4EESA

Crystal structure of ilov
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
110
structure length
110
Chain Sequence
IEKNFVITDPRLPDNPIIFASDGFLELTEYSREEILGRNARFLQGPETDQATVQKIRDAIRDQRETTVQLINYTKSGKKFWNLLHLQPVRDQKGELQYFIGVQLDGSDHV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein, flavoprotein
molecule keywords Phototropin-2
publication title Structural Tuning of the Fluorescent Protein iLOV for Improved Photostability.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 33
structure length 110
sequence length 110
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4eesA00
5G4YA 3IS2A 3IS2B 3H82B 1UGUA 3K3DA 5HD5A 2D02A 1S4SA 1ODVA 3MR0A 4NXFA 3CAXA 5TBMA 1S66L 4GS9B 1F98A 4L9EA 2R78A 3A0SA 1V9ZA 1OTAA 2L1MA 2PDRA 4PKYG 5A8BA 4WN5A 2KX6A 3G6OA 3CLOA 4R3AA 3UMEA 2Z6DA 4DJ3A 2W0NA 4HIAA 4L9GA 3FC7A 1OTIA 4YWZA 4BBTA 4XT2A 1T1CA 4HNBA 3LYXA 1OTDA 3FG8A 1OTEA 3F1NA 3F1NB 3MJQA 4HJ3A 1F9IA 1MZUA 2JN7A 2PYPA 3UMDA 4R38A 4MN5A 4R70A 3H7WB 5J4EA 1GSWA 4WL9A 3GDIA 4I39A 4EQ1A 5HSQA 2QJ5A 4GHIA 4GHIB 4NXBA 3E4OA 3OLOA 4JGPA 1G28A 4NXEA 2Z6CA 4HP4A 2GJ3A 1N9LA 2BASA 3MQQA 2VLGA 4JGQA 2L4RA 3P7NA 4EETB 3MXQA 5AVFA 3LIAA 3NHQA 3H9WA 2EA9A 3A0VA 1TS8A 3MQOA 4BBVA 2HV1A 3BY8A 1JNUA 4R6LA 1V9YA 5HDSA 4HH2A 3NJAA 3B33A 2P7JA 4EXOA 5DJTA 4HJ6A 3VOLA 4BBUA 3LIFA 1XFNA 5TBMB 4EERA 3D72A 1OT6A 4WF0A 2ZOHA 3EWKA 1XJ3A 2L0WA 1GSVA 4E04A 2VV6A 1T1AA 3BY9A 1DP9A 2K7SA 4EESA 5J7EA 5HDCA 1D06A 3ICYA 2PHYA 3RTYA 3LUQA 3PYPA 5F68A 5IU1A 4XT2B 4I3JA 1LSWA 1LSVA 5J3WA 5HWVA 5F69A 2QKPA 2VEAA 1TS7A 4EEPA 1DRMA 3MFXA 1N9NA 3NOTC 1LL8A 1OTBA 2PD7A 2OWHA 1DP6A 3RH8B 4HH3A 2I9VA 4KUKA 4I38A 2D01A 1X0OA 3LIEA 1XJ4A 3A0RA 4GCZA 4JGOA 4L9FA 3GECA 3C8CA 4WLAA 2PR5A 1T19A 4WUJA 5DKLA 1GSXA 3UB8A 2VV8A 1P0ZA 4DJ2A 4LRZE 4EEUA 1T1BA 3CWFA 1S1ZA 2V1AA 3HJKA 4K08A 1D7EA 1VB6A 1OJ5A 2M1CA 4LPZA 2YKFA 5HD3A 3UB9A 3ULFA 2V9AA 1LT0A 5DJUA 3K3CA 2WKPA 1N9OA 4GW9A 5IS1A 5HWWA 2B02A 1BYWA 5HWTA 3F1OA 3F1OB 4HOIA 3UE6A 2YKHA 5KIZA 2QHKA 2ZOIA 4M4XA 2VV7A 1Y28A 3H82A 5G4ZA 5I5LA 3LI9A 4F3LA 4F3LB 2INWA 4MN6A 1DP8A 2J80A 4GS9A 2CMNA 1UWNX 1XJ2A 4HP9A 2V1BA 2QWSA 2OOLA 3VE4A 3NOPC 1TS6A 3ZQ5A 3LIBA 4B9OA 3HJIA 5AVEA 1OT9A 4LLOB 2ZBBA 1OJGA 3T50A 5DKKA 3UB7A 3SW1A 2V0WA 3KX0X 3VE3A 5F5YA 4RQ9A 3BWLA 3E4QA 1T18A 2H28A 4I3AA 3NOUC 3LI8A 1WA9A 1KOUA 3EEHA 4KUOA 3UB6A 4HHDA 4H6JA 4H6JB 1XJ6A 2WKQA 1TS0A 2PD8A 4HI4A 3F1PA 3F1PB 2JHEA 4HQAA 2W27A 3PHYA 5F6AA 3H7WA 2WKRA 1LSXA 4I3IA 4KQDA 2QJ7A 2KDKA 1S1YA 3LICA 2PYRA 2OWJA 2V0UA 4I5SA 4LRXC 4PKYA 4EW7A 1P97A 2PR6A 1EW0A 1S67L 4HJ4A 4JGRA 5HDDA 4NXGA 1S4RA 1UWPX 5HZHA 1NWZA 4HY8A 2A24A 2A24B 3E4PA 3LIDA 3IBRA 1XFQA 4LRYC 5EFWA 3C2WA
chains in the Genus database with same CATH superfamily
1ES3A 3BFDA 1BTLA 1UGUA 5HD5A 1QMFA 3UY6A 2Y59A 3IH8A 4PM9A 3W4PA 3MR0A 4CJNA 1YSQA 4NXFA 3NULA 5TBMA 1YT4A 5GLAA 4EUVA 1YLTA 1F98A 4S2OA 1YSPA 2Y2KA 3JPUA 5EVIC 4Q0JA 1P9WA 4PKYG 5A8BA 4K91A 3ZNTA 3B3XA 4ZRRA 4YINA 4R3AA 4S2KA 2Y2LA 1CEFA 4L9GA 1HD8A 2DMWA 1XX2A 1OTIA 3G32A 1CQAA 4BBTA 3MFDA 4XT2A 3QNBA 3VSLA 2EXBA 2A3UA 3MKFA 5AQ9A 1YKDA 5FA7A 3F1NA 4P6ZS 2X02A 4G3VA 1IKIA 3MXRA 1F9IA 4GOGA 1S0WA 3HREA 2R9XA 4GD6A 4FUWA 2JN7A 1NYMA 4JF6A 2W3HA 3GVBA 2J7VA 3T1SA 5CXWA 5DF8A 3H7WB 1K57C 5HX9A 4ZTKA 5J4EA 5DTKA 4I39A 4NXBA 1XXMA 4QPRA 1BULA 3BFGA 5CX7A 1JWVA 1EI5A 2Z6CA 4S2PA 1BUEA 4OPRA 1M40A 3MQQA 2XH9A 4S2LA 3DTMA 5EUAA 4KZBA 2OAQ1 1VM1A 5AVFA 1G68A 3CPTB 4BD0A 3A0VA 3FV7A 1XKZA 5EE8A 1MPLA 3KSIA 1TD5A 1SKFA 3IHBA 1SKOA 2W3EA 1OPXA 4BBVA 4X69A 4C75A 3O86A 4PAUA 1H8ZA 1FILA 3MS6A 2XSSA 2B95A 1FIKA 2P7JA 2EX9A 3IWIA 3LGOA 3VOLA 4MNRA 4BBUA 1XFNA 5TBMB 3ZG9B 1OT6A 3A3IA 3IX3A 2Y4AA 2L0WA 4NEED 4II7A 4E04A 3G35A 1L0GA 4WEJA 3SH8A 2UV0E 3BY9A 1DP9A 2J3WA 2HF6A 5HDCA 4EUZA 1E25A 5L09A 4IJGA 2EWVA 1HTZA 4XT2B 3DW0A 1PW1A 2WZXA 1I5QA 2VA0A 4KQOA 5J3WA 1K0KA 3V5MA 4MCWA 5JYPA 5F69A 2ZLYA 3UDXA 1NYYA 4EEPA 3NOTC 3PR6A 1LL8A 2ZQAA 4WBGA 3LR5A 2PD7A 5FAPA 2HPBA 3DAVA 4KZ3A 3GTCA 5FI6A 4GN2A 2G2WA 3IQAA 3V39A 4JF5A 3NIAA 3A0RA 4L9FA 2BG1A 3ZGAB 2JBFA 3BLSA 3HLCA 4PM8A 4Y7PA 1P0ZA 3G31A 3OPRA 3NDGA 5EOEA 3HLFA 2P74A 3K2NA 5M19A 2V1AA 3U4LP 2MJ6A 1XA1A 5FDSA 4LCMA 1IFQA 1SKOB 2HJEA 3B47A 3VOYA 3HLEA 1LT0A 4LCLA 5DJUA 1K56D 2ZM8A 1DJAA 2JKTM 5HWTA 2P04A 3T4KA 3UE6A 2ZC4B 2QHKA 3IXGA 2VV7A 3O5YA 1Y28A 4IHQA 2Y2GA 1ONGA 4Y2FA 5I5LA 1YMXA 1F5MA 2OAP1 4F3LA 2V2FF 4X6TA 5E43A 2J80A 2CMNA 1UWNX 2WGWB 1JVJA 5HPIA 4G3WA 3VSKA 2QWSA 2OOLA 1Z09A 3BJNA 2Y79A 2VGLM 1TS6A 3IHAA 5KSCA 1YLJA 4N1HA 5CTMA 4LFUA 5IT5A 2HJ9C 1MWUA 3KSHA 1PZOA 3NBLA 3UB7A 2Y2OA 4E3NA 1K55A 1YLYA 1BT5A 3DBAA 3VE3A 2PBYA 2WKIA 3T4OA 2W1TA 2H28A 4I3AA 4RX3A 3RFBA 1PYYA 1ESUA 2WGVA 1IYPA 1KOUA 4JXWA 3BLMA 5DTSA 3FWLA 4JXVA 3P09A 3TOIA 2Q9MA 4NETA 5C5KA 4N1XA 2J3TC 2WAFA 5E2GA 4HI4A 3ISGA 3F1PB 4OP8A 1W5DA 1GHPA 4JXGA 3WRTA 2WK0A 2XD5A 3QP5A 4DE2A 2WKRA 2OLVA 5GLCA 2A2LA 4S2MA 3JVUA 5EECA 4ZJ2A 1HVBA 2XROA 3C30A 2KDKA 1S1YA 3LO7A 3G34A 2E8JA 2V0UA 4FTXA 4FH2A 4LRXC 3RXXA 3GR2A 3V3RA 3SS4A 4XUXA 1P97A 