3T1RA

Mglb with tetrameric arrangement
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
133
structure length
133
Chain Sequence
LVLYGAPYERAVEVLEETLRETGARYALLIDRKGFVLAHKEALWAPKPPPLDTLATLVASNAAATQALAKLLGEARFQEEVHQGERMGLYVDEAGEHALLVLVFDETAPLGKVKLHGKRAAEALARIAEEALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gliding protein MglB
publication title Structural analysis of the Ras-like G protein MglA and its cognate GAP MglB and implications for bacterial polarity.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Signaling protein
total genus 36
structure length 133
sequence length 133
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03259 Robl_LC7 Roadblock/LC7 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 3t1rA00
1A0KA 2VK3A 1FIKA 1Y4OA 4X1LA 1J3WA 1VETB 5EM0A 1VEUB 3T1XA 3KYEA 3CPTA 1AWIA 2E8JA 3CHWP 5EVEA 2V8CA 3UB5P 3DAVA 1SZVA 3T1SA 3MSHA 4D60A 1PFLA 2BTFP 2PBDP 2ZL1B 3NECA 1SKOA 1VEUA 2B95A 4ESPA 1PNEA 3L7HA 4FTXA 1CQAA 1D1JA 2V8FA 1PRQA 3T12B 2JKFA 2PAVP 3T1QB 5FEGA 5FDSA 1CF0A 1F2KA 3NULA 4QWOA 2JKGA 5EV0A 3CPTB 3U4LP 2PRFA 1VETA 4X25A 4FUWA 1K0KA 2ZL1A 3D9YA 1Z09A 3MS6A 2ACGA 2HZ5A 5FEFA 4X1MA 1ACFA 1HLUP 1SKOB 3T1RA 1YPRA 3LEQA 1G5UA 3LGOA 1CJFA 3L9KA 5EM1A 1FILA
chains in the Genus database with same CATH superfamily
3M6HA 4DJ2A 3KX0X 3K3DA 1KVLA 4OPZA 3RXXA 3BQAA 1PW8A 2Y2GA 2WGIA 3W4OA 1XXMA 2MJ6A 3HUNA 5DJUA 4DE0A 3GVBA 3WRZA 2DCFA 4Y15A 1V9YA 1GSXA 2I9VA 4S2JA 4XT2B 3LUQA 3IF6B 3LIDA 3FKVA 1RGYA 1TS7A 3PBTA 1PI4A 2JKRI 4BD0A 5F82A 5EVEA 3UPPA 4K91A 3M2KA 3KSGA 5CTMA 2WYXA 2M1CA 4D60A 2HP9A 3WWXA 2XA7S 1PIOA 1KGEA 3NY4A 3SZTA 4CLCC 1PWDA 2XR0A 4EESA 2Q0OA 3O5YA 3CG5A 4X56A 2EXAA 4LRZE 2JKFA 3SH7A 1IOUA 5KSCA 3NDGA 1W5DA 3UB9A 1UWPX 4H6JB 1OTEA 3CZDA 3HLBA 3QP5A 2VJWA 5A8BA 4MBKA 3EOIA 5CECA 5CX7A 5DKKA 2EX2A 3IXDA 1RP5A 4MNRA 4O0PA 4ETXA 4EV4A 5CEBA 4LCMA 4RA7A 2PD7A 5DVAA 4ARZB 1C3BA 4DMZA 2Y2QA 2IWBA 3LFVA 1S4RA 3LGOA 2PYRA 1QMEA 3ZVTA 3IXBA 1F9IA 1T1CA 4HP4A 1LL8A 1F98A 1RGZA 1BSGA 3V3RA 2PHYA 4OONA 4CLCE 5GLDA 5DJTA 1ERQA 3MXSA 5A91A 1LSWA 4CLCA 1MPLA 2IWCA 4OQGA 4GD8A 1YMXA 2OOLA 1MWUA 2EFXA 3P01A 5FDHA 3DBAA 3IS2A 4P87A 4WM9A 2XSSA 4KZ7A 5TBMB 2CMNA 2X71A 3M2JA 1K55A 3TJZC 5EE8A 1K4EA 2A49A 2WKRA 5EUAA 4E6XA 2ZQAA 1Z6FA 2WUQA 1OJ5A 4EERA 1VEUA 1YSQA 4R3AA 4BJPA 3PHYA 1NYMA 1D1JA 2LB9A 3MKFA 1XJ6A 5FDSA 2O9CA 3E98A 4E3NA 3VFHA 3PYPA 2ZM8A 1TVFA 2PBYA 3NULA 4IVKA 3PBOA 3MQQA 4GZBA 5AJGA 4YINA 3CUEC 1KE0A 3BFFA 1YMSA 5HDCA 3QP1A 3HREA 3SS3A 4ETZA 1DJAA 5AVFA 3HBRA 4L9FA 2VV8A 1YLYA 2XDMA 4QB8A 3BFEA 4X1MA 4OP8A 3NHQA 2Y2KA 4PM5A 2NUPC 2A24B 3F1NA 4KZAA 2J80A 5AQBA 4F3LA 3WS5A 5L8MA 2FFFB 2Q9MA 3LI8A 3B3XA 3N8RA 4JF4A 4P6ZM 4BLMA 3HL9A 2HJ9C 1JNUA 4M3KA 4EUVA 4NXEA 4KQDA 2E8JA 2H5SA 3RTYA 4UEYA 2BLSA 4Y17A 3F1PB 4E3JA 1SZVA 3T1SA 4KZ8A 3NC8A 3T4SA 5EFWA 2Z6CA 4Y7PA 1X0OA 3UE6A 2ZM2A 3MZEA 2XH9A 2QJ7A 4LGWA 2V1AA 4D2OA 2V9AA 4Q0HA 1YQSA 2P04A 3CI6A 2KLIA 3E4QA 4XUZA 2JHEA 1SKFA 2L0WA 2ZQ8A 3MKEA 3OLOA 2GNXA 2VGKA 3S1YA 1FSYA 4EBNA 4IUHA 4I39A 4C3QA 2PR5A 1I2WA 1G6AA 1NJ4A 5FAPA 2ZC7A 2PR6A 1ZC2A 2ZC3B 4OOLA 3EGXC 4IHQA 4GJ4A 4R23A 1CJFA 5J7EA 5JYPA 3L9KA 1K4FA 1EI5A 3HUOA 3QP2A 1VB6A 1XP4A 4HBUA 3Q82A 2K2NA 1XPBA 2J9PA 1JWVA 2DRWA 5C5KA 2ZBBA 3M6BA 4FD8A 4QY5A 3W8KA 5D3OA 3FZCA 4QY6A 5FQIA 5EOOA 4EBPA 5E2FA 1TDLA 1SDEA 4HH2A 3IBRA 1MWRA 1H3QA 3VOYA 1BZAA 4Y13A 5HAPA 1YM1A 1XFQA 3O87A 4X53A 3LYXA 3KSHA 1E4DA 3ZGAB 1KDSA 1NXYA 3VP0A 2FH5A 2HP5A 3NOTC 4IJGA 4FCFA 3LIEA 1K6SA 3UO9A 1NY0A 3H7WB 4HH3A 3VSLA 