4I38A

Structures of it intermediates from time-resolved laue crystallography collected at 14id-b, aps
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
125
structure length
125
Chain Sequence
b'MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
publication title Volume-conserving trans-cis isomerization pathways in photoactive yellow protein visualized by picosecond X-ray crystallography
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Luminescent protein
total genus 36
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2012-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4i38A00
4I3IA 4R6LA 1OTEA 4GHIB 1KOUA 5F69A 4MN6A 2CMNA 4L9EA 3IS2A 5TBMB 4GS9B 4EXOA 4KQDA 3UE6A 1XFQA 4DJ3A 2HV1A 2L0WA 3IBRA 5J7EA 1ODVA 3LICA 3NOTC 1S1YA 3EEHA 1T1CA 2YKHA 3BWLA 1LSWA 5HZHA 3SW1A 1V9YA 3F1OA 3NOPC 2V0UA 2YKFA 3F1PB 2W27A 5DJUA 5HD3A 2PD7A 5AVEA 1DP9A 1LL8A 3D72A 3H7WB 2OOLA 3LIDA 4HNBA 2PR6A 5A8BA 1WA9A 2L4RA 3PYPA 2ZBBA 2QJ7A 4LRZE 2QHKA 4EESA 4EERA 2I9VA 3FG8A 3HJIA 1JNUA 4GHIA 3RTYA 4KUKA 4HH2A 1DP8A 3NOUC 1XFNA 3MFXA 3P7NA 4GCZA 3VE4A 4BBTA 1X0OA 5EFWA 5G4YA 4NXGA 5HD5A 3K3DA 4L9GA 2A24B 4WLAA 1G28A 2ZOHA 1LT0A 4HJ6A 3G6OA 4B9OA 2PDRA 4BBVA 3K3CA 4F3LB 4GW9A 1DRMA 5F68A 4EEPA 1OT6A 2K7SA 1XJ6A 3F1PA 4I39A 3UB9A 1N9LA 3MXQA 3UMEA 1UWNX 4LPZA 2Z6CA 1F9IA 4EW7A 3UB8A 2B02A 1N9NA 2QJ5A 3MQOA 3ULFA 5IS1A 1D06A 2VV8A 4WUJA 1EW0A 2OWHA 1OTIA 2WKQA 5IU1A 5G4ZA 1VB6A 1BYWA 2V0WA 5HSQA 2D01A 3LI8A 2PHYA 4KUOA 5HDDA 3CAXA 4NXFA 4I5SA 3BY8A 4WL9A 3MQQA 3H82B 2OWJA 2V1BA 1XJ3A 4HP9A 5HWWA 2A24A 3C8CA 4HQAA 3KX0X 3E4PA 2H28A 5HWVA 4F3LA 3PHYA 3LIFA 4WF0A 4JGRA 3UMDA 3VE3A 2VV6A 4E04A 2QKPA 4I3JA 3LI9A 2PD8A 5J4EA 1TS6A 2PYPA 4NXBA 2VLGA 4HY8A 1P97A 5J3WA 4I3AA 2QWSA 3GECA 3HJKA 4HOIA 5TBMA 4GS9A 3A0RA 1OJ5A 1OT9A 4HJ4A 2V1AA 1XJ2A 3RH8B 4PKYG 5DKKA 3F1OB 1S1ZA 1OJGA 1D7EA 4XT2B 1T1AA 1P0ZA 4EETB 2WKRA 4JGPA 5F5YA 3VOLA 4NXEA 3E4QA 2P7JA 3B33A 4LLOB 3FC7A 4HIAA 5KIZA 2Z6DA 3E4OA 1DP6A 3H7WA 2JN7A 1T1BA 5I5LA 4K08A 1UWPX 1XJ4A 2EA9A 2V9AA 3LIBA 3MJQA 4JGQA 4PKYA 1OTDA 2D02A 5HDCA 2KDKA 3T50A 3F1NB 2J80A 3ZQ5A 1MZUA 1NWZA 3GDIA 4HHDA 3A0SA 4HI4A 2R78A 2W0NA 1T18A 2VEAA 1OTAA 2WKPA 5HWTA 5AVFA 3LYXA 1TS0A 4R38A 3UB6A 3C2WA 1Y28A 4EEUA 3EWKA 4HP4A 1UGUA 5HDSA 4JGOA 1TS7A 2BASA 2VV7A 4H6JB 4R70A 4LRYC 4M4XA 3CWFA 4XT2A 3NJAA 4YWZA 1S67L 4MN5A 1GSWA 1V9ZA 3ICYA 4BBUA 2JHEA 3CLOA 4HJ3A 3IS2B 2L1MA 3A0VA 2INWA 4LRXC 4RQ9A 2PR5A 2KX6A 5DJTA 5DKLA 1F98A 3UB7A 3H9WA 1TS8A 2GJ3A 4R3AA 1GSXA 3F1NA 4WN5A 3BY9A 1N9OA 3NHQA 4L9FA 3OLOA 1S66L 5F6AA 1OTBA 2M1CA 4I38A 4EQ1A 3LIEA 2ZOIA 1GSVA 1T19A 3LUQA 2PYRA 3H82A 4HH3A 1LSXA 1S4RA 4DJ2A 3MR0A 1S4SA 4H6JA 1LSVA 3LIAA
chains in the Genus database with same CATH superfamily
1YM1A 4I3IA 4KG5A 5FAOA 1OTEA 4OPZA 2Y2OA 3IWIA 2EXBA 4MN6A 5EVIC 3MKEA 4KZ6A 4LV0A 2XA7S 2XA7M 1NY0A 5CECA 3U4LP 5EM0A 3NDEA 2BG1A 4GS9B 4EXOA 3OZHA 3M6HA 4ZJ3A 2C5WB 5IHVA 2ZC7A 5TGFA 2L0WA 4WMCD 5CTNA 3LICA 4MBHA 1IELA 3IT9A 4K0XA 3HUOA 1V9YA 3F1OA 1ZKJA 2V0UA 1KDSA 1K4EA 2WGVA 3LY3A 1WE4A 5DJUA 5HD3A 4XUXA 1DP9A 4CQHA 3MQ0A 3C7UA 3K2NA 1G6OA 3AGFA 3H7WB 3LIDA 1GHIA 2WKEA 5CHUA 5HARA 4Q0JA 4S2MA 1Z6FA 4R3BA 4B4ZA 2C6WB 4EERA 4PM7A 5J8XA 2WADA 2O9AA 1E4DA 3Q7VA 2E8IA 3AGDA 4DKIA 1K25A 3SS3A 2Y2MA 3S22A 2PU4A 4DE1A 2UWXA 3MFXA 3ZDJA 2UV0E 4JBFA 3WRTA 5EFWA 5HW3A 4BWIA 4OOYA 2OAP1 4L9GA 3ZGAB 5HAPA 3A3FA 5MC7A 4R23A 4R4RA 1ERQA 1LT0A 4FH2A 3T4SA 2O0YA 2G2WA 5FDSA 2ZM8A 2VKSA 1MWUA 4B9OA 2PDRA 4F3LB 1GA9A 5A90A 3FKVA 2XH9A 1OT6A 2K7SA 2BTFP 2W1RA 4Y3IA 4I39A 4DE0A 2W3GA 3S7NA 3UB9A 3MXQA 1SHVA 2Y2NA 1FSYA 3WS4A 3KSIA 4WYYA 2Y2GA 2JKRI 3FZCA 1N9NA 3MQOA 2QPNA 3EGXC 4E3OA 1YSPA 4ESPA 4IVIA 4PMAA 5L09A 1PNEA 4DRTA 2VV8A 2EX9A 2FH5A 4R4SA 1OTIA 4ZDXA 5IT5A 1VB6A 1TVFA 3LI8A 3N6IA 4F94A 4DN0A 1W5DA 3CUEC 1CK3A 4NXFA 3BY8A 4II7A 4H8RA 1BLSA 3RJUA 3T4OA 3UE3A 2OWJA 1XJ3A 5HX9A 1CI8A 5FQKA 1H0MA 1HVBA 3I7JA 3NDGA 3PHYA 4ZRRA 4FOFA 4WF0A 4LV2A 3NBLA 5DTTA 2XF3A 2XFTA 2QKPA 3HLEA 4Y0TA 3LI9A 2J3TD 4IEDA 2HP9A 2PYPA 2X02A 4KZAA 4UEYA 5FA7A 2O9CA 1BLCA 1P97A 3CITA 2WK0A 4BD0A 4KZ3A 2Y79A 4UAAA 4JKTA 2XROA 5JYPA 5FATA 4OOLA 1MPLA 1OT9A 4HJ4A 3RH8B 3NULA 5EV0A 3CMZA 3IWOA 4O0PA 1AWIA 1M6KA 3F1OB 1KGFA 1S1ZA 4DE2A 2ZD8A 4RA7A 4YFMA 1XX2A 1KGGA 3T4KA 2K31A 2ZC4B 3BEBA 5EOEA 4XT2B 3T1XA 1T1AA 1P0ZA 1EWZA 5DTSA 4RYEA 3UE0A 1H8YA 3CHWP 1NXYA 4KQRA 3E2LA 3IHAA 1L0GA 4BLMA 3HLWA 4HIAA 4D60A 3E4OA 1TDGA 3N8RA 1FQGA 2JN7A 2WUQA 4NEED 2IWBA 5I5LA 1EI5A 1SDNA 1UWPX 4K08A 4ZAMA 2V9AA 1SDEA 3LIBA 4MMNA 2D02A 5GL9A 2J7VA 5KMWA 3CPTA 5AJGA 3HBRA 4GN2A 5HL6A 4Y5FA 2G7UA 2EFUA 3WRZA 2Y2HA 3LY4A 4RX2A 1NWZA 1FIKA 3GDIA 4E3LA 2XFSA 4HHDA 5CERA 2R9XA 3NC8A 2Z2MB 4ZBEA 1T18A 3G2ZA 1XPBA 2VEAA 4HEFA 3HCYA 5HWTA 5AVFA 1BZAA 4G3WA 1RCJA 1Y28A 2WKIA 2X71A 3T4QA 2NUTC 4H6JB 2JKGA 3OPHA 5FI7A 4IBRA 3VP3A 2WZZA 1YLPA 3ZG8B 3D4FA 4KZ4A 4Q8IA 1S67L 3O88A 1GSWA 4U0XA 2J3WA 3ICYA 3CLOA 3S4XA 5E2FA 1CEGA 1QMEA 2V20A 2L1MA 4MDZA 2VX8A 3A0VA 3EGDC 4RQ9A 1K38A 1F98A 5EE8A 2DNSA 1O7EA 