4I38A

Structures of it intermediates from time-resolved laue crystallography collected at 14id-b, aps
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
publication title Volume-conserving trans-cis isomerization pathways in photoactive yellow protein visualized by picosecond X-ray crystallography
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Luminescent protein
total genus 36
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2012-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4i38A00
1LSVA 1XFNA 5HWTA 5J7EA 4LRYC 3F1PA 1TS0A 3PYPA 3NOTC 4NXBA 2VV7A 4I39A 1OJGA 1OTIA 2PHYA 1LT0A 2V9AA 4LRXC 4M4XA 4I3IA 4JGRA 5HWVA 5DKLA 2Z6CA 3H7WB 4KUKA 5J4EA 2QJ7A 3F1OB 4YWZA 1TS8A 3UE6A 1TS6A 4PKYA 3A0SA 3CLOA 2D01A 2L1MA 2WKPA 1GSWA 3H82B 2OWHA 1DRMA 1V9ZA 2PYPA 1LSWA 2PD7A 2K7SA 4XT2B 4LRZE 1X0OA 3UB9A 4HY8A 4L9EA 4HJ4A 2ZOHA 4HH3A 4I3JA 2R78A 4EERA 4NXFA 2ZOIA 1Y28A 3F1NB 1LSXA 1V9YA 1LL8A 3E4OA 5A8BA 4GS9B 3K3CA 1S1YA 3NOUC 4H6JA 1S1ZA 4R70A 3E4PA 3MXQA 5AVFA 1GSXA 1T1CA 5F6AA 3LIEA 1F98A 3HJKA 4I5SA 2ZBBA 4GW9A 3D72A 4MN6A 3HJIA 4EETB 4WN5A 3C2WA 5DKKA 3VE4A 3VE3A 1N9OA 5EFWA 1T18A 4HOIA 3LICA 5F5YA 1DP8A 3T50A 2WKQA 3ZQ5A 1S4RA 5HD5A 3BY8A 4HJ3A 4HIAA 2VV6A 2V1BA 4F3LB 2W27A 3ICYA 2P7JA 2V0UA 3PHYA 2OWJA 3FG8A 1S4SA 4KQDA 4HNBA 2EA9A 5I5LA 1N9NA 5HDCA 2L0WA 3UB7A 1WA9A 1UWPX 3EEHA 2W0NA 3LI8A 3C8CA 5TBMA 4HI4A 3GECA 1XJ4A 5HDSA 5KIZA 3IS2A 3ULFA 1XJ2A 5AVEA 4EW7A 2PD8A 2J80A 2YKHA 1OTDA 1D06A 2PR5A 3F1PB 5IS1A 2VV8A 3NHQA 4HHDA 3LYXA 5F68A 1EW0A 3K3DA 4HJ6A 3LI9A 4R6LA 4EESA 3SW1A 1NWZA 3MQOA 4NXGA 1KOUA 5TBMB 4HH2A 4PKYG 4KUOA 1MZUA 3IS2B 3CWFA 4WL9A 3LIAA 1N9LA 4I38A 3RH8B 3BWLA 4E04A 2PR6A 1OT6A 2PYRA 4WUJA 2KX6A 3MFXA 4LPZA 4GHIA 3MQQA 5HZHA 3MR0A 3UB8A 2INWA 4NXEA 2H28A 1VB6A 5HWWA 5G4ZA 1P0ZA 3EWKA 4H6JB 3F1OA 3NOPC 2QKPA 3MJQA 4R38A 4EEPA 4I3AA 3NJAA 2A24A 5HSQA 2JN7A 2V0WA 3H82A 4BBUA 4HP9A 3E4QA 2HV1A 4GCZA 2B02A 1OTEA 1XJ3A 4XT2A 4B9OA 4GHIB 1P97A 2WKRA 3G6OA 2BASA 3BY9A 4K08A 5HD3A 4EXOA 2M1CA 2VLGA 3F1NA 3UMDA 2QHKA 3LIDA 1S66L 4GS9A 2A24B 1D7EA 4BBTA 4BBVA 3GDIA 1T19A 3IBRA 4L9FA 4JGPA 1BYWA 4MN5A 3P7NA 1S67L 4DJ2A 2Z6DA 4R3AA 5G4YA 5J3WA 2GJ3A 3OLOA 2QWSA 3LIBA 4HP4A 5HDDA 1XFQA 4HQAA 1OTAA 2YKFA 3CAXA 5DJUA 1ODVA 2KDKA 2OOLA 3KX0X 2D02A 1OT9A 4WLAA 3B33A 3RTYA 4LLOB 2I9VA 4EEUA 1T1AA 4RQ9A 1F9IA 3UMEA 1UWNX 5DJTA 3H9WA 1GSVA 3LIFA 4WF0A 1JNUA 3A0VA 3VOLA 3A0RA 4F3LA 3LUQA 3FC7A 1UGUA 1OTBA 1DP6A 2QJ5A 1XJ6A 1T1BA 4JGOA 2V1AA 4JGQA 4L9GA 1TS7A 1OJ5A 3H7WA 1G28A 3UB6A 5F69A 2CMNA 4EQ1A 4DJ3A 5IU1A 1DP9A 2PDRA 2L4RA 2JHEA 2VEAA
chains in the Genus database with same CATH superfamily
4RYEA 4WZ5C 3C38A 4Y0UA 3F1PA 1FCOA 1TS0A 5IT5A 4H8RA 4U0XA 1STZA 4WZ5A 5EVEA 1OTIA 2PHYA 1MY8A 2B95A 4WELA 1HD8A 1NLZA 1VETB 3JVUA 4IUHA 3V50A 5AQ7A 3BM6A 2ZM0A 2QJ7A 4YWZA 1TS6A 3A0SA 3D4FA 2E8JA 2WKEA 4RA7A 3S4XA 4X56A 2C6WB 3QP8A 4M3KA 5DFYA 4R4RA 3PBOA 4S2PA 4GKUA 1XP4A 1V9ZA 1LSWA 1SHVA 1BUEA 3IHAA 3FKWA 1LI9A 4LRZE 1O7EA 2HDQA 4X25A 1W7FA 1NXYA 4L9EA 5E43A 2Q9NA 4QJGA 4K0XA 4I3JA 4BL2A 2R78A 4KZ6A 2WKHA 4NXFA 3OPHA 1ALQA 3R4KA 4KQQA 4P85A 2IWBA 4GJ4A 4E6XA 1ZHHB 1W8YA 3E4OA 4X6TA 4H6JA 1FILA 1XKZA 3CPTB 1IYSA 5EUAA 3E4PA 5AVFA 1GSXA 1T1CA 3N6IA 3KYQA 4P6ZM 3HLEA 3DW0A 3HJKA 4I5SA 2HP5A 4F94A 2WGWB 4GW9A 3C30A 1GA9A 4MN6A 4BL3A 4WN5A 4E6WA 1KGEA 3N8RA 3FPWA 4BJPA 3EEAA 5DKKA 1FOFA 4DN0A 1TDGA 1FIKA 5JYOA 4R0QA 1T18A 4R1GA 4HOIA 3LICA 2ZC5B 1DP8A 3T50A 3VP4A 2WKQA 4QPRA 3A3IA 2VGKA 4N92A 2RCXA 3VFHA 1YLZA 4HJ3A 3IWQA 3UNWA 2VV6A 3O3VA 1H8ZA 1MC0A 1PW8A 3M2JA 3T4QA 3W2ZA 3VSKA 1PZOA 2P7JA 4OP8A 4BMWA 2V0UA 1NLYA 2OWJA 5FQIA 4P0MA 4ZJ1A 2OV5A 2H0YA 3IWIA 2OSUA 4WM9A 2PRFA 1GHIA 5EOOA 3MMHA 1N9NA 1CF0A 2L0WA 4GLQA 1SKOB 3W4PA 4WYYA 3UPOA 3C8CA 1JTGA 3BW6A 3IXHA 4D2OA 4HI4A 1XJ4A 3SZTA 2J3WA 5KIZA 4WEKA 2WUQA 1QMFA 1K56A 2XQZA 4EW7A 1ESIA 2J80A 2YKHA 1IOUA 5CX7A 3V67A 2PR5A 2B18A 2VV8A 3IX3A 4JKTA 1EW0A 5HW3A 4OVDA 4HJ6A 1KDSA 2LB9A 4R6LA 3IXDA 4IBRA 4OKPA 1NWZA 4NXGA 3NDGA 1NZUA 2Y2MA 1FCMA 4DE1A 3NIAA 3MFDA 2O99A 4AFIA 4NG2A 4OONA 4II7A 4KUOA 5EVID 1VM1A 1MWTA 2XD5A 1K38A 4S2NA 3CWFA 2V20A 2ZQCA 3V39A 5A90A 2R9WA 3RH8B 3IH8A 5CXWA 2O9AA 2PYRA 4GNUA 4WUJA 4LPZA 5HL6A 4JBFA 3MR0A 3ZVWA 1TEMA 3UB8A 1QMEA 1K4FA 5EM1A 3UE0A 3LEZA 2DNSA 5EECA 4HBTA 4LENA 4QY6A 2EWWA 5CGSA 3IF6C 1VQQA 3NOPC 4R38A 2JN7A 3HUMA 4Y17A 4BD0A 1BTLA 5HPIA 1BSGA 2KOIA 2B02A 4GZBA 2BLSA 3N8SA 3EGDC 2G2WA 3KSGA 2Y4AA 4ZDXA 2X01A 1PI4A 3OBFA 3P98A 3VSLA 3JPUA 4K91A 2M1CA 4WMCD 1VHMA 3HCYA 4Q8IA 4OPQA 5EM0A 1D7EA 4QWOA 2J8YA 3GDIA 1T19A 4ESPA 2EX8A 4L9FA 4JGPA 2Z2LB 3I7JA 4DJ2A 4R3AA 1K57A 4OQIA 4RX2A 5HDDA 3NY4A 2YKFA 1PWGA 4DE3A 1ODVA 2OOLA 1Y54A 1PZPA 2IWCA 5DF9A 2VZWA 3TE8A 4N9KA 1NRFA 3Q1FA 3UPNA 1H0MA 5HAPA 2I9VA 4JPMA 3WRZA 1T1AA 1F9IA 5DJTA 4DDSA 3H9WA 2DMWA 4JF6A 5DVAA 1RGYA 3EGXC 2WGVA 3A0RA 5FQQA 3LUQA 1UGUA 4QY5A 1PW1A 3P01A 3LEQA 3KYZA 4JGQA 2XR0A 3BFEA 5EOEA 3SS4A 1TS7A 3O87A 2ZLYA 4S2KA 3H7WA 3LY4A 3IT9A 2G2UA 3HLGA 3IQAA 2JKRI 4Y3IA 