4I38A

Structures of it intermediates from time-resolved laue crystallography collected at 14id-b, aps
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
publication title Volume-conserving trans-cis isomerization pathways in photoactive yellow protein visualized by picosecond X-ray crystallography
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Luminescent protein
total genus 36
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2012-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4i38A00
4EQ1A 5TBMB 2B02A 3NOPC 4LLOB 3EWKA 3D72A 5HD3A 3MR0A 5G4YA 2GJ3A 2V0WA 5HWVA 2JHEA 1LT0A 4DJ3A 5F6AA 2QHKA 3T50A 4GS9A 3BWLA 4KUKA 2KDKA 1T1BA 4F3LB 1XJ6A 4LRYC 1OTAA 4PKYA 1X0OA 4DJ2A 2L0WA 2Z6DA 2Z6CA 1WA9A 2ZOHA 4HY8A 4H6JA 3VE3A 4I38A 1XJ3A 5AVEA 5HZHA 1GSWA 1EW0A 2L4RA 4KQDA 4LRXC 4GHIA 4R3AA 3K3CA 3NJAA 4L9FA 3H9WA 3MQQA 2A24A 4L9EA 4BBVA 4R6LA 4WLAA 3RTYA 3VOLA 1F9IA 2YKFA 5J7EA 3MFXA 1XJ2A 5HDDA 1P0ZA 1S67L 3BY9A 4EERA 5DJTA 4NXGA 4YWZA 3KX0X 3LIEA 3K3DA 4HIAA 2V1AA 2QJ5A 3NOUC 1GSVA 4I3AA 3LUQA 3F1PB 3IS2B 5HWTA 1OJ5A 2V0UA 2OOLA 1XFNA 3GDIA 1T18A 4HNBA 4B9OA 5HDCA 3E4PA 1LL8A 2PD8A 1S1ZA 3NHQA 4KUOA 1F98A 2OWJA 5KIZA 2OWHA 5HD5A 4NXFA 1DRMA 5AVFA 4JGQA 1UWNX 5F69A 2PYRA 2PYPA 4I5SA 3H7WB 1MZUA 3A0RA 1UGUA 3PYPA 1N9OA 3P7NA 4HOIA 4BBTA 1TS8A 2I9VA 2WKQA 3HJIA 3LI9A 1UWPX 3GECA 2D01A 4NXBA 5G4ZA 4E04A 3E4OA 3MQOA 3LI8A 3CAXA 4GS9B 4I3IA 2HV1A 2WKRA 1V9YA 3G6OA 2BASA 4GCZA 1D06A 1OTEA 3F1NA 4BBUA 3VE4A 5HDSA 2P7JA 5A8BA 3E4QA 1XFQA 4HJ4A 1G28A 4WN5A 2PDRA 1T19A 3F1OA 3UB8A 2L1MA 3LYXA 3UB9A 3A0VA 3EEHA 2VV7A 2ZBBA 4GHIB 3FG8A 4HP9A 4PKYG 5DKKA 5IU1A 2ZOIA 4EW7A 4XT2A 4I3JA 2M1CA 5I5LA 2A24B 3UE6A 4RQ9A 1OTIA 3UMEA 3H82A 5TBMA 2V9AA 1LSVA 4HH3A 4EEPA 3IBRA 1D7EA 5HSQA 2YKHA 4EETB 4HJ6A 1V9ZA 3HJKA 3H7WA 2R78A 1DP9A 5J4EA 3C8CA 4LPZA 4F3LA 1VB6A 5IS1A 1S1YA 4LRZE 1Y28A 2QJ7A 2H28A 1GSXA 2V1BA 4HJ3A 5F68A 1T1AA 3BY8A 2PR5A 1LSXA 1P97A 1KOUA 4M4XA 3ULFA 1S4RA 2CMNA 1NWZA 3CLOA 4JGOA 2PD7A 1JNUA 2QKPA 3LIAA 4R38A 2PR6A 1T1CA 3ZQ5A 3LIFA 2VV6A 3B33A 3C2WA 1OJGA 4I39A 2D02A 3PHYA 3FC7A 3SW1A 4HI4A 4HH2A 5EFWA 1OT9A 1OTBA 5F5YA 2JN7A 3MJQA 2J80A 2WKPA 1XJ4A 5J3WA 4MN6A 4JGPA 3LICA 4H6JB 4EESA 3UB7A 1LSWA 4JGRA 5DJUA 1S4SA 1DP8A 2PHYA 3ICYA 3A0SA 2W27A 3MXQA 4EXOA 3LIBA 3F1PA 3IS2A 4L9GA 4HP4A 3NOTC 2VEAA 1S66L 1N9LA 1TS7A 1N9NA 2EA9A 3F1NB 4MN5A 2VLGA 4WF0A 4WL9A 3UB6A 4EEUA 2VV8A 1TS0A 4NXEA 2QWSA 1OTDA 4R70A 2INWA 2K7SA 5DKLA 3F1OB 3LIDA 3UMDA 4GW9A 4HHDA 1OT6A 4WUJA 1BYWA 3RH8B 5HWWA 3OLOA 2KX6A 2W0NA 1DP6A 1TS6A 4XT2B 4K08A 3CWFA 4HQAA 1ODVA 3H82B
chains in the Genus database with same CATH superfamily
1KGGA 1L2SA 5DF9A 4Q0IA 3VP1A 5HD3A 4XUXA 3AGDA 3C5AA 2ZJ9A 4OQ0A 2V0WA 3D4FA 3PAEA 5L07A 4GS9A 4KUKA 5L10A 3UPPA 4Y15A 4N1XA 3LR5A 2XSSA 4S2IA 3A3JA 3S22A 2Y2QA 4ZTKA 1QMEA 1BZAA 2Y2MA 4HESA 1ES2A 3QHYA 4ZJ3A 5DF8A 5GL9A 3SS3A 3DTIA 4H6JA 3ZDJA 3VE3A 4I38A 2ACGA 2M7UA 1VHMA 1YT4A 3LY4A 2Z2MB 4GD8A 3JVUA 3K3CA 3FWLA 5FDSA 3N8SA 4PM8A 2GZAA 2W3GA 3ZCZA 4JLFA 1L0FA 1N4OA 3GSGA 4R6LA 3JVVA 3CI6A 3TW8A 4NKPA 2CC1A 3IF6A 3LCEA 3VOLA 1ZC2A 2LB9A 3RFBA 5CTMA 2XFSA 3FPVA 1EI5A 1D1JA 1ERQA 2Y8HA 3MSHA 3BY9A 5DTKA 5DJTA 4B93A 2V2FF 5E2GA 1ALQA 3KX0X 4S2NC 3VV4A 1F2KA 3B42A 5E2EA 2EX2A 1CEFA 3UE1A 3G30A 1IFQA 3CUEA 2JE5A 1JWPA 3NULA 1H8YA 1P9WA 2IWDA 3FKWA 1OJ5A 2OOLA 4GLQA 4EBNA 3DWKA 1XFNA 4QB8A 2ZL1A 1PRQA 1T18A 3AGFA 4HNBA 1I5QA 4UAAA 5HDCA 1OPXA 1S1ZA 3NHQA 4JXVA 4KUOA 2ZQCA 3IHAA 1S6RA 1CF0A 3IH8A 3S1YA 3L9KA 4X53A 1HD8A 2OWHA 3EEAA 2HP6A 2EXBA 1DRMA 4JGQA 5F69A 2PYRA 4I5SA 1CQAA 1TVFA 5EVLA 1N9OA 2XA7S 3WS1A 3MFDA 1MWSA 4H8RA 3ZG0A 5MC7A 3HVFA 1MPLA 3DTEA 3BJNA 3EGXC 1TD5A 3HJIA 2D01A 4NG2A 5G4ZA 4PHTA 4OPQA 1FOFA 3N8RA 3HLWA 5EVID 5GLDA 4KZ3A 2BLSA 1MWRA 1BLSA 2HV1A 2WKRA 3N4IA 2ZLYA 2GDNA 4RX2A 5AQ9A 3G35A 4Y5FA 3QP1A 1D06A 1OTEA 3VOZA 1E4DA 4PM6A 2KOIA 5HAIA 1K25A 3T4OA 1K55A 2K31A 1TF1A 2WGVA 5EECA 1ZTUA 2EX8A 1XFQA 4WYYA 3DAVA 5HL6A 4QPRA 3U2AA 3UB8A 4D60A 2WK0A 3LY3A 4HBUA 4MEZA 1KE3A 4GHIB 3FG8A 4PKYG 3JYIA 2ZOIA 4EW7A 1RCJA 3PBOA 1YLTA 3UE6A 2R9XA 2UV0E 2MJ6A 2WKEA 3EOIA 4KZ6A 4X68A 3UMEA 2E8JA 5EOOA 4DE2A 5FL3A 1W8YA 4MDZA 1XGJA 4Z1WA 2ZC4B 2M7VA 4YFMA 3TRCA 4QHCA 2JKGA 3UDXA 3T4KA 3TOIA 3HJKA 1FCNA 1DP9A 4C75A 4LPZA 4QD4A 2XR0A 4F3LA 2XFTA 3PBTA 4R4SA 5IS1A 2KLIA 1DY6A 1ESIA 3QNBA 3VP0A 1Y28A 4ZAMA 5GLCA 3C4OA 3W4OA 5AQAA 1GSXA 1MY8A 2V1BA 3Q81A 1T1AA 3BY8A 2J7VA 4EWFA 4QU3A 1Z09A 3CG5A 1NXYA 4PM9A 3WRTA 2G7UA 3MQ0A 1IKIA 2EWVA 1PZPA 3BFCA 3UE3A 5CHJA 1BLCA 3G34A 3IWOA 4R38A 3I7JA 2GNXA 5M1AA 3PHYA 3SW1A 4HH2A 2HP9A 1OT9A 3OPPA 4DE0A 2XH9A 3KSIA 4DDYA 3CPTA 3MJQA 2J80A 3FZCA 3W2ZA 3PXPA 3UPOA 4JGPA 2G2UA 2O99A 1NLZA 1LL5A 1PWCA 5D3OA 4EESA 2WAEA 5EPHA 5DJUA 1S4SA 3KYZA 1IYSA 1J3WA 2PHYA 3WWXA 3A0SA 2W27A 3IX4A 2FFYA 5FQJA 2P04A 2VEAA 1S66L 1N9LA 1N9NA 3F1NB 5FAPA 4MN5A 4WELA 2EWWA 4JXSA 3WS5A 3N7WA 1EROA 4EEUA 1PZOA 1YLPA 3OC2A 1W7FA 4IJGA 5A93A 4WZ5A 5JYPA 4S2MA 1GCEA 3F1OB 1XA1A 1K4EA 4HHDA 4QWOA 4CLCB 1BYWA 