4BMWA 3C4OA 1TS8A 3VOZA 4R0QA 1K54A 1TD5A 1ERMA 3UDFA 3DWKA 4MCWA 1LI9A 3VP1A 3LEQA 3PBOA 2Y2QA 4O7DA 2B95A 5E2HA 1N9OA 3NHQA 3OCNA 4L9FA 5FI2A 1S66L 1Y4OA 2HP6A 2VK3A 3VSLA 4GJ4A 5EUAA 2M1CA 4M3KA 4FTXA 1L0DA 2XSSA 2FZ0A 2ZOIA 5FI6A 3AGEA 3ZG5A 3NECA 3H82A 3MXSA 5FEFA 3MR0A 1LSVA 3T1RA 3TJZC 1JTDA 4CLCA 5FSRA 2WZXA 4GHIB 4XUZA 1GA0A 5F1GA 1KOUA 5BOHA 2M7VA 4KENB 2ZMFA 3ISGA 1VETA 3QP2A 4OPYA 4GD6A 4L9EA 5U47A 2ZQ8A 3UE6A 1XFQA 1BULA 4KQQA 1BTLA 2HV1A 1ZG4A 1NYMA 3ZFZA 3IBRA 3MZFA 1NRFA 4N9LA 1ODVA 4C6YA 2HJEA 1FCOA 5L07A 5HZHA 4QHCA 5FL3A 2Y2LA 3UO9A 3BRMA 2YKFA 3F1PB 3KSHA 4NG2A 4Q0IA 2PD7A 4IBXA 1LL8A 1I2SA 2JKFA 2Y4AA 4P85A 4EBPA 4EU0A 2OOLA 3TOIA 4FH4A 3OOVA 3G34A 3M6BA 2HP5A 3MKFA 1FCNA 2HJ9C 1FCMA 2ZBBA 3A3JA 4LRZE 3FG8A 3ZVTA 3W8KA 2WAFA 3R7WA 1PWGA 4FSFA 3BM6A 3MMHA 1HZOA 1SZVA 3RTYA 5FEGA 4FCFA 1DP8A 5CX7A 4GDBA 2H10A 2Q9NA 3SH8A 3P7NA 4GCZA 1YLYA 2J8YA 3ZNYA 3VOYA 2EX2A 1VQQA 2HF6A 1X0OA 4JF4A 4WEJA 5HPFA 1K56A 5FQMA 2ZQCA 4NXGA 4S2IA 3MFDA 4N9KA 5DF7A 3K3DA 2OV5A 3P98A 3OPRA 2A24B 4WLAA 3WS5A 3ZNTA 3P09A 3HL9A 5GLAA 1H8MA 2ZQAA 3K3CA 1IOUA 2FFFB 5F68A 2HGVA 3V67A 2KOIA 4OQHA 3WS1A 1F2KA 2Y2JA 1N9LA 1M40A 3UMEA 4LPZA 3S7QA 2ZJ9A 3G31A 2XGNA 4GZBA 3NIAA 2PRFA 3HLFA 3LR0A 5TJJA 3IHBA 4L0LA 2QJ5A 3FWLA 3ULFA 1S6RA 2HDQA 4NK3A 5FQIA 4DXBA 4WUJA 5EVIA 2QYBA 2WKQA 4WEKA 4E3NA 1KVLA 2V0WA 5HSQA 2PHYA 4KUOA 3DTMA 3LFVA 2HPBA 1VHMA 3GR2A 3D3OA 4LCMA 4OQIA 4FD8A 4I5SA 1PW8A 4UA6A 1ESUA 3H82B 2NUPC 3O5YA 3BW6A 3ZG9B 2J9PA 3PR6A 5M1AA 3KX0X 2K2NA 4JPMA 2PBYA 3V3RA 3LIFA 2XK1A 4E04A 4QB8A 4IHQA 3PBNA 3A3EA 1KGEA 4OOMA 3PBSA 1GHMA 2PD8A 3IH9A 1IYOA 1TS6A 1ZC2A 3GV9A 3W4OA 4AFIA 1LI0A 2P9VA 5AQBA 3IX8A 5EVLA 1E3UA 3CZDA 3JVVA 4E6XA 5EVEA 2WGIA 3NI9A 2OLVA 1ES2A 1OJ5A 1XJ2A 5F83A 1D7EA 1W63Q 1P9WA 4YNRA 3FKWA 3IXBA 2WKHA 3VOLA 4KG6A 3PBQA 3T4LA 3Q81A 4G3KA 4K0WA 4OPQA 3B33A 3MZDA 4KZ7A 5GLDA 5TFQA 1KE0A 1T1BA 4UHUA 2Q0OA 4MEZA 4ARZA 3ZG0A 3R7WB 3OPPA 5AQ7A 4DDSA 4BENA 5FAPA 3TW8A 3F1NB 3ZQ5A 3RFBA 3VP0A 1MZUA 2VA0A 1YLWA 1W63M 2XD5A 3VFHA 2V8CA 5KSCA 2XLNA 1MKMA 4HI4A 2R78A 2W0NA 3IXGA 4WM9A 4DMZA 2XRNA 3TE8A 3T4TA 1WYCA 2H5SA 1UGUA 2M7UA 4LGWA 3UPNA 4JGOA 1TS7A 2ZM0A 1YLZA 1BT5A 1ES4A 3CUEA 5CEDA 1SKOA 4S2LA 2I72A 4G3VA 4HJ3A 4ZJ2A 3V50A 4LRXC 2PR5A 4GOGA 2KX6A 5DJTA 5DKLA 3CI6A 4E3KA 4D2OA 3W4PA 3U2AA 5E43A 3H9WA 3QP4A 4DXCA 2PAVP 1W8YA 1XXMA 2H0TA 2ZC3B 1HTZA 3NCKA 3BFCA 1GSXA 3W4QA 1ES5A 4X69A 3UPPA 1O07A 4JXGA 3O86A 3WS2A 2JBFA 2KLIA 5GHXA 3E2KA 5D3OA 3T1SA 3IF6C 1K57C 1GSVA 1T19A 3PXPA 4OONA 1LHYA 4Z1WA 1C3BA 3EQUA 4WZ5C 3FYZA 4LCLA 1S4RA 4DE3A 3P01A 2WGWA 1S4SA 4Y2FA 3UY6A 2J3TC 3LIAA 3Q7VB 2R9WA 4R6LA 2GNXA 3OC2A 3GTCA 1AXBA 1ZTUA 2ZQDA 1MXOA 2CMNA 2W1TA 2OSUA 2VGLS 2IWDA 3Q1FA 3LR4A 3IS2A 4KQDA 1RGZA 3HUMA 4BD1A 1GCEA 2ZC6B 4OKPA 4X6TA 1JTGA 1T1CA 1K55A 3SW1A 3NOPC 4FUWA 3B3XA 2QMIA 4QU3A 3OCLA 4B4XA 4GDNA 2W27A 2ZC5B 5AVEA 1PZOA 3DTIA 3G32A 1IEMA 2WYXA 3WWXA 2V8FA 5KZHA 4X56A 2PR6A 1CF0A 3RXWA 4ARZB 1KDWA 4ZTKA 3PYPA 4PPRA 1TEMA 1IFQA 2QHKA 4EESA 3S1YA 3JVUA 4IUKA 2V2FF 3BLSA 1FOFA 4KZ5A 3HJIA 4N1XA 4B88A 1XA1A 3SZTA 4LENA 1HD8A 3BQAA 2PU2A 4X53A 3VE4A 4BBTA 2VJWA 2OLUA 1YKDA 5G4YA 5GHZA 3BECA 3VV4A 5HD5A 5FDHA 4UA7A 5G18A 4C75A 2IWCA 4ETZA 2QZ6A 1G28A 2ZOHA 5EECA 3TSGA 2CC1A 4PM9A 2EWVA 4Y17A 3MZEA 1A0KA 3B42A 1W79A 4EEPA 1XJ6A 3IH8A 4RX3A 5DFXA 3R4KA 1UWNX 1PI5A 1KE4A 1P9RA 2Z6CA 3O87A 1Y54A 2W3DA 3UB8A 4O01A 5IS1A 2LB5A 1IKGA 1D06A 3GQZA 3FV7A 5CTMA 2PBDP 4WBGA 5K5BA 3T1QB 1ZG6A 4MLLA 4GD8A 5IU1A 4OLGA 4S2OA 4K91A 2WAEA 4OQGA 4JXWA 1NJ4A 2JKTM 3CAXA 4WZ4A 4KZ8A 2HZ5A 4OP5A 3MQQA 3HLGA 1I5QA 1L2SA 1YSQA 3DWZA 5L10A 2E8JA 2WGWB 4QY5A 3BLMA 4HQAA 2O99A 3T4JA 3PBTA 2XR0A 4QWOA 3W2ZA 3BQ8A 4E3MA 4P6ZS 4QPRA 2H28A 3CPTB 4F3LA 3LCEA 2EX6A 4PM8A 4HBUA 2VV6A 2W1TB 4Y7PA 4I3JA 4YINA 3QHYA 1PWCA 3G4PA 1TDLA 5CEBA 4PM5A 5J4EA 2VZWA 2Y2KA 4N1HA 1IYQA 4GKUA 1ALQA 1YT4A 3IX3A 4MBKA 3IXHA 3Q07A 5J3WA 4ID4A 3ITBA 3GECA 5EVID 1MKIA 2B18A 4X55A 5TBMA 2O9BA 4P0MA 5HAQA 5AQ9A 3N8SA 3L7HA 2V1AA 1YPRA 1MWTA 4PKYG 1YAXA 2OAQ1 5DKKA 1OJGA 1XGJA 3WS0A 3C30A 3BFFA 4Y0UA 1N4OA 2B5RA 4X1MA 2DRWA 5CGXA 4S2NC 1EROA 4NXEA 4PHTA 1J9MA 1JWVA 3E4QA 2Y2IA 2P7JA 5HFOA 4LLOB 1FR1A 1WYBA 5LBRA 5CHMA 4A5RA 3PAEA 1DP6A 1ZHHB 3HVFA 4IVKA 2EA9A 2LB9A 1Q2QA 3QP8A 1OTDA 4KQOA 4OH0A 4GLQA 1YMSA 3LEZA 3T50A 1G5UA 2J80A 3QNCA 2ZMVA 4O8GA 1E3UD 3MS6A 2GX5A 1BSGA 3EOIA 1K4FA 4QJGA 1Z09A 4NETA 3BJNA 3A0SA 1LLBA 3T12B 1LL9A 1OTAA 3VSKA 1NLYA 3SS4A 3IQAA 3QP5A 1MWSA 3LYXA 3UB6A 3C2WA 1PFLA 2RCXA 4LFUA 4B93A 5HDSA 2DCFA 5EPHA 2BASA 4S2JA 2XQZA 2VV7A 3LGOA 4R70A 4UA9A 1YLJA 4CLCB 4LRYC 3ZYTA 4M4XA 4BQMA 4XT2A 3NJAA 4JLFA 2W3FA 2ZLYA 4MN5A 3IBJA 1K6RA 3V5MA 3M2KA 3NY4A 4BBUA 1VETB 2A3UA 1FILA 2JHEA 3N8LA 4ZJ1A 2EXAA 1Q2PA 3VP2A 5M19A 3BFGA 2DMWA 3UB7A 4S2KA 4JXVA 3GRJA 4JXSA 1OPXA 2GJ3A 3PAGA 2ZL1A 4R3AA 1OMEA 4X25A 3BY9A 1PRQA 4CJNA 4WMCA 1KE3A 3UE1A 2ZM2A 3UB5P 4EWFA 5CXWA 3OPLA 1JVJA 4JF6A 2GZAA 4Z9QA 1DY6A 4EQ1A 3LIEA 4E6WA 5L8MA 4U3TA 3LUQA 2PYRA 1NZOA 3CJMA 2HDSA 4HH3A 