2EFXA 4HEFA 5IU1A 3ZG5A 1ZC2A 1JTDA 4LV2A 3PXPA 5FASA 2L4RA 5FAQA 5EPHA 5KSHA 4FTXA 1Q2QA 4MN7A 4CLCB 5L2FA 4LV1A 1FSYA 2NUPC 4LRYC 2PAVP 3PYPA 3FYZA 3B47A 4NXBA 4I39A 1BLSA 2PU4A 3S7NA 2V9AA 3LGOA 4I3IA 4JGRA 4YNRA 5DKLA 3H7WB 2QZ6A 3B42A 1WE4A 2D01A 2L1MA 4E3MA 3ZVTA 1GSWA 3H82B 1XPBA 4EBLA 4EU0A 1YLWA 1DJAA 4U3TA 1XXMA 1Y4OA 1W8QA 2K31A 3VOYA 2PYPA 1CQAA 2XA7S 5L8MA 3AGDA 2K7SA 1IKGA 3HLDA 3HL9A 4XT2B 5HFOA 3M6HA 2AVXA 3OOVA 1BULA 2A2LA 1DY6A 2WGIA 3A3FA 4N1XA 1KGGA 2OLUA 4RX3A 2Y2LA 3Q81A 4Q0HA 3MSHA 5GHZA 4DE2A 1S1YA 4WEJA 1FSWA 5GLAA 3CG5A 3OZHA 3BFFA 2W1RA 4KZBA 2R9XA 3LIEA 1F98A 2BG1A 1YQSA 3G35A 1K0KA 4DKIA 1L2SA 4MDZA 3T1RA 3D72A 4CLCD 4EETB 4MEZA 3MXSA 3C5AA 2HJ9C 1G6OA 3C2WA 1SKFA 4E3KA 5AQ9A 3HUNA 1TVFA 4JF4A 4OH0A 3VE4A 2QYBA 4P87A 1SCWA 3DAVA 5F5YA 5CTNA 3NBLA 4KG6A 2ZMAA 3ZQ5A 1JWZA 3G34A 3QP6A 5HD5A 5E2GA 1YPRA 4O7DA 4DXCA 1FCNA 4F3LB 2W27A 2ZL1A 4S2LA 3ICYA 4E3JA 2ZM2A 3TW8A 2JKRM 3ZG0A 4PAUA 3FG8A 4KQDA 2V1ZA 4MNRA 4BD1A 5I5LA 4MMNA 3QNCA 1BLPA 5HDCA 3UDIA 1S6RA 1H8YA 5FSRA 3EEHA 2ZMVA 3LI8A 1HLUP 1L0DA 5TBMA 3HVFA 1LL5A 5HDSA 5FI2A 3TJZC 3IS2A 2ZMFA 5CEDA 2PD8A 1NZOA 1K25A 4BENA 3DTKA 3NC8A 1RGZA 3F1PB 2OAQ1 5F68A 2ZL1B 5FQKA 2XEPA 4IUKA 4X1MA 3UN7A 2HDSA 3K3DA 4IEDA 1IYPA 2VGLS 3G32A 3SOIA 2VKSA 5KMWA 2JKFA 4EESA 4Y2FA 3VV4A 3BJNA 2B5RA 3N7WA 4G3VA 4GD6A 4WBGA 4D60A 5EVIC 2JBFA 4ETXA 4ZTKA 5TBMB 4HH2A 5FQMA 3KSIA 3PBTA 4R3BA 1F5MA 1MZUA 3IS2B 4WL9A 3LIAA 4E3NA 4QB8A 1N9LA 4ZBEA 4E3IA 5KSCA 1Q2PA 1OMEA 1YLJA 3UDXA 4E3OA 1LL9A 3BWLA 1ZTUA 1J9MA 3EQUA 3MFXA 3C4OA 5GLCA 5HZHA 5HAIA 2XROA 4ZRRA 4EUZA 2A3UA 3MZEA 2H28A 2QMIA 4NETA 1JVJA 1OPXA 5FAOA 4IHQA 4H6JB 1FQGA 3F1OA 3MJQA 4KZ8A 4PM7A 4JXGA 2A24A 2JE5A 5HSQA 3ZCZA 2Y2IA 3GMWA 2XSSA 2V0WA 3ITBA 3QHYA 2EX6A 2J9PA 3MKEA 2H5SA 3WS0A 4HP9A 2HV1A 3FWLA 1OTEA 4B9OA 5A91A 3N4IA 3CUEC 4UHUA 3SH9A 1ONHA 2BASA 3BY9A 3ZG8B 1TF1A 3IX8A 3ZHHA 1TD5A 4EXOA 3BLSA 5FATA 3F1NA 4WMCA 2QHKA 1YT4A 5FQJA 1ZG6A 4C6YA 3LIDA 4JF5A 2WK0A 1S66L 4GS9A 2A24B 4BBTA 1W63M 5CERA 3OC2A 3BQAA 3MXRA 4Y15A 1MBLA 4KZAA 1BYWA 4FH4A 5CGXA 3P7NA 4NK3A 4Q0JA 5M1AA 4Z1WA 4Y0TA 2Y8HA 2W3DA 1L0GA 3LIBA 3PBNA 1XGIA 4HQAA 1OTAA 3OPPA 3E0YA 1U60A 2Y2NA 4G3WA 1K55C 1H5XA 5F1GA 2FH5A 2HF6A 3RTYA 5FDSA 3CMZA 1ES2A 4LV3A 4RQ9A 2HDRA 1UWNX 5CGWA 3JYIA 4ID4A 3HBRA 2ACGA 3Q7ZA 1GSVA 3LIFA 4WF0A 4DE0A 1JNUA 1KE4A 1MWRA 3A3EA 1XJ6A 3BRMA 2NUTC 4QHCA 5LBRA 4LFUA 4UA7A 3DTIA 2J9OA 5L09A 1G28A 1SZVA 4L0LA 4EQ1A 3B3XA 3HREA 3IF6A 3MQ0A 3VP0A 3TRCA 2PDRA 1TDLA 1YLTA 1IELA 3T4SA 5TJJA 4OLGA 1XGJA 5GLBA 1LSVA 5HWTA 2H0TA 2X02A 4CJNA 1K4EA 3NOTC 2XK1A 2VV7A 5E2FA 1WYCA 1OJGA 1LT0A 4LRXC 3BFCA 2XH9A 4M4XA 1O07A 2I72A 2W3HA 3AGFA 1N4OA 2ZC3B 2Z6CA 5CHUA 4KUKA 3TOIA 3UB5P 5J4EA 3UE6A 3ITAA 2WZXA 5CEBA 1EROA 1YMSA 2WKPA 1H3QA 1LHYA 2V8FA 3VP2A 3MZFA 1K56D 5L07A 1DRMA 3VFFA 2GDNA 3ZYTA 3S7PA 1DJCA 3CZDA 3LR5A 3UB9A 1CK3A 5HAQA 2HJEA 5AJGA 4HH3A 3A3JA 4XXRA 4ARZA 4B93A 3A3DA 4MBHA 1MKIA 5L10A 2ZOIA 1Y28A 1LSXA 4OP5A 1V9YA 4X53A 1ZG4A 4UA9A 1BT5A 5HPFA 3K3CA 3T4KA 5FAPA 3NOUC 5CTMA 4B4XA 2XFSA 2XDMA 2EXAA 4R70A 4EQIA 2WAEA 2Y2JA 4CLCC 3FKVA 1E3UA 3LY3A 1L3LA 2PBYA 5GL9A 5AQBA 4PM5A 3PTEA 3ZFZA 4DDYA 1L0EA 3UPPA 1PNEA 4S2IA 3BFGA 1XA1A 5EFWA 1W63Q 1AWIA 5IHVA 3DTEA 2DRWA 3G2YA 1W79A 1L0FA 1YAXA 3K2NA 3BEBA 3IXGA 4HIAA 4X68A 2X71A 4OOYA 4UQIS 2V1BA 5CHMA 5U47A 2VJWA 1PI5A 4QU3A 1ERQA 3PHYA 2J7VA 1S4SA 4N9LA 4S2JA 1KVLA 3E2KA 1G5UA 3D9YA 2P08A 1UWPX 2OLVA 3GSGA 2W0NA 5TGFA 2WAFA 1VEUA 1RP5A 3DWKA 3PAGA 5KZHA 3GECA 4PM9A 2CC1A 1A0KA 1GHMA 5AVEA 4U0TA 1OTDA 1D06A 4JXSA 3BECA 5F82A 4GOGA 2JKTI 4R3JA 5FI6A 4HHDA 3LYXA 4OPRA 1AXBA 3Q82A 5DF7A 4IVIA 1K6SA 3OCNA 1K6RA 1IFQA 1K54C 3N8LA 1F2KA 2J3TD 4EBPA 4K0WA 2KLIA 3S1YA 1KOUA 3WS5A 2HPBA 3EOIA 1FR1A 2GZAA 3TSGA 3QNBA 3ZNTA 5EE8A 1SDEA 2ZM8A 4EWFA 4PKYG 5DTSA 5A92A 3Q07A 3QP5A 1GA0A 1CI9A 4I38A 1G6AA 1JWPA 3HLFA 1PYYA 1KE3A 3GRJA 4KG5A 2Y59A 3L9KA 2ZQ8A 2ZQDA 2GX5A 3MQQA 5FEFA 2XF3A 1NJ4A 4X1LA 3NDEA 5FI7A 3KSHA 1E25A 1ESUA 4NXEA 1HZOA 2K2NA 3QP1A 1VETA 1XX2A 4MLLA 3ZG9B 4PMAA 4PHTA 3W8KA 1ES3A 3CITA 4C75A 1EI5A 5DF8A 3R7WA 3IXBA 2IWDA 3ISGA 5TR7A 2Y2PA 1JWVA 3E4QA 4GCZA 3UE3A 2VX8A 1CI8A 3L7HA 1P97A 2WKRA 2XRNA 5C5KA 1D1JA 5DFXA 3ZGAB 2HP9A 5AQAA 4RVAA 3UMDA 3IH9A 4X69A 4GN2A 2QPNA 4MBFA 2Z2MB 4ZJ2A 3LO7A 2M7UA 3CPTA 2EX2A 2E8IA 3IHBA 5F83A 4BBVA 4KZ5A 2VGJA 1I2SA 4KZ3A 3IBRA 3R7WB 3VMAA 1S67L 2Z6DA 2C5WB 5G18A 2HP6A 2GJ3A 2QWSA 3O86A 2O9CA 4O8GA 4IJGA 3D3OA 2WGWA 5CRFA 3BYDA 3DTMA 1XFQA 4S2MA 3S7QA 3UE1A 4O0PA 4FCFA 5DJUA 4KQOA 2JKTM 2WKIA 3SS5A 5EVIA 4DXBA 4OPYA 1OT9A 4R23A 4WLAA 4S2OA 3UY6A 3G31A 1DJBA 5GHXA 3OCLA 2WZZA 4KQRA 2UV0E 1IKIA 1I5QA 3ZDJA 2Q0OA 3UMEA 2ZC7A 1KVMA 1YM1A 5TFQA 2FZ0A 3LR3A 3WS4A 2Y2KA 1HVBA 4CPKA 3FPVA 3VOLA 3S22A 4GDBA 3LFVA 4B4ZA 3FC7A 5FL3A 1M6KA 1OTBA 1RCJA 2QJ5A 1T1BA 1CJFA 5CHJA 3DWZA 1MWSA 1KE0A 2ZC6B 3CHWP 1OJ5A 4ETZA 1W5DA 1YLYA 5A93A 4YFMA 1SKOA 5EVIB 2CMNA 3BFDA 2FFYA 4LV0A 5GLDA 4QD4A 2JHEA 1G68A 4FUWA 2ZC4B 3S7OA 1XFNA 4EV4A 5J7EA 3M2KA 