2ZQAA 2R9WA 3OLOA 1ONGA 3NC8A 4X25A 2X02A 2KX6A 2W1TB 3GTCA 4O8GA 3CWFA 1PFLA 5U47A 5FDHA 4JPMA 2WKHA 3IXDA 4CPKA 3O86A 5CXWA 1MKMA 2I72A 2ZC3B 5DTTA 3DBAA 3CMZA 4JXGA 1U60A 2JHEA 4GB7A 1AWIA 1LT0A 5F6AA 1E3UA 3WS4A 3BWLA 4ESPA 3O3VA 4FUWA 4YNRA 1T1BA 3GRJA 4WBGA 3SS4A 4DF6A 3A3IA 2O9CA 1X0OA 4DJ2A 2L0WA 4OKPA 5JYOA 1FR1A 5BOHA 4MBHA 1I2SA 3R7WA 3VP2A 3O88A 3MZFA 1F5MA 3VP4A 4HY8A 4Y17A 3UO9A 3V39A 1W63Q 2A3UA 2P08A 5F82A 2ZQDA 4BENA 4X1MA 3HL9A 2L4RA 4KQDA 4CLCC 3DWZA 4OLDA 4IVKA 2VJWA 3T1XA 3NJAA 2Y2LA 3MQQA 3NIAA 4KZ8A 4DDSA 4L9EA 3SH7A 4OONA 4WEJA 2YKFA 2ZM2A 4BD1A 5J7EA 3MFXA 1JTGA 1XJ2A 3TE8A 4KQOA 5HDDA 2DNSA 1MBLA 3P01A 1S67L 4YINA 3OOVA 2VGLS 4O0PA 1XKZA 4OLGA 3WS2A 4YWZA 3FV7A 1H8ZA 5EVIC 3AGEA 3F1PB 2X01A 3IS2B 1YSQA 5HWTA 2PU2A 2V20A 2V0UA 3IHBA 4MBKA 4JBFA 4KZ4A 3IXBA 3UPNA 1ZG6A 4JXWA 1W5DA 4ME4A 3BFFA 4A5RA 2OWJA 2HPBA 4EQIA 5FA7A 4E3NA 4S2NA 4NXFA 3HUMA 1UWNX 2PYPA 2FZ0A 2ZMAA 3T4LA 1MZUA 1YKDA 3GMWA 3BYDA 3E2LA 4KG6A 3G4PA 4ZDXA 4BBTA 1SKOA 4OOYA 3E0YA 4E3IA 4BWIA 2WKQA 2XD1A 4OQHA 2B18A 3IF5A 3GECA 4NXBA 3SH8A 3E4OA 2PU4A 3CAXA 1ZHHB 1SDNA 2ZQ9A 3RXXA 3G32A 2J3TC 4BLMA 4GS9B 3HLEA 3BEBA 1V9YA 3G6OA 3KYEA 3U4LP 1K56A 4NK3A 5DVAA 2NUPC 1SZVA 3MKFA 5FQIA 2OAQ1 1KGEA 3E4QA 3UY6A 2HP5A 4OH0A 3KSGA 2JKFA 5HAPA 1CEGA 3V67A 1RGYA 1XA7A 2OAP1 3FYZA 1YAXA 1SCWA 5K5BA 3A0VA 1K57C 1VEUB 2ZBBA 1HLUP 2JKRM 1PI5A 1PIOA 3VMAA 1M40A 2VKSA 3LGOA 3IXGA 5DKKA 5IU1A 3WRZA 5FQQA 4G3WA 4XT2A 2M1CA 5F1FA 5FI7A 3C4PA 1XP4A 1P9RA 5CX7A 3A3FA 3P09A 3T4SA 3H82A 3IF6B 5TBMA 2V9AA 1LSVA 1C3BA 2J8YA 4HH3A 4BL2A 4IBRA 4NETA 1KDWA 1VETA 5HSQA 4CLCD 3KYQA 4HJ6A 1M6KA 2XROA 5CECA 3G2ZA 2R78A 5J4EA 4KZ5A 1HVBA 4U3TA 1CI9A 1YSPA 1H5XA 3ZG5A 1S1YA 3TJZC 4LRZE 5E2HA 3MF0A 5FQKA 2QJ7A 2H28A 5HAQA 1G6AA 2B95A 2JC7A 2ZM8A 3VFFA 1SHVA 4CQHA 3W4QA 4Y0TA 2ZL1B 4X56A 3V50A 4OPRA 2X71A 1S4RA 2CMNA 2HGVA 4BD0A 3BLMA 1Q2PA 2O9BA 4DMZA 2PD7A 1JNUA 3SOIA 3QP5A 2OLUA 5L09A 3B33A 4OP8A 5E2FA 1XGIA 3ZNYA 1Q2QA 2D02A 4Z9QA 3FC7A 4XXRA 3VOYA 3HLCA 5F5YA 3C7UA 4PM7A 2J3WA 1L0EA 3V3SA 3JPUA 3LICA 1FSWA 1BLPA 3UB5P 1AXBA 1ZKJA 3UB7A 5HARA 5KZHA 2XD5A 3W8KA 2Z2LB 3E2KA 1ES4A 4EXOA 3LIBA 4KZ9A 4L9GA 1TS7A 3NCKA 5AJGA 4JF4A 4FOFA 3FPWA 4WF0A 3RXWA 1W79A 2H5SA 3UB6A 4OP5A 2VV8A 3C30A 3ZYTA 2INWA 3S7OA 2C6WB 2HJ9C 3LR0A 4IEDA 2PAVP 2J3TD 2Y4AA 4MBFA 4B4XA 4GW9A 4EUZA 4WUJA 1IKGA 3ZVWA 3BM6A 3RH8B 5HWWA 4LV1A 4ARZA 4R1GA 4P0MA 5CGXA 3OCNA 4R3BA 5HPFA 4ZRRA 2AVXA 3PR6A 4OPZA 3KO6A 4EQ1A 2B02A 2VK3A 1Y54A 4E3KA 4U0XA 4R23A 3D72A 4YOFA 5FEGA 3IWIA 3GR2A 2GJ3A 5HWVA 2QHKA 2IWBA 4WMCD 4ETZA 3CHWP 2WADA 3BFDA 2K2NA 2KDKA 5L2FA 3MS6A 4F3LB 1XJ6A 4U0TA 3BFEA 2EXAA 4PKYA 2E8IA 2HZ5A 2HDSA 2HDUA 1NYMA 3UE0A 4DXBA 4EUVA 2Q9MA 4EBPA 1K55C 1YQSA 4BQMA 2QZ6A 4LCMA 2Z6CA 4D2OA 5GLBA 4NEED 1LI9A 2BG1A 3K2NA 2JKRI 1YLWA 1YMXA 3S7PA 1XJ3A 2P9VA 4KG2A 3BRMA 2OV5A 5EOEA 3HLGA 1EW0A 2ZMVA 5HFOA 2Y2GA 4L9FA 4S2LA 3H9WA 2A24A 4E3MA 4MLLA 1NYYA 3C38A 1ZG4A 1QMFA 2W3HA 4Q8IA 2V8CA 3VSLA 1XXMA 3S4XA 4K0WA 3MKEA 4X6TA 1RGZA 1F9IA 1TEMA 1H3QA 4GKUA 2O0YA 3CPTB 2ZC7A 1G5UA 4CLCA 4EERA 3NBLA 4LV2A 3PTEA 4RVAA 3K3DA 3QP2A 2V1AA 2IA2A 1GSVA 3QNCA 2Y79A 5EUAA 4JF5A 4KQRA 4BMWA 4S2JA 1IYOA 1HZOA 3G2YA 3GDIA 1IEMA 1KE4A 1IYPA 4B9OA 1WYBA 3SZTA 4HEFA 5M18A 1K6SA 4CLCE 5EV0A 2XK1A 3BQ8A 3KSFA 3HUOA 1FCOA 1F98A 3IWQA 5KIZA 1KGFA 3BLSA 2GX5A 5HD5A 5HL1A 5EVIA 4N1HA 1PNEA 4GZBA 3H7WB 4KQQA 4OPYA 1WE4A 3A0RA 3HLFA 3QP6A 2BTFP 3PYPA 1NJ4A 2RCXA 3P7NA 2DMWA 3DTKA 1TS8A 2XF3A 1KDSA 1UWPX 5G18A 5CGSA 3LI8A 3HREA 4FSFA 3NDEA 3MZEA 4I3IA 1PWDA 4X55A 3OZHA 4CJNA 4KZBA 1GHMA 1GHIA 3O5YA 3Q7VA 4GJ4A 4GNUA 4QY6A 2WGWA 2WZXA 4BBUA 2HDQA 3ZFZA 3VE4A 4KG5A 3ZHHA 3R7WB 1NRJA 1YM1A 4MCWA 2OLVA 4HJ4A 1G28A 4WN5A 2ZM0A 5CGWA 4Y3IA 2PDRA 1T19A 2FH5A 2Y2NA 4P85A 5FAOA 3LYXA 2EX6A 3UB9A 4C3QA 4S2OA 5GHXA 1KVMA 1O7EA 5F83A 3N8LA 4JKTA 5KSCA 4MNRA 5KSHA 3PBNA 5CEBA 1Z6FA 1YLYA 1OTIA 3T1QB 1IYQA 5IT5A 2VX8A 3DW0A 3OPRA 2Y59A 4LENA 4AFIA 1D7EA 2HF6A 1PI4A 5TGFA 5CERA 3LR4A 1GA9A 2YKHA 2ZC5B 4EETB 4P6ZM 1L0GA 1V9ZA 3FKVA 3W4PA 3LEQA 4IUHA 4F94A 4OVDA 1LL9A 4X1LA 3C8CA 1DJCA 1VB6A 1CI8A 3RJUA 1YMSA 5FATA 4M3KA 3CITA 4O7DA 3IX3A 4HJ3A 5F68A 1S0WA 1NZUA 5IHVA 3QP4A 5A90A 1VM1A 1LSXA 1CJFA 1P97A 1KOUA 3BW6A 1H0MA 4PMAA 4PPRA 1NWZA 3CLOA 3CJMA 1W8QA 3IX8A 4Q0HA 2QKPA 3MXSA 2PR6A 1T1CA 3LIFA 5A92A 4LV3A 2WAFA 4OOMA 3UN7A 3D9YA 1KE0A 1MWTA 3GVBA 1BTLA 3C2WA 3ISGA 3HUNA 1OJGA 5FQMA 3ITBA 3NI9A 4HI4A 3EQVA 5EE8A 5EFWA 2Y2HA 5TJJA 1NZOA 3P98A 1I2WA 1SKOB 4IBXA 2JN7A 3B47A 1FCMA 4E3JA 1XJ4A 5J3WA 3D3OA 4MN6A 5TFQA 1VEUA 3MMHA 2HJEA 4DE1A 4UQIM 3NY4A 1G68A 2J9PA 4H6JB 1K54C 2IWCA 4RX3A 5GHYA 5AQBA 1L0DA 4UA7A 2PBYA 1DP8A 2JCHA 5GLAA 3ICYA 3SH9A 3MXQA 4HP4A 3NOTC 4N92A 1KVLA 1STZA 3A3EA 4UEYA 4WL9A 1LHYA 3KSHA 1TS0A 4NXEA 5L8MA 1OTDA 2ZQ8A 4R3JA 2K7SA 1NY0A 4KENB 5DKLA 4QJGA 5C5KA 3LIDA 3UMDA 1ERMA 2OSUA 3ZG8B 1OT6A 4BL3A 4FCFA 2PRFA 1TS6A 3GQZA 4XT2B 4K08A 4G3KA 1E25A 4HQAA 1ODVA 4O01A 3T1RA 3H82B 5TBMB 3NOPC 4ETXA 4II7A 4LLOB 3EWKA 1ESUA 