4EESA

Crystal structure of ilov
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
110
structure length
110
Chain Sequence
b'IEKNFVITDPRLPDNPIIFASDGFLELTEYSREEILGRNARFLQGPETDQATVQKIRDAIRDQRETTVQLINYTKSGKKFWNLLHLQPVRDQKGELQYFIGVQLDGSDHV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Phototropin-2
publication title Structural Tuning of the Fluorescent Protein iLOV for Improved Photostability.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Signaling protein, flavoprotein
total genus 33
structure length 110
sequence length 110
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4eesA00
4H6JB 5G4ZA 4KUKA 4DJ3A 3A0VA 3UB6A 1GSXA 5IU1A 1LSWA 4XT2B 4NXGA 3FC7A 2ZBBA 5HSQA 3MQOA 2JHEA 1OTEA 5HWTA 4I5SA 4GCZA 1D7EA 5HD5A 4PKYA 2INWA 1VB6A 1G28A 4EEUA 1OT9A 4WLAA 2PYRA 3F1PB 1OT6A 4GHIB 4JGOA 2QKPA 3NJAA 5HWVA 1DP6A 1V9ZA 3BY9A 1XFNA 4B9OA 5IS1A 3CAXA 4HI4A 3PYPA 2VEAA 3NHQA 4GS9B 2JN7A 2PR6A 1S4RA 4LRXC 3UMDA 4LRYC 1DRMA 1X0OA 1EW0A 5A8BA 4HNBA 3PHYA 4R70A 3CWFA 5HDCA 4I3JA 3LI8A 3E4QA 5F5YA 1F9IA 1V9YA 1S67L 2PYPA 3VE3A 3G6OA 2GJ3A 4I39A 3F1OA 4EW7A 2PHYA 2L4RA 1JNUA 3ULFA 3EWKA 1D06A 3ZQ5A 1N9NA 3LI9A 5I5LA 3HJKA 3UB8A 5F6AA 2VLGA 3B33A 1UWPX 3D72A 2HV1A 4BBVA 2L0WA 4L9FA 4L9EA 5KIZA 1BYWA 1WA9A 2BASA 3A0RA 3FG8A 5HWWA 3GDIA 4HIAA 3RH8B 4WN5A 1LT0A 1NWZA 2VV8A 1T1CA 4MN6A 2YKHA 4R38A 1LSXA 2D01A 4JGRA 2VV6A 3CLOA 3LIEA 3UMEA 3K3CA 2QWSA 5J7EA 1Y28A 1TS6A 2Z6DA 5J4EA 2OWJA 2J80A 2QJ5A 5F68A 3E4OA 4EESA 3ICYA 4EXOA 1OTIA 3F1OB 3HJIA 1DP9A 2KX6A 2OWHA 5HDSA 5EFWA 2EA9A 4KUOA 1GSVA 1S1YA 2R78A 2Z6CA 5AVFA 2V1BA 5G4YA 3KX0X 3VE4A 4HHDA 1LL8A 2W0NA 4LRZE 4EERA 3IS2A 4LPZA 4HP9A 1F98A 4HH3A 2VV7A 4WL9A 5DJUA 1T1AA 1N9LA 4YWZA 1OTAA 3EEHA 2WKPA 3H82A 3SW1A 2CMNA 4HJ4A 3A0SA 2ZOIA 1S1ZA 3LIDA 3MXQA 1ODVA 1XJ4A 3UB9A 2QJ7A 3MQQA 2ZOHA 2WKQA 1TS7A 1T18A 4EQ1A 1UWNX 5DJTA 3LIFA 5TBMA 2P7JA 4DJ2A 5HD3A 1XFQA 1P97A 1T19A 3UE6A 3H7WA 1T1BA 5DKKA 1OJGA 2V0WA 4K08A 4R3AA 1P0ZA 2W27A 2D02A 4EETB 2V9AA 3NOTC 3LIAA 2PDRA 4KQDA 3IS2B 2L1MA 1S66L 4RQ9A 4JGPA 2PR5A 3H9WA 3BY8A 3H82B 2V1AA 2PD8A 4I3IA 1S4SA 2OOLA 5HZHA 3UB7A 4HOIA 3MFXA 4WF0A 3K3DA 4JGQA 2K7SA 1OTBA 2A24A 3E4PA 4NXBA 2I9VA 2KDKA 4I38A 3VOLA 3F1NA 4F3LA 1DP8A 1XJ3A 3NOUC 1TS8A 4WUJA 1MZUA 5TBMB 4LLOB 3P7NA 3LICA 4L9GA 1XJ2A 4I3AA 4E04A 2QHKA 3H7WB 3LUQA 4H6JA 4M4XA 2YKFA 5J3WA 3OLOA 4BBUA 3BWLA 3GECA 2V0UA 4HJ6A 1LSVA 4XT2A 5F69A 3MJQA 1XJ6A 1GSWA 3C8CA 3RTYA 1UGUA 4HQAA 4BBTA 3LYXA 4HJ3A 4NXEA 5AVEA 2WKRA 4GW9A 4NXFA 4HH2A 1OTDA 3F1PA 1N9OA 3NOPC 4GHIA 4EEPA 4MN5A 2M1CA 3LIBA 3IBRA 1TS0A 1OJ5A 5DKLA 2A24B 4PKYG 3C2WA 5HDDA 2H28A 4HP4A 3F1NB 1KOUA 2PD7A 4F3LB 3MR0A 4HY8A 2B02A 4GS9A 3T50A 4R6LA
chains in the Genus database with same CATH superfamily
4H6JB 4OKPA 2LB5A 3A0VA 4EU0A 2OAQ1 2XK1A 3QP4A 5CTNA 3D9YA 2P9VA 2ZMAA 4PM7A 3CJMA 4XXRA 2O99A 5FASA 1LSWA 2J7VA 5CGSA 1SCWA 4N9LA 2ZQDA 5BOHA 2WADA 1K6SA 4NKPA 2Y2HA 2G7UA 3O3VA 2XA7M 4Y2FA 3LEQA 4I5SA 3PAEA 1XP4A 4GCZA 1Y54A 3OBFA 3IF6A 2PU4A 2Y2JA 4KZ8A 1CJFA 1TF1A 1OT9A 4Y7PA 3MFDA 5CEDA 3QP2A 3R7WB 3F1PB 2WGIA 3BRMA 2QKPA 4BWIA 3SS4A 2OSUA 3NDEA 1U60A 5F82A 3QNBA 4P0MA 1ERMA 4S2IA 3TW8A 1L0GA 5IS1A 1BULA 1WYBA 4IBXA 3CMZA 2HDRA 4KQRA 5JYOA 4E3LA 1YLJA 1H8ZA 2JN7A 1RGYA 5CECA 4LRXC 2ZC3B 1ES5A 4LRYC 3NI9A 1FCOA 3BYDA 3C5AA 3PHYA 4R70A 3CWFA 5HDCA 3G34A 2PRFA 3KSHA 1V9YA 4E6WA 2PYPA 1YLTA 3PR6A 2GJ3A 5CERA 3NC8A 1W63M 4DMZA 3EWKA 4K91A 5FL3A 3DAVA 5HW3A 3V67A 3ZYTA 4DXCA 3LI9A 3Q07A 2UV0E 1PW8A 2EX8A 3D72A 2ZQCA 2HV1A 4BBVA 1O07A 4L9EA 1HZOA 2Y91A 1FIKA 3V39A 1WA9A 5HWWA 4X1MA 5C5KA 2XLNA 1NWZA 2Y2KA 4H8RA 1KDSA 1T1CA 2YKHA 3ZG9B 1F5MA 3UB5P 1YLYA 2VGLS 4B93A 3UPOA 4UQIS 3UMEA 4QB8A 1OPXA 2QWSA 1ZG4A 1TS6A 4ETZA 4WEKA 3W4PA 4QWOA 2GNXA 3AGEA 1G6AA 5J4EA 3PBQA 5F68A 2ZQ8A 3GMWA 1MKIA 2Y8HA 2BLSA 4EXOA 5TFQA 1CI9A 3HJIA 2B5RA 2Q9NA 3VSLA 1H8YA 2KX6A 2OWHA 5DF7A 2NUTC 3LFVA 2EA9A 1XGJA 2Z6CA 1FSYA 2V1BA 1XPBA 4D2OA 5AQ7A 2IA2A 3HUOA 2Y79A 3KX0X 2OLUA 1LL8A 1L3LA 3O88A 2H0TA 1C3BA 3MS6A 3KYEA 3HLDA 1YLWA 1IYOA 4JXWA 2XRNA 1L2SA 2PBDP 4X55A 1PI4A 3Q7VA 4RA7A 4WL9A 2W1TB 2CMNA 3T4TA 4HJ4A 5EVEA 5CHMA 4MNRA 4Q8IA 3IWOA 1Z6FA 5GLDA 4WBGA 3WS4A 1ODVA 3N8RA 5EUAA 1STZA 2QJ7A 4DRTA 1G6OA 2WKQA 4B4ZA 3EOIA 2EXBA 4R3JA 1CEGA 5FAOA 5TBMA 1XFQA 1EI5A 2EX9A 1T1BA 1SKFA 1OJGA 3LR3A 3A3JA 3W2ZA 2V0WA 4K08A 4R3AA 1ES3A 4LCMA 1HTZA 5FQ9A 5GLAA 3AGDA 5FI7A 3NOTC 4L0LA 3LIAA 5CHJA 4IHQA 4GDNA 2P08A 3MKEA 3FPWA 1S6RA 1BLPA 1LL9A 3EQVA 3MBZA 2XQZA 3VMAA 1CEFA 1S66L 2CC1A 3MXRA 3M2JA 4KG6A 3M6HA 3H9WA 4DN0A 3H82B 1GHMA 4CLCE 1S4SA 3RFBA 2M7UA 2WZZA 4HOIA 4N1XA 3K3DA 5JYPA 4HESA 2JKFA 5E2FA 1ZKJA 4NXBA 2WZXA 5DF9A 4Y0UA 3FKVA 4CLCA 4X53A 3F1NA 3DTEA 2C6WB 3MMHA 4LV1A 4BD1A 3VV4A 1JWZA 1XJ3A 2R9WA 5J8XA 4I3AA 2QHKA 4OQ0A 4GD6A 1XGIA 4CJNA 2XA7S 4X68A 4M4XA 4WZ5A 3OLOA 4BBUA 5KSHA 4IVKA 4R3BA 4HJ6A 1D1JA 2GX5A 3ZG5A 5KMWA 4XT2A 1VETA 2XD5A 2FH5A 5FDHA 3MJQA 1CI8A 4BENA 5EOEA 3PAGA 3IH9A 2HPBA 4Y0TA 2V8FA 2O0YA 5HAPA 3S7PA 1AWIA 1MBLA 3C8CA 3GV9A 1UGUA 1ZTUA 