4OOLA 4DF6A 4FD8A 3E2LA 3T1QB 1NRJA 1ONGA 1MKMA 3KYEA 3CUEA 2H10A 5HWVA 3T4TA 3C4PA 2LB5A 3OPRA 3F1OB 1TS8A 1NYYA 1PFLA 2P74A 1FR6A 2PU2A 4OPZA 4CLCE 4PKYA 3CLOA 1MXOA 1IYOA 5EVLA 2XLNA 2OWHA 3HUOA 5FA7A 1LI0A 4FH2A 4N1HA 2PD7A 1J3WA 2XFTA 3BQ8A 3MZDA 3VP1A 3JVVA 1X0OA 1ES5A 4HY8A 1YKDA 1ZKJA 4HJ4A 4UQIM 4GDNA 2ZOHA 2WADA 2EX9A 2Y2OA 1IYQA 3QP2A 4JXVA 4EERA 5FEGA 1SDNA 3F1NB 3PAEA 2V8CA 1I2WA 1LL8A 5A8BA 4S2NC 4YOFA 1K55A 4GS9B 3V5MA 3WS1A 5BOHA 5GHYA 4NEED 5E2EA 3RXWA 1S1ZA 4PM6A 3MXQA 4OQHA 3VP3A 4EUVA 4MCWA 2XGNA 3LCEA 5F6AA 3IF5A 2ZJ9A 5DTKA 3C7UA 1Z09A 2ZBBA 2W3FA 2XA7M 1PWCA 3HJIA 2O0YA 4OQGA 3GV9A 2RL3A 2V2FF 3LR0A 4FSFA 4DRTA 3CJMA 4B88A 3VE3A 3U4LP 1N9OA 1PRQA 4WZ4A 4HBUA 4UA6A 4UEYA 1S4RA 4XUZA 2WYXA 3BY8A 3TG9A 1MPLA 5FQ9A 3PBQA 3WS2A 2BTFP 1P9WA 2PBDP 3NULA 3P09A 3RJUA 1CEGA 1E4DA 4C3QA 4BLMA 1CEFA 4HNBA 3IWOA 3MKFA 2EA9A 4PPRA 3NCKA 4OLDA 4ZJ3A 1N9BA 1YSQA 1NY0A 2ZQ9A 3UB7A 3KSFA 4KZ7A 1WA9A 2GNXA 2VK3A 4IBXA 3E98A 3T1SA 1C3BA 3IF6B 4P6ZS 1HTZA 5K5BA 4MBKA 3RXXA 2FFFB 1YSPA 1NYMA 1XJ2A 4OQ0A 3ULFA 4GD8A 5HL1A 2JKGA 1Z6FA 2EXBA 2IA2A 2JCHA 2G7UA 5IS1A 3NHQA 1K57C 2J3TC 2VA0A 2P9VA 4KG2A 3FV7A 3EQVA 3LI9A 5MC7A 2Y91A 1H8MA 4YINA 4DMZA 2Y79A 3SW1A 3MQOA 3G2ZA 4Z9QA 1M40A 2W3GA 3UDFA 3PR6A 3V3SA 3Q7VA 1P9RA 4JXWA 4HESA 4Y0OA 1BLCA 3ZG7B 1WYBA 4Y5FA 5CECA 4LGWA 3QP4A 4Y7PA 4CQHA 1S0WA 5HARA 4UAAA 4Y13A 3FZCA 3T1XA 2W1TA 4E04A 1PIOA 2PR6A 1OT6A 4NKPA 5HX9A 4CLCA 2HDUA 2KX6A 3CI6A 4LCMA 2P9VB 4GHIA 4ARZB 3WRTA 2VGLM 3T4OA 2INWA 3O5YA 4OOMA 4GB7A 3SH7A 3DBAA 4P6BA 3GR2A 4BQMA 3Q7VB 1KGFA 1VB6A 3GVBA 4ME4A 4R4SA 5HWWA 5G4ZA 2M7VA 1P0ZA 3EWKA 4A5RA 4ZAMA 2QKPA 4EEPA 3MF0A 4I3AA 3NJAA 4Q0IA 4JLFA 2Y2HA 3H82A 2Q9MA 2Y55A 2UWXA 1ACFA 4PM8A 3W4QA 4BWIA 4XUXA 2W3EA 2W1TB 4LCLA 4BBUA 4KZ9A 1IEMA 3T4JA 3M6BA 2OAP1 1MWUA 1XJ3A 4XT2A 4GHIB 3G6OA 4K08A 5DTTA 4X55A 5JYPA 2ZQ7A 3IBJA 3SS3A 5M18A 3PBSA 2EWVA 5HD3A 3T4LA 2VLGA 2MJ6A 1XA7A 3NI9A 2P04A 3VOZA 5J8XA 3HLCA 1YMXA 1BLHA 3LR4A 5M19A 3G30A 2Y2GA 2EFUA 4MN5A 1GHPA 3IX4A 4FOFA 3C7VA 1PWDA 5G4YA 5J3WA 3RFBA 3OLOA 4HP4A 3O88A 1VEUB 3OPLA 2ZQAA 3W4OA 1K54A 3CAXA 1ES4A 2HZ5A 2KDKA 3KX0X 4EBNA 2ZD8A 2D02A 5E2HA 3V3RA 1YLPA 2Y2QA 3U2AA 3B33A 3KO6A 4LLOB 2JC7A 3MS6A 1LLBA 3HLWA 3UO9A 3AGEA 3NECA 1EWZA 4EEUA 2DCFA 2O9BA 3BLMA 3A0VA 2XD1A 4F3LA 1E3UD 4KZ4A 1DP6A 5D3OA 2PT7A 4JGOA 3G4PA 2HGVA 2V1AA 1ERMA 5FDHA 4L9GA 1GCEA 4IVKA 3SH8A 4KENB 5F1FA 3PBRA 3GTCA 4E3LA 1KDWA 3GQZA 3UB6A 5F69A 4DJ3A 3HLBA 4O01A 3T12B 2A49A 3WWXA 1DP9A 3MBZA 1BZAA 3ZNYA 2VEAA 5I94A 4G3KA 5EV0A
chains in the Genus database with same CATH topology
3T4SA 5TJJA 4MN7A 4CLCB 3S7OA 1LSVA 1XFNA 3C38A 5HWTA 5J7EA 2NUPC 4OOLA 4LRYC 3F1PA 5IT5A 1TS0A 3PYPA 3NOTC 3B47A 1NRJA 4NXBA 2VV7A 4I39A 1STZA 1OJGA 1OTIA 2PHYA 1LT0A 3S7NA 2V9AA 4LRXC 4WELA 1MKMA 4M4XA 3CUEA 1NLZA 4I3IA 4JGRA 3JVUA 4IUHA 5HWVA 2W3HA 4YNRA 3T4TA 5DKLA 2Z6CA 3H7WB 4KUKA 2LB5A 5J4EA 2QJ7A 3F1OB 4YWZA 1TS8A 3UE6A 1TS6A 4CLCE 3B42A 4PKYA 3A0SA 3CLOA 2D01A 2L1MA 2WKPA 5DFYA 1GSWA 3H82B 1H3QA 3PBOA 4EU0A 2OWHA 1DRMA 2K31A 1V9ZA 2PYPA 1LSWA 2PD7A 2XA7S 3ZYTA 5L8MA 2K7SA 3S7PA 3BQ8A 4XT2B 4LRZE 3JVVA 1X0OA 3LR5A 3UB9A 4HY8A 1YKDA 2HJEA 3OOVA 4L9EA 4HJ4A 2A2LA 4UQIM 2ZOHA 5AJGA 4HH3A 4I3JA 2R78A 4ARZA 4B93A 4EERA 4NXFA 2ZOIA 1Y28A 4Q0HA 3F1NB 3R4KA 1LSXA 4GJ4A 1ZHHB 1V9YA 1LL8A 3E4OA 5A8BA 4YOFA 5HPFA 4GS9B 3K3CA 1S1YA 3T4KA 4WEJA 3NOUC 4NEED 4H6JA 1S1ZA 4R70A 3E4PA 3MXQA 5AVFA 1GSXA 1T1CA 4EUVA 4MCWA 4CLCC 2W1RA 3KYQA 4P6ZM 5F6AA 3LIEA 1F98A 3HJKA 4I5SA 2ZBBA 2XA7M 2W3FA 4MDZA 4GW9A 3C30A 3D72A 4MN6A 4CLCD 3HJIA 2O0YA 4EETB 4WN5A 2HJ9C 1G6OA 3C2WA 3FPWA 3EEAA 4BJPA 3LR0A 5DKKA 4FSFA 4DN0A 3VE4A 2QYBA 3VE3A 1N9OA 5EFWA 1W63Q 1T18A 4HOIA 3LICA 5F5YA 1DP8A 3T50A 4UEYA 2WKQA 4QPRA 3ZQ5A 1S4RA 1YAXA 5HD5A 3K2NA 3BY8A 4HJ3A 4HIAA 2VV6A 3PBQA 4UQIS 2V1BA 1P9WA 4F3LB 2W27A 1MC0A 3T4QA 3W2ZA 3ICYA 2P7JA 2VJWA 4BMWA 3TW8A 2V0UA 2JKRM 1NLYA 2OWJA 3FG8A 1S4SA 3PHYA 4KQDA 4PAUA 4HNBA 2EA9A 5I5LA 4MMNA 3MMHA 1N9NA 1YSQA 5HDCA 2L0WA 4GLQA 3UB7A 3KSFA 2P08A 1WA9A 1UWPX 2GNXA 3EEHA 2W0NA 2ZMVA 3LI8A 3E98A 3C8CA 5TBMA 3BW6A 4HI4A 3GECA 1XJ4A 4P6ZS 5K5BA 5HDSA 2J3WA 5KIZA 4WEKA 3TJZC 3IS2A 1YSPA 1XJ2A 2ZMFA 5AVEA 3ULFA 4EW7A 2PD8A 2J80A 2YKHA 1OTDA 1D06A 1IOUA 5CX7A 2IA2A 3V67A 2PR5A 2B18A 2G7UA 2JKTI 3F1PB 5IS1A 2VV8A 3NHQA 2OAQ1 4HHDA 3LYXA 5F68A 4IUKA 2J3TC 2VA0A 1EW0A 3K3DA 4HJ6A 3EQVA 2VGLS 3OCNA 3LI9A 2LB9A 2VKSA 4R6LA 5MC7A 4EESA 1H8MA 4Y2FA 3VV4A 4DMZA 1IFQA 2Y79A 3BJNA 3SW1A 1NWZA 3MQOA 2J3TD 4NXGA 2W3GA 4G3VA 3PR6A 2KLIA 1KOUA 3EOIA 2GZAA 1P9RA 4ETXA 2O99A 5TBMB 4AFIA 4HH2A 4II7A 4PKYG 4KUOA 3KSIA 3PBTA 1F5MA 1MZUA 3IS2B 3CWFA 4WL9A 4Y5FA 3LIAA 1N9LA 4I38A 4CQHA 3RH8B 2W1TA 3BWLA 4E04A 2PR6A 1OT6A 1ZTUA 4NKPA 4CLCA 2O9AA 2PYRA 4WUJA 3EQUA 2KX6A 3MFXA 3CI6A 4LPZA 4GHIA 5HL6A 2GX5A 3MQQA 4ARZB 5HZHA 3MR0A 3UB8A 2VGLM 3T4OA 3KSHA 2INWA 2XROA 3O5YA 4OOMA 4NXEA 4ZRRA 2K2NA 2H28A 3DBAA 2EWWA 1OPXA 1VB6A 4ME4A 5HWWA 5G4ZA 4IHQA 1P0ZA 3EWKA 4H6JB 4PHTA 2M7VA 3F1OA 3NOPC 2QKPA 