1PW8A 3V3RA 1K6RA 1CK3A 3MR0A 5G4YA 1VETB 5FSRA 2QPNA 4OQIA 4RYEA 3EGDC 1TDLA 4DJ3A 3QP8A 3WS0A 3T50A 1PW1A 3V5MA 2XLNA 1A0KA 3PAGA 5LBRA 3T4QA 3ZNTA 4LRYC 4E3OA 4P6ZS 1OTAA 4Y7PA 2Q9NA 4Y0UA 3M2JA 1K38A 1FQGA 2EFUA 2Y2JA 2Z6DA 3OPHA 1WA9A 3IF6C 5AQ7A 2ZOHA 2WGIA 3TSGA 4IHQA 3UDIA 4GD6A 2HDRA 4EBLA 4DKIA 1E3UD 2VZWA 2G2WA 5AVEA 5HZHA 4L0LA 5TR7A 1GSWA 4LRXC 4FH2A 2A2LA 4GHIA 4KZ7A 4R3AA 2NUTC 2Y2OA 4FTXA 3HLBA 1K0KA 5KMWA 4DE3A 3TG9A 4KZAA 4BBVA 4WLAA 4K91A 2W1RA 3CUEC 4S2PA 3RTYA 5HPIA 1H8MA 2VA0A 4GDNA 4B4ZA 3A3DA 4E3LA 2P74A 3LO7A 2XRNA 2UWXA 1P0ZA 4R4RA 1N9BA 1BT5A 2RL3A 1DJBA 4NXGA 3M6HA 3NDGA 3T1SA 3LIEA 1JWVA 3BQAA 4UQIS 4HIAA 4B88A 3VSKA 3GV9A 2QJ5A 3NOUC 4I3AA 4GDBA 3LUQA 1JTDA 3T4TA 2J9OA 4C6YA 2ZQ7A 4ZJ1A 2XDMA 5CHUA 5HW3A 4WZ4A 3S7NA 4EU0A 2EFXA 3E4PA 5CEDA 1LL8A 2PD8A 4UHUA 3B3XA 4JF6A 3ZG7B 4Y13A 3IQAA 5EM1A 4RA7A 1ES3A 3M2KA 1Y4OA 4P87A 3MBZA 5FAQA 2Y55A 5DF7A 5AVFA 5DFYA 4ARZB 4LGWA 1UGUA 4WM9A 5CRFA 2XGNA 2H10A 1SDEA 4HOIA 1J9MA 4N9KA 2JKTM 3O87A 3SS5A 1GHPA 3HBRA 1L3LA 2I9VA 3IH9A 3LI9A 2H0YA 4E04A 1ES5A 3MQOA 4R0QA 1TDGA 5CTNA 1MKIA 2DCFA 3M6BA 1BLHA 3IBJA 4GN2A 2O9AA 2PBDP 3PBRA 2FFFB 2V1ZA 4LV0A 1NRFA 4IVIA 4PM5A 1VQQA 4BJPA 2BASA 4LFUA 4GCZA 5DFXA 5F1GA 3F1NA 5A91A 1PYYA 1ONHA 2P7JA 4MMNA 5HDSA 5A8BA 1MXOA 2VGLM 5FI2A 2WKIA 1SKFA 4WEKA 3C7VA 3OCLA 2DRWA 3CZDA 3IXHA 3F1OA 2XEPA 4UA6A 2P9VB 2L1MA 4QY5A 5FQ9A 3Q7ZA 1DJAA 3EEHA 2VV7A 1G6OA 1FR6A 3R4KA 1K56D 4S2KA 4HP9A 1JWZA 3HLDA 2WUQA 3G31A 4DXCA 2W1TA 3LEZA 4DRTA 4I3JA 2W3EA 2A49A 5I5LA 2A24B 5DTSA 4RQ9A 1W63M 3MZDA 5EVEA 3HCYA 5FASA 2EX9A 3L7HA 4EEPA 4PAUA 4ZBEA 3IBRA 3PBQA 4P6BA 1RP5A 4MN7A 1PWGA 1YLJA 1XX2A 3ZG9B 2Y2IA 2W3DA 1GA0A 4LCLA 1YPRA 2Q0OA 3UDFA 2JBFA 3H7WA 2H0TA 2PT7A 3Q1FA 5FI6A 5M19A 1XPBA 4IUKA 1FIKA 4FD8A 4OQGA 2PR5A 4E6XA 4Q0JA 3BECA 4M4XA 3ULFA 3N6IA 1EWZA 3Q82A 2WYXA 1WYCA 4JGOA 1O07A 4X69A 2VGJA 1BSGA 1LI0A 1BULA 3LIAA 1HTZA 2ZD8A 3ITAA 3ZQ5A 3BFGA 2VV6A 1FILA 3EQUA 3OBFA 5EVIB 3T12B 5HX9A 5GHZA 4I39A 3S7QA 2WZZA 4G3VA 1JVJA 1OTBA 2V8FA 2VGKA 2QMIA 3Q07A 2WKPA 1IOUA 2B5RA 1LLBA 3E98A 4DN0A 3NECA 1FSYA 3VFHA 4WZ5C 4Y0OA 2QYBA 4K0XA 1NLYA 2LB5A 1LSWA 1ACFA 1OMEA 4JGRA 4ZJ2A 5EM0A 1K4FA 2XQZA 2Y2PA 5CHMA 1IELA 4XUZA 3ZGAB 3F1PA 5J8XA 2ZMFA 3IS2A 4OOLA 3MXRA 3Q7VB 4EV4A 4E6WA 3PBSA 4Y2FA 2WGWB 2EA9A 2VLGA 2W3FA 4N9LA 3LFVA 5E43A 1MWUA 4HBTA 2QWSA 5I94A 4R70A 1MC0A 1BUEA 1K54A 3T4JA 1YLZA 3DTMA 3LR3A 4GOGA 2Y91A 1K57A 3VP3A 2XA7M 2JKTI 4WMCA 4FH4A 3IT9A 2W0NA 3OPLA 1DP6A 3UNWA 5FEFA 4UA9A 3ZVTA 2ZC6B 2Y2KA 2C5WB 4ID4A
chains in the Genus database with same CATH topology
4EQ1A 5TBMB 2B02A 1MKMA 3NOPC 4ETXA 4II7A 4LLOB 3EWKA 4Q0IA 5DF9A 3D72A 4YOFA 5HD3A 3MR0A 5G4YA 3DBAA 2GJ3A 3EGDC 2V0WA 5HWVA 2JHEA 1LT0A 4DJ3A 5F6AA 2QHKA 4ETZA 3T50A 4GS9A 3BWLA 2K2NA 4KUKA 2KDKA 4YNRA 1T1BA 5LBRA 3T4QA 4F3LB 1XJ6A 4LRYC 3LR5A 2XSSA 4P6ZS 1OTAA 2O9CA 4PKYA 1X0OA 4DJ2A 2L0WA 4EUVA 2Z6DA 3R7WA 2Z6CA 1WA9A 2ZOHA 1F5MA 4HY8A 4NEED 4IHQA 3K2NA 2JKRI 1W63Q 4H6JA 2P08A 3VE3A 3S7PA 4I38A 1XJ3A 2VZWA 2M7UA 5AVEA 5HZHA 4L0LA 1GSWA 1VHMA 1EW0A 2L4RA 2ZMVA 4KQDA 4LRXC 4CLCC 2A2LA 4GHIA 2VJWA 4R3AA 3JVUA 3K3CA 2NUTC 3NJAA 4L9FA 2GZAA 2W3GA 3H9WA 3MQQA 2A24A 4L9EA 4BBVA 4R6LA 4WLAA 3JVVA 3C38A 3CI6A 2W3HA 2W1RA 3CUEC 3TW8A 3RTYA 4NKPA 5HPIA 1H8MA 2VA0A 3VOLA 4WEJA 2LB9A 1F9IA 2YKFA 3RFBA 5J7EA 3MFXA 1H3QA 1XJ2A 3TE8A 2O0YA 4KQOA 5HDDA 2XRNA 3FPVA 1P0ZA 2Y8HA 3P01A 4CLCA 1S67L 3BY9A 4EERA 5DJTA 4B93A 3OOVA 2VGLS 4O0PA 4NXGA 4YWZA 3KX0X 3LIEA 3K3DA 3VV4A 3BQAA 4UQIS 4HIAA 2V1AA 2IA2A 3B42A 2QJ5A 3NOUC 1GSVA 4I3AA 3LUQA 1IFQA 3CUEA 2Y79A 3F1PB 3IS2B 3T4TA 1YSQA 5HWTA 4BMWA 1P9WA 1OJ5A 2V0UA 2OOLA 4GLQA 1XFNA 3GDIA 3S7NA 1T18A 4HNBA 4B9OA 4EU0A 5HDCA 1OPXA 3E4PA 1LL8A 2PD8A 1S1ZA 3NHQA 4CLCE 4ME4A 3BQ8A 3KSFA 4KUOA 1F98A 2OWJA 5KIZA 2OWHA 3EEAA 2GX5A 5HD5A 4NXFA 1DRMA 5AVFA 4JGQA 1UWNX 5F69A 2PYRA 2PYPA 2FZ0A 4I5SA 3H7WB 5DFYA 3T4LA 1MZUA 3A0RA 4ARZB 1UGUA 1YKDA 3PYPA 1N9OA 2XA7S 3P7NA 2DMWA 4HOIA 4BBTA 2JKTM 5MC7A 1TS8A 3BJNA 2I9VA 3E0YA 3EGXC 4BWIA 2WKQA 1TD5A 3HJIA 3LI9A 2B18A 1UWPX 3GECA 2D01A 4NXBA 5G4ZA 4E04A 3E4OA 3MQOA 3LI8A 3CAXA 4PHTA 1ZHHB 3IBJA 2O9AA 4FSFA 2J3TC 4GS9B 4I3IA 2HV1A 2WKRA 1V9YA 3PBRA 3G6OA 4BJPA 2BASA 3O5YA 4GCZA 4GJ4A 4Y5FA 2NUPC 1D06A 5DFXA 1OTEA 3F1NA 4BBUA 2KOIA 3VE4A 5HDSA 2P7JA 4MMNA 5A8BA 3T4OA 2OAQ1 3E4QA 2K31A 2VGLM 1TF1A 3R7WB 3KSGA 1NRJA 4MCWA 1ZTUA 1XFQA 4WEKA 4HJ4A 1G28A 3OCLA 4WN5A 4Y3IA 5HL6A 2PDRA 1T19A 4QPRA 3U2AA 2FH5A 3V67A 3F1OA 3UB8A 2L1MA 2OAP1 5K5BA 1YAXA 3LYXA 3UB9A 3A0VA 3EEHA 2VV7A 1G6OA 3R4KA 2ZBBA 2JKRM 4GHIB 3FG8A 4HP9A 2VKSA 4PKYG 5DKKA 5KSHA 5IU1A 2ZOIA 2W1TA 3PBNA 4EW7A 4G3WA 4XT2A 3PBOA 2M1CA 2W3EA 4I3JA 5I5LA 2A24B 3UE6A 4RQ9A 1OTIA 1W63M 1P9RA 5CX7A 3HCYA 2MJ6A 3UMEA 3EOIA 3T4SA 5IT5A 3H82A 5TBMA 2V9AA 1LSVA 5FL3A 2VX8A 4MDZA 4Z1WA 4HH3A 4EEPA 2M7VA 4PAUA 3TRCA 3IBRA 3PBQA 4AFIA 1D7EA 2HF6A 4MN7A 5HSQA 3LR4A 3T4KA 2YKHA 2W3DA 4CLCD 4EETB 3KYQA 4HJ6A 4P6ZM 1V9ZA 3HJKA 2XROA 4IUHA 3H7WA 2R78A 1DP9A 5J4EA 3C8CA 