3T1RA

Mglb with tetrameric arrangement
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
133
structure length
133
Chain Sequence
LVLYGAPYERAVEVLEETLRETGARYALLIDRKGFVLAHKEALWAPKPPPLDTLATLVASNAAATQALAKLLGEARFQEEVHQGERMGLYVDEAGEHALLVLVFDETAPLGKVKLHGKRAAEALARIAEEALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Gliding protein MglB
publication title Structural analysis of the Ras-like G protein MglA and its cognate GAP MglB and implications for bacterial polarity.
pubmed doi rcsb
source organism Thermus thermophilus
total genus 36
structure length 133
sequence length 133
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03259 Robl_LC7 Roadblock/LC7 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 3t1rA00
3MSHA 2PBDP 1D1JA 5EM0A 1G5UA 5EVEA 3T1SA 3T12B 3T1QB 3L9KA 1Y4OA 2ACGA 1VETB 3DAVA 1CQAA 4FTXA 3CPTB 3D9YA 2BTFP 1J3WA 1K0KA 2ZL1B 3U4LP 4X25A 1CJFA 5EV0A 1F2KA 1SZVA 5EM1A 3MS6A 2E8JA 5FDSA 3NECA 1FILA 4X1LA 1PNEA 3CHWP 1Z09A 2B95A 1VEUA 3T1XA 4FUWA 2PRFA 2HZ5A 1HLUP 1PRQA 2VK3A 3LGOA 1PFLA 2PAVP 1FIKA 3LEQA 3T1RA 1SKOA 2JKGA 3KYEA 2V8CA 4QWOA 4X1MA 1VEUB 5FEGA 3NULA 1YPRA 1ACFA 4ESPA 1VETA 4D60A 3L7HA 2V8FA 1CF0A 1AWIA 3CPTA 1A0KA 3UB5P 2ZL1A 2JKFA 1SKOB 5FEFA
chains in the Genus database with same CATH superfamily
2PBDP 1N4OA 3CG5A 2JBFA 4LLOB 1IYOA 3HLEA 1FR6A 4JGRA 3GQZA 4UHUA 1K6RA 4JXVA 3Q82A 3UB8A 3BJNA 3E2KA 1XP4A 3S1YA 1G6OA 4S2OA 3D9YA 1U60A 3UE3A 1K0KA 5EOEA 4LV0A 3SH9A 3MKEA 1MKMA 1ERQA 1IELA 5AVFA 2OLUA 2ZBBA 4JXWA 1NRFA 2E8JA 3UPOA 3BW6A 2WK0A 2I9VA 3M6HA 5GL9A 1M6KA 2XSSA 1KDWA 1OT6A 2Y2LA 4DDYA 4DMZA 4JPMA 2INWA 5HARA 3S22A 3UPNA 2PRFA 4HJ4A 3NHQA 5KMWA 5F1GA 4QHCA 2KDKA 4H6JB 2PYPA 3T50A 1XX2A 1W63M 3HL9A 2X02A 3R4KA 3LEZA 4WEKA 3IS2B 5HAPA 2A24B 1Q2QA 1G6AA 4X1MA 2WUQA 3B42A 2J3WA 3PR6A 1O07A 5E2EA 5AQAA 4EEPA 2WKQA 5JYOA 3JVVA 1XJ6A 4OONA 4YINA 2EXAA 4RQ9A 1W8QA 5AVEA 5IU1A 2WYXA 1A0KA 4GZBA 1IEMA 3SOIA 4R23A 2JKFA 2XDMA 2H0YA 5EE8A 3C8CA 3Q7VB 2XLNA 3IXHA 2J9OA 1XJ4A 2UWXA 4S2IA 1I2WA 3VP2A 3T1SA 5IS1A 2WKIA 1IFQA 1X0OA 3MR0A 4BLMA 4EW7A 5FASA 2ZQ7A 3K3DA 1E3UD 2LB9A 3IX3A 2A2LA 1EWZA 3IT9A 2W3FA 4OOYA 5EV0A 2DCFA 3OOVA 3W4QA 5HW3A 5FDSA 4PM7A 2ZOIA 1FQGA 5J3WA 3OBFA 4BBVA 4LPZA 2V1BA 3VP4A 3TOIA 2B02A 1SHVA 4OPQA 4OOLA 4GDBA 1FSWA 3IXGA 1YMSA 1CI8A 1OTDA 3MQOA 1T18A 3ISGA 1SKOA 5HDDA 4OLGA 3KYEA 4OVDA 5EFWA 1TS6A 3E98A 4HOIA 3H82A 3M6BA 3NIAA 3MJQA 1UWNX 1F9IA 2J3TD 2EFUA 5HDSA 3UN7A 1FSYA 1XFQA 4ARZB 4D60A 4A5RA 2V8FA 2GZAA 4II7A 4FH4A 5CTNA 3FKVA 2Y2GA 4S2JA 4K0WA 4S2NA 4LRYC 4E3KA 2Y4AA 2JN7A 4O8GA 2EX8A 5HD3A 3TRCA 5HL1A 3T4TA 2VKSA 4UEYA 4OKPA 1LSWA 4DXBA 1ZC2A 2Y2KA 3LIAA 2BASA 1F5MA 4IBRA 1PW8A 3F1NA 4EESA 3KSIA 4HHDA 1KGGA 3CUEC 3C7VA 4EV4A 4FOFA 2ZL1B 3Q07A 3KSFA 1YAXA 2VGLS 3N8LA 3W2ZA 5DJUA 3NECA 4X6TA 4GCZA 2J8YA 4EU0A 5EVIC 2CC1A 2VV8A 4HY8A 2V20A 5HX9A 5FA7A 3TJZC 5DF7A 1JNUA 1NLYA 4HBTA 4GJ4A 3UDFA 3SS3A 3BYDA 2NUTC 2CMNA 4OQ0A 4JGQA 5CRFA 4CLCC 4FD8A 4QD4A 4KENB 2A24A 4WF0A 1TDLA 4QWOA 5A92A 4BQMA 4Q8IA 4MDZA 1VB6A 3N7WA 4EWFA 5CX7A 4B93A 3GR2A 2ZMAA 4LENA 3VOYA 5DF9A 3L7HA 4WN5A 1JWZA 4B9OA 2G2WA 2AVXA 5F83A 3EEHA 3CPTA 3D4FA 4UA9A 1EROA 2VGLM 3C7UA 2WKHA 3HLFA 3ZGAB 2HJEA 3MSHA 3HUNA 1OTAA 1G28A 4ZTKA 4QU3A 2P74A 3CITA 3MBZA 4KQRA 1STZA 4X68A 3JVUA 3CWFA 4Q0JA 1VETB 2PHYA 2MJ6A 4MBKA 4BENA 3MZFA 4ZDXA 1AXBA 5TBMB 4IEDA 5M19A 2W1TA 5F82A 5E2GA 2V0WA 3RH8B 1S1ZA 4WEJA 1K25A 1PNEA 3CHWP 1ESIA 2HDUA 1Z09A 3O3VA 1VEUA 4N9LA 5G4ZA 3ZDJA 3MFDA 4JF5A 4QJGA 2PU2A 1YQSA 3UMEA 3HLBA 3WS1A 