4HQAA 1FCMA 1MWRA 1PFLA 1E25A 1GCEA 1NYMA 4S2MA 5AVEA 2RCXA 4QJGA 2HGVA 3WS0A 4Y0OA 1TDGA 4GHIA 3HLWA 4MN5A 2M1CA 2EWVA 2XFTA 3W8KA 3C2WA 1HVBA 2O9BA 3UE3A 3BLSA 3EQUA 4HP4A 2EFXA 3BW6A 2QMIA 4O8GA 1E3UA 1BLHA 4UHUA 3KYZA 5AQBA 2A3UA 2X02A 5KSCA 3UDXA 2W3EA 2B02A 3RJUA 3FYZA 5A91A 4WMCD 3NDGA 1W79A 1LI9A 3IHBA 3UY6A 2ZC7A 4R6LA 4G3VA 1NZOA 4YOFA 5G4ZA 1PWCA 3N8SA 3PTEA 3BJNA 5FAPA 2E8IA 1KDWA 2WGVA 1M40A 2VK3A 5FQJA 5IU1A 1SZVA 3CUEC 4C3QA 5IT5A 3A3FA 3QP8A 1BTLA 2Y2GA 4DDSA 2W1RA 3T4JA 3A3IA 1DY6A 5F1FA 5HSQA 2K31A 4Q0HA 2RL3A 3LCEA 2JCHA 2INWA 1Z09A 2ZL1A 4OPQA 2IWBA 3FKWA 2PYRA 4UEYA 4NK3A 2XD1A 2DMWA 5HWVA 1DP6A 3BY9A 2A2LA 2J3TC 1PI5A 3KSFA 4WEJA 4NG2A 3NULA 4B9OA 2JC7A 3CAXA 3PYPA 3ZG7B 1QMEA 1NLYA 5HFOA 3ZG0A 4GS9B 1IOUA 2PR6A 3ZCZA 1FR1A 4ID4A 3OPRA 1DRMA 1X0OA 3C7VA 3PBRA 1EW0A 2H10A 5A8BA 3EGDC 3UDIA 2P9VB 4I3JA 3CG5A 2P04A 3TSGA 3OCLA 1GHIA 5KZHA 1KE3A 3G6OA 4EWFA 1ES4A 3LEZA 3CI6A 2L4RA 1JNUA 3ULFA 4LCLA 3ZGAB 1D06A 3HLEA 1RP5A 3ZVWA 1N9NA 3ITAA 3UB8A 1H5XA 3IF6B 5A92A 1ACFA 3L9KA 1JWVA 3B33A 2L0WA 4PAUA 3LGOA 3AGFA 3LY4A 4X6TA 2MJ6A 1BYWA 3W4QA 3FG8A 2IWCA 1W63Q 1XKZA 2XDMA 3BECA 3FPVA 3GDIA 4S2NC 1N9BA 3M6BA 3IXHA 4DF6A 3ZDJA 2WUQA 1LT0A 3T1QB 4DE3A 2EWWA 4X69A 3V3SA 4GD8A 2FFYA 1KVMA 4ESPA 2XEPA 3HCYA 5L09A 2DRWA 4KQOA 4JGRA 4R0QA 1W8YA 3LIEA 4GLQA 3K3CA 3MZEA 5J7EA 1Y28A 4II7A 1VQQA 1K4EA 2J80A 4KZ6A 4YINA 3S7OA 1PWGA 4OPYA 3VP2A 3HLFA 2PAVP 1OTIA 3ZFZA 1DP9A 1K57A 1VM1A 3LR0A 1KE4A 1PWDA 3GSGA 2LB9A 3OC2A 5GHXA 2J9PA 5AVFA 4O01A 3IXGA 2NUPC 3OOVA 3IF6C 3SH8A 2W0NA 1JTDA 5EPHA 3O5YA 3MZDA 3Q81A 3SS3A 4MBHA 4OPRA 4CLCD 1YSPA 1O7EA 3IS2A 3IBJA 1F2KA 3T12B 4Y15A 3T1RA 4CQHA 3SW1A 2QPNA 3C4OA 2VGKA 1XXMA 2XFSA 1XA1A 2XF3A 4OPZA 1GHPA 2C5WB 3CHWP 2QZ6A 4E3NA 4Y13A 1XJ4A 4K0XA 3G4PA 2ZQ9A 3UB9A 2B18A 3MQQA 3ZNTA 1FQGA 2Y2PA 3N8LA 5DJTA 2P7JA 4DJ2A 1P97A 4E3JA 3VOZA 5HX9A 5EVLA 2Y2IA 3H7WA 5L10A 3ZHHA 2VKSA 3ISGA 2JKGA 3IWIA 3HREA 4N9KA 4GJ4A 3LY3A 4FSFA 1YLPA 2PDRA 5U47A 4KQDA 1KGFA 4EBPA 5FEGA 2L1MA 5AQ9A 1E3UD 1DJAA 1IYPA 4QU3A 3VOYA 5HPIA 2HP5A 3Q7VB 4YFMA 4Y3IA 2UWXA 2V1AA 2PD8A 3MZFA 3V3RA 5D3OA 2OOLA 4X25A 4ME4A 5HZHA 3LR4A 2QYBA 2I72A 3JYIA 4JGQA 3S22A 4JF6A 2AVXA 2DNSA 2VJWA 1NJ4A 5E2EA 2WKIA 4OP8A 1NLZA 3E2KA 2WKHA 2KDKA 4I38A 3VOLA 4JF5A 5EOOA 2G2WA 4EBLA 4XUXA 4F3LA 4BQMA 2K2NA 2J3TD 3NOUC 4IBRA 4JBFA 1YT4A 4AFIA 5TBMB 4R23A 4WELA 3VSKA 4L9GA 1XJ2A 4E04A 3A3DA 4JKTA 4DE2A 5E2GA 3CPTB 3B47A 5J3WA 1P9RA 3GECA 2V0UA 2ZM2A 4OLGA 3UPNA 4S2JA 2WKEA 3ZNYA 3E2LA 1YSQA 4LFUA 1FILA 5DTKA 5FQQA 3W4OA 4ZRRA 5EECA 2ZD8A 4BJPA 3BM6A 2DCFA 3RTYA 4BBTA 2EX2A 5DFYA 4PM9A 2Q9MA 2Z2MB 4KZAA 4WZ4A 5EM1A 4DDYA 4QPRA 1OTDA 1N9OA 4IUHA 4WYYA 3HBRA 3D4FA 3LIBA 4O7DA 5DKLA 4PKYG 2H28A 3CPTA 5DTTA 1MC0A 4CLCB 5M18A 3F1NB 1KOUA 2PD7A 4F94A 3GQZA 4HY8A 1KGEA 3NY4A 5A90A 3FWLA 3CZDA 5DVAA 1IEMA 4KUKA 1FSWA 3HUNA 3UB6A 3G32A 3VP1A 4PM5A 2O9CA 2V8CA 1VETB 4XT2B 4NXGA 4DXBA 5CRFA 4N1HA 4E6XA 2EFUA 2BG1A 3U2AA 3QNCA 2Y2LA 3FC7A 2ZBBA 3HLGA 3MQOA 4JLFA 5A93A 4ZDXA 1K38A 1D7EA 3T4SA 4OOLA 5HD5A 2PBYA 4PKYA 4PM8A 1VB6A 4IEDA 3RXXA 2XSSA 4WLAA 3GTCA 2XGNA 4GZBA 1OT6A 4GHIB 3S4XA 3NJAA 3S7QA 3C38A 3IHAA 4KQQA 4X1LA 4BL2A 1Q2PA 3V5MA 2W3DA 4U0TA 4JXSA 2Y55A 1TEMA 1MWSA 2HP9A 3GRJA 3BFEA 1I2WA 4HI4A 4KG2A 4CLCC 2VEAA 2WGWA 4OOYA 1S4RA 3UMDA 1MKMA 4A5RA 1PNEA 4ETXA 5GHZA 3WWXA 3HLCA 2ZC5B 3LI8A 2E8JA 1F9IA 1IYQA 3PBSA 4WZ5C 3IQAA 3VE3A 2ACGA 3NIAA 5HARA 3F1OA 4EW7A 2PHYA 4MLLA 3WS5A 3E98A 3LO7A 4NETA 1P9WA 3ZQ5A 1DJBA 3PXPA 1CK3A 5AQAA 5I5LA 3HJKA 5F6AA 5FDSA 3C7UA 4QY5A 2Y59A 2ZL1B 4ARZA 2XR0A 4L9FA 1ZG6A 4DKIA 2EX6A 1GA9A 2BASA 3A0RA 2EXAA 3BQAA 3WS2A 1YM1A 3BFFA 2V2FF 3N4IA 2XH9A 3DTIA 2VZWA 1VEUA 3RH8B 4WN5A 3MSHA 2VV8A 5FAQA 3JVUA 5MC7A 2JKRM 3SOIA 3LR5A 3M2KA 3Q7ZA 5CX7A 1WE4A 2VV6A 3CLOA 4LENA 4NEED 4QD4A 1SDEA 3Q1FA 4FUWA 2Z6DA 3BLMA 4LV3A 3E4OA 3G30A 1W7FA 3ICYA 3T4QA 3E0YA 1MXOA 4G3KA 4ZBEA 4Y5FA 3TE8A 5EVIA 2HDQA 1GSVA 2R78A 1K55A 1KVLA 5G4YA 2ZMFA 5HAQA 3OCNA 3TJZC 3IX8A 1H8MA 3VE4A 3IH8A 3U4LP 3MKFA 5EM0A 1LL5A 4LPZA 4OQHA 1F98A 4HH3A 5EVIC 4YNRA 2Y2NA 5DJUA 1TVFA 1N9LA 4YWZA 1N4OA 1OTAA 3EEHA 1ESIA 4HEFA 1PIOA 2WAEA 2ZC6B 4GDBA 4P6BA 3A0SA 2ZOIA 3G2ZA 1KGGA 4B4XA 1G68A 4OQGA 5IHVA 4ZJ2A 3MXQA 3FV7A 1HLUP 4RVAA 5EE8A 1YLZA 2ZOHA 1TS7A 2W3GA 3O86A 1XX2A 1T18A 4EQ1A 1UWNX 1ZHHB 3I7JA 4Y17A 4IJGA 4PHTA 3LIFA 5HD3A 3ITBA 1T19A 3QHYA 3UE6A 1NZUA 4JXGA 5DKKA 5L07A 4N92A 2JKTM 4E3OA 4OLDA 1QMFA 3UDFA 4EETB 3HL9A 1JVJA 2V9AA 4FD8A 1MY8A 1WYCA 1H3QA 1K56A 3DWZA 1NYYA 3IS2B 4EV4A 2OAP1 4RX3A 5LBRA 2OLVA 3JPUA 4JGPA 5L8MA 4HBTA 3IF5A 2PR5A 4BLMA 3UN7A 4KZ3A 3BY8A 2ZQ7A 5GHYA 4MBKA 3HUMA 4I3IA 4WM9A 3P09A 4LV0A 1W8QA 4BL3A 2HP6A 4CPKA 5FQKA 2K7SA 3TG9A 2HDUA 2A24A 3T1SA 3HLBA 1L0EA 4PPRA 1DP8A 1K54A 1TS8A 2Y2OA 5GLBA 2G2UA 5L2FA 3DBAA 3UNWA 1OMEA 3H7WB 3LUQA 1K57C 4RX2A 5FQIA 4H6JA 3SS5A 2A49A 5TJJA 4ZTKA 2YKFA 4OQIA 2ZM8A 3T4LA 2GDNA 3V50A 4KENB 3T4OA 1K54C 4C6YA 4EBNA 1XJ6A 4OP5A 2HJEA 1ZC2A 1MPLA 1GSWA 4P6ZM 1IFQA 5F83A 3TOIA 3LYXA 1L0DA 4JF4A 4HJ3A 