5FQJA 3AGDA 3C7UA 3ZYTA 3ZQ5A 5FEGA 2J7VA 4G3VA 1TEMA 2W27A 2YKHA 5E2GA 5FATA 4BL3A 3N8LA 2KOIA 3BEBA 3U4LP 4BWIA 2PRFA 2Y79A 4R0QA 4PPRA 1YLPA 2EXBA 3N7WA 1XJ4A 2Y4AA 3E2KA 4MDZA 2WKIA 2P08A 3Q7VB 1ZKJA 3C30A 3LY4A 3MS6A 4O8GA 1ESIA 5FQMA 5F6AA 1PYYA 3HLEA 4WLAA 4GS9A 4YOFA 3NOPC 3UDXA 2QHKA 1J9MA 3FPWA 4BQMA 2VKSA 4EETB 5A92A 2RCXA 5AQ9A 2EWWA 2K7SA 4C6YA 3P7NA 1CI9A 1MXOA 1NYYA 1OTIA 2V0WA 1HD8A 4KZ3A 3A3EA 1NZUA 4OH0A 5HWWA 5DKLA 2XROA 3O88A 4N9LA 1LLBA 4OPRA 2P7JA 2W3FA 3ULFA 3UB5P 1MKIA 3G6OA 5DFYA 3T4QA 1MBLA 3OPPA 4NG2A 1NRFA 2WK0A 4P0MA 2XK1A 3NBLA 4S2OA 3AGFA 3GMWA 5FQKA 3VSKA 4GHIA 4HEFA 5HAIA 5HD5A 2XFSA 1JTDA 4BENA 1L2SA 2J9OA 3VP4A 2VEAA 1KGFA 2WADA 5FL3A 3GSGA 3OBFA 4R4SA 4U3TA 1N4OA 3QHYA 2QMIA 5EV0A 4JGRA 3MF0A 3UE3A 2WKPA 1KE3A 3BRMA 2HDUA 3ITAA 3A3FA 3G31A 4MLLA 4GDNA 4MEZA 2ZMFA 4UQIM 3FKWA 1QMFA 1ACFA 1W63Q 1ZG6A 3UNWA 2VGJA 3IXGA 3VFFA 5EVIA 1S1ZA 1LI9A 4GNUA 4K08A 1YLJA 4H8RA 4HJ4A 4HOIA 1GA0A 1W8QA 4X1LA 5CTNA 5K5BA 1LL9A 4ZJ2A 3MMHA 4DDSA 1LI0A 3MBZA 5L09A 4HJ6A 3ZFZA 3B33A 3ZG0A 3PBRA 4WN5A 3WS1A 1O7EA 4Q8IA 2PT7A 3DTEA 3HVFA 2ZMAA 1L3LA 2ZQCA 1E3UA 3R7WA 4LENA 3ITBA 4KG5A 3F1OB 2V1ZA 2Z6DA 4FH2A 5GHYA 2W1RA 3GTCA 5FI2A 5BOHA 4OPQA 3TW8A 1TF1A 3GQZA 4GW9A 3E0YA 2XD1A 4CJNA 5FQQA 1TDGA 3T12B 3JVUA 4CLCB 1IKIA 4G3WA 3HLWA 1OTBA 1HTZA 3ZHHA 3UMDA 3NJAA 1CEGA 5G4YA 1DY6A 3BLSA 2UV0E 3IS2B 4IEDA 3HUMA 4EWFA 1FCMA 4DXCA 2XA7M 4JXWA 4Y3IA 2K31A 2HPBA 2H10A 3LIBA 2ACGA 1GHPA 3UE0A 4ZAMA 3IF6C 3NOUC 4JXGA 5GLAA 5F5YA 3B47A 3PBQA 5CXWA 3BFGA 2B02A 3UN7A 3IXHA 3LR3A 1EROA 2H28A 1JWPA 2O9BA 4KZ4A 3G32A 1N9LA 2NUTC 2ZQDA 3C7VA 3S4XA 2ZD8A 1G68A 4MMNA 4JGOA 5HFOA 1FCNA 4EQIA 3HLCA 3SOIA 3MZFA 3K2NA 2GJ3A 2QWSA 3FYZA 2C6WB 2V8CA 1IEMA 4PM9A 1DJBA 3U2AA 3TE8A 2W3DA 3DTMA 1JVJA 1KOUA 3H9WA 4LLOB 1XKZA 3KSFA 3NECA 2Y55A 4F3LB 3NDEA 2PD8A 2V1BA 4XT2A 3IF6A 4RYEA 5DF7A 1F5MA 4B9OA 3HLDA 1MWTA 5U47A 2P9VB 3OC2A 2WKHA 2XQZA 4P85A 1CK3A 5FQ9A 2BG1A 1VETA 4NXGA 1AXBA 1IYSA 3D9YA 1WYCA 4Y0UA 3S7QA 4PM7A 1GHIA 3LICA 1PW1A 2V20A 4HNBA 2B5RA 1TS0A 3C4PA 2V0UA 4ZTKA 1ONGA 2PU4A 2W3HA 1FILA 1BLCA 4H6JA 4K0XA 4GKUA 2XEPA 2ZOHA 2VZWA 1TS6A 3FPVA 2XLNA 4LFUA 3VMAA 1J3WA 3FWLA 3I7JA 2ZC4B 3O86A 4B4XA 1ES5A 3HLFA 3S22A 1W7FA 4PM6A 2Y2OA 4IBRA 5GHXA 2VX8A 4UA6A 4F94A 1OMEA 5EVID 5CHUA 4Y5FA 2R78A 4FOFA 5IS1A 1PWGA 3QP4A 3UDIA 1NRJA 2ZL1B 1XJ2A 4O7DA 3GDIA 5KIZA 1OTAA 2IWDA 3SS4A 3KYQA 1GA9A 3NIAA 4HESA 2H0TA 1EWZA 4JF5A 1FCOA 2Z2MB 4KZ6A 4MBHA 1H0MA 5KMWA 4OKPA 3WS0A 3CUEA 3TOIA 1N9NA 4WF0A 2VLGA 5TBMA 3JYIA 2ZMVA 5MC7A 4E04A 1K56A 1T1AA 4WBGA 2BASA 1GSVA 1E3UD 4Z9QA 1VM1A 3IQAA 1FR1A 1I2SA 1S6RA 3BWLA 3EGDC 1L0GA 1HLUP 4NK3A 4R3BA 1RCJA 4HIAA 4P6BA 4EEPA 5HDDA 5EM1A 5DFXA 5F83A 1K38A 4Y2FA 2Y2NA 1WA9A 3BJNA 3TRCA 5M18A 1BTLA 1P9RA 5HWTA 2L1MA 1SCWA 4NXBA 4PKYG 1S4SA 4I3IA 5L10A 1SDNA 4DF6A 1BLHA 1S1YA 2X01A 3UPNA 4X6TA 3S7OA 5DTKA 5TR7A 2A24A 3FC7A 3IBJA 4L9GA 3BM6A 4E3IA 1T1BA 4GS9B 4JGQA 1NZOA 5KSHA 4N1XA 1KGGA 3DWZA 4GLQA 1P9WA 1ALQA 2V8FA 5M1AA 2QZ6A 3T1QB 4E3LA 1SHVA 3S7PA 3EEAA 3F1PA 1BT5A 4HBTA 4NXFA 1KDWA 1Q2PA 1DP6A 4CLCD 3P98A 2L4RA 3T4OA 2OAQ1 4L9EA 4LV2A 4AFIA 3BECA 5HW3A 1LHYA 4FH4A 3OPLA 1T19A 5L2FA 2ZC5B 4I38A 1ES3A 1XGJA 5TFQA 5DF9A 3MXQA 5HSQA 1E25A 4GHIB 1A0KA 1H5XA 1W8YA 2ZJ9A 1FOFA 2VK3A 5E2HA 4OQ0A 5DF8A 2EWVA 1KE4A 3IWQA 4Y0TA 3OPRA 2VGLS 3ZNTA 3PAEA 1VQQA 5FSRA 4S2KA 2XFTA 1ZG4A 3EEHA 3S7NA 4XXRA 4PM8A 3ISGA 5GL9A 1OTDA 4QPRA 1XGIA 2WAEA 2G2WA 5EVIB 4ZBEA 5HARA 3VP2A 1SKOA 1M40A 4DDYA 5L07A 2WKQA 4HHDA 1JTGA 4FTXA 4OLGA 