3PXPA 3UB5P 3SS3A 1UWPX 1YAXA 3O88A 2P9VA 3HLBA 1NWZA 2A24A 3SH9A 5CHUA 2EWWA 3OC2A 4UHUA 1PI5A 4Z9QA 5A90A 2O0YA 4WMCD 3EOIA 1AWIA 2OSUA 3HLGA 1GHMA 3ZVWA 5G4YA 5DVAA 3Q1FA 3OPHA 4ZJ3A 3PAGA 2IWDA 1S4SA 1GHIA 1ODVA 3EGXC 4BL2A 1GA0A 4L9EA 3A0SA 4JF4A 3FKWA 4C6YA 4FOFA 3S7QA 3LY4A 3C7VA 2WKHA 4ARZB 4HESA 3QP6A 4OLGA 3DWZA 4U3TA 4DJ3A 2QMIA 1PNEA 1JTDA 1TEMA 3OCNA 2W1TB 3NDEA 3BEBA 3LYXA 4H8RA 3FG8A 4DN0A 4MMNA 3TRCA 3T4QA 2PRFA 5FEFA 1YLZA 5MC7A 2Y2NA 1YLPA 3NY4A 4CLCD 4HBUA 2NUPC 5I94A 4DE3A 3HUOA 1NY0A 2HZ5A 4MN5A 3UDIA 4E6WA 3IWQA 5TR7A 4BJPA 4R70A 5J8XA 2ZC5B 1ZKJA 1E4DA 3GDIA 1FQGA 1JWZA 4Y15A 1IYSA 4OP5A 5EVEA 4GHIB 1LL9A 1NRJA 1ERQA 1MY8A 1K55C 3MZEA 1YQSA 4C3QA 3ZG5A 2L4RA 3CPTA 3LIAA 3NHQA 4X56A 1PW8A 3H9WA 3DTIA 2JKTI 4GDBA 3IX8A 3KSFA 4EV4A 5CGWA 1XGJA 3CJMA 2V8FA 3IXBA 4ZBEA 3LFVA 4Y0OA 2GNXA 4HH2A 3Q7VB 2C6WB 4P6BA 4JXSA 5HL6A 3HLWA 1NLZA 4EXOA 3G4PA 2Y2MA 4BMWA 2VGLS 5HAIA 3IWOA 1BZAA 2IWCA 1W8QA 3D72A 4ETXA 1OMEA 3EWKA 1XJ3A 3A3FA 3OPLA 3MZFA 1MKMA 4ME4A 1T1AA 3S7OA 3EEAA 3JYIA 3HCYA 2Y55A 1D06A 2PHYA 3RTYA 5FSRA 2JC7A 3MF0A 5IU1A 3FKVA 3IBJA 2WYXA 4D60A 4KZ8A 1LSWA 4B88A 1Y4OA 3NC8A 3T4SA 5HWVA 4QHCA 2ZJ9A 3PTEA 5FI2A 3OCLA 5HW3A 1CF0A 3MFXA 3NCKA 3L9KA 3VFHA 1KE4A 3SOIA 3N4IA 3MBZA 1OTBA 3WRZA 3RH8B 4PM5A 3EGDC 1NRFA 4I38A 4QY5A 4KG6A 4DXBA 1W63M 3QNCA 4E6XA 3FZCA 4X68A 4NK3A 4DXCA 4L0LA 4DDSA 3GECA 3LCEA 4Y0UA 1KDWA 4WLAA 5EVID 1MXOA 4IEDA 2VJWA 4GZBA 5FAOA 1PWGA 1S6RA 1T19A 2BLSA 4WUJA 1MBLA 4KG5A 1GSXA 2ZQCA 4YNRA 4BWIA 5EVLA 1IYQA 5CEDA 4OPQA 4OVDA 4EEUA 3HJKA 4K08A 3RJUA 3PBTA 1OJ5A 3ZHHA 2M1CA 3OPPA 3ZDJA 3UB9A 4OQ0A 4DE1A 2XFSA 4Q0IA 3Q82A 2V1ZA 1BLHA 5HWWA 2R9WA 1TVFA 3OZHA 2UWXA 3F1OB 4HOIA 2CC1A 5KIZA 1CEGA 3VMAA 1KGEA 3SH7A 2ZOIA 2ZQ9A 3DWKA 4BLMA 1PFLA 1IOUA 2WGIA 1FSWA 2ZD8A 3LEZA 1E3UA 4R3JA 2INWA 4MN6A 1IYOA 2WGWA 4UQIM 5D3OA 5CERA 2EX2A 2LB5A 4HP9A 5CGSA 3M2JA 3VP1A 4JBFA 1HZOA 4GD8A 3IX4A 3NOPC 3MMHA 5LBRA 3UDFA 2X71A 3LIBA 4X1MA 3HJIA 3T1XA 1DJCA 1LI9A 4LLOB 2XA7M 3M6BA 3IF5A 1K6SA 2XLNA 1FCMA 3E4QA 2ACGA 4QB8A 5F83A 2B5RA 2JCHA 3NOUC 3LI8A 2VZWA 3M6HA 4KUOA 4QY6A 3UB6A 4H6JB 4DE0A 1L2SA 2WKQA 2PD8A 2ZM2A 3A3EA 3F1PA 1KGFA 1MWRA 2X01A 2Y2HA 4HQAA 4OOYA 4R4SA 4Y17A 4QJGA 4LGWA 3CITA 1H5XA 2RL3A 1WYBA 3S1YA 2IA2A 4CLCE 2C5WB 4R3BA 2PYRA 3KYZA 2H0TA 1IELA 4I5SA 4BL3A 4EW7A 3WS1A 1S67L 4E3LA 4JGRA 1N4OA 1S4RA 4FSFA 3C38A 4UA9A 2ZMAA 2DRWA 2HP5A 5DFYA 1K4FA 3E4PA 1MC0A 4ZJ1A 3BFCA 4OQHA 4E3KA 5F82A 2QZ6A 1LHYA 3N8RA 1LI0A 5HFOA 4N9LA 4LRYC 5FEGA 1YMSA 4JKTA 3HL9A 5EFWA 4Y0TA 1STZA 3GMWA 3IS2B 4JPMA 4LENA 3K3DA 4GDNA 3KSGA 2OLUA 1ZHHB 3BYDA 2HDQA 1GA9A 3CAXA 4WEKA 1S66L 1FSYA 3E98A 4ESPA 2R78A 1VETA 2FFFB 1OTAA 2XR0A 4MEZA 3R7WB 3T4JA 2L1MA 2PDRA 1FCNA 5FI7A 4WN5A 2KX6A 4ARZA 4KG2A 2M7VA 5HL1A 3IXHA 5F1GA 3UE1A 4PM6A 1G6OA 2W0NA 5EPHA 3FC7A 3N6IA 4YWZA 3B42A 3EQVA 4HNBA 1OTEA 4R0QA 3W8KA 2VX8A 1J3WA 3MJQA 4HJ3A 4OLDA 4KZ4A 4R4RA 3IXDA 1FR6A 1XGIA 3QP2A 2G2UA 2WAEA 1MZUA 4R38A 4RVAA 4WZ5A 5FDHA 2KOIA 2A49A 1K54A 3LEQA 3IH9A 3VP0A 1W63Q 3LR4A 5KSHA 3BW6A 5M1AA 2JKRM 4EBPA 3A3JA 4LV2A 1GSWA 4WL9A 4FD8A 4UEYA 4PHTA 3VP2A 4CLCB 3T12B 5HSQA 1QMEA 4GHIA 3E4OA 3OLOA 5E2EA 4LV3A 1G28A 3A3DA 3MXSA 4OQGA 1H0MA 2GJ3A 1WYCA 4HP4A 3S7NA 4PMAA 4AFIA 2ZC3B 5KMWA 3L7HA 5AJGA 3ZYTA 1W7FA 5EV0A 3TSGA 2Y2QA 2ZM0A 3AGDA 3WS2A 4MN7A 2Q0OA 1KVLA 4N9KA 1V9YA 4R6LA 3Q7VA 3B33A 4UQIS 4BD1A 3Q7ZA 2J3TD 2Q9NA 3O87A 3N8LA 4GNUA 3E0YA 4HJ6A 3ZG0A 3LY3A 4KZ6A 3LIFA 4CLCC 1EWZA 3SZTA 4EU0A 2FH5A 4EERA 4WF0A 3UE3A 4DKIA 2ZOHA 1VETB 2EFUA 3DTKA 2XA7S 3BRMA 4KQQA 2M7UA 4MBFA 3PBNA 2VV6A 3HUNA 4EESA 5HAPA 2EX6A 4OPYA 4R1GA 4K0XA 3PYPA 2HGVA 5F68A 5U47A 3RXWA 1TDLA 2J9OA 1CI8A 4O01A 3E2LA 1KGGA 4OQIA 3BM6A 2V20A 1ALQA 1PWDA 2VEAA 1TS7A 5CRFA 3HVFA 4ETZA 1N9NA 2XFTA 3MZDA 4UAAA 1WE4A 4FH4A 4Q0HA 5F1FA 3ITAA 3G2ZA 3BFFA 3CHWP 3VOZA 1DP6A 5TJJA 4HH3A 1L0FA 2I9VA 3UE0A 2D01A 1X0OA 1Z6FA 3LIEA 4WYYA 4BQMA 3WS5A 1XJ4A 1ZTUA 2VKSA 4X53A 4MDZA 4JGOA 4IUHA 4IVIA 2Y2PA 3C7UA 3ITBA 5CHMA 5DKLA 3UB8A 4EBLA 5FQIA 2VV8A 3M2KA 4GLQA 4LRZE 5EM0A 3CWFA 1ZG6A 1D7EA 1DJBA 1VB6A 2VGKA 3P98A 3EQUA 3C5AA 4KZ9A 2YKFA 3ZCZA 2EFXA 3T4LA 1RGZA 3ULFA 2V9AA 2PBDP 2XK1A 2WKPA 1N9OA 4GW9A 4WZ5C 5IS1A 4JLFA 1K54C 4OOLA 1W79A 4IBXA 1BYWA 5DTTA 4DF6A 3F1OA 2GZAA 4OKPA 4XUZA 2XRNA 1H8YA 1VHMA 4M4XA 2WZZA 1PI4A 1TDGA 3UPPA 3UPNA 2PU4A 3H82A 1KE0A 3V3SA 1K56A 2HP9A 2FZ0A 3FYZA 2LB9A 3GQZA 2HP6A 1I2WA 4B4ZA 4U0TA 4WZ4A 4U0XA 1EROA 4PPRA 4R23A 3LI9A 3AGFA 3S7PA 4KZ5A 4GS9A 1L0DA 3CUEC 4RX2A 3QP8A 4K0WA 2ZL1B 4LV0A 3ZQ5A 1XP4A 4IBRA 1FCOA 2XD1A 5AVEA 3JVVA 4NKPA 1PWCA 2B18A 1OJGA 2Y2JA 3MSHA 4F94A 1YLWA 2V0WA 2O9BA 3CG5A 3SS5A 4RQ9A 4MBKA 1Y54A 1T18A 3UPOA 3Q07A 4EQIA 4X1LA 4E3OA 3O3VA 4WELA 3W2ZA 5L8MA 2JKRI 3EEHA 4HHDA 4H6JA 4S2NC 1XJ6A 3HUMA 4EBNA 2J8YA 3ZG7B 1TS0A 3W4QA 3WS0A 1ZG4A 2JHEA 2V8CA 1M6KA 3C4OA 4E3JA 1I2SA 3PHYA 4HBTA 4B4XA 5F6AA 2VK3A 5FQ9A 4QD4A 5GLDA 3FPWA 1SHVA 3VP4A 5CTNA 1RP5A 2JKGA 3HLDA 2QJ7A 2JE5A 3ZG8B 1XPBA 2OWJA 5G18A 1CI9A 3U2AA 5HPFA 5L07A 4Y3IA 