4I38A

Structures of it intermediates from time-resolved laue crystallography collected at 14id-b, aps
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Luminescent protein
molecule keywords Photoactive yellow protein
publication title Volume-conserving trans-cis isomerization pathways in photoactive yellow protein visualized by picosecond X-ray crystallography
pubmed doi rcsb
source organism Halorhodospira halophila
total genus 36
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2012-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4i38A00
4K08A 5HDSA 4HJ4A 4LLOB 3OLOA 1OT6A 2KDKA 2L1MA 4GCZA 3NOTC 3UB6A 4GHIB 4WN5A 5A8BA 3BY9A 2WKRA 2WKPA 2L4RA 3MR0A 4JGRA 3ICYA 2JN7A 2PR5A 2PD8A 4EEPA 3MQQA 4HH2A 1D06A 1LSVA 1TS0A 3MJQA 4R3AA 5HSQA 4E04A 3F1OB 4HOIA 4L9GA 3LICA 2B02A 2QHKA 4BBTA 4B9OA 4H6JB 1P97A 2VV6A 4GS9B 1OJGA 3E4QA 2Z6CA 1GSWA 2QJ5A 2W0NA 4HQAA 5IU1A 3UB8A 3VOLA 2D01A 3HJKA 3UE6A 1F98A 1BYWA 1OJ5A 1OTDA 1N9OA 4GHIA 3GDIA 3FC7A 3VE3A 1VB6A 1DRMA 3H7WB 1N9LA 4KUOA 1TS8A 4I39A 4HJ6A 2Z6DA 4R70A 3NJAA 1S67L 3CLOA 2EA9A 5G4ZA 5HWVA 4HHDA 3LIFA 2PR6A 2PD7A 3F1OA 2P7JA 3MXQA 3T50A 3A0RA 4GW9A 4EW7A 3B33A 2VV7A 2GJ3A 1TS6A 2W27A 3LYXA 1X0OA 4H6JA 1MZUA 4L9EA 3ZQ5A 4GS9A 3K3DA 4HH3A 4YWZA 4R6LA 5I5LA 1NWZA 2YKFA 5DJUA 1P0ZA 3H7WA 5J4EA 3MQOA 2K7SA 1WA9A 3CWFA 4EQ1A 1OTEA 1S4SA 3D72A 1G28A 4NXEA 2PDRA 4JGPA 2OOLA 2OWHA 1JNUA 1GSXA 4BBUA 3IBRA 4WLAA 5HDDA 3IS2B 5F69A 4PKYA 3LIEA 4HP9A 5DKLA 4HI4A 1V9YA 3A0VA 3LIBA 3FG8A 4NXFA 1TS7A 3KX0X 4KUKA 2VV8A 4WUJA 2PYRA 3LIDA 4NXBA 4WL9A 2ZBBA 3C8CA 4MN6A 2WKQA 3BWLA 3EEHA 5IS1A 2VLGA 4XT2B 5F68A 4KQDA 3G6OA 3C2WA 5J3WA 2JHEA 2QWSA 4I3IA 1T18A 4LRYC 4HP4A 5TBMB 2PYPA 1XJ4A 3CAXA 3NOUC 4EERA 3PHYA 4DJ2A 1XJ3A 3E4OA 5HWWA 1XFNA 2KX6A 1XJ2A 5HD3A 1KOUA 4HNBA 3VE4A 3IS2A 4I5SA 5F5YA 2QKPA 4DJ3A 3NOPC 5G4YA 1OTAA 4JGQA 2HV1A 1UWPX 4MN5A 1GSVA 1OT9A 4HIAA 1UGUA 3MFXA 4M4XA 1OTBA 5HDCA 4LPZA 3LIAA 2V0WA 3K3CA 1OTIA 1S4RA 4XT2A 1DP8A 4EEUA 2V9AA 1S66L 1UWNX 4I3JA 2L0WA 4EETB 1LL8A 5AVFA 5HZHA 2V0UA 3F1PA 4NXGA 4EXOA 3H82A 5TBMA 3SW1A 4BBVA 2H28A 4WF0A 5EFWA 5HD5A 4LRXC 3UB9A 4F3LB 1V9ZA 3RH8B 2J80A 3EWKA 2OWJA 4EESA 3H9WA 1T1BA 5F6AA 3F1NB 3E4PA 4PKYG 3LI9A 3UMDA 3LUQA 2BASA 2A24A 2INWA 2CMNA 4L9FA 2V1BA 4JGOA 3LI8A 5KIZA 5DKKA 1N9NA 1T1CA 2R78A 3GECA 2PHYA 4I3AA 1T19A 1S1ZA 3P7NA 1DP9A 2YKHA 4LRZE 3F1PB 1ODVA 1LSXA 5DJTA 2QJ7A 3H82B 1DP6A 3NHQA 2VEAA 1XJ6A 5AVEA 3PYPA 3ULFA 2I9VA 4F3LA 1F9IA 4I38A 5HWTA 4RQ9A 5J7EA 3F1NA 1EW0A 2V1AA 2M1CA 1Y28A 2A24B 2ZOIA 3RTYA 4HJ3A 3UMEA 1LSWA 3BY8A 4HY8A 1S1YA 1LT0A 2D02A 3A0SA 3UB7A 4R38A 3HJIA 1T1AA 2ZOHA 1D7EA 1XFQA
chains in the Genus database with same CATH superfamily
4K08A 1NLYA 3LY3A 3UY6A 1E4DA 1OT6A 4A5RA 4Q0HA 2L1MA 4EU0A 2BLSA 4WBGA 1BULA 3IBJA 2ZJ9A 2Y2NA 2ZC5B 1JWVA 5AQBA 5IHVA 4QWOA 5A92A 4X25A 3OPLA 5CEDA 3UB6A 2LB9A 4U3TA 3UPNA 2Y2OA 2WKRA 4QD4A 2PR5A 4WM9A 5AQ9A 2VK3A 1H8MA 4EEPA 3MQQA 4HH2A 2VA0A 4E6XA 1D06A 3U4LP 2Y2QA 3S7OA 4DE2A 2ZC3B 5HSQA 1G6OA 4FOFA 3Q7VB 4UA6A 1Q2PA 3IXBA 5L8MA 4KG6A 3ZG0A 2QPNA 5HFOA 1PFLA 1CJFA 2EXBA 2PU4A 1PYYA 3BLMA 3GMWA 3O88A 5CTMA 2Y8HA 2O9CA 2QHKA 4BBTA 3HL9A 4B9OA 1YT4A 2XROA 4OQGA 3G32A 5L10A 3OPRA 1OJGA 2KLIA 1L0DA 2ACGA 4ZAMA 2HF6A 5IU1A 2ZMVA 1HZOA 1STZA 1FOFA 3G2ZA 3S7NA 4OONA 5CGWA 5TR7A 3BQ8A 4MDZA 1DRMA 3H7WB 4R4RA 3VSKA 1N9LA 5GHXA 1FILA 3B42A 3QP8A 1IELA 3WRZA 2EWWA 4KZ3A 1CI9A 1S67L 5FL3A 5G4ZA 1JWPA 3GQZA 2B95A 3HCYA 5HWVA 1PNEA 4X1LA 4DXBA 4S2IA 3Q7VA 4JLFA 1YM1A 5HAIA 4JF4A 3MXQA 3A3EA 5DTTA 2V2FF 4EBLA 4GW9A 1ES2A 4PM7A 3R4KA 3UDFA 2VV7A 1H5XA 1TS6A 3LYXA 1X0OA 3DWZA 4B4ZA 4L9EA 2H10A 3HLBA 3IH9A 3SH9A 3RXXA 4S2LA 3CMZA 3VV4A 3CUEA 4ZJ1A 1NWZA 3T1RA 1NZOA 4LV3A 4BENA 4HESA 5FSRA 4DKIA 3H7WA 2X02A 4MMNA 2K7SA 1OTEA 1SDNA 4BMWA 2XQZA 4UHUA 4BBUA 2GNXA 4WLAA 1JWZA 1MY8A 1XP4A 3BLSA 1W5DA 5F69A 4LENA 4P6ZS 4HP9A 1ZHHB 1V9YA 4IEDA 3MQ0A 1K6RA 1ZTUA 3O3VA 5FATA 3K2NA 3PAEA 1LLBA 3IWIA 1M6KA 4NK3A 4DE1A 5FQJA 4X55A 4MN6A 1J9MA 1PWDA 3BWLA 5F68A 3ZVTA 2Y2GA 3WS2A 5HL1A 1I2WA 2K2NA 3G6OA 3DTEA 2JHEA 4GD6A 4E3NA 3OZHA 2QWSA 4I3IA 3RFBA 4LRYC 1NZUA 5G18A 2P08A 3PHYA 2G2WA 3TSGA 3N8SA 1XFNA 4OPZA 3BFDA 3IXHA 3O86A 2XEPA 2HDUA 2NUPC 1MWSA 1SKOB 4I5SA 3T12B 2Y4AA 3VOYA 4GN2A 4OVDA 3ZCZA 2V1ZA 3UDXA 4S2KA 4UQIS 3OC2A 1ZG6A 2WKIA 4JGQA 2HV1A 4X56A 1KGGA 4Y15A 1W8YA 3PXPA 3HLEA 4MN5A 2JBFA 2PRFA 3IHAA 1NJ4A 1OTBA 4ETZA 3G4PA 1S6RA 2FFYA 4ID4A 4Y7PA 2Q9NA 1S4RA 1I5QA 4QJGA 4EEUA 4R1GA 2HP5A 2Y2LA 1UWNX 4B4XA 3OBFA 3ISGA 1RCJA 4Y13A 3G30A 3LR5A 3QP5A 1ACFA 5HAPA 1JVJA 1C3BA 2DNSA 5A93A 5EV0A 2P04A 3IT9A 3T4OA 5EVIC 5HD5A 1FR1A 4KQOA 5FASA 3PBTA 2ZC4B 4EESA 1SKOA 2Y2JA 3B3XA 1NXYA 3DAVA 1MXOA 1PZPA 4RA7A 1E25A 4X6TA 2BASA 2PAVP 3G2YA 1CI8A 2BG1A 1ES3A 2CMNA 2RL3A 4L9FA 4MBHA 4JGOA 3T4JA 3DTIA 3LI8A 5J8XA 4FD8A 1P9RA 1S0WA 1N9NA 2V8CA 2R78A 2XR0A 2G2UA 2R9WA 4LFUA 3S1YA 1PZOA 4D2OA 4U0TA 4WZ5A 4OPYA 2PHYA 4BL2A 1K55C 1Z6FA 3VP0A 3VFFA 1CK3A 1XGIA 3KSHA 3IWOA 5EPHA 4S2PA 5DJTA 1LL9A 4PMAA 3H82B 1H0MA 