4FSFA 3R4KA 3E4OA 1T18A 1LSXA 1Q2QA 2JKRM 1PZPA 4KZBA 3UE1A 1G28A 4II7A 5EPHA 1F2KA 3H82B 4KUKA 5E2EA 4DKIA 3A3JA 3MXRA 1GCEA 1L0EA 1WE4A 2QJ5A 4FUWA 4X25A 4EU0A 4OVDA 3ICYA 2P74A 4B93A 1TD5A 3EQVA 3B42A 3R7WB 1PI5A 1HZOA 4GD6A 2HZ5A 5E43A 4N1HA 2EX9A 3ZVWA 5GLBA 3V39A 3W4QA 1IKGA 2Y91A 5HX9A 2M7VA 1STZA 4MBFA 1ZHHB 4HP9A 1Y28A 3IWOA 5I5LA 1BLSA 2HP6A 3G2YA 4BL2A 4DE2A 3HJIA 1N9OA 1XJ3A 5HD3A 4ID4A 3OOVA 4EXOA 4GOGA 2O9AA 3WRTA 4MN7A 4E3OA 4GCZA 5FI7A 3D4FA 2OLUA 2Y2HA 3CPTA 5FA7A 5AQ7A 2HJEA 4R1GA 2INWA 3IF5A 4UAAA 1XX2A 5TJJA 4GB7A 1FR6A 3QNBA 3MSHA 4E6WA 4WEKA 1IYOA 1PFLA 2XF3A 4MCWA 3T4KA 1M6KA 3L7HA 2JBFA 3VOLA 4WUJA 3T4JA 2PAVP 3A3DA 4EEUA 3DTKA 3Q1FA 1CF0A 4KG2A 3E4PA 3EWKA 2WGWA 2FFYA 4R38A 4LV3A 4KUOA 4WMCA 2YKFA 3OCLA 1D7EA 4KQQA 4UA7A 3MZDA 1W79A 1BULA 1FQGA 4M4XA 4ZJ1A 1DRMA 3V3SA 3E2LA 2Y2MA 1YLZA 4JKTA 1W63M 2WGVA 5FI6A 3VE4A 4YFMA 4RQ9A 5G18A 3BFDA 3JPUA 3JVVA 2HF6A 3ZG5A 4OPYA 2FZ0A 5F1FA 4LRXC 5CHJA 2EA9A 1IELA 1TS8A 4KQRA 3MR0A 2OLVA 5J4EA 3SH8A 2QYBA 2G2UA 2W3EA 3CITA 1O07A 3UDFA 4LCLA 1VETB 3A0VA 3DTIA 5EM0A 2J3WA 1VEUB 3FV7A 5FAOA 3MQ0A 3NCKA 3KYEA 1OT9A 3AGEA 1H8YA 4QU3A 5FASA 5F69A 4IVIA 2AVXA 1XFNA 3A3IA 3LR5A 2KX6A 3Q81A 5F68A 4QJGA 3RXWA 3CHWP 4HI4A 3DWKA 2VA0A 3V67A 5A93A 5TGFA 4WZ4A 2PBDP 4EBLA 4DE1A 1K55C 4JBFA 1I5QA 2X02A 1P0ZA 3LIAA 3C8CA 2JKTM 2W1TA 1DJCA 3WS4A 4C75A 4XUXA 3BQ8A 3HLGA 2O0YA 3RH8B 3IHBA 2JKGA 2XGNA 3W2ZA 3PXPA 4EUZA 3C2WA 3F1NB 2EX6A 3F1OA 1K25A 4OLDA 2Y2IA 5I94A 4DN0A 2A2LA 3FG8A 5HL1A 3GRJA 1IYQA 2G7UA 3C5AA 4R6LA 4B4ZA 4Q0IA 5JYOA 1ONHA 1LT0A 3G4PA 3T1RA 3DW0A 3SS5A 5HL6A 5CEDA 3GR2A 2ZC6B 4WYYA 2PU2A 4B88A 4N92A 2HDQA 3P09A 3UY6A 5IU1A 4OP5A 3PR6A 3MQOA 3KYZA 3LO7A 4UA9A 4X69A 3BYDA 4HJ3A 1UGUA 1BUEA 4LV1A 3TG9A 3ZG9B 1NWZA 4JXVA 5G4ZA 3BLMA 2Y2PA 3V5MA 2WKEA 1MC0A 5CGWA 5HAQA 2DMWA 1P97A 2Y2LA 3DAVA 1ERMA 3IH8A 4PAUA 1OJGA 1V9ZA 2BTFP 3N6IA 4ARZA 2J3TC 2B95A 3SH9A 3VV4A 2JN7A 4BBUA 1KVMA 2KDKA 2WZZA 3VP3A 3IT9A 3ZCZA 2WAFA 1H8MA 1PRQA 4ME4A 1NLZA 3MFDA 1IYPA 2JC7A 4BBVA 4LV0A 4OOMA 5GHZA 3HCYA 5EECA 1K57C 2HDRA 4YWZA 5EVLA 4DJ3A 3G35A 4E3MA 4DE3A 2D02A 3ZDJA 2UWXA 4KENB 2E8IA 4S2NC 5FAQA 5J3WA 4ZDXA 4R4RA 2DNSA 4P6ZS 3IX3A 1YPRA 2VV7A 1L0FA 5HPIA 2P9VA 2Y2JA 3G2ZA 4S2LA 1S66L 2JKTI 1MZUA 4U0XA 3UB7A 1YT4A 3PAGA 3ZG7B 2Q9NA 4L0LA 4WL9A 2A3UA 5GLCA 1LSVA 4S2PA 5HWVA 4WMCD 1CEFA 2R9XA 2OWJA 2WZXA 3T50A 4Y0OA 3IH9A 2RL3A 1XA1A 2PYPA 5AVEA 4PHTA 3PBNA 1ES2A 3T1XA 3A0RA 4Q0JA 1U60A 4GDBA 1UWNX 2HDSA 1EW0A 4S2MA 3EQUA 2ZQ7A 3MFXA 4JF6A 4EQ1A 1BLPA 2XD5A 4JLFA 1K57A 2QPNA 5J8XA 2B18A 2PDRA 1XA7A 3BY8A 4N9KA 1PWCA 1MWSA 4S2NA 2W3GA 2ZLYA 1CQAA 1K54C 5DTSA 4KZ5A 1ZTUA 4RX3A 3BFCA 5CRFA 2ZOIA 3Q07A 4I3JA 2OV5A 3T4LA 3PBSA 1D06A 3W4PA 3UB8A 4QWOA 4OQHA 4O01A 4WELA 1L0DA 5F1GA 3BY9A 4WZ5C 5DTTA 3K3CA 2ZL1A 2GDNA 2JCHA 2XRNA 2HV1A 3Q7ZA 1Z09A 3IWIA 1Y54A 1WYBA 2QKPA 4RX2A 3LY3A 1FSWA 1SKOB 5LBRA 4JXSA 1ES4A 4OQIA 4WEJA 4ZJ3A 4LPZA 4DXBA 2C5WB 3OZHA 3G30A 4GN2A 4IBXA 4YNRA 2OWHA 1YKDA 3UPOA 1DP9A 2ZM0A 3PTEA 1Y4OA 3LR0A 1K6RA 4CPKA 2GX5A 3ZG8B 4ZRRA 3CAXA 4MN5A 4KQOA 4PKYA 4G3KA 1IFQA 5EOEA 4QHCA 4HQAA 2HGVA 1K54A 1LL5A 3RFBA 3GECA 5A90A 4MN6A 3LCEA 3SW1A 3O3VA 4KG6A 1ESUA 3VP1A 2V2FF 4WZ5A 4R3JA 3A0SA 2VGLM 5HDSA 1OT6A 4BD1A 4ESPA 4IUKA 2D01A 1ODVA 3N8SA 4JGPA 3LEZA 4UHUA 4I3AA 4X68A 3D3OA 3N4IA 3OCNA 3T4TA 1OPXA 2Z2LB 3C4OA 4LRYC 5HPFA 2Y8HA 4K0WA 3CPTB 4DRTA 2ZQ9A 3QNCA 3UB6A 4U0TA 1K0KA 2GZAA 3KSIA 1PZOA 2EFUA 5CGSA 1CI8A 4EW7A 4QD4A 2VV6A 3CWFA 4PMAA 4E3KA 2EX8A 5AQAA 1N9BA 2O99A 4NKPA 2W0NA 