3P01A 4ID4A 2PR6A 3PBSA 1EW0A 4RYEA 5L10A 4NXGA 5A91A 3HBRA 3VP3A 2PU2A 4GKUA 4MBHA 2K31A 5GL9A 1J9MA 3Q81A 1PZPA 4N92A 1ERMA 3LIDA 3PBOA 5JYOA 5HARA 2W1RA 3KYQA 3IS2A 1H3QA 3BQAA 3H82B 4KZ7A 1IKGA 2WKEA 2D02A 4O8GA 2ZQ7A 3IF6A 4NG2A 1CJFA 1K6RA 4OONA 4OH0A 4GS9B 1NXYA 4WMCA 1VQQA 4P85A 1V9ZA 1KDSA 3CZDA 3R7WA 5DF7A 2I72A 2P08A 4KENB 2XEPA 3G6OA 3CLOA 3KYEA 1K4EA 3UMEA 2Z6DA 2Z2LB 4HIAA 1PRQA 1T1CA 1OTDA 1FR1A 4OOMA 3F1NB 1W8YA 1BLSA 3T1RA 5M18A 2K2NA 1P9RA 3NECA 3S22A 2JKFA 4ZDXA 1ES5A 4O7DA 3TJZC 2Z2MB 1K38A 1BLCA 2GX5A 2ZQ8A 2PYPA 2W3DA 3UMDA 2QPNA 1MWTA 4CQHA 1H8MA 1F2KA 5FATA 1Q2PA 5E2HA 4CLCA 4EQ1A 2QJ5A 3OOVA 4B93A 2ZC6B 1XA7A 3AGEA 4JGPA 4NXEA 1IEMA 5L2FA 1N9LA 2BASA 2H0YA 2VLGA 4JGQA 4EETB 3P7NA 3MXQA 5CHJA 3UN7A 4P0MA 1NZOA 2EA9A 1TS8A 4KZAA 3MQOA 5GLBA 3E2KA 2EX8A 1ES2A 1ACFA 1ONHA 2HV1A 3BY8A 1NLYA 5EOOA 1JNUA 2Y2IA 1DY6A 5HDSA 1CK3A 3NJAA 3G30A 2XDMA 4E3IA 4KQRA 5FASA 1D1JA 3IF6B 5CGXA 5DJTA 3UNWA 1O07A 3PBQA 3FPVA 2HDRA 1GSVA 1A0KA 4QWOA 3BECA 4S2JA 5GHYA 5TFQA 1AXBA 1NZUA 2K7SA 5J7EA 3MKEA 3ICYA 1SDNA 3N8SA 3LUQA 3KO6A 4CPKA 2BTFP 4X55A 1ESIA 3TW8A 5AQBA 4M3KA 4I3JA 4Z1WA 3VV4A 1ZC2A 3NI9A 1LSVA 4GB7A 3IT9A 4QU3A 1YM1A 5FQJA 1SZVA 5CECA 2QKPA 4Y5FA 3WS4A 1DRMA 4UA7A 3TG9A 1LL5A 2W3FA 3OBFA 4D2OA 3IF6C 4E3MA 4ZAMA 2OWHA 2KLIA 3W4OA 4KUKA 5HAQA 1VEUA 4O0PA 3WWXA 3BQ8A 4GCZA 5FAQA 3G2YA 2WADA 1ES4A 3ZVTA 3C8CA 4Q8IA 2PR5A 1KE3A 4P6ZM 3C4PA 4XXRA 2J9PA 1FOFA 5IHVA 5E2FA 4YFMA 4EWFA 1MWSA 3D3OA 3V67A 4P87A 2IWBA 4DJ2A 4X25A 3UO9A 5GHZA 1G6AA 1T1BA 3CUEA 1S1ZA 1RGYA 5EVIA 3MQ0A 3CMZA 2H10A 5K5BA 3D4FA 4LPZA 2DNSA 2XF3A 1PIOA 5HD3A 2Y91A 3K3CA 3ZNYA 2PAVP 5BOHA 3LR3A 4YOFA 2B02A 1E3UD 4Y13A 3LR0A 1TF1A 1NJ4A 4WM9A 3S4XA 2YKHA 3CI6A 2RCXA 2ZQDA 4IUKA 4DMZA 1K25A 5G4ZA 4FCFA 3N7WA 5AQ7A 3PBRA 4S2NA 3GSGA 5A93A 2H5SA 2GDNA 4IVKA 1JWPA 5FQMA 1G5UA 1L0EA 2ZMFA 4F3LB 1SDEA 3BFEA 1DP8A 3ZFZA 1N9BA 4GJ4A 1XJ2A 1LLBA 2V1BA 1K57A 3VE4A 2ZL1A 5FQKA 4DDYA 1BSGA 4HEFA 4S2IA 4B9OA 1JTGA 4BENA 1OT9A 1YPRA 2NUTC 2ZBBA 3DTEA 3I7JA 3T50A 5DKKA 3GV9A 5CEBA 3SW1A 1GCEA 2G7UA 2WUQA 3KX0X 5F5YA 4G3KA 3BWLA 3V50A 3QP4A 4PM7A 2VGJA 3D9YA 2DCFA 5FQQA 1WA9A 2QYBA 3T4TA 1VEUB 4OPZA 2E8IA 2FFYA 1L3LA 2HDUA 2ZMVA 3R4KA 4UA6A 2W27A 1RCJA 5GHXA 2AVXA 3VFFA 3H7WA 1LSXA 4I3IA 4LV1A 4KQDA 2ZC7A 5FL3A 1U60A 2O9AA 5KZHA 4RA7A 2O99A 3GRJA 1KVMA 1O7EA 3LICA 2Y8HA 3T1QB 2W3GA 1C3BA 5EVIB 2PT7A 4PKYA 3PAEA 3QHYA 1MKIA 3QP1A 2EXAA 1HLUP 1Q2QA 4HJ4A 5HDDA 4DRTA 5DF9A 2XQZA 1BLPA 2XGNA 5DFXA 5EM1A 2P9VB 5HZHA 5TGFA 5AQAA 1SCWA 2O9CA 4HY8A 2A24B 2OV5A 4A5RA 5A92A 4MLLA 3IBRA 1XFQA 2HDSA 3TE8A 3C2WA
chains in the Genus database with same CATH topology
1STZA 5G4YA 3IS2A 1H3QA 3BQAA 3H82B 3IS2B 1UGUA 3K3DA 5HD5A 3KSGA 2D02A 4O8GA 1S4SA 1ZHHB 1ODVA 3MR0A 1YSQA 4NXFA 3CAXA 4WEKA 1S66L 5TBMA 4EUVA 3EGXC 4GS9B 1F98A 3E98A 1YSPA 4L9EA 2R78A 3A0SA 1V9ZA 1OTAA 4Q0JA 1P9WA 3R7WA 3R7WB 3T4JA 2L1MA 2P08A 2PDRA 4PKYG 5A8BA 4FOFA 3S7QA 4WN5A 2KX6A 4ARZA 4ARZB 2M7VA 3G6OA 3CLOA 4ZRRA 4R3AA 3UMEA 2Z6DA 4DJ3A 1G6OA 2W0NA 4HIAA 4L9GA 2DMWA 3FC7A 1OTIA 4YWZA 4BBTA 3B42A 4XT2A 3OCNA 3EQVA 1T1CA 2W1TB 4HNBA 3LYXA 1OTDA 3FG8A 4DN0A 4OOMA 1OTEA 1YKDA 3F1NA 2VX8A 3F1NB 4MMNA 3TRCA 3T4QA 2K2NA 3MJQA 1P9RA 4HJ3A 4P6ZS 4G3VA 5MC7A 4CLCD 3TJZC 2NUPC 1F9IA 2GX5A 1MZUA 2JN7A 2PYPA 2W3DA 3UMDA 4R38A 2W3HA 4MN5A 2KOIA 4CQHA 4BJPA 4R70A 1H8MA 3H7WB 1W63Q 3LR4A 5KSHA 3BW6A 2JKRM 5J4EA 1GSWA 4WL9A 4UEYA 3GDIA 4PHTA 4I39A 4CLCA 4CLCB 4EQ1A 5HSQA 2QJ5A 4GHIA 3OOVA 4GHIB 4NXBA 4B93A 3E4OA 4QPRA 3OLOA 4JGPA 1G28A 5CX7A 2GJ3A 2Z6CA 1NRJA 4HP4A 4NXEA 1N9LA 2BASA 3MQQA 3S7NA 2VLGA 2OAQ1 4JGQA 2L4RA 3P7NA 4EETB 3MXQA 4AFIA 5AVFA 3LIAA 3NHQA 3H9WA 2EA9A 3A0VA 2JKTI 5AJGA 3ZYTA 1TS8A 3KSIA 3MQOA 1TD5A 3KSFA 2W3EA 1OPXA 4BBVA 2HV1A 3BY8A 4MN7A 1NLYA 3LFVA 1JNUA 4PAUA 4R6LA 1V9YA 2GNXA 5HDSA 4HH2A 2XSSA 3NJAA 5HL6A 3B33A 4UQIS 1NLZA 2J3TD 2P7JA 4EXOA 3E0YA 4BMWA 5DJTA 2VGLS 4HJ6A 3VOLA 4BBUA 3LIFA 4CLCC 1XFNA 5TBMB 4EU0A 2FH5A 4EERA 3D72A 1OT6A 4WF0A 3UE3A 4ETXA 3PBQA 2ZOHA 3EWKA 3FPVA 1XJ3A 2XA7S 2L0WA 4NEED 2M7UA 4II7A 1GSVA 1MKMA 3PBNA 4ME4A 4E04A 2VV6A 1T1AA 4WEJA 3S7OA 3EEAA 3BY9A 1DP9A 2J3WA 2K7SA 4EESA 5J7EA 2HF6A 5HDCA 3HCYA 1D06A 3ICYA 2PHYA 3RTYA 3LUQA 3KO6A 3PYPA 2HGVA 5F68A 4IJGA 3MF0A 2EWVA 5IU1A 3TW8A 4O01A 3IBJA 4XT2B 4I3JA 1LSWA 4Z1WA 3VV4A 2VA0A 4KQOA 1LSVA 5J3WA 3T4SA 5HWVA 4MCWA 5F69A 2QKPA 2VEAA 4Y5FA 3OCLA 1TS7A 4EEPA 1DRMA 3MFXA 4ETZA 1N9NA 3NOTC 2W3FA 3OBFA 3PR6A 4Q0HA 1LL8A 3LR5A 1OTBA 2PD7A 2OWHA 1DP6A 5TJJA 4HH3A 3RH8B 2KLIA 3EGDC 2I9VA 4KUKA 4I38A 2D01A 1X0OA 4O0PA 1W63M 3LIEA 3BQ8A 1XJ4A 4L0LA 1ZTUA 3A0RA 4GCZA 2VKSA 4MDZA 4JGOA 4L9FA 3GECA 3C8CA 4IUHA 4WLAA 2PR5A 2VJWA 4P6ZM 1T19A 4WUJA 5DKLA 1GSXA 3UB8A 3D3OA 3V67A 4YNRA 4BWIA 2VV8A 1P0ZA 4GLQA 4DJ2A 4LRZE 4EEUA 1T1BA 3CUEA 3CWFA 3K2NA 1S1ZA 2V1AA 3HJKA 4K08A 2MJ6A 3PBTA 1D7EA 1VB6A 3MQ0A 1OJ5A 1IFQA 3EQUA 5K5BA 2HJEA 2M1CA 4LPZA 2YKFA 3T4LA 5HD3A 3B47A 3UB9A 3ULFA 2V9AA 1LT0A 5DJUA 3K3CA 4Q0IA 2WKPA 1N9OA 3LR3A 4GW9A 5IS1A 4YOFA 