4O7DA 2ZM0A 2R9XA 1MY8A 1YLWA 5CGSA 4JF4A 4EBLA 5FQJA 3RTYA 3VE4A 2JE5A 1Z6FA 2HGVA 2ZC3B 2JKGA 4DKIA 1XJ2A 4P0MA 1GA0A 1ES3A 1QMEA 2UV0E 1XA1A 3LFVA 3PBQA 3EEAA 3WWXA 3MQ0A 4KZ9A 1LT0A 3IF6A 3PTEA 1H0MA 1CF0A 3BLMA 5MC7A 2JKRM 1PIOA 3N6IA 4YFMA 3HLWA 4ZRRA 1K6SA 3MFXA 5LBRA 3V3SA 1O7EA 1PWCA 1D1JA 5HAIA 1K4FA 4E3IA 3MF0A 4BJPA 4PHTA 1NLZA 5CXWA 3QP1A 1KVMA 4P87A 4D2OA 2O9CA 3HLDA 1KGEA 3F1PA 3U4LP 4GHIB 4WZ4A 3DBAA 1CJFA 1L0EA 3UDXA 5CEBA 4PMAA 1Y54A 1F98A 3LR0A 4MN5A 2WGIA 4IUKA 3T1XA 4Y5FA 3KSHA 3ICYA 5F1FA 4HI4A 2EX2A 4ZAMA 3IBJA 3ZG9B 4S2NC 1ODVA 5J7EA 3CZDA 2HP6A 1BSGA 2OV5A 3MKFA 4HQAA 1YLYA 3IXDA 2PT7A 1YPRA 4ZJ3A 3KX0X 1KGFA 3NDEA 4FCFA 1UWPX 5EVLA 3ZNTA 1MPLA 5DKKA 1LHYA 5TR7A 3DTIA 2WKEA 2XGNA 3DWZA 3LI9A 2ZM8A 5EVIA 1SKOB 2IA2A 1PZOA 3GVBA 5CTMA 5KSHA 1CI9A 3H82B 1LL9A 4JGOA 3ZG7B 4OQGA 3G4PA 1OT9A 2ACGA 3F1OA 3JPUA 4Z1WA 3DTEA 4CLCA 3VP0A 2QWSA 2L0WA 3P7NA 4GLQA 1YMXA 1NZOA 1YSQA 4NK3A 3EQVA 2Y2PA 2KX6A 3IH8A 1OTIA 3TW8A 4R4SA 3PBRA 4EEUA 4HH3A 4NXFA 4KG2A 3EGXC 2K7SA 3RJUA 3G6OA 5A91A 1P0ZA 3F1NB 3P09A 1D06A 2QYBA 4QPRA 3N8RA 3WRTA 4WLAA 4HP9A 1XGIA 2LB5A 1MWUA 1DP6A 1SCWA 4P6ZS 2W3EA 3BLSA 3LY3A 1TS7A 3MMHA 1S67L 1C3BA 4GW9A 1I2SA 3QP5A 4NXBA 3LY4A 5IHVA 1YLJA 2IWBA 4EUZA 1MBLA 3A0RA 5DTKA 3OCNA 4LV2A 1IYSA 3SZTA 3FPVA 1L0GA 3NY4A 1Q2PA 4F94A 2X71A 3Q81A 4Q0IA 4E6XA 1AWIA 3LI8A 4BBTA 3MZEA 3UB5P 5FSRA 1L2SA 5KSCA 3LICA 4MLLA 4MEZA 4HIAA 2P9VA 3OPHA 1G5UA 5EVEA 3HUOA 4QY6A 3FG8A 4GS9A 2XROA 3ZQ5A 4HJ3A 4G3WA 1GHIA 3CPTB 5EPHA 4PM6A 4GHIA 1TS0A 2XK1A 3T4JA 4X25A 5CHMA 2HJ9C 2KLIA 2OAP1 4KQQA 4P6ZM 2J9PA 2L4RA 2M7VA 1K57A 1L0FA 4EXOA 2HDSA 1LSVA 3IWOA 3ZFZA 3Q7ZA 3HUMA 3VE3A 1YLZA 1FOFA 1HVBA 1ES2A 3IBRA 2OWJA 3AGFA 2BG1A 3C30A 3LGOA 5DFXA 3GSGA 1T19A 3IF6C 2W1TB 1RGYA 4Z9QA 4MBHA 2EX9A 3GDIA 3DW0A 4N1HA 4KZ5A 3IF5A 1NYYA 3PBSA 3RFBA 4WUJA 2J80A 5L07A 3V50A 3HLGA 3UB9A 4QB8A 2XFTA 4BMWA 1VEUB 3H7WA 2D02A 4GKUA 3H9WA 1EI5A 3E4QA 4B4ZA 3BY8A 4EETB 4GB7A 1UGUA 3WS5A 4DF6A 1P97A 4YWZA 2EX6A 1JVJA 2Y2HA 3SS5A 1TF1A 2E8IA 4GD8A 3DTKA 4OH0A 1ESUA 2QMIA 3E4OA 5M1AA 5A90A 4WMCA 4UA6A 5A8BA 3QP8A 4E3JA 1WE4A 5A93A 3IF6B 3LR4A 2G2UA 3PAEA 5FI7A 3A0SA 5AJGA 1J3WA 1H8MA 1JTGA 3VSKA 2OWHA 2W0NA 1TS8A 4OP8A 3IQAA 3UO9A 2QHKA 3IX8A 4C6YA 1YKDA 1E4DA 2RCXA 4NG2A 5HL6A 2Q9NA 4GNUA 2ZLYA 4HJ6A 2GJ3A 4S2MA 4JXSA 3ZHHA 4MBFA 3BY9A 2VK3A 4Y13A 5EVID 3BFEA 4EQ1A 3S7NA 2GX5A 3F1PB 2XFSA 4JF6A 5HFOA 4AFIA 2A3UA 5L09A 4JXGA 2JCHA 1NJ4A 3UB7A 4EQIA 3ITAA 2K2NA 3HBRA 3HJKA 4UAAA 3K2NA 5HSQA 4JBFA 4WELA 1H3QA 4CLCD 5BOHA 4K91A 3UB6A 1SDEA 5EECA 1W5DA 2VJWA 3QP4A 2Y2IA 2HDRA 1XKZA 4OOMA 4PPRA 2WAEA 1MWRA 3NJAA 3UMDA 3ZG8B 2ZQCA 3ZG5A 5HWVA 3IX4A 1WA9A 2FFFB 1NY0A 4HEFA 1PI4A 4R3JA 2YKHA 1VM1A 3VV4A 2WZZA 2ZC5B 2Y91A 3E4PA 1KDSA 1KE4A 3GV9A 4DJ3A 2Y2NA 2BTFP 2H0TA 2XA7S 1BYWA 5EVIB 4L0LA 2Z2LB 2VEAA 1RGZA 2EXBA 1BLPA 1NWZA 2QJ7A 4OPZA 3EWKA 1TVFA 3UDIA 4Y3IA 4NKPA 4I39A 1YT4A 5FATA 4OPRA 3A0VA 1YSPA 3UE0A 3LO7A 3F1OB 1XA7A 4KZ8A 4OPYA 2J7VA 4KZ3A 4CLCB 3DWKA 1HLUP 1P9WA 2XH9A 3RXWA 3T4SA 3HCYA 3OPPA 1K56A 1GSXA 2G7UA 1MXOA 3PHYA 4WBGA 5FQ9A 4DE3A 1NYMA 1ZTUA 2VGJA 2XD1A 3B3XA 1FIKA 4NETA 3LR5A 1K55A 2ZM2A 5GLBA 3BQ8A 2H5SA 3NOTC 3UE1A 1XFNA 2JC7A 3UNWA 2M1CA 4M4XA 3ZG0A 2FZ0A 3O5YA 4WZ5C 3PBNA 1WYCA 3CLOA 3S7QA 4S2KA 3LYXA 1FCNA 4X55A 1Y28A 5GHXA 3IXBA 4WYYA 3W4OA 5AQ7A 3MXQA 2XA7M 1P9RA 4IJGA 1RP5A 4RYEA 1MC0A 4OQIA 1MZUA 4HH2A 1BLHA 1MWSA 2OLVA 1PWGA 3S7OA 1S6RA 4R6LA 1K57C 1FR1A 3T12B 4S2PA 4Y15A 1ZG6A 4QY5A 4CLCE 1K4EA 2JKTM 5KIZA 4ZBEA 4O0PA 5CGXA 