3MJQA 4R38A 4EEPA 3MF0A 4I3AA 3NJAA 4Q0IA 2A24A 3CITA 5HSQA 2XSSA 2JN7A 2V0WA 3H82A 4BWIA 3R7WA 5HPIA 2W3EA 2W1TB 4BBUA 3T4JA 4HP9A 3E4QA 2HV1A 2KOIA 4GCZA 3UE3A 2OAP1 2VX8A 2B02A 1OTEA 1XJ3A 4XT2A 4B9OA 4GHIB 1P97A 2WKRA 3CUEC 2XRNA 3G6OA 2BASA 3BY9A 4K08A 5C5KA 5DFXA 3EGDC 3KSGA 1TF1A 3IBJA 1TD5A 3PBSA 2EWVA 5HD3A 3OBFA 4EXOA 2M1CA 3T4LA 2VLGA 3F1NA 3UMDA 2MJ6A 1VHMA 2QHKA 3HCYA 2P04A 3LIDA 1S66L 4GS9A 2A24B 1D7EA 4BBTA 1W63M 2M7UA 4BBVA 3GDIA 1T19A 3OC2A 3BQAA 3LR4A 3IBRA 4L9FA 3R7WB 4JGPA 1BYWA 4MN5A 3P7NA 1S67L 4FOFA 4DJ2A 2Z6DA 4R3AA 5G4YA 4Q0JA 5J3WA 2GJ3A 4Z1WA 3OLOA 3RFBA 2QWSA 2Y8HA 2O9CA 2W3DA 4O8GA 3LIBA 4HP4A 4IJGA 3D3OA 3PBNA 5HDDA 1XFQA 4HQAA 1OTAA 3S7QA 2YKFA 4O0PA 3CAXA 3E0YA 5DJUA 4KQOA 1ODVA 2JKTM 2KDKA 2OOLA 3KX0X 4G3WA 2D02A 1OT9A 3U2AA 5DF9A 2FH5A 4WLAA 2HF6A 2VZWA 3B33A 3TE8A 3KO6A 3RTYA 4LLOB 2I9VA 4EEUA 3OCLA 1T1AA 4RQ9A 1F9IA 3UMEA 1UWNX 5DJTA 3H9WA 2DMWA 2FZ0A 2O9BA 3LR3A 1GSVA 3LIFA 4WF0A 3EGXC 1JNUA 3FPVA 3A0VA 3VOLA 3A0RA 4F3LA 3LFVA 3LUQA 3FC7A 1UGUA 5FL3A 1OTBA 1DP6A 2PT7A 1XJ6A 2QJ5A 3P01A 1T1BA 4JGOA 3KYZA 2HGVA 2V1AA 4JGQA 4L9GA 1TS7A 3PBRA 2NUTC 5LBRA 1OJ5A 3H7WA 1G28A 4ETZA 3UB6A 4L0LA 5F69A 2CMNA 4EQ1A 4DJ3A 2JKRI 4Y3IA 4O01A 5IU1A 3MQ0A 1DP9A 3PXPA 3TRCA 2PDRA 2L4RA 5KSHA 2JHEA 2VEAA 4G3KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LSV A;  1XFN A;  5HWT A;  5J7E A;  4LRY C;  3F1P A;  1TS0 A;  3PYP A;  3NOT C;  4NXB A;  2VV7 A;  4I39 A;  1OJG A;  1OTI A;  2PHY A;  1LT0 A;  2V9A A;  4LRX C;  4M4X A;  4I3I A;  4JGR A;  5HWV A;  5DKL A;  2Z6C A;  3H7W B;  4KUK A;  5J4E A;  2QJ7 A;  3F1O B;  4YWZ A;  1TS8 A;  3UE6 A;  1TS6 A;  4PKY A;  3A0S A;  3CLO A;  2D01 A;  2L1M A;  2WKP A;  1GSW A;  3H82 B;  2OWH A;  1DRM A;  1V9Z A;  2PYP A;  1LSW A;  2PD7 A;  2K7S A;  4XT2 B;  4LRZ E;  1X0O A;  3UB9 A;  4HY8 A;  4L9E A;  4HJ4 A;  2ZOH A;  4HH3 A;  4I3J A;  2R78 A;  4EER A;  4NXF A;  2ZOI A;  1Y28 A;  3F1N B;  1LSX A;  1V9Y A;  1LL8 A;  3E4O A;  5A8B A;  4GS9 B;  3K3C A;  1S1Y A;  3NOU C;  4H6J A;  1S1Z A;  4R70 A;  3E4P A;  3MXQ A;  5AVF A;  1GSX A;  1T1C A;  5F6A A;  3LIE A;  1F98 A;  3HJK A;  4I5S A;  2ZBB A;  4GW9 A;  3D72 A;  4MN6 A;  3HJI A;  4EET B;  4WN5 A;  3C2W A;  5DKK A;  3VE4 A;  3VE3 A;  1N9O A;  5EFW A;  1T18 A;  4HOI A;  3LIC A;  5F5Y A;  1DP8 A;  3T50 A;  2WKQ A;  3ZQ5 A;  1S4R A;  5HD5 A;  3BY8 A;  4HJ3 A;  4HIA A;  2VV6 A;  2V1B A;  4F3L B;  2W27 A;  3ICY A;  2P7J A;  2V0U A;  3PHY A;  2OWJ A;  3FG8 A;  1S4S A;  4KQD A;  4HNB A;  2EA9 A;  5I5L A;  1N9N A;  5HDC A;  2L0W A;  3UB7 A;  1WA9 A;  1UWP X;  3EEH A;  2W0N A;  3LI8 A;  3C8C A;  5TBM A;  4HI4 A;  3GEC A;  1XJ4 A;  5HDS A;  5KIZ A;  3IS2 A;  3ULF A;  1XJ2 A;  5AVE A;  4EW7 A;  2PD8 A;  2J80 A;  2YKH A;  1OTD A;  1D06 A;  2PR5 A;  3F1P B;  5IS1 A;  2VV8 A;  3NHQ A;  4HHD A;  3LYX A;  5F68 A;  1EW0 A;  3K3D A;  4HJ6 A;  3LI9 A;  4R6L A;  4EES A;  3SW1 A;  1NWZ A;  3MQO A;  4NXG A;  1KOU A;  5TBM B;  4HH2 A;  4PKY G;  4KUO A;  1MZU A;  3IS2 B;  3CWF A;  4WL9 A;  3LIA A;  1N9L A;  4I38 A;  3RH8 B;  3BWL A;  4E04 A;  2PR6 A;  1OT6 A;  2PYR A;  4WUJ A;  2KX6 A;  3MFX A;  4LPZ A;  4GHI A;  3MQQ A;  5HZH A;  3MR0 A;  3UB8 A;  2INW A;  4NXE A;  2H28 A;  1VB6 A;  5HWW A;  5G4Z A;  1P0Z A;  3EWK A;  4H6J B;  3F1O A;  3NOP C;  2QKP A;  3MJQ A;  4R38 A;  4EEP A;  4I3A A;  3NJA A;  2A24 A;  5HSQ A;  2JN7 A;  2V0W A;  3H82 A;  4BBU A;  4HP9 A;  3E4Q A;  2HV1 A;  4GCZ A;  2B02 A;  1OTE A;  1XJ3 A;  4XT2 A;  4B9O A;  4GHI B;  1P97 A;  2WKR A;  3G6O A;  2BAS A;  3BY9 A;  4K08 A;  5HD3 A;  4EXO A;  2M1C A;  2VLG A;  3F1N A;  3UMD A;  2QHK A;  3LID A;  1S66 L;  4GS9 A;  2A24 B;  1D7E A;  4BBT A;  4BBV A;  3GDI A;  1T19 A;  3IBR A;  4L9F A;  4JGP A;  1BYW A;  4MN5 A;  3P7N A;  1S67 L;  4DJ2 A;  2Z6D A;  4R3A A;  5G4Y A;  5J3W A;  2GJ3 A;  3OLO A;  2QWS A;  3LIB A;  4HP4 A;  5HDD A;  1XFQ A;  4HQA A;  1OTA A;  2YKF A;  3CAX A;  5DJU A;  1ODV A;  2KDK A;  2OOL A;  3KX0 X;  2D02 A;  1OT9 A;  4WLA A;  3B33 A;  3RTY A;  4LLO B;  2I9V A;  4EEU A;  1T1A A;  4RQ9 A;  1F9I A;  3UME A;  1UWN X;  5DJT A;  3H9W A;  1GSV A;  3LIF A;  4WF0 A;  1JNU A;  3A0V A;  3VOL A;  3A0R A;  4F3L A;  3LUQ A;  3FC7 A;  1UGU A;  1OTB A;  1DP6 A;  2QJ5 A;  1XJ6 A;  1T1B A;  4JGO A;  2V1A A;  4JGQ A;  4L9G A;  1TS7 A;  1OJ5 A;  3H7W A;  1G28 A;  3UB6 A;  5F69 A;  2CMN A;  4EQ1 A;  4DJ3 A;  5IU1 A;  1DP9 A;  2PDR A;  2L4R A;  2JHE A;  2VEA A; 
#chains in the Genus database with same CATH topology