4OOLA 5HWWA 2JKTM 2B02A 1BYWA 5HWTA 3F1OA 3F1OB 1TF1A 2GZAA 3LR0A 4HOIA 2P04A 2XRNA 3T4KA 3UE6A 2YKHA 5KIZA 3CI6A 2QHKA 1VHMA 2ZOIA 4M4XA 2VV7A 3O5YA 1Y28A 4IHQA 4IUKA 3H82A 4DMZA 5G4ZA 2FZ0A 1IOUA 3PBRA 2LB9A 4Y2FA 5I5LA 1F5MA 2OAP1 3LI9A 2ZMFA 4F3LB 4F3LA 2INWA 4MN6A 1DP8A 3S7PA 2J80A 4GS9A 2CMNA 1UWNX 3CUEC 5HPIA 4GJ4A 4UQIM 2LB5A 1XJ2A 4G3WA 4HP9A 2V1BA 2QWSA 2OOLA 3BJNA 3VE4A 2Y79A 2VGLM 3NOPC 1TS6A 3MMHA 3ZQ5A 5LBRA 3LIBA 4B9OA 3HJIA 5AVEA 3JVVA 4NKPA 1OT9A 5IT5A 4LLOB 2NUTC 2ZBBA 2XA7M 2B18A 2HJ9C 1OJGA 3KSHA 3T50A 5DKKA 3UB7A 3SW1A 2V0WA 2G7UA 3DBAA 2O9BA 3KX0X 3VE3A 5F5YA 4RQ9A 3T4OA 4G3KA 3BWLA 2W1TA 3E4QA 1T18A 2H28A 4I3AA 3RFBA 3NOUC 3LI8A 4WELA 1WA9A 3W2ZA 5L8MA 2QYBA 2VZWA 3T4TA 1KOUA 2JKRI 3EEHA 4KUOA 3UB6A 4HHDA 4H6JA 4H6JB 1XJ6A 5C5KA 2WKQA 2J3TC 1TS0A 2PD8A 4HI4A 2ZMVA 3R4KA 3F1PA 3F1PB 2JHEA 4HQAA 2W27A 3PHYA 5F6AA 3H7WA 2WKRA 1LSXA 3FPWA 4I3IA 3CITA 4KQDA 2A2LA 5FL3A 3JVUA 2IA2A 2O9AA 2XROA 3C30A 2QJ7A 4CLCE 2KDKA 2O99A 1S1YA 3LICA 2PYRA 3KYZA 2Y8HA 2OWJA 2V0UA 2W3GA 4I5SA 2PT7A 4LRXC 4PKYA 3U2AA 5HPFA 4Y3IA 3P01A 4EW7A 1P97A 2PR6A 3PBSA 1EW0A 1S67L 3PXPA 4HJ4A 4JGRA 5HDDA 4NXGA 5DF9A 1S4RA 1UWPX 4FSFA 1YAXA 3C38A 2K31A 5DFXA 5HZHA 1NWZA 5DFYA 2O9CA 4HY8A 2A24A 2A24B 3E4PA 1MC0A 3LIDA 2EWWA 3OC2A 3PBOA 2W1RA 2O0YA 3KYQA 3IBRA 3EOIA 1XFQA 4LRYC 3TE8A 5EFWA 3C2WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G4Y A;  3IS2 A;  3IS2 B;  3H82 B;  1UGU A;  3K3D A;  5HD5 A;  2D02 A;  1S4S A;  1ODV A;  3MR0 A;  4NXF A;  3CAX A;  5TBM A;  1S66 L;  4GS9 B;  1F98 A;  4L9E A;  2R78 A;  3A0S A;  1V9Z A;  1OTA A;  2L1M A;  2PDR A;  4PKY G;  5A8B A;  4WN5 A;  2KX6 A;  3G6O A;  3CLO A;  4R3A A;  3UME A;  2Z6D A;  4DJ3 A;  2W0N A;  4HIA A;  4L9G A;  3FC7 A;  1OTI A;  4YWZ A;  4BBT A;  4XT2 A;  1T1C A;  4HNB A;  3LYX A;  1OTD A;  3FG8 A;  1OTE A;  3F1N A;  3F1N B;  3MJQ A;  4HJ3 A;  1F9I A;  1MZU A;  2JN7 A;  2PYP A;  3UMD A;  4R38 A;  4MN5 A;  4R70 A;  3H7W B;  5J4E A;  1GSW A;  4WL9 A;  3GDI A;  4I39 A;  4EQ1 A;  5HSQ A;  2QJ5 A;  4GHI A;  4GHI B;  4NXB A;  3E4O A;  3OLO A;  4JGP A;  1G28 A;  4NXE A;  2Z6C A;  4HP4 A;  2GJ3 A;  1N9L A;  2BAS A;  3MQQ A;  2VLG A;  4JGQ A;  2L4R A;  3P7N A;  4EET B;  3MXQ A;  5AVF A;  3LIA A;  3NHQ A;  3H9W A;  2EA9 A;  3A0V A;  1TS8 A;  3MQO A;  4BBV A;  2HV1 A;  3BY8 A;  1JNU A;  4R6L A;  1V9Y A;  5HDS A;  4HH2 A;  3NJA A;  3B33 A;  2P7J A;  4EXO A;  5DJT A;  4HJ6 A;  3VOL A;  4BBU A;  3LIF A;  1XFN A;  5TBM B;  4EER A;  3D72 A;  1OT6 A;  4WF0 A;  2ZOH A;  3EWK A;  1XJ3 A;  2L0W A;  1GSV A;  4E04 A;  2VV6 A;  1T1A A;  3BY9 A;  1DP9 A;  2K7S A;  4EES A;  5J7E A;  5HDC A;  1D06 A;  3ICY A;  2PHY A;  3RTY A;  3LUQ A;  3PYP A;  5F68 A;  5IU1 A;  4XT2 B;  4I3J A;  1LSW A;  1LSV A;  5J3W A;  5HWV A;  5F69 A;  2QKP A;  2VEA A;  1TS7 A;  4EEP A;  1DRM A;  3MFX A;  1N9N A;  3NOT C;  1LL8 A;  1OTB A;  2PD7 A;  2OWH A;  1DP6 A;  3RH8 B;  4HH3 A;  2I9V A;  4KUK A;  4I38 A;  2D01 A;  1X0O A;  3LIE A;  1XJ4 A;  3A0R A;  4GCZ A;  4JGO A;  4L9F A;  3GEC A;  3C8C A;  4WLA A;  2PR5 A;  1T19 A;  4WUJ A;  5DKL A;  1GSX A;  3UB8 A;  2VV8 A;  1P0Z A;  4DJ2 A;  4LRZ E;  4EEU A;  1T1B A;  3CWF A;  1S1Z A;  2V1A A;  3HJK A;  4K08 A;  1D7E A;  1VB6 A;  1OJ5 A;  2M1C A;  4LPZ A;  2YKF A;  5HD3 A;  3UB9 A;  3ULF A;  2V9A A;  1LT0 A;  5DJU A;  3K3C A;  2WKP A;  1N9O A;  4GW9 A;  5IS1 A;  5HWW A;  2B02 A;  1BYW A;  5HWT A;  3F1O A;  3F1O B;  4HOI A;  3UE6 A;  2YKH A;  5KIZ A;  2QHK A;  2ZOI A;  4M4X A;  2VV7 A;  1Y28 A;  3H82 A;  5G4Z A;  5I5L A;  3LI9 A;  4F3L A;  4F3L B;  2INW A;  4MN6 A;  1DP8 A;  2J80 A;  4GS9 A;  2CMN A;  1UWN X;  1XJ2 A;  4HP9 A;  2V1B A;  2QWS A;  2OOL A;  3VE4 A;  3NOP C;  1TS6 A;  3ZQ5 A;  3LIB A;  4B9O A;  3HJI A;  5AVE A;  1OT9 A;  4LLO B;  2ZBB A;  1OJG A;  3T50 A;  5DKK A;  3UB7 A;  3SW1 A;  2V0W A;  3KX0 X;  3VE3 A;  5F5Y A;  4RQ9 A;  3BWL A;  3E4Q A;  1T18 A;  2H28 A;  4I3A A;  3NOU C;  3LI8 A;  1WA9 A;  1KOU A;  3EEH A;  4KUO A;  3UB6 A;  4HHD A;  4H6J A;  4H6J B;  1XJ6 A;  2WKQ A;  1TS0 A;  2PD8 A;  4HI4 A;  3F1P A;  3F1P B;  2JHE A;  4HQA A;  2W27 A;  3PHY A;  5F6A A;  3H7W A;  2WKR A;  1LSX A;  4I3I A;  4KQD A;  2QJ7 A;  2KDK A;  1S1Y A;  3LIC A;  2PYR A;  2OWJ A;  2V0U A;  4I5S A;  4LRX C;  4PKY A;  4EW7 A;  1P97 A;  2PR6 A;  1EW0 A;  1S67 L;  4HJ4 A;  4JGR A;  5HDD A;  4NXG A;  1S4R A;  1UWP X;  5HZH A;  1NWZ A;  4HY8 A;  2A24 A;  2A24 B;  3E4P A;  3LID A;  3IBR A;  1XFQ A;  4LRY C;  5EFW A;  3C2W A; 
#chains in the Genus database with same CATH topology