4PM8A 1BTLA 4GDNA 4KZ6A 3FWLA 2PBYA 3FC7A 3CMZA 4ID4A 4XUXA 1OTBA 1S1YA 2XQZA 1BUEA 1ONGA 3BECA 2P9VB 3ULFA 1H8ZA 4X1LA 2B95A 5E2FA 4GS9B 4PM5A 4DRTA 1HZOA 3IWQA 1OMEA 1T1CA 2QJ5A 2H10A 2JHEA 1N9BA 4BD1A 2L1MA 4P6BA 4L9EA 4WM9A 4DE2A 3LR3A 2QPNA 1KOUA 4N92A 1IOUA 2XD5A 4Y0UA 5FDHA 3KYQA 4CPKA 4MN6A 3NULA 4CQHA 3LIEA 3V67A 4PM9A 3UE6A 1PWDA 3HJIA 5GHYA 3R7WA 2IWDA 2QZ6A 4I5SA 4E3OA 2VV7A 3BFFA 4DE1A 3MXSA 4FH2A 2ZMFA 4NXEA 4IBXA 4X53A 1ES4A 5HWWA 2FFYA 5M18A 2P04A 3CAXA 3H7WB 3JYIA 5J8XA 1SKFA 4M3KA 4LCMA 3DAVA 3OC2A 2O99A 4NEED 2HPBA 5DJTA 3EOIA 1NXYA 2VLGA 1W63Q 2JKRI 4I3AA 3QNBA 1SZVA 4Y17A 2PR6A 2Z2MB 4L9FA 4BD0A 1G68A 2X01A 3UY6A 1IKGA 4C75A 4YOFA 4L9GA 1PZPA 3AGEA 1PRQA 5DF8A 1CEGA 1PW1A 5FQQA 5I94A 2PAVP 4RVAA 3VP3A 1NZUA 4MN7A 1N9NA 2A49A 2HDQA 3PYPA 5U47A 3MQQA 2ZC7A 3VOZA 1V9YA 1FCOA 1GSWA 2WGWA 4EBNA 3IHAA 2Y2QA 1ALQA 4ZJ1A 2VX8A 3ZCZA 3OZHA 3V39A 5CECA 1PI5A 2HP5A 3VSLA 4LCLA 3C2WA 3A3DA 3KSGA 2VGKA 5L2FA 4MMNA 4OQHA 5L10A 3NCKA 2V0UA 1ES5A 2ZC4B 2ZD8A 3T1QB 1K56D 5F5YA 5FL3A 3K3CA 5TFQA 3U2AA 4Y2FA 1KVLA 2XEPA 3LIDA 4LRXC 3WS0A 3N8SA 1YM1A 4XXRA 3BM6A 2I72A 3C4OA 4E6WA 3C5AA 4GD6A 3BFCA 4U3TA 3I7JA 4WZ5A 3G32A 3SH8A 2VV6A 5J4EA 1K55C 1H8YA 2WKRA 3TG9A 5F68A 1DJAA 1LL5A 2ZQ8A 5AQ9A 4FUWA 3SH7A 2HZ5A 4XT2A 2V2FF 2EFXA 1W79A 2Y59A 5E43A 5KZHA 3RXXA 3LUQA 2P08A 2WADA 3C38A 4PKYA 1DY6A 4FSFA 1E25A 2R78A 3AGDA 3EGDC 4U0TA 1BULA 3BFGA 1T1BA 3NOPC 3LIFA 4E3NA 3G34A 1JWVA 3NDGA 1RCJA 5CHUA 5K5BA 1GHMA 2OAQ1 4R70A 1S0WA 3OPRA 1K54A 4B88A 3ZYTA 3A3JA 3PXPA 4IVIA 1IKIA 4LV3A 3S4XA 3EQUA 4Y7PA 3CJMA 1WYBA 4KUKA 4DDSA 2D01A 2PR5A 4UQIS 4UA7A 4BL3A 5DVAA 1Y4OA 4PKYG 1DRMA 4KUOA 4I38A 3G2YA 2PD8A 3E2LA 1JTDA 4FTXA 3FV7A 3D72A 4RX2A 3O88A 4F3LA 1OPXA 2Z6DA 5G4YA 4E3LA 1N9LA 1LI9A 2R9WA 3WRZA 4U0XA 2B5RA 2ZQAA 2WGVA 2ZQDA 1DP9A 3A3IA 1YLPA 5FAQA 1SDNA 5CEDA 2O9AA 1HD8A 2RL3A 1LSXA 2Y2MA 1XJ3A 1L3LA 2C5WB 4R0QA 4DJ2A 5GLDA 3M2KA 3WS4A 3A3FA 3LEQA 5EOOA 2WAFA 2J3TC 4G3KA 4LFUA 2V8CA 1OJ5A 3DTMA 3S7PA 2Y8HA 4H8RA 4UQIM 4NXGA 2B18A 4S2LA 1W7FA 3IWIA 4ESPA 3D3OA 3MXRA 3W8KA 3BWLA 2Y2JA 3TE8A 1PYYA 3MZDA 2V1AA 5FEFA 5CERA 2ZQ9A 4E04A 3BRMA 2EA9A 5DFYA 4JLFA 4N9KA 5EM0A 1D7EA 2Y55A 3TSGA 3L9KA 3VMAA 3QHYA 3T4OA 1V9ZA 4KZBA 4Y0OA 2H28A 3VFHA 4I3IA 5HPIA 2Z6CA 3R7WB 2ZMVA 4X69A 3NI9A 5FAOA 3E0YA 4H6JA 4B4XA 1S66L 4OLDA 1XGJA 3T4LA 3G30A 1F2KA 2PU4A 2PDRA 3B47A 2EWWA 1BLCA 5FQMA 2DMWA 3IS2A 1OTEA 3GRJA 4OP5A 2VZWA 4E3MA 3FYZA 1L0DA 1DJBA 4R3AA 3GTCA 5FQIA 2V1ZA 4KZAA 3BQAA 1CK3A 4EUVA 5D3OA 4KZ7A 1N9OA 1PFLA 3P98A 3SW1A 3QP6A 3GMWA 5CGWA 4KG6A 2PYRA 4EERA 1TD5A 4O01A 3KO6A 4R3BA 1GA9A 3T1RA 2ZC6B 2HP9A 3Q7VA 5DTTA 4MCWA 3LCEA 5FEGA 2O0YA 2BLSA 2WZXA 1S4RA 2PD7A 3KYZA 1ACFA 3OLOA 5F6AA 1MWTA 4P85A 2GDNA 3N4IA 3BFDA 5HPFA 3G31A 3IHBA 2GNXA 1DJCA 2O9BA 3HVFA 3NOUC 4IUHA 2WGWB 4ME4A 4R38A 3T4QA 4KZ4A 5DTSA 5TJJA 4PAUA 1BZAA 4GN2A 3V3RA 5TGFA 1ZKJA 3O87A 2K31A 1LL8A 3NC8A 4JKTA 4KQDA 1I5QA 4IVKA 2W3DA 3B33A 1M40A 5EM1A 5L8MA 3MS6A 5HWTA 5IT5A 3M2JA 1BLSA 1IYPA 4DXCA 1KE3A 1S4SA 4ETXA 3PBTA 5HAQA 4ETZA 1TEMA 1GSVA 1FCMA 4K0XA 4ARZA 5HZHA 1IYQA 3SS4A 1K54C 4CJNA 1KE0A 1MKIA 4Y0TA 2C6WB 1E3UA 5HDCA 3UPPA 3WS2A 4RA7A 1LI0A 3C4PA 1NRJA 3P01A 2DRWA 5FQKA 1H5XA 5I5LA 4EBPA 1JWPA 4RX3A 2KOIA 3HLCA 4HESA 4XT2B 3A3EA 2W1RA 3V5MA 5GLCA 1ERMA 3GECA 4WMCD 3VFFA 1GCEA 2DNSA 3PBOA 5FI6A 4GOGA 2HF6A 1J9MA 3W4PA 3O86A 2ZL1A 1DP8A 3FPWA 4WL9A 4BL2A 3FKWA 4XUZA 4C3QA 1K38A 2HV1A 2ZOHA 1BT5A 4K08A 4LV1A 2NUPC 2QKPA 1HTZA 5DKLA 1XXMA 5AQBA 4BWIA 2WKPA 3G2ZA 4G3VA 1CQAA 4HBUA 