1LSXA 3HUNA 4MBFA 4DJ2A 4E3IA 1CJFA 2P74A 4H6JA 3GMWA 2EWWA 2A2LA 4LV1A 1IKIA 3G2YA 4WELA 2XDMA 4EUVA 1PW1A 5F69A 3JYIA 5HPIA 5A92A 3EQVA 1SCWA 4CLCE 1K6SA 1PZPA 1S0WA 3C7VA 1XP4A 3N7WA 1PIOA 4P87A 1PI4A 5TBMB 4HBTA 4KZ9A 5FASA 2Y55A 3KSFA 4DJ3A 1NLZA 5J7EA 2HDRA 3NOTC 1S1YA 3EEHA 3M2JA 2YKHA 3BWLA 1ES3A 1MBLA 1CEFA 1LSWA 1PYYA 1PWDA 4OP8A 3Q7ZA 4YOFA 4PM6A 2Y91A 2Q9MA 5CGWA 4P6BA 1XKZA 1KVMA 2Y2PA 3D72A 2Y59A 4OQ0A 5EM1A 2EFXA 2IA2A 4X68A 3MF0A 1DJBA 4HNBA 2W3HA 5A8BA 4Y13A 1WA9A 2L4RA 1GHPA 5FQJA 3LR5A 3GVBA 2QJ7A 2I9VA 5I94A 3TRCA 3GSGA 1CQAA 1RP5A 3UNWA 1W7FA 5EVIB 1LL5A 1VEUA 4RVAA 1JNUA 4GHIA 4KUKA 4HH2A 2VGKA 3NOUC 4EUZA 1XFNA 3LR3A 5GLCA 5A91A 2JKRM 5A93A 2Y8HA 1MY8A 1XA7A 1BLPA 4KG2A 1ONHA 5CHJA 5DTKA 5GLBA 2JC7A 1IYSA 4KZBA 1STZA 4MN7A 4HJ6A 3G6OA 3G35A 4BBVA 3ZCZA 2XEPA 4GW9A 1DRMA 4MNRA 3SH9A 1U60A 3QNBA 3RXXA 3F1PA 1ONGA 3IF6A 1K57A 4UQIS 4UQIM 5GHYA 2Z2LB 1F9IA 1DJCA 2P9VB 4WZ5A 4Y0OA 2X01A 2VGLM 4EW7A 1TF1A 2B02A 4XXRA 1BLHA 4ETXA 1ESIA 5CGSA 1JWPA 2ZL1B 2RL3A 2VGJA 3MSHA 1EW0A 5DVAA 5DF8A 1L0FA 3S7OA 2OWHA 1K55C 5G4ZA 3D9YA 1BYWA 2D01A 4R3JA 2H0YA 5E2EA 5M18A 5HDDA 3N4IA 4EV4A 1N9BA 3C4PA 5DF9A 4NKPA 1XGIA 3IF5A 3KYZA 1FR6A 4WL9A 3JPUA 4C3QA 1YQSA 3G30A 2V1BA 4S2PA 3SOIA 3Q82A 4HP9A 2A24A 5HAIA 3VMAA 5HWWA 4IUHA 3DBAA 3C8CA 4DDYA 4OVDA 4CLCD 3E4PA 3FPVA 4E3JA 3BFDA 5HWVA 4LV3A 1G6AA 4JGRA 3UMDA 4DF6A 1K54C 1K0KA 3VE3A 5CRFA 1VM1A 1E25A 5KSHA 4EBNA 3UPOA 4NXBA 2VLGA 5JYOA 3UN7A 4HY8A 3E98A 3ITAA 4I3AA 2QWSA 1F5MA 1NZUA 3HJKA 2A49A 4HOIA 2JKTI 4GS9A 3A0RA 3IWQA 3EEAA 4HESA 3DTKA 3O3VA 1JWZA 3KYQA 2V1ZA 2ZQ9A 3BFEA 5FQQA 5C5KA 5F1FA 1FSWA 2HDUA 4EETB 3VP4A 2WKRA 4JGPA 5F5YA 1SKOB 4CLCC 4PAUA 1D1JA 1BUEA 4EBLA 5FQ9A 3A3IA 3FC7A 3S7PA 2ZMAA 5KIZA 2Z6DA 2ACGA 3H7WA 3HLCA 4X1LA 1H3QA 4JF5A 1DJAA 5EOOA 3QP6A 5F82A 3IXDA 1XJ4A 1H5XA 1L0EA 3MJQA 4JGQA 4PKYA 1VEUB 5HDCA 5L2FA 2G2UA 1SKFA 1NYYA 3HREA 2KDKA 4BL3A 2FFYA 3HLBA 2PT7A 3BYDA 1K56D 3PTEA 4R1GA 1YLTA 3DW0A 2GDNA 2BLSA 3PBRA 5AQAA 3VFFA 3TG9A 2P04A 2WKPA 3MBZA 3LO7A 3UDIA 2XD1A 1J3WA 4Q0HA 4QD4A 1TS0A 4R38A 2W3EA 4EEUA 3EWKA 4HP4A 3FPWA 1ACFA 1W8QA 4U0TA 4Y15A 4EQIA 3IX4A 3ZVWA 3C38A 4QY6A 3V39A 3SS5A 4GB7A 1MC0A 3CWFA 3IF6B 4P6ZM 1MWRA 4BJPA 3KSGA 1IYPA 4YWZA 1V9ZA 2ZQ7A 2J9OA 2P08A 4GNUA 1QMFA 3A3DA 3IS2B 2AVXA 4ME4A 2JE5A 2INWA 3MXRA 1G68A 5FAQA 1CI9A 3ZG7B 3SH7A 1H8ZA 4OLDA 3ZHHA 1I2WA 3KYEA 5HL1A 1NRJA 2JCHA 3E0YA 3F1NA 3KO6A 4WN5A 3L9KA 5DFYA 4N92A 3V3SA 5TR7A 3DTEA 3OLOA 2MJ6A 5F6AA 1HLUP 1OTBA 3C5AA 4I38A 3QP1A 3CG5A 1YMXA 3UDXA 5E2GA 4BL2A 3HLDA 3OBFA 3B47A 4IJGA 3DAVA 4CPKA 4OPRA 1RGYA 1L3LA 2EX8A 4S2NA
chains in the Genus database with same CATH topology
4I3IA 4CLCA 4R6LA 1OTEA 2GNXA 3OC2A 4GHIB 4WELA 4EUVA 1KOUA 5F69A 4MN6A 2M7VA 1ZTUA 5HPIA 2ZMFA 2CMNA 2XA7S 2W1TA 2VGLS 3EQVA 4CLCE 2XA7M 4L9EA 3LR4A 3IS2A 5TBMB 4GS9B 4EXOA 4KQDA 3UE6A 1XFQA 3KSFA 4DJ3A 2HV1A 2L0WA 3IBRA 1NLZA 5J7EA 1ODVA 3LICA 2HJEA 3NOTC 1S1YA 3EEHA 1T1CA 2YKHA 3BWLA 1LSWA 5HZHA 3SW1A 1V9YA 5FL3A 3F1OA 3NOPC 2V0UA 4YOFA 2YKFA 3OCLA 3F1PB 3KSHA 2W27A 4Q0IA 5DJUA 5HD3A 2PD7A 5AVEA 1DP9A 4CQHA 1LL8A 3MQ0A 3D72A 3K2NA 1G6OA 2IA2A 4EU0A 3H7WB 2OOLA 3LIDA 3MF0A 3OOVA 4HNBA 2PR6A 2W3HA 4ARZB 5A8BA 1WA9A 2L4RA 4Q0JA 2HJ9C 3PYPA 3LR5A 2ZBBA 2QJ7A 1IFQA 2QHKA 4LRZE 4EESA 2I9VA 4EERA 3JVUA 4IUKA 3FG8A 3TRCA 2O9AA 3R7WA 3HJIA 4FSFA 3MMHA 1JNUA 4GHIA 3RTYA 4KUKA 4HH2A 1DP8A 5CX7A 3NOUC 1XFNA 3LR3A 3MFXA 3P7NA 4GCZA 3BQAA 2JKRM 3VE4A 4BBTA 2VJWA 2HF6A 1X0OA 2Y8HA 4WEJA 1YKDA 5HPFA 5EFWA 5G4YA 4NXGA 3VV4A 5HD5A 3K3DA 4BWIA 2OAP1 4L9GA 4ETZA 2A24B 4WLAA 5MC7A 1STZA 4MN7A 1G28A 2ZOHA 1LT0A 3T4SA 2O0YA 4HJ6A 3G6OA 2EWVA 2VKSA 4B9OA 2PDRA 4BBVA 1H8MA 3K3CA 4F3LB 4GW9A 1IOUA 1DRMA 5F68A 2HGVA 3B42A 4EEPA 1OT6A 2K7SA 3V67A 1XJ6A 2KOIA 2W1RA 3F1PA 4Y3IA 4I39A 2W3GA 3S7NA 3UB9A 1N9LA 4UQIS 3MXQA 3UMEA 5DFXA 4UQIM 3R4KA 1UWNX 4LPZA 3S7QA 3KSIA 1P9RA 2Z6CA 1F9IA 2JKRI 2W3DA 3LR0A 2VGLM 3UB8A 4EW7A 5TJJA 1TF1A 4L0LA 2B02A 1N9NA 2QJ5A 4O01A 3MQOA 3EGXC 3ULFA 1YSPA 4ETXA 5IS1A 2LB5A 1D06A 2VV8A 2FH5A 4WUJA 1EW0A 2QYBA 3S7OA 5K5BA 2OWHA 1OTIA 2WKQA 4WEKA 5IU1A 5G4ZA 5IT5A 1VB6A 1BYWA 2V0WA 5HSQA 2D01A 3LI8A 2PHYA 4KUOA 5HDDA 3LFVA 1VHMA 4DN0A 2JKTM 3CUEC 3CAXA 4NXFA 3D3OA 5DF9A 4I5SA 4NKPA 3BY8A 4II7A 3KYZA 4WL9A 3MQQA 3T4OA 3H82B 3UE3A 2OWJA 2NUPC 3O5YA 1YSQA 1XJ3A 2V1BA 3BW6A 4HP9A 5HWWA 2A24A 3PR6A 4IUHA 3DBAA 3C8CA 4HQAA 2O99A 3T4JA 3PBTA 3KX0X 4CLCD 3W2ZA 2K2NA 3BQ8A 3E4PA 3FPVA 4P6ZS 4QPRA 2H28A 5HWVA 4F3LA 3PHYA 3LIFA 4ZRRA 4FOFA 4WF0A 4JGRA 3UMDA 3VE3A 2VV6A 2W1TB 4E04A 2QKPA 4I3JA 4IHQA 3PBNA 4OOMA 3PBSA 5KSHA 3LI9A 2PD8A 2J3TD 5J4EA 1TS6A 2PYPA 2VZWA 4NXBA 2VLGA 4AFIA 4UEYA 2O9CA 4HY8A 1P97A 3E98A 3CITA 5J3WA 4I3AA 2QWSA 1F5MA 2Y79A 3GECA 3JVVA 3HJKA 2B18A 2XROA 4HOIA 5TBMA 2O9BA 2JKTI 4GS9A 3A0RA 4OOLA 1OJ5A 1OT9A 4HJ4A 2V1AA 1XJ2A 3RH8B 3EEAA 4O0PA 4PKYG 1YAXA 2OAQ1 3F1OB 5DKKA 3KYQA 1S1ZA 1OJGA 3C30A 1D7EA 1W63Q 3T4KA 2K31A 5C5KA 4XT2B 1T1AA 1P0ZA 1P9WA 4YNRA 4EETB 2WKRA 4JGPA 5F5YA 3VOLA 4NXEA 4PHTA 4CLCC 