4KG2A 3CI6A 3IXGA 5FDSA 3MKEA 1K54C 2VGLM 1DP6A 4CLCD 1O7EA 3QNBA 4E3JA 5DF7A 1G6AA 2JKFA 5E2HA 3PYPA 2LB5A 1PI4A 1PRQA 1DJBA 5HWTA 4RQ9A 1K38A 3WS1A 3ZHHA 4IHQA 2VZWA 3I7JA 4FH2A 3UPOA 2A24B 1SZVA 2WYXA 4QU3A 2OSUA 5FA7A 4FTXA 4HJ3A 4S2MA 2O9AA 3BY8A 1SKFA 1LT0A 2Y2HA 2Q9MA 4GDBA 2HDRA 3IWQA 2M7VA 4MNRA 4G3KA 4HJ4A 2DMWA 3A3FA 3OLOA 2A49A 1NYMA 4PM9A 3LCEA 3IHBA 4BD1A 3NOTC 3C4PA 4LV0A 1ZC2A 1EWZA 3Q82A 4S2NC 4JXWA 2ZQ7A 2NUTC 4XXRA 3EQVA 3MR0A 4JGRA 4KENB 4Y0UA 2FZ0A 3BQAA 1LSVA 2J3TC 2QZ6A 3P09A 1SHVA 4X1MA 4WZ4A 1SDEA 1VETB 5FQQA 2J3TD 4IVIA 4HOIA 1PW1A 4U0XA 4L9GA 3WWXA 3LICA 4E3IA 5GLBA 3UB5P 2ZQCA 3PBQA 1K6SA 2Y2IA 1P97A 4K91A 1FCNA 3S4XA 3E4QA 3NIAA 4O8GA 2Z6CA 1K4EA 2W0NA 4HQAA 1N9BA 3N7WA 5AQ7A 2W3DA 2D01A 3EQUA 3GRJA 2PT7A 1VEUB 3HJKA 4FH4A 1F98A 4KZ6A 3OPPA 4D60A 2WAEA 3GDIA 4GLQA 1MBLA 5HPFA 2ZM8A 2ZL1B 4HJ6A 3VP3A 1ESIA 1XA7A 2EA9A 3HLCA 4M3KA 1GA9A 1VETA 4IVKA 2PR6A 2B18A 2JE5A 2P7JA 4YINA 4P87A 2O0YA 4EQIA 4EW7A 3FKVA 4P0MA 3B33A 3N4IA 2GJ3A 2W27A 1NRFA 4E3OA 3MMHA 5CERA 4DE0A 3P01A 4OH0A 2Y2PA 4C6YA 4ZTKA 3FPVA 3A3DA 1XKZA 1XGJA 3K3DA 3V3SA 4RYEA 4YWZA 3IF5A 3PAGA 4R6LA 1MWTA 3G35A 1VEUA 4UEYA 5KMWA 2JCHA 2HDSA 2VJWA 5E2FA 5FEFA 5DJUA 4KZ9A 2V20A 2ZL1A 5CHUA 3FWLA 4EQ1A 3D72A 5CEBA 3ZG8B 1G28A 3HLFA 1NY0A 2PDRA 2OWHA 2AVXA 4UAAA 5I94A 1K57C 4EBPA 1YSQA 1LI9A 5CXWA 3MSHA 3N8RA 4JBFA 4PM6A 4X69A 1F2KA 4KZ7A 1D1JA 3L9KA 3LIBA 5TFQA 1ES5A 1TS7A 3KX0X 5EVIB 1PW8A 4P6BA 3SS3A 5IT5A 2VV8A 4NKPA 4WUJA 3ZYTA 5FI6A 2EFXA 3LIDA 1YPRA 3HLGA 3ZVWA 3HREA 5CGXA 4FSFA 3C8CA 1YMXA 4KQQA 3EEHA 2VLGA 3BECA 1FQGA 2HP9A 1HTZA 4CPKA 5DVAA 4GD8A 1ALQA 1YLTA 2A3UA 1BLSA 4XUZA 1T18A 4OQ0A 5HL6A 4HP4A 2IWCA 3MXSA 2BTFP 3NOUC 1N4OA 4EERA 3IXDA 4DJ2A 1XJ3A 3E4OA 4C3QA 5HWWA 3NI9A 1ONGA 4IUKA 4K0WA 4MN7A 1KVLA 1QMFA 3N8LA 4UA7A 4MCWA 4R0QA 3FPWA 5F5YA 2QKPA 1J3WA 1OTAA 1Z09A 4GKUA 2HP6A 2Q0OA 4N9LA 5EVIA 1UWPX 1BLHA 3KSGA 2DRWA 3MFXA 4OOMA 4DE3A 2QMIA 5HDCA 2V0WA 1OTIA 3T4QA 4WMCA 2EX6A 5DFXA 2V9AA 1S66L 1YLPA 5E2EA 4L0LA 4JF6A 5F83A 4Y2FA 5EE8A 4KZAA 4EBNA 4Z9QA 4BBVA 2H28A 3KYEA 4WF0A 2JKRI 1K56D 3UB9A 4JF5A 4F3LB 1V9ZA 3RH8B 2OWJA 1K55A 3F1NB 2A2LA 3E4PA 2HJEA 4Y5FA 3L7HA 2XH9A 3MBZA 1W7FA 5HW3A 2WGWB 2GX5A 5K5BA 3LI9A 3UMDA 4DXCA 1K54A 2HJ9C 2INWA 1U60A 5HARA 3PBOA 5KIZA 1PI5A 5CGSA 3S7QA 3DTMA 5GHZA 3NULA 1BT5A 1OMEA 3M6HA 2XGNA 5F82A 5AJGA 2W3HA 5L09A 3IX8A 1S1ZA 3P7NA 3LY4A 1SCWA 2G7UA 1H3QA 1LSXA 1KDWA 4E3LA 4MBFA 5EVEA 2EX8A 2ZC6B 3DTKA 2VEAA 1XJ6A 5AVEA 3CPTB 2IWDA 1NLZA 4F3LA 1L0EA 3MKFA 1F9IA 4RVAA 2WZXA 5J7EA 3F1NA 2V1AA 1K0KA 2WGWA 4S2OA 2ZOIA 1IFQA 4S2NA 5FAOA 1FIKA 3KYZA 3B47A 4HY8A 5GLDA 1S1YA 3W4OA 3C7UA 5FQIA 4R38A 4K0XA 2Y79A 1E3UA 4HBUA 1ONHA 2J9PA 2ZOHA 5GLCA 1MWRA 5HDSA 3EGXC 3E2KA 5BOHA 4JXVA 4ARZB 2O99A 2J3WA 5CTNA 2KDKA 2EWVA 2VGLS 3E0YA 4GCZA 4N1XA 1NYYA 2JKTM 3NCKA 3RJUA 1W79A 3SS4A 2OV5A 5A8BA 3TJZC 1YLJA 3C38A 5HX9A 4WEJA 3CPTA 3C5AA 3ICYA 2PD8A 4QB8A 3JPUA 1LI0A 2RCXA 4YNRA 4IJGA 2XF3A 1TS0A 5EOOA 3LEQA 4LCLA 2WGIA 1RP5A 2Y55A 2XRNA 1KE4A 1KVMA 1GCEA 3F1OB 3CHWP 3WS5A 5CRFA 4R23A 2ZQDA 5C5KA 5EECA 2B02A 4OP8A 4OLDA 3IQAA 3SH7A 4H6JB 2XA7M 3N6IA 4KQRA 5JYOA 4GS9B 4ARZA 4OOLA 3PTEA 4QY6A 2QJ5A 4IBRA 4Q0JA 5MC7A 4Y0TA 1WE4A 3UB8A 2JKGA 4CLCC 3Q07A 1L2SA 1BYWA 3MZEA 1OJ5A 1OTDA 3NDEA 3ZG9B 2ZMAA 2J9OA 3W2ZA 3FC7A 3VE3A 1VB6A 4NG2A 4Y3IA 2VGKA 4O0PA 3QP1A 2JC7A 1BUEA 1TS8A 5E2GA 1GHMA 2C5WB 2XLNA 5D3OA 4I39A 5CHJA 4X53A 5L2FA 2PBYA 2Z2MB 1FCMA 4R70A 3T4LA 3NJAA 2ZMFA 4HHDA 3LIFA 4E3KA 2PD7A 3F1OA 1IYOA 1ERMA 3BM6A 3VP4A 1MPLA 1XX2A 3CITA 3TRCA 3QHYA 4H6JA 1MZUA 5E43A 3IX4A 3HUOA 3ZQ5A 4GS9A 1W63Q 3NECA 1TDGA 4HH3A 4ESPA 4GDNA 1YKDA 4OOYA 5DTKA 4ZBEA 2H0TA 4EUVA 5I5LA 3P98A 1IKGA 2YKFA 2Y59A 1P0ZA 5J4EA 3FV7A 3MQOA 1IYPA 3BW6A 1WA9A 3CWFA 4QY5A 5FEGA 2EX2A 4NXEA 4BL3A 4G3WA 2OOLA 4OPQA 2CC1A 2ZLYA 3C30A 5U47A 1DJAA 4PHTA 4MEZA 2XFTA 3AGDA 3IS2B 4KZ5A 4PKYA 2P9VA 3W4PA 1KDSA 3A0VA 3ZFZA 3FG8A 3T1QB 4NXFA 1PIOA 1KGEA 4KUKA 4OP5A 5GLAA 4DRTA 5F1FA 3O87A 2P74A 2JKTI 4WYYA 3NC8A 4WL9A 4R3JA 2HPBA 3UNWA 2ZM2A 2WKQA 3Q1FA 5IS1A 1EI5A 2W1TA 3A3JA 3PBSA 4KQDA 1M40A 2UWXA 4BLMA 2Z2LB 3LR0A 3MFDA 1IEMA 1CEGA 5TBMB 3CAXA 3W8KA 4ZJ2A 4BWIA 2JKRM 1IYQA 3JVUA 2ZQ9A 1XJ2A 5HD3A 1KOUA 4HNBA 3IS2A 5CHMA 5FQ9A 5G4YA 4II7A 2C6WB 1IOUA 3KSIA 2H0YA 4NEED 3BFCA 4EUZA 4CLCE 2XFSA 1HD8A 4HIAA 3BEBA 4M4XA 4JXSA 4LGWA 3LIAA 4LV1A 5M18A 4XUXA 1BZAA 2L0WA 3MZFA 1LL8A 1GHIA 3FKWA 2V0UA 3BFEA 3F1PA 1HLUP 4O7DA 4EXOA 5TBMA 3SW1A 4HBTA 3SOIA 1H8YA 4MBKA 5EFWA 1O07A 2GDNA 1YAXA 3EWKA 4ETXA 3C7VA 2EX9A 2MJ6A 3OCNA 4F94A 3WS4A 2Y2KA 3Q81A 2PBDP 4OLGA 3D9YA 4CJNA 4E6WA 3LUQA 1L0FA 2B5RA 1KE3A 4P85A 2WUQA 2X71A 1MC0A 1TD5A 1FSYA 5DKKA 1TEMA 5FAQA 4PAUA 4EWFA 3S22A 4FUWA 2WAFA 3D3OA 1CQAA 4BD0A 3T4KA 1VQQA 4ZDXA 1T19A 1W8QA 4OKPA 4ZJ3A 2W3FA 3DW0A 3UE1A 1DP9A 1RGZA 1YLZA 2O9BA 1F5MA 1ODVA 2VX8A 3IH8A 4LV2A 2QJ7A 1ERQA 3NBLA 3UE0A 3UE3A 4YFMA 2W3GA 4IUHA 1L0GA 2I9VA 1XA1A 1NRJA 1I2SA 1DY6A 2XSSA 3AGFA 1GA0A 1EW0A 1FSWA 3M2JA 5EM0A 4CLCB 1Y28A 3UO9A 