2P7JA 4HP4A 4KQOA 4BBUA 5HD5A 4LRZE 2OOLA 1EW0A 1QMFA 5G18A 4I3JA 5C5KA 4YNRA 3OPLA 1VQQA 4HNBA 2XR0A 1YLTA 2XRNA 3Q1FA 3FZCA 3ZVWA 1FILA 2Y79A 1W8YA 1T1AA 2M7UA 3NBLA 3OCLA 3QP2A 3T4KA 1TDGA 1OJGA 3HREA 2W3HA 2YKFA 1LLBA 3CUEA 1XPBA 2XF3A 2EWVA 1ONHA 4JGPA 5F69A 3G35A 2W27A 4F3LB 3PAGA 3LIBA 2JKTI 2VA0A 4DE0A 1ZHHB 2V9AA 1ZG4A 4LGWA 4MNRA 4Q0HA 4N1XA 5GLAA 2OSUA 2ZJ9A 2Y2OA 3ZNYA 5CHJA 4R4RA 5EUAA 2IWCA 4R1GA 3IH9A 4KG5A 4ZJ2A 1VETA 2Q9MA 5GHZA 2FH5A 3BEBA 3VP1A 4IHQA 1GHPA 3CI6A 4X56A 3VOLA 5E2HA 5FAPA 2Q0OA 5TBMA 2W3GA 5JYPA 3QNCA 1CEFA 1VHMA 4DN0A 5FI2A 3ITBA 3ZVTA
chains in the Genus database with same CATH topology
3MSHA 2PBDP 1D1JA 5EM0A 1G5UA 5EVEA 3T1SA 3T12B 3T1QB 3L9KA 1Y4OA 2ACGA 1VETB 3DAVA 1CQAA 4FTXA 3CPTB 3D9YA 2BTFP 1J3WA 1K0KA 2ZL1B 3U4LP 4X25A 1CJFA 5EV0A 1F2KA 1SZVA 5EM1A 3MS6A 2E8JA 5FDSA 3NECA 1FILA 4X1LA 1PNEA 3CHWP 1Z09A 2B95A 1VEUA 3T1XA 4FUWA 2PRFA 2HZ5A 1HLUP 1PRQA 2VK3A 3LGOA 1PFLA 2PAVP 1FIKA 3LEQA 3T1RA 1SKOA 2JKGA 3KYEA 2V8CA 4QWOA 4X1MA 1VEUB 5FEGA 3NULA 1YPRA 1ACFA 4ESPA 1VETA 4D60A 3L7HA 2V8FA 1CF0A 1AWIA 3CPTA 1A0KA 3UB5P 2ZL1A 2JKFA 1SKOB 5FEFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MSH A;  2PBD P;  1D1J A;  5EM0 A;  1G5U A;  5EVE A;  3T1S A;  3T12 B;  3T1Q B;  3L9K A;  1Y4O A;  2ACG A;  1VET B;  3DAV A;  1CQA A;  4FTX A;  3CPT B;  3D9Y A;  2BTF P;  1J3W A;  1K0K A;  2ZL1 B;  3U4L P;  4X25 A;  1CJF A;  5EV0 A;  1F2K A;  1SZV A;  5EM1 A;  3MS6 A;  2E8J A;  5FDS A;  3NEC A;  1FIL A;  4X1L A;  1PNE A;  3CHW P;  1Z09 A;  2B95 A;  1VEU A;  3T1X A;  4FUW A;  2PRF A;  2HZ5 A;  1HLU P;  1PRQ A;  2VK3 A;  3LGO A;  1PFL A;  2PAV P;  1FIK A;  3LEQ A;  3T1R A;  1SKO A;  2JKG A;  3KYE A;  2V8C A;  4QWO A;  4X1M A;  1VEU B;  5FEG A;  3NUL A;  1YPR A;  1ACF A;  4ESP A;  1VET A;  4D60 A;  3L7H A;  2V8F A;  1CF0 A;  1AWI A;  3CPT A;  1A0K A;  3UB5 P;  2ZL1 A;  2JKF A;  1SKO B;  5FEF A; 
#chains in the Genus database with same CATH topology
 2PBD P;  1N4O A;  3CG5 A;  2JBF A;  4LLO B;  1IYO A;  3HLE A;  1FR6 A;  4JGR A;  3GQZ A;  4UHU A;  1K6R A;  4JXV A;  3Q82 A;  3UB8 A;  3BJN A;  3E2K A;  1XP4 A;  3S1Y A;  1G6O A;  4S2O A;  3D9Y A;  1U60 A;  3UE3 A;  1K0K A;  5EOE A;  4LV0 A;  3SH9 A;  3MKE A;  1MKM A;  1ERQ A;  1IEL A;  5AVF A;  2OLU A;  2ZBB A;  4JXW A;  1NRF A;  2E8J A;  3UPO A;  3BW6 A;  2WK0 A;  2I9V A;  3M6H A;  5GL9 A;  1M6K A;  2XSS A;  1KDW A;  1OT6 A;  2Y2L A;  4DDY A;  4DMZ A;  4JPM A;  2INW A;  5HAR A;  3S22 A;  3UPN A;  2PRF A;  4HJ4 A;  3NHQ A;  5KMW A;  5F1G A;  4QHC A;  2KDK A;  4H6J B;  2PYP A;  3T50 A;  1XX2 A;  1W63 M;  3HL9 A;  2X02 A;  3R4K A;  3LEZ A;  4WEK A;  3IS2 B;  5HAP A;  2A24 B;  1Q2Q A;  1G6A A;  4X1M A;  2WUQ A;  3B42 A;  2J3W A;  3PR6 A;  1O07 A;  5E2E A;  5AQA A;  4EEP A;  2WKQ A;  5JYO A;  3JVV A;  1XJ6 A;  4OON A;  4YIN A;  2EXA A;  4RQ9 A;  1W8Q A;  5AVE A;  5IU1 A;  2WYX A;  1A0K A;  4GZB A;  1IEM A;  3SOI A;  4R23 A;  2JKF A;  2XDM A;  2H0Y A;  5EE8 A;  3C8C A;  3Q7V B;  2XLN A;  3IXH A;  2J9O A;  1XJ4 A;  2UWX A;  4S2I A;  1I2W A;  3VP2 A;  3T1S A;  5IS1 A;  2WKI A;  1IFQ A;  1X0O A;  3MR0 A;  4BLM A;  4EW7 A;  5FAS A;  2ZQ7 A;  3K3D A;  1E3U D;  2LB9 A;  3IX3 A;  2A2L A;  1EWZ A;  3IT9 A;  2W3F A;  4OOY A;  5EV0 A;  2DCF A;  3OOV A;  3W4Q A;  5HW3 A;  5FDS A;  4PM7 A;  2ZOI A;  1FQG A;  5J3W A;  3OBF A;  4BBV A;  4LPZ A;  2V1B A;  3VP4 A;  3TOI A;  2B02 A;  1SHV A;  4OPQ A;  4OOL A;  4GDB A;  1FSW A;  3IXG A;  1YMS A;  1CI8 A;  1OTD A;  3MQO A;  1T18 A;  3ISG