4JGOA

The crystal structure of sporulation kinase d sensor domain from bacillus subtilis subsp.
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
206
structure length
206
Chain Sequence
EKDTIAAEHKQEASVLLNLHRNKINYLIGETMARMTSLSIAIDRPVDIKKMQSILEKTFDSEPRFSGLYFLNAKGDVTASTTELKTKVNLADRSFFIKAKETKKTVISDSYSSRITGQPIFTICVPVLDSKRNVTDYLVAAIQIDYLKNLINLLSPDVYIEVVNQDGKMIFASGQASHAEDQKPVSGYLDDISWNMKVYPNPVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sporulation kinase D
publication title Insight into the sporulation phosphorelay: Crystal structure of the sensor domain of Bacillus subtilis histidine kinase, KinD.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Transferase
total genus 56
structure length 206
sequence length 206
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2013-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4jgoA02
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4jgoA01
2VV6A 1XFNA 3K3CA 4WUJA 2D02A 2K7SA 2W27A 4EEUA 5KIZA 3MJQA 1TS6A 3NOTC 1S67L 4HIAA 4EXOA 5G4ZA 2Z6DA 1S1YA 3NHQA 2EA9A 3C8CA 1DP8A 2PYRA 4EESA 4H6JB 3UB7A 2INWA 2VEAA 2I9VA 2VLGA 4LPZA 3GDIA 1T18A 2A24A 4E04A 3A0VA 5HDDA 5TBMA 1Y28A 4HP9A 4WN5A 4NXBA 1OTDA 1DP9A 4XT2A 4L9FA 1DP6A 1P0ZA 4I5SA 2V9AA 4NXGA 3H82A 3RH8B 1JNUA 2OWHA 3E4OA 4GS9B 4EQ1A 2QKPA 1OTEA 3FC7A 4I3JA 3LICA 3MQOA 3NOUC 3EWKA 1OJGA 3PYPA 2KDKA 1DRMA 4KUKA 4RQ9A 3OLOA 1OT6A 1S1ZA 3HJIA 2L0WA 3IS2B 4H6JA 4JGQA 3GECA 4MN5A 2WKRA 2J80A 4KUOA 1OT9A 1GSWA 1T19A 1XJ3A 2PR5A 1UGUA 3T50A 1XJ6A 3VE4A 3VE3A 4PKYG 3KX0X 1N9NA 5J3WA 1V9ZA 4PKYA 4HQAA 3K3DA 2L4RA 4L9GA 4HHDA 1EW0A 1OTAA 4GS9A 5A8BA 4DJ3A 2QJ5A 2QHKA 4YWZA 1TS0A 5I5LA 5HWWA 5AVFA 1LSVA 4HJ3A 2Z6CA 3E4PA 3F1PB 5DJTA 4R70A 3ZQ5A 4DJ2A 4I38A 2V0UA 4WLAA 4KQDA 1LSXA 2WKQA 1VB6A 3LI8A 1OJ5A 4WL9A 4EW7A 5G4YA 2V0WA 1LT0A 3IS2A 4NXFA 1N9OA 2ZOIA 3EEHA 4F3LB 3NJAA 1GSVA 1ODVA 2PDRA 3P7NA 