4PAUA 3PBQA 3T4LA 3E4QA 4G3KA 2P7JA 3B33A 4LLOB 3FC7A 4HIAA 5LBRA 3S7PA 5KIZA 2Z6DA 3E4OA 1DP6A 3H7WA 2JN7A 1T1BA 4NEED 1H3QA 1ZHHB 5I5LA 4K08A 1UWPX 4ARZA 3R7WB 1XJ4A 2EA9A 2V9AA 2LB9A 3LIBA 3MJQA 4JGQA 4MMNA 4PKYA 1OTDA 2D02A 5HDCA 4KQOA 4GLQA 5AJGA 3TW8A 2KDKA 5HL6A 3T50A 3F1NB 2J80A 3ZQ5A 2ZMVA 4O8GA 4Y5FA 2PT7A 2G7UA 3RFBA 2GX5A 3EOIA 1MZUA 2VA0A 1W63M 1NWZA 3GDIA 3PBRA 4HHDA 3BJNA 1MKMA 3A0SA 4HI4A 2R78A 2W0NA 1T18A 4DMZA 2VEAA 2P04A 1OTAA 2XRNA 2WKPA 3HCYA 1NLYA 5HWTA 5AVFA 4G3WA 3LYXA 4Q0HA 3TE8A 3T4TA 1TS0A 4R38A 3UB6A 3C2WA 2W3EA 1Y28A 4EEUA 3EWKA 4B93A 4HP4A 1UGUA 2M7UA 5HDSA 3FPWA 4JGOA 1TS7A 2BASA 3T4QA 2VV7A 2NUTC 4H6JB 4R70A 4CLCB 3C38A 4LRYC 3ZYTA 4M4XA 1MC0A 3CWFA 4P6ZM 4XT2A 4BJPA 3NJAA 3CUEA 2W3FA 3KSGA 4YWZA 1S67L 4MN5A 1GSWA 2J3WA 3IBJA 1V9ZA 3ICYA 4BBUA 4G3VA 2JHEA 3CLOA 2P08A 4HJ3A 3IS2B 2L1MA 4ME4A 4MDZA 2VX8A 3A0VA 2INWA 3EGDC 4LRXC 4RQ9A 2PR5A 2DMWA 2KX6A 5DJTA 5DKLA 3CI6A 1F98A 3UB7A 3U2AA 4BMWA 3H9WA 1TS8A 1TD5A 1OPXA 2GJ3A 4MCWA 4R3AA 1GSXA 1NRJA 3E0YA 3F1NA 3PBOA 3KO6A 4WN5A 3BY9A 1N9OA 5DFYA 3NHQA 3OCNA 4L9FA 3OLOA 1S66L 2MJ6A 5F6AA 4GJ4A 1OTBA 2M1CA 2KLIA 2GZAA 4I38A 4EQ1A 3LIEA 2XSSA 2FZ0A 2ZOIA 1GSVA 1T19A 3PXPA 5L8MA 4Z1WA 3EQUA 3LUQA 2PYRA 3OBFA 3B47A 4IJGA 3H82A 4HH3A 1LSXA 1S4RA 4DJ2A 3P01A 3MR0A 1S4SA 4Y2FA 4H6JA 2J3TC 1LSVA 2EWWA 2A2LA 3TJZC 3LIAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I3I A;  4R6L A;  1OTE A;  4GHI B;  1KOU A;  5F69 A;  4MN6 A;  2CMN A;  4L9E A;  3IS2 A;  5TBM B;  4GS9 B;  4EXO A;  4KQD A;  3UE6 A;  1XFQ A;  4DJ3 A;  2HV1 A;  2L0W A;  3IBR A;  5J7E A;  1ODV A;  3LIC A;  3NOT C;  1S1Y A;  3EEH A;  1T1C A;  2YKH A;  3BWL A;  1LSW A;  5HZH A;  3SW1 A;  1V9Y A;  3F1O A;  3NOP C;  2V0U A;  2YKF A;  3F1P B;  2W27 A;  5DJU A;  5HD3 A;  2PD7 A;  5AVE A;  1DP9 A;  1LL8 A;  3D72 A;  3H7W B;  2OOL A;  3LID A;  4HNB A;  2PR6 A;  5A8B A;  1WA9 A;  2L4R A;  3PYP A;  2ZBB A;  2QJ7 A;  4LRZ E;  2QHK A;  4EES A;  4EER A;  2I9V A;  3FG8 A;  3HJI A;  1JNU A;  4GHI A;  3RTY A;  4KUK A;  4HH2 A;  1DP8 A;  3NOU C;  1XFN A;  3MFX A;  3P7N A;  4GCZ A;  3VE4 A;  4BBT A;  1X0O A;  5EFW A;  5G4Y A;  4NXG A;  5HD5 A;  3K3D A;  4L9G A;  2A24 B;  4WLA A;  1G28 A;  2ZOH A;  1LT0 A;  4HJ6 A;  3G6O A;  4B9O A;  2PDR A;  4BBV A;  3K3C A;  4F3L B;  4GW9 A;  1DRM A;  5F68 A;  4EEP A;  1OT6 A;  2K7S A;  1XJ6 A;  3F1P A;  4I39 A;  3UB9 A;  1N9L A;  3MXQ A;  3UME A;  1UWN X;  4LPZ A;  2Z6C A;  1F9I A;  4EW7 A;  3UB8 A;  2B02 A;  1N9N A;  2QJ5 A;  3MQO A;  3ULF A;  5IS1 A;  1D06 A;  2VV8 A;  4WUJ A;  1EW0 A;  2OWH A;  1OTI A;  2WKQ A;  5IU1 A;  5G4Z A;  1VB6 A;  1BYW A;  2V0W A;  5HSQ A;  2D01 A;  3LI8 A;  2PHY A;  4KUO A;  5HDD A;  3CAX A;  4NXF A;  4I5S A;  3BY8 A;  4WL9 A;  3MQQ A;  3H82 B;  2OWJ A;  2V1B A;  1XJ3 A;  4HP9 A;  5HWW A;  2A24 A;  3C8C A;  4HQA A;  3KX0 X;  3E4P A;  2H28 A;  5HWV A;  4F3L A;  3PHY A;  3LIF A;  4WF0 A;  4JGR A;  3UMD A;  3VE3 A;  2VV6 A;  4E04 A;  2QKP A;  4I3J A;  3LI9 A;  2PD8 A;  5J4E A;  1TS6 A;  2PYP A;  4NXB A;  2VLG A;  4HY8 A;  1P97 A;  5J3W A;  4I3A A;  2QWS A;  3GEC A;  3HJK A;  4HOI A;  5TBM A;  4GS9 A;  3A0R A;  1OJ5 A;  1OT9 A;  4HJ4 A;  2V1A A;  1XJ2 A;  3RH8 B;  4PKY G;  5DKK A;  3F1O B;  1S1Z A;  1OJG A;  1D7E A;  4XT2 B;  1T1A A;  1P0Z A;  4EET B;  2WKR A;  4JGP A;  5F5Y A;  3VOL A;  4NXE A;  3E4Q A;  2P7J A;  3B33 A;  4LLO B;  3FC7 A;  4HIA A;  5KIZ A;  2Z6D A;  3E4O A;  1DP6 A;  3H7W A;  2JN7 A;  1T1B A;  5I5L A;  4K08 A;  1UWP X;  1XJ4 A;  2EA9 A;  2V9A A;  3LIB A;  3MJQ A;  4JGQ A;  4PKY A;  1OTD A;  2D02 A;  5HDC A;  2KDK A;  3T50 A;  3F1N B;  2J80 A;  3ZQ5 A;  1MZU A;  1NWZ A;  3GDI A;  4HHD A;  3A0S A;  4HI4 A;  2R78 A;  2W0N A;  1T18 A;  2VEA A;  1OTA A;  2WKP A;  5HWT A;  5AVF A;  3LYX A;  1TS0 A;  4R38 A;  3UB6 A;  3C2W A;  1Y28 A;  4EEU A;  3EWK A;  4HP4 A;  1UGU A;  5HDS A;  4JGO A;  1TS7 A;  2BAS A;  2VV7 A;  4H6J B;  4R70 A;  4LRY C;  4M4X A;  3CWF A;  4XT2 A;  3NJA A;  4YWZ A;  1S67 L;  4MN5 A;  1GSW A;  1V9Z A;  3ICY A;  4BBU A;  2JHE A;  3CLO A;  4HJ3 A;  3IS2 B;  2L1M A;  3A0V A;  2INW A;  4LRX C;  4RQ9 A;  2PR5 A;  2KX6 A;  5DJT A;  5DKL A;  1F98 A;  3UB7 A;  3H9W A;  1TS8 A;  2GJ3 A;  4R3A A;  1GSX A;  3F1N A;  4WN5 A;  3BY9 A;  1N9O A;  3NHQ A;  4L9F A;  3OLO A;  1S66 L;  5F6A A;  1OTB A;  2M1C A;  4I38 A;  4EQ1 A;  3LIE A;  2ZOI A;  1GSV A;  1T19 A;  3LUQ A;  2PYR A;  3H82 A;  4HH3 A;  1LSX A;  1S4R A;  4DJ2 A;  3MR0 A;  1S4S A;  4H6J A;  1LSV A;  3LIA A; 
#chains in the Genus database with same CATH topology
