ3 A;  4Z1W A;  1S1Z A;  3T4S A;  4I3A A;  4YNR A;  4KQD A;  4IHQ A;  1S4R A;  1V9Y A;  3S7O A;  2ZOI A;  4BBV A;  1OTA A;  5DFX A;  4P6Z S;  4P6Z M;  3UE6 A;  4K08 A;  3UB6 A;  2J3W A;  1XFQ A;  3H82 B;  3KYZ A;  4KUK A;  3SW1 A;  2BAS A;  2J3T C;  1LSV A;  2R78 A;  2YKF A;  2OAQ 1;  3LI9 A;  2D01 A;  3EEH A;  4ARZ B;  2HJ9 C;  4KUO A;  3EGX C;  3B47 A;  1NLY A;  4H6J B;  4O8G A;  3KSG A;  2OWJ A;  4CLC A;  2EA9 A;  3FPW A;  2VKS A;  2B02 A;  3OCN A;  1JNU A;  1OJG A;  2VV8 A;  1W63 Q;  5HWT A;  2W1R A;  2Z6D A;  3OCL A;  4FSF A;  1YKD A;  2V1A A;  3JVV A;  2B18 A;  2QJ5 A;  4CLC C;  3HCY A;  2V9A A;  3MJQ A;  2INW A;  3CUE A;  3E4P A;  4MN6 A;  5I5L A;  3PXP A;  5HWW A;  1WA9 A;  2EWW A;  4WEK A;  3E4Q A;  3CWF A;  2M7V A;  4I38 A;  1VB6 A;  2W0N A;  4GLQ A;  4MCW A;  2PD7 A;  3LUQ A;  2NUP C;  5F6A A;  5A8B A;  3CUE C;  2XRN A;  4NXE A;  1OT9 A;  2JKT I;  2GZA A;  3C38 A;  3DBA A;  1TD5 A;  3EOI A;  3R4K A;  4JGO A;  1OTB A;  1ZHH B;  5TBM A;  4BJP A;  4Y2F A;  2WKP A;  4EU0 A;  3EQU A;  3C8C A;  3D72 A;  3UB8 A;  3RTY A;  3P01 A;  2LB9 A;  5G4Z A;  3U2A A;  4CLC B;  5DFY A;  3V67 A;  2J80 A;  2PHY A;  2M1C A;  3HJK A;  4NKP A;  3UMD A;  3T4Q A;  3BQA A;  3OOV A;  4MN5 A;  2OWH A;  5AVF A;  4HNB A;  2XA7 S;  2XA7 M;  4EW7 A;  4G3V A;  1TS0 A;  4HHD A;  1D06 A;  2V0W A;  4WL9 A;  4AFI A;  3JVU A;  4YWZ A;  3LIA A;  1P97 A;  1XJ6 A;  2PD8 A;  5HPI A;  3R7W A;  1T19 A;  2EWV A;  4PHT A;  2PR6 A;  4EET B;  4O01 A;  5C5K A;  4LRX C;  3LIE A;  3C30 A;  3CI6 A;  2M7U A;  3H9W A;  3P7N A;  3VOL A;  2JHE A;  4HJ4 A;  2L4R A;  5TJJ A;  1XJ3 A;  3LIF A;  2WKR A;  3MQO A;  4HH2 A;  5TBM B;  4R6L A;  1STZ A;  1OTI A;  3BY9 A;  4XT2 A;  5J4E A;  5L8M A;  2VJW A;  2VA0 A;  4OOL A;  2KDK A;  3K3D A;  3TE8 A;  1MKM A;  1W63 M;  4Y5F A;  3W2Z A;  3B33 A;  1NWZ A;  4I3J A;  3PHY A;  3GEC A;  3IBR A;  4GCZ A;  5HDD A;  2V1B A;  3HJI A;  4EER A;  4EEU A;  4CLC E;  4I5S A;  4PAU A;  3GDI A;  4IJG A;  4NEE D;  5F69 A;  4M4X A;  3PBR A;  3R7W B;  4IUH A;  3KX0 X;  3S7N A;  3VE3 A;  2QKP A;  4MMN A;  4L9G A;  3G6O A;  2VZW A;  4QPR A;  4F3L A;  2D02 A;  4HJ6 A;  1S1Y A;  1P0Z A;  2ZBB A;  2ZOH A;  4BBT A;  3T4K A;  2K31 A;  3OC2 A;  5HZH A;  2JN7 A;  3NHQ A;  4BMW A;  4GHI A;  2O0Y A;  4EXO A;  4KQO A;  1P9R A;  4XT2 B;  3K2N A;  3EWK