A;  1SKO A;  5HDD A;  4OLG A;  3KYE A;  4OVD A;  5EFW A;  1TS6 A;  3E98 A;  4HOI A;  3H82 A;  3M6B A;  3NIA A;  3MJQ A;  1UWN X;  1F9I A;  2J3T D;  2EFU A;  5HDS A;  3UN7 A;  1FSY A;  1XFQ A;  4ARZ B;  4D60 A;  4A5R A;  2V8F A;  2GZA A;  4II7 A;  4FH4 A;  5CTN A;  3FKV A;  2Y2G A;  4S2J A;  4K0W A;  4S2N A;  4LRY C;  4E3K A;  2Y4A A;  2JN7 A;  4O8G A;  2EX8 A;  5HD3 A;  3TRC A;  5HL1 A;  3T4T A;  2VKS A;  4UEY A;  4OKP A;  1LSW A;  4DXB A;  1ZC2 A;  2Y2K A;  3LIA A;  2BAS A;  1F5M A;  4IBR A;  1PW8 A;  3F1N A;  4EES A;  3KSI A;  4HHD A;  1KGG A;  3CUE C;  3C7V A;  4EV4 A;  4FOF A;  2ZL1 B;  3Q07 A;  3KSF A;  1YAX A;  2VGL S;  3N8L A;  3W2Z A;  5DJU A;  3NEC A;  4X6T A;  4GCZ A;  2J8Y A;  4EU0 A;  5EVI C;  2CC1 A;  2VV8 A;  4HY8 A;  2V20 A;  5HX9 A;  5FA7 A;  3TJZ C;  5DF7 A;  1JNU A;  1NLY A;  4HBT A;  4GJ4 A;  3UDF A;  3SS3 A;  3BYD A;  2NUT C;  2CMN A;  4OQ0 A;  4JGQ A;  5CRF A;  4CLC C;  4FD8 A;  4QD4 A;  4KEN B;  2A24 A;  4WF0 A;  1TDL A;  4QWO A;  5A92 A;  4BQM A;  4Q8I A;  4MDZ A;  1VB6 A;  3N7W A;  4EWF A;  5CX7 A;  4B93 A;  3GR2 A;  2ZMA A;  4LEN A;  3VOY A;  5DF9 A;  3L7H A;  4WN5 A;  1JWZ A;  4B9O A;  2G2W A;  2AVX A;  5F83 A;  3EEH A;  3CPT A;  3D4F A;  4UA9 A;  1ERO A;  2VGL M;  3C7U A;  2WKH A;  3HLF A;  3ZGA B;  2HJE A;  3MSH A;  3HUN A;  1OTA A;  1G28 A;  4ZTK A;  4QU3 A;  2P74 A;  3CIT A;  3MBZ A;  4KQR A;  1STZ A;  4X68 A;  3JVU A;  3CWF A;  4Q0J A;  1VET B;  2PHY A;  2MJ6 A;  4MBK A;  4BEN A;  3MZF A;  4ZDX A;  1AXB A;  5TBM B;  4IED A;  5M19 A;  2W1T A;  5F82 A;  5E2G A;  2V0W A;  3RH8 B;  1S1Z A;  4WEJ A;  1K25 A;  1PNE A;  3CHW P;  1ESI A;  2HDU A;  1Z09 A;  3O3V A;  1VEU A;  4N9L A;  5G4Z A;  3ZDJ A;  3MFD A;  4JF5 A;  4QJG A;  2PU2 A;  1YQS A;  3UME A;  3HLB A;  3WS1 A;  4O7D A;  2ZM0 A;  2R9X A;  1MY8 A;  1YLW A;  5CGS A;  4JF4 A;  4EBL A;  5FQJ A;  3RTY A;  3VE4 A;  2JE5 A;  1Z6F A;  2HGV A;  2ZC3 B;  2JKG A;  4DKI A;  1XJ2 A;  4P0M A;  1GA0 A;  1ES3 A;  1QME A;  2UV0 E;  1XA1 A;  3LFV A;  3PBQ A;  3EEA A;  3WWX A;  3MQ0 A;  4KZ9 A;  1LT0 A;  3IF6 A;  3PTE A;  1H0M A;  1CF0 A;  3BLM A;  5MC7 A;  2JKR M;  1PIO A;  3N6I A;  4YFM A;  3HLW A;  4ZRR A;  1K6S A;  3MFX A;  5LBR A;  3V3S A;  1O7E A;  1PWC A;  1D1J A;  5HAI A;  1K4F A;  4E3I A;  3MF0 A;  4BJP A;  4PHT A;  1NLZ A;  5CXW A;  3QP1 A;  1KVM A;  4P87 A;  4D2O A;  2O9C A;  3HLD A;  1KGE A;  3F1P A;  3U4L P;  4GHI B;  4WZ4 A;  3DBA A;  1CJF A;  1L0E A;  3UDX A;  5CEB A;  4PMA A;  1Y54 A;  1F98 A;  3LR0 A;  4MN5 A;  2WGI A;  4IUK A;  3T1X A;  4Y5F A;  3KSH A;  3ICY A;  5F1F A;  4HI4 A;  2EX2 A;  4ZAM A;  3IBJ A;  3ZG9 B;  4S2N C;  1ODV A;  5J7E A;  3CZD A;  2HP6 A;  1BSG A;  2OV5 A;  3MKF A;  4HQA A;  1YLY A;  3IXD A;  2PT7 A;  1YPR A;  4ZJ3 A;  3KX0 X;  1KGF A;  3NDE A;  4FCF A;  1UWP X;  5EVL A;  3ZNT A;  1MPL A;  5DKK A;  1LHY A;  5TR7 A;  3DTI A;  2WKE A;  2XGN A;  3DWZ A;  3LI9 A;  2ZM8 A;  5EVI A;  1SKO B;  2IA2 A;  1PZO A;  3GVB A;  5CTM A;  5KSH A;  1CI9 A;  3H82 B;  1LL9 A;  4JGO A;  3ZG7 B;  4OQG A;  3G4P A;  1OT9 A;  2ACG A;  3F1O A;  3JPU A;  4Z1W A;  3DTE A;  4CLC A;  3VP0 A;  2QWS A;  2L0W A;  3P7N A;  4GLQ A;  1YMX A;  1NZO A;  1YSQ A;  4NK3 A;  3EQV A;  2Y2P A;  2KX6 A;  3IH8 A;  1OTI A;  3TW8 A;  4R4S A;  3PBR A;  4EEU A;  4HH3 A;  4NXF A;  4KG2 A;  3EGX C;  2K7S A;  3RJU A;  3G6O A;  5A91 A;  1P0Z A;  3F1N B;  3P09 A;  1D06 A;  2QYB A;  4QPR A;  3N8R A;  3WRT A;  4WLA A;  4HP9 A;  1XGI A;  2LB5 A;  1MWU A;  1DP6 A;  1SCW A;  4P6Z S;  2W3E A;  