 1YM1 A;  4I3I A;  4KG5 A;  5FAO A;  1OTE A;  4OPZ A;  2Y2O A;  3IWI A;  2EXB A;  4MN6 A;  5EVI C;  3MKE A;  4KZ6 A;  4LV0 A;  2XA7 S;  2XA7 M;  1NY0 A;  5CEC A;  3U4L P;  5EM0 A;  3NDE A;  2BG1 A;  4GS9 B;  4EXO A;  3OZH A;  3M6H A;  4ZJ3 A;  2C5W B;  5IHV A;  2ZC7 A;  5TGF A;  2L0W A;  4WMC D;  5CTN A;  3LIC A;  4MBH A;  1IEL A;  3IT9 A;  4K0X A;  3HUO A;  1V9Y A;  3F1O A;  1ZKJ A;  2V0U A;  1KDS A;  1K4E A;  2WGV A;  3LY3 A;  1WE4 A;  5DJU A;  5HD3 A;  4XUX A;  1DP9 A;  4CQH A;  3MQ0 A;  3C7U A;  3K2N A;  1G6O A;  3AGF A;  3H7W B;  3LID A;  1GHI A;  2WKE A;  5CHU A;  5HAR A;  4Q0J A;  4S2M A;  1Z6F A;  4R3B A;  4B4Z A;  2C6W B;  4EER A;  4PM7 A;  5J8X A;  2WAD A;  2O9A A;  1E4D A;  3Q7V A;  2E8I A;  3AGD A;  4DKI A;  1K25 A;  3SS3 A;  2Y2M A;  3S22 A;  2PU4 A;  4DE1 A;  2UWX A;  3MFX A;  3ZDJ A;  2UV0 E;  4JBF A;  3WRT A;  5EFW A;  5HW3 A;  4BWI A;  4OOY A;  2OAP 1;  4L9G A;  3ZGA B;  5HAP A;  3A3F A;  5MC7 A;  4R23 A;  4R4R A;  1ERQ A;  1LT0 A;  4FH2 A;  3T4S A;  2O0Y A;  2G2W A;  5FDS A;  2ZM8 A;  2VKS A;  1MWU A;  4B9O A;  2PDR A;  4F3L B;  1GA9 A;  5A90 A;  3FKV A;  2XH9 A;  1OT6 A;  2K7S A;  2BTF P;  2W1R A;  4Y3I A;  4I39 A;  4DE0 A;  2W3G A;  3S7N A;  3UB9 A;  3MXQ A;  1SHV A;  2Y2N A;  1FSY A;  3WS4 A;  3KSI A;  4WYY A;  2Y2G A;  2JKR I;  3FZC A;  1N9N A;  3MQO A;  2QPN A;  3EGX C;  4E3O A;  1YSP A;  4ESP A;  4IVI A;  4PMA A;  5L09 A;  1PNE A;  4DRT A;  2VV8 A;  2EX9 A;  2FH5 A;  4R4S A;  1OTI A;  4ZDX A;  5IT5 A;  1VB6 A;  1TVF A;  3LI8 A;  3N6I A;  4F94 A;  4DN0 A;  1W5D A;  3CUE C;  1CK3 A;  4NXF A;  3BY8 A;  4II7 A;  4H8R A;  1BLS A;  3RJU A;  3T4O A;  3UE3 A;  2OWJ A;  1XJ3 A;  5HX9 A;  1CI8 A;  5FQK A;  1H0M A;  1HVB A;  3I7J A;  3NDG A;  3PHY A;  4ZRR A;  4FOF A;  4WF0 A;  4LV2 A;  3NBL A;  5DTT A;  2XF3 A;  2XFT A;  2QKP A;  3HLE A;  4Y0T A;  3LI9 A;  2J3T D;  4IED A;  2HP9 A;  2PYP A;  2X02 A;  4KZA A;  4UEY A;  5FA7 A;  2O9C A;  1BLC A;  1P97 A;  3CIT A;  2WK0 A;  4BD0 A;  4KZ3 A;  2Y79 A;  4UAA A;  4JKT A;  2XRO A;  5JYP A;  5FAT A;  4OOL A;  1MPL A;  1OT9 A;  4HJ4 A;  3RH8 B;  3NUL A;  5EV0 A;  3CMZ A;  3IWO A;  4O0P A;  1AWI A;  1M6K A;  3F1O B;  1KGF A;  1S1Z A;  4DE2 A;  2ZD8 A;  4RA7 A;  4YFM A;  1XX2 A;  1KGG A;  3T4K A;  2K31 A;  2ZC4 B;  3BEB A;  5EOE A;  4XT2 B;  3T1X A;  1T1A A;  1P0Z A;  1EWZ A;  5DTS A;  4RYE A;  3UE0 A;  1H8Y A;  3CHW P;  1NXY A;  4KQR A;  3E2L A;  3IHA A;  1L0G A;  4BLM A;  3HLW A;  4HIA A;  4D60 A;  3E4O A;  1TDG A;  3N8R A;  1FQG A;  2JN7 A;  2WUQ A;  4NEE D;  2IWB A;  5I5L A;  1EI5 A;  1SDN A;  1UWP X;  4K08 A;  4ZAM A;  2V9A A;  1SDE A;  3LIB A;  4MMN A;  2D02 A;  5GL9 A;  2J7V A;  5KMW A;  3CPT A;  5AJG A;  3HBR A;  4GN2 A;  5HL6 A;  4Y5F A;  2G7U A;  2EFU A;  3WRZ A;  2Y2H A;  3LY4 A;  4RX2 A;  1NWZ A;  1FIK A;  3GDI A;  4E3L A;  2XFS A;  4HHD A;  5CER A;  2R9X A;  3NC8 A;  2Z2M B;  4ZBE A;  1T18 A;  3G2Z A;  1XPB A;  2VEA A;  4HEF A;  3HCY A;  5HWT A;  5AVF A;  1BZA A;  4G3W A;  1RCJ A;  1Y28 A;  2WKI A;  2X71 A;  3T4Q A;  2NUT C;  4H6J B;  2JKG A;  3OPH A;  5FI7 A;  4IBR A;  3VP3 A;  2WZZ A;  1YLP A;  3ZG8 B;  3D4F A;  4KZ4 A;  4Q8I A;  1S67 L;  3O88 A;  1GSW A;  4U0X A;  2J3W A;  3ICY A;  3CLO A;  3S4X A;  5E2F A;  1CEG A;  1QME A;  2V20 A;  2L1M A;  4MDZ A;  2VX8 A;  3A0V A;  3EGD C;  4RQ9 A;  1K38 A;  1F98 A;  5EE8 A;  2DNS A;  1O7E A;  4BMW A;  3C4O A;  1TS8 A;  3VOZ A;  4R0Q A;  1K54 A;  1TD5 A;  1ERM A;  3UDF A;  3DWK A;  4MCW A;  1LI9 A;  3VP1 A;  3LEQ A;  3PBO A;  2Y2Q A;  4O7D A;  2B95 A;  5E2H A;  1N9O A;  3NHQ A;  3OCN A;  4L9F A;  5FI2 A;  1S66 L;  1Y4O A;  2HP6 A;  2VK3 A;  3VSL A;  4GJ4 A;  5EUA A;  2M1C A;  4M3K A;  4FTX A;  1L0D A;  2XSS A;  2FZ0 A;  2ZOI A;  5FI6 A;  3AGE A;  3ZG5 A;  3NEC A;  3H82 A;  3MXS A;  5FEF A;  3MR0 A;  1LSV A;  3T1R A;  3TJZ C;  1JTD A;  4CLC A;  5FSR A;  2WZX A;  4GHI B;  4XUZ A;  1GA0 A;  5F1G A;  1KOU A;  5BOH A;  2M7V A;  4KEN B;  2ZMF A;  3ISG A;  1VET A;  3QP2 A;  4OPY A;  4GD6 A;  4L9E A;  5U47 A;  2ZQ8 A;  3UE6 A;  1XFQ A;  1BUL A;  4KQQ A;  1BTL A;  2HV1 A;  1ZG4 A;  1NYM A;  3ZFZ A;  3IBR A;  3MZF A;  1NRF A;  4N9L A;  1ODV A;  4C6Y A;  2HJE A;  1FCO A;  5L07 A;  5HZH A;  4QHC A;  5FL3 A;  2Y2L A;  3UO9 A;  3BRM A;  2YKF A;  3F1P B;  3KSH A;  4NG2 A;  4Q0I A;  2PD7 A;  4IBX A;  1LL8 A;  1I2S A;  2JKF A;  2Y4A A;  4P85 A;  4EBP A;  4EU0 A;  2OOL A;  3TOI A;  4FH4 A;  3OOV A;  3G34 A;  3M6B A;  2HP5 A;  3MKF A;  1FCN A;  2HJ9 C;  1FCM A;  2ZBB A;  3A3J A;  4LRZ E;  3FG8 A;  3ZVT A;  3W8K A;  2WAF A;  3R7W A;  1PWG A;  4FSF A;  3BM6 A;  3MMH A;  1HZO A;  1SZV A;  3RTY A;  5FEG A;  4FCF A;  1DP8 A;  5CX7 A;  4GDB A;  2H10 A;  2Q9N A;  3SH8 A;  3P7N A;  4GCZ A;  1YLY A;  2J8Y A;  3ZNY A;  3VOY A;  2EX2 A;  1VQQ A;  2HF6 A;  1X0O A;  4JF4 A;  4WEJ A;  5HPF A;  1K56 A;  5FQM A;  2ZQC A;  4NXG A;  4S2I A;  3MFD A;  4N9K A;  5DF7 A;  3K3D A;  2OV5 A;  3P98 A;  3OPR A;  2A24 B;  4WLA A;  3WS5 A;  3ZNT A;  3P09 A;  3HL9 A;  5GLA A;  1H8M A;  2ZQA A;  3K3C A;  1IOU A;  2FFF B;  5F68 A;  2HGV A;  3V67 A;  2KOI A;  4OQH A;  3WS1 A;  1F2K A;  2Y2J A;  1N9L A;  1M40 A;  3UME A;  4LPZ A;  3S7Q A;  2ZJ9 A;  3G31 A;  2XGN A;  4GZB A;  3NIA A;  2PRF A;  3HLF A;  3LR0 A;  5TJJ A;  3IHB A;  4L0L A;  2QJ5 A;  3FWL A;  3ULF A;  1S6R A;  2HDQ A;  4NK3 A;  5FQI A;  4DXB A;  4WUJ A;  5EVI A;  2QYB A;  2WKQ A;  4WEK A;  4E3N A;  1KVL A;  2V0W A;  5HSQ A;  2PHY A;  