1MKMA 3QP6A 2H0YA 3LIFA 4JPMA 5CGXA 5EVIC 4R70A 2WGWB 4KZ9A 3H7WA 1FIKA 3D72A 4OOYA 1MY8A 3V50A 2R9WA 3VOZA 4BBTA 3CJMA 4S2IA 1VHMA 2J8YA 5CERA 3LI9A 2OAP1 2IA2A 4NEED 1YSPA 1YLTA 3WS2A 1AWIA 3BW6A 1JWZA 3IHAA 3ZNYA 5IHVA 1GHMA 1K56D 3Q7VA 2CC1A 2M7UA 1S0WA 1BYWA 3OPHA 3IX4A 5M19A 1YAXA 3QP8A 1PNEA 3LR4A 4HY8A 2J3TD 4UQIS 2LB5A 4Z1WA 4A5RA 4I5SA 1NLYA 4CQHA 1G6OA 3HJKA 3GV9A 1HVBA 4BMWA 5IT5A 1YLWA 1H8ZA 3C38A 5KZHA 1GSWA 1S67L 2JE5A 2Y59A 4RVAA 5CHMA 5HZHA 3TSGA 3NI9A 2I72A 2OSUA 3KO6A 5FEFA 1DP8A 3IX8A 3G34A 4X55A 3CMZA 3LEQA 1G5UA 3MJQA 3UMEA 2W1TB 3CLOA 4NETA 3RJUA 3H82A 3VE3A
chains in the Genus database with same CATH topology
1A0KA 2VK3A 1FIKA 1Y4OA 4X1LA 1J3WA 1VETB 5EM0A 1VEUB 3T1XA 3KYEA 3CPTA 1AWIA 2E8JA 3CHWP 5EVEA 2V8CA 3UB5P 3DAVA 1SZVA 3T1SA 3MSHA 4D60A 1PFLA 2BTFP 2PBDP 2ZL1B 3NECA 1SKOA 1VEUA 2B95A 4ESPA 1PNEA 3L7HA 4FTXA 1CQAA 1D1JA 2V8FA 1PRQA 3T12B 2JKFA 2PAVP 3T1QB 5FEGA 5FDSA 1CF0A 1F2KA 3NULA 4QWOA 2JKGA 5EV0A 3CPTB 3U4LP 2PRFA 1VETA 4X25A 4FUWA 1K0KA 2ZL1A 3D9YA 1Z09A 3MS6A 2ACGA 2HZ5A 5FEFA 4X1MA 1ACFA 1HLUP 1SKOB 3T1RA 1YPRA 3LEQA 1G5UA 3LGOA 1CJFA 3L9KA 5EM1A 1FILA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A0K A;  2VK3 A;  1FIK A;  1Y4O A;  4X1L A;  1J3W A;  1VET B;  5EM0 A;  1VEU B;  3T1X A;  3KYE A;  3CPT A;  1AWI A;  2E8J A;  3CHW P;  5EVE A;  2V8C A;  3UB5 P;  3DAV A;  1SZV A;  3T1S A;  3MSH A;  4D60 A;  1PFL A;  2BTF P;  2PBD P;  2ZL1 B;  3NEC A;  1SKO A;  1VEU A;  2B95 A;  4ESP A;  1PNE A;  3L7H A;  4FTX A;  1CQA A;  1D1J A;  2V8F A;  1PRQ A;  3T12 B;  2JKF A;  2PAV P;  3T1Q B;  5FEG A;  5FDS A;  1CF0 A;  1F2K A;  3NUL A;  4QWO A;  2JKG A;  5EV0 A;  3CPT B;  3U4L P;  2PRF A;  1VET A;  4X25 A;  4FUW A;  1K0K A;  2ZL1 A;  3D9Y A;  1Z09 A;  3MS6 A;  2ACG A;  2HZ5 A;  5FEF A;  4X1M A;  1ACF A;  1HLU P;  1SKO B;  3T1R A;  1YPR A;  3LEQ A;  1G5U A;  3LGO A;  1CJF A;  3L9K A;  5EM1 A;  1FIL A; 
#chains in the Genus database with same CATH topology
 3M6H A;  4DJ2 A;  3KX0 X;  3K3D A;  1KVL A;  4OPZ A;  3RXX A;  3BQA A;  1PW8 A;  2Y2G A;  2WGI A;  3W4O A;  1XXM A;  2MJ6 A;  3HUN A;  5DJU A;  4DE0 A;  3GVB A;  3WRZ A;  2DCF A;  4Y15 A;  1V9Y A;  1GSX A;  2I9V A;  4S2J A;  4XT2 B;  3LUQ A;  3IF6 B;  3LID A;  3FKV A;  1RGY A;  1TS7 A;  3PBT A;  1PI4 A;  2JKR I;  4BD0 A;  5F82 A;  5EVE A;  3UPP A;  4K91 A;  3M2K A;  3KSG A;  5CTM A;  2WYX A;  2M1C A;  4D60 A;  2HP9 A;  3WWX A;  2XA7 S;  1PIO A;  1KGE A;  3NY4 A;  3SZT A;  4CLC C;  1PWD A;  2XR0 A;  4EES A;  2Q0O A;  3O5Y A;  3CG5 A;  4X56 A;  2EXA A;  4LRZ E;  2JKF A;  3SH7 A;  1IOU A;  5KSC A;  3NDG A;  1W5D A;  3UB9 A;  1UWP X;  4H6J B;  1OTE A;  3CZD A;  3HLB A;  3QP5 A;  2VJW A;  5A8B A;  4MBK A;  3EOI A;  5CEC A;  5CX7 A;  5DKK A;  2EX2 A;  3IXD A;  1RP5 A;  4MNR A;  4O0P A;  4ETX A;  4EV4 A;  5CEB A;  4LCM A;  4RA7 A;  2PD7 A;  5DVA A;  4ARZ B;  1C3B A;  4DMZ A;  2Y2Q A;  2IWB A;  3LFV A;  1S4R A;  3LGO A;  2PYR A;  1QME A;  3ZVT A;  3IXB A;  1F9I A;  1T1C A;  4HP4 A;  1LL8 A;  1F98 A;  1RGZ A;  1BSG A;  3V3R A;  2PHY A;  4OON A;  4CLC E;  5GLD A;  5DJT A;  1ERQ A;  3MXS A;  5A91 A;  1LSW A;  4CLC A;  1MPL A;  2IWC A;  4OQG A;  4GD8 A;  1YMX A;  2OOL A;  1MWU A;  2EFX A;  3P01 A;  5FDH A;  3DBA A;  3IS2 A;  4P87 A;  4WM9 A;  2XSS A;  4KZ7 A;  5TBM B;  2CMN A;  2X71 A;  3M2J A;  1K55 A;  3TJZ C;  5EE8 A;  1K4E A;  2A49 A;  2WKR A;  5EUA A;  4E6X A;  2ZQA A;  1Z6F A;  2WUQ A;  1OJ5 A;  4EER A;  1VEU A;  1YSQ A;  4R3A A;  4BJP A;  3PHY A;  1NYM A;  1D1J