1D06A 4GW9A 1D7EA 2L1MA 4GHIB 4LRZE 4K08A 1S66L 1GSXA 4MN6A 4LLOB 4LRYC 3MXQA 3LIBA 1OTIA 5F69A 5DKKA 3UB9A 2OOLA 1BYWA 2KX6A 2PD8A 1XFQA 3FG8A 3F1PA 2PD7A 1WA9A 2HV1A 2M1CA 3ICYA 1NWZA 2V1AA 3D72A 4HH2A 1F9IA 3H9WA 4HOIA 4NXEA 3CWFA 4BBUA 3HJKA 4WF0A 5J7EA 2PR6A 4HH3A 2QJ7A 2B02A 4F3LA 3PHYA 2CMNA 2VV8A 3E4QA 2W0NA 4HJ6A 4EERA 1V9YA 1XJ4A 4GHIA 3UE6A 1P97A 3LIDA 3BY9A 3LI9A 3MQQA 2D01A 2QWSA 5F5YA 2BASA 5HD5A 5J4EA 3LIFA 5AVEA 1X0OA 5IU1A 3LUQA 1T1CA 5IS1A 5DJUA 5EFWA 1F98A 2ZBBA 5F6AA 2PHYA 4GCZA 4I3IA 3MR0A 4BBTA 2JHEA 4B9OA 4JGOA 3F1OB 3BWLA 4EETB 3H7WB 2R78A 3MFXA 5HZHA 5HWVA 2YKFA 3G6OA 4M4XA 4L9EA 3VOLA 2WKPA 3UMEA 1KOUA 2YKHA 5HWTA 3C2WA 5F68A 2V1BA 3SW1A 1OTBA 1XJ2A 3LIAA 3UB8A 3A0RA 3LIEA 3F1NA 5DKLA 1UWPX 2JN7A 1TS7A 3A0SA 1S4SA 4LRXC 3UB6A 2PYPA 4HY8A 3CAXA 4R38A 1S4RA 5HSQA 4JGRA 1LL8A 3IBRA 3LYXA 4HI4A 3F1OA 1N9LA 3H7WA 1T1AA 2GJ3A 1MZUA 5HD3A 4HJ4A 3ULFA 2P7JA 4HP4A 3B33A 1LSWA 2H28A 4JGPA 4R3AA 3NOPC 2OWJA 4EEPA 4I39A 4HNBA 2A24B 1TS8A 1UWNX 5TBMB 4R6LA 5HDCA 3F1NB 2VV7A 2ZOHA 3UMDA 4XT2B 3RTYA 3BY8A 5HDSA 4I3AA 3H82B 1T1BA 1G28A 4BBVA 3CLOA
chains in the Genus database with same CATH superfamily
2VV6A 4NK3A 1A0KA 4DE2A 3K3CA 2JKFA 2D02A 1PWDA 4EEUA 4K91A 3AGFA 1L2SA 2J3WA 3NOTC 5EVIA 2VGJA 2UV0E 5EM1A 3HUMA 3ZHHA 1P9WA 4EUZA 2ZM0A 2EA9A 3JPUA 4YFMA 3T1QB 2PAVP 1IYQA 1SDNA 3UB7A 3OOVA 1BT5A 4ZJ2A 2V2FF 2VGKA 4BD0A 4F94A 3BJNA 4FH4A 2IWCA 1D1JA 1T18A 4QPRA 4FUWA 2FFFB 1WYBA 3A0VA 5HDDA 5FDSA 3QNCA 3QP8A 4S2KA 1TEMA 1CI8A 3MFDA 2HF6A 4KQOA 4WN5A 4NXBA 1DP9A 1S6RA 2WKHA 4ARZA 4I5SA 4NXGA 3RH8B 1JNUA 2HDQA 3ZG5A 3E4OA 3GSGA 4GS9B 4UQIM 3NDEA 1MBLA 2XQZA 3ITBA 3MQOA 3UPOA 3OPHA 3KYQA 3FYZA 1SCWA 2GX5A 2QPNA 3NECA 3PBQA 3IBJA 3HLBA 3OLOA 1S1ZA 5FEFA 2ZD8A 4U0TA 5CTMA 4H6JA 3W4QA 4JGQA 4A5RA 3GECA 4CLCA 2WKRA 2GNXA 4WZ5A 3BFEA 2G7UA 3HVFA 1Y54A 4ZDXA 4E6XA 4R3BA 4DF6A 4MBHA 3CMZA 1W63Q 