 1ES3 A;  3BFD A;  1BTL A;  1UGU A;  5HD5 A;  1QMF A;  3UY6 A;  2Y59 A;  3IH8 A;  4PM9 A;  3W4P A;  3MR0 A;  4CJN A;  1YSQ A;  4NXF A;  3NUL A;  5TBM A;  1YT4 A;  5GLA A;  4EUV A;  1YLT A;  1F98 A;  4S2O A;  1YSP A;  2Y2K A;  3JPU A;  5EVI C;  4Q0J A;  1P9W A;  4PKY G;  5A8B A;  4K91 A;  3ZNT A;  3B3X A;  4ZRR A;  4YIN A;  4R3A A;  4S2K A;  2Y2L A;  1CEF A;  4L9G A;  1HD8 A;  2DMW A;  1XX2 A;  1OTI A;  3G32 A;  1CQA A;  4BBT A;  3MFD A;  4XT2 A;  3QNB A;  3VSL A;  2EXB A;  2A3U A;  3MKF A;  5AQ9 A;  1YKD A;  5FA7 A;  3F1N A;  4P6Z S;  2X02 A;  4G3V A;  1IKI A;  3MXR A;  1F9I A;  4GOG A;  1S0W A;  3HRE A;  2R9X A;  4GD6 A;  4FUW A;  2JN7 A;  1NYM A;  4JF6 A;  2W3H A;  3GVB A;  2J7V A;  3T1S A;  5CXW A;  5DF8 A;  3H7W B;  1K57 C;  5HX9 A;  4ZTK A;  5J4E A;  5DTK A;  4I39 A;  4NXB A;  1XXM A;  4QPR A;  1BUL A;  3BFG A;  5CX7 A;  1JWV A;  1EI5 A;  2Z6C A;  4S2P A;  1BUE A;  4OPR A;  1M40 A;  3MQQ A;  2XH9 A;  4S2L A;  3DTM A;  5EUA A;  4KZB A;  2OAQ 1;  1VM1 A;  5AVF A;  1G68 A;  3CPT B;  4BD0 A;  3A0V A;  3FV7 A;  1XKZ A;  5EE8 A;  1MPL A;  3KSI A;  1TD5 A;  1SKF A;  3IHB A;  1SKO A;  2W3E A;  1OPX A;  4BBV A;  4X69 A;  4C75 A;  3O86 A;  4PAU A;  1H8Z A;  1FIL A;  3MS6 A;  2XSS A;  2B95 A;  1FIK A;  2P7J A;  2EX9 A;  3IWI A;  3LGO A;  3VOL A;  4MNR A;  4BBU A;  1XFN A;  5TBM B;  3ZG9 B;  1OT6 A;  3A3I A;  3IX3 A;  2Y4A A;  2L0W A;  4NEE D;  4II7 A;  4E04 A;  3G35 A;  1L0G A;  4WEJ A;  3SH8 A;  2UV0 E;  3BY9 A;  1DP9 A;  2J3W A;  2HF6 A;  5HDC A;  4EUZ A;  1E25 A;  5L09 A;  4IJG A;  2EWV A;  1HTZ A;  4XT2 B;  3DW0 A;  1PW1 A;  2WZX A;  1I5Q A;  2VA0 A;  4KQO A;  5J3W A;  1K0K A;  3V5M A;  4MCW A;  5JYP A;  5F69 A;  2ZLY A;  3UDX A;  1NYY A;  4EEP A;  3NOT C;  3PR6 A;  1LL8 A;  2ZQA A;  4WBG A;  3LR5 A;  2PD7 A;  5FAP A;  2HPB A;  3DAV A;  4KZ3 A;  3GTC A;  5FI6 A;  4GN2 A;  2G2W A;  3IQA A;  3V39 A;  4JF5 A;  3NIA A;  3A0R A;  4L9F A;  2BG1 A;  3ZGA B;  2JBF A;  3BLS A;  3HLC A;  4PM8 A;  4Y7P A;  1P0Z A;  3G31 A;  3OPR A;  3NDG A;  5EOE A;  3HLF A;  2P74 A;  3K2N A;  5M19 A;  2V1A A;  3U4L P;  2MJ6 A;  1XA1 A;  5FDS A;  4LCM A;  1IFQ A;  1SKO B;  2HJE A;  3B47 A;  3VOY A;  3HLE A;  1LT0 A;  4LCL A;  5DJU A;  1K56 D;  2ZM8 A;  1DJA A;  2JKT M;  5HWT A;  2P04 A;  3T4K A;  3UE6 A;  2ZC4 B;  2QHK A;  3IXG A;  2VV7 A;  3O5Y A;  1Y28 A;  4IHQ A;  2Y2G A;  1ONG A;  4Y2F A;  5I5L A;  1YMX A;  1F5M A;  2OAP 1;  4F3L A;  2V2F F;  4X6T A;  5E43 A;  2J80 A;  2CMN A;  1UWN X;  2WGW B;  1JVJ A;  5HPI A;  4G3W A;  3VSK A;  2QWS A;  2OOL A;  1Z09 A;  3BJN A;  2Y79 A;  2VGL M;  1TS6 A;  3IHA A;  5KSC A;  1YLJ A;  4N1H A;  5CTM A;  4LFU A;  5IT5 A;  2HJ9 C;  1MWU A;  3KSH A;  1PZO A;  3NBL A;  3UB7 A;  2Y2O A;  4E3N A;  1K55 A;  1YLY A;  1BT5 A;  3DBA A;  3VE3 A;  2PBY A;  2WKI A;  3T4O A;  2W1T A;  2H28 A;  4I3A A;  4RX3 A;  3RFB A;  1PYY A;  1ESU A;  2WGV A;  1IYP A;  1KOU A;  4JXW A;  3BLM A;  5DTS A;  3FWL A;  4JXV A;  3P09 A;  3TOI A;  2Q9M A;  4NET A;  5C5K A;  4N1X A;  2J3T C;  2WAF A;  5E2G A;  4HI4 A;  3ISG A;  3F1P B;  4OP8 A;  1W5D A;  1GHP A;  4JXG A;  3WRT A;  2WK0 A;  2XD5 A;  3QP5 A;  4DE2 A;  2WKR A;  2OLV A;  5GLC A;  2A2L A;  4S2M A;  3JVU A;  5EEC A;  4ZJ2 A;  1HVB A;  2XRO A;  3C30 A;  2KDK A;  1S1Y A;  3LO7 A;  3G34 A;  2E8J A;  2V0U A;  4FTX A;  4FH2 A;  4LRX C;  3RXX A;  3GR2 A;  3V3R A;  3SS4 A;  4XUX A;  1P97 A;  3PXP A;  3UB5 P;  3SS3 A;  1UWP X;  1YAX A;  3O88 A;  2P9V A;  3HLB A;  1NWZ A;  2A24 A;  3SH9 A;  5CHU A;  2EWW A;  3OC2 A;  4UHU A;  1PI5 A;  4Z9Q A;  5A90 A;  2O0Y A;  4WMC D;  3EOI A;  1AWI A;  2OSU A;  3HLG A;  1GHM A;  3ZVW A;  5G4Y A;  5DVA A;  3Q1F A;  3OPH A;  4ZJ3 A;  3PAG A;  2IWD A;  1S4S A;  1GHI A;  1ODV A;  3EGX C;  4BL2 A;  1GA0 A;  4L9E A;  3A0S A;  4JF4 A;  3FKW A;  4C6Y A;  4FOF A;  3S7Q A;  3LY4 A;  3C7V A;  2WKH A;  4ARZ B;  4HES A;  3QP6 A;  4OLG A;  3DWZ A;  4U3T A;  4DJ3 A;  2QMI A;  1PNE A;  1JTD A;  1TEM A;  3OCN A;  2W1T B;  3NDE A;  3BEB A;  3LYX A;  4H8R A;  3FG8 A;  4DN0 A;  4MMN A;  3TRC A;  3T4Q A;  2PRF A;  5FEF A;  1YLZ A;  5MC7 A;  2Y2N A;  1YLP A;  3NY4 A;  4CLC D;  4HBU A;  2NUP C;  5I94 A;  4DE3 A;  3HUO A;  1NY0 A;  2HZ5 A;  4MN5 A;  3UDI A;  4E6W A;  3IWQ A;  5TR7 A;  4BJP A;  4R70 A;  5J8X A;  2ZC5 B;  1ZKJ A;  1E4D A;  3GDI A;  1FQG A;  1JWZ A;  4Y15 A;  1IYS A;  4OP5 A;  5EVE A;  4GHI B;  1LL9 A;  1NRJ A;  1ERQ A;  1MY8 A;  1K55 C;  3MZE A;  1YQS A;  4C3Q A;  3ZG5 A;  2L4R A;  3CPT A;  3LIA A;  3NHQ A;  4X56 A;  1PW8 A;  3H9W A;  3DTI A;  2JKT I;  4GDB A;  3IX8 A;  3KSF A;  4EV4 A;  5CGW A;  1XGJ A;  3CJM A;  2V8F A;  3IXB A;  4ZBE A;  3LFV A;  4Y0O A;  2GNX A;  4HH2 A;  3Q7V B;  2C6W B;  4P6B A;  4JXS A;  5HL6 A;  3HLW A;  1NLZ A;  4EXO A;  3G4P A;  2Y2M A;  4BMW A;  2VGL S;  5HAI A;  3IWO A;  1BZA A;  2IWC A;  1W8Q A;  3D72 A;  4ETX A;  1OME A;  3EWK A;  1XJ3 A;  3A3F A;  3OPL A;  3MZF A;  1MKM A;  4ME4 A;  1T1A A;  3S7O A;  3EEA A;  3JYI A;  3HCY A;  2Y55 A;  1D06 A;  2PHY A;  3RTY A;  5FSR A;  2JC7 A;  3MF0 A;  5IU1 A;  3FKV A;  3IBJ A;  2WYX A;  4D60 A;  4KZ8 A;  1LSW A;  4B88 A;  1Y4O A;  3NC8 A;  3T4S A;  5HWV A;  4QHC A;  2ZJ9 A;  3PTE A;  5FI2 A;  3OCL A;  5HW3 A;  1CF0 A;  3MFX A;  3NCK A;  3L9K A;  3VFH A;  1KE4 A;  3SOI A;  3N4I A;  3MBZ A;  1OTB A;  3WRZ A;  3RH8 B;  4PM5 A;  3EGD C;  1NRF A;  4I38 A;  4QY5 A;  4KG6 A;  4DXB A;  1W63 M;  3QNC A;  4E6X A;  3FZC A;  4X68 A;  4NK3 A;  4DXC