A;  2LB9 A;  3MKF A;  1XJ6 A;  5FDS A;  2O9C A;  3E98 A;  4E3N A;  3VFH A;  3PYP A;  2ZM8 A;  1TVF A;  2PBY A;  3NUL A;  4IVK A;  3PBO A;  3MQQ A;  4GZB A;  5AJG A;  4YIN A;  3CUE C;  1KE0 A;  3BFF A;  1YMS A;  5HDC A;  3QP1 A;  3HRE A;  3SS3 A;  4ETZ A;  1DJA A;  5AVF A;  3HBR A;  4L9F A;  2VV8 A;  1YLY A;  2XDM A;  4QB8 A;  3BFE A;  4X1M A;  4OP8 A;  3NHQ A;  2Y2K A;  4PM5 A;  2NUP C;  2A24 B;  3F1N A;  4KZA A;  2J80 A;  5AQB A;  4F3L A;  3WS5 A;  5L8M A;  2FFF B;  2Q9M A;  3LI8 A;  3B3X A;  3N8R A;  4JF4 A;  4P6Z M;  4BLM A;  3HL9 A;  2HJ9 C;  1JNU A;  4M3K A;  4EUV A;  4NXE A;  4KQD A;  2E8J A;  2H5S A;  3RTY A;  4UEY A;  2BLS A;  4Y17 A;  3F1P B;  4E3J A;  1SZV A;  3T1S A;  4KZ8 A;  3NC8 A;  3T4S A;  5EFW A;  2Z6C A;  4Y7P A;  1X0O A;  3UE6 A;  2ZM2 A;  3MZE A;  2XH9 A;  2QJ7 A;  4LGW A;  2V1A A;  4D2O A;  2V9A A;  4Q0H A;  1YQS A;  2P04 A;  3CI6 A;  2KLI A;  3E4Q A;  4XUZ A;  2JHE A;  1SKF A;  2L0W A;  2ZQ8 A;  3MKE A;  3OLO A;  2GNX A;  2VGK A;  3S1Y A;  1FSY A;  4EBN A;  4IUH A;  4I39 A;  4C3Q A;  2PR5 A;  1I2W A;  1G6A A;  1NJ4 A;  5FAP A;  2ZC7 A;  2PR6 A;  1ZC2 A;  2ZC3 B;  4OOL A;  3EGX C;  4IHQ A;  4GJ4 A;  4R23 A;  1CJF A;  5J7E A;  5JYP A;  3L9K A;  1K4F A;  1EI5 A;  3HUO A;  3QP2 A;  1VB6 A;  1XP4 A;  4HBU A;  3Q82 A;  2K2N A;  1XPB A;  2J9P A;  1JWV A;  2DRW A;  5C5K A;  2ZBB A;  3M6B A;  4FD8 A;  4QY5 A;  3W8K A;  5D3O A;  3FZC A;  4QY6 A;  5FQI A;  5EOO A;  4EBP A;  5E2F A;  1TDL A;  1SDE A;  4HH2 A;  3IBR A;  1MWR A;  1H3Q A;  3VOY A;  1BZA A;  4Y13 A;  5HAP A;  1YM1 A;  1XFQ A;  3O87 A;  4X53 A;  3LYX A;  3KSH A;  1E4D A;  3ZGA B;  1KDS A;  1NXY A;  3VP0 A;  2FH5 A;  2HP5 A;  3NOT C;  4IJG A;  4FCF A;  3LIE A;  1K6S A;  3UO9 A;  1NY0 A;  3H7W B;  4HH3 A;  3VSL A;  5FQJ A;  3AGD A;  3C7U A;  3ZYT A;  3ZQ5 A;  5FEG A;  2J7V A;  4G3V A;  1TEM A;  2W27 A;  2YKH A;  5E2G A;  5FAT A;  4BL3 A;  3N8L A;  2KOI A;  3BEB A;  3U4L P;  4BWI A;  2PRF A;  2Y79 A;  4R0Q A;  4PPR A;  1YLP A;  2EXB A;  3N7W A;  1XJ4 A;  2Y4A A;  3E2K A;  4MDZ A;  2WKI A;  2P08 A;  3Q7V B;  1ZKJ A;  3C30 A;  3LY4 A;  3MS6 A;  4O8G A;  1ESI A;  5FQM A;  5F6A A;  1PYY A;  3HLE A;  4WLA A;  4GS9 A;  4YOF A;  3NOP C;  3UDX A;  2QHK A;  1J9M A;  3FPW A;  4BQM A;  2VKS A;  4EET B;  5A92 A;  2RCX A;  5AQ9 A;  2EWW A;  2K7S A;  4C6Y A;  3P7N A;  1CI9 A;  1MXO A;  1NYY A;  1OTI A;  2V0W A;  1HD8 A;  4KZ3 A;  3A3E A;  1NZU A;  4OH0 A;  5HWW A;  5DKL A;  2XRO A;  3O88 A;  4N9L A;  1LLB A;  4OPR A;  2P7J A;  2W3F A;  3ULF A;  3UB5 P;  1MKI A;  3G6O A;  5DFY A;  3T4Q A;  1MBL A;  3OPP A;  4NG2 A;  1NRF A;  2WK0 A;  4P0M A;  2XK1 A;  3NBL A;  4S2O A;  3AGF A;  3GMW A;  5FQK A;  3VSK A;  4GHI A;  4HEF A;  5HAI A;  5HD5 A;  2XFS A;  1JTD A;  4BEN A;  1L2S A;  2J9O A;  3VP4 A;  2VEA A;  1KGF A;  2WAD A;  5FL3 A;  3GSG A;  3OBF A;  4R4S A;  4U3T A;  1N4O A;  3QHY A;  2QMI A;  5EV0 A;  4JGR A;  3MF0 A;  3UE3 A;  2WKP A;  1KE3 A;  3BRM A;  2HDU A;  3ITA A;  3A3F A;  3G31 A;  4MLL A;  4GDN A;  4MEZ A;  2ZMF A;  4UQI M;  3FKW A;  1QMF A;  1ACF A;  1W63 Q;  1ZG6 A;  3UNW A;  2VGJ A;  3IXG A;  3VFF A;  5EVI A;  1S1Z A;  1LI9 A;  4GNU A;  4K08 A;  1YLJ A;  4H8R A;  4HJ4 A;  4HOI A;  1GA0 A;  1W8Q A;  4X1L A;  5CTN A;  5K5B A;  1LL9 A;  4ZJ2 A;  3MMH A;  4DDS A;  1LI0 A;  3MBZ A;  5L09 A;  4HJ6 A;  3ZFZ A;  3B33 A;  3ZG0 A;  3PBR A;  4WN5 A;  3WS1 A;  1O7E A;  4Q8I A;  2PT7 A;  3DTE A;  3HVF A;  2ZMA A;  1L3L A;  2ZQC A;  1E3U A;  3R7W A;  4LEN A;  3ITB A;  4KG5 A;  3F1O B;  