2ZM8A 4NETA 1IELA 3O86A 5HAIA 4PAUA 3EOIA 3VE3A 2PRFA 3VSKA 1SKFA 3KSHA 5J3WA 4YOFA 4S2NC 2L4RA 1WYCA 2R9WA 2XK1A 1OTAA 4ESPA 5A8BA 2O99A 3EGDC 3T4LA 3CITA 3C30A 3WRZA 1TS0A 3N8SA 3B47A 1PZPA 2VJWA 1HD8A 1KVLA 3QP2A 5IHVA 4R70A 3LR3A 1O7EA 1OPXA 3VFFA 2V0UA 1LSXA 2VA0A 2XA7S 5E2GA 2WZXA 4WL9A 3IXHA 4OQIA 3V5MA 2M7VA 1LT0A 3IS2A 4NXFA 4OPYA 1PNEA 4CQHA 1N9OA 5FQKA 4QY5A 3VP3A 1ODVA 2W3FA 3ZG0A 3FKWA 1J3WA 1ES2A 1LL5A 3N8RA 1NY0A 4GHIB 3O3VA 2OAQ1 1S66L 2P04A 1GSXA 4OQGA 3HLDA 3D4FA 3MXQA 1K6RA 3PAGA 4OPZA 2VKSA 1DJAA 3UB9A 3UDXA 4ETZA 2Y4AA 2W1TA 3EQUA 4DRTA 1G68A 1DJBA 2ZMVA 2PD8A 1STZA 1XFQA 1HVBA 3Q82A 4G3VA 4OH0A 3F1PA 5BOHA 3DTMA 2ZQ7A 1KGGA 1L3LA 5FSRA 4ZTKA 4B93A 1NWZA 1S0WA 1F9IA 1XPBA 2ZLYA 3OPLA 3V50A 3RXXA 1K55A 4WF0A 4H8RA 4F3LA 3VP0A 5GLBA 2FZ0A 3G4PA 2W0NA 2ZL1A 3KSGA 2PBDP 3T4KA 1V9YA 3Q07A 1PI5A 3BECA 2VGLS 3LIDA 3BY9A 4BL2A 2NUTC 4IHQA 4HBUA 5FQQA 4BWIA 5CERA 3LIFA 5AVEA 3QP4A 5DFYA 2DRWA 4P85A 3T4JA 4FD8A 2JKGA 1E3UD 4Y15A 4II7A 2XLNA 1O07A 1T1CA 3PTEA 2Y91A 5IS1A 3ZGAB 2ACGA 5GLAA 5FASA 3TSGA 4JBFA 5G18A 3OPRA 3L9KA 1RGZA 3C5AA 5HL1A 1MWRA 4LENA 3ZVTA 3HLWA 3MR0A 4E3OA 1CI9A 3BYDA 3F1OB 3S7PA 3BWLA 1XXMA 2R78A 3MZFA 3IF6C 4OKPA 4X6TA 4WMCA 1Z09A 3HLFA 2EX8A 3G6OA 1XP4A 3A3FA 4IVIA 2ZJ9A 2YKHA 3NY4A 3FWLA 5CX7A 2V1BA 5FDHA 2JKRI 5EVID 1VEUB 1OTBA 3IF6B 5JYPA 5DKLA 3UDIA 2JN7A 4BMWA 3S22A 1KDSA 4B4XA 3A0SA 4B4ZA 5I94A 2B18A 4LRXC 1GCEA 4PPRA 1SKOA 4Y2FA 5HSQA 4JGRA 4GZBA 1LL8A 4Q0HA 4IJGA 1K6SA 3H7WA 4IEDA 2EX6A 4KZAA 2PU2A 4IVKA 3ULFA 4HP4A 3A3IA 3WS2A 4LV1A 4KENB 4C75A 4DXCA 4JGPA 4PM7A 2OWJA 3S7NA 1ESUA 2XR0A 4K0WA 1LHYA 2A24B 2J8YA 3ZFZA 3Q7VB 3NDGA 1BLCA 3PBOA 1MWUA 1FCOA 4OOYA 2ZQ9A 2JKTM 4EBNA 4XT2B 3RTYA 3BY8A 1RP5A 5HDSA 3LEQA 4DDSA 2MJ6A 1IYOA 4E3LA 2ZQ8A 1G28A 4OLGA 3CLOA 4GJ4A 4Q0JA 4KZBA 1GHPA 4UEYA 2C6WB 2XEPA 1U60A 2DNSA 1IOUA 4CLCD 5KIZA 3MJQA 1TS6A 2E8JA 1FCNA 