A;  4L0L A;  4DDS A;  3GEC A;  3LCE A;  4Y0U A;  1KDW A;  4WLA A;  5EVI D;  1MXO A;  4IED A;  2VJW A;  4GZB A;  5FAO A;  1PWG A;  1S6R A;  1T19 A;  2BLS A;  4WUJ A;  1MBL A;  4KG5 A;  1GSX A;  2ZQC A;  4YNR A;  4BWI A;  5EVL A;  1IYQ A;  5CED A;  4OPQ A;  4OVD A;  4EEU A;  3HJK A;  4K08 A;  3RJU A;  3PBT A;  1OJ5 A;  3ZHH A;  2M1C A;  3OPP A;  3ZDJ A;  3UB9 A;  4OQ0 A;  4DE1 A;  2XFS A;  4Q0I A;  3Q82 A;  2V1Z A;  1BLH A;  5HWW A;  2R9W A;  1TVF A;  3OZH A;  2UWX A;  3F1O B;  4HOI A;  2CC1 A;  5KIZ A;  1CEG A;  3VMA A;  1KGE A;  3SH7 A;  2ZOI A;  2ZQ9 A;  3DWK A;  4BLM A;  1PFL A;  1IOU A;  2WGI A;  1FSW A;  2ZD8 A;  3LEZ A;  1E3U A;  4R3J A;  2INW A;  4MN6 A;  1IYO A;  2WGW A;  4UQI M;  5D3O A;  5CER A;  2EX2 A;  2LB5 A;  4HP9 A;  5CGS A;  3M2J A;  3VP1 A;  4JBF A;  1HZO A;  4GD8 A;  3IX4 A;  3NOP C;  3MMH A;  5LBR A;  3UDF A;  2X71 A;  3LIB A;  4X1M A;  3HJI A;  3T1X A;  1DJC A;  1LI9 A;  4LLO B;  2XA7 M;  3M6B A;  3IF5 A;  1K6S A;  2XLN A;  1FCM A;  3E4Q A;  2ACG A;  4QB8 A;  5F83 A;  2B5R A;  2JCH A;  3NOU C;  3LI8 A;  2VZW A;  3M6H A;  4KUO A;  4QY6 A;  3UB6 A;  4H6J B;  4DE0 A;  1L2S A;  2WKQ A;  2PD8 A;  2ZM2 A;  3A3E A;  3F1P A;  1KGF A;  1MWR A;  2X01 A;  2Y2H A;  4HQA A;  4OOY A;  4R4S A;  4Y17 A;  4QJG A;  4LGW A;  3CIT A;  1H5X A;  2RL3 A;  1WYB A;  3S1Y A;  2IA2 A;  4CLC E;  2C5W B;  4R3B A;  2PYR A;  3KYZ A;  2H0T A;  1IEL A;  4I5S A;  4BL3 A;  4EW7 A;  3WS1 A;  1S67 L;  4E3L A;  4JGR A;  1N4O A;  1S4R A;  4FSF A;  3C38 A;  4UA9 A;  2ZMA A;  2DRW A;  2HP5 A;  5DFY A;  1K4F A;  3E4P A;  1MC0 A;  4ZJ1 A;  3BFC A;  4OQH A;  4E3K A;  5F82 A;  2QZ6 A;  1LHY A;  3N8R A;  1LI0 A;  5HFO A;  4N9L A;  4LRY C;  5FEG A;  1YMS A;  4JKT A;  3HL9 A;  5EFW A;  4Y0T A;  1STZ A;  3GMW A;  3IS2 B;  4JPM A;  4LEN A;  3K3D A;  4GDN A;  3KSG A;  2OLU A;  1ZHH B;  3BYD A;  2HDQ A;  1GA9 A;  3CAX A;  4WEK A;  1S66 L;  1FSY A;  3E98 A;  4ESP A;  2R78 A;  1VET A;  2FFF B;  1OTA A;  2XR0 A;  4MEZ A;  3R7W B;  3T4J A;  2L1M A;  2PDR A;  1FCN A;  5FI7 A;  4WN5 A;  2KX6 A;  4ARZ A;  4KG2 A;  2M7V A;  5HL1 A;  3IXH A;  5F1G A;  3UE1 A;  4PM6 A;  1G6O A;  2W0N A;  5EPH A;  3FC7 A;  3N6I A;  4YWZ A;  3B42 A;  3EQV A;  4HNB A;  1OTE A;  4R0Q A;  3W8K A;  2VX8 A;  1J3W A;  3MJQ A;  4HJ3 A;  4OLD A;  4KZ4 A;  4R4R A;  3IXD A;  1FR6 A;  1XGI A;  3QP2 A;  2G2U A;  2WAE A;  1MZU A;  4R38 A;  4RVA A;  4WZ5 A;  5FDH A;  2KOI A;  2A49 A;  1K54 A;  3LEQ A;  3IH9 A;  3VP0 A;  1W63 Q;  3LR4 A;  5KSH A;  3BW6 A;  5M1A A;  2JKR M;  4EBP A;  3A3J A;  4LV2 A;  1GSW A;  4WL9 A;  4FD8 A;  4UEY A;  4PHT A;  3VP2 A;  4CLC B;  3T12 B;  5HSQ A;  1QME A;  4GHI A;  3E4O A;  3OLO A;  5E2E A;  4LV3 A;  1G28 A;  3A3D A;  3MXS A;  4OQG A;  1H0M A;  2GJ3 A;  1WYC A;  4HP4 A;  3S7N A;  4PMA A;  4AFI A;  2ZC3 B;  5KMW A;  3L7H A;  5AJG A;  3ZYT A;  1W7F A;  5EV0 A;  3TSG A;  2Y2Q A;  2ZM0 A;  3AGD A;  3WS2 A;  4MN7 A;  2Q0O A;  1KVL A;  4N9K A;  1V9Y A;  4R6L A;  3Q7V A;  3B33 A;  4UQI S;  4BD1 A;  3Q7Z A;  2J3T D;  2Q9N A;  3O87 A;  3N8L A;  4GNU A;  3E0Y A;  4HJ6 A;  3ZG0 A;  3LY3 A;  4KZ6 A;  3LIF A;  4CLC C;  1EWZ A;  3SZT A;  4EU0 A;  2FH5 A;  4EER A;  4WF0 A;  3UE3 A;  4DKI A;  2ZOH A;  1VET B;  2EFU A;  3DTK A;  2XA7 S;  3BRM A;  4KQQ A;  2M7U A;  4MBF A;  3PBN A;  2VV6 A;  3HUN A;  4EES A;  5HAP A;  2EX6 A;  4OPY A;  4R1G A;  4K0X A;  3PYP A;  2HGV A;  5F68 A;  5U47 A;  3RXW A;  1TDL A;  2J9O A;  1CI8 A;  4O01 A;  3E2L A;  1KGG A;  4OQI A;  3BM6 A;  2V20 A;  1ALQ A;  1PWD A;  2VEA A;  1TS7 A;  5CRF A;  3HVF A;  4ETZ A;  1N9N A;  2XFT A;  3MZD A;  4UAA A;  1WE4 A;  4FH4 A;  4Q0H A;  5F1F A;  3ITA A;  3G2Z A;  3BFF A;  3CHW P;  3VOZ A;  1DP6 A;  5TJJ A;  4HH3 A;  1L0F A;  2I9V A;  3UE0 A;  2D01 A;  1X0O A;  1Z6F A;  3LIE A;  4WYY A;  4BQM A;  3WS5 A;  1XJ4 A;  1ZTU A;  2VKS A;  4X53 A;  4MDZ A;  4JGO A;  4IUH A;  4IVI A;  2Y2P A;  3C7U A;  3ITB A;  5CHM A;  5DKL A;  3UB8 A;  4EBL A;  5FQI A;  2VV8 A;  3M2K A;  4GLQ A;  4LRZ E;  5EM0 A;  3CWF A;  1ZG6 A;  1D7E A;  1DJB A;  1VB6 A;  2VGK A;  3P98 A;  3EQU A;  3C5A A;  4KZ9 A;  2YKF A;  3ZCZ A;  2EFX A;  3T4L A;  1RGZ A;  3ULF A;  2V9A A;  2PBD P;  2XK1 A;  2WKP A;  1N9O A;  4GW9 A;  4WZ5 C;  5IS1 A;  4JLF A;  1K54 C;  4OOL A;  1W79 A;  4IBX A;  1BYW A;  5DTT A;  4DF6 A;  3F1O A;  2GZA A;  4OKP A;  4XUZ A;  2XRN A;  1H8Y A;  1VHM A;  4M4X A;  2WZZ A;  1PI4 A;  1TDG A;  3UPP A;  3UPN A;  2PU4 A;  3H82 A;  1KE0 A;  3V3S A;  1K56 A;  2HP9 A;  2FZ0 A;  3FYZ A;  2LB9 A;  3GQZ A;  2HP6 A;  1I2W A;  4B4Z A;  4U0T A;  4WZ4 A;  4U0X A;  1ERO A;  4PPR A;  4R23 A;  3LI9 A;  3AGF A;  3S7P A;  4KZ5 A;  4GS9 A;  1L0D A;  3CUE C;  4RX2 A;  3QP8 A;  4K0W A;  2ZL1 B;  4LV0 A;  3ZQ5 A;  1XP4 A;  4IBR A;  1FCO A;  2XD1 A;  5AVE A;  3JVV A;  4NKP A;  1PWC A;  2B18 A;  1OJG A;  2Y2J A;  3MSH A;  4F94 A;  1YLW A;  2V0W A;  2O9B A;  3CG5 A;  3SS5 A;  4RQ9 A;  4MBK A;  1Y54 A;  1T18 A;  3UPO A;  3Q07 A;  4EQI A;  4X1L A;  4E3O A;  3O3V A;  4WEL A;  