 4RYE A;  4WZ5 C;  3C38 A;  4Y0U A;  3F1P A;  1FCO A;  1TS0 A;  5IT5 A;  4H8R A;  4U0X A;  1STZ A;  4WZ5 A;  5EVE A;  1OTI A;  2PHY A;  1MY8 A;  2B95 A;  4WEL A;  1HD8 A;  1NLZ A;  1VET B;  3JVU A;  4IUH A;  3V50 A;  5AQ7 A;  3BM6 A;  2ZM0 A;  2QJ7 A;  4YWZ A;  1TS6 A;  3A0S A;  3D4F A;  2E8J A;  2WKE A;  4RA7 A;  3S4X A;  4X56 A;  2C6W B;  3QP8 A;  4M3K A;  5DFY A;  4R4R A;  3PBO A;  4S2P A;  4GKU A;  1XP4 A;  1V9Z A;  1LSW A;  1SHV A;  1BUE A;  3IHA A;  3FKW A;  1LI9 A;  4LRZ E;  1O7E A;  2HDQ A;  4X25 A;  1W7F A;  1NXY A;  4L9E A;  5E43 A;  2Q9N A;  4QJG A;  4K0X A;  4I3J A;  4BL2 A;  2R78 A;  4KZ6 A;  2WKH A;  4NXF A;  3OPH A;  1ALQ A;  3R4K A;  4KQQ A;  4P85 A;  2IWB A;  4GJ4 A;  4E6X A;  1ZHH B;  1W8Y A;  3E4O A;  4X6T A;  4H6J A;  1FIL A;  1XKZ A;  3CPT B;  1IYS A;  5EUA A;  3E4P A;  5AVF A;  1GSX A;  1T1C A;  3N6I A;  3KYQ A;  4P6Z M;  3HLE A;  3DW0 A;  3HJK A;  4I5S A;  2HP5 A;  4F94 A;  2WGW B;  4GW9 A;  3C30 A;  1GA9 A;  4MN6 A;  4BL3 A;  4WN5 A;  4E6W A;  1KGE A;  3N8R A;  3FPW A;  4BJP A;  3EEA A;  5DKK A;  1FOF A;  4DN0 A;  1TDG A;  1FIK A;  5JYO A;  4R0Q A;  1T18 A;  4R1G A;  4HOI A;  3LIC A;  2ZC5 B;  1DP8 A;  3T50 A;  3VP4 A;  2WKQ A;  4QPR A;  3A3I A;  2VGK A;  4N92 A;  2RCX A;  3VFH A;  1YLZ A;  4HJ3 A;  3IWQ A;  3UNW A;  2VV6 A;  3O3V A;  1H8Z A;  1MC0 A;  1PW8 A;  3M2J A;  3T4Q A;  3W2Z A;  3VSK A;  1PZO A;  2P7J A;  4OP8 A;  4BMW A;  2V0U A;  1NLY A;  2OWJ A;  5FQI A;  4P0M A;  4ZJ1 A;  2OV5 A;  2H0Y A;  3IWI A;  2OSU A;  4WM9 A;  2PRF A;  1GHI A;  5EOO A;  3MMH A;  1N9N A;  1CF0 A;  2L0W A;  4GLQ A;  1SKO B;  3W4P A;  4WYY A;  3UPO A;  3C8C A;  1JTG A;  3BW6 A;  3IXH A;  4D2O A;  4HI4 A;  1XJ4 A;  3SZT A;  2J3W A;  5KIZ A;  4WEK A;  2WUQ A;  1QMF A;  1K56 A;  2XQZ A;  4EW7 A;  1ESI A;  2J80 A;  2YKH A;  1IOU A;  5CX7 A;  3V67 A;  2PR5 A;  2B18 A;  2VV8 A;  3IX3 A;  4JKT A;  1EW0 A;  5HW3 A;  4OVD A;  4HJ6 A;  1KDS A;  2LB9 A;  4R6L A;  3IXD A;  4IBR A;  4OKP A;  1NWZ A;  4NXG A;  3NDG A;  1NZU A;  2Y2M A;  1FCM A;  4DE1 A;  3NIA A;  3MFD A;  2O99 A;  4AFI A;  4NG2 A;  4OON A;  4II7 A;  4KUO A;  5EVI D;  1VM1 A;  1MWT A;  2XD5 A;  1K38 A;  4S2N A;  3CWF A;  2V20 A;  2ZQC A;  3V39 A;  5A90 A;  2R9W A;  3RH8 B;  3IH8 A;  5CXW A;  2O9A A;  2PYR A;  4GNU A;  4WUJ A;  4LPZ A;  5HL6 A;  4JBF A;  3MR0 A;  3ZVW A;  1TEM A;  3UB8 A;  1QME A;  1K4F A;  5EM1 A;  3UE0 A;  3LEZ A;  2DNS A;  5EEC A;  4HBT A;  4LEN A;  4QY6 A;  2EWW A;  5CGS A;  3IF6 C;  1VQQ A;  3NOP C;  4R38 A;  2JN7 A;  3HUM A;  4Y17 A;  4BD0 A;  1BTL A;  5HPI A;  1BSG A;  2KOI A;  2B02 A;  4GZB A;  2BLS A;  3N8S A;  3EGD C;  2G2W A;  3KSG A;  2Y4A A;  4ZDX A;  2X01 A;  1PI4 A;  3OBF A;  3P98 A;  3VSL A;  3JPU A;  4K91 A;  2M1C A;  4WMC D;  1VHM A;  3HCY A;  4Q8I A;  4OPQ A;  5EM0 A;  1D7E A;  4QWO A;  2J8Y A;  3GDI A;  1T19 A;  4ESP A;  2EX8 A;  4L9F A;  4JGP A;  2Z2L B;  3I7J A;  4DJ2 A;  4R3A A;  1K57 A;  4OQI A;  4RX2 A;  5HDD A;  3NY4 A;  2YKF A;  1PWG A;  4DE3 A;  1ODV A;  2OOL A;  1Y54 A;  1PZP A;  2IWC A;  5DF9 A;  2VZW A;  3TE8 A;  4N9K A;  1NRF A;  3Q1F A;  3UPN A;  1H0M A;  5HAP A;  2I9V A;  4JPM A;  3WRZ A;  1T1A A;  1F9I A;  5DJT A;  4DDS A;  3H9W A;  2DMW A;  4JF6 A;  5DVA A;  1RGY A;  3EGX C;  2WGV A;  3A0R A;  5FQQ A;  3LUQ A;  1UGU A;  4QY5 A;  1PW1 A;  3P01 A;  3LEQ A;  3KYZ A;  4JGQ A;  2XR0 A;  3BFE A;  5EOE A;  3SS4 A;  1TS7 A;  3O87 A;  2ZLY A;  4S2K A;  3H7W A;  3LY4 A;  3IT9 A;  2G2U A;  3HLG A;  3IQA A;  2JKR I;  4Y3I A;  2EFX A;  4HEF A;  5IU1 A;  3ZG5 A;  1ZC2 A;  1JTD A;  4LV2 A;  3PXP A;  5FAS A;  2L4R A;  5FAQ A;  5EPH A;  5KSH A;  4FTX A;  1Q2Q A;  4MN7 A;  4CLC B;  5L2F A;  4LV1 A;  1FSY A;  2NUP C;  4LRY C;  2PAV P;  3PYP A;  3FYZ A;  3B47 A;  4NXB A;  4I39 A;  1BLS A;  2PU4 A;  3S7N A;  2V9A A;  3LGO A;  4I3I A;  4JGR A;  4YNR A;  5DKL A;  3H7W B;  2QZ6 A;  3B42 A;  1WE4 A;  2D01 A;  2L1M A;  4E3M A;  3ZVT A;  1GSW A;  3H82 B;  1XPB A;  4EBL A;  4EU0 A;  1YLW A;  1DJA A;  4U3T A;  1XXM A;  1Y4O A;  1W8Q A;  2K31 A;  3VOY A;  2PYP A;  1CQA A;  2XA7 S;  5L8M A;  3AGD A;  2K7S A;  1IKG A;  3HLD A;  3HL9 A;  4XT2 B;  5HFO A;  3M6H A;  2AVX A;  3OOV A;  1BUL A;  2A2L A;  1DY6 A;  2WGI A;  3A3F A;  4N1X A;  1KGG A;  2OLU A;  4RX3 A;  2Y2L A;  3Q81 A;  4Q0H A;  3MSH A;  5GHZ A;  4DE2 A;  1S1Y A;  4WEJ A;  1FSW A;  5GLA A;  3CG5 A;  3OZH A;  3BFF A;  2W1R A;  4KZB A;  2R9X A;  3LIE A;  1F98 A;  2BG1 A;  1YQS A;  3G35 A;  1K0K A;  4DKI A;  1L2S A;  4MDZ A;  3T1R A;  3D72 A;  4CLC D;  4EET B;  4MEZ A;  3MXS A;  3C5A A;  2HJ9 C;  1G6O A;  3C2W A;  1SKF A;  4E3K A;  5AQ9 A;  3HUN A;  1TVF A;  4JF4 A;  4OH0 A;  3VE4 A;  2QYB A;  4P87 A;  1SCW A;  3DAV A;  5F5Y A;  5CTN A;  3NBL A;  4KG6 A;  2ZMA A;  3ZQ5 A;  1JWZ A;  3G34 A;  3QP6 A;  5HD5 A;  5E2G A;  1YPR A;  4O7D A;  4DXC A;  1FCN A;  4F3L B;  2W27 A;  2ZL1 A;  4S2L A;  3ICY A;  4E3J A;  2ZM2 A;  3TW8 A;  2JKR M;  3ZG0 A;  4PAU A;  3FG8 A;  4KQD A;  2V1Z A;  4MNR A;  4BD1 A;  5I5L A;  4MMN A;  3QNC A;  1BLP A;  5HDC A;  3UDI A;  1S6R A;  1H8Y A;  5FSR A;  3EEH A;  2ZMV A;  3LI8 A;  1HLU P;  1L0D A;  5TBM A;  3HVF A;  1LL5 A;  5HDS A;  5FI2 A;  3TJZ C;  3IS2 A;  2ZMF A;  5CED A;  2PD8 A;  1NZO A;  1K25 A;  4BEN A;  3DTK A;  3NC8 A;  1RGZ A;  3F1P B;  2OAQ 1;  5F68 A;  2ZL1 B;  5FQK A;  2XEP A;  4IUK A;  4X1M A;  3UN7 A;  2HDS A;  3K3D A;  4IED A;  1IYP A;  2VGL S;  3G32 A;  3SOI A;  2VKS A;  5KMW A;  2JKF A;  4EES A;  4Y2F A;  3VV4 A;  