4NXEA 4KZ7A 1J3WA 2XROA 2WKRA 3IX4A 4FH2A 4Q0JA 3R7WA 4NXFA 4HH2A 3F1PA 3NOPC 3BFDA 1LHYA 4EUVA 1PYYA 4EEPA 1Y4OA 3GVBA 1E4DA 1OJ5A 1JWPA 1ONHA 2X71A 5FI2A 4UA9A 4WMCA 5HDDA 4IVIA 1LI0A 4DE0A 3N7WA 2JE5A 3BFGA 1NRFA 4F3LB 4QHCA 1ESUA 1YMSA 3MR0A 3S1YA 4R4RA 2KLIA 2IWDA 1NY0A 4DJ3A 2ZC4B 2H0YA 3CITA 3G31A 1ONGA 4O0PA 1GSXA 5DF8A 4ZAMA 2Y2MA 1MWUA 2ZLYA 2JKRI 4OOMA 2JHEA 1OTEA 3OPHA 3K2NA 2J3WA 4XUZA 5HWTA 5FATA 3PBOA 4FTXA 1G28A 5CGXA 4EEUA 3VP0A 1BLCA 4OVDA 5FEFA 5FSRA 1YAXA 3OZHA 4GNUA 4JGOA 4MN7A 3OPLA 3NBLA 4P87A 5FI6A 1HD8A 1V9ZA 4U3TA 4B88A 3UPPA 4ZJ3A 1PW1A 4MBFA 1I2SA 1XFNA 4PMAA 3DWKA 5EVID 2HZ5A 5HPFA 3NHQA 5M1AA 2JBFA 1PZOA 4MMNA 3MF0A 4KZBA 4HNBA 4GN2A 3IXDA 3P01A 5M19A 2B95A 4S2LA 4KZ5A 3E4QA 5F5YA 1S67L 2ZMVA 1BUEA 1CF0A 1DJCA 4OH0A 4X56A 1YKDA 4I39A 4KZ4A 1YPRA 1IYSA 2ZQAA 3VFFA 5CXWA 3IT9A 4FCFA 4Z9QA 1K4FA 2VLGA 4U0XA 1UWPX 5TGFA 5F1GA 2WK0A 5KIZA 3IXBA 3IX3A 4G3WA 3SH7A 3ZVTA 5FQMA 3NCKA 3T4KA 5CGWA 3MQ0A 4HIAA 3WRTA 4JPMA 5I94A 3KYQA 4UA7A 4MN6A 4MCWA 1ALQA 1SKOB 2W1TA 5CHUA 1BZAA 3JVVA 2JKTI 4R38A 3EEAA 2X01A 1H0MA 4QY6A 2HJ9C 1LSXA 2D01A 3N6IA 1CQAA 1PRQA 2WGWB 1IELA 5EV0A 1K25A 3SH9A 1J9MA 5DTSA 1VHMA 4GKUA 1RGZA 3HVFA 2OWJA 2QJ5A 4DE1A 1ERQA 4D60A 4EESA 1EROA 2FFFB 1K56D 3QP6A 1TD5A 3F1OB 4MDZA 3EGXC 5HDSA 5EFWA 3VFHA 3UE0A 5E2HA 4KUOA 1S1YA 4Z1WA 2ZJ9A 4RYEA 4ARZB 1PZPA 1SKOA 5HL1A 3Q82A 3DTKA 4HHDA 4K0WA 1LLBA 4LRZE 4M3KA 2Y4AA 4GB7A 2Y2QA 3PBTA 1KE0A 3VP4A 4EERA 2M7VA 4P85A 4HP9A 1VEUB 3BQ8A 2H5SA 5GLCA 2VGJA 4E3KA 2VV7A 1K6RA 1T1AA 3C4PA 2VX8A 2WKPA 2WYXA 3H82A 1K0KA 4C75A 1S1ZA 2VA0A 2BTFP 3LIDA 1FR6A 3IWQA 2ZM0A 3A3EA 1EWZA 3P98A 1IKGA 2PT7A 5FA7A 1SHVA 1IKIA 3O87A 4FH4A 5GL9A 2VGLM 5K5BA 3QP1A 4UQIM 2Q0OA 4R4SA 4KG5A 1A0KA 3ZG8B 5EVIB 4BMWA 1W5DA 3GR2A 1P0ZA 2W27A 3CUEA 2D02A 4P6ZS 3TRCA 1ES2A 5CTMA 2FZ0A 4MEZA 5HL6A 2P74A 2V20A 3SZTA 1SDNA 3G2YA 1JTGA 1S0WA 5HAIA 2W3FA 3BEBA 2PU2A 2R9XA 4RQ9A 1MWTA 3OPPA 1BLSA 1FOFA 2WAFA 3UB7A 2Z2LB 4JXVA 3MFXA 4WF0A 1XA7A 4FOFA 1YQSA 4S2OA 5CEBA 1FCNA 1OTBA 4R1GA 3WRZA 1L0FA 1M6KA 3E4PA 2I9VA 4Q0IA 3DW0A 1BSGA 3WS1A 3C30A 4WUJA 1MZUA 2GZAA 3KO6A 3NECA 2HDSA 3KSIA 4LLOB 3P7NA 1NXYA 3KSGA 3LICA 4HBUA 3B3XA 3R4KA 1NRJA 4LGWA 1G5UA 3B42A 4E3MA 2W3HA 4E3IA 4LV2A 3D3OA 4UAAA 3BWLA 4EUZA 1K55C 2V1ZA 4PM6A 4IUKA 5TR7A 1LSVA 2OV5A 3DTMA 5F69A 5DFXA 4OONA 1BT5A 3T1XA 3FZCA 2J9OA 5G18A 3S7NA 3PBNA 1I5QA 4GOGA 5AJGA 3MXSA 4S2NA 3UE1A 2O9AA 4GW9A 2J8YA 2KOIA 3VP3A 3IBRA 1TS0A 1TDLA 2A24B 1AXBA 1RCJA 3BFCA 1GA0A 2HF6A 1Q2QA 4EQIA 4ZJ1A 4UA6A 3QP5A 4S2KA 4S2PA 3RXWA 1YMXA 5E43A 3L7HA 4GS9A 4BD0A 3T50A 4KZ9A 3G35A 3UO9A
chains in the Genus database with same CATH topology
4G3VA 4H6JB 4YOFA 5G4ZA 2LB5A 4KUKA 4DJ3A 3A0VA 3CITA 4EU0A 3BJNA 2OAQ1 3UB6A 4O0PA 1GSXA 2O99A 5IU1A 1LSWA 3CUEC 2O9CA 5IT5A 2JKRI 4XT2B 4NXGA 2W1RA 3T4JA 3U2AA 4NKPA 3FC7A 2ZBBA 5HSQA 3MQOA 2G7UA 2K31A 2JHEA 1OTEA 4OOMA 2XA7M 4Q0HA 4Y2FA 3K2NA 2J3WA 5HWTA 4I5SA 4GCZA 1D7EA 3OBFA 3T4SA 4OOLA 3PBOA 5HD5A 4PKYA 2INWA 1VB6A 1G28A 4EEUA 1TF1A 1OT9A 2XSSA 4WLAA 3R7WB 2PYRA 4UEYA 3F1PB 1YAXA 1OT6A 4GHIB 2DMWA 4JGOA 2QKPA 3NJAA 4BWIA 3S7QA 4MN7A 5HWVA 3C38A 1DP6A 1V9ZA 2W3DA 3BY9A 2A2LA 2J3TC 1XFNA 3KSFA 3TW8A 4WEJA 4B9OA 5IS1A 3CAXA 4HI4A 3PYPA 4CLCC 2VEAA 5HPFA 1NLYA 3NHQA 4GS9B 1IOUA 2JN7A 2PR6A 1S4RA 4LRXC 3UMDA 1MKMA 4MMNA 4LRYC 1DRMA 3MF0A 1X0OA 3PBRA 1EW0A 5A8BA 4HNBA 3EGDC 3PHYA 4R70A 3P01A 4ETXA 3CWFA 5HDCA 4I3JA 3KSHA 2P04A 3LI8A 3E4QA 5F5YA 1F9IA 1V9YA 1S67L 2ZMVA 3PBSA 2PYPA 3OCLA 3VE3A 1YKDA 3G6OA 3PR6A 2GJ3A 4I39A 3CI6A 3F1OA 4EW7A 2PHYA 2L4RA 1JNUA 1W63M 3ULFA 3E98A 4DMZA 3EWKA 1D06A 1P9WA 3ZQ5A 5FL3A 3PXPA 3V67A 1N9NA 3ZYTA 3LI9A 5I5LA 3HJKA 3UB8A 5F6AA 2VLGA 3B33A 1UWPX 3D72A 4ARZA 2HV1A 4BBVA 2L0WA 4L9FA 4PAUA 4L9EA 2MJ6A 5KIZA 1BYWA 1WA9A 2BASA 3A0RA 3FG8A 1W63Q 4G3WA 5HWWA 3BQAA 3FPVA 3GDIA 5C5KA 3T4KA 3MQ0A 4HIAA 2VZWA 3RH8B 4WN5A 1LT0A 3KYQA 1NWZA 2EWWA 2VV8A 1T1CA 3JVUA 5MC7A 2JKRM 2YKHA 4MN6A 4MCWA 2W1TA 3HCYA 3JVVA 1F5MA 2JKTI 4R38A 3LR5A 2VGLS 3EEAA 4B93A 4KQOA 5CX7A 2HJ9C 1LSXA 2D01A 4JGRA 2VV6A 3CLOA 4UQIS 3LIEA 4NEED 4GLQA 3UMEA 1OPXA 3K3CA 2QWSA 5J7EA 1Y28A 4II7A 1TS6A 4ETZA 4WEKA 1VHMA 2Z6DA 2GNXA 5J4EA 2OWJA 2J80A 2QJ5A 3PBQA 5F68A 3E4OA 4EESA 3ICYA 3S7OA 2Y8HA 4EXOA 3T4QA 1TD5A 1OTIA 3E0YA 3F1OB 3HJIA 1DP9A 4MDZA 3EGXC 2KX6A 4G3KA 2OWHA 5HDSA 3LR0A 2NUTC 4Y5FA 5EFWA 3LFVA 3TE8A 2EA9A 4KUOA 1GSVA 2LB9A 1S1YA 2R78A 3OC2A 4Z1WA 2Z6CA 5AVFA 2V1BA 5G4YA 2ZMFA 2IA2A 3OCNA 3TJZC 4ARZB 4O01A 2NUPC 1H8MA 3OOVA 2Y79A 3KX0X 3VE4A 4HHDA 1LL8A 2W0NA 4LRZE 3PBTA 3O5YA 4EERA 4CLCD 1YSPA 2M7VA 3IS2A 4LPZA 4HP9A 1F98A 3BQ8A 2XRNA 3IBJA 4HH3A 2VV7A 4YNRA 4WL9A 5DJUA 1T1AA 2W1TB 1N9LA 4YWZA 1OTAA 4CQHA 2VX8A 2WKPA 3EEHA 3H82A 3SW1A 2CMNA 3T4TA 4HJ4A 3A0SA 2ZOIA 1S1ZA 2VA0A 3LIDA 3MXQA 1ODVA 1XJ4A 2PT7A 1STZA 2QJ7A 3UB9A 2B18A 3MQQA 1G6OA 2ZOHA 2WKQA 3EOIA 1TS7A 2W3GA 1T18A 2VGLM 4EQ1A 1UWNX 5K5BA 5DJTA 1ZHHB 4IJGA 4PHTA 3LIFA 4UQIM 5TBMA 2P7JA 4DJ2A 5HD3A 1XFQA 1P97A 1T19A 3UE6A 3H7WA 1T1BA 5DKKA 1OJGA 