4LPZA 4F3LA 1VB6A 1YSPA 2PT7A 3PBTA 5IS1A 2KLIA 1S1YA 3TJZC 4LRZE 3CITA 1Y28A 3MF0A 2QJ7A 2H28A 1GSXA 2V1BA 4HJ3A 4IUKA 5F68A 1T1AA 3BY8A 2PR5A 1LSXA 4Q0JA 4CQHA 1P97A 1KOUA 3BW6A 4M4XA 3ULFA 2G7UA 1S4RA 2CMNA 1NWZA 3CLOA 3MQ0A 2HGVA 4JGOA 2EWVA 2O9BA 4Q0HA 4DMZA 3UE3A 2PD7A 1JNUA 2QKPA 3LIAA 4R38A 2PR6A 1T1CA 3ZQ5A 3LIFA 2VV6A 3B33A 4OOMA 2GNXA 3EQUA 3OBFA 3C2WA 1OJGA 4I39A 2D02A 3PHYA 3S7QA 3FC7A 3SW1A 4HI4A 3EQVA 4HH2A 4G3VA 5EFWA 1OT9A 5TJJA 1OTBA 5F5YA 3KSIA 2JN7A 3B47A 3MJQA 2J80A 2WKPA 1IOUA 2J3WA 1XJ4A 3E98A 3D3OA 3PXPA 4MN6A 5J3WA 3W2ZA 4DN0A 3MMHA 4JGPA 2O99A 2HJEA 3LICA 1NLZA 4UQIM 4H6JB 4EESA 2QYBA 1NLYA 3UB7A 2LB5A 1LSWA 4JGRA 5DJUA 1S4SA 3KYZA 1DP8A 2PHYA 3ICYA 3A0SA 2W27A 3MXQA 4EXOA 3LIBA 3F1PA 2ZMFA 3IS2A 4L9GA 4HP4A 4OOLA 3NOTC 2P04A 2VEAA 1S66L 1N9LA 1TS7A 3PBSA 4Y2FA 1N9NA 2EA9A 3F1NB 5AJGA 4MN5A 4WELA 2EWWA 1STZA 4FOFA 3FPWA 2VLGA 2W3FA 4UEYA 4WF0A 4WL9A 3LFVA 3UB6A 4EEUA 3KSHA 2VV8A 3C30A 1TS0A 4NXEA 3OC2A 4IJGA 2QWSA 1OTDA 5L8MA 4R70A 1MC0A 3ZYTA 2INWA 2K7SA 3S7OA 5DKLA 3LR0A 2HJ9C 3T4JA 5C5KA 3F1OB 2J3TD 3LR3A 3LIDA 3UMDA 4GW9A 4HHDA 1OT6A 4WUJA 4CLCB 1BYWA 2XA7M 3RH8B 2JKTI 5HWWA 3OLOA 4ARZA 2KX6A 3OCNA 2W0NA 1DP6A 2W1TB 1TS6A 4XT2B 4K08A 4O8GA 3CWFA 4G3KA 5HPFA 4ZRRA 4HQAA 1ODVA 4O01A 3PR6A 3KO6A 3H82B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EQ1 A;  5TBM B;  2B02 A;  3NOP C;  4LLO B;  3EWK A;  3D72 A;  5HD3 A;  3MR0 A;  5G4Y A;  2GJ3 A;  2V0W A;  5HWV A;  2JHE A;  1LT0 A;  4DJ3 A;  5F6A A;  2QHK A;  3T50 A;  4GS9 A;  3BWL A;  4KUK A;  2KDK A;  1T1B A;  4F3L B;  1XJ6 A;  4LRY C;  1OTA A;  4PKY A;  1X0O A;  4DJ2 A;  2L0W A;  2Z6D A;  2Z6C A;  1WA9 A;  2ZOH A;  4HY8 A;  4H6J A;  3VE3 A;  4I38 A;  1XJ3 A;  5AVE A;  5HZH A;  1GSW A;  1EW0 A;  2L4R A;  4KQD A;  4LRX C;  4GHI A;  4R3A A;  3K3C A;  3NJA A;  4L9F A;  3H9W A;  3MQQ A;  2A24 A;  4L9E A;  4BBV A;  4R6L A;  4WLA A;  3RTY A;  3VOL A;  1F9I A;  2YKF A;  5J7E A;  3MFX A;  1XJ2 A;  5HDD A;  1P0Z A;  1S67 L;  3BY9 A;  4EER A;  5DJT A;  4NXG A;  4YWZ A;  3KX0 X;  3LIE A;  3K3D A;  4HIA A;  2V1A A;  2QJ5 A;  3NOU C;  1GSV A;  4I3A A;  3LUQ A;  3F1P B;  3IS2 B;  5HWT A;  1OJ5 A;  2V0U A;  2OOL A;  1XFN A;  3GDI A;  1T18 A;  4HNB A;  4B9O A;  5HDC A;  3E4P A;  1LL8 A;  2PD8 A;  1S1Z A;  3NHQ A;  4KUO A;  1F98 A;  2OWJ A;  5KIZ A;  2OWH A;  5HD5 A;  4NXF A;  1DRM A;  5AVF A;  4JGQ A;  1UWN X;  5F69 A;  2PYR A;  2PYP A;  4I5S A;  3H7W B;  1MZU A;  3A0R A;  1UGU A;  3PYP A;  1N9O A;  3P7N A;  4HOI A;  4BBT A;  1TS8 A;  2I9V A;  2WKQ A;  3HJI A;  3LI9 A;  1UWP X;  3GEC A;  2D01 A;  4NXB A;  5G4Z A;  4E04 A;  3E4O A;  3MQO A;  3LI8 A;  3CAX A;  4GS9 B;  4I3I A;  2HV1 A;  2WKR A;  1V9Y A;  3G6O A;  2BAS A;  4GCZ A;  1D06 A;  1OTE A;  3F1N A;  4BBU A;  3VE4 A;  5HDS A;  2P7J A;  5A8B A;  3E4Q A;  1XFQ A;  4HJ4 A;  1G28 A;  4WN5 A;  2PDR A;  1T19 A;  3F1O A;  3UB8 A;  2L1M A;  3LYX A;  3UB9 A;  3A0V A;  3EEH A;  2VV7 A;  2ZBB A;  4GHI B;  3FG8 A;  4HP9 A;  4PKY G;  5DKK A;  5IU1 A;  2ZOI A;  4EW7 A;  4XT2 A;  4I3J A;  2M1C A;  5I5L A;  2A24 B;  3UE6 A;  4RQ9 A;  1OTI A;  3UME A;  3H82 A;  5TBM A;  2V9A A;  1LSV A;  4HH3 A;  4EEP A;  3IBR A;  1D7E A;  5HSQ A;  2YKH A;  4EET B;  4HJ6 A;  1V9Z A;  3HJK A;  3H7W A;  2R78 A;  1DP9 A;  5J4E A;  3C8C A;  4LPZ A;  4F3L A;  1VB6 A;  5IS1 A;  1S1Y A;  4LRZ E;  1Y28 A;  2QJ7 A;  2H28 A;  1GSX A;  2V1B A;  4HJ3 A;  5F68 A;  1T1A A;  3BY8 A;  2PR5 A;  1LSX A;  1P97 A;  1KOU A;  4M4X A;  3ULF A;  1S4R A;  2CMN A;  1NWZ A;  3CLO A;  4JGO A;  2PD7 A;  1JNU A;  2QKP A;  3LIA A;  4R38 A;  2PR6 A;  1T1C A;  3ZQ5 A;  3LIF A;  2VV6 A;  3B33 A;  3C2W A;  1OJG A;  4I39 A;  2D02 A;  3PHY A;  3FC7 A;  3SW1 A;  4HI4 A;  4HH2 A;  5EFW A;  1OT9 A;  1OTB A;  5F5Y A;  2JN7 A;  3MJQ A;  2J80 A;  2WKP A;  1XJ4 A;  5J3W A;  4MN6 A;  4JGP A;  3LIC A;  4H6J B;  4EES A;  3UB7 A;  1LSW A;  4JGR A;  5DJU A;  1S4S A;  1DP8 A;  2PHY A;  3ICY A;  3A0S A;  2W27 A;  3MXQ A;  4EXO A;  3LIB A;  3F1P A;  3IS2 A;  4L9G A;  4HP4 A;  3NOT C;  2VEA A;  1S66 L;  1N9L A;  1TS7 A;  1N9N A;  2EA9 A;  3F1N B;  4MN5 A;  2VLG A;  4WF0 A;  4WL9 A;  3UB6 A;  4EEU A;  2VV8 A;  1TS0 A;  4NXE A;  2QWS A;  1OTD A;  4R70 A;  2INW A;  2K7S A;  5DKL A;  3F1O B;  3LID A;  3UMD A;  4GW9 A;  4HHD A;  1OT6 A;  4WUJ A;  1BYW A;  3RH8 B;  5HWW A;  3OLO A;  2KX6 A;  2W0N A;  1DP6 A;  1TS6 A;  4XT2 B;  4K08 A;  3CWF A;  4HQA A;  1ODV A;  3H82 B; 
#chains in the Genus database with same CATH topology
 1KGG A;  1L2S A;  5DF9 A;  4Q0I A;  3VP1 A;  5HD3 A;  4XUX A;  3AGD A;  3C5A A;  2ZJ9 A;  4OQ0 A;  2V0W A;  3D4F A;  3PAE A;  5L07 A;  4GS9 A;  4KUK A;  5L10 A;  3UPP A;  4Y15 A;  4N1X A;  3LR5 A;  2XSS A;  4S2I A;  3A3J A;  3S22 A;  2Y2Q A;  4ZTK A;  1QME A;  1BZA A;  2Y2M A;  4HES A;  1ES2 A;  3QHY A;  4ZJ3 A;  5DF8 A;  5GL9 A;  3SS3 A;  3DTI A;  4H6J A;  3ZDJ A;  3VE3 A;  4I38 A;  2ACG A;  2M7U A;  1VHM A;  1YT4 A;  3LY4 A;  2Z2M B;  4GD8 A;  3JVU A;  3K3C A;  3FWL A;  5FDS A;  3N8S A;  4PM8 A;  2GZA A;  2W3G A;  3ZCZ A;  4JLF A;  1L0F A;  1N4O A;  3GSG A;  4R6L A;  3JVV A;  3CI6 A;  3TW8 A;  4NKP A;  2CC1 A;  3IF6 A;  3LCE A;  3VOL A;  1ZC2 A;  2LB9 A;  3RFB A;  5CTM A;  2XFS A;  3FPV A;  1EI5 A;  1D1J A;  1ERQ A;  2Y8H A;  3MSH A;  3BY9 A;  5DTK A;  5DJT A;  4B93 A;  2V2F F;  5E2G A;  1ALQ A;  3KX0 X;  4S2N C;  3VV4 A;  1F2K A;  3B42 A;  5E2E A;  2EX2 A;  1CEF A;  3UE1 A;  3G30 A;  1IFQ A;  3CUE A;  2JE5 A;  1JWP A;  3NUL A;  1H8Y A;  1P9W A;  2IWD A;  3FKW A;  1OJ5 A;  2OOL A;  4GLQ A;  4EBN A;  3DWK A;  1XFN A;  4QB8 A;  2ZL1 A;  1PRQ A;  1T18 A;  3AGF A;  4HNB A;  1I5Q A;  4UAA A;  5HDC A;  1OPX A;  1S1Z A;  3NHQ A;  4JXV A;  4KUO A;  2ZQC A;  3IHA A;  1S6R A;  1CF0 A;  3IH8 A;  3S1Y A;  3L9K A;  4X53 A;  1HD8 A;  2OWH A;  3EEA A;  2HP6 A;  2EXB A;  1DRM A;  4JGQ A;  5F69 A;  2PYR A;  4I5S A;  1CQA A;  1TVF A;  5EVL A;  1N9O A;  2XA7 S;  3WS1 A;  3MFD A;  1MWS A;  4H8R A;  3ZG0 A;  5MC7 A;  3HVF A;  1MPL A;  3DTE A;  3BJN A;  3EGX C;  1TD5 A;  3HJI A;  2D01 A;  4NG2 A;  5G4Z A;  4PHT A;  4OPQ A;  1FOF A;  3N8R A;  3HLW A;  5EVI D;  5GLD A;  4KZ3 A;  2BLS A;  1MWR A;  1BLS A;  2HV1 A;  2WKR A;  3N4I A;  2ZLY A;  2GDN A;  4RX2 A;  5AQ9 A;  3G35 A;  4Y5F A;  3QP1 A;  1D06 A;  1OTE A;  3VOZ A;  1E4D A;  4PM6 A;  2KOI A;  5HAI A;  1K25 A;  3T4O A;  1K55 A;  2K31 A;  1TF1 A;  2WGV A;  5EEC A;  1ZTU A;  2EX8 A;  1XFQ A;  4WYY A;  3DAV A;  5HL6 A;  4QPR A;  3U2A A;  3UB8 A;  4D60 A;  2WK0 A;  3LY3 A;  4HBU A;  4MEZ A;  1KE3 A;  4GHI B;  3FG8 A;  4PKY G;  3JYI A;  2ZOI A;  4EW7 A;  1RCJ A;  3PBO A;  1YLT A;  3UE6 A;  2R9X A;  2UV0 E;  2MJ6 A;  2WKE A;  3EOI A;  4KZ6 A;  4X68 A;  3UME A;  2E8J A;  5EOO A;  4DE2 A;  5FL3 A;  1W8Y A;  4MDZ A;  1XGJ A;  4Z1W A;  2ZC4 B;  2M7V A;  4YFM A;  3TRC A;  4QHC A;  2JKG A;  3UDX A;  3T4K A;  3TOI A;  3HJK A;  1FCN A;  1DP9 A;  4C75 A;  4LPZ A;  4QD4 A;  2XR0 A;  4F3L A;  2XFT A;  3PBT A;  4R4S A;  5IS1 A;  2KLI A;  1DY6 A;  1ESI A;  3QNB A;  3VP0 A;  1Y28 A;  4ZAM A;  5GLC A;  3C4O A;  3W4O A;  5AQA A;  1GSX A;  1MY8 A;  2V1B A;  3Q81 A;  1T1A A;  3BY8 A;  2J7V A;  4EWF A;  4QU3 A;  1Z09 A;  3CG5 A;  1NXY A;  4PM9 A;  3WRT A;  2G7U A;  3MQ0 A;  1IKI A;  2EWV A;  1PZP A;  3BFC A;  3UE3 A;  5CHJ A;  1BLC A;  3G34 A;  3IWO A;  4R38 A;  3I7J A;  2GNX A;  5M1A A;  3PHY A;  3SW1 A;  4HH2 A;  2HP9 A;  1OT9 A;  3OPP A;  4DE0 A;  2XH9 A;  3KSI A;  4DDY A;  3CPT A;  3MJQ A;  2J80 A;  3FZC A;  3W2Z A;  3PXP A;  3UPO A;  4JGP A;  2G2U A;  2O99 A;  1NLZ A;  1LL5 A;  1PWC A;  5D3O A;  4EES A;  2WAE A;  5EPH A;  5DJU A;  1S4S A;  3KYZ A;  1IYS A;  1J3W A;  2PHY A;  3WWX A;  3A0S A;  2W27 A;  3IX4 A;  2FFY A;  5FQJ A;  2P04 A;  2VEA A;  1S66 L;  1N9L A;  1N9N A;  3F1N B;  5FAP A;  4MN5 A;  4WEL A;  2EWW A;  4JXS A;  3WS5 A;  3N7W A;  1ERO A;  4EEU A;  1PZO A;  1YLP A;  3OC2 A;  1W7F A;  4IJG A;  5A93 A;  4WZ5 A;  5JYP A;  4S2M A;  1GCE A;  3F1O B;  1XA1 A;  1K4E A;  4HHD A;  4QWO A;  4CLC B;  1BYW A;  2ZQA A;  2R9W A;  3OLO A;  1ONG A;  3NC8 A;  4X25 A;  2X02 A;  2KX6 A;  2W1T B;  3GTC A;  4O8G A;  3CWF A;  1PFL A;  5U47 A;  5FDH A;  4JPM A;  2WKH A;  3IXD A;  4CPK A;  3O86 A;  5CXW A;  1MKM A;  2I72 A;  2ZC3 B;  5DTT A;  3DBA A;  3CMZ A;  4JXG A;  1U60 A;  2JHE A;  4GB7 A;  1AWI A;  1LT0 A;  5F6A A;  1E3U A;  3WS4 A;  3BWL A;  4ESP A;  3O3V A;  4FUW A;  4YNR A;  1T1B A;  3GRJ A;  4WBG A;  3SS4 A;  4DF6 A;  3A3I A;  2O9C A;  1X0O A;  4DJ2 A;  2L0W A;  4OKP A;  5JYO A;  1FR1 A;  5BOH A;  4MBH A;  1I2S A;  3R7W A;  3VP2 A;  3O88 A;  3MZF A;  1F5M A;  3VP4 A;  4HY8 A;  4Y17 A;  3UO9 A;  3V39 A;  1W63 Q;  2A3U A;  2P08 A;  5F82 A;  2ZQD A;  4BEN A;  4X1M A;  3HL9 A;  2L4R A;  4KQD A;  4CLC C;  3DWZ A;  4OLD A;  4IVK A;  2VJW A;  3T1X A;  3NJA A;  2Y2L A;  3MQQ A;  3NIA A;  4KZ8 A;  4DDS A;  4L9E A;  3SH7 A;  4OON A;  4WEJ A;  2YKF A;  2ZM2 A;  4BD1 A;  5J7E A;  3MFX A;  1JTG A;  1XJ2 A;  3TE8 A;  4KQO A;  5HDD A;  2DNS A;  1MBL A;  3P01 A;  1S67 L;  4YIN A;  3OOV A;  2VGL S;  4O0P A;  1XKZ A;  4OLG A;  3WS2 A;  4YWZ A;  3FV7 A;  1H8Z A;  5EVI C;  3AGE A;  3F1P B;  2X01 A;  3IS2 B;  1YSQ A;  5HWT A;  2PU2 A;  2V20 A;  2V0U A;  3IHB A;  4MBK A;  4JBF A;  4KZ4 A;  3IXB A;  3UPN A;  1ZG6 A;  4JXW A;  1W5D A;  4ME4 A;  3BFF A;  4A5R A;  2OWJ A;  2HPB A;  4EQI A;  5FA7 A;  4E3N A;  4S2N A;  4NXF A;  3HUM A;  1UWN X;  2PYP A;  2FZ0 A;  2ZMA A;  3T4L A;  1MZU A;  1YKD A;  3GMW A;  3BYD A;  3E2L A;  4KG6 A;  3G4P A;  4ZDX A;  4BBT A;  1SKO A;  4OOY A;  3E0Y A;  4E3I A;  4BWI A;  2WKQ A;  2XD1 A;  4OQH A;  2B18 A;  3IF5 A;  3GEC A;  4NXB A;  3SH8 A;  3E4O A;  2PU4 A;  3CAX A;  1ZHH B;  1SDN A;  2ZQ9 A;  3RXX A;  3G32 A;  2J3T C;  4BLM A;  4GS9 B;  3HLE A;  3BEB A;  1V9Y A;  3G6O A;  3KYE A;  3U4L P;  1K56 A;  4NK3 A;  5DVA A;  2NUP C;  1SZV A;  3MKF A;  5FQI A;  2OAQ 1;  1KGE A;  3E4Q A;  3UY6 A;  2HP5 A;  4OH0 A;  3KSG A;  2JKF A;  5HAP A;  1CEG A;  3V67 A;  1RGY A;  1XA7 A;  