2V1Z A;  2Z6D A;  4FH2 A;  5GHY A;  2W1R A;  3GTC A;  5FI2 A;  5BOH A;  4OPQ A;  3TW8 A;  1TF1 A;  3GQZ A;  4GW9 A;  3E0Y A;  2XD1 A;  4CJN A;  5FQQ A;  1TDG A;  3T12 B;  3JVU A;  4CLC B;  1IKI A;  4G3W A;  3HLW A;  1OTB A;  1HTZ A;  3ZHH A;  3UMD A;  3NJA A;  1CEG A;  5G4Y A;  1DY6 A;  3BLS A;  2UV0 E;  3IS2 B;  4IED A;  3HUM A;  4EWF A;  1FCM A;  4DXC A;  2XA7 M;  4JXW A;  4Y3I A;  2K31 A;  2HPB A;  2H10 A;  3LIB A;  2ACG A;  1GHP A;  3UE0 A;  4ZAM A;  3IF6 C;  3NOU C;  4JXG A;  5GLA A;  5F5Y A;  3B47 A;  3PBQ A;  5CXW A;  3BFG A;  2B02 A;  3UN7 A;  3IXH A;  3LR3 A;  1ERO A;  2H28 A;  1JWP A;  2O9B A;  4KZ4 A;  3G32 A;  1N9L A;  2NUT C;  2ZQD A;  3C7V A;  3S4X A;  2ZD8 A;  1G68 A;  4MMN A;  4JGO A;  5HFO A;  1FCN A;  4EQI A;  3HLC A;  3SOI A;  3MZF A;  3K2N A;  2GJ3 A;  2QWS A;  3FYZ A;  2C6W B;  2V8C A;  1IEM A;  4PM9 A;  1DJB A;  3U2A A;  3TE8 A;  2W3D A;  3DTM A;  1JVJ A;  1KOU A;  3H9W A;  4LLO B;  1XKZ A;  3KSF A;  3NEC A;  2Y55 A;  4F3L B;  3NDE A;  2PD8 A;  2V1B A;  4XT2 A;  3IF6 A;  4RYE A;  5DF7 A;  1F5M A;  4B9O A;  3HLD A;  1MWT A;  5U47 A;  2P9V B;  3OC2 A;  2WKH A;  2XQZ A;  4P85 A;  1CK3 A;  5FQ9 A;  2BG1 A;  1VET A;  4NXG A;  1AXB A;  1IYS A;  3D9Y A;  1WYC A;  4Y0U A;  3S7Q A;  4PM7 A;  1GHI A;  3LIC A;  1PW1 A;  2V20 A;  4HNB A;  2B5R A;  1TS0 A;  3C4P A;  2V0U A;  4ZTK A;  1ONG A;  2PU4 A;  2W3H A;  1FIL A;  1BLC A;  4H6J A;  4K0X A;  4GKU A;  2XEP A;  2ZOH A;  2VZW A;  1TS6 A;  3FPV A;  2XLN A;  4LFU A;  3VMA A;  1J3W A;  3FWL A;  3I7J A;  2ZC4 B;  3O86 A;  4B4X A;  1ES5 A;  3HLF A;  3S22 A;  1W7F A;  4PM6 A;  2Y2O A;  4IBR A;  5GHX A;  2VX8 A;  4UA6 A;  4F94 A;  1OME A;  5EVI D;  5CHU A;  4Y5F A;  2R78 A;  4FOF A;  5IS1 A;  1PWG A;  3QP4 A;  3UDI A;  1NRJ A;  2ZL1 B;  1XJ2 A;  4O7D A;  3GDI A;  5KIZ A;  1OTA A;  2IWD A;  3SS4 A;  3KYQ A;  1GA9 A;  3NIA A;  4HES A;  2H0T A;  1EWZ A;  4JF5 A;  1FCO A;  2Z2M B;  4KZ6 A;  4MBH A;  1H0M A;  5KMW A;  4OKP A;  3WS0 A;  3CUE A;  3TOI A;  1N9N A;  4WF0 A;  2VLG A;  5TBM A;  3JYI A;  2ZMV A;  5MC7 A;  4E04 A;  1K56 A;  1T1A A;  4WBG A;  2BAS A;  1GSV A;  1E3U D;  4Z9Q A;  1VM1 A;  3IQA A;  1FR1 A;  1I2S A;  1S6R A;  3BWL A;  3EGD C;  1L0G A;  1HLU P;  4NK3 A;  4R3B A;  1RCJ A;  4HIA A;  4P6B A;  4EEP A;  5HDD A;  5EM1 A;  5DFX A;  5F83 A;  1K38 A;  4Y2F A;  2Y2N A;  1WA9 A;  3BJN A;  3TRC A;  5M18 A;  1BTL A;  1P9R A;  5HWT A;  2L1M A;  1SCW A;  4NXB A;  4PKY G;  1S4S A;  4I3I A;  5L10 A;  1SDN A;  4DF6 A;  1BLH A;  1S1Y A;  2X01 A;  3UPN A;  4X6T A;  3S7O A;  5DTK A;  5TR7 A;  2A24 A;  3FC7 A;  3IBJ A;  4L9G A;  3BM6 A;  4E3I A;  1T1B A;  4GS9 B;  4JGQ A;  1NZO A;  5KSH A;  4N1X A;  1KGG A;  3DWZ A;  4GLQ A;  1P9W A;  1ALQ A;  2V8F A;  5M1A A;  2QZ6 A;  3T1Q B;  4E3L A;  1SHV A;  3S7P A;  3EEA A;  3F1P A;  1BT5 A;  4HBT A;  4NXF A;  1KDW A;  1Q2P A;  1DP6 A;  4CLC D;  3P98 A;  2L4R A;  3T4O A;  2OAQ 1;  4L9E A;  4LV2 A;  4AFI A;  3BEC A;  5HW3 A;  1LHY A;  4FH4 A;  3OPL A;  1T19 A;  5L2F A;  2ZC5 B;  4I38 A;  1ES3 A;  1XGJ A;  5TFQ A;  5DF9 A;  3MXQ A;  5HSQ A;  1E25 A;  4GHI B;  1A0K A;  1H5X A;  1W8Y A;  2ZJ9 A;  1FOF A;  2VK3 A;  5E2H A;  4OQ0 A;  5DF8 A;  2EWV A;  1KE4 A;  3IWQ A;  4Y0T A;  3OPR A;  2VGL S;  3ZNT A;  3PAE A;  1VQQ A;  5FSR A;  4S2K A;  2XFT A;  1ZG4 A;  3EEH A;  3S7N A;  4XXR A;  4PM8 A;  3ISG A;  5GL9 A;  1OTD A;  4QPR A;  1XGI A;  2WAE A;  2G2W A;  5EVI B;  4ZBE A;  5HAR A;  3VP2 A;  1SKO A;  1M40 A;  4DDY A;  5L07 A;  2WKQ A;  4HHD A;  1JTG A;  4FTX