4KUO A;  3DTM A;  3LFV A;  2HPB A;  1VHM A;  3GR2 A;  3D3O A;  4LCM A;  4OQI A;  4FD8 A;  4I5S A;  1PW8 A;  4UA6 A;  1ESU A;  3H82 B;  2NUP C;  3O5Y A;  3BW6 A;  3ZG9 B;  2J9P A;  3PR6 A;  5M1A A;  3KX0 X;  2K2N A;  4JPM A;  2PBY A;  3V3R A;  3LIF A;  2XK1 A;  4E04 A;  4QB8 A;  4IHQ A;  3PBN A;  3A3E A;  1KGE A;  4OOM A;  3PBS A;  1GHM A;  2PD8 A;  3IH9 A;  1IYO A;  1TS6 A;  1ZC2 A;  3GV9 A;  3W4O A;  4AFI A;  1LI0 A;  2P9V A;  5AQB A;  3IX8 A;  5EVL A;  1E3U A;  3CZD A;  3JVV A;  4E6X A;  5EVE A;  2WGI A;  3NI9 A;  2OLV A;  1ES2 A;  1OJ5 A;  1XJ2 A;  5F83 A;  1D7E A;  1W63 Q;  1P9W A;  4YNR A;  3FKW A;  3IXB A;  2WKH A;  3VOL A;  4KG6 A;  3PBQ A;  3T4L A;  3Q81 A;  4G3K A;  4K0W A;  4OPQ A;  3B33 A;  3MZD A;  4KZ7 A;  5GLD A;  5TFQ A;  1KE0 A;  1T1B A;  4UHU A;  2Q0O A;  4MEZ A;  4ARZ A;  3ZG0 A;  3R7W B;  3OPP A;  5AQ7 A;  4DDS A;  4BEN A;  5FAP A;  3TW8 A;  3F1N B;  3ZQ5 A;  3RFB A;  3VP0 A;  1MZU A;  2VA0 A;  1YLW A;  1W63 M;  2XD5 A;  3VFH A;  2V8C A;  5KSC A;  2XLN A;  1MKM A;  4HI4 A;  2R78 A;  2W0N A;  3IXG A;  4WM9 A;  4DMZ A;  2XRN A;  3TE8 A;  3T4T A;  1WYC A;  2H5S A;  1UGU A;  2M7U A;  4LGW A;  3UPN A;  4JGO A;  1TS7 A;  2ZM0 A;  1YLZ A;  1BT5 A;  1ES4 A;  3CUE A;  5CED A;  1SKO A;  4S2L A;  2I72 A;  4G3V A;  4HJ3 A;  4ZJ2 A;  3V50 A;  4LRX C;  2PR5 A;  4GOG A;  2KX6 A;  5DJT A;  5DKL A;  3CI6 A;  4E3K A;  4D2O A;  3W4P A;  3U2A A;  5E43 A;  3H9W A;  3QP4 A;  4DXC A;  2PAV P;  1W8Y A;  1XXM A;  2H0T A;  2ZC3 B;  1HTZ A;  3NCK A;  3BFC A;  1GSX A;  3W4Q A;  1ES5 A;  4X69 A;  3UPP A;  1O07 A;  4JXG A;  3O86 A;  3WS2 A;  2JBF A;  2KLI A;  5GHX A;  3E2K A;  5D3O A;  3T1S A;  3IF6 C;  1K57 C;  1GSV A;  1T19 A;  3PXP A;  4OON A;  1LHY A;  4Z1W A;  1C3B A;  3EQU A;  4WZ5 C;  3FYZ A;  4LCL A;  1S4R A;  4DE3 A;  3P01 A;  2WGW A;  1S4S A;  4Y2F A;  3UY6 A;  2J3T C;  3LIA A;  3Q7V B;  2R9W A;  4R6L A;  2GNX A;  3OC2 A;  3GTC A;  1AXB A;  1ZTU A;  2ZQD A;  1MXO A;  2CMN A;  2W1T A;  2OSU A;  2VGL S;  2IWD A;  3Q1F A;  3LR4 A;  3IS2 A;  4KQD A;  1RGZ A;  3HUM A;  4BD1 A;  1GCE A;  2ZC6 B;  4OKP A;  4X6T A;  1JTG A;  1T1C A;  1K55 A;  3SW1 A;  3NOP C;  4FUW A;  3B3X A;  2QMI A;  4QU3 A;  3OCL A;  4B4X A;  4GDN A;  2W27 A;  2ZC5 B;  5AVE A;  1PZO A;  3DTI A;  3G32 A;  1IEM A;  2WYX A;  3WWX A;  2V8F A;  5KZH A;  4X56 A;  2PR6 A;  1CF0 A;  3RXW A;  4ARZ B;  1KDW A;  4ZTK A;  3PYP A;  4PPR A;  1TEM A;  1IFQ A;  2QHK A;  4EES A;  3S1Y A;  3JVU A;  4IUK A;  2V2F F;  3BLS A;  1FOF A;  4KZ5 A;  3HJI A;  4N1X A;  4B88 A;  1XA1 A;  3SZT A;  4LEN A;  1HD8 A;  3BQA A;  2PU2 A;  4X53 A;  3VE4 A;  4BBT A;  2VJW A;  2OLU A;  1YKD A;  5G4Y A;  5GHZ A;  3BEC A;  3VV4 A;  5HD5 A;  5FDH A;  4UA7 A;  5G18 A;  4C75 A;  2IWC A;  4ETZ A;  2QZ6 A;  1G28 A;  2ZOH A;  5EEC A;  3TSG A;  2CC1 A;  4PM9 A;  2EWV A;  4Y17 A;  3MZE A;  1A0K A;  3B42 A;  1W79 A;  4EEP A;  1XJ6 A;  3IH8 A;  4RX3 A;  5DFX A;  3R4K A;  1UWN X;  1PI5 A;  1KE4 A;  1P9R A;  2Z6C A;  3O87 A;  1Y54 A;  2W3D A;  3UB8 A;  4O01 A;  5IS1 A;  2LB5 A;  1IKG A;  1D06 A;  3GQZ A;  3FV7 A;  5CTM A;  2PBD P;  4WBG A;  5K5B A;  3T1Q B;  1ZG6 A;  4MLL A;  4GD8 A;  5IU1 A;  4OLG A;  4S2O A;  4K91 A;  2WAE A;  4OQG A;  4JXW A;  1NJ4 A;  2JKT M;  3CAX A;  4WZ4 A;  4KZ8 A;  2HZ5 A;  4OP5 A;  3MQQ A;  3HLG A;  1I5Q A;  1L2S A;  1YSQ A;  3DWZ A;  5L10 A;  2E8J A;  2WGW B;  4QY5 A;  3BLM A;  4HQA A;  2O99 A;  3T4J A;  3PBT A;  2XR0 A;  4QWO A;  3W2Z A;  3BQ8 A;  4E3M A;  4P6Z S;  4QPR A;  2H28 A;  3CPT B;  4F3L A;  3LCE A;  2EX6 A;  4PM8 A;  4HBU A;  2VV6 A;  2W1T B;  4Y7P A;  4I3J A;  4YIN A;  3QHY A;  1PWC A;  3G4P A;  1TDL A;  5CEB A;  4PM5 A;  5J4E A;  2VZW A;  2Y2K A;  4N1H A;  1IYQ A;  4GKU A;  1ALQ A;  1YT4 A;  3IX3 A;  4MBK A;  3IXH A;  3Q07 A;  5J3W A;  4ID4 A;  3ITB A;  3GEC A;  5EVI D;  1MKI A;  2B18 A;  4X55 A;  5TBM A;  2O9B A;  4P0M A;  5HAQ A;  5AQ9 A;  3N8S A;  3L7H A;  2V1A A;  1YPR A;  1MWT A;  4PKY G;  1YAX A;  2OAQ 1;  5DKK A;  1OJG A;  1XGJ A;  3WS0 A;  3C30 A;  3BFF A;  4Y0U A;  1N4O A;  2B5R A;  4X1M A;  2DRW A;  5CGX A;  4S2N C;  1ERO A;  4NXE A;  4PHT A;  1J9M A;  1JWV A;  3E4Q A;  2Y2I A;  2P7J A;  5HFO A;  4LLO B;  1FR1 A;  1WYB A;  5LBR A;  5CHM A;  4A5R A;  3PAE A;  1DP6 A;  1ZHH B;  3HVF A;  4IVK A;  2EA9 A;  2LB9 A;  1Q2Q A;  3QP8 A;  1OTD A;  4KQO A;  4OH0 A;  4GLQ A;  1YMS A;  3LEZ A;  3T50 A;  1G5U A;  2J80 A;  3QNC A;  2ZMV A;  4O8G A;  1E3U D;  3MS6 A;  2GX5 A;  1BSG A;  3EOI A;  1K4F A;  4QJG A;  1Z09 A;  4NET A;  3BJN A;  3A0S A;  1LLB A;  3T12 B;  1LL9 A;  1OTA A;  3VSK A;  1NLY A;  3SS4 A;  3IQA A;  3QP5 A;  1MWS A;  3LYX A;  3UB6 A;  3C2W A;  1PFL A;  2RCX A;  4LFU A;  4B93 A;  5HDS A;  2DCF A;  5EPH A;  2BAS A;  4S2J A;  2XQZ A;  2VV7 A;  3LGO A;  4R70 A;  4UA9 A;  1YLJ A;  4CLC B;  4LRY C;  3ZYT A;  4M4X A;  4BQM A;  4XT2 A;  3NJA A;  4JLF A;  2W3F A;  2ZLY A;  4MN5 A;  3IBJ A;  1K6R A;  3V5M A;  3M2K A;  3NY4 A;  4BBU A;  1VET B;  2A3U A;  1FIL A;  2JHE A;  3N8L