2OAP 1;  3FYZ A;  1YAX A;  1SCW A;  5K5B A;  3A0V A;  1K57 C;  1VEU B;  2ZBB A;  1HLU P;  2JKR M;  1PI5 A;  1PIO A;  3VMA A;  1M40 A;  2VKS A;  3LGO A;  3IXG A;  5DKK A;  5IU1 A;  3WRZ A;  5FQQ A;  4G3W A;  4XT2 A;  2M1C A;  5F1F A;  5FI7 A;  3C4P A;  1XP4 A;  1P9R A;  5CX7 A;  3A3F A;  3P09 A;  3T4S A;  3H82 A;  3IF6 B;  5TBM A;  2V9A A;  1LSV A;  1C3B A;  2J8Y A;  4HH3 A;  4BL2 A;  4IBR A;  4NET A;  1KDW A;  1VET A;  5HSQ A;  4CLC D;  3KYQ A;  4HJ6 A;  1M6K A;  2XRO A;  5CEC A;  3G2Z A;  2R78 A;  5J4E A;  4KZ5 A;  1HVB A;  4U3T A;  1CI9 A;  1YSP A;  1H5X A;  3ZG5 A;  1S1Y A;  3TJZ C;  4LRZ E;  5E2H A;  3MF0 A;  5FQK A;  2QJ7 A;  2H28 A;  5HAQ A;  1G6A A;  2B95 A;  2JC7 A;  2ZM8 A;  3VFF A;  1SHV A;  4CQH A;  3W4Q A;  4Y0T A;  2ZL1 B;  4X56 A;  3V50 A;  4OPR A;  2X71 A;  1S4R A;  2CMN A;  2HGV A;  4BD0 A;  3BLM A;  1Q2P A;  2O9B A;  4DMZ A;  2PD7 A;  1JNU A;  3SOI A;  3QP5 A;  2OLU A;  5L09 A;  3B33 A;  4OP8 A;  5E2F A;  1XGI A;  3ZNY A;  1Q2Q A;  2D02 A;  4Z9Q A;  3FC7 A;  4XXR A;  3VOY A;  3HLC A;  5F5Y A;  3C7U A;  4PM7 A;  2J3W A;  1L0E A;  3V3S A;  3JPU A;  3LIC A;  1FSW A;  1BLP A;  3UB5 P;  1AXB A;  1ZKJ A;  3UB7 A;  5HAR A;  5KZH A;  2XD5 A;  3W8K A;  2Z2L B;  3E2K A;  1ES4 A;  4EXO A;  3LIB A;  4KZ9 A;  4L9G A;  1TS7 A;  3NCK A;  5AJG A;  4JF4 A;  4FOF A;  3FPW A;  4WF0 A;  3RXW A;  1W79 A;  2H5S A;  3UB6 A;  4OP5 A;  2VV8 A;  3C30 A;  3ZYT A;  2INW A;  3S7O A;  2C6W B;  2HJ9 C;  3LR0 A;  4IED A;  2PAV P;  2J3T D;  2Y4A A;  4MBF A;  4B4X A;  4GW9 A;  4EUZ A;  4WUJ A;  1IKG A;  3ZVW A;  3BM6 A;  3RH8 B;  5HWW A;  4LV1 A;  4ARZ A;  4R1G A;  4P0M A;  5CGX A;  3OCN A;  4R3B A;  5HPF A;  4ZRR A;  2AVX A;  3PR6 A;  4OPZ A;  3KO6 A;  4EQ1 A;  2B02 A;  2VK3 A;  1Y54 A;  4E3K A;  4U0X A;  4R23 A;  3D72 A;  4YOF A;  5FEG A;  3IWI A;  3GR2 A;  2GJ3 A;  5HWV A;  2QHK A;  2IWB A;  4WMC D;  4ETZ A;  3CHW P;  2WAD A;  3BFD A;  2K2N A;  2KDK A;  5L2F A;  3MS6 A;  4F3L B;  1XJ6 A;  4U0T A;  3BFE A;  2EXA A;  4PKY A;  2E8I A;  2HZ5 A;  2HDS A;  2HDU A;  1NYM A;  3UE0 A;  4DXB A;  4EUV A;  2Q9M A;  4EBP A;  1K55 C;  1YQS A;  4BQM A;  2QZ6 A;  4LCM A;  2Z6C A;  4D2O A;  5GLB A;  4NEE D;  1LI9 A;  2BG1 A;  3K2N A;  2JKR I;  1YLW A;  1YMX A;  3S7P A;  1XJ3 A;  2P9V A;  4KG2 A;  3BRM A;  2OV5 A;  5EOE A;  3HLG A;  1EW0 A;  2ZMV A;  5HFO A;  2Y2G A;  4L9F A;  4S2L A;  3H9W A;  2A24 A;  4E3M A;  4MLL A;  1NYY A;  3C38 A;  1ZG4 A;  1QMF A;  2W3H A;  4Q8I A;  2V8C A;  3VSL A;  1XXM A;  3S4X A;  4K0W A;  3MKE A;  4X6T A;  1RGZ A;  1F9I A;  1TEM A;  1H3Q A;  4GKU A;  2O0Y A;  3CPT B;  2ZC7 A;  1G5U A;  4CLC A;  4EER A;  3NBL A;  4LV2 A;  3PTE A;  4RVA A;  3K3D A;  3QP2 A;  2V1A A;  2IA2 A;  1GSV A;  3QNC A;  2Y79 A;  5EUA A;  4JF5 A;  4KQR A;  4BMW A;  4S2J A;  1IYO A;  1HZO A;  3G2Y A;  3GDI A;  1IEM A;  1KE4 A;  1IYP A;  4B9O A;  1WYB A;  3SZT A;  4HEF A;  5M18 A;  1K6S A;  4CLC E;  5EV0 A;  2XK1 A;  3BQ8 A;  3KSF A;  3HUO A;  1FCO A;  1F98 A;  3IWQ A;  5KIZ A;  1KGF A;  3BLS A;  2GX5 A;  5HD5 A;  5HL1 A;  5EVI A;  4N1H A;  1PNE A;  4GZB A;  3H7W B;  4KQQ A;  4OPY A;  1WE4 A;  3A0R A;  3HLF A;  3QP6 A;  2BTF P;  3PYP A;  1NJ4 A;  2RCX A;  3P7N A;  2DMW A;  3DTK A;  1TS8 A;  2XF3 A;  1KDS A;  1UWP X;  5G18 A;  5CGS A;  3LI8 A;  3HRE A;  4FSF A;  3NDE A;  3MZE A;  4I3I A;  1PWD A;  4X55 A;  3OZH A;  4CJN A;  4KZB A;  1GHM A;  1GHI A;  3O5Y A;  3Q7V A;  4GJ4 A;  4GNU A;  4QY6 A;  2WGW A;  2WZX A;  4BBU A;  2HDQ A;  3ZFZ A;  3VE4 A;  4KG5 A;  3ZHH A;  3R7W B;  1NRJ A;  1YM1 A;  4MCW A;  2OLV A;  4HJ4 A;  1G28 A;  4WN5 A;  2ZM0 A;  5CGW A;  4Y3I A;  2PDR A;  1T19 A;  2FH5 A;  2Y2N A;  4P85 A;  5FAO A;  3LYX A;  2EX6 A;  3UB9 A;  4C3Q A;  4S2O A;  5GHX A;  1KVM A;  1O7E A;  5F83 A;  3N8L A;  4JKT A;  5KSC A;  4MNR A;  5KSH A;  3PBN A;  5CEB A;  1Z6F A;  1YLY A;  1OTI A;  3T1Q B;  1IYQ A;  5IT5 A;  2VX8 A;  3DW0 A;  3OPR A;  2Y59 A;  4LEN A;  4AFI A;  1D7E A;  2HF6 A;  1PI4 A;  5TGF A;  5CER A;  3LR4 A;  1GA9 A;  2YKH A;  2ZC5 B;  4EET B;  4P6Z M;  1L0G A;  1V9Z A;  3FKV A;  3W4P A;  3LEQ A;  4IUH A;  4F94 A;  4OVD A;  1LL9 A;  4X1L A;  3C8C A;  1DJC A;  1VB6 A;  1CI8 A;  3RJU A;  1YMS A;  5FAT A;  4M3K A;  3CIT A;  4O7D A;  3IX3 A;  4HJ3 A;  5F68 A;  1S0W A;  1NZU A;  5IHV A;  3QP4 A;  5A90 A;  1VM1 A;  1LSX A;  1CJF A;  1P97 A;  1KOU A;  3BW6 A;  1H0M A;  4PMA A;  4PPR A;  1NWZ A;  3CLO A;  3CJM A;  1W8Q A;  3IX8 A;  4Q0H A;  2QKP A;  3MXS A;  2PR6 A;  1T1C A;  3LIF A;  5A92 A;  4LV3 A;  2WAF A;  4OOM A;  3UN7 A;  3D9Y A;  1KE0 A;  1MWT A;  3GVB A;  1BTL A;  3C2W A;  3ISG A;  3HUN A;  1OJG A;  5FQM A;  3ITB A;  3NI9 A;  4HI4 A;  3EQV A;  5EE8 A;  5EFW A;  2Y2H A;  5TJJ A;  1NZO A;  3P98 A;  1I2W A;  1SKO B;  4IBX A;  2JN7 A;  3B47 A;  1FCM A;  4E3J A;  1XJ4 A;  5J3W A;  3D3O A;  4MN6 A;  5TFQ A;  1VEU A;  3MMH A;  2HJE A;  4DE1 A;  4UQI M;  3NY4 A;  1G68 A;  2J9P A;  4H6J B;  1K54 C;  2IWC A;  4RX3 A;  5GHY A;  5AQB A;  1L0D A;  4UA7 A;  2PBY