3LR3A 3W2ZA 4BMWA 2V0WA 2VKSA 2JKTM 4K08A 4R3AA 1P0ZA 2W27A 3CUEA 2D02A 4P6ZS 3TRCA 4GJ4A 4EETB 4FSFA 2V9AA 3NOTC 4L0LA 3LIAA 2PDRA 4IHQA 2P08A 1H3QA 2FZ0A 3FPWA 5HL6A 4KQDA 3IS2B 2L1MA 2W3FA 3EQVA 2OAP1 5LBRA 1S66L 4RQ9A 5HPIA 4JGPA 5L8MA 2PR5A 4Y3IA 3H9WA 4DN0A 3BY8A 3H82B 2V1AA 2PD8A 4I3IA 4CLCE 1S4SA 3RFBA 2OOLA 4ME4A 5HZHA 3UB7A 3LR4A 2M7UA 4HOIA 2QYBA 3MFXA 4WF0A 3K3DA 4FOFA 4JGQA 2VJWA 2K7SA 1OTBA 2A24A 1NLZA 3E4PA 4NXBA 5DF9A 2I9VA 2KDKA 4I38A 4CLCA 3VOLA 3F1NA 4Q0IA 3MMHA 4F3LA 3C30A 1DP8A 3VV4A 2K2NA 2J3TD 1XJ3A 3NOUC 1TS8A 4WUJA 1MZUA 4AFIA 2GZAA 3KO6A 5TBMB 3KSIA 4LLOB 3P7NA 3KSGA 3LICA 4WELA 4L9GA 1XJ2A 4I3AA 3R4KA 1NRJA 2QHKA 3DBAA 4E04A 3H7WB 3LUQA 2XA7S 4H6JA 3B42A 5TJJA 2W3HA 4M4XA 3B47A 2YKFA 5J3WA 1P9RA 3OLOA 3D3OA 4BBUA 3BWLA 3GECA 5KSHA 2V0UA 3T4LA 4HJ6A 4IUKA 2GX5A 1LSVA 3T4OA 4XT2A 5F69A 1YSQA 2FH5A 5DFXA 3MJQA 1XJ6A 4ZRRA 4BJPA 2HJEA 1GSWA 2O0YA 3S7PA 4P6ZM 1IFQA 3C8CA 3RTYA 1UGUA 1ZTUA 4HQAA 3S7NA 4BBTA 3LYXA 5DFYA 3PBNA 4HJ3A 4NXEA 5AVEA 5AJGA 2XROA 2WKRA 4Q0JA 2HGVA 2O9AA 4GW9A 4NXFA 4HH2A 3R7WA 4QPRA 1OTDA 2KOIA 3F1PA 1N9OA 3NOPC 4IUHA 4GHIA 4EUVA 4EEPA 4MN5A 2M1CA 3LIBA 3IBRA 1TS0A 1OJ5A 2EWVA 2A24B 5DKLA 4PKYG 3C2WA 5HDDA 2H28A 2O9BA 3UE3A 2HF6A 3EQUA 1MC0A 4CLCB 4HP4A 3F1NB 3BW6A 4O8GA 1KOUA 2PD7A 4F3LB 3KYZA 3MR0A 4HY8A 2W3EA 2B02A 4GS9A 2KLIA 3T50A 4R6LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H6J B;  5G4Z A;  4KUK A;  4DJ3 A;  3A0V A;  3UB6 A;  1GSX A;  5IU1 A;  1LSW A;  4XT2 B;  4NXG A;  3FC7 A;  2ZBB A;  5HSQ A;  3MQO A;  2JHE A;  1OTE A;  5HWT A;  4I5S A;  4GCZ A;  1D7E A;  5HD5 A;  4PKY A;  2INW A;  1VB6 A;  1G28 A;  4EEU A;  1OT9 A;  4WLA A;  2PYR A;  3F1P B;  1OT6 A;  4GHI B;  4JGO A;  2QKP A;  3NJA A;  5HWV A;  1DP6 A;  1V9Z A;  3BY9 A;  1XFN A;  4B9O A;  5IS1 A;  3CAX A;  4HI4 A;  3PYP A;  2VEA A;  3NHQ A;  4GS9 B;  2JN7 A;  2PR6 A;  1S4R A;  4LRX C;  3UMD A;  4LRY C;  1DRM A;  1X0O A;  1EW0 A;  5A8B A;  4HNB A;  3PHY A;  4R70 A;  3CWF A;  5HDC A;  4I3J A;  3LI8 A;  3E4Q A;  5F5Y A;  1F9I A;  1V9Y A;  1S67 L;  2PYP A;  3VE3 A;  3G6O A;  2GJ3 A;  4I39 A;  3F1O A;  4EW7 A;  2PHY A;  2L4R A;  1JNU A;  3ULF A;  3EWK A;  1D06 A;  3ZQ5 A;  1N9N A;  3LI9 A;  5I5L A;  3HJK A;  3UB8 A;  5F6A A;  2VLG A;  3B33 A;  1UWP X;  3D72 A;  2HV1 A;  4BBV A;  2L0W A;  4L9F A;  4L9E A;  5KIZ A;  1BYW A;  1WA9 A;  2BAS A;  3A0R A;  3FG8 A;  5HWW A;  3GDI A;  4HIA A;  3RH8 B;  4WN5 A;  1LT0 A;  1NWZ A;  2VV8 A;  1T1C A;  4MN6 A;  2YKH A;  4R38 A;  1LSX A;  2D01 A;  4JGR A;  2VV6 A;  3CLO A;  3LIE A;  3UME A;  3K3C A;  2QWS A;  5J7E A;  1Y28 A;  1TS6 A;  2Z6D A;  5J4E A;  2OWJ A;  2J80 A;  2QJ5 A;  5F68 A;  3E4O A;  4EES A;  3ICY A;  4EXO A;  1OTI A;  3F1O B;  3HJI A;  1DP9 A;  2KX6 A;  2OWH A;  5HDS A;  5EFW A;  2EA9 A;  4KUO A;  1GSV A;  1S1Y A;  2R78 A;  2Z6C A;  5AVF A;  2V1B A;  5G4Y A;  3KX0 X;  3VE4 A;  4HHD A;  1LL8 A;  2W0N A;  4LRZ E;  4EER A;  3IS2 A;  4LPZ A;  4HP9 A;  1F98 A;  4HH3 A;  2VV7 A;  4WL9 A;  5DJU A;  1T1A A;  1N9L A;  4YWZ A;  1OTA A;  3EEH A;  2WKP A;  3H82 A;  3SW1 A;  2CMN A;  4HJ4 A;  3A0S A;  2ZOI A;  1S1Z A;  3LID A;  3MXQ A;  1ODV A;  1XJ4 A;  3UB9 A;  2QJ7 A;  3MQQ A;  2ZOH A;  2WKQ A;  1TS7 A;  1T18 A;  4EQ1 A;  1UWN X;  5DJT A;  3LIF A;  5TBM A;  2P7J A;  4DJ2 A;  5HD3 A;  1XFQ A;  1P97 A;  1T19 A;  3UE6 A;  3H7W A;  1T1B A;  5DKK A;  1OJG A;  2V0W A;  4K08 A;  4R3A A;  1P0Z A;  2W27 A;  2D02 A;  4EET B;  2V9A A;  3NOT C;  3LIA A;  2PDR A;  4KQD A;  3IS2 B;  2L1M A;  1S66 L;  4RQ9 A;  4JGP A;  2PR5 A;  3H9W A;  3BY8 A;  3H82 B;  2V1A A;  2PD8 A;  4I3I A;  1S4S A;  2OOL A;  5HZH A;  3UB7 A;  4HOI A;  3MFX A;  4WF0 A;  3K3D A;  4JGQ A;  2K7S A;  1OTB A;  2A24 A;  3E4P A;  4NXB A;  2I9V A;  2KDK A;  4I38 A;  3VOL A;  3F1N A;  4F3L A;  1DP8 A;  1XJ3 A;  3NOU C;  1TS8 A;  4WUJ A;  1MZU A;  5TBM B;  4LLO B;  3P7N A;  3LIC A;  4L9G A;  1XJ2 A;  4I3A A;  4E04 A;  2QHK A;  3H7W B;  3LUQ A;  4H6J A;  4M4X A;  2YKF A;  5J3W A;  3OLO A;  4BBU A;  3BWL A;  3GEC A;  2V0U A;  4HJ6 A;  1LSV A;  4XT2 A;  5F69 A;  3MJQ A;  1XJ6 A;  1GSW A;  3C8C A;  3RTY A;  1UGU A;  4HQA A;  4BBT A;  3LYX A;  4HJ3 A;  4NXE A;  5AVE A;  2WKR A;  4GW9 A;  4NXF A;  4HH2 A;  1OTD A;  3F1P A;  1N9O A;  3NOP C;  4GHI A;  4EEP A;  4MN5 A;  2M1C A;  3LIB A;  3IBR A;  1TS0 A;  1OJ5 A;  5DKL A;  2A24 B;  4PKY G;  3C2W A;  5HDD A;  2H28 A;  4HP4 A;  3F1N B;  1KOU A;  2PD7 A;  4F3L B;  3MR0 A;  4HY8 A;  2B02 A;  4GS9 A;  3T50 A;  4R6L A; 
#chains in the Genus database with same CATH topology