3RTYA 2QYBA 5FQMA 4ZRRA 3UMEA 1LSWA 3IF6C 2D02A 3A0SA 3UB7A 1JTGA 5DF9A 3ITAA 5KSHA 4GNUA 3ZG7B 2X01A 5FAPA 2EFUA 1XFQA 5TJJA 4LLOB 3BJNA 3DBAA 3JYIA 4CQHA 3M6BA 4LCMA 2K31A 2H5SA 4DDSA 4NETA 1JTDA 1W63M 2WZZA 2E8IA 4GHIB 3GV9A 4WN5A 3HBRA 3G34A 3BY9A 3IX3A 3TOIA 2WKPA 2L4RA 5FI7A 2JN7A 1H8ZA 4EV4A 2V8FA 2WGVA 1K4FA 4Q8IA 3MJQA 4R3AA 4CLCA 2R9XA 1MKIA 3WRTA 3NY4A 4E04A 1VHMA 2J8YA 2HGVA 1BTLA 2FFFB 4Q0IA 4Y0OA 1G68A 3LO7A 3PR6A 4PM5A 3VSLA 2E8JA 2VV6A 5L07A 3RXWA 1IKIA 1ESUA 1MKMA 5KSCA 5FDHA 1GSWA 3V50A 3MXRA 3VOLA 2EXAA 4FCFA 3UE6A 1WYBA 1N9OA 3TW8A 5M1AA 2ZM0A 4GHIA 3VMAA 3ITBA 4RX3A 5M19A 3GR2A 3HUMA 1PWGA 4KUOA 3VOZA 1KGFA 1Q2QA 5CECA 4X68A 5A91A 4RX2A 1EROA 1A0KA 5KZHA 2Z6DA 3V3RA 1ZKJA 1YLWA 4DMZA 2J7VA 3CLOA 1YSPA 4GOGA 5JYPA 4BQMA 3V67A 5DF8A 3SZTA 3QP6A 3UN7A 3GTCA 5F1GA 4QHCA 3T50A 2XA7S 3A0RA 4QPRA 3O5YA 3HVFA 3BFGA 2VGJA 4N92A 4UA9A 2WKHA 3PBRA 3SS5A 3QNCA 4P6ZM 1ZG4A 2ZQ8A 3BFFA 4ME4A 2VKSA 1OPXA 4MLLA 4C75A 3DWKA 4KZ8A 4N9KA 4Z1WA 3R7WB 3LEZA 3OPHA 3V39A 1YMSA 1QMEA 3ZGAB 2GZAA 1YQSA 5HPIA 4OQHA 1AXBA 2UV0E 3EEAA 1BSGA 2Y91A 4IBXA 1S4SA 4JKTA 4DDYA 4JGPA 1G5UA 3EGDC 1JNUA 5EUAA 1GSXA 4PM8A 5EVID 3IBRA 4R3BA 3U2AA 2WKEA 2WK0A 5HDDA 1PWCA 3LIEA 5DKLA 4HI4A 3CUEC 3PBNA 5EM1A 4H8RA 1L3LA 3FYZA 3VP1A 3CG5A 5TGFA 3OOVA 3QP4A 5CX7A 4WMCD 2PYRA 1KE0A 1D7EA 4UQIM 3V5MA 1FCOA 4NXBA 2ZBBA 3BYDA 2XD1A 3R7WA 3G31A 3WS0A 4XT2B 2ZC7A 3VFHA 3C2WA 3MS6A 5J3WA 4B93A 1Y4OA 5GL9A 3MF0A 1MWUA 4PPRA 1TDLA 2PYPA 1XJ4A 4JXGA 2IWBA 4OQIA 3UDIA 3SH8A 4AFIA 5FI2A 3D4FA 2KX6A 1BLCA 1BLPA 3M2KA 3VE4A 2P9VB 4DJ3A 3NOPC 3TE8A 3CZDA 2ZD8A 3VP2A 5AQAA 5DTSA 1TF1A 4B88A 5EOEA 3TG9A 1GSVA 1K57A 2PU2A 1OT9A 1HVBA 1UGUA 3FZCA 2XK1A 2OLUA 2Y2MA 4LPZA 2W1TB 4G3VA 4KZ4A 4GZBA 1ES4A 3K3CA 4JPMA 4DN0A 4XT2A 1DP8A 3T1XA 4I3JA 3W4QA 4EETB 4DF6A 3T4TA 3IF6B 5AVFA 5HZHA 1RGYA 3LR4A 4NXGA 1XXMA 3H82A 3ZNTA 2FH5A 1FR6A 2IA2A 2ZQAA 2W1RA 4LRXC 5A90A 2J80A 1CF0A 4YOFA 2OAP1 3H9WA 3T1SA 1T1BA 5F6AA 2I72A 4Y17A 3A3IA 4S2JA 5GHYA 4PKYG 5EVLA 1K25A 4N1HA 1E3UD 2XDMA 1Y54A 1XPBA 3LGOA 3BRMA 4OPRA 2A24A 3OCLA 4HEFA 3QP2A 4GJ4A 3NDGA 3S7PA 4BJPA 2DCFA 2V1BA 1LHYA 1LL5A 1T1CA 2OLVA 1GHPA 3HLDA 3GECA 3LFVA 3EOIA 3UPPA 3ZG5A 1DJCA 4I3AA 3GVBA 5FQKA 3JVVA 3HLWA 3E98A 2KOIA 1WYCA 2YKHA 3C4OA 2HZ5A 3IF6A 1P9WA 4LRZE 3F1PB 3KYQA 5LBRA 5DFYA 3GSGA 3KO6A 3AGEA 1AWIA 4GB7A 3NHQA 2WADA 4KZBA 3ULFA 5HAQA 4KG5A 3Q7ZA 1CEFA 2XD5A 4O01A 4I38A 2W3EA 2HDQA 1VM1A 3HUNA 4WZ5C 3LR3A 2M1CA 1K56A 3ZDJA 3ZNYA 2M7UA 3KSFA 1YLYA 3CJMA 1TVFA 2OAQ1 4R4SA 4E3MA 4WELA 3MZDA 3HJIA 3T4SA 1IYSA 3E2LA 1T1AA 4WEKA
chains in the Genus database with same CATH topology
4K08A 5TJJA 1NLYA 3EGXC 4HJ4A 5HDSA 2DMWA 4LLOB 3OLOA 3BJNA 3DBAA 4ARZB 4CQHA 2O99A 1OT6A 2J3WA 4Q0HA 2KDKA 2EWVA 2K31A 2L1MA 2VGLS 3E0YA 4GCZA 4EU0A 3NOTC 2JKTM 3IBJA 1W63M 3UB6A 4GHIB 2LB9A 4WN5A 5A8BA 3TJZC 3C38A 3BY9A 2WKRA 4WEJA 2WKPA 2NUTC 3EQVA 2L4RA 3MR0A 4JGRA 3ICYA 2FZ0A 2JN7A 2PR5A 2PD8A 1H8MA 4EEPA 3MQQA 4HH2A 2VA0A 1D06A 4YNRA 3BQAA 4IJGA 1LSVA 2J3TC 1TS0A 3S7OA 3MJQA 4R3AA 4CLCA 2J3TD 2XRNA 5HSQA 1G6OA 4FOFA 4E04A 3F1OB 4HOIA 5L8MA 1VHMA 4L9GA 5C5KA 3LICA 2B02A 2HGVA 4Q0IA 2Y8HA 2O9CA 2QHKA 4BBTA 3PR6A 3PBQA 4B9OA 4H6JB 2XA7M 2XROA 1P97A 2VV6A 4GS9B 1OJGA 1MKMA 2KLIA 3E4QA 4O8GA 4OOLA 4ARZA 2Z6CA 1GSWA 2QJ5A 2W0NA 4HQAA 4Q0JA 5MC7A 2HF6A 5IU1A 2ZMVA 3UB8A 3VOLA 2W3DA 2D01A 3EQUA 4CLCC 1STZA 2PT7A 3HJKA 3UE6A 1F98A 1BYWA 1OJ5A 1OTDA 1N9OA 3TW8A 4GHIA 3GDIA 3W2ZA 3S7NA 3FC7A 3VE3A 1VB6A 3BQ8A 4MDZA 1DRMA 4GLQA 4Y3IA 3H7WB 5HPFA 4O0PA 1N9LA 4KUOA 1TS8A 4I39A 3B42A 4HJ6A 2Z6DA 2EWWA 4R70A 3T4LA 3NJAA 4DMZA 2ZMFA 1S67L 5FL3A 3CLOA 1YSPA 2EA9A 5G4ZA 3HCYA 5HWVA 4HHDA 3LIFA 3V67A 2PR6A 2B18A 2PD7A 3F1OA 2P7JA 3MXQA 2O0YA 3T50A 2XA7S 3A0RA 4QPRA 4GW9A 3O5YA 4EW7A 3R4KA 3B33A 2VV7A 2GJ3A 1TS6A 2W27A 3LYXA 1X0OA 3CITA 3PBRA 3TRCA 3MMHA 4H6JA 1MZUA 3P01A 4L9EA 4P6ZM 3ZQ5A 4GS9A 1W63Q 3FPVA 3K3DA 4HH3A 2VKSA 4ME4A 1OPXA 1YKDA 4YWZA 4R6LA 4Z1WA 3R7WB 4UEYA 3VV4A 3CUEA 5I5LA 4EUVA 1NWZA 2VJWA 2YKFA 2GZAA 5DJUA 5HPIA 1P0ZA 3H7WA 5J4EA 3MQOA 3BW6A 3EEAA 4MMNA 2K7SA 1WA9A 3CWFA 4EQ1A 1OTEA 1S4SA 3D72A 1G28A 4BMWA 4NXEA 2PDRA 4JGPA 4G3WA 2OOLA 2OWHA 3EGDC 1JNUA 3C30A 1GSXA 4BBUA 2GNXA 4PHTA 3IBRA 4WLAA 3U2AA 1YSQA 5HDDA 3IS2B 5F69A 4PKYA 3LIEA 4P6ZS 4HP9A 5DKLA 1ZHHB 4HI4A 3CUEC 3PBNA 1V9YA 3A0VA 3LIBA 3FG8A 4NXFA 1TS7A 3KX0X 4KUKA 3OOVA 3MQ0A 5IT5A 2VV8A 4NKPA 5CX7A 4WUJA 2PYRA 1ZTUA 3ZYTA 3K2NA 4UQIM 3LIDA 2JKTI 4NXBA 4WL9A 2ZBBA 4FSFA 3C8CA 4MN6A 2WKQA 3R7WA 3BWLA 3EEHA 5IS1A 2W1TA 2VLGA 4XT2B 5F68A 3PBSA 4KQDA 2K2NA 3G6OA 3C2WA 5J3WA 2JHEA 4B93A 3LR0A 2QWSA 3MF0A 4I3IA 3RFBA 1T18A 4LRYC 5HL6A 4HP4A 5TBMB 2PYPA 1XJ4A 3CAXA 3NOUC 2P08A 4EERA 4BWIA 2JKRM 3PHYA 4DJ2A 1XJ3A 3E4OA 3JVUA 4AFIA 1XFNA 5HWWA 4IUKA 4MN7A 2KX6A 1XJ2A 5HD3A 2NUPC 1KOUA 4HNBA 3VE4A 4MCWA 3IS2A 3FPWA 4I5SA 5F5YA 2QKPA 4DJ3A 3NOPC 5G4YA 3TE8A 1OTAA 4WEKA 4II7A 1IOUA 4UQIS 3OC2A 3KSIA 4JGQA 4NEED 1TF1A 2HV1A 1UWPX 4CLCE 3PXPA 4MN5A 1GSVA 1OT9A 3KSGA 4HIAA 1UGUA 3MFXA 4M4XA 