3W2Z A;  5L8M A;  2JKR I;  3EEH A;  4HHD A;  4H6J A;  4S2N C;  1XJ6 A;  3HUM A;  4EBN A;  2J8Y A;  3ZG7 B;  1TS0 A;  3W4Q A;  3WS0 A;  1ZG4 A;  2JHE A;  2V8C A;  1M6K A;  3C4O A;  4E3J A;  1I2S A;  3PHY A;  4HBT A;  4B4X A;  5F6A A;  2VK3 A;  5FQ9 A;  4QD4 A;  5GLD A;  3FPW A;  1SHV A;  3VP4 A;  5CTN A;  1RP5 A;  2JKG A;  3HLD A;  2QJ7 A;  2JE5 A;  3ZG8 B;  1XPB A;  2OWJ A;  5G18 A;  1CI9 A;  3U2A A;  5HPF A;  5L07 A;  4Y3I A;  3P01 A;  4ID4 A;  2PR6 A;  3PBS A;  1EW0 A;  4RYE A;  5L10 A;  4NXG A;  5A91 A;  3HBR A;  3VP3 A;  2PU2 A;  4GKU A;  4MBH A;  2K31 A;  5GL9 A;  1J9M A;  3Q81 A;  1PZP A;  4N92 A;  1ERM A;  3LID A;  3PBO A;  5JYO A;  5HAR A;  2W1R A;  3KYQ A;  3IS2 A;  1H3Q A;  3BQA A;  3H82 B;  4KZ7 A;  1IKG A;  2WKE A;  2D02 A;  4O8G A;  2ZQ7 A;  3IF6 A;  4NG2 A;  1CJF A;  1K6R A;  4OON A;  4OH0 A;  4GS9 B;  1NXY A;  4WMC A;  1VQQ A;  4P85 A;  1V9Z A;  1KDS A;  3CZD A;  3R7W A;  5DF7 A;  2I72 A;  2P08 A;  4KEN B;  2XEP A;  3G6O A;  3CLO A;  3KYE A;  1K4E A;  3UME A;  2Z6D A;  2Z2L B;  4HIA A;  1PRQ A;  1T1C A;  1OTD A;  1FR1 A;  4OOM A;  3F1N B;  1W8Y A;  1BLS A;  3T1R A;  5M18 A;  2K2N A;  1P9R A;  3NEC A;  3S22 A;  2JKF A;  4ZDX A;  1ES5 A;  4O7D A;  3TJZ C;  2Z2M B;  1K38 A;  1BLC A;  2GX5 A;  2ZQ8 A;  2PYP A;  2W3D A;  3UMD A;  2QPN A;  1MWT A;  4CQH A;  1H8M A;  1F2K A;  5FAT A;  1Q2P A;  5E2H A;  4CLC A;  4EQ1 A;  2QJ5 A;  3OOV A;  4B93 A;  2ZC6 B;  1XA7 A;  3AGE A;  4JGP A;  4NXE A;  1IEM A;  5L2F A;  1N9L A;  2BAS A;  2H0Y A;  2VLG A;  4JGQ A;  4EET B;  3P7N A;  3MXQ A;  5CHJ A;  3UN7 A;  4P0M A;  1NZO A;  2EA9 A;  1TS8 A;  4KZA A;  3MQO A;  5GLB A;  3E2K A;  2EX8 A;  1ES2 A;  1ACF A;  1ONH A;  2HV1 A;  3BY8 A;  1NLY A;  5EOO A;  1JNU A;  2Y2I A;  1DY6 A;  5HDS A;  1CK3 A;  3NJA A;  3G30 A;  2XDM A;  4E3I A;  4KQR A;  5FAS A;  1D1J A;  3IF6 B;  5CGX A;  5DJT A;  3UNW A;  1O07 A;  3PBQ A;  3FPV A;  2HDR A;  1GSV A;  1A0K A;  4QWO A;  3BEC A;  4S2J A;  5GHY A;  5TFQ A;  1AXB A;  1NZU A;  2K7S A;  5J7E A;  3MKE A;  3ICY A;  1SDN A;  3N8S A;  3LUQ A;  3KO6 A;  4CPK A;  2BTF P;  4X55 A;  1ESI A;  3TW8 A;  5AQB A;  4M3K A;  4I3J A;  4Z1W A;  3VV4 A;  1ZC2 A;  3NI9 A;  1LSV A;  4GB7 A;  3IT9 A;  4QU3 A;  1YM1 A;  5FQJ A;  1SZV A;  5CEC A;  2QKP A;  4Y5F A;  3WS4 A;  1DRM A;  4UA7 A;  3TG9 A;  1LL5 A;  2W3F A;  3OBF A;  4D2O A;  3IF6 C;  4E3M A;  4ZAM A;  2OWH A;  2KLI A;  3W4O A;  4KUK A;  5HAQ A;  1VEU A;  4O0P A;  3WWX A;  3BQ8 A;  4GCZ A;  5FAQ A;  3G2Y A;  2WAD A;  1ES4 A;  3ZVT A;  3C8C A;  4Q8I A;  2PR5 A;  1KE3 A;  4P6Z M;  3C4P A;  4XXR A;  2J9P A;  1FOF A;  5IHV A;  5E2F A;  4YFM A;  4EWF A;  1MWS A;  3D3O A;  3V67 A;  4P87 A;  2IWB A;  4DJ2 A;  4X25 A;  3UO9 A;  5GHZ A;  1G6A A;  1T1B A;  3CUE A;  1S1Z A;  1RGY A;  5EVI A;  3MQ0 A;  3CMZ A;  2H10 A;  5K5B A;  3D4F A;  4LPZ A;  2DNS A;  2XF3 A;  1PIO A;  5HD3 A;  2Y91 A;  3K3C A;  3ZNY A;  2PAV P;  5BOH A;  3LR3 A;  4YOF A;  2B02 A;  1E3U D;  4Y13 A;  3LR0 A;  1TF1 A;  1NJ4 A;  4WM9 A;  3S4X A;  2YKH A;  3CI6 A;  2RCX A;  2ZQD A;  4IUK A;  4DMZ A;  1K25 A;  5G4Z A;  4FCF A;  3N7W A;  5AQ7 A;  3PBR A;  4S2N A;  3GSG A;  5A93 A;  2H5S A;  2GDN A;  4IVK A;  1JWP A;  5FQM A;  1G5U A;  1L0E A;  2ZMF A;  4F3L B;  1SDE A;  3BFE A;  1DP8 A;  3ZFZ A;  1N9B A;  4GJ4 A;  1XJ2 A;  1LLB A;  2V1B A;  1K57 A;  3VE4 A;  2ZL1 A;  5FQK A;  4DDY A;  1BSG A;  4HEF A;  4S2I A;  4B9O A;  1JTG A;  4BEN A;  1OT9 A;  1YPR A;  2NUT C;  2ZBB A;  3DTE A;  3I7J A;  3T50 A;  5DKK A;  3GV9 A;  5CEB A;  3SW1 A;  1GCE A;  2G7U A;  2WUQ A;  3KX0 X;  5F5Y A;  4G3K A;  3BWL A;  3V50 A;  3QP4 A;  4PM7 A;  2VGJ A;  3D9Y A;  2DCF A;  5FQQ A;  1WA9 A;  2QYB A;  3T4T A;  1VEU B;  4OPZ A;  2E8I A;  2FFY A;  1L3L A;  2HDU A;  2ZMV A;  3R4K A;  4UA6 A;  2W27 A;  1RCJ A;  5GHX A;  2AVX A;  3VFF A;  3H7W A;  1LSX A;  4I3I A;  4LV1 A;  4KQD A;  2ZC7 A;  5FL3 A;  1U60 A;  2O9A A;  5KZH A;  4RA7 A;  2O99 A;  3GRJ A;  1KVM A;  1O7E A;  3LIC A;  2Y8H A;  3T1Q B;  2W3G A;  1C3B A;  5EVI B;  2PT7 A;  4PKY A;  3PAE A;  3QHY A;  1MKI A;  3QP1 A;  2EXA A;  1HLU P;  1Q2Q A;  4HJ4 A;  5HDD A;  4DRT A;  5DF9 A;  2XQZ A;  1BLP A;  2XGN A;  5DFX A;  5EM1 A;  2P9V B;  5HZH A;  5TGF A;  5AQA A;  1SCW A;  2O9C A;  4HY8 A;  2A24 B;  2OV5 A;  4A5R A;  5A92 A;  4MLL A;  3IBR A;  1XFQ A;  2HDS A;  3TE8 A;  3C2W A; 
#chains in the Genus database with same CATH homology