 4H6J B;  4OKP A;  2LB5 A;  3A0V A;  4EU0 A;  2OAQ 1;  2XK1 A;  3QP4 A;  5CTN A;  3D9Y A;  2P9V A;  2ZMA A;  4PM7 A;  3CJM A;  4XXR A;  2O99 A;  5FAS A;  1LSW A;  2J7V A;  5CGS A;  1SCW A;  4N9L A;  2ZQD A;  5BOH A;  2WAD A;  1K6S A;  4NKP A;  2Y2H A;  2G7U A;  3O3V A;  2XA7 M;  4Y2F A;  3LEQ A;  4I5S A;  3PAE A;  1XP4 A;  4GCZ A;  1Y54 A;  3OBF A;  3IF6 A;  2PU4 A;  2Y2J A;  4KZ8 A;  1CJF A;  1TF1 A;  1OT9 A;  4Y7P A;  3MFD A;  5CED A;  3QP2 A;  3R7W B;  3F1P B;  2WGI A;  3BRM A;  2QKP A;  4BWI A;  3SS4 A;  2OSU A;  3NDE A;  1U60 A;  5F82 A;  3QNB A;  4P0M A;  1ERM A;  4S2I A;  3TW8 A;  1L0G A;  5IS1 A;  1BUL A;  1WYB A;  4IBX A;  3CMZ A;  2HDR A;  4KQR A;  5JYO A;  4E3L A;  1YLJ A;  1H8Z A;  2JN7 A;  1RGY A;  5CEC A;  4LRX C;  2ZC3 B;  1ES5 A;  4LRY C;  3NI9 A;  1FCO A;  3BYD A;  3C5A A;  3PHY A;  4R70 A;  3CWF A;  5HDC A;  3G34 A;  2PRF A;  3KSH A;  1V9Y A;  4E6W A;  2PYP A;  1YLT A;  3PR6 A;  2GJ3 A;  5CER A;  3NC8 A;  1W63 M;  4DMZ A;  3EWK A;  4K91 A;  5FL3 A;  3DAV A;  5HW3 A;  3V67 A;  3ZYT A;  4DXC A;  3LI9 A;  3Q07 A;  2UV0 E;  1PW8 A;  2EX8 A;  3D72 A;  2ZQC A;  2HV1 A;  4BBV A;  1O07 A;  4L9E A;  1HZO A;  2Y91 A;  1FIK A;  3V39 A;  1WA9 A;  5HWW A;  4X1M A;  5C5K A;  2XLN A;  1NWZ A;  2Y2K A;  4H8R A;  1KDS A;  1T1C A;  2YKH A;  3ZG9 B;  1F5M A;  3UB5 P;  1YLY A;  2VGL S;  4B93 A;  3UPO A;  4UQI S;  3UME A;  4QB8 A;  1OPX A;  2QWS A;  1ZG4 A;  1TS6 A;  4ETZ A;  4WEK A;  3W4P A;  4QWO A;  2GNX A;  3AGE A;  1G6A A;  5J4E A;  3PBQ A;  5F68 A;  2ZQ8 A;  3GMW A;  1MKI A;  2Y8H A;  2BLS A;  4EXO A;  5TFQ A;  1CI9 A;  3HJI A;  2B5R A;  2Q9N A;  3VSL A;  1H8Y A;  2KX6 A;  2OWH A;  5DF7 A;  2NUT C;  3LFV A;  2EA9 A;  1XGJ A;  2Z6C A;  1FSY A;  2V1B A;  1XPB A;  4D2O A;  5AQ7 A;  2IA2 A;  3HUO A;  2Y79 A;  3KX0 X;  2OLU A;  1LL8 A;  1L3L A;  3O88 A;  2H0T A;  1C3B A;  3MS6 A;  3KYE A;  3HLD A;  1YLW A;  1IYO A;  4JXW A;  2XRN A;  1L2S A;  2PBD P;  4X55 A;  1PI4 A;  3Q7V A;  4RA7 A;  4WL9 A;  2W1T B;  2CMN A;  3T4T A;  4HJ4 A;  5EVE A;  5CHM A;  4MNR A;  4Q8I A;  3IWO A;  1Z6F A;  5GLD A;  4WBG A;  3WS4 A;  1ODV A;  3N8R A;  5EUA A;  1STZ A;  2QJ7 A;  4DRT A;  1G6O A;  2WKQ A;  4B4Z A;  3EOI A;  2EXB A;  4R3J A;  1CEG A;  5FAO A;  5TBM A;  1XFQ A;  1EI5 A;  2EX9 A;  1T1B A;  1SKF A;  1OJG A;  3LR3 A;  3A3J A;  3W2Z A;  2V0W A;  4K08 A;  4R3A A;  1ES3 A;  4LCM A;  1HTZ A;  5FQ9 A;  5GLA A;  3AGD A;  5FI7 A;  3NOT C;  4L0L A;  3LIA A;  5CHJ A;  4IHQ A;  4GDN A;  2P08 A;  3MKE A;  3FPW A;  1S6R A;  1BLP A;  1LL9 A;  3EQV A;  3MBZ A;  2XQZ A;  3VMA A;  1CEF A;  1S66 L;  2CC1 A;  3MXR A;  3M2J A;  4KG6 A;  3M6H A;  3H9W A;  4DN0 A;  3H82 B;  1GHM A;  4CLC E;  1S4S A;  3RFB A;  2M7U A;  2WZZ A;  4HOI A;  4N1X A;  3K3D A;  5JYP A;  4HES A;  2JKF A;  5E2F A;  1ZKJ A;  4NXB A;  2WZX A;  5DF9 A;  4Y0U A;  3FKV A;  4CLC A;  4X53 A;  3F1N A;  3DTE A;  2C6W B;  3MMH A;  4LV1 A;  4BD1 A;  3VV4 A;  1JWZ A;  1XJ3 A;  2R9W A;  5J8X A;  4I3A A;  2QHK A;  4OQ0 A;  4GD6 A;  1XGI A;  4CJN A;  2XA7 S;  4X68 A;  4M4X A;  4WZ5 A;  3OLO A;  4BBU A;  5KSH A;  4IVK A;  4R3B A;  4HJ6 A;  1D1J A;  2GX5 A;  3ZG5 A;  5KMW A;  4XT2 A;  1VET A;  2XD5 A;  2FH5 A;  5FDH A;  3MJQ A;  1CI8 A;  4BEN A;  5EOE A;  3PAG A;  3IH9 A;  2HPB A;  4Y0T A;  2V8F A;  2O0Y A;  5HAP A;  3S7P A;  1AWI A;  1MBL A;  3C8C A;  3GV9 A;  1UGU A;  1ZTU A;  4HQA A;  1FCM A;  1MWR A;  1PFL A;  1E25 A;  1GCE A;  1NYM A;  4S2M A;  5AVE A;  2RCX A;  4QJG A;  2HGV A;  3WS0 A;  4Y0O A;  1TDG A;  4GHI A;  3HLW A;  4MN5 A;  2M1C A;  2EWV A;  2XFT A;  3W8K A;  3C2W A;  1HVB A;  2O9B A;  3UE3 A;  3BLS A;  3EQU A;  4HP4 A;  2EFX A;  3BW6 A;  2QMI A;  4O8G A;  1E3U A;  1BLH A;  4UHU A;  3KYZ A;  5AQB A;  2A3U A;  2X02 A;  5KSC A;  3UDX A;  2W3E A;  2B02 A;  3RJU A;  3FYZ A;  5A91 A;  4WMC D;  3NDG A;  1W79 A;  1LI9 A;  3IHB A;  3UY6 A;  2ZC7 A;  4R6L A;  4G3V A;  1NZO A;  4YOF A;  5G4Z A;  1PWC A;  3N8S A;  3PTE A;  3BJN A;  5FAP A;  2E8I A;  1KDW A;  2WGV A;  1M40 A;  2VK3 A;  5FQJ A;  5IU1 A;  1SZV A;  3CUE C;  4C3Q A;  5IT5 A;  3A3F A;  3QP8 A;  1BTL A;  2Y2G A;  4DDS A;  2W1R A;  3T4J A;  3A3I A;  1DY6 A;  5F1F A;  5HSQ A;  2K31 A;  4Q0H A;  2RL3 A;  3LCE A;  2JCH A;  2INW A;  1Z09 A;  2ZL1 A;  4OPQ A;  2IWB A;  3FKW A;  2PYR A;  4UEY A;  4NK3 A;  2XD1 A;  2DMW A;  5HWV A;  1DP6 A;  3BY9 A;  2A2L A;  2J3T C;  1PI5 A;  3KSF A;  4WEJ A;  4NG2 A;  3NUL A;  4B9O A;  2JC7 A;  3CAX A;  3PYP A;  3ZG7 B;  1QME A;  1NLY A;  5HFO A;  3ZG0 A;  4GS9 B;  1IOU A;  2PR6 A;  3ZCZ A;  1FR1 A;  4ID4 A;  3OPR A;  1DRM A;  1X0O A;  3C7V A;  3PBR A;  1EW0 A;  2H10 A;  5A8B A;  3EGD C;  3UDI A;  2P9V B;  4I3J A;  3CG5 A;  2P04 A;  3TSG A;  3OCL A;  1GHI A;  5KZH A;  1KE3 A;  3G6O A;  4EWF A;  1ES4 A;  3LEZ A;  3CI6 A;  2L4R A;  1JNU A;  3ULF A;  4LCL A;  3ZGA B;  1D06 A;  3HLE A;  1RP5 A;  3ZVW A;  1N9N A;  3ITA A;  3UB8 A;  1H5X A;  3IF6 B;  5A92 A;  1ACF A;  3L9K A;  1JWV A;  3B33 A;  2L0W A;  4PAU A;  3LGO A;  3AGF A;  3LY4 A;  4X6T A;  2MJ6 A;  1BYW A;  3W4Q A;  3FG8 A;  2IWC A;  1W63 Q;  1XKZ A;  2XDM A;  3BEC A;  3FPV A;  3GDI A;  4S2N C;  1N9B A;  3M6B A;  3IXH A;  4DF6 A;  3ZDJ A;  2WUQ A;  1LT0 A;  3T1Q B;  4DE3 A;  2EWW A;  4X69 A;  3V3S A;  4GD8 A;  2FFY A;  1KVM A;  4ESP A;  2XEP A;  3HCY A;  5L09 A;  2DRW A;  4KQO A;  4JGR A;  4R0Q A;  1W8Y A;  3LIE A;  4GLQ A;  3K3C A;  3MZE A;  5J7E A;  1Y28 A;  4II7 A;  1VQQ A;  1K4E A;  