A;  1DP8 A;  2JCH A;  5GLA A;  3ICY A;  3SH9 A;  3MXQ A;  4HP4 A;  3NOT C;  4N92 A;  1KVL A;  1STZ A;  3A3E A;  4UEY A;  4WL9 A;  1LHY A;  3KSH A;  1TS0 A;  4NXE A;  5L8M A;  1OTD A;  2ZQ8 A;  4R3J A;  2K7S A;  1NY0 A;  4KEN B;  5DKL A;  4QJG A;  5C5K A;  3LID A;  3UMD A;  1ERM A;  2OSU A;  3ZG8 B;  1OT6 A;  4BL3 A;  4FCF A;  2PRF A;  1TS6 A;  3GQZ A;  4XT2 B;  4K08 A;  4G3K A;  1E25 A;  4HQA A;  1ODV A;  4O01 A;  3T1R A;  3H82 B;  5TBM B;  3NOP C;  4ETX A;  4II7 A;  4LLO B;  3EWK A;  1ESU A;  1PW8 A;  3V3R A;  1K6R A;  1CK3 A;  3MR0 A;  5G4Y A;  1VET B;  5FSR A;  2QPN A;  4OQI A;  4RYE A;  3EGD C;  1TDL A;  4DJ3 A;  3QP8 A;  3WS0 A;  3T50 A;  1PW1 A;  3V5M A;  2XLN A;  1A0K A;  3PAG A;  5LBR A;  3T4Q A;  3ZNT A;  4LRY C;  4E3O A;  4P6Z S;  1OTA A;  4Y7P A;  2Q9N A;  4Y0U A;  3M2J A;  1K38 A;  1FQG A;  2EFU A;  2Y2J A;  2Z6D A;  3OPH A;  1WA9 A;  3IF6 C;  5AQ7 A;  2ZOH A;  2WGI A;  3TSG A;  4IHQ A;  3UDI A;  4GD6 A;  2HDR A;  4EBL A;  4DKI A;  1E3U D;  2VZW A;  2G2W A;  5AVE A;  5HZH A;  4L0L A;  5TR7 A;  1GSW A;  4LRX C;  4FH2 A;  2A2L A;  4GHI A;  4KZ7 A;  4R3A A;  2NUT C;  2Y2O A;  4FTX A;  3HLB A;  1K0K A;  5KMW A;  4DE3 A;  3TG9 A;  4KZA A;  4BBV A;  4WLA A;  4K91 A;  2W1R A;  3CUE C;  4S2P A;  3RTY A;  5HPI A;  1H8M A;  2VA0 A;  4GDN A;  4B4Z A;  3A3D A;  4E3L A;  2P74 A;  3LO7 A;  2XRN A;  2UWX A;  1P0Z A;  4R4R A;  1N9B A;  1BT5 A;  2RL3 A;  1DJB A;  4NXG A;  3M6H A;  3NDG A;  3T1S A;  3LIE A;  1JWV A;  3BQA A;  4UQI S;  4HIA A;  4B88 A;  3VSK A;  3GV9 A;  2QJ5 A;  3NOU C;  4I3A A;  4GDB A;  3LUQ A;  1JTD A;  3T4T A;  2J9O A;  4C6Y A;  2ZQ7 A;  4ZJ1 A;  2XDM A;  5CHU A;  5HW3 A;  4WZ4 A;  3S7N A;  4EU0 A;  2EFX A;  3E4P A;  5CED A;  1LL8 A;  2PD8 A;  4UHU A;  3B3X A;  4JF6 A;  3ZG7 B;  4Y13 A;  3IQA A;  5EM1 A;  4RA7 A;  1ES3 A;  3M2K A;  1Y4O A;  4P87 A;  3MBZ A;  5FAQ A;  2Y55 A;  5DF7 A;  5AVF A;  5DFY A;  4ARZ B;  4LGW A;  1UGU A;  4WM9 A;  5CRF A;  2XGN A;  2H10 A;  1SDE A;  4HOI A;  1J9M A;  4N9K A;  2JKT M;  3O87 A;  3SS5 A;  1GHP A;  3HBR A;  1L3L A;  2I9V A;  3IH9 A;  3LI9 A;  2H0Y A;  4E04 A;  1ES5 A;  3MQO A;  4R0Q A;  1TDG A;  5CTN A;  1MKI A;  2DCF A;  3M6B A;  1BLH A;  3IBJ A;  4GN2 A;  2O9A A;  2PBD P;  3PBR A;  2FFF B;  2V1Z A;  4LV0 A;  1NRF A;  4IVI A;  4PM5 A;  1VQQ A;  4BJP A;  2BAS A;  4LFU A;  4GCZ A;  5DFX A;  5F1G A;  3F1N A;  5A91 A;  1PYY A;  1ONH A;  2P7J A;  4MMN A;  5HDS A;  5A8B A;  1MXO A;  2VGL M;  5FI2 A;  2WKI A;  1SKF A;  4WEK A;  3C7V A;  3OCL A;  2DRW A;  3CZD A;  3IXH A;  3F1O A;  2XEP A;  4UA6 A;  2P9V B;  2L1M A;  4QY5 A;  5FQ9 A;  3Q7Z A;  1DJA A;  3EEH A;  2VV7 A;  1G6O A;  1FR6 A;  3R4K A;  1K56 D;  4S2K A;  4HP9 A;  1JWZ A;  3HLD A;  2WUQ A;  3G31 A;  4DXC A;  2W1T A;  3LEZ A;  4DRT A;  4I3J A;  2W3E A;  2A49 A;  5I5L A;  2A24 B;  5DTS A;  4RQ9 A;  1W63 M;  3MZD A;  5EVE A;  3HCY A;  5FAS A;  2EX9 A;  3L7H A;  4EEP A;  4PAU A;  4ZBE A;  3IBR A;  3PBQ A;  4P6B A;  1RP5 A;  4MN7 A;  1PWG A;  1YLJ A;  1XX2 A;  3ZG9 B;  2Y2I A;  2W3D A;  1GA0 A;  4LCL A;  1YPR A;  2Q0O A;  3UDF A;  2JBF A;  3H7W A;  2H0T A;  2PT7 A;  3Q1F A;  5FI6 A;  5M19 A;  1XPB A;  4IUK A;  1FIK A;  4FD8 A;  4OQG A;  2PR5 A;  4E6X A;  4Q0J A;  3BEC A;  4M4X A;  3ULF A;  3N6I A;  1EWZ A;  3Q82 A;  2WYX A;  1WYC A;  4JGO A;  1O07 A;  4X69 A;  2VGJ A;  1BSG A;  1LI0 A;  1BUL A;  3LIA A;  1HTZ A;  2ZD8 A;  3ITA A;  3ZQ5 A;  3BFG A;  2VV6 A;  1FIL A;  3EQU A;  3OBF A;  5EVI B;  3T12 B;  5HX9 A;  5GHZ A;  4I39 A;  3S7Q A;  2WZZ A;  4G3V A;  1JVJ A;  1OTB A;  2V8F A;  2VGK A;  2QMI A;  3Q07 A;  2WKP A;  1IOU A;  2B5R A;  1LLB A;  3E98 A;  4DN0 A;  3NEC A;  1FSY A;  3VFH A;  4WZ5 C;  4Y0O A;  2QYB A;  4K0X A;  1NLY A;  2LB5 A;  1LSW A;  1ACF A;  1OME A;  4JGR A;  4ZJ2 A;  5EM0 A;  1K4F A;  2XQZ A;  2Y2P A;  5CHM A;  1IEL A;  4XUZ A;  3ZGA B;  3F1P A;  5J8X A;  2ZMF A;  3IS2 A;  4OOL A;  3MXR A;  3Q7V B;  4EV4 A;  4E6W A;  3PBS A;  4Y2F A;  2WGW B;  2EA9 A;  2VLG A;  2W3F A;  4N9L A;  3LFV A;  5E43 A;  1MWU A;  4HBT A;  2QWS A;  5I94 A;  4R70 A;  1MC0 A;  1BUE A;  1K54 A;  3T4J A;  1YLZ A;  3DTM A;  3LR3 A;  4GOG A;  2Y91 A;  1K57 A;  3VP3 A;  2XA7 M;  2JKT I;  4WMC A;  4FH4 A;  3IT9 A;  2W0N A;  3OPL A;  1DP6 A;  3UNW A;  5FEF A;  4UA9 A;  3ZVT A;  2ZC6 B;  2Y2K A;  2C5W B;  4ID4 A; 
#chains in the Genus database with same CATH homology