 1STZ A;  5G4Y A;  3IS2 A;  1H3Q A;  3BQA A;  3H82 B;  3IS2 B;  1UGU A;  3K3D A;  5HD5 A;  3KSG A;  2D02 A;  4O8G A;  1S4S A;  1ZHH B;  1ODV A;  3MR0 A;  1YSQ A;  4NXF A;  3CAX A;  4WEK A;  1S66 L;  5TBM A;  4EUV A;  3EGX C;  4GS9 B;  1F98 A;  3E98 A;  1YSP A;  4L9E A;  2R78 A;  3A0S A;  1V9Z A;  1OTA A;  4Q0J A;  1P9W A;  3R7W A;  3R7W B;  3T4J A;  2L1M A;  2P08 A;  2PDR A;  4PKY G;  5A8B A;  4FOF A;  3S7Q A;  4WN5 A;  2KX6 A;  4ARZ A;  4ARZ B;  2M7V A;  3G6O A;  3CLO A;  4ZRR A;  4R3A A;  3UME A;  2Z6D A;  4DJ3 A;  1G6O A;  2W0N A;  4HIA A;  4L9G A;  2DMW A;  3FC7 A;  1OTI A;  4YWZ A;  4BBT A;  3B42 A;  4XT2 A;  3OCN A;  3EQV A;  1T1C A;  2W1T B;  4HNB A;  3LYX A;  1OTD A;  3FG8 A;  4DN0 A;  4OOM A;  1OTE A;  1YKD A;  3F1N A;  2VX8 A;  3F1N B;  4MMN A;  3TRC A;  3T4Q A;  2K2N A;  3MJQ A;  1P9R A;  4HJ3 A;  4P6Z S;  4G3V A;  5MC7 A;  4CLC D;  3TJZ C;  2NUP C;  1F9I A;  2GX5 A;  1MZU A;  2JN7 A;  2PYP A;  2W3D A;  3UMD A;  4R38 A;  2W3H A;  4MN5 A;  2KOI A;  4CQH A;  4BJP A;  4R70 A;  1H8M A;  3H7W B;  1W63 Q;  3LR4 A;  5KSH A;  3BW6 A;  2JKR M;  5J4E A;  1GSW A;  4WL9 A;  4UEY A;  3GDI A;  4PHT A;  4I39 A;  4CLC A;  4CLC B;  4EQ1 A;  5HSQ A;  2QJ5 A;  4GHI A;  3OOV A;  4GHI B;  4NXB A;  4B93 A;  3E4O A;  4QPR A;  3OLO A;  4JGP A;  1G28 A;  5CX7 A;  2GJ3 A;  2Z6C A;  1NRJ A;  4HP4 A;  4NXE A;  1N9L A;  2BAS A;  3MQQ A;  3S7N A;  2VLG A;  2OAQ 1;  4JGQ A;  2L4R A;  3P7N A;  4EET B;  3MXQ A;  4AFI A;  5AVF A;  3LIA A;  3NHQ A;  3H9W A;  2EA9 A;  3A0V A;  2JKT I;  5AJG A;  3ZYT A;  1TS8 A;  3KSI A;  3MQO A;  1TD5 A;  3KSF A;  2W3E A;  1OPX A;  4BBV A;  2HV1 A;  3BY8 A;  4MN7 A;  1NLY A;  3LFV A;  1JNU A;  4PAU A;  4R6L A;  1V9Y A;  2GNX A;  5HDS A;  4HH2 A;  2XSS A;  3NJA A;  5HL6 A;  3B33 A;  4UQI S;  1NLZ A;  2J3T D;  2P7J A;  4EXO A;  3E0Y A;  4BMW A;  5DJT A;  2VGL S;  4HJ6 A;  3VOL A;  4BBU A;  3LIF A;  4CLC C;  1XFN A;  5TBM B;  4EU0 A;  2FH5 A;  4EER A;  3D72 A;  1OT6 A;  4WF0 A;  3UE3 A;  4ETX A;  3PBQ A;  2ZOH A;  3EWK A;  3FPV A;  1XJ3 A;  2XA7 S;  2L0W A;  4NEE D;  2M7U A;  4II7 A;  1GSV A;  1MKM A;  3PBN A;  4ME4 A;  4E04 A;  2VV6 A;  1T1A A;  4WEJ A;  3S7O A;  3EEA A;  3BY9 A;  1DP9 A;  2J3W A;  2K7S A;  4EES A;  5J7E A;  2HF6 A;  5HDC A;  3HCY A;  1D06 A;  3ICY A;  2PHY A;  3RTY A;  3LUQ A;  3KO6 A;  3PYP A;  2HGV A;  5F68 A;  4IJG A;  3MF0 A;  2EWV A;  5IU1 A;  3TW8 A;  4O01 A;  3IBJ A;  4XT2 B;  4I3J A;  1LSW A;  4Z1W A;  3VV4 A;  2VA0 A;  4KQO A;  1LSV A;  5J3W A;  3T4S A;  5HWV A;  4MCW A;  5F69 A;  2QKP A;  2VEA A;  4Y5F A;  3OCL A;  1TS7 A;  4EEP A;  1DRM A;  3MFX A;  4ETZ A;  1N9N A;  3NOT C;  2W3F A;  3OBF A;  3PR6 A;  4Q0H A;  1LL8 A;  3LR5 A;  1OTB A;  2PD7 A;  2OWH A;  1DP6 A;  5TJJ A;  4HH3 A;  3RH8 B;  2KLI A;  3EGD C;  2I9V A;  4KUK A;  4I38 A;  2D01 A;  1X0O A;  4O0P A;  1W63 M;  3LIE A;  3BQ8 A;  1XJ4 A;  4L0L A;  1ZTU A;  3A0R A;  4GCZ A;  2VKS A;  4MDZ A;  4JGO A;  4L9F A;  3GEC A;  3C8C A;  4IUH A;  4WLA A;  2PR5 A;  2VJW A;  4P6Z M;  1T19 A;  4WUJ A;  5DKL A;  1GSX A;  3UB8 A;  3D3O A;  3V67 A;  4YNR A;  4BWI A;  2VV8 A;  1P0Z A;  4GLQ A;  4DJ2 A;  4LRZ E;  4EEU A;  1T1B A;  3CUE A;  3CWF A;  3K2N A;  1S1Z A;  2V1A A;  3HJK A;  4K08 A;  2MJ6 A;  3PBT A;  1D7E A;  1VB6 A;  3MQ0 A;  1OJ5 A;  1IFQ A;  3EQU A;  5K5B A;  2HJE A;  2M1C A;  4LPZ A;  2YKF A;  3T4L A;  5HD3 A;  3B47 A;  3UB9 A;  3ULF A;  2V9A A;  1LT0 A;  5DJU A;  3K3C A;  4Q0I A;  2WKP A;  1N9O A;  3LR3 A;  4GW9 A;  5IS1 A;  4YOF A;  4OOL A;  5HWW A;  2JKT M;  2B02 A;  1BYW A;  5HWT A;  3F1O A;  3F1O B;  1TF1 A;  2GZA A;  3LR0 A;  4HOI A;  2P04 A;  2XRN A;  3T4K A;  3UE6 A;  2YKH A;  5KIZ A;  3CI6 A;  2QHK A;  1VHM A;  2ZOI A;  4M4X A;  2VV7 A;  3O5Y A;  1Y28 A;  4IHQ A;  4IUK A;  3H82 A;  4DMZ A;  5G4Z A;  2FZ0 A;  1IOU A;  3PBR A;  2LB9 A;  4Y2F A;  5I5L A;  1F5M A;  2OAP 1;  3LI9 A;  2ZMF A;  4F3L B;  4F3L A;  2INW A;  4MN6 A;  1DP8 A;  3S7P A;  2J80 A;  4GS9 A;  2CMN A;  1UWN X;  3CUE C;  5HPI A;  4GJ4 A;  4UQI M;  2LB5 A;  1XJ2 A;  4G3W A;  4HP9 A;  2V1B A;  2QWS A;  2OOL A;  3BJN A;  3VE4 A;  2Y79 A;  2VGL M;  3NOP C;  1TS6 A;  3MMH A;  3ZQ5 A;  5LBR A;  3LIB A;  4B9O A;  3HJI A;  5AVE A;  3JVV A;  4NKP A;  1OT9 A;  5IT5 A;  4LLO B;  2NUT C;  2ZBB A;  2XA7 M;  2B18 A;  2HJ9 C;  1OJG A;  3KSH A;  3T50 A;  5DKK A;  3UB7 A;  3SW1 A;  2V0W A;  2G7U A;  3DBA A;  2O9B A;  3KX0 X;  3VE3 A;  5F5Y A;  4RQ9 A;  3T4O A;  4G3K A;  3BWL A;  2W1T A;  3E4Q A;  1T18 A;  2H28 A;  4I3A A;  3RFB A;  3NOU C;  3LI8 A;  4WEL A;  1WA9 A;  3W2Z A;  5L8M A;  2QYB A;  2VZW A;  3T4T A;  1KOU A;  2JKR I;  3EEH A;  4KUO A;  3UB6 A;  4HHD A;  4H6J A;  4H6J B;  1XJ6 A;  5C5K A;  2WKQ A;  2J3T C;  1TS0 A;  2PD8 A;  4HI4 A;  2ZMV A;  3R4K A;  3F1P A;  3F1P B;  2JHE A;  4HQA A;  2W27 A;  3PHY A;  5F6A A;  3H7W A;  2WKR A;  1LSX A;  3FPW A;  4I3I A;  3CIT A;  4KQD A;  2A2L A;  5FL3 A;  3JVU A;  2IA2 A;  2O9A A;  2XRO A;  3C30 A;  2QJ7 A;  4CLC E;  2KDK A;  2O99 A;  1S1Y A;  3LIC A;  2PYR A;  3KYZ A;  2Y8H A;  2OWJ A;  2V0U A;  2W3G A;  4I5S A;  2PT7 A;  4LRX C;  4PKY A;  3U2A A;  5HPF A;  4Y3I A;  3P01 A;  4EW7 A;  1P97 A;  2PR6 A;  3PBS A;  1EW0 A;  1S67 L;  3PXP A;  4HJ4 A;  4JGR A;  5HDD A;  4NXG A;  5DF9 A;  1S4R A;  1UWP X;  4FSF A;  1YAX A;  3C38 A;  2K31 A;  5DFX A;  5HZH A;  1NWZ A;  5DFY A;  2O9C A;  4HY8 A;  2A24 A;  2A24 B;  3E4P A;  1MC0 A;  3LID A;  2EWW A;  3OC2 A;  3PBO A;  2W1R A;  2O0Y A;  3KYQ A;  3IBR A;  3EOI A;  1XFQ A;  4LRY C;  3TE8 A;  5EFW A;  3C2W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...