4Y0UA 3IX4A 4GD6A 5G4ZA 2Z6DA 1S1YA 4KZ6A 3VV4A 2JE5A 5DVAA 2HJEA 4OPRA 4O7DA 4MBFA 3PXPA 4KG2A 4HESA 2HDSA 4U3TA 1YLZA 1IKIA 1GA0A 4S2OA 1ZHHB 2XA7M 1SDEA 3JVVA 3MZDA 4L0LA 3W8KA 3GDIA 4DMZA 3D9YA 5GLCA 5F83A 1Y28A 4E3NA 2WGWA 4QB8A 4ZRRA 3CUEA 1OTDA 4L9FA 2V8FA 1P0ZA 5HW3A 2V9AA 4FOFA 5KSHA 3OCNA 2OWHA 4X25A 1GHIA 2Y2GA 1OTEA 3FC7A 4I3JA 3LICA 4GLQA 4IUKA 1OJGA 4OLDA 1W7FA 1FR6A 1I2WA 4KUKA 2R9XA 1TDLA 4NEED 1IKGA 1OT6A 1FQGA 1CQAA 1LI0A 3HJIA 3IF5A 4E3MA 1PIOA 3G35A 5AQ9A 4S2NA 2J80A 4KUOA 1OT9A 2W3HA 2HJ9C 5FA7A 1FOFA 1GSWA 3C7VA 1T19A 1UGUA 1N9BA 2J3TC 4Y7PA 5TGFA 3VE4A 1BZAA 3HBRA 1NYMA 2JBFA 3MKEA 4PKYG 3KX0X 3MS6A 4PKYA 4E6WA 4O01A 3AGEA 3E2LA 1HTZA 2VGLM 4HQAA 3DW0A 5M19A 4S2PA 3WWXA 5CGXA 2CC1A 3SS3A 4X53A 3EEAA 4MMNA 4S2MA 5HWWA 3TJZC 2V8CA 1LSVA 4HJ3A 1CF0A 2Y2QA 5DJTA 3T12B 2VX8A 2XFSA 4I38A 4WLAA 4C3QA 2WKQA 1OJ5A 1H8ZA 4DKIA 3IT9A 5G4YA 2V0WA 1VETA 3IQAA 3EEHA 3TOIA 1Q2PA 2X71A 3MF0A 5DTTA 3LY4A 3FPWA 2XRNA 2G2WA 2PDRA 3HUNA 3FV7A 4GW9A 1TD5A 4EUVA 1VQQA 4LLOB 4LRYC 4WBGA 4KZ8A 3N7WA 2Y2JA 5GHZA 3IX3A 3KYEA 2OOLA 2Y59A 5F82A 4QU3A 3VFHA 4GD8A 3ZG9B 4WYYA 3Q7ZA 3BLSA 4CJNA 5AQBA 4WMCD 4DXBA 4EU0A 4WZ4A 4N9LA 3E0YA 2DCFA 4GKUA 3DWKA 3IWOA 1JWZA 2ZQAA 3LFVA 5E43A 1WA9A 2HV1A 4OP8A 2M1CA 3ICYA 3HL9A 5HX9A 3H9WA 4HOIA 3T1XA 1GHMA 3PBSA 3QP1A 5J7EA 2PR6A 4HH3A 2QJ7A 2WKEA 2W3EA 3IHBA 4LGWA 2CMNA 4QD4A 2VV8A 1CJFA 1KE3A 3E4QA 3KO6A 1W8YA 4HJ6A 1YM1A 2Y79A 3VSLA 1XJ4A 2P9VA 2HGVA 2PBYA 3MSHA 1YKDA 1ALQA 5A90A 2XSSA 3JVUA 2GZAA 4S2JA 3QHYA 3RXWA 5MC7A 2BASA 2C5WB 5HD5A 5A91A 3HLEA 1H5XA 1F2KA 5TFQA 1X0OA 5FATA 1YAXA 5IU1A 3CPTA 2BG1A 2EXAA 4UA9A 5DJUA 5EFWA 5U47A 3ZG7B 3ITAA 3MZEA 1VHMA 4QJGA 3GR2A 2ZBBA 2OAP1 4I3IA 1PRQA 3HREA 1M40A 1Y4OA 1MPLA 4ETXA 5CGSA 2JHEA 1IYPA 1MKIA 4R1GA 4G3KA 4JPMA 5F1GA 4RX3A 5CHMA 1N4OA 4MBKA 2Y2MA 3MFXA 5CEDA 1PI4A 5HZHA 2KOIA 3DTKA 5JYOA 2QZ6A 2ZC4B 3WRTA 3CG5A 