4OOMA 1OTBA 5HDCA 4ETZA 4LPZA 2W1TB 4G3VA 3LIAA 2V0WA 3K3CA 4DN0A 1OTIA 1S4RA 4XT2A 3T4QA 1DP8A 4EEUA 5DFXA 2V9AA 1S66L 1UWNX 4I3JA 2L0WA 4L0LA 3OBFA 4EETB 1LL8A 3T4TA 3LR5A 5AVFA 5HZHA 4Y2FA 3LR4A 2V0UA 3F1PA 4NXGA 2P04A 4EXOA 3H82A 5TBMA 3SW1A 3T4OA 4BBVA 2FH5A 2H28A 4WF0A 2JKRI 2IA2A 5EFWA 5HD5A 2W1RA 4KQOA 4LRXC 3UB9A 4F3LB 1V9ZA 2J80A 3RH8B 3PBTA 4YOFA 2OAP1 1YAXA 3EWKA 4ETXA 2OWJA 4EESA 3H9WA 1T1BA 2MJ6A 5F6AA 3F1NB 2A2LA 3E4PA 3OCNA 2HJEA 4Y5FA 4PKYG 2GX5A 5K5BA 3LI9A 3UMDA 3LUQA 2BASA 2A24A 3OCLA 4GJ4A 2HJ9C 2INWA 3S7PA 4BJPA 2CMNA 4L9FA 2V1BA 3PBOA 1MC0A 4JGOA 3T4JA 3LI8A 5KIZA 1TD5A 1P9RA 5DKKA 1N9NA 1T1CA 3S7QA 2R78A 4PAUA 3D3OA 5AJGA 3GECA 3LFVA 3EOIA 2W3HA 2PHYA 3T4KA 4I3AA 1T19A 1S1ZA 3JVVA 2W3FA 3E98A 3P7NA 2KOIA 1DP9A 2YKHA 2O9BA 2G7UA 1F5MA 1P9WA 4LRZE 3F1PB 3KSHA 3KYQA 1ODVA 1LSXA 1H3QA 2VX8A 5LBRA 5DJTA 2QJ7A 5DFYA 3H82B 3KO6A 3CI6A 3UE3A 2VGLM 2W3GA 1DP6A 4IUHA 4CLCD 3NHQA 2VEAA 1XJ6A 5AVEA 3PYPA 3ULFA 2I9VA 1NLZA 2LB5A 4F3LA 1F9IA 1NRJA 4O01A 4I38A 5HWTA 4RQ9A 5J7EA 2XSSA 3F1NA 1EW0A 2W3EA 4CLCB 2V1AA 4IHQA 3LR3A 2M1CA 1Y28A 2VZWA 2A24B 2ZOIA 3RTYA 2QYBA 1IFQA 2M7UA 4ZRRA 3KSFA 3KYZA 4HJ3A 3UMEA 1LSWA 2O9AA 3B47A 3BY8A 2OAQ1 4HY8A 1S1YA 1LT0A 4WELA 2D02A 3A0SA 3UB7A 4R38A 3HJIA 5DF9A 3T4SA 5KSHA 2Y79A 2M7VA 1T1AA 2ZOHA 1D7EA 4G3KA 1XFQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K08 A;  5HDS A;  4HJ4 A;  4LLO B;  3OLO A;  1OT6 A;  2KDK A;  2L1M A;  4GCZ A;  3NOT C;  3UB6 A;  4GHI B;  4WN5 A;  5A8B A;  3BY9 A;  2WKR A;  2WKP A;  2L4R A;  3MR0 A;  4JGR A;  3ICY A;  2JN7 A;  2PR5 A;  2PD8 A;  4EEP A;  3MQQ A;  4HH2 A;  1D06 A;  1LSV A;  1TS0 A;  3MJQ A;  4R3A A;  5HSQ A;  4E04 A;  3F1O B;  4HOI A;  4L9G A;  3LIC A;  2B02 A;  2QHK A;  4BBT A;  4B9O A;  4H6J B;  1P97 A;  2VV6 A;  4GS9 B;  1OJG A;  3E4Q A;  2Z6C A;  1GSW A;  2QJ5 A;  2W0N A;  4HQA A;  5IU1 A;  3UB8 A;  3VOL A;  2D01 A;  3HJK A;  3UE6 A;  1F98 A;  1BYW A;  1OJ5 A;  1OTD A;  1N9O A;  4GHI A;  3GDI A;  3FC7 A;  3VE3 A;  1VB6 A;  1DRM A;  3H7W B;  1N9L A;  4KUO A;  1TS8 A;  4I39 A;  4HJ6 A;  2Z6D A;  4R70 A;  3NJA A;  1S67 L;  3CLO A;  2EA9 A;  5G4Z A;  5HWV A;  4HHD A;  3LIF A;  2PR6 A;  2PD7 A;  3F1O A;  2P7J A;  3MXQ A;  3T50 A;  3A0R A;  4GW9 A;  4EW7 A;  3B33 A;  2VV7 A;  2GJ3 A;  1TS6 A;  2W27 A;  3LYX A;  1X0O A;  4H6J A;  1MZU A;  4L9E A;  3ZQ5 A;  4GS9 A;  3K3D A;  4HH3 A;  4YWZ A;  4R6L A;  5I5L A;  1NWZ A;  2YKF A;  5DJU A;  1P0Z A;  3H7W A;  5J4E A;  3MQO A;  2K7S A;  1WA9 A;  3CWF A;  4EQ1 A;  1OTE A;  1S4S A;  3D72 A;  1G28 A;  4NXE A;  2PDR A;  4JGP A;  2OOL A;  2OWH A;  1JNU A;  1GSX A;  4BBU A;  3IBR A;  4WLA A;  5HDD A;  3IS2 B;  5F69 A;  4PKY A;  3LIE A;  4HP9 A;  5DKL A;  4HI4 A;  1V9Y A;  3A0V A;  3LIB A;  3FG8 A;  4NXF A;  1TS7 A;  3KX0 X;  4KUK A;  2VV8 A;  4WUJ A;  2PYR A;  3LID A;  4NXB A;  4WL9 A;  2ZBB A;  3C8C A;  4MN6 A;  2WKQ A;  3BWL A;  3EEH A;  5IS1 A;  2VLG A;  4XT2 B;  5F68 A;  4KQD A;  3G6O A;  3C2W A;  5J3W A;  2JHE A;  2QWS A;  4I3I A;  1T18 A;  4LRY C;  4HP4 A;  5TBM B;  2PYP A;  1XJ4 A;  3CAX A;  3NOU C;  4EER A;  3PHY A;  4DJ2 A;  1XJ3 A;  3E4O A;  5HWW A;  1XFN A;  2KX6 A;  1XJ2 A;  5HD3 A;  1KOU A;  4HNB A;  3VE4 A;  3IS2 A;  4I5S A;  5F5Y A;  2QKP A;  4DJ3 A;  3NOP C;  5G4Y A;  1OTA A;  4JGQ A;  2HV1 A;  1UWP X;  4MN5 A;  1GSV A;  1OT9 A;  4HIA A;  1UGU A;  3MFX A;  4M4X A;  1OTB A;  5HDC A;  4LPZ A;  3LIA A;  2V0W A;  3K3C A;  1OTI A;  1S4R A;  4XT2 A;  1DP8 A;  4EEU A;  2V9A A;  1S66 L;  1UWN X;  4I3J A;  2L0W A;  4EET B;  1LL8 A;  5AVF A;  5HZH A;  2V0U A;  3F1P A;  4NXG A;  4EXO A;  3H82 A;  5TBM A;  3SW1 A;  4BBV A;  2H28 A;  4WF0 A;  5EFW A;  5HD5 A;  4LRX C;  3UB9 A;  4F3L B;  1V9Z A;  3RH8 B;  2J80 A;  3EWK A;  2OWJ A;  4EES A;  3H9W A;  1T1B A;  5F6A A;  3F1N B;  3E4P A;  4PKY G;  3LI9 A;  3UMD A;  3LUQ A;  2BAS A;  2A24 A;  2INW A;  2CMN A;  4L9F A;  2V1B A;  4JGO A;  3LI8 A;  5KIZ A;  5DKK A;  1N9N A;  1T1C A;  2R78 A;  3GEC A;  2PHY A;  4I3A A;  1T19 A;  1S1Z A;  3P7N A;  1DP9 A;  2YKH A;  4LRZ E;  3F1P B;  1ODV A;  1LSX A;  5DJT A;  2QJ7 A;  3H82 B;  1DP6 A;  3NHQ A;  2VEA A;  1XJ6 A;  5AVE A;  3PYP A;  3ULF A;  2I9V A;  4F3L A;  1F9I A;  4I38 A;  5HWT A;  4RQ9 A;  5J7E A;  3F1N A;  1EW0 A;  2V1A A;  2M1C A;  1Y28 A;  2A24 B;  2ZOI A;  3RTY A;  4HJ3 A;  3UME A;  1LSW A;  3BY8 A;  4HY8 A;  1S1Y A;  1LT0 A;  2D02 A;  3A0S A;  3UB7 A;  4R38 A;  3HJI A;  1T1A A;  2ZOH A;  1D7E A;  1XFQ A; 
#chains in the Genus database with same CATH topology