3BJN A;  2B5R A;  3N7W A;  4G3V A;  4GD6 A;  4WBG A;  4D60 A;  5EVI C;  2JBF A;  4ETX A;  4ZTK A;  5TBM B;  4HH2 A;  5FQM A;  3KSI A;  3PBT A;  4R3B A;  1F5M A;  1MZU A;  3IS2 B;  4WL9 A;  3LIA A;  4E3N A;  4QB8 A;  1N9L A;  4ZBE A;  4E3I A;  5KSC A;  1Q2P A;  1OME A;  1YLJ A;  3UDX A;  4E3O A;  1LL9 A;  3BWL A;  1ZTU A;  1J9M A;  3EQU A;  3MFX A;  3C4O A;  5GLC A;  5HZH A;  5HAI A;  2XRO A;  4ZRR A;  4EUZ A;  2A3U A;  3MZE A;  2H28 A;  2QMI A;  4NET A;  1JVJ A;  1OPX A;  5FAO A;  4IHQ A;  4H6J B;  1FQG A;  3F1O A;  3MJQ A;  4KZ8 A;  4PM7 A;  4JXG A;  2A24 A;  2JE5 A;  5HSQ A;  3ZCZ A;  2Y2I A;  3GMW A;  2XSS A;  2V0W A;  3ITB A;  3QHY A;  2EX6 A;  2J9P A;  3MKE A;  2H5S A;  3WS0 A;  4HP9 A;  2HV1 A;  3FWL A;  1OTE A;  4B9O A;  5A91 A;  3N4I A;  3CUE C;  4UHU A;  3SH9 A;  1ONH A;  2BAS A;  3BY9 A;  3ZG8 B;  1TF1 A;  3IX8 A;  3ZHH A;  1TD5 A;  4EXO A;  3BLS A;  5FAT A;  3F1N A;  4WMC A;  2QHK A;  1YT4 A;  5FQJ A;  1ZG6 A;  4C6Y A;  3LID A;  4JF5 A;  2WK0 A;  1S66 L;  4GS9 A;  2A24 B;  4BBT A;  1W63 M;  5CER A;  3OC2 A;  3BQA A;  3MXR A;  4Y15 A;  1MBL A;  4KZA A;  1BYW A;  4FH4 A;  5CGX A;  3P7N A;  4NK3 A;  4Q0J A;  5M1A A;  4Z1W A;  4Y0T A;  2Y8H A;  2W3D A;  1L0G A;  3LIB A;  3PBN A;  1XGI A;  4HQA A;  1OTA A;  3OPP A;  3E0Y A;  1U60 A;  2Y2N A;  4G3W A;  1K55 C;  1H5X A;  5F1G A;  2FH5 A;  2HF6 A;  3RTY A;  5FDS A;  3CMZ A;  1ES2 A;  4LV3 A;  4RQ9 A;  2HDR A;  1UWN X;  5CGW A;  3JYI A;  4ID4 A;  3HBR A;  2ACG A;  3Q7Z A;  1GSV A;  3LIF A;  4WF0 A;  4DE0 A;  1JNU A;  1KE4 A;  1MWR A;  3A3E A;  1XJ6 A;  3BRM A;  2NUT C;  4QHC A;  5LBR A;  4LFU A;  4UA7 A;  3DTI A;  2J9O A;  5L09 A;  1G28 A;  1SZV A;  4L0L A;  4EQ1 A;  3B3X A;  3HRE A;  3IF6 A;  3MQ0 A;  3VP0 A;  3TRC A;  2PDR A;  1TDL A;  1YLT A;  1IEL A;  3T4S A;  5TJJ A;  4OLG A;  1XGJ A;  5GLB A;  1LSV A;  5HWT A;  2H0T A;  2X02 A;  4CJN A;  1K4E A;  3NOT C;  2XK1 A;  2VV7 A;  5E2F A;  1WYC A;  1OJG A;  1LT0 A;  4LRX C;  3BFC A;  2XH9 A;  4M4X A;  1O07 A;  2I72 A;  2W3H A;  3AGF A;  1N4O A;  2ZC3 B;  2Z6C A;  5CHU A;  4KUK A;  3TOI A;  3UB5 P;  5J4E A;  3UE6 A;  3ITA A;  2WZX A;  5CEB A;  1ERO A;  1YMS A;  2WKP A;  1H3Q A;  1LHY A;  2V8F A;  3VP2 A;  3MZF A;  1K56 D;  5L07 A;  1DRM A;  3VFF A;  2GDN A;  3ZYT A;  3S7P A;  1DJC A;  3CZD A;  3LR5 A;  3UB9 A;  1CK3 A;  5HAQ A;  2HJE A;  5AJG A;  4HH3 A;  3A3J A;  4XXR A;  4ARZ A;  4B93 A;  3A3D A;  4MBH A;  1MKI A;  5L10 A;  2ZOI A;  1Y28 A;  1LSX A;  4OP5 A;  1V9Y A;  4X53 A;  1ZG4 A;  4UA9 A;  1BT5 A;  5HPF A;  3K3C A;  3T4K A;  5FAP A;  3NOU C;  5CTM A;  4B4X A;  2XFS A;  2XDM A;  2EXA A;  4R70 A;  4EQI A;  2WAE A;  2Y2J A;  4CLC C;  3FKV A;  1E3U A;  3LY3 A;  1L3L A;  2PBY A;  5GL9 A;  5AQB A;  4PM5 A;  3PTE A;  3ZFZ A;  4DDY A;  1L0E A;  3UPP A;  1PNE A;  4S2I A;  3BFG A;  1XA1 A;  5EFW A;  1W63 Q;  1AWI A;  5IHV A;  3DTE A;  2DRW A;  3G2Y A;  1W79 A;  1L0F A;  1YAX A;  3K2N A;  3BEB A;  3IXG A;  4HIA A;  4X68 A;  2X71 A;  4OOY A;  4UQI S;  2V1B A;  5CHM A;  5U47 A;  2VJW A;  1PI5 A;  4QU3 A;  1ERQ A;  3PHY A;  2J7V A;  1S4S A;  4N9L A;  4S2J A;  1KVL A;  3E2K A;  1G5U A;  3D9Y A;  2P08 A;  1UWP X;  2OLV A;  3GSG A;  2W0N A;  5TGF A;  2WAF A;  1VEU A;  1RP5 A;  3DWK A;  3PAG A;  5KZH A;  3GEC A;  4PM9 A;  2CC1 A;  1A0K A;  1GHM A;  5AVE A;  4U0T A;  1OTD A;  1D06 A;  4JXS A;  3BEC A;  5F82 A;  4GOG A;  2JKT I;  4R3J A;  5FI6 A;  4HHD A;  3LYX A;  4OPR A;  1AXB A;  3Q82 A;  5DF7 A;  4IVI A;  1K6S A;  3OCN A;  1K6R A;  1IFQ A;  1K54 C;  3N8L A;  1F2K A;  2J3T D;  4EBP A;  4K0W A;  2KLI A;  3S1Y A;  1KOU A;  3WS5 A;  2HPB A;  3EOI A;  1FR1 A;  2GZA A;  3TSG A;  3QNB A;  3ZNT A;  5EE8 A;  1SDE A;  2ZM8 A;  4EWF A;  4PKY G;  5DTS A;  5A92 A;  3Q07 A;  3QP5 A;  1GA0 A;  1CI9 A;  4I38 A;  1G6A A;  1JWP A;  3HLF A;  1PYY A;  1KE3 A;  3GRJ A;  4KG5 A;  2Y59 A;  3L9K A;  2ZQ8 A;  2ZQD A;  2GX5 A;  3MQQ A;  5FEF A;  2XF3 A;  1NJ4 A;  4X1L A;  3NDE A;  5FI7 A;  3KSH A;  1E25 A;  1ESU A;  4NXE A;  1HZO A;  2K2N A;  3QP1 A;  1VET A;  1XX2 A;  4MLL A;  3ZG9 B;  4PMA A;  4PHT A;  3W8K A;  1ES3 A;  3CIT A;  4C75 A;  1EI5 A;  5DF8 A;  3R7W A;  3IXB A;  2IWD A;  3ISG A;  5TR7 A;  2Y2P A;  1JWV A;  3E4Q A;  4GCZ A;  3UE3 A;  2VX8 A;  1CI8 A;  3L7H A;  1P97 A;  2WKR A;  2XRN A;  5C5K A;  1D1J A;  5DFX A;  3ZGA B;  2HP9 A;  5AQA A;  4RVA A;  3UMD A;  3IH9 A;  4X69 A;  4GN2 A;  2QPN A;  4MBF A;  2Z2M B;  4ZJ2 A;  3LO7 A;  2M7U A;  3CPT A;  2EX2 A;  2E8I A;  3IHB A;  5F83 A;  4BBV A;  4KZ5 A;  2VGJ A;  1I2S A;  4KZ3 A;  3IBR A;  3R7W B;  3VMA A;  1S67 L;  2Z6D A;  2C5W B;  5G18 A;  2HP6 A;  2GJ3 A;  2QWS A;  3O86 A;  2O9C A;  4O8G A;  4IJG A;  3D3O A;  2WGW A;  5CRF A;  3BYD A;  3DTM A;  1XFQ A;  4S2M A;  3S7Q A;  3UE1 A;  4O0P A;  4FCF A;  5DJU A;  4KQO A;  2JKT M;  2WKI A;  3SS5 A;  5EVI A;  4DXB A;  4OPY A;  1OT9 A;  4R23 A;  4WLA A;  4S2O A;  3UY6 A;  3G31 A;  1DJB A;  5GHX A;  3OCL A;  2WZZ A;  4KQR A;  2UV0 E;  1IKI A;  1I5Q A;  3ZDJ A;  2Q0O A;  3UME A;  2ZC7 A;  1KVM A;  1YM1 A;  5TFQ A;  2FZ0 A;  3LR3 A;  3WS4 A;  2Y2K A;  1HVB A;  4CPK A;  3FPV A;  3VOL A;  3S22 A;  4GDB A;  3LFV A;  4B4Z A;  3FC7 A;  5FL3 A;  1M6K A;  1OTB A;  1RCJ A;  2QJ5 A;  1T1B A;  1CJF A;  5CHJ A;  3DWZ A;  1MWS A;  1KE0 A;  2ZC6 B;  3CHW P;  1OJ5 A;  4ETZ A;  1W5D A;  1YLY A;  5A93 A;  4YFM A;  1SKO A;  5EVI B;  2CMN A;  3BFD A;  2FFY A;  4LV0 A;  5GLD A;  4QD4 A;  2JHE A;  1G68 A;  4FUW A;  2ZC4 B;  3S7O A;  1XFN A;  4EV4 A;  5J7E A;  3M2K A;  4OOL A;  4DF6 A;  4FD8 A;  3E2L A;  3T1Q B;  1NRJ A;  1ONG A;  1MKM A;  3KYE A;  3CUE A;  2H10 A;  5HWV A;  3T4T A;  3C4P A;  2LB5 A;  3OPR A;  3F1O B;  1TS8 A;  1NYY A;  1PFL A;  2P74 A;  1FR6 A;  2PU2 A;  4OPZ A;  4CLC E;  4PKY A;  3CLO A;  1MXO A;  1IYO A;  5EVL A;  2XLN A;  2OWH A;  3HUO A;  5FA7 A;  1LI0 A;  4FH2 A;  4N1H A;  2PD7 A;  1J3W A;  2XFT A;  3BQ8 A;  3MZD A;  3VP1 A;  3JVV A;  1X0O A;  1ES5 A;  4HY8 A;  1YKD A;  1ZKJ A;  4HJ4 A;  4UQI M;  4GDN A;  2ZOH A;  2WAD A;  2EX9 A;  2Y2O A;  1IYQ A;  3QP2 A;  4JXV A;  4EER A;  5FEG A;  1SDN A;  3F1N B;  3PAE A;  2V8C A;  1I2W A;  1LL8 A;  5A8B A;  4S2N C;  4YOF A;  1K55 A;  4GS9 B;  3V5M A;  3WS1 A;  5BOH A;  5GHY A;  4NEE D;  5E2E A;  3RXW A;  1S1Z A;  4PM6 A;  3MXQ A;  4OQH A;  3VP3 A;  4EUV A;  4MCW A;  2XGN A;  3LCE A;  5F6A A;  3IF5 A;  2ZJ9 A;  5DTK A;  3C7U A;  1Z09 A;  2ZBB A;  2W3F A;  2XA7 M;  1PWC A;  3HJI A;  2O0Y A;  4OQG A;  3GV9 A;  2RL3 A;  2V2F F;  3LR0 A;  4FSF A;  4DRT A;  3CJM A;  4B88 A;  3VE3 A;  3U4L P;  1N9O A;  1PRQ A;  4WZ4 A;  4HBU A;  4UA6 A;  4UEY A;  1S4R A;  4XUZ A;  2WYX A;  3BY8 A;  3TG9 A;  1MPL A;  5FQ9 A;  3PBQ A;  3WS2 A;  2BTF P;  1P9W A;  2PBD P;  3NUL A;  3P09 A;  3RJU A;  1CEG A;  1E4D A;  4C3Q A;  4BLM A;  1CEF A;  4HNB A;  3IWO A;  3MKF A;  2EA9 A;  4PPR A;  3NCK A;  4OLD A;  4ZJ3 A;  1N9B A;  1YSQ A;  1NY0 A;  2ZQ9 A;  3UB7 A;  3KSF A;  4KZ7 A;  1WA9 A;  2GNX A;  2VK3 A;  4IBX A;  3E98 A;  3T1S A;  1C3B A;  3IF6 B;  4P6Z S;  1HTZ A;  5K5B A;  4MBK A;  3RXX A;  2FFF B;  1YSP A;  1NYM A;  1XJ2 A;  4OQ0 A;  3ULF A;  4GD8 A;  5HL1 A;  2JKG A;  1Z6F A;  2EXB A;  2IA2 A;  2JCH A;  2G7U A;  5IS1 A;  3NHQ A;  1K57 C;  2J3T C;  2VA0 A;  2P9V A;  4KG2 A;  3FV7 A;  3EQV A;  3LI9 A;  5MC7 A;  2Y91 A;  1H8M A;  4YIN A;  4DMZ A;  2Y79 A;  3SW1 A;  3MQO A;  3G2Z A;  4Z9Q A;  1M40 A;  2W3G A;  3UDF A;  3PR6 A;  3V3S A;  3Q7V A;  1P9R A;  4JXW A;  4HES A;  4Y0O A;  1BLC A;  3ZG7 B;  1WYB A;  4Y5F A;  5CEC A;  4LGW A;  3QP4 A;  4Y7P A;  4CQH A;  1S0W A;  5HAR A;  4UAA A;  4Y13 A;  3FZC A;  3T1X A;  2W1T A;  4E04 A;  1PIO A;  2PR6 A;  1OT6 A;  4NKP A;  5HX9 A;  4CLC A;  2HDU A;  2KX6 A;  3CI6 A;  4LCM A;  2P9V B;  4GHI A;  4ARZ B;  3WRT A;  2VGL M;  3T4O A;  2INW A;  3O5Y A;  4OOM A;  4GB7 A;  3SH7 A;  3DBA A;  4P6B A;  3GR2 A;  4BQM A;  3Q7V B;  1KGF A;  1VB6 A;  3GVB A;  4ME4 A;  4R4S A;  5HWW A;  5G4Z A;  2M7V A;  1P0Z A;  3EWK A;  4A5R A;  4ZAM A;  2QKP A;  4EEP A;  3MF0 A;  4I3A A;  3NJA A;  4Q0I A;  4JLF A;  2Y2H A;  3H82 A;  2Q9M A;  2Y55 A;  2UWX A;  1ACF A;  4PM8 A;  3W4Q A;  4BWI A;  4XUX A;  2W3E A;  2W1T B;  4LCL A;  4BBU A;  4KZ9 A;  1IEM A;  3T4J A;  3M6B A;  2OAP 1;  1MWU A;  1XJ3 A;  4XT2 A;  4GHI B;  3G6O A;  4K08 A;  5DTT A;  4X55 A;  5JYP A;  2ZQ7 A;  3IBJ A;  3SS3 A;  5M18 A;  3PBS A;  2EWV A;  5HD3 A;  3T4L A;  2VLG A;  2MJ6 A;  1XA7 A;  3NI9 A;  2P04 A;  3VOZ A;  5J8X A;  3HLC A;  1YMX A;  1BLH A;  3LR4 A;  5M19 A;  3G30 A;  2Y2G A;  2EFU A;  4MN5 A;  1GHP A;  3IX4 A;  4FOF A;  3C7V A;  1PWD A;  5G4Y A;  5J3W A;  3RFB A;  3OLO A;  4HP4 A;  3O88 A;  1VEU B;  3OPL A;  2ZQA A;  3W4O A;  1K54 A;  3CAX A;  1ES4 A;  2HZ5 A;  2KDK A;  3KX0 X;  4EBN A;  2ZD8 A;  2D02 A;  5E2H A;  3V3R A;  1YLP A;  2Y2Q A;  3U2A A;  3B33 A;  3KO6 A;  4LLO B;  2JC7 A;  3MS6 A;  1LLB A;  3HLW A;  3UO9 A;  3AGE A;  3NEC A;  1EWZ A;  4EEU A;  2DCF A;  2O9B A;  3BLM A;  3A0V A;  2XD1 A;  4F3L A;  1E3U D;  4KZ4 A;  1DP6 A;  5D3O A;  2PT7 A;  4JGO A;  3G4P A;  2HGV A;  2V1A A;  1ERM A;  5FDH A;  4L9G A;  1GCE A;  4IVK A;  3SH8 A;  4KEN B;  5F1F A;  3PBR A;  3GTC A;  4E3L A;  1KDW A;  3GQZ A;  3UB6 A;  5F69 A;  4DJ3 A;  3HLB A;  4O01 A;  3T12 B;  2A49 A;  3WWX A;  1DP9 A;  3MBZ A;  1BZA A;  3ZNY A;  2VEA A;  5I94 A;  4G3K A;  5EV0 A; 
#chains in the Genus database with same CATH homology
 3T4S A;  5TJJ A;  4MN7 A;  4CLC B;  3S7O A;  1LSV A;  1XFN A;  3C38 A;  5HWT A;  5J7E A;  2NUP C;  4OOL A;  4LRY C;  3F1P A;  5IT5 A;  1TS0 A;  3PYP A;  3NOT C;  3B47 A;  1NRJ A;  4NXB A;  2VV7 A;  4I39 A;  1STZ A;  1OJG A;  1OTI A;  2PHY A;  1LT0 A;  3S7N A;  2V9A A;  4LRX C;  4WEL A;  1MKM A;  4M4X A;  3CUE A;  1NLZ A;  4I3I A;  4JGR A;  3JVU A;  4IUH A;  5HWV A;  2W3H A;  4YNR A;  3T4T A;  5DKL A;  2Z6C A;  3H7W B;  4KUK A;  2LB5 A;  5J4E A;  2QJ7 A;  3F1O B;  4YWZ A;  1TS8 A;  3UE6 A;  1TS6 A;  4CLC E;  3B42 A;  4PKY A;  3A0S A;  3CLO A;  2D01 A;  2L1M A;  2WKP A;  5DFY A;  1GSW A;  3H82 B;  1H3Q A;  3PBO A;  4EU0 A;  2OWH A;  1DRM A;  2K31 A;  1V9Z A;  2PYP A;  1LSW A;  2PD7 A;  2XA7 S;  3ZYT A;  5L8M A;  2K7S A;  3S7P A;  3BQ8 A;  4XT2 B;  4LRZ E;  3JVV A;  1X0O A;  3LR5 A;  3UB9 A;  4HY8 A;  1YKD A;  2HJE A;  3OOV A;  4L9E A;  4HJ4 A;  2A2L A;  4UQI M;  2ZOH A;  5AJG A;  4HH3 A;  4I3J A;  2R78 A;  4ARZ A;  4B93 A;  4EER A;  4NXF A;  2ZOI A;  1Y28 A;  4Q0H A;  3F1N B;  3R4K A;  1LSX A;  4GJ4 A;  1ZHH B;  1V9Y A;  1LL8 A;  3E4O A;  5A8B A;  4YOF A;  5HPF A;  4GS9 B;  3K3C A;  1S1Y A;  3T4K A;  4WEJ A;  3NOU C;  4NEE D;  4H6J A;  1S1Z A;  4R70 A;  3E4P A;  3MXQ A;  5AVF A;  1GSX A;  1T1C A;  4EUV A;  4MCW A;  4CLC C;  2W1R A;  3KYQ A;  4P6Z M;  5F6A A;  3LIE A;  1F98 A;  3HJK A;  4I5S A;  2ZBB A;  2XA7 M;  2W3F A;  4MDZ A;  4GW9 A;  3C30 A;  3D72 A;  4MN6 A;  4CLC D;  3HJI A;  2O0Y A;  4EET B;  4WN5 A;  2HJ9 C;  1G6O A;  3C2W A;  3FPW A;  3EEA A;  4BJP A;  3LR0 A;  5DKK A;  4FSF A;  4DN0 A;  3VE4 A;  2QYB A;  3VE3 A;  1N9O A;  5EFW A;  1W63 Q;  1T18 A;  4HOI A;  3LIC A;  5F5Y A;  1DP8 A;  3T50 A;  4UEY A;  2WKQ A;  4QPR A;  3ZQ5 A;  1S4R A;  1YAX A;  5HD5 A;  3K2N A;  3BY8 A;  4HJ3 A;  4HIA A;  2VV6 A;  3PBQ A;  4UQI S;  2V1B A;  1P9W A;  4F3L B;  2W27 A;  1MC0 A;  3T4Q A;  3W2Z A;  3ICY A;  2P7J A;  2VJW A;  4BMW A;  3TW8 A;  2V0U A;  2JKR M;  1NLY A;  2OWJ A;  3FG8 A;  1S4S A;  3PHY A;  4KQD A;  4PAU A;  4HNB A;  2EA9 A;  5I5L A;  4MMN A;  3MMH A;  1N9N A;  1YSQ A;  5HDC A;  2L0W A;  4GLQ A;  3UB7 A;  3KSF A;  2P08 A;  1WA9 A;  1UWP X;  2GNX A;  3EEH A;  2W0N A;  2ZMV A;  3LI8 A;  3E98 A;  3C8C A;  5TBM A;  3BW6 A;  4HI4 A;  3GEC A;  1XJ4 A;  4P6Z S;  5K5B A;  5HDS A;  2J3W A;  5KIZ A;  4WEK A;  3TJZ C;  3IS2 A;  1YSP A;  1XJ2 A;  2ZMF A;  5AVE A;  3ULF A;  4EW7 A;  2PD8 A;  2J80 A;  2YKH A;  1OTD A;  1D06 A;  1IOU A;  5CX7 A;  2IA2 A;  3V67 A;  2PR5 A;  2B18 A;  2G7U A;  2JKT I;  3F1P B;  5IS1 A;  2VV8 A;  3NHQ A;  2OAQ 1;  4HHD A;  3LYX A;  5F68 A;  4IUK A;  2J3T C;  2VA0 A;  1EW0 A;  3K3D A;  4HJ6 A;  3EQV A;  2VGL S;  3OCN A;  3LI9 A;  2LB9 A;  2VKS A;  4R6L A;  5MC7 A;  4EES A;  1H8M A;  4Y2F A;  3VV4 A;  4DMZ A;  1IFQ A;  2Y79 A;  3BJN A;  3SW1 A;  1NWZ A;  3MQO A;  2J3T D;  4NXG A;  2W3G A;  4G3V A;  3PR6 A;  2KLI A;  1KOU A;  3EOI A;  2GZA A;  1P9R A;  4ETX A;  2O99 A;  5TBM B;  4AFI A;  4HH2 A;  4II7 A;  4PKY G;  4KUO A;  3KSI A;  3PBT A;  1F5M A;  1MZU A;  3IS2 B;  3CWF A;  4WL9 A;  4Y5F A;  3LIA A;  1N9L A;  4I38 A;  4CQH A;  3RH8 B;  2W1T A;  3BWL A;  4E04 A;  2PR6 A;  1OT6 A;  1ZTU A;  4NKP A;  4CLC A;  2O9A A;  2PYR A;  4WUJ A;  3EQU A;  2KX6 A;  3MFX A;  3CI6 A;  4LPZ A;  4GHI A;  5HL6 A;  2GX5 A;  3MQQ A;  4ARZ B;  5HZH A;  3MR0 A;  3UB8 A;  2VGL M;  3T4O A;  3KSH A;  2INW A;  2XRO A;  3O5Y A;  4OOM A;  4NXE A;  4ZRR A;  2K2N A;  2H28 A;  3DBA A;  2EWW A;  1OPX A;  1VB6 A;  4ME4 A;  5HWW A;  5G4Z A;  4IHQ A;  1P0Z A;  3EWK A;  4H6J B;  4PHT A;  2M7V A;  3F1O A;  3NOP C;  2QKP A;  3MJQ A;  4R38 A;  4EEP A;  3MF0 A;  4I3A A;  3NJA A;  4Q0I A;  2A24 A;  3CIT A;  5HSQ A;  2XSS A;  2JN7 A;  2V0W A;  3H82 A;  4BWI A;  3R7W A;  5HPI A;  2W3E A;  2W1T B;  4BBU A;  3T4J A;  4HP9 A;  3E4Q A;  2HV1 A;  2KOI A;  4GCZ A;  3UE3 A;  2OAP 1;  2VX8 A;  2B02 A;  1OTE A;  1XJ3 A;  4XT2 A;  4B9O A;  4GHI B;  1P97 A;  2WKR A;  3CUE C;  2XRN A;  3G6O A;  2BAS A;  3BY9 A;  4K08 A;  5C5K A;  5DFX A;  3EGD C;  3KSG A;  1TF1 A;  3IBJ A;  1TD5 A;  3PBS A;  2EWV A;  5HD3 A;  3OBF A;  4EXO A;  2M1C A;  3T4L A;  2VLG A;  3F1N A;  3UMD A;  2MJ6 A;  1VHM A;  2QHK A;  3HCY A;  2P04 A;  3LID A;  1S66 L;  4GS9 A;  2A24 B;  1D7E A;  4BBT A;  1W63 M;  2M7U A;  4BBV A;  3GDI A;  1T19 A;  3OC2 A;  3BQA A;  3LR4 A;  3IBR A;  4L9F A;  3R7W B;  4JGP A;  1BYW A;  4MN5 A;  3P7N A;  1S67 L;  4FOF A;  4DJ2 A;  2Z6D A;  4R3A A;  5G4Y A;  4Q0J A;  5J3W A;  2GJ3 A;  4Z1W A;  3OLO A;  3RFB A;  2QWS A;  2Y8H A;  2O9C A;  2W3D A;  4O8G A;  3LIB A;  4HP4 A;  4IJG A;  3D3O A;  3PBN A;  5HDD A;  1XFQ A;  4HQA A;  1OTA A;  3S7Q A;  2YKF A;  4O0P A;  3CAX A;  3E0Y A;  5DJU A;  4KQO A;  1ODV A;  2JKT M;  2KDK A;  2OOL A;  3KX0 X;  4G3W A;  2D02 A;  1OT9 A;  3U2A A;  5DF9 A;  2FH5 A;  4WLA A;  2HF6 A;  2VZW A;  3B33 A;  3TE8 A;  3KO6 A;  3RTY A;  4LLO B;  2I9V A;  4EEU A;  3OCL A;  1T1A A;  4RQ9 A;  1F9I A;  3UME A;  1UWN X;  5DJT A;  3H9W A;  2DMW A;  2FZ0 A;  2O9B A;  3LR3 A;  1GSV A;  3LIF A;  4WF0 A;  3EGX C;  1JNU A;  3FPV A;  3A0V A;  3VOL A;  3A0R A;  4F3L A;  3LFV A;  3LUQ A;  3FC7 A;  1UGU A;  5FL3 A;  1OTB A;  1DP6 A;  2PT7 A;  1XJ6 A;  2QJ5 A;  3P01 A;  1T1B A;  4JGO A;  3KYZ A;  2HGV A;  2V1A A;  4JGQ A;  4L9G A;  1TS7 A;  3PBR A;  2NUT C;  5LBR A;  1OJ5 A;  3H7W A;  1G28 A;  4ETZ A;  3UB6 A;  4L0L A;  5F69 A;  2CMN A;  4EQ1 A;  4DJ3 A;  2JKR I;  4Y3I A;  4O01 A;  5IU1 A;  3MQ0 A;  1DP9 A;  3PXP A;  3TRC A;  2PDR A;  2L4R A;  5KSH A;  2JHE A;  2VEA A;  4G3K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...