A;  4ZJ1 A;  2EXA A;  1Q2P A;  3VP2 A;  5M19 A;  3BFG A;  2DMW A;  3UB7 A;  4S2K A;  4JXV A;  3GRJ A;  4JXS A;  1OPX A;  2GJ3 A;  3PAG A;  2ZL1 A;  4R3A A;  1OME A;  4X25 A;  3BY9 A;  1PRQ A;  4CJN A;  4WMC A;  1KE3 A;  3UE1 A;  2ZM2 A;  3UB5 P;  4EWF A;  5CXW A;  3OPL A;  1JVJ A;  4JF6 A;  2GZA A;  4Z9Q A;  1DY6 A;  4EQ1 A;  3LIE A;  4E6W A;  5L8M A;  4U3T A;  3LUQ A;  2PYR A;  1NZO A;  3CJM A;  2HDS A;  4HH3 A;  1LSX A;  3HUN A;  4MBF A;  4DJ2 A;  4E3I A;  1CJF A;  2P74 A;  4H6J A;  3GMW A;  2EWW A;  2A2L A;  4LV1 A;  1IKI A;  3G2Y A;  4WEL A;  2XDM A;  4EUV A;  1PW1 A;  5F69 A;  3JYI A;  5HPI A;  5A92 A;  3EQV A;  1SCW A;  4CLC E;  1K6S A;  1PZP A;  1S0W A;  3C7V A;  1XP4 A;  3N7W A;  1PIO A;  4P87 A;  1PI4 A;  5TBM B;  4HBT A;  4KZ9 A;  5FAS A;  2Y55 A;  3KSF A;  4DJ3 A;  1NLZ A;  5J7E A;  2HDR A;  3NOT C;  1S1Y A;  3EEH A;  3M2J A;  2YKH A;  3BWL A;  1ES3 A;  1MBL A;  1CEF A;  1LSW A;  1PYY A;  1PWD A;  4OP8 A;  3Q7Z A;  4YOF A;  4PM6 A;  2Y91 A;  2Q9M A;  5CGW A;  4P6B A;  1XKZ A;  1KVM A;  2Y2P A;  3D72 A;  2Y59 A;  4OQ0 A;  5EM1 A;  2EFX A;  2IA2 A;  4X68 A;  3MF0 A;  1DJB A;  4HNB A;  2W3H A;  5A8B A;  4Y13 A;  1WA9 A;  2L4R A;  1GHP A;  5FQJ A;  3LR5 A;  3GVB A;  2QJ7 A;  2I9V A;  5I94 A;  3TRC A;  3GSG A;  1CQA A;  1RP5 A;  3UNW A;  1W7F A;  5EVI B;  1LL5 A;  1VEU A;  4RVA A;  1JNU A;  4GHI A;  4KUK A;  4HH2 A;  2VGK A;  3NOU C;  4EUZ A;  1XFN A;  3LR3 A;  5GLC A;  5A91 A;  2JKR M;  5A93 A;  2Y8H A;  1MY8 A;  1XA7 A;  1BLP A;  4KG2 A;  1ONH A;  5CHJ A;  5DTK A;  5GLB A;  2JC7 A;  1IYS A;  4KZB A;  1STZ A;  4MN7 A;  4HJ6 A;  3G6O A;  3G35 A;  4BBV A;  3ZCZ A;  2XEP A;  4GW9 A;  1DRM A;  4MNR A;  3SH9 A;  1U60 A;  3QNB A;  3RXX A;  3F1P A;  1ONG A;  3IF6 A;  1K57 A;  4UQI S;  4UQI M;  5GHY A;  2Z2L B;  1F9I A;  1DJC A;  2P9V B;  4WZ5 A;  4Y0O A;  2X01 A;  2VGL M;  4EW7 A;  1TF1 A;  2B02 A;  4XXR A;  1BLH A;  4ETX A;  1ESI A;  5CGS A;  1JWP A;  2ZL1 B;  2RL3 A;  2VGJ A;  3MSH A;  1EW0 A;  5DVA A;  5DF8 A;  1L0F A;  3S7O A;  2OWH A;  1K55 C;  5G4Z A;  3D9Y A;  1BYW A;  2D01 A;  4R3J A;  2H0Y A;  5E2E A;  5M18 A;  5HDD A;  3N4I A;  4EV4 A;  1N9B A;  3C4P A;  5DF9 A;  4NKP A;  1XGI A;  3IF5 A;  3KYZ A;  1FR6 A;  4WL9 A;  3JPU A;  4C3Q A;  1YQS A;  3G30 A;  2V1B A;  4S2P A;  3SOI A;  3Q82 A;  4HP9 A;  2A24 A;  5HAI A;  3VMA A;  5HWW A;  4IUH A;  3DBA A;  3C8C A;  4DDY A;  4OVD A;  4CLC D;  3E4P A;  3FPV A;  4E3J A;  3BFD A;  5HWV A;  4LV3 A;  1G6A A;  4JGR A;  3UMD A;  4DF6 A;  1K54 C;  1K0K A;  3VE3 A;  5CRF A;  1VM1 A;  1E25 A;  5KSH A;  4EBN A;  3UPO A;  4NXB A;  2VLG A;  5JYO A;  3UN7 A;  4HY8 A;  3E98 A;  3ITA A;  4I3A A;  2QWS A;  1F5M A;  1NZU A;  3HJK A;  2A49 A;  4HOI A;  2JKT I;  4GS9 A;  3A0R A;  3IWQ A;  3EEA A;  4HES A;  3DTK A;  3O3V A;  1JWZ A;  3KYQ A;  2V1Z A;  2ZQ9 A;  3BFE A;  5FQQ A;  5C5K A;  5F1F A;  1FSW A;  2HDU A;  4EET B;  3VP4 A;  2WKR A;  4JGP A;  5F5Y A;  1SKO B;  4CLC C;  4PAU A;  1D1J A;  1BUE A;  4EBL A;  5FQ9 A;  3A3I A;  3FC7 A;  3S7P A;  2ZMA A;  5KIZ A;  2Z6D A;  2ACG A;  3H7W A;  3HLC A;  4X1L A;  1H3Q A;  4JF5 A;  1DJA A;  5EOO A;  3QP6 A;  5F82 A;  3IXD A;  1XJ4 A;  1H5X A;  1L0E A;  3MJQ A;  4JGQ A;  4PKY A;  1VEU B;  5HDC A;  5L2F A;  2G2U A;  1SKF A;  1NYY A;  3HRE A;  2KDK A;  4BL3 A;  2FFY A;  3HLB A;  2PT7 A;  3BYD A;  1K56 D;  3PTE A;  4R1G A;  1YLT A;  3DW0 A;  2GDN A;  2BLS A;  3PBR A;  5AQA A;  3VFF A;  3TG9 A;  2P04 A;  2WKP A;  3MBZ A;  3LO7 A;  3UDI A;  2XD1 A;  1J3W A;  4Q0H A;  4QD4 A;  1TS0 A;  4R38 A;  2W3E A;  4EEU A;  3EWK A;  4HP4 A;  3FPW A;  1ACF A;  1W8Q A;  4U0T A;  4Y15 A;  4EQI A;  3IX4 A;  3ZVW A;  3C38 A;  4QY6 A;  3V39 A;  3SS5 A;  4GB7 A;  1MC0 A;  3CWF A;  3IF6 B;  4P6Z M;  1MWR A;  4BJP A;  3KSG A;  1IYP A;  4YWZ A;  1V9Z A;  2ZQ7 A;  2J9O A;  2P08 A;  4GNU A;  1QMF A;  3A3D A;  3IS2 B;  2AVX A;  4ME4 A;  2JE5 A;  2INW A;  3MXR A;  1G68 A;  5FAQ A;  1CI9 A;  3ZG7 B;  3SH7 A;  1H8Z A;  4OLD A;  3ZHH A;  1I2W A;  3KYE A;  5HL1 A;  1NRJ A;  2JCH A;  3E0Y A;  3F1N A;  3KO6 A;  4WN5 A;  3L9K A;  5DFY A;  4N92 A;  3V3S A;  5TR7 A;  3DTE A;  3OLO A;  2MJ6 A;  5F6A A;  1HLU P;  1OTB A;  3C5A A;  4I38 A;  3QP1 A;  3CG5 A;  1YMX A;  3UDX A;  5E2G A;  4BL2 A;  3HLD A;  3OBF A;  3B47 A;  4IJG A;  3DAV A;  4CPK A;  4OPR A;  1RGY A;  1L3L A;  2EX8 A;  4S2N A; 
#chains in the Genus database with same CATH homology