 4K08 A;  1NLY A;  3LY3 A;  3UY6 A;  1E4D A;  1OT6 A;  4A5R A;  4Q0H A;  2L1M A;  4EU0 A;  2BLS A;  4WBG A;  1BUL A;  3IBJ A;  2ZJ9 A;  2Y2N A;  2ZC5 B;  1JWV A;  5AQB A;  5IHV A;  4QWO A;  5A92 A;  4X25 A;  3OPL A;  5CED A;  3UB6 A;  2LB9 A;  4U3T A;  3UPN A;  2Y2O A;  2WKR A;  4QD4 A;  2PR5 A;  4WM9 A;  5AQ9 A;  2VK3 A;  1H8M A;  4EEP A;  3MQQ A;  4HH2 A;  2VA0 A;  4E6X A;  1D06 A;  3U4L P;  2Y2Q A;  3S7O A;  4DE2 A;  2ZC3 B;  5HSQ A;  1G6O A;  4FOF A;  3Q7V B;  4UA6 A;  1Q2P A;  3IXB A;  5L8M A;  4KG6 A;  3ZG0 A;  2QPN A;  5HFO A;  1PFL A;  1CJF A;  2EXB A;  2PU4 A;  1PYY A;  3BLM A;  3GMW A;  3O88 A;  5CTM A;  2Y8H A;  2O9C A;  2QHK A;  4BBT A;  3HL9 A;  4B9O A;  1YT4 A;  2XRO A;  4OQG A;  3G32 A;  5L10 A;  3OPR A;  1OJG A;  2KLI A;  1L0D A;  2ACG A;  4ZAM A;  2HF6 A;  5IU1 A;  2ZMV A;  1HZO A;  1STZ A;  1FOF A;  3G2Z A;  3S7N A;  4OON A;  5CGW A;  5TR7 A;  3BQ8 A;  4MDZ A;  1DRM A;  3H7W B;  4R4R A;  3VSK A;  1N9L A;  5GHX A;  1FIL A;  3B42 A;  3QP8 A;  1IEL A;  3WRZ A;  2EWW A;  4KZ3 A;  1CI9 A;  1S67 L;  5FL3 A;  5G4Z A;  1JWP A;  3GQZ A;  2B95 A;  3HCY A;  5HWV A;  1PNE A;  4X1L A;  4DXB A;  4S2I A;  3Q7V A;  4JLF A;  1YM1 A;  5HAI A;  4JF4 A;  3MXQ A;  3A3E A;  5DTT A;  2V2F F;  4EBL A;  4GW9 A;  1ES2 A;  4PM7 A;  3R4K A;  3UDF A;  2VV7 A;  1H5X A;  1TS6 A;  3LYX A;  1X0O A;  3DWZ A;  4B4Z A;  4L9E A;  2H10 A;  3HLB A;  3IH9 A;  3SH9 A;  3RXX A;  4S2L A;  3CMZ A;  3VV4 A;  3CUE A;  4ZJ1 A;  1NWZ A;  3T1R A;  1NZO A;  4LV3 A;  4BEN A;  4HES A;  5FSR A;  4DKI A;  3H7W A;  2X02 A;  4MMN A;  2K7S A;  1OTE A;  1SDN A;  4BMW A;  2XQZ A;  4UHU A;  4BBU A;  2GNX A;  4WLA A;  1JWZ A;  1MY8 A;  1XP4 A;  3BLS A;  1W5D A;  5F69 A;  4LEN A;  4P6Z S;  4HP9 A;  1ZHH B;  1V9Y A;  4IED A;  3MQ0 A;  1K6R A;  1ZTU A;  3O3V A;  5FAT A;  3K2N A;  3PAE A;  1LLB A;  3IWI A;  1M6K A;  4NK3 A;  4DE1 A;  5FQJ A;  4X55 A;  4MN6 A;  1J9M A;  1PWD A;  3BWL A;  5F68 A;  3ZVT A;  2Y2G A;  3WS2 A;  5HL1 A;  1I2W A;  2K2N A;  3G6O A;  3DTE A;  2JHE A;  4GD6 A;  4E3N A;  3OZH A;  2QWS A;  4I3I A;  3RFB A;  4LRY C;  1NZU A;  5G18 A;  2P08 A;  3PHY A;  2G2W A;  3TSG A;  3N8S A;  1XFN A;  4OPZ A;  3BFD A;  3IXH A;  3O86 A;  2XEP A;  2HDU A;  2NUP C;  1MWS A;  1SKO B;  4I5S A;  3T12 B;  2Y4A A;  3VOY A;  4GN2 A;  4OVD A;  3ZCZ A;  2V1Z A;  3UDX A;  4S2K A;  4UQI S;  3OC2 A;  1ZG6 A;  2WKI A;  4JGQ A;  2HV1 A;  4X56 A;  1KGG A;  4Y15 A;  1W8Y A;  3PXP A;  3HLE A;  4MN5 A;  2JBF A;  2PRF A;  3IHA A;  1NJ4 A;  1OTB A;  4ETZ A;  3G4P A;  1S6R A;  2FFY A;  4ID4 A;  4Y7P A;  2Q9N A;  1S4R A;  1I5Q A;  4QJG A;  4EEU A;  4R1G A;  2HP5 A;  2Y2L A;  1UWN X;  4B4X A;  3OBF A;  3ISG A;  1RCJ A;  4Y13 A;  3G30 A;  3LR5 A;  3QP5 A;  1ACF A;  5HAP A;  1JVJ A;  1C3B A;  2DNS A;  5A93 A;  5EV0 A;  2P04 A;  3IT9 A;  3T4O A;  5EVI C;  5HD5 A;  1FR1 A;  4KQO A;  5FAS A;  3PBT A;  2ZC4 B;  4EES A;  1SKO A;  2Y2J A;  3B3X A;  1NXY A;  3DAV A;  1MXO A;  1PZP A;  4RA7 A;  1E25 A;  4X6T A;  2BAS A;  2PAV P;  3G2Y A;  1CI8 A;  2BG1 A;  1ES3 A;  2CMN A;  2RL3 A;  4L9F A;  4MBH A;  4JGO A;  3T4J A;  3DTI A;  3LI8 A;  5J8X A;  4FD8 A;  1P9R A;  1S0W A;  1N9N A;  2V8C A;  2R78 A;  2XR0 A;  2G2U A;  2R9W A;  4LFU A;  3S1Y A;  1PZO A;  4D2O A;  4U0T A;  4WZ5 A;  4OPY A;  2PHY A;  4BL2 A;  1K55 C;  1Z6F A;  3VP0 A;  3VFF A;  1CK3 A;  1XGI A;  3KSH A;  3IWO A;  5EPH A;  4S2P A;  5DJT A;  1LL9 A;  4PMA A;  3H82 B;  1H0M A;  4KG2 A;  3CI6 A;  3IXG A;  5FDS A;  3MKE A;  1K54 C;  2VGL M;  1DP6 A;  4CLC D;  1O7E A;  3QNB A;  4E3J A;  5DF7 A;  1G6A A;  2JKF A;  5E2H A;  3PYP A;  2LB5 A;  1PI4 A;  1PRQ A;  1DJB A;  5HWT A;  4RQ9 A;  1K38 A;  3WS1 A;  3ZHH A;  4IHQ A;  2VZW A;  3I7J A;  4FH2 A;  3UPO A;  2A24 B;  1SZV A;  2WYX A;  4QU3 A;  2OSU A;  5FA7 A;  4FTX A;  4HJ3 A;  4S2M A;  2O9A A;  3BY8 A;  1SKF A;  1LT0 A;  2Y2H A;  2Q9M A;  4GDB A;  2HDR A;  3IWQ A;  2M7V A;  4MNR A;  4G3K A;  4HJ4 A;  2DMW A;  3A3F A;  3OLO A;  2A49 A;  1NYM A;  4PM9 A;  3LCE A;  3IHB A;  4BD1 A;  3NOT C;  3C4P A;  4LV0 A;  1ZC2 A;  1EWZ A;  3Q82 A;  4S2N C;  4JXW A;  2ZQ7 A;  2NUT C;  4XXR A;  3EQV A;  3MR0 A;  4JGR A;  4KEN B;  4Y0U A;  2FZ0 A;  3BQA A;  1LSV A;  2J3T C;  2QZ6 A;  3P09 A;  1SHV A;  4X1M A;  4WZ4 A;  1SDE A;  1VET B;  5FQQ A;  2J3T D;  4IVI A;  4HOI A;  1PW1 A;  4U0X A;  4L9G A;  3WWX A;  3LIC A;  4E3I A;  5GLB A;  3UB5 P;  2ZQC A;  3PBQ A;  1K6S A;  2Y2I A;  1P97 A;  4K91 A;  1FCN A;  3S4X A;  3E4Q A;  3NIA A;  4O8G A;  2Z6C A;  1K4E A;  2W0N A;  4HQA A;  1N9B A;  3N7W A;  5AQ7 A;  2W3D A;  2D01 A;  3EQU A;  3GRJ A;  2PT7 A;  1VEU B;  3HJK A;  4FH4 A;  1F98 A;  4KZ6 A;  3OPP A;  4D60 A;  2WAE A;  3GDI A;  4GLQ A;  1MBL A;  5HPF A;  2ZM8 A;  2ZL1 B;  4HJ6 A;  3VP3 A;  1ESI A;  1XA7 A;  2EA9 A;  3HLC A;  4M3K A;  1GA9 A;  1VET A;  4IVK A;  2PR6 A;  2B18 A;  2JE5 A;  2P7J A;  4YIN A;  4P87 A;  2O0Y A;  4EQI A;  4EW7 A;  3FKV A;  4P0M A;  3B33 A;  3N4I A;  2GJ3 A;  2W27 A;  1NRF A;  4E3O A;  3MMH A;  5CER A;  4DE0 A;  3P01 A;  4OH0 A;  2Y2P A;  4C6Y A;  4ZTK A;  3FPV A;  3A3D A;  1XKZ A;  1XGJ A;  3K3D A;  3V3S A;  4RYE A;  4YWZ A;  3IF5 A;  3PAG A;  4R6L A;  1MWT A;  3G35 A;  1VEU A;  4UEY A;  5KMW A;  2JCH A;  2HDS A;  2VJW A;  5E2F A;  5FEF A;  5DJU A;  4KZ9 A;  2V20 A;  2ZL1 A;  5CHU A;  3FWL A;  4EQ1 A;  3D72 A;  5CEB A;  3ZG8 B;  1G28 A;  3HLF A;  1NY0 A;  2PDR A;  2OWH A;  2AVX A;  4UAA A;  5I94 A;  1K57 C;  4EBP A;  1YSQ A;  1LI9 A;  