3BLS A;  3LY3 A;  1TS7 A;  3MMH A;  1S67 L;  1C3B A;  4GW9 A;  1I2S A;  3QP5 A;  4NXB A;  3LY4 A;  5IHV A;  1YLJ A;  2IWB A;  4EUZ A;  1MBL A;  3A0R A;  5DTK A;  3OCN A;  4LV2 A;  1IYS A;  3SZT A;  3FPV A;  1L0G A;  3NY4 A;  1Q2P A;  4F94 A;  2X71 A;  3Q81 A;  4Q0I A;  4E6X A;  1AWI A;  3LI8 A;  4BBT A;  3MZE A;  3UB5 P;  5FSR A;  1L2S A;  5KSC A;  3LIC A;  4MLL A;  4MEZ A;  4HIA A;  2P9V A;  3OPH A;  1G5U A;  5EVE A;  3HUO A;  4QY6 A;  3FG8 A;  4GS9 A;  2XRO A;  3ZQ5 A;  4HJ3 A;  4G3W A;  1GHI A;  3CPT B;  5EPH A;  4PM6 A;  4GHI A;  1TS0 A;  2XK1 A;  3T4J A;  4X25 A;  5CHM A;  2HJ9 C;  2KLI A;  2OAP 1;  4KQQ A;  4P6Z M;  2J9P A;  2L4R A;  2M7V A;  1K57 A;  1L0F A;  4EXO A;  2HDS A;  1LSV A;  3IWO A;  3ZFZ A;  3Q7Z A;  3HUM A;  3VE3 A;  1YLZ A;  1FOF A;  1HVB A;  1ES2 A;  3IBR A;  2OWJ A;  3AGF A;  2BG1 A;  3C30 A;  3LGO A;  5DFX A;  3GSG A;  1T19 A;  3IF6 C;  2W1T B;  1RGY A;  4Z9Q A;  4MBH A;  2EX9 A;  3GDI A;  3DW0 A;  4N1H A;  4KZ5 A;  3IF5 A;  1NYY A;  3PBS A;  3RFB A;  4WUJ A;  2J80 A;  5L07 A;  3V50 A;  3HLG A;  3UB9 A;  4QB8 A;  2XFT A;  4BMW A;  1VEU B;  3H7W A;  2D02 A;  4GKU A;  3H9W A;  1EI5 A;  3E4Q A;  4B4Z A;  3BY8 A;  4EET B;  4GB7 A;  1UGU A;  3WS5 A;  4DF6 A;  1P97 A;  4YWZ A;  2EX6 A;  1JVJ A;  2Y2H A;  3SS5 A;  1TF1 A;  2E8I A;  4GD8 A;  3DTK A;  4OH0 A;  1ESU A;  2QMI A;  3E4O A;  5M1A A;  5A90 A;  4WMC A;  4UA6 A;  5A8B A;  3QP8 A;  4E3J A;  1WE4 A;  5A93 A;  3IF6 B;  3LR4 A;  2G2U A;  3PAE A;  5FI7 A;  3A0S A;  5AJG A;  1J3W A;  1H8M A;  1JTG A;  3VSK A;  2OWH A;  2W0N A;  1TS8 A;  4OP8 A;  3IQA A;  3UO9 A;  2QHK A;  3IX8 A;  4C6Y A;  1YKD A;  1E4D A;  2RCX A;  4NG2 A;  5HL6 A;  2Q9N A;  4GNU A;  2ZLY A;  4HJ6 A;  2GJ3 A;  4S2M A;  4JXS A;  3ZHH A;  4MBF A;  3BY9 A;  2VK3 A;  4Y13 A;  5EVI D;  3BFE A;  4EQ1 A;  3S7N A;  2GX5 A;  3F1P B;  2XFS A;  4JF6 A;  5HFO A;  4AFI A;  2A3U A;  5L09 A;  4JXG A;  2JCH A;  1NJ4 A;  3UB7 A;  4EQI A;  3ITA A;  2K2N A;  3HBR A;  3HJK A;  4UAA A;  3K2N A;  5HSQ A;  4JBF A;  4WEL A;  1H3Q A;  4CLC D;  5BOH A;  4K91 A;  3UB6 A;  1SDE A;  5EEC A;  1W5D A;  2VJW A;  3QP4 A;  2Y2I A;  2HDR A;  1XKZ A;  4OOM A;  4PPR A;  2WAE A;  1MWR A;  3NJA A;  3UMD A;  3ZG8 B;  2ZQC A;  3ZG5 A;  5HWV A;  3IX4 A;  1WA9 A;  2FFF B;  1NY0 A;  4HEF A;  1PI4 A;  4R3J A;  2YKH A;  1VM1 A;  3VV4 A;  2WZZ A;  2ZC5 B;  2Y91 A;  3E4P A;  1KDS A;  1KE4 A;  3GV9 A;  4DJ3 A;  2Y2N A;  2BTF P;  2H0T A;  2XA7 S;  1BYW A;  5EVI B;  4L0L A;  2Z2L B;  2VEA A;  1RGZ A;  2EXB A;  1BLP A;  1NWZ A;  2QJ7 A;  4OPZ A;  3EWK A;  1TVF A;  3UDI A;  4Y3I A;  4NKP A;  4I39 A;  1YT4 A;  5FAT A;  4OPR A;  3A0V A;  1YSP A;  3UE0 A;  3LO7 A;  3F1O B;  1XA7 A;  4KZ8 A;  4OPY A;  2J7V A;  4KZ3 A;  4CLC B;  3DWK A;  1HLU P;  1P9W A;  2XH9 A;  3RXW A;  3T4S A;  3HCY A;  3OPP A;  1K56 A;  1GSX A;  2G7U A;  1MXO A;  3PHY A;  4WBG A;  5FQ9 A;  4DE3 A;  1NYM A;  1ZTU A;  2VGJ A;  2XD1 A;  3B3X A;  1FIK A;  4NET A;  3LR5 A;  1K55 A;  2ZM2 A;  5GLB A;  3BQ8 A;  2H5S A;  3NOT C;  3UE1 A;  1XFN A;  2JC7 A;  3UNW A;  2M1C A;  4M4X A;  3ZG0 A;  2FZ0 A;  3O5Y A;  4WZ5 C;  3PBN A;  1WYC A;  3CLO A;  3S7Q A;  4S2K A;  3LYX A;  1FCN A;  4X55 A;  1Y28 A;  5GHX A;  3IXB A;  4WYY A;  3W4O A;  5AQ7 A;  3MXQ A;  2XA7 M;  1P9R A;  4IJG A;  1RP5 A;  4RYE A;  1MC0 A;  4OQI A;  1MZU A;  4HH2 A;  1BLH A;  1MWS A;  2OLV A;  1PWG A;  3S7O A;  1S6R A;  4R6L A;  1K57 C;  1FR1 A;  3T12 B;  4S2P A;  4Y15 A;  1ZG6 A;  4QY5 A;  4CLC E;  1K4E A;  2JKT M;  5KIZ A;  