2J80 A;  4KZ6 A;  4YIN A;  3S7O A;  1PWG A;  4OPY A;  3VP2 A;  3HLF A;  2PAV P;  1OTI A;  3ZFZ A;  1DP9 A;  1K57 A;  1VM1 A;  3LR0 A;  1KE4 A;  1PWD A;  3GSG A;  2LB9 A;  3OC2 A;  5GHX A;  2J9P A;  5AVF A;  4O01 A;  3IXG A;  2NUP C;  3OOV A;  3IF6 C;  3SH8 A;  2W0N A;  1JTD A;  5EPH A;  3O5Y A;  3MZD A;  3Q81 A;  3SS3 A;  4MBH A;  4OPR A;  4CLC D;  1YSP A;  1O7E A;  3IS2 A;  3IBJ A;  1F2K A;  3T12 B;  4Y15 A;  3T1R A;  4CQH A;  3SW1 A;  2QPN A;  3C4O A;  2VGK A;  1XXM A;  2XFS A;  1XA1 A;  2XF3 A;  4OPZ A;  1GHP A;  2C5W B;  3CHW P;  2QZ6 A;  4E3N A;  4Y13 A;  1XJ4 A;  4K0X A;  3G4P A;  2ZQ9 A;  3UB9 A;  2B18 A;  3MQQ A;  3ZNT A;  1FQG A;  2Y2P A;  3N8L A;  5DJT A;  2P7J A;  4DJ2 A;  1P97 A;  4E3J A;  3VOZ A;  5HX9 A;  5EVL A;  2Y2I A;  3H7W A;  5L10 A;  3ZHH A;  2VKS A;  3ISG A;  2JKG A;  3IWI A;  3HRE A;  4N9K A;  4GJ4 A;  3LY3 A;  4FSF A;  1YLP A;  2PDR A;  5U47 A;  4KQD A;  1KGF A;  4EBP A;  5FEG A;  2L1M A;  5AQ9 A;  1E3U D;  1DJA A;  1IYP A;  4QU3 A;  3VOY A;  5HPI A;  2HP5 A;  3Q7V B;  4YFM A;  4Y3I A;  2UWX A;  2V1A A;  2PD8 A;  3MZF A;  3V3R A;  5D3O A;  2OOL A;  4X25 A;  4ME4 A;  5HZH A;  3LR4 A;  2QYB A;  2I72 A;  3JYI A;  4JGQ A;  3S22 A;  4JF6 A;  2AVX A;  2DNS A;  2VJW A;  1NJ4 A;  5E2E A;  2WKI A;  4OP8 A;  1NLZ A;  3E2K A;  2WKH A;  2KDK A;  4I38 A;  3VOL A;  4JF5 A;  5EOO A;  2G2W A;  4EBL A;  4XUX A;  4F3L A;  4BQM A;  2K2N A;  2J3T D;  3NOU C;  4IBR A;  4JBF A;  1YT4 A;  4AFI A;  5TBM B;  4R23 A;  4WEL A;  3VSK A;  4L9G A;  1XJ2 A;  4E04 A;  3A3D A;  4JKT A;  4DE2 A;  5E2G A;  3CPT B;  3B47 A;  5J3W A;  1P9R A;  3GEC A;  2V0U A;  2ZM2 A;  4OLG A;  3UPN A;  4S2J A;  2WKE A;  3ZNY A;  3E2L A;  1YSQ A;  4LFU A;  1FIL A;  5DTK A;  5FQQ A;  3W4O A;  4ZRR A;  5EEC A;  2ZD8 A;  4BJP A;  3BM6 A;  2DCF A;  3RTY A;  4BBT A;  2EX2 A;  5DFY A;  4PM9 A;  2Q9M A;  2Z2M B;  4KZA A;  4WZ4 A;  5EM1 A;  4DDY A;  4QPR A;  1OTD A;  1N9O A;  4IUH A;  4WYY A;  3HBR A;  3D4F A;  3LIB A;  4O7D A;  5DKL A;  4PKY G;  2H28 A;  3CPT A;  5DTT A;  1MC0 A;  4CLC B;  5M18 A;  3F1N B;  1KOU A;  2PD7 A;  4F94 A;  3GQZ A;  4HY8 A;  1KGE A;  3NY4 A;  5A90 A;  3FWL A;  3CZD A;  5DVA A;  1IEM A;  4KUK A;  1FSW A;  3HUN A;  3UB6 A;  3G32 A;  3VP1 A;  4PM5 A;  2O9C A;  2V8C A;  1VET B;  4XT2 B;  4NXG A;  4DXB A;  5CRF A;  4N1H A;  4E6X A;  2EFU A;  2BG1 A;  3U2A A;  3QNC A;  2Y2L A;  3FC7 A;  2ZBB A;  3HLG A;  3MQO A;  4JLF A;  5A93 A;  4ZDX A;  1K38 A;  1D7E A;  3T4S A;  4OOL A;  5HD5 A;  2PBY A;  4PKY A;  4PM8 A;  1VB6 A;  4IED A;  3RXX A;  2XSS A;  4WLA A;  3GTC A;  2XGN A;  4GZB A;  1OT6 A;  4GHI B;  3S4X A;  3NJA A;  3S7Q A;  3C38 A;  3IHA A;  4KQQ A;  4X1L A;  4BL2 A;  1Q2P A;  3V5M A;  2W3D A;  4U0T A;  4JXS A;  2Y55 A;  1TEM A;  1MWS A;  2HP9 A;  3GRJ A;  3BFE A;  1I2W A;  4HI4 A;  4KG2 A;  4CLC C;  2VEA A;  2WGW A;  4OOY A;  1S4R A;  3UMD A;  1MKM A;  4A5R A;  1PNE A;  4ETX A;  5GHZ A;  3WWX A;  3HLC A;  2ZC5 B;  3LI8 A;  2E8J A;  1F9I A;  1IYQ A;  3PBS A;  4WZ5 C;  3IQA A;  3VE3 A;  2ACG A;  3NIA A;  5HAR A;  3F1O A;  4EW7 A;  2PHY A;  4MLL A;  3WS5 A;  3E98 A;  3LO7 A;  4NET A;  1P9W A;  3ZQ5 A;  1DJB A;  3PXP A;  1CK3 A;  5AQA A;  5I5L A;  3HJK A;  5F6A A;  5FDS A;  3C7U A;  4QY5 A;  2Y59 A;  2ZL1 B;  4ARZ A;  2XR0 A;  4L9F A;  1ZG6 A;  4DKI A;  2EX6 A;  1GA9 A;  2BAS A;  3A0R A;  2EXA A;  3BQA A;  3WS2 A;  1YM1 A;  3BFF A;  2V2F F;  3N4I A;  2XH9 A;  3DTI A;  2VZW A;  1VEU A;  3RH8 B;  4WN5 A;  3MSH A;  2VV8 A;  5FAQ A;  3JVU A;  5MC7 A;  2JKR M;  3SOI A;  3LR5 A;  3M2K A;  3Q7Z A;  5CX7 A;  1WE4 A;  2VV6 A;  3CLO A;  4LEN A;  4NEE D;  4QD4 A;  1SDE A;  3Q1F A;  4FUW A;  2Z6D A;  3BLM A;  4LV3 A;  3E4O A;  3G30 A;  1W7F A;  3ICY A;  3T4Q A;  3E0Y A;  1MXO A;  4G3K A;  4ZBE A;  4Y5F A;  3TE8 A;  5EVI A;  2HDQ A;  1GSV A;  2R78 A;  1K55 A;  1KVL A;  5G4Y A;  2ZMF A;  5HAQ A;  3OCN A;  3TJZ C;  3IX8 A;  1H8M A;  3VE4 A;  3IH8 A;  3U4L P;  3MKF A;  5EM0 A;  1LL5 A;  4LPZ A;  4OQH A;  1F98 A;  4HH3 A;  5EVI C;  4YNR A;  2Y2N A;  5DJU A;  1TVF A;  1N9L A;  4YWZ A;  1N4O A;  1OTA A;  3EEH A;  1ESI A;  4HEF A;  1PIO A;  2WAE A;  2ZC6 B;  4GDB A;  4P6B A;  3A0S A;  2ZOI A;  3G2Z A;  1KGG A;  4B4X A;  1G68 A;  4OQG A;  5IHV A;  4ZJ2 A;  3MXQ A;  3FV7 A;  1HLU P;  4RVA A;  5EE8 A;  1YLZ A;  2ZOH A;  1TS7 A;  2W3G A;  3O86 A;  1XX2 A;  1T18 A;  4EQ1 A;  1UWN X;  1ZHH B;  3I7J A;  4Y17 A;  4IJG A;  4PHT A;  3LIF A;  5HD3 A;  3ITB A;  1T19 A;  3QHY A;  3UE6 A;  1NZU A;  4JXG A;  5DKK A;  5L07 A;  4N92 A;  2JKT M;  4E3O A;  4OLD A;  1QMF A;  3UDF A;  4EET B;  3HL9 A;  1JVJ A;  2V9A A;  4FD8 A;  1MY8 A;  1WYC A;  1H3Q A;  1K56 A;  3DWZ A;  1NYY A;  3IS2 B;  4EV4 A;  2OAP 1;  4RX3 A;  5LBR A;  2OLV A;  3JPU A;  4JGP A;  5L8M A;  4HBT A;  3IF5 A;  2PR5 A;  4BLM A;  3UN7 A;  4KZ3 A;  3BY8 A;  2ZQ7 A;  5GHY A;  4MBK A;  3HUM A;  4I3I A;  4WM9 A;  3P09 A;  4LV0 A;  1W8Q A;  4BL3 A;  2HP6 A;  4CPK A;  5FQK A;  2K7S A;  3TG9 A;  2HDU A;  2A24 A;  3T1S A;  3HLB