5CXW A;  3MSH A;  3N8R A;  4JBF A;  4PM6 A;  4X69 A;  1F2K A;  4KZ7 A;  1D1J A;  3L9K A;  3LIB A;  5TFQ A;  1ES5 A;  1TS7 A;  3KX0 X;  5EVI B;  1PW8 A;  4P6B A;  3SS3 A;  5IT5 A;  2VV8 A;  4NKP A;  4WUJ A;  3ZYT A;  5FI6 A;  2EFX A;  3LID A;  1YPR A;  3HLG A;  3ZVW A;  3HRE A;  5CGX A;  4FSF A;  3C8C A;  1YMX A;  4KQQ A;  3EEH A;  2VLG A;  3BEC A;  1FQG A;  2HP9 A;  1HTZ A;  4CPK A;  5DVA A;  4GD8 A;  1ALQ A;  1YLT A;  2A3U A;  1BLS A;  4XUZ A;  1T18 A;  4OQ0 A;  5HL6 A;  4HP4 A;  2IWC A;  3MXS A;  2BTF P;  3NOU C;  1N4O A;  4EER A;  3IXD A;  4DJ2 A;  1XJ3 A;  3E4O A;  4C3Q A;  5HWW A;  3NI9 A;  1ONG A;  4IUK A;  4K0W A;  4MN7 A;  1KVL A;  1QMF A;  3N8L A;  4UA7 A;  4MCW A;  4R0Q A;  3FPW A;  5F5Y A;  2QKP A;  1J3W A;  1OTA A;  1Z09 A;  4GKU A;  2HP6 A;  2Q0O A;  4N9L A;  5EVI A;  1UWP X;  1BLH A;  3KSG A;  2DRW A;  3MFX A;  4OOM A;  4DE3 A;  2QMI A;  5HDC A;  2V0W A;  1OTI A;  3T4Q A;  4WMC A;  2EX6 A;  5DFX A;  2V9A A;  1S66 L;  1YLP A;  5E2E A;  4L0L A;  4JF6 A;  5F83 A;  4Y2F A;  5EE8 A;  4KZA A;  4EBN A;  4Z9Q A;  4BBV A;  2H28 A;  3KYE A;  4WF0 A;  2JKR I;  1K56 D;  3UB9 A;  4JF5 A;  4F3L B;  1V9Z A;  3RH8 B;  2OWJ A;  1K55 A;  3F1N B;  2A2L A;  3E4P A;  2HJE A;  4Y5F A;  3L7H A;  2XH9 A;  3MBZ A;  1W7F A;  5HW3 A;  2WGW B;  2GX5 A;  5K5B A;  3LI9 A;  3UMD A;  4DXC A;  1K54 A;  2HJ9 C;  2INW A;  1U60 A;  5HAR A;  3PBO A;  5KIZ A;  1PI5 A;  5CGS A;  3S7Q A;  3DTM A;  5GHZ A;  3NUL A;  1BT5 A;  1OME A;  3M6H A;  2XGN A;  5F82 A;  5AJG A;  2W3H A;  5L09 A;  3IX8 A;  1S1Z A;  3P7N A;  3LY4 A;  1SCW A;  2G7U A;  1H3Q A;  1LSX A;  1KDW A;  4E3L A;  4MBF A;  5EVE A;  2EX8 A;  2ZC6 B;  3DTK A;  2VEA A;  1XJ6 A;  5AVE A;  3CPT B;  2IWD A;  1NLZ A;  4F3L A;  1L0E A;  3MKF A;  1F9I A;  4RVA A;  2WZX A;  5J7E A;  3F1N A;  2V1A A;  1K0K A;  2WGW A;  4S2O A;  2ZOI A;  1IFQ A;  4S2N A;  5FAO A;  1FIK A;  3KYZ A;  3B47 A;  4HY8 A;  5GLD A;  1S1Y A;  3W4O A;  3C7U A;  5FQI A;  4R38 A;  4K0X A;  2Y79 A;  1E3U A;  4HBU A;  1ONH A;  2J9P A;  2ZOH A;  5GLC A;  1MWR A;  5HDS A;  3EGX C;  3E2K A;  5BOH A;  4JXV A;  4ARZ B;  2O99 A;  2J3W A;  5CTN A;  2KDK A;  2EWV A;  2VGL S;  3E0Y A;  4GCZ A;  4N1X A;  1NYY A;  2JKT M;  3NCK A;  3RJU A;  1W79 A;  3SS4 A;  2OV5 A;  5A8B A;  3TJZ C;  1YLJ A;  3C38 A;  5HX9 A;  4WEJ A;  3CPT A;  3C5A A;  3ICY A;  2PD8 A;  4QB8 A;  3JPU A;  1LI0 A;  2RCX A;  4YNR A;  4IJG A;  2XF3 A;  1TS0 A;  5EOO A;  3LEQ A;  4LCL A;  2WGI A;  1RP5 A;  2Y55 A;  2XRN A;  1KE4 A;  1KVM A;  1GCE A;  3F1O B;  3CHW P;  3WS5 A;  5CRF A;  4R23 A;  2ZQD A;  5C5K A;  5EEC A;  2B02 A;  4OP8 A;  4OLD A;  3IQA A;  3SH7 A;  4H6J B;  2XA7 M;  3N6I A;  4KQR A;  5JYO A;  4GS9 B;  4ARZ A;  4OOL A;  3PTE A;  4QY6 A;  2QJ5 A;  4IBR A;  4Q0J A;  5MC7 A;  4Y0T A;  1WE4 A;  3UB8 A;  2JKG A;  4CLC C;  3Q07 A;  1L2S A;  1BYW A;  3MZE A;  1OJ5 A;  1OTD A;  3NDE A;  3ZG9 B;  2ZMA A;  2J9O A;  3W2Z A;  3FC7 A;  3VE3 A;  1VB6 A;  4NG2 A;  4Y3I A;  2VGK A;  4O0P A;  3QP1 A;  2JC7 A;  1BUE A;  1TS8 A;  5E2G A;  1GHM A;  2C5W B;  2XLN A;  5D3O A;  4I39 A;  5CHJ A;  4X53 A;  5L2F A;  2PBY A;  2Z2M B;  1FCM A;  4R70 A;  3T4L A;  3NJA A;  2ZMF A;  4HHD A;  3LIF A;  4E3K A;  2PD7 A;  3F1O A;  1IYO A;  1ERM A;  3BM6 A;  3VP4 A;  1MPL A;  1XX2 A;  3CIT A;  3TRC A;  3QHY A;  4H6J A;  1MZU A;  5E43 A;  3IX4 A;  3HUO A;  3ZQ5 A;  4GS9 A;  1W63 Q;  3NEC A;  1TDG A;  4HH3 A;  4ESP A;  4GDN A;  1YKD A;  4OOY A;  5DTK A;  4ZBE A;  2H0T A;  4EUV A;  5I5L A;  3P98 A;  1IKG A;  2YKF A;  2Y59 A;  1P0Z A;  5J4E A;  3FV7 A;  3MQO A;  1IYP A;  3BW6 A;  1WA9 A;  3CWF A;  4QY5 A;  5FEG A;  2EX2 A;  4NXE A;  4BL3 A;  4G3W A;  2OOL A;  4OPQ A;  2CC1 A;  2ZLY A;  3C30 A;  5U47 A;  1DJA A;  4PHT A;  4MEZ A;  2XFT A;  3AGD A;  3IS2 B;  4KZ5 A;  4PKY A;  2P9V A;  3W4P A;  1KDS A;  3A0V A;  3ZFZ A;  3FG8 A;  3T1Q B;  4NXF A;  1PIO A;  1KGE A;  4KUK A;  4OP5 A;  5GLA A;  4DRT A;  5F1F A;  3O87 A;  2P74 A;  2JKT I;  4WYY A;  3NC8 A;  4WL9 A;  4R3J A;  2HPB A;  3UNW A;  2ZM2 A;  2WKQ A;  3Q1F A;  5IS1 A;  1EI5 A;  2W1T A;  3A3J A;  3PBS A;  4KQD A;  1M40 A;  2UWX A;  4BLM A;  2Z2L B;  3LR0 A;  3MFD A;  1IEM A;  1CEG A;  5TBM B;  3CAX A;  3W8K A;  4ZJ2 A;  4BWI A;  2JKR M;  1IYQ A;  3JVU A;  2ZQ9 A;  1XJ2 A;  5HD3 A;  1KOU A;  4HNB A;  3IS2 A;  5CHM A;  5FQ9 A;  5G4Y A;  4II7 A;  2C6W B;  1IOU A;  3KSI A;  2H0Y A;  4NEE D;  3BFC A;  4EUZ A;  4CLC E;  2XFS A;  1HD8 A;  4HIA A;  3BEB A;  4M4X A;  4JXS A;  4LGW A;  3LIA A;  4LV1 A;  5M18 A;  4XUX A;  1BZA A;  2L0W A;  3MZF A;  1LL8 A;  1GHI A;  3FKW A;  2V0U A;  3BFE A;  3F1P A;  1HLU P;  4O7D A;  4EXO A;  5TBM A;  3SW1 A;  4HBT A;  3SOI A;  1H8Y A;  4MBK A;  5EFW A;  1O07 A;  2GDN A;  1YAX A;  3EWK A;  4ETX A;  3C7V A;  2EX9 A;  2MJ6 A;  3OCN A;  4F94 A;  3WS4 A;  2Y2K A;  3Q81 A;  2PBD P;  4OLG A;  3D9Y A;  4CJN A;  4E6W A;  3LUQ A;  1L0F A;  2B5R A;  1KE3 A;  4P85 A;  2WUQ A;  2X71 A;  1MC0 A;  1TD5 A;  1FSY A;  5DKK A;  1TEM A;  5FAQ A;  