 4EQ1 A;  5TBM B;  2B02 A;  1MKM A;  3NOP C;  4ETX A;  4II7 A;  4LLO B;  3EWK A;  4Q0I A;  5DF9 A;  3D72 A;  4YOF A;  5HD3 A;  3MR0 A;  5G4Y A;  3DBA A;  2GJ3 A;  3EGD C;  2V0W A;  5HWV A;  2JHE A;  1LT0 A;  4DJ3 A;  5F6A A;  2QHK A;  4ETZ A;  3T50 A;  4GS9 A;  3BWL A;  2K2N A;  4KUK A;  2KDK A;  4YNR A;  1T1B A;  5LBR A;  3T4Q A;  4F3L B;  1XJ6 A;  4LRY C;  3LR5 A;  2XSS A;  4P6Z S;  1OTA A;  2O9C A;  4PKY A;  1X0O A;  4DJ2 A;  2L0W A;  4EUV A;  2Z6D A;  3R7W A;  2Z6C A;  1WA9 A;  2ZOH A;  1F5M A;  4HY8 A;  4NEE D;  4IHQ A;  3K2N A;  2JKR I;  1W63 Q;  4H6J A;  2P08 A;  3VE3 A;  3S7P A;  4I38 A;  1XJ3 A;  2VZW A;  2M7U A;  5AVE A;  5HZH A;  4L0L A;  1GSW A;  1VHM A;  1EW0 A;  2L4R A;  2ZMV A;  4KQD A;  4LRX C;  4CLC C;  2A2L A;  4GHI A;  2VJW A;  4R3A A;  3JVU A;  3K3C A;  2NUT C;  3NJA A;  4L9F A;  2GZA A;  2W3G A;  3H9W A;  3MQQ A;  2A24 A;  4L9E A;  4BBV A;  4R6L A;  4WLA A;  3JVV A;  3C38 A;  3CI6 A;  2W3H A;  2W1R A;  3CUE C;  3TW8 A;  3RTY A;  4NKP A;  5HPI A;  1H8M A;  2VA0 A;  3VOL A;  4WEJ A;  2LB9 A;  1F9I A;  2YKF A;  3RFB A;  5J7E A;  3MFX A;  1H3Q A;  1XJ2 A;  3TE8 A;  2O0Y A;  4KQO A;  5HDD A;  2XRN A;  3FPV A;  1P0Z A;  2Y8H A;  3P01 A;  4CLC A;  1S67 L;  3BY9 A;  4EER A;  5DJT A;  4B93 A;  3OOV A;  2VGL S;  4O0P A;  4NXG A;  4YWZ A;  3KX0 X;  3LIE A;  3K3D A;  3VV4 A;  3BQA A;  4UQI S;  4HIA A;  2V1A A;  2IA2 A;  3B42 A;  2QJ5 A;  3NOU C;  1GSV A;  4I3A A;  3LUQ A;  1IFQ A;  3CUE A;  2Y79 A;  3F1P B;  3IS2 B;  3T4T A;  1YSQ A;  5HWT A;  4BMW A;  1P9W A;  1OJ5 A;  2V0U A;  2OOL A;  4GLQ A;  1XFN A;  3GDI A;  3S7N A;  1T18 A;  4HNB A;  4B9O A;  4EU0 A;  5HDC A;  1OPX A;  3E4P A;  1LL8 A;  2PD8 A;  1S1Z A;  3NHQ A;  4CLC E;  4ME4 A;  3BQ8 A;  3KSF A;  4KUO A;  1F98 A;  2OWJ A;  5KIZ A;  2OWH A;  3EEA A;  2GX5 A;  5HD5 A;  4NXF A;  1DRM A;  5AVF A;  4JGQ A;  1UWN X;  5F69 A;  2PYR A;  2PYP A;  2FZ0 A;  4I5S A;  3H7W B;  5DFY A;  3T4L A;  1MZU A;  3A0R A;  4ARZ B;  1UGU A;  1YKD A;  3PYP A;  1N9O A;  2XA7 S;  3P7N A;  2DMW A;  4HOI A;  4BBT A;  2JKT M;  5MC7 A;  1TS8 A;  3BJN A;  2I9V A;  3E0Y A;  3EGX C;  4BWI A;  2WKQ A;  1TD5 A;  3HJI A;  3LI9 A;  2B18 A;  1UWP X;  3GEC A;  2D01 A;  4NXB A;  5G4Z A;  4E04 A;  3E4O A;  3MQO A;  3LI8 A;  3CAX A;  4PHT A;  1ZHH B;  3IBJ A;  2O9A A;  4FSF A;  2J3T C;  4GS9 B;  4I3I A;  2HV1 A;  2WKR A;  1V9Y A;  3PBR A;  3G6O A;  4BJP A;  2BAS A;  3O5Y A;  4GCZ A;  4GJ4 A;  4Y5F A;  2NUP C;  1D06 A;  5DFX A;  1OTE A;  3F1N A;  4BBU A;  2KOI A;  3VE4 A;  5HDS A;  2P7J A;  4MMN A;  5A8B A;  3T4O A;  2OAQ 1;  3E4Q A;  2K31 A;  2VGL M;  1TF1 A;  3R7W B;  3KSG A;  1NRJ A;  4MCW A;  1ZTU A;  1XFQ A;  4WEK A;  4HJ4 A;  1G28 A;  3OCL A;  4WN5 A;  4Y3I A;  5HL6 A;  2PDR A;  1T19 A;  4QPR A;  3U2A A;  2FH5 A;  3V67 A;  3F1O A;  3UB8 A;  2L1M A;  2OAP 1;  5K5B A;  1YAX A;  3LYX A;  3UB9 A;  3A0V A;  3EEH A;  2VV7 A;  1G6O A;  3R4K A;  2ZBB A;  2JKR M;  4GHI B;  3FG8 A;  4HP9 A;  2VKS A;  4PKY G;  5DKK A;  5KSH A;  5IU1 A;  2ZOI A;  2W1T A;  3PBN A;  4EW7 A;  4G3W A;  4XT2 A;  3PBO A;  2M1C A;  2W3E A;  4I3J A;  5I5L A;  2A24 B;  3UE6 A;  4RQ9 A;  1OTI A;  1W63 M;  1P9R A;  5CX7 A;  3HCY A;  2MJ6 A;  3UME A;  3EOI A;  3T4S A;  5IT5 A;  3H82 A;  5TBM A;  2V9A A;  1LSV A;  5FL3 A;  2VX8 A;  4MDZ A;  4Z1W A;  4HH3 A;  4EEP A;  2M7V A;  4PAU A;  3TRC A;  3IBR A;  3PBQ A;  4AFI A;  1D7E A;  2HF6 A;  4MN7 A;  5HSQ A;  3LR4 A;  3T4K A;  2YKH A;  2W3D A;  4CLC D;  4EET B;  3KYQ A;  4HJ6 A;  4P6Z M;  1V9Z A;  3HJK A;  2XRO A;  4IUH A;  3H7W A;  2R78 A;  1DP9 A;  5J4E A;  3C8C A;  4LPZ A;  4F3L A;  1VB6 A;  1YSP A;  2PT7 A;  3PBT A;  5IS1 A;  2KLI A;  1S1Y A;  3TJZ C;  4LRZ E;  3CIT A;  1Y28 A;  3MF0 A;  2QJ7 A;  2H28 A;  1GSX A;  2V1B A;  4HJ3 A;  4IUK A;  5F68 A;  1T1A A;  3BY8 A;  2PR5 A;  1LSX A;  4Q0J A;  4CQH A;  1P97 A;  1KOU A;  3BW6 A;  4M4X A;  3ULF A;  2G7U A;  1S4R A;  2CMN A;  1NWZ A;  3CLO A;  3MQ0 A;  2HGV A;  4JGO A;  2EWV A;  2O9B A;  4Q0H A;  4DMZ A;  3UE3 A;  2PD7 A;  1JNU A;  2QKP A;  3LIA A;  4R38 A;  2PR6 A;  1T1C A;  3ZQ5 A;  3LIF A;  2VV6 A;  3B33 A;  4OOM A;  2GNX A;  3EQU A;  3OBF A;  3C2W A;  1OJG A;  4I39 A;  2D02 A;  3PHY A;  3S7Q A;  3FC7 A;  3SW1 A;  4HI4 A;  3EQV A;  4HH2 A;  4G3V A;  5EFW A;  1OT9 A;  5TJJ A;  1OTB A;  5F5Y A;  3KSI A;  2JN7 A;  3B47 A;  3MJQ A;  2J80 A;  2WKP A;  1IOU A;  2J3W A;  1XJ4 A;  3E98 A;  3D3O A;  3PXP A;  4MN6 A;  5J3W A;  3W2Z A;  4DN0 A;  3MMH A;  4JGP A;  2O99 A;  2HJE A;  3LIC A;  1NLZ A;  4UQI M;  4H6J B;  4EES A;  2QYB A;  1NLY A;  3UB7 A;  2LB5 A;  1LSW A;  4JGR A;  5DJU A;  1S4S A;  3KYZ A;  1DP8 A;  2PHY A;  3ICY A;  3A0S A;  2W27 A;  3MXQ A;  4EXO A;  3LIB A;  3F1P A;  2ZMF A;  3IS2 A;  4L9G A;  4HP4 A;  4OOL A;  3NOT C;  2P04 A;  2VEA A;  1S66 L;  1N9L A;  1TS7 A;  3PBS A;  4Y2F A;  1N9N A;  2EA9 A;  3F1N B;  5AJG A;  4MN5 A;  4WEL A;  2EWW A;  1STZ A;  4FOF A;  3FPW A;  2VLG A;  2W3F A;  4UEY A;  4WF0 A;  4WL9 A;  3LFV A;  3UB6 A;  4EEU A;  3KSH A;  2VV8 A;  3C30 A;  1TS0 A;  4NXE A;  3OC2 A;  4IJG A;  2QWS A;  1OTD A;  5L8M A;  4R70 A;  1MC0 A;  3ZYT A;  2INW A;  2K7S A;  3S7O A;  5DKL A;  3LR0 A;  2HJ9 C;  3T4J A;  5C5K A;  3F1O B;  2J3T D;  3LR3 A;  3LID A;  3UMD A;  4GW9 A;  4HHD A;  1OT6 A;  4WUJ A;  4CLC B;  1BYW A;  2XA7 M;  3RH8 B;  2JKT I;  5HWW A;  3OLO A;  4ARZ A;  2KX6 A;  3OCN A;  2W0N A;  1DP6 A;  2W1T B;  1TS6 A;  4XT2 B;  4K08 A;  4O8G A;  3CWF A;  4G3K A;  5HPF A;  4ZRR A;  4HQA A;  1ODV A;  4O01 A;  3PR6 A;  3KO6 A;  3H82 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...