4ZBE A;  4O0P A;  5CGX A;  4PM8 A;  1BTL A;  4GDN A;  4KZ6 A;  3FWL A;  2PBY A;  3FC7 A;  3CMZ A;  4ID4 A;  4XUX A;  1OTB A;  1S1Y A;  2XQZ A;  1BUE A;  1ONG A;  3BEC A;  2P9V B;  3ULF A;  1H8Z A;  4X1L A;  2B95 A;  5E2F A;  4GS9 B;  4PM5 A;  4DRT A;  1HZO A;  3IWQ A;  1OME A;  1T1C A;  2QJ5 A;  2H10 A;  2JHE A;  1N9B A;  4BD1 A;  2L1M A;  4P6B A;  4L9E A;  4WM9 A;  4DE2 A;  3LR3 A;  2QPN A;  1KOU A;  4N92 A;  1IOU A;  2XD5 A;  4Y0U A;  5FDH A;  3KYQ A;  4CPK A;  4MN6 A;  3NUL A;  4CQH A;  3LIE A;  3V67 A;  4PM9 A;  3UE6 A;  1PWD A;  3HJI A;  5GHY A;  3R7W A;  2IWD A;  2QZ6 A;  4I5S A;  4E3O A;  2VV7 A;  3BFF A;  4DE1 A;  3MXS A;  4FH2 A;  2ZMF A;  4NXE A;  4IBX A;  4X53 A;  1ES4 A;  5HWW A;  2FFY A;  5M18 A;  2P04 A;  3CAX A;  3H7W B;  3JYI A;  5J8X A;  1SKF A;  4M3K A;  4LCM A;  3DAV A;  3OC2 A;  2O99 A;  4NEE D;  2HPB A;  5DJT A;  3EOI A;  1NXY A;  2VLG A;  1W63 Q;  2JKR I;  4I3A A;  3QNB A;  1SZV A;  4Y17 A;  2PR6 A;  2Z2M B;  4L9F A;  4BD0 A;  1G68 A;  2X01 A;  3UY6 A;  1IKG A;  4C75 A;  4YOF A;  4L9G A;  1PZP A;  3AGE A;  1PRQ A;  5DF8 A;  1CEG A;  1PW1 A;  5FQQ A;  5I94 A;  2PAV P;  4RVA A;  3VP3 A;  1NZU A;  4MN7 A;  1N9N A;  2A49 A;  2HDQ A;  3PYP A;  5U47 A;  3MQQ A;  2ZC7 A;  3VOZ A;  1V9Y A;  1FCO A;  1GSW A;  2WGW A;  4EBN A;  3IHA A;  2Y2Q A;  1ALQ A;  4ZJ1 A;  2VX8 A;  3ZCZ A;  3OZH A;  3V39 A;  5CEC A;  1PI5 A;  2HP5 A;  3VSL A;  4LCL A;  3C2W A;  3A3D A;  3KSG A;  2VGK A;  5L2F A;  4MMN A;  4OQH A;  5L10 A;  3NCK A;  2V0U A;  1ES5 A;  2ZC4 B;  2ZD8 A;  3T1Q B;  1K56 D;  5F5Y A;  5FL3 A;  3K3C A;  5TFQ A;  3U2A A;  4Y2F A;  1KVL A;  2XEP A;  3LID A;  4LRX C;  3WS0 A;  3N8S A;  1YM1 A;  4XXR A;  3BM6 A;  2I72 A;  3C4O A;  4E6W A;  3C5A A;  4GD6 A;  3BFC A;  4U3T A;  3I7J A;  4WZ5 A;  3G32 A;  3SH8 A;  2VV6 A;  5J4E A;  1K55 C;  1H8Y A;  2WKR A;  3TG9 A;  5F68 A;  1DJA A;  1LL5 A;  2ZQ8 A;  5AQ9 A;  4FUW A;  3SH7 A;  2HZ5 A;  4XT2 A;  2V2F F;  2EFX A;  1W79 A;  2Y59 A;  5E43 A;  5KZH A;  3RXX A;  3LUQ A;  2P08 A;  2WAD A;  3C38 A;  4PKY A;  1DY6 A;  4FSF A;  1E25 A;  2R78 A;  3AGD A;  3EGD C;  4U0T A;  1BUL A;  3BFG A;  1T1B A;  3NOP C;  3LIF A;  4E3N A;  3G34 A;  1JWV A;  3NDG A;  1RCJ A;  5CHU A;  5K5B A;  1GHM A;  2OAQ 1;  4R70 A;  1S0W A;  3OPR A;  1K54 A;  4B88 A;  3ZYT A;  3A3J A;  3PXP A;  4IVI A;  1IKI A;  4LV3 A;  3S4X A;  3EQU A;  4Y7P A;  3CJM A;  1WYB A;  4KUK A;  4DDS A;  2D01 A;  2PR5 A;  4UQI S;  4UA7 A;  4BL3 A;  5DVA A;  1Y4O A;  4PKY G;  1DRM A;  4KUO A;  4I38 A;  3G2Y A;  2PD8 A;  3E2L A;  1JTD A;  4FTX A;  3FV7 A;  3D72 A;  4RX2 A;  3O88 A;  4F3L A;  1OPX A;  2Z6D A;  5G4Y A;  4E3L A;  1N9L A;  1LI9 A;  2R9W A;  3WRZ A;  4U0X A;  2B5R A;  2ZQA A;  2WGV A;  2ZQD A;  1DP9 A;  3A3I A;  1YLP A;  5FAQ A;  1SDN A;  5CED A;  2O9A A;  1HD8 A;  2RL3 A;  1LSX A;  2Y2M A;  1XJ3 A;  1L3L A;  2C5W B;  4R0Q A;  4DJ2 A;  5GLD A;  3M2K A;  3WS4 A;  3A3F A;  3LEQ A;  5EOO A;  2WAF A;  2J3T C;  4G3K A;  4LFU A;  2V8C A;  1OJ5 A;  3DTM A;  3S7P A;  2Y8H A;  4H8R A;  4UQI M;  4NXG A;  2B18 A;  4S2L A;  1W7F A;  3IWI A;  4ESP A;  3D3O A;  3MXR A;  3W8K A;  3BWL A;  2Y2J A;  3TE8 A;  1PYY A;  3MZD A;  2V1A A;  5FEF A;  5CER A;  2ZQ9 A;  4E04 A;  3BRM A;  2EA9 A;  5DFY A;  4JLF A;  4N9K A;  5EM0 A;  1D7E A;  2Y55 A;  3TSG A;  3L9K A;  3VMA A;  3QHY A;  3T4O A;  1V9Z A;  4KZB A;  4Y0O A;  2H28 A;  3VFH A;  4I3I A;  5HPI A;  2Z6C A;  3R7W B;  2ZMV A;  4X69 A;  3NI9 A;  5FAO A;  3E0Y A;  4H6J A;  4B4X A;  1S66 L;  4OLD A;  1XGJ A;  3T4L A;  3G30 A;  1F2K A;  2PU4 A;  2PDR A;  3B47 A;  2EWW A;  1BLC A;  5FQM A;  2DMW A;  3IS2 A;  1OTE A;  3GRJ A;  4OP5 A;  2VZW A;  4E3M A;  3FYZ A;  1L0D A;  1DJB A;  4R3A A;  3GTC A;  5FQI A;  2V1Z A;  4KZA A;  3BQA A;  1CK3 A;  4EUV A;  5D3O A;  4KZ7 A;  1N9O A;  1PFL A;  3P98 A;  3SW1 A;  3QP6 A;  3GMW A;  5CGW A;  4KG6 A;  2PYR A;  4EER A;  1TD5 A;  4O01 A;  3KO6 A;  4R3B A;  1GA9 A;  3T1R A;  2ZC6 B;  2HP9 A;  3Q7V A;  5DTT A;  4MCW A;  3LCE A;  5FEG A;  2O0Y A;  2BLS A;  2WZX A;  1S4R A;  2PD7 A;  3KYZ A;  1ACF A;  3OLO A;  5F6A A;  1MWT A;  4P85 A;  2GDN A;  3N4I A;  3BFD A;  5HPF A;  3G31 A;  3IHB A;  2GNX A;  1DJC A;  2O9B A;  3HVF A;  3NOU C;  4IUH A;  2WGW B;  4ME4 A;  4R38 A;  3T4Q A;  4KZ4 A;  5DTS A;  5TJJ A;  4PAU A;  1BZA A;  4GN2 A;  3V3R A;  5TGF A;  1ZKJ A;  3O87 A;  2K31 A;  1LL8 A;  3NC8 A;  4JKT A;  4KQD A;  1I5Q A;  4IVK A;  2W3D A;  3B33 A;  1M40 A;  5EM1 A;  5L8M A;  3MS6 A;  5HWT A;  5IT5 A;  3M2J A;  1BLS A;  1IYP A;  4DXC A;  1KE3 A;  1S4S A;  4ETX A;  3PBT A;  5HAQ A;  4ETZ A;  1TEM A;  1GSV A;  1FCM A;  4K0X A;  4ARZ A;  5HZH A;  1IYQ A;  3SS4 A;  1K54 C;  4CJN A;  1KE0 A;  1MKI A;  4Y0T A;  2C6W B;  1E3U A;  5HDC A;  3UPP A;  3WS2 A;  4RA7 A;  1LI0 A;  3C4P A;  1NRJ A;  3P01 A;  2DRW A;  5FQK A;  1H5X A;  5I5L A;  4EBP A;  1JWP A;  4RX3 A;  2KOI A;  3HLC A;  4HES A;  4XT2 B;  3A3E A;  2W1R A;  3V5M A;  5GLC A;  1ERM A;  3GEC A;  4WMC D;  3VFF A;  1GCE A;  2DNS A;  3PBO A;  5FI6 A;  4GOG A;  2HF6 A;  1J9M A;  3W4P A;  3O86 A;  2ZL1 A;  1DP8 A;  3FPW A;  4WL9 A;  4BL2 A;  3FKW A;  4XUZ A;  4C3Q A;  1K38 A;  2HV1 A;  2ZOH A;  1BT5 A;  4K08 A;  4LV1 A;  2NUP C;  2QKP A;  1HTZ A;  5DKL A;  1XXM A;  5AQB A;  4BWI A;  2WKP A;  3G2Z A;  4G3V A;  1CQA A;  4HBU A;  2P7J A;  4HP4 A;  4KQO A;  4BBU A;  5HD5 A;  4LRZ E;  2OOL A;  1EW0 A;  1QMF A;  5G18 A;  4I3J A;  5C5K A;  4YNR A;  3OPL A;  1VQQ A;  4HNB A;  2XR0 A;  1YLT A;  2XRN A;  3Q1F A;  3FZC A;  3ZVW A;  1FIL A;  2Y79 A;  1W8Y A;  1T1A A;  2M7U A;  3NBL A;  3OCL A;  3QP2 A;  3T4K A;  1TDG A;  1OJG A;  3HRE A;  2W3H A;  2YKF A;  1LLB A;  3CUE A;  1XPB A;  2XF3 A;  2EWV A;  1ONH A;  4JGP A;  5F69 A;  3G35 A;  2W27 A;  4F3L B;  3PAG A;  3LIB A;  2JKT I;  2VA0 A;  4DE0 A;  1ZHH B;  2V9A A;  1ZG4 A;  4LGW A;  4MNR A;  4Q0H A;  4N1X A;  5GLA A;  2OSU A;  2ZJ9 A;  2Y2O A;  3ZNY A;  5CHJ A;  4R4R A;  5EUA A;  2IWC A;  4R1G A;  3IH9 A;  4KG5 A;  4ZJ2 A;  1VET A;  2Q9M A;  5GHZ A;  2FH5 A;  3BEB A;  3VP1 A;  4IHQ A;  1GHP A;  3CI6 A;  4X56 A;  3VOL A;  5E2H A;  5FAP A;  2Q0O A;  5TBM A;  2W3G A;  5JYP A;  3QNC A;  1CEF A;  1VHM A;  4DN0 A;  5FI2 A;  3ITB A;  3ZVT A; 
#chains in the Genus database with same CATH homology
 3MSH A;  2PBD P;  1D1J A;  5EM0 A;  1G5U A;  5EVE A;  3T1S A;  3T12 B;  3T1Q B;  3L9K A;  1Y4O A;  2ACG A;  1VET B;  3DAV A;  1CQA A;  4FTX A;  3CPT B;  3D9Y A;  2BTF P;  1J3W A;  1K0K A;  2ZL1 B;  3U4L P;  4X25 A;  1CJF A;  5EV0 A;  1F2K A;  1SZV A;  5EM1 A;  3MS6 A;  2E8J A;  5FDS A;  3NEC A;  1FIL A;  4X1L A;  1PNE A;  3CHW P;  1Z09 A;  2B95 A;  1VEU A;  3T1X A;  4FUW A;  2PRF A;  2HZ5 A;  1HLU P;  1PRQ A;  2VK3 A;  3LGO A;  1PFL A;  2PAV P;  1FIK A;  3LEQ A;  3T1R A;  1SKO A;  2JKG A;  3KYE A;  2V8C A;  4QWO A;  4X1M A;  1VEU B;  5FEG A;  3NUL A;  1YPR A;  1ACF A;  4ESP A;  1VET A;  4D60 A;  3L7H A;  2V8F A;  1CF0 A;  1AWI A;  3CPT A;  1A0K A;  3UB5 P;  2ZL1 A;  2JKF A;  1SKO B;  5FEF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...