4PAU A;  4EWF A;  3S22 A;  4FUW A;  2WAF A;  3D3O A;  1CQA A;  4BD0 A;  3T4K A;  1VQQ A;  4ZDX A;  1T19 A;  1W8Q A;  4OKP A;  4ZJ3 A;  2W3F A;  3DW0 A;  3UE1 A;  1DP9 A;  1RGZ A;  1YLZ A;  2O9B A;  1F5M A;  1ODV A;  2VX8 A;  3IH8 A;  4LV2 A;  2QJ7 A;  1ERQ A;  3NBL A;  3UE0 A;  3UE3 A;  4YFM A;  2W3G A;  4IUH A;  1L0G A;  2I9V A;  1XA1 A;  1NRJ A;  1I2S A;  1DY6 A;  2XSS A;  3AGF A;  1GA0 A;  1EW0 A;  1FSW A;  3M2J A;  5EM0 A;  4CLC B;  1Y28 A;  3UO9 A;  3RTY A;  2QYB A;  5FQM A;  4ZRR A;  3UME A;  1LSW A;  3IF6 C;  2D02 A;  3A0S A;  3UB7 A;  1JTG A;  5DF9 A;  3ITA A;  5KSH A;  4GNU A;  3ZG7 B;  2X01 A;  5FAP A;  2EFU A;  1XFQ A;  5TJJ A;  4LLO B;  3BJN A;  3DBA A;  3JYI A;  4CQH A;  3M6B A;  4LCM A;  2K31 A;  2H5S A;  4DDS A;  4NET A;  1JTD A;  1W63 M;  2WZZ A;  2E8I A;  4GHI B;  3GV9 A;  4WN5 A;  3HBR A;  3G34 A;  3BY9 A;  3IX3 A;  3TOI A;  2WKP A;  2L4R A;  5FI7 A;  2JN7 A;  1H8Z A;  4EV4 A;  2V8F A;  2WGV A;  1K4F A;  4Q8I A;  3MJQ A;  4R3A A;  4CLC A;  2R9X A;  1MKI A;  3WRT A;  3NY4 A;  4E04 A;  1VHM A;  2J8Y A;  2HGV A;  1BTL A;  2FFF B;  4Q0I A;  4Y0O A;  1G68 A;  3LO7 A;  3PR6 A;  4PM5 A;  3VSL A;  2E8J A;  2VV6 A;  5L07 A;  3RXW A;  1IKI A;  1ESU A;  1MKM A;  5KSC A;  5FDH A;  1GSW A;  3V50 A;  3MXR A;  3VOL A;  2EXA A;  4FCF A;  3UE6 A;  1WYB A;  1N9O A;  3TW8 A;  5M1A A;  2ZM0 A;  4GHI A;  3VMA A;  3ITB A;  4RX3 A;  5M19 A;  3GR2 A;  3HUM A;  1PWG A;  4KUO A;  3VOZ A;  1KGF A;  1Q2Q A;  5CEC A;  4X68 A;  5A91 A;  4RX2 A;  1ERO A;  1A0K A;  5KZH A;  2Z6D A;  3V3R A;  1ZKJ A;  1YLW A;  4DMZ A;  2J7V A;  3CLO A;  1YSP A;  4GOG A;  5JYP A;  4BQM A;  3V67 A;  5DF8 A;  3SZT A;  3QP6 A;  3UN7 A;  3GTC A;  5F1G A;  4QHC A;  3T50 A;  2XA7 S;  3A0R A;  4QPR A;  3O5Y A;  3HVF A;  3BFG A;  2VGJ A;  4N92 A;  4UA9 A;  2WKH A;  3PBR A;  3SS5 A;  3QNC A;  4P6Z M;  1ZG4 A;  2ZQ8 A;  3BFF A;  4ME4 A;  2VKS A;  1OPX A;  4MLL A;  4C75 A;  3DWK A;  4KZ8 A;  4N9K A;  4Z1W A;  3R7W B;  3LEZ A;  3OPH A;  3V39 A;  1YMS A;  1QME A;  3ZGA B;  2GZA A;  1YQS A;  5HPI A;  4OQH A;  1AXB A;  2UV0 E;  3EEA A;  1BSG A;  2Y91 A;  4IBX A;  1S4S A;  4JKT A;  4DDY A;  4JGP A;  1G5U A;  3EGD C;  1JNU A;  5EUA A;  1GSX A;  4PM8 A;  5EVI D;  3IBR A;  4R3B A;  3U2A A;  2WKE A;  2WK0 A;  5HDD A;  1PWC A;  3LIE A;  5DKL A;  4HI4 A;  3CUE C;  3PBN A;  5EM1 A;  4H8R A;  1L3L A;  3FYZ A;  3VP1 A;  3CG5 A;  5TGF A;  3OOV A;  3QP4 A;  5CX7 A;  4WMC D;  2PYR A;  1KE0 A;  1D7E A;  4UQI M;  3V5M A;  1FCO A;  4NXB A;  2ZBB A;  3BYD A;  2XD1 A;  3R7W A;  3G31 A;  3WS0 A;  4XT2 B;  2ZC7 A;  3VFH A;  3C2W A;  3MS6 A;  5J3W A;  4B93 A;  1Y4O A;  5GL9 A;  3MF0 A;  1MWU A;  4PPR A;  1TDL A;  2PYP A;  1XJ4 A;  4JXG A;  2IWB A;  4OQI A;  3UDI A;  3SH8 A;  4AFI A;  5FI2 A;  3D4F A;  2KX6 A;  1BLC A;  1BLP A;  3M2K A;  3VE4 A;  2P9V B;  4DJ3 A;  3NOP C;  3TE8 A;  3CZD A;  2ZD8 A;  3VP2 A;  5AQA A;  5DTS A;  1TF1 A;  4B88 A;  5EOE A;  3TG9 A;  1GSV A;  1K57 A;  2PU2 A;  1OT9 A;  1HVB A;  1UGU A;  3FZC A;  2XK1 A;  2OLU A;  2Y2M A;  4LPZ A;  2W1T B;  4G3V A;  4KZ4 A;  4GZB A;  1ES4 A;  3K3C A;  4JPM A;  4DN0 A;  4XT2 A;  1DP8 A;  3T1X A;  4I3J A;  3W4Q A;  4EET B;  4DF6 A;  3T4T A;  3IF6 B;  5AVF A;  5HZH A;  1RGY A;  3LR4 A;  4NXG A;  1XXM A;  3H82 A;  3ZNT A;  2FH5 A;  1FR6 A;  2IA2 A;  2ZQA A;  2W1R A;  4LRX C;  5A90 A;  2J80 A;  1CF0 A;  4YOF A;  2OAP 1;  3H9W A;  3T1S A;  1T1B A;  5F6A A;  2I72 A;  4Y17 A;  3A3I A;  4S2J A;  5GHY A;  4PKY G;  5EVL A;  1K25 A;  4N1H A;  1E3U D;  2XDM A;  1Y54 A;  1XPB A;  3LGO A;  3BRM A;  4OPR A;  2A24 A;  3OCL A;  4HEF A;  3QP2 A;  4GJ4 A;  3NDG A;  3S7P A;  4BJP A;  2DCF A;  2V1B A;  1LHY A;  1LL5 A;  1T1C A;  2OLV A;  1GHP A;  3HLD A;  3GEC A;  3LFV A;  3EOI A;  3UPP A;  3ZG5 A;  1DJC A;  4I3A A;  3GVB A;  5FQK A;  3JVV A;  3HLW A;  3E98 A;  2KOI A;  1WYC A;  2YKH A;  3C4O A;  2HZ5 A;  3IF6 A;  1P9W A;  4LRZ E;  3F1P B;  3KYQ A;  5LBR A;  5DFY A;  3GSG A;  3KO6 A;  3AGE A;  1AWI A;  4GB7 A;  3NHQ A;  2WAD A;  4KZB A;  3ULF A;  5HAQ A;  4KG5 A;  3Q7Z A;  1CEF A;  2XD5 A;  4O01 A;  4I38 A;  2W3E A;  2HDQ A;  1VM1 A;  3HUN A;  4WZ5 C;  3LR3 A;  2M1C A;  1K56 A;  3ZDJ A;  3ZNY A;  2M7U A;  3KSF A;  1YLY A;  3CJM A;  1TVF A;  2OAQ 1;  4R4S A;  4E3M A;  4WEL A;  3MZD A;  3HJI A;  3T4S A;  1IYS A;  3E2L A;  1T1A A;  4WEK A; 
#chains in the Genus database with same CATH homology