 4I3I A;  4CLC A;  4R6L A;  1OTE A;  2GNX A;  3OC2 A;  4GHI B;  4WEL A;  4EUV A;  1KOU A;  5F69 A;  4MN6 A;  2M7V A;  1ZTU A;  5HPI A;  2ZMF A;  2CMN A;  2XA7 S;  2W1T A;  2VGL S;  3EQV A;  4CLC E;  2XA7 M;  4L9E A;  3LR4 A;  3IS2 A;  5TBM B;  4GS9 B;  4EXO A;  4KQD A;  3UE6 A;  1XFQ A;  3KSF A;  4DJ3 A;  2HV1 A;  2L0W A;  3IBR A;  1NLZ A;  5J7E A;  1ODV A;  3LIC A;  2HJE A;  3NOT C;  1S1Y A;  3EEH A;  1T1C A;  2YKH A;  3BWL A;  1LSW A;  5HZH A;  3SW1 A;  1V9Y A;  5FL3 A;  3F1O A;  3NOP C;  2V0U A;  4YOF A;  2YKF A;  3OCL A;  3F1P B;  3KSH A;  2W27 A;  4Q0I A;  5DJU A;  5HD3 A;  2PD7 A;  5AVE A;  1DP9 A;  4CQH A;  1LL8 A;  3MQ0 A;  3D72 A;  3K2N A;  1G6O A;  2IA2 A;  4EU0 A;  3H7W B;  2OOL A;  3LID A;  3MF0 A;  3OOV A;  4HNB A;  2PR6 A;  2W3H A;  4ARZ B;  5A8B A;  1WA9 A;  2L4R A;  4Q0J A;  2HJ9 C;  3PYP A;  3LR5 A;  2ZBB A;  2QJ7 A;  1IFQ A;  2QHK A;  4LRZ E;  4EES A;  2I9V A;  4EER A;  3JVU A;  4IUK A;  3FG8 A;  3TRC A;  2O9A A;  3R7W A;  3HJI A;  4FSF A;  3MMH A;  1JNU A;  4GHI A;  3RTY A;  4KUK A;  4HH2 A;  1DP8 A;  5CX7 A;  3NOU C;  1XFN A;  3LR3 A;  3MFX A;  3P7N A;  4GCZ A;  3BQA A;  2JKR M;  3VE4 A;  4BBT A;  2VJW A;  2HF6 A;  1X0O A;  2Y8H A;  4WEJ A;  1YKD A;  5HPF A;  5EFW A;  5G4Y A;  4NXG A;  3VV4 A;  5HD5 A;  3K3D A;  4BWI A;  2OAP 1;  4L9G A;  4ETZ A;  2A24 B;  4WLA A;  5MC7 A;  1STZ A;  4MN7 A;  1G28 A;  2ZOH A;  1LT0 A;  3T4S A;  2O0Y A;  4HJ6 A;  3G6O A;  2EWV A;  2VKS A;  4B9O A;  2PDR A;  4BBV A;  1H8M A;  3K3C A;  4F3L B;  4GW9 A;  1IOU A;  1DRM A;  5F68 A;  2HGV A;  3B42 A;  4EEP A;  1OT6 A;  2K7S A;  3V67 A;  1XJ6 A;  2KOI A;  2W1R A;  3F1P A;  4Y3I A;  4I39 A;  2W3G A;  3S7N A;  3UB9 A;  1N9L A;  4UQI S;  3MXQ A;  3UME A;  5DFX A;  4UQI M;  3R4K A;  1UWN X;  4LPZ A;  3S7Q A;  3KSI A;  1P9R A;  2Z6C A;  1F9I A;  2JKR I;  2W3D A;  3LR0 A;  2VGL M;  3UB8 A;  4EW7 A;  5TJJ A;  1TF1 A;  4L0L A;  2B02 A;  1N9N A;  2QJ5 A;  4O01 A;  3MQO A;  3EGX C;  3ULF A;  1YSP A;  4ETX A;  5IS1 A;  2LB5 A;  1D06 A;  2VV8 A;  2FH5 A;  4WUJ A;  1EW0 A;  2QYB A;  3S7O A;  5K5B A;  2OWH A;  1OTI A;  2WKQ A;  4WEK A;  5IU1 A;  5G4Z A;  5IT5 A;  1VB6 A;  1BYW A;  2V0W A;  5HSQ A;  2D01 A;  3LI8 A;  2PHY A;  4KUO A;  5HDD A;  3LFV A;  1VHM A;  4DN0 A;  2JKT M;  3CUE C;  3CAX A;  4NXF A;  3D3O A;  5DF9 A;  4I5S A;  4NKP A;  3BY8 A;  4II7 A;  3KYZ A;  4WL9 A;  3MQQ A;  3T4O A;  3H82 B;  3UE3 A;  2OWJ A;  2NUP C;  3O5Y A;  1YSQ A;  1XJ3 A;  2V1B A;  3BW6 A;  4HP9 A;  5HWW A;  2A24 A;  3PR6 A;  4IUH A;  3DBA A;  3C8C A;  4HQA A;  2O99 A;  3T4J A;  3PBT A;  3KX0 X;  4CLC D;  3W2Z A;  2K2N A;  3BQ8 A;  3E4P A;  3FPV A;  4P6Z S;  4QPR A;  2H28 A;  5HWV A;  4F3L A;  3PHY A;  3LIF A;  4ZRR A;  4FOF A;  4WF0 A;  4JGR A;  3UMD A;  3VE3 A;  2VV6 A;  2W1T B;  4E04 A;  2QKP A;  4I3J A;  4IHQ A;  3PBN A;  4OOM A;  3PBS A;  5KSH A;  3LI9 A;  2PD8 A;  2J3T D;  5J4E A;  1TS6 A;  2PYP A;  2VZW A;  4NXB A;  2VLG A;  4AFI A;  4UEY A;  2O9C A;  4HY8 A;  1P97 A;  3E98 A;  3CIT A;  5J3W A;  4I3A A;  2QWS A;  1F5M A;  2Y79 A;  3GEC A;  3JVV A;  3HJK A;  2B18 A;  2XRO A;  4HOI A;  5TBM A;  2O9B A;  2JKT I;  4GS9 A;  3A0R A;  4OOL A;  1OJ5 A;  1OT9 A;  4HJ4 A;  2V1A A;  1XJ2 A;  3RH8 B;  3EEA A;  4O0P A;  4PKY G;  1YAX A;  2OAQ 1;  3F1O B;  5DKK A;  3KYQ A;  1S1Z A;  1OJG A;  3C30 A;  1D7E A;  1W63 Q;  3T4K A;  2K31 A;  5C5K A;  4XT2 B;  1T1A A;  1P0Z A;  1P9W A;  4YNR A;  4EET B;  2WKR A;  4JGP A;  5F5Y A;  3VOL A;  4NXE A;  4PHT A;  4CLC C;  4PAU A;  3PBQ A;  3T4L A;  3E4Q A;  4G3K A;  2P7J A;  3B33 A;  4LLO B;  3FC7 A;  4HIA A;  5LBR A;  3S7P A;  5KIZ A;  2Z6D A;  3E4O A;  1DP6 A;  3H7W A;  2JN7 A;  1T1B A;  4NEE D;  1H3Q A;  1ZHH B;  5I5L A;  4K08 A;  1UWP X;  4ARZ A;  3R7W B;  1XJ4 A;  2EA9 A;  2V9A A;  2LB9 A;  3LIB A;  3MJQ A;  4JGQ A;  4MMN A;  4PKY A;  1OTD A;  2D02 A;  5HDC A;  4KQO A;  4GLQ A;  5AJG A;  3TW8 A;  2KDK A;  5HL6 A;  3T50 A;  3F1N B;  2J80 A;  3ZQ5 A;  2ZMV A;  4O8G A;  4Y5F A;  2PT7 A;  2G7U A;  3RFB A;  2GX5 A;  3EOI A;  1MZU A;  2VA0 A;  1W63 M;  1NWZ A;  3GDI A;  3PBR A;  4HHD A;  3BJN A;  1MKM A;  3A0S A;  4HI4 A;  2R78 A;  2W0N A;  1T18 A;  4DMZ A;  2VEA A;  2P04 A;  1OTA A;  2XRN A;  2WKP A;  3HCY A;  1NLY A;  5HWT A;  5AVF A;  4G3W A;  3LYX A;  4Q0H A;  3TE8 A;  3T4T A;  1TS0 A;  4R38 A;  3UB6 A;  3C2W A;  2W3E A;  1Y28 A;  4EEU A;  3EWK A;  4B93 A;  4HP4 A;  1UGU A;  2M7U A;  5HDS A;  3FPW A;  4JGO A;  1TS7 A;  2BAS A;  3T4Q A;  2VV7 A;  2NUT C;  4H6J B;  4R70 A;  4CLC B;  3C38 A;  4LRY C;  3ZYT A;  4M4X A;  1MC0 A;  3CWF A;  4P6Z M;  4XT2 A;  4BJP A;  3NJA A;  3CUE A;  2W3F A;  3KSG A;  4YWZ A;  1S67 L;  4MN5 A;  1GSW A;  2J3W A;  3IBJ A;  1V9Z A;  3ICY A;  4BBU A;  4G3V A;  2JHE A;  3CLO A;  2P08 A;  4HJ3 A;  3IS2 B;  2L1M A;  4ME4 A;  4MDZ A;  2VX8 A;  3A0V A;  2INW A;  3EGD C;  4LRX C;  4RQ9 A;  2PR5 A;  2DMW A;  2KX6 A;  5DJT A;  5DKL A;  3CI6 A;  1F98 A;  3UB7 A;  3U2A A;  4BMW A;  3H9W A;  1TS8 A;  1TD5 A;  1OPX A;  2GJ3 A;  4MCW A;  4R3A A;  1GSX A;  1NRJ A;  3E0Y A;  3F1N A;  3PBO A;  3KO6 A;  4WN5 A;  3BY9 A;  1N9O A;  5DFY A;  3NHQ A;  3OCN A;  4L9F A;  3OLO A;  1S66 L;  2MJ6 A;  5F6A A;  4GJ4 A;  1OTB A;  2M1C A;  2KLI A;  2GZA A;  4I38 A;  4EQ1 A;  3LIE A;  2XSS A;  2FZ0 A;  2ZOI A;  1GSV A;  1T19 A;  3PXP A;  5L8M A;  4Z1W A;  3EQU A;  3LUQ A;  2PYR A;  3OBF A;  3B47 A;  4IJG A;  3H82 A;  4HH3 A;  1LSX A;  1S4R A;  4DJ2 A;  3P01 A;  3MR0 A;  1S4S A;  4Y2F A;  4H6J A;  2J3T C;  1LSV A;  2EWW A;  2A2L A;  3TJZ C;  3LIA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...