A;  4JGP A;  3LR0 A;  3O5Y A;  2P08 A;  4UEY A;  1Y28 A;  1NLZ A;  3MFX A;  4PKY A;  3RFB A;  5HD5 A;  4GW9 A;  4WF0 A;  1LSW A;  4R70 A;  4BBU A;  1MZU A;  4B9O A;  5HSQ A;  1TS8 A;  2VEA A;  2JKT M;  3CAX A;  3T4J A;  3IS2 A;  2LB5 A;  2W3F A;  3IBJ A;  4EQ1 A;  2QWS A;  3FPV A;  3PBS A;  3MQ0 A;  5DKK A;  3F1N A;  4F3L B;  2WKQ A;  4ETZ A;  2GX5 A;  4LLO B;  3LID A;  2PYP A;  2VX8 A;  3NJA A;  4FOF A;  4EES A;  4CQH A;  4GHI B;  1G6O A;  2FZ0 A;  4WN5 A;  3BQ8 A;  2I9V A;  3EGD C;  5J3W A;  2DMW A;  3A0R A;  4NXB A;  1F98 A;  5HDC A;  2HGV A;  1H3Q A;  5F5Y A;  4WEJ A;  4IUK A;  3H7W A;  3LR4 A;  2W3G A;  4WEL A;  1T1C A;  5J7E A;  2W1T A;  3PBN A;  1N9O A;  4O0P A;  3UB9 A;  3LR3 A;  3LIC A;  3BJN A;  1YSQ A;  1T1B A;  3IS2 B;  1UGU A;  2V0U A;  2ZMV A;  2P7J A;  1OPX A;  1T1A A;  2Z6C A;  3NOT C;  3OBF A;  3BWL A;  3PR6 A;  3K3C A;  3MQQ A;  4NXG A;  2PYR A;  5CX7 A;  2Y8H A;  3F1N B;  3KSH A;  4DJ2 A;  4II7 A;  5MC7 A;  1N9N A;  4L9E A;  1XJ2 A;  1P9W A;  1LSX A;  2HF6 A;  2W3H A;  4Y3I A;  3FG8 A;  2O9B A;  4ETX A;  5HWV A;  2VV7 A;  4HIA A;  3TW8 A;  3E98 A;  3E0Y A;  3LIB A;  4MDZ A;  1XFN A;  3MF0 A;  4GS9 A;  2ZMF A;  5AJG A;  2Y79 A;  3B42 A;  4NXF A;  1DP9 A;  4JGQ A;  2QJ7 A;  4RQ9 A;  3LI8 A;  3LR5 A;  1UWN X;  2QYB A;  2NUT C;  1D7E A;  4B93 A;  3S7P A;  3H7W B;  1T18 A;  4Q0I A;  4WUJ A;  2O9A A;  3CIT A;  4Q0J A;  2KX6 A;  2CMN A;  2W1T B;  2JKR I;  2XRO A;  3KSI A;  3OLO A;  1GSW A;  2H28 A;  1EW0 A;  2K7S A;  4UQI S;  1DP6 A;  1BYW A;  4UQI M;  3A0V A;  1VHM A;  3KSF A;  2HJE A;  5DKL A;  2J3T D;  1ZTU A;  3KYQ A;  4LRZ E;  2VV6 A;  2KLI A;  3T50 A;  2OOL A;  1KOU A;  1TF1 A;  4I3I A;  3PBT A;  1NRJ A;  4G3W A;  4HJ3 A;  4EEP A;  2MJ6 A;  3S7Q A;  5DF9 A;  2VLG A;  3ZYT A;  3T4O A;  5DJT A;  1X0O A;  3NOP C;  3VV4 A;  1S4S A;  2W3E A;  3TJZ C;  5LBR A;  4LPZ A;  4R3A A;  1UWP X;  1XJ4 A;  1YAX A;  3C2W A;  2QHK A;  2PR5 A;  4GS9 B;  3A0S A;  4CLC D;  2L1M A;  4DJ3 A;  5F68 A;  2GNX A;  2A2L A;  3RH8 B;  3BY8 A;  3NOU C;  5EFW A;  2K2N A;  2PT7 A;  5DJU A;  4BWI A;  3MMH A;  3CLO A;  5IU1 A;  4R38 A;  4HP4 A;  5IT5 A;  2KOI A;  5AVE A;  1G28 A;  3EEA A;  4HI4 A;  4ME4 A;  4OOM A;  3F1P A;  2W3D A;  5G4Y A;  3KO6 A;  2OAP 1;  1LL8 A;  4I39 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...