A;  4OLG A;  4FSF A;  3R4K A;  3E4O A;  1T18 A;  1LSX A;  1Q2Q A;  2JKR M;  1PZP A;  4KZB A;  3UE1 A;  1G28 A;  4II7 A;  5EPH A;  1F2K A;  3H82 B;  4KUK A;  5E2E A;  4DKI A;  3A3J A;  3MXR A;  1GCE A;  1L0E A;  1WE4 A;  2QJ5 A;  4FUW A;  4X25 A;  4EU0 A;  4OVD A;  3ICY A;  2P74 A;  4B93 A;  1TD5 A;  3EQV A;  3B42 A;  3R7W B;  1PI5 A;  1HZO A;  4GD6 A;  2HZ5 A;  5E43 A;  4N1H A;  2EX9 A;  3ZVW A;  5GLB A;  3V39 A;  3W4Q A;  1IKG A;  2Y91 A;  5HX9 A;  2M7V A;  1STZ A;  4MBF A;  1ZHH B;  4HP9 A;  1Y28 A;  3IWO A;  5I5L A;  1BLS A;  2HP6 A;  3G2Y A;  4BL2 A;  4DE2 A;  3HJI A;  1N9O A;  1XJ3 A;  5HD3 A;  4ID4 A;  3OOV A;  4EXO A;  4GOG A;  2O9A A;  3WRT A;  4MN7 A;  4E3O A;  4GCZ A;  5FI7 A;  3D4F A;  2OLU A;  2Y2H A;  3CPT A;  5FA7 A;  5AQ7 A;  2HJE A;  4R1G A;  2INW A;  3IF5 A;  4UAA A;  1XX2 A;  5TJJ A;  4GB7 A;  1FR6 A;  3QNB A;  3MSH A;  4E6W A;  4WEK A;  1IYO A;  1PFL A;  2XF3 A;  4MCW A;  3T4K A;  1M6K A;  3L7H A;  2JBF A;  3VOL A;  4WUJ A;  3T4J A;  2PAV P;  3A3D A;  4EEU A;  3DTK A;  3Q1F A;  1CF0 A;  4KG2 A;  3E4P A;  3EWK A;  2WGW A;  2FFY A;  4R38 A;  4LV3 A;  4KUO A;  4WMC A;  2YKF A;  3OCL A;  1D7E A;  4KQQ A;  4UA7 A;  3MZD A;  1W79 A;  1BUL A;  1FQG A;  4M4X A;  4ZJ1 A;  1DRM A;  3V3S A;  3E2L A;  2Y2M A;  1YLZ A;  4JKT A;  1W63 M;  2WGV A;  5FI6 A;  3VE4 A;  4YFM A;  4RQ9 A;  5G18 A;  3BFD A;  3JPU A;  3JVV A;  2HF6 A;  3ZG5 A;  4OPY A;  2FZ0 A;  5F1F A;  4LRX C;  5CHJ A;  2EA9 A;  1IEL A;  1TS8 A;  4KQR A;  3MR0 A;  2OLV A;  5J4E A;  3SH8 A;  2QYB A;  2G2U A;  2W3E A;  3CIT A;  1O07 A;  3UDF A;  4LCL A;  1VET B;  3A0V A;  3DTI A;  5EM0 A;  2J3W A;  1VEU B;  3FV7 A;  5FAO A;  3MQ0 A;  3NCK A;  3KYE A;  1OT9 A;  3AGE A;  1H8Y A;  4QU3 A;  5FAS A;  5F69 A;  4IVI A;  2AVX A;  1XFN A;  3A3I A;  3LR5 A;  2KX6 A;  3Q81 A;  5F68 A;  4QJG A;  3RXW A;  3CHW P;  4HI4 A;  3DWK A;  2VA0 A;  3V67 A;  5A93 A;  5TGF A;  4WZ4 A;  2PBD P;  4EBL A;  4DE1 A;  1K55 C;  4JBF A;  1I5Q A;  2X02 A;  1P0Z A;  3LIA A;  3C8C A;  2JKT M;  2W1T A;  1DJC A;  3WS4 A;  4C75 A;  4XUX A;  3BQ8 A;  3HLG A;  2O0Y A;  3RH8 B;  3IHB A;  2JKG A;  2XGN A;  3W2Z A;  3PXP A;  4EUZ A;  3C2W A;  3F1N B;  2EX6 A;  3F1O A;  1K25 A;  4OLD A;  2Y2I A;  5I94 A;  4DN0 A;  2A2L A;  3FG8 A;  5HL1 A;  3GRJ A;  1IYQ A;  2G7U A;  3C5A A;  4R6L A;  4B4Z A;  4Q0I A;  5JYO A;  1ONH A;  1LT0 A;  3G4P A;  3T1R A;  3DW0 A;  3SS5 A;  5HL6 A;  5CED A;  3GR2 A;  2ZC6 B;  4WYY A;  2PU2 A;  4B88 A;  4N92 A;  2HDQ A;  3P09 A;  3UY6 A;  5IU1 A;  4OP5 A;  3PR6 A;  3MQO A;  3KYZ A;  3LO7 A;  4UA9 A;  4X69 A;  3BYD A;  4HJ3 A;  1UGU A;  1BUE A;  4LV1 A;  3TG9 A;  3ZG9 B;  1NWZ A;  4JXV A;  5G4Z A;  3BLM A;  2Y2P A;  3V5M A;  2WKE A;  1MC0 A;  5CGW A;  5HAQ A;  2DMW A;  1P97 A;  2Y2L A;  3DAV A;  1ERM A;  3IH8 A;  4PAU A;  1OJG A;  1V9Z A;  2BTF P;  3N6I A;  4ARZ A;  2J3T C;  2B95 A;  3SH9 A;  3VV4 A;  2JN7 A;  4BBU A;  1KVM A;  2KDK A;  2WZZ A;  3VP3 A;  3IT9 A;  3ZCZ A;  2WAF A;  1H8M A;  1PRQ A;  4ME4 A;  1NLZ A;  3MFD A;  1IYP A;  2JC7 A;  4BBV A;  4LV0 A;  4OOM A;  5GHZ A;  3HCY A;  5EEC A;  1K57 C;  2HDR A;  4YWZ A;  5EVL A;  4DJ3 A;  3G35 A;  4E3M A;  4DE3 A;  2D02 A;  3ZDJ A;  2UWX A;  4KEN B;  2E8I A;  4S2N C;  5FAQ A;  5J3W A;  4ZDX A;  4R4R A;  2DNS A;  4P6Z S;  3IX3 A;  1YPR A;  2VV7 A;  1L0F A;  5HPI A;  2P9V A;  2Y2J A;  3G2Z A;  4S2L A;  1S66 L;  2JKT I;  1MZU A;  4U0X A;  3UB7 A;  1YT4 A;  3PAG A;  3ZG7 B;  2Q9N A;  4L0L A;  4WL9 A;  2A3U A;  5GLC A;  1LSV A;  4S2P A;  5HWV A;  