A;  1L0E A;  4PPR A;  1DP8 A;  1K54 A;  1TS8 A;  2Y2O A;  5GLB A;  2G2U A;  5L2F A;  3DBA A;  3UNW A;  1OME A;  3H7W B;  3LUQ A;  1K57 C;  4RX2 A;  5FQI A;  4H6J A;  3SS5 A;  2A49 A;  5TJJ A;  4ZTK A;  2YKF A;  4OQI A;  2ZM8 A;  3T4L A;  2GDN A;  3V50 A;  4KEN B;  3T4O A;  1K54 C;  4C6Y A;  4EBN A;  1XJ6 A;  4OP5 A;  2HJE A;  1ZC2 A;  1MPL A;  1GSW A;  4P6Z M;  1IFQ A;  5F83 A;  3TOI A;  3LYX A;  1L0D A;  4JF4 A;  4HJ3 A;  4NXE A;  4KZ7 A;  1J3W A;  2XRO A;  2WKR A;  3IX4 A;  4FH2 A;  4Q0J A;  3R7W A;  4NXF A;  4HH2 A;  3F1P A;  3NOP C;  3BFD A;  1LHY A;  4EUV A;  1PYY A;  4EEP A;  1Y4O A;  3GVB A;  1E4D A;  1OJ5 A;  1JWP A;  1ONH A;  2X71 A;  5FI2 A;  4UA9 A;  4WMC A;  5HDD A;  4IVI A;  1LI0 A;  4DE0 A;  3N7W A;  2JE5 A;  3BFG A;  1NRF A;  4F3L B;  4QHC A;  1ESU A;  1YMS A;  3MR0 A;  3S1Y A;  4R4R A;  2KLI A;  2IWD A;  1NY0 A;  4DJ3 A;  2ZC4 B;  2H0Y A;  3CIT A;  3G31 A;  1ONG A;  4O0P A;  1GSX A;  5DF8 A;  4ZAM A;  2Y2M A;  1MWU A;  2ZLY A;  2JKR I;  4OOM A;  2JHE A;  1OTE A;  3OPH A;  3K2N A;  2J3W A;  4XUZ A;  5HWT A;  5FAT A;  3PBO A;  4FTX A;  1G28 A;  5CGX A;  4EEU A;  3VP0 A;  1BLC A;  4OVD A;  5FEF A;  5FSR A;  1YAX A;  3OZH A;  4GNU A;  4JGO A;  4MN7 A;  3OPL A;  3NBL A;  4P87 A;  5FI6 A;  1HD8 A;  1V9Z A;  4U3T A;  4B88 A;  3UPP A;  4ZJ3 A;  1PW1 A;  4MBF A;  1I2S A;  1XFN A;  4PMA A;  3DWK A;  5EVI D;  2HZ5 A;  5HPF A;  3NHQ A;  5M1A A;  2JBF A;  1PZO A;  4MMN A;  3MF0 A;  4KZB A;  4HNB A;  4GN2 A;  3IXD A;  3P01 A;  5M19 A;  2B95 A;  4S2L A;  4KZ5 A;  3E4Q A;  5F5Y A;  1S67 L;  2ZMV A;  1BUE A;  1CF0 A;  1DJC A;  4OH0 A;  4X56 A;  1YKD A;  4I39 A;  4KZ4 A;  1YPR A;  1IYS A;  2ZQA A;  3VFF A;  5CXW A;  3IT9 A;  4FCF A;  4Z9Q A;  1K4F A;  2VLG A;  4U0X A;  1UWP X;  5TGF A;  5F1G A;  2WK0 A;  5KIZ A;  3IXB A;  3IX3 A;  4G3W A;  3SH7 A;  3ZVT A;  5FQM A;  3NCK A;  3T4K A;  5CGW A;  3MQ0 A;  4HIA A;  3WRT A;  4JPM A;  5I94 A;  3KYQ A;  4UA7 A;  4MN6 A;  4MCW A;  1ALQ A;  1SKO B;  2W1T A;  5CHU A;  1BZA A;  3JVV A;  2JKT I;  4R38 A;  3EEA A;  2X01 A;  1H0M A;  4QY6 A;  2HJ9 C;  1LSX A;  2D01 A;  3N6I A;  1CQA A;  1PRQ A;  2WGW B;  1IEL A;  5EV0 A;  1K25 A;  3SH9 A;  1J9M A;  5DTS A;  1VHM A;  4GKU A;  1RGZ A;  3HVF A;  2OWJ A;  2QJ5 A;  4DE1 A;  1ERQ A;  4D60 A;  4EES A;  1ERO A;  2FFF B;  1K56 D;  3QP6 A;  1TD5 A;  3F1O B;  4MDZ A;  3EGX C;  5HDS A;  5EFW A;  3VFH A;  3UE0 A;  5E2H A;  4KUO A;  1S1Y A;  4Z1W A;  2ZJ9 A;  4RYE A;  4ARZ B;  1PZP A;  1SKO A;  5HL1 A;  3Q82 A;  3DTK A;  4HHD A;  4K0W A;  1LLB A;  4LRZ E;  4M3K A;  2Y4A A;  4GB7 A;  2Y2Q A;  3PBT A;  1KE0 A;  3VP4 A;  4EER A;  2M7V A;  4P85 A;  4HP9 A;  1VEU B;  3BQ8 A;  2H5S A;  5GLC A;  2VGJ A;  4E3K A;  2VV7 A;  1K6R A;  1T1A A;  3C4P A;  2VX8 A;  2WKP A;  2WYX A;  3H82 A;  1K0K A;  4C75 A;  1S1Z A;  2VA0 A;  2BTF P;  3LID A;  1FR6 A;  3IWQ A;  2ZM0 A;  3A3E A;  1EWZ A;  3P98 A;  1IKG A;  2PT7 A;  5FA7 A;  1SHV A;  1IKI A;  3O87 A;  4FH4 A;  5GL9 A;  2VGL M;  5K5B A;  3QP1 A;  4UQI M;  2Q0O A;  4R4S A;  4KG5 A;  1A0K A;  3ZG8 B;  5EVI B;  4BMW A;  1W5D A;  3GR2 A;  1P0Z A;  2W27 A;  3CUE A;  2D02 A;  4P6Z S;  3TRC A;  1ES2 A;  5CTM A;  2FZ0 A;  4MEZ A;  5HL6 A;  2P74 A;  2V20 A;  3SZT A;  1SDN A;  3G2Y A;  1JTG A;  1S0W A;  5HAI A;  2W3F A;  3BEB A;  2PU2 A;  2R9X A;  4RQ9 A;  1MWT A;  3OPP A;  1BLS A;  1FOF A;  2WAF A;  3UB7 A;  2Z2L B;  4JXV A;  3MFX A;  4WF0 A;  1XA7 A;  4FOF A;  1YQS A;  4S2O A;  5CEB A;  1FCN A;  1OTB A;  4R1G A;  3WRZ A;  1L0F A;  1M6K A;  3E4P A;  2I9V A;  4Q0I A;  3DW0 A;  1BSG A;  3WS1 A;  3C30 A;  4WUJ A;  1MZU A;  2GZA A;  3KO6 A;  3NEC A;  2HDS A;  3KSI A;  4LLO B;  3P7N A;  1NXY A;  3KSG A;  3LIC A;  4HBU A;  3B3X A;  3R4K A;  1NRJ A;  4LGW A;  1G5U A;  3B42 A;  4E3M A;  2W3H A;  4E3I A;  4LV2 A;  3D3O A;  4UAA A;  3BWL A;  4EUZ A;  1K55 C;  2V1Z A;  4PM6 A;  4IUK A;  5TR7 A;  1LSV A;  2OV5 A;  3DTM A;  5F69 A;  5DFX A;  4OON A;  1BT5 A;  3T1X A;  3FZC A;  2J9O A;  5G18 A;  3S7N A;  3PBN A;  1I5Q A;  4GOG A;  5AJG A;  3MXS A;  4S2N A;  3UE1 A;  2O9A A;  4GW9 A;  2J8Y A;  2KOI A;  3VP3 A;  3IBR A;  1TS0 A;  1TDL A;  2A24 B;  1AXB A;  1RCJ A;  3BFC A;  1GA0 A;  2HF6 A;  1Q2Q A;  4EQI A;  4ZJ1 A;  4UA6 A;  3QP5 A;  4S2K A;  4S2P A;  3RXW A;  1YMX A;  5E43 A;  3L7H A;  4GS9 A;  4BD0 A;  3T50 A;  4KZ9 A;  3G35 A;  3UO9 A; 
#chains in the Genus database with same CATH homology