 4K08 A;  5TJJ A;  1NLY A;  3EGX C;  4HJ4 A;  5HDS A;  2DMW A;  4LLO B;  3OLO A;  3BJN A;  3DBA A;  4ARZ B;  4CQH A;  2O99 A;  1OT6 A;  2J3W A;  4Q0H A;  2KDK A;  2EWV A;  2K31 A;  2L1M A;  2VGL S;  3E0Y A;  4GCZ A;  4EU0 A;  3NOT C;  2JKT M;  3IBJ A;  1W63 M;  3UB6 A;  4GHI B;  2LB9 A;  4WN5 A;  5A8B A;  3TJZ C;  3C38 A;  3BY9 A;  2WKR A;  4WEJ A;  2WKP A;  2NUT C;  3EQV A;  2L4R A;  3MR0 A;  4JGR A;  3ICY A;  2FZ0 A;  2JN7 A;  2PR5 A;  2PD8 A;  1H8M A;  4EEP A;  3MQQ A;  4HH2 A;  2VA0 A;  1D06 A;  4YNR A;  3BQA A;  4IJG A;  1LSV A;  2J3T C;  1TS0 A;  3S7O A;  3MJQ A;  4R3A A;  4CLC A;  2J3T D;  2XRN A;  5HSQ A;  1G6O A;  4FOF A;  4E04 A;  3F1O B;  4HOI A;  5L8M A;  1VHM A;  4L9G A;  5C5K A;  3LIC A;  2B02 A;  2HGV A;  4Q0I A;  2Y8H A;  2O9C A;  2QHK A;  4BBT A;  3PR6 A;  3PBQ A;  4B9O A;  4H6J B;  2XA7 M;  2XRO A;  1P97 A;  2VV6 A;  4GS9 B;  1OJG A;  1MKM A;  2KLI A;  3E4Q A;  4O8G A;  4OOL A;  4ARZ A;  2Z6C A;  1GSW A;  2QJ5 A;  2W0N A;  4HQA A;  4Q0J A;  5MC7 A;  2HF6 A;  5IU1 A;  2ZMV A;  3UB8 A;  3VOL A;  2W3D A;  2D01 A;  3EQU A;  4CLC C;  1STZ A;  2PT7 A;  3HJK A;  3UE6 A;  1F98 A;  1BYW A;  1OJ5 A;  1OTD A;  1N9O A;  3TW8 A;  4GHI A;  3GDI A;  3W2Z A;  3S7N A;  3FC7 A;  3VE3 A;  1VB6 A;  3BQ8 A;  4MDZ A;  1DRM A;  4GLQ A;  4Y3I A;  3H7W B;  5HPF A;  4O0P A;  1N9L A;  4KUO A;  1TS8 A;  4I39 A;  3B42 A;  4HJ6 A;  2Z6D A;  2EWW A;  4R70 A;  3T4L A;  3NJA A;  4DMZ A;  2ZMF A;  1S67 L;  5FL3 A;  3CLO A;  1YSP A;  2EA9 A;  5G4Z A;  3HCY A;  5HWV A;  4HHD A;  3LIF A;  3V67 A;  2PR6 A;  2B18 A;  2PD7 A;  3F1O A;  2P7J A;  3MXQ A;  2O0Y A;  3T50 A;  2XA7 S;  3A0R A;  4QPR A;  4GW9 A;  3O5Y A;  4EW7 A;  3R4K A;  3B33 A;  2VV7 A;  2GJ3 A;  1TS6 A;  2W27 A;  3LYX A;  1X0O A;  3CIT A;  3PBR A;  3TRC A;  3MMH A;  4H6J A;  1MZU A;  3P01 A;  4L9E A;  4P6Z M;  3ZQ5 A;  4GS9 A;  1W63 Q;  3FPV A;  3K3D A;  4HH3 A;  2VKS A;  4ME4 A;  1OPX A;  1YKD A;  4YWZ A;  4R6L A;  4Z1W A;  3R7W B;  4UEY A;  3VV4 A;  3CUE A;  5I5L A;  4EUV A;  1NWZ A;  2VJW A;  2YKF A;  2GZA A;  5DJU A;  5HPI A;  1P0Z A;  3H7W A;  5J4E A;  3MQO A;  3BW6 A;  3EEA A;  4MMN A;  2K7S A;  1WA9 A;  3CWF A;  4EQ1 A;  1OTE A;  1S4S A;  3D72 A;  1G28 A;  4BMW A;  4NXE A;  2PDR A;  4JGP A;  4G3W A;  2OOL A;  2OWH A;  3EGD C;  1JNU A;  3C30 A;  1GSX A;  4BBU A;  2GNX A;  4PHT A;  3IBR A;  4WLA A;  3U2A A;  1YSQ A;  5HDD A;  3IS2 B;  5F69 A;  4PKY A;  3LIE A;  4P6Z S;  4HP9 A;  5DKL A;  1ZHH B;  4HI4 A;  3CUE C;  3PBN A;  1V9Y A;  3A0V A;  3LIB A;  3FG8 A;  4NXF A;  1TS7 A;  3KX0 X;  4KUK A;  3OOV A;  3MQ0 A;  5IT5 A;  2VV8 A;  4NKP A;  5CX7 A;  4WUJ A;  2PYR A;  1ZTU A;  3ZYT A;  3K2N A;  4UQI M;  3LID A;  2JKT I;  4NXB A;  4WL9 A;  2ZBB A;  4FSF A;  3C8C A;  4MN6 A;  2WKQ A;  3R7W A;  3BWL A;  3EEH A;  5IS1 A;  2W1T A;  2VLG A;  4XT2 B;  5F68 A;  3PBS A;  4KQD A;  2K2N A;  3G6O A;  3C2W A;  5J3W A;  2JHE A;  4B93 A;  3LR0 A;  2QWS A;  3MF0 A;  4I3I A;  3RFB A;  1T18 A;  4LRY C;  5HL6 A;  4HP4 A;  5TBM B;  2PYP A;  1XJ4 A;  3CAX A;  3NOU C;  2P08 A;  4EER A;  4BWI A;  2JKR M;  3PHY A;  4DJ2 A;  1XJ3 A;  3E4O A;  3JVU A;  4AFI A;  1XFN A;  5HWW A;  4IUK A;  4MN7 A;  2KX6 A;  1XJ2 A;  5HD3 A;  2NUP C;  1KOU A;  4HNB A;  3VE4 A;  4MCW A;  3IS2 A;  3FPW A;  4I5S A;  5F5Y A;  2QKP A;  4DJ3 A;  3NOP C;  5G4Y A;  3TE8 A;  1OTA A;  4WEK A;  4II7 A;  1IOU A;  4UQI S;  3OC2 A;  3KSI A;  4JGQ A;  4NEE D;  1TF1 A;  2HV1 A;  1UWP X;  4CLC E;  3PXP A;  4MN5 A;  1GSV A;  1OT9 A;  3KSG A;  4HIA A;  1UGU A;  3MFX A;  4M4X A;  4OOM A;  1OTB A;  5HDC A;  4ETZ A;  4LPZ A;  2W1T B;  4G3V A;  3LIA A;  2V0W A;  3K3C A;  4DN0 A;  1OTI A;  1S4R A;  4XT2 A;  3T4Q A;  1DP8 A;  4EEU A;  5DFX A;  2V9A A;  1S66 L;  1UWN X;  4I3J A;  2L0W A;  4L0L A;  3OBF A;  4EET B;  1LL8 A;  3T4T A;  3LR5 A;  5AVF A;  5HZH A;  4Y2F A;  3LR4 A;  2V0U A;  3F1P A;  4NXG A;  2P04 A;  4EXO A;  3H82 A;  5TBM A;  3SW1 A;  3T4O A;  4BBV A;  2FH5 A;  2H28 A;  4WF0 A;  2JKR I;  2IA2 A;  5EFW A;  5HD5 A;  2W1R A;  4KQO A;  4LRX C;  3UB9 A;  4F3L B;  1V9Z A;  2J80 A;  3RH8 B;  3PBT A;  4YOF A;  2OAP 1;  1YAX A;  3EWK A;  4ETX A;  2OWJ A;  4EES A;  3H9W A;  1T1B A;  2MJ6 A;  5F6A A;  3F1N B;  2A2L A;  3E4P A;  3OCN A;  2HJE A;  4Y5F A;  4PKY G;  2GX5 A;  5K5B A;  3LI9 A;  3UMD A;  3LUQ A;  2BAS A;  2A24 A;  3OCL A;  4GJ4 A;  2HJ9 C;  2INW A;  3S7P A;  4BJP A;  2CMN A;  4L9F A;  2V1B A;  3PBO A;  1MC0 A;  4JGO A;  3T4J A;  3LI8 A;  5KIZ A;  1TD5 A;  1P9R A;  5DKK A;  1N9N A;  1T1C A;  3S7Q A;  2R78 A;  4PAU A;  3D3O A;  5AJG A;  3GEC A;  3LFV A;  3EOI A;  2W3H A;  2PHY A;  3T4K A;  4I3A A;  1T19 A;  1S1Z A;  3JVV A;  2W3F A;  3E98 A;  3P7N A;  2KOI A;  1DP9 A;  2YKH A;  2O9B A;  2G7U A;  1F5M A;  1P9W A;  4LRZ E;  3F1P B;  3KSH A;  3KYQ A;  1ODV A;  1LSX A;  1H3Q A;  2VX8 A;  5LBR A;  5DJT A;  2QJ7 A;  5DFY A;  3H82 B;  3KO6 A;  3CI6 A;  3UE3 A;  2VGL M;  2W3G A;  1DP6 A;  4IUH A;  4CLC D;  3NHQ A;  2VEA A;  1XJ6 A;  5AVE A;  3PYP A;  3ULF A;  2I9V A;  1NLZ A;  2LB5 A;  4F3L A;  1F9I A;  1NRJ A;  4O01 A;  4I38 A;  5HWT A;  4RQ9 A;  5J7E A;  2XSS A;  3F1N A;  1EW0 A;  2W3E A;  4CLC B;  2V1A A;  4IHQ A;  3LR3 A;  2M1C A;  1Y28 A;  2VZW A;  2A24 B;  2ZOI A;  3RTY A;  2QYB A;  1IFQ A;  2M7U A;  4ZRR A;  3KSF A;  3KYZ A;  4HJ3 A;  3UME A;  1LSW A;  2O9A A;  3B47 A;  3BY8 A;  2OAQ 1;  4HY8 A;  1S1Y A;  1LT0 A;  4WEL A;  2D02 A;  3A0S A;  3UB7 A;  4R38 A;  3HJI A;  5DF9 A;  3T4S A;  5KSH A;  2Y79 A;  2M7V A;  1T1A A;  2ZOH A;  1D7E A;  4G3K A;  1XFQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...