4WMC D;  1CEF A;  2R9X A;  2OWJ A;  2WZX A;  3T50 A;  4Y0O A;  3IH9 A;  2RL3 A;  1XA1 A;  2PYP A;  5AVE A;  4PHT A;  3PBN A;  1ES2 A;  3T1X A;  3A0R A;  4Q0J A;  1U60 A;  4GDB A;  1UWN X;  2HDS A;  1EW0 A;  4S2M A;  3EQU A;  2ZQ7 A;  3MFX A;  4JF6 A;  4EQ1 A;  1BLP A;  2XD5 A;  4JLF A;  1K57 A;  2QPN A;  5J8X A;  2B18 A;  2PDR A;  1XA7 A;  3BY8 A;  4N9K A;  1PWC A;  1MWS A;  4S2N A;  2W3G A;  2ZLY A;  1CQA A;  1K54 C;  5DTS A;  4KZ5 A;  1ZTU A;  4RX3 A;  3BFC A;  5CRF A;  2ZOI A;  3Q07 A;  4I3J A;  2OV5 A;  3T4L A;  3PBS A;  1D06 A;  3W4P A;  3UB8 A;  4QWO A;  4OQH A;  4O01 A;  4WEL A;  1L0D A;  5F1G A;  3BY9 A;  4WZ5 C;  5DTT A;  3K3C A;  2ZL1 A;  2GDN A;  2JCH A;  2XRN A;  2HV1 A;  3Q7Z A;  1Z09 A;  3IWI A;  1Y54 A;  1WYB A;  2QKP A;  4RX2 A;  3LY3 A;  1FSW A;  1SKO B;  5LBR A;  4JXS A;  1ES4 A;  4OQI A;  4WEJ A;  4ZJ3 A;  4LPZ A;  4DXB A;  2C5W B;  3OZH A;  3G30 A;  4GN2 A;  4IBX A;  4YNR A;  2OWH A;  1YKD A;  3UPO A;  1DP9 A;  2ZM0 A;  3PTE A;  1Y4O A;  3LR0 A;  1K6R A;  4CPK A;  2GX5 A;  3ZG8 B;  4ZRR A;  3CAX A;  4MN5 A;  4KQO A;  4PKY A;  4G3K A;  1IFQ A;  5EOE A;  4QHC A;  4HQA A;  2HGV A;  1K54 A;  1LL5 A;  3RFB A;  3GEC A;  5A90 A;  4MN6 A;  3LCE A;  3SW1 A;  3O3V A;  4KG6 A;  1ESU A;  3VP1 A;  2V2F F;  4WZ5 A;  4R3J A;  3A0S A;  2VGL M;  5HDS A;  1OT6 A;  4BD1 A;  4ESP A;  4IUK A;  2D01 A;  1ODV A;  3N8S A;  4JGP A;  3LEZ A;  4UHU A;  4I3A A;  4X68 A;  3D3O A;  3N4I A;  3OCN A;  3T4T A;  1OPX A;  2Z2L B;  3C4O A;  4LRY C;  5HPF A;  2Y8H A;  4K0W A;  3CPT B;  4DRT A;  2ZQ9 A;  3QNC A;  3UB6 A;  4U0T A;  1K0K A;  2GZA A;  3KSI A;  1PZO A;  2EFU A;  5CGS A;  1CI8 A;  4EW7 A;  4QD4 A;  2VV6 A;  3CWF A;  4PMA A;  4E3K A;  2EX8 A;  5AQA A;  1N9B A;  2O99 A;  4NKP A;  2W0N A;  1MKM A;  3QP6 A;  2H0Y A;  3LIF A;  4JPM A;  5CGX A;  5EVI C;  4R70 A;  2WGW B;  4KZ9 A;  3H7W A;  1FIK A;  3D72 A;  4OOY A;  1MY8 A;  3V50 A;  2R9W A;  3VOZ A;  4BBT A;  3CJM A;  4S2I A;  1VHM A;  2J8Y A;  5CER A;  3LI9 A;  2OAP 1;  2IA2 A;  4NEE D;  1YSP A;  1YLT A;  3WS2 A;  1AWI A;  3BW6 A;  1JWZ A;  3IHA A;  3ZNY A;  5IHV A;  1GHM A;  1K56 D;  3Q7V A;  2CC1 A;  2M7U A;  1S0W A;  1BYW A;  3OPH A;  3IX4 A;  5M19 A;  1YAX A;  3QP8 A;  1PNE A;  3LR4 A;  4HY8 A;  2J3T D;  4UQI S;  2LB5 A;  4Z1W A;  4A5R A;  4I5S A;  1NLY A;  4CQH A;  1G6O A;  3HJK A;  3GV9 A;  1HVB A;  4BMW A;  5IT5 A;  1YLW A;  1H8Z A;  3C38 A;  5KZH A;  1GSW A;  1S67 L;  2JE5 A;  2Y59 A;  4RVA A;  5CHM A;  5HZH A;  3TSG A;  3NI9 A;  2I72 A;  2OSU A;  3KO6 A;  5FEF A;  1DP8 A;  3IX8 A;  3G34 A;  4X55 A;  3CMZ A;  3LEQ A;  1G5U A;  3MJQ A;  3UME A;  2W1T B;  3CLO A;  4NET A;  3RJU A;  3H82 A;  3VE3 A; 
#chains in the Genus database with same CATH homology
 1A0K A;  2VK3 A;  1FIK A;  1Y4O A;  4X1L A;  1J3W A;  1VET B;  5EM0 A;  1VEU B;  3T1X A;  3KYE A;  3CPT A;  1AWI A;  2E8J A;  3CHW P;  5EVE A;  2V8C A;  3UB5 P;  3DAV A;  1SZV A;  3T1S A;  3MSH A;  4D60 A;  1PFL A;  2BTF P;  2PBD P;  2ZL1 B;  3NEC A;  1SKO A;  1VEU A;  2B95 A;  4ESP A;  1PNE A;  3L7H A;  4FTX A;  1CQA A;  1D1J A;  2V8F A;  1PRQ A;  3T12 B;  2JKF A;  2PAV P;  3T1Q B;  5FEG A;  5FDS A;  1CF0 A;  1F2K A;  3NUL A;  4QWO A;  2JKG A;  5EV0 A;  3CPT B;  3U4L P;  2PRF A;  1VET A;  4X25 A;  4FUW A;  1K0K A;  2ZL1 A;  3D9Y A;  1Z09 A;  3MS6 A;  2ACG A;  2HZ5 A;  5FEF A;  4X1M A;  1ACF A;  1HLU P;  1SKO B;  3T1R A;  1YPR A;  3LEQ A;  1G5U A;  3LGO A;  1CJF A;  3L9K A;  5EM1 A;  1FIL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...