 4G3V A;  4H6J B;  4YOF A;  5G4Z A;  2LB5 A;  4KUK A;  4DJ3 A;  3A0V A;  3CIT A;  4EU0 A;  3BJN A;  2OAQ 1;  3UB6 A;  4O0P A;  1GSX A;  2O99 A;  5IU1 A;  1LSW A;  3CUE C;  2O9C A;  5IT5 A;  2JKR I;  4XT2 B;  4NXG A;  2W1R A;  3T4J A;  3U2A A;  4NKP A;  3FC7 A;  2ZBB A;  5HSQ A;  3MQO A;  2G7U A;  2K31 A;  2JHE A;  1OTE A;  4OOM A;  2XA7 M;  4Q0H A;  4Y2F A;  3K2N A;  2J3W A;  5HWT A;  4I5S A;  4GCZ A;  1D7E A;  3OBF A;  3T4S A;  4OOL A;  3PBO A;  5HD5 A;  4PKY A;  2INW A;  1VB6 A;  1G28 A;  4EEU A;  1TF1 A;  1OT9 A;  2XSS A;  4WLA A;  3R7W B;  2PYR A;  4UEY A;  3F1P B;  1YAX A;  1OT6 A;  4GHI B;  2DMW A;  4JGO A;  2QKP A;  3NJA A;  4BWI A;  3S7Q A;  4MN7 A;  5HWV A;  3C38 A;  1DP6 A;  1V9Z A;  2W3D A;  3BY9 A;  2A2L A;  2J3T C;  1XFN A;  3KSF A;  3TW8 A;  4WEJ A;  4B9O A;  5IS1 A;  3CAX A;  4HI4 A;  3PYP A;  4CLC C;  2VEA A;  5HPF A;  1NLY A;  3NHQ A;  4GS9 B;  1IOU A;  2JN7 A;  2PR6 A;  1S4R A;  4LRX C;  3UMD A;  1MKM A;  4MMN A;  4LRY C;  1DRM A;  3MF0 A;  1X0O A;  3PBR A;  1EW0 A;  5A8B A;  4HNB A;  3EGD C;  3PHY A;  4R70 A;  3P01 A;  4ETX A;  3CWF A;  5HDC A;  4I3J A;  3KSH A;  2P04 A;  3LI8 A;  3E4Q A;  5F5Y A;  1F9I A;  1V9Y A;  1S67 L;  2ZMV A;  3PBS A;  2PYP A;  3OCL A;  3VE3 A;  1YKD A;  3G6O A;  3PR6 A;  2GJ3 A;  4I39 A;  3CI6 A;  3F1O A;  4EW7 A;  2PHY A;  2L4R A;  1JNU A;  1W63 M;  3ULF A;  3E98 A;  4DMZ A;  3EWK A;  1D06 A;  1P9W A;  3ZQ5 A;  5FL3 A;  3PXP A;  3V67 A;  1N9N A;  3ZYT A;  3LI9 A;  5I5L A;  3HJK A;  3UB8 A;  5F6A A;  2VLG A;  3B33 A;  1UWP X;  3D72 A;  4ARZ A;  2HV1 A;  4BBV A;  2L0W A;  4L9F A;  4PAU A;  4L9E A;  2MJ6 A;  5KIZ A;  1BYW A;  1WA9 A;  2BAS A;  3A0R A;  3FG8 A;  1W63 Q;  4G3W A;  5HWW A;  3BQA A;  3FPV A;  3GDI A;  5C5K A;  3T4K A;  3MQ0 A;  4HIA A;  2VZW A;  3RH8 B;  4WN5 A;  1LT0 A;  3KYQ A;  1NWZ A;  2EWW A;  2VV8 A;  1T1C A;  3JVU A;  5MC7 A;  2JKR M;  2YKH A;  4MN6 A;  4MCW A;  2W1T A;  3HCY A;  3JVV A;  1F5M A;  2JKT I;  4R38 A;  3LR5 A;  2VGL S;  3EEA A;  4B93 A;  4KQO A;  5CX7 A;  2HJ9 C;  1LSX A;  2D01 A;  4JGR A;  2VV6 A;  3CLO A;  4UQI S;  3LIE A;  4NEE D;  4GLQ A;  3UME A;  1OPX A;  3K3C A;  2QWS A;  5J7E A;  1Y28 A;  4II7 A;  1TS6 A;  4ETZ A;  4WEK A;  1VHM A;  2Z6D A;  2GNX A;  5J4E A;  2OWJ A;  2J80 A;  2QJ5 A;  3PBQ A;  5F68 A;  3E4O A;  4EES A;  3ICY A;  3S7O A;  2Y8H A;  4EXO A;  3T4Q A;  1TD5 A;  1OTI A;  3E0Y A;  3F1O B;  3HJI A;  1DP9 A;  4MDZ A;  3EGX C;  2KX6 A;  4G3K A;  2OWH A;  5HDS A;  3LR0 A;  2NUT C;  4Y5F A;  5EFW A;  3LFV A;  3TE8 A;  2EA9 A;  4KUO A;  1GSV A;  2LB9 A;  1S1Y A;  2R78 A;  3OC2 A;  4Z1W A;  2Z6C A;  5AVF A;  2V1B A;  5G4Y A;  2ZMF A;  2IA2 A;  3OCN A;  3TJZ C;  4ARZ B;  4O01 A;  2NUP C;  1H8M A;  3OOV A;  2Y79 A;  3KX0 X;  3VE4 A;  4HHD A;  1LL8 A;  2W0N A;  4LRZ E;  3PBT A;  3O5Y A;  4EER A;  4CLC D;  1YSP A;  2M7V A;  3IS2 A;  4LPZ A;  4HP9 A;  1F98 A;  3BQ8 A;  2XRN A;  3IBJ A;  4HH3 A;  2VV7 A;  4YNR A;  4WL9 A;  5DJU A;  1T1A A;  2W1T B;  1N9L A;  4YWZ A;  1OTA A;  4CQH A;  2VX8 A;  2WKP A;  3EEH A;  3H82 A;  3SW1 A;  2CMN A;  3T4T A;  4HJ4 A;  3A0S A;  2ZOI A;  1S1Z A;  2VA0 A;  3LID A;  3MXQ A;  1ODV A;  1XJ4 A;  2PT7 A;  1STZ A;  2QJ7 A;  3UB9 A;  2B18 A;  3MQQ A;  1G6O A;  2ZOH A;  2WKQ A;  3EOI A;  1TS7 A;  2W3G A;  1T18 A;  2VGL M;  4EQ1 A;  1UWN X;  5K5B A;  5DJT A;  1ZHH B;  4IJG A;  4PHT A;  3LIF A;  4UQI M;  5TBM A;  2P7J A;  4DJ2 A;  5HD3 A;  1XFQ A;  1P97 A;  1T19 A;  3UE6 A;  3H7W A;  1T1B A;  5DKK A;  1OJG A;  3LR3 A;  3W2Z A;  4BMW A;  2V0W A;  2VKS A;  2JKT M;  4K08 A;  4R3A A;  1P0Z A;  2W27 A;  3CUE A;  2D02 A;  4P6Z S;  3TRC A;  4GJ4 A;  4EET B;  4FSF A;  2V9A A;  3NOT C;  4L0L A;  3LIA A;  2PDR A;  4IHQ A;  2P08 A;  1H3Q A;  2FZ0 A;  3FPW A;  5HL6 A;  4KQD A;  3IS2 B;  2L1M A;  2W3F A;  3EQV A;  2OAP 1;  5LBR A;  1S66 L;  4RQ9 A;  5HPI A;  4JGP A;  5L8M A;  2PR5 A;  4Y3I A;  3H9W A;  4DN0 A;  3BY8 A;  3H82 B;  2V1A A;  2PD8 A;  4I3I A;  4CLC E;  1S4S A;  3RFB A;  2OOL A;  4ME4 A;  5HZH A;  3UB7 A;  3LR4 A;  2M7U A;  4HOI A;  2QYB A;  3MFX A;  4WF0 A;  3K3D A;  4FOF A;  4JGQ A;  2VJW A;  2K7S A;  1OTB A;  2A24 A;  1NLZ A;  3E4P A;  4NXB A;  5DF9 A;  2I9V A;  2KDK A;  4I38 A;  4CLC A;  3VOL A;  3F1N A;  4Q0I A;  3MMH A;  4F3L A;  3C30 A;  1DP8 A;  3VV4 A;  2K2N A;  2J3T D;  1XJ3 A;  3NOU C;  1TS8 A;  4WUJ A;  1MZU A;  4AFI A;  2GZA A;  3KO6 A;  5TBM B;  3KSI A;  4LLO B;  3P7N A;  3KSG A;  3LIC A;  4WEL A;  4L9G A;  1XJ2 A;  4I3A A;  3R4K A;  1NRJ A;  2QHK A;  3DBA A;  4E04 A;  3H7W B;  3LUQ A;  2XA7 S;  4H6J A;  3B42 A;  5TJJ A;  2W3H A;  4M4X A;  3B47 A;  2YKF A;  5J3W A;  1P9R A;  3OLO A;  3D3O A;  4BBU A;  3BWL A;  3GEC A;  5KSH A;  2V0U A;  3T4L A;  4HJ6 A;  4IUK A;  2GX5 A;  1LSV A;  3T4O A;  4XT2 A;  5F69 A;  1YSQ A;  2FH5 A;  5DFX A;  3MJQ A;  1XJ6 A;  4ZRR A;  4BJP A;  2HJE A;  1GSW A;  2O0Y A;  3S7P A;  4P6Z M;  1IFQ A;  3C8C A;  3RTY A;  1UGU A;  1ZTU A;  4HQA A;  3S7N A;  4BBT A;  3LYX A;  5DFY A;  3PBN A;  4HJ3 A;  4NXE A;  5AVE A;  5AJG A;  2XRO A;  2WKR A;  4Q0J A;  2HGV A;  2O9A A;  4GW9 A;  4NXF A;  4HH2 A;  3R7W A;  4QPR A;  1OTD A;  2KOI A;  3F1P A;  1N9O A;  3NOP C;  4IUH A;  4GHI A;  4EUV A;  4EEP A;  4MN5 A;  2M1C A;  3LIB A;  3IBR A;  1TS0 A;  1OJ5 A;  2EWV A;  2A24 B;  5DKL A;  4PKY G;  3C2W A;  5HDD A;  2H28 A;  2O9B A;  3UE3 A;  2HF6 A;  3EQU A;  1MC0 A;  4CLC B;  4HP4 A;  3F1N B;  3BW6 A;  4O8G A;  1KOU A;  2PD7 A;  4F3L B;  3KYZ A;  3MR0 A;  4HY8 A;  2W3E A;  2B02 A;  4GS9 A;  2KLI A;  3T50 A;  4R6L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...