3NBLA 4ZAMA 3UNWA 2HDRA 4YNRA 2E8IA 5CHUA 3R7WB 3UMEA 3M2JA 3ZYTA 1G6OA 2BLSA 2Q9MA 5EVIC 4Y5FA 3MBZA 4WELA 3N8LA 3Q7VA 3LIAA 2I72A 3UB8A 3UPNA 1G5UA 1YLPA 5FQIA 1I2SA 2W1RA 1IFQA 4O8GA 4M3KA 4KZ3A 3SH7A 2HP6A 1S4SA 2EFUA 3UB6A 2HP9A 3IWQA 4HY8A 3WS5A 5EVLA 1YLYA 5EVIB 4JF6A 4RYEA 3IBRA 1N9LA 1PW8A 1JWVA 1ESIA 2A49A 1XGIA 4OPQA 2GJ3A 4EV4A 3OPPA 4AFIA 2P74A 3UE0A 4D60A 1HLUP 4QY6A 3S7OA 1ES4A 1TVFA 5L8MA 4NG2A 1H3QA 4RA7A 3FPVA 4MLLA 4R6LA 5HDCA 5EVEA 3T1RA 3AGDA 1YPRA 3UE1A 1K4EA 4ARZB 1C3BA 1QMEA 4KZ7A 4FTXA 4OOLA 1K25A 4N9KA 1NZUA 5L07A 4E3JA 4EWFA 4CLCC 1XFNA 3T1SA 2W27A 4WZ5C 2AVXA 4CLCE 5FAPA 2ZC6B 4IBXA 1S67L 2FFYA 1XX2A 1BLPA 1FILA 4EQIA 3L7HA 3IWIA 4EXOA 5E2HA 4X56A 1YLJA 5HARA 1DP8A 3MXRA 3PAEA 2K31A 2PYRA 4JLFA 4GDBA 1W8QA 1L0EA 4H6JB 4CLCB 2VEAA 2B95A 4KG5A 3W2ZA 4BQMA 1CEGA 4OQ0A 2I9VA 4LV3A 3W4OA 1YT4A 2XFTA 1MWSA 4LPZA 4ZBEA 1RCJA 4P0MA 4PHTA 5TBMA 3MKFA 5GLDA 1ONGA 1PFLA 1WE4A 5EV0A 5IT5A 1SHVA 2Y2OA 3WS4A 1DP6A 3TE8A 2X02A 4UHUA 3H82A 2H10A 1JVJA 2A2LA 2A3UA 4EQ1A 2Y2IA 3G31A 1NRFA 3B42A 3WS0A 5CRFA 4UA7A 1IEMA 3EWKA 5J8XA 1MY8A 3SS5A 1YLTA 4WM9A 2KDKA 3ZCZA 3DTEA 3BFFA 1J9MA 5DFXA 4P87A 1W79A 1YLWA 4OOMA 3BLMA 3N4IA 4DE1A 2OV5A 3IS2B 5FI7A 2O9BA 3LR4A 2ZQCA 5AJGA 3HLGA 2VK3A 3UO9A 5EE8A 5GHYA 3BM6A 3UY6A 2PR5A 1NJ4A 3MQ0A 4IUHA 1XJ6A 4Y13A 5L10A 4JKTA 3NCKA 5CEBA 1N9NA 4N1XA 3D3OA 4WEKA 3K3DA 2W1TB 1K57C 3C38A 1EW0A 4MCWA 4GS9A 5EM0A 5FQ9A 2ZC3B 4DJ3A 2QJ5A 3VP4A 3IXGA 4XXRA 5EECA 1BLHA 2EX9A 5I5LA 3ISGA 2Z6CA 3F1PB 3ZQ5A 3T4TA 4DJ2A 2XGNA 4KQDA 1ZC2A 1VB6A 3LI8A 2NUPC 3S7QA 4NKPA 5HL6A 3S4XA 1L0GA 3LGOA 4EW7A 3IX8A 1NLYA 2DMWA 3OC2A 4F3LB 3NJAA 4X68A 2ZL1B 4Q0IA 4KZ4A 3P7NA 1D06A 1D7EA 2L1MA 4OONA 4LRZE 1PWCA 2FH5A 3QP6A 4DE3A 2Y2HA 2J7VA 4IBRA 2Y2LA 5DKKA 5HAQA 1ACFA 3CI6A 1YMXA 2OSUA 2B5RA 1G6AA 2J9OA 2J9PA 3QNBA 3GQZA 1H8MA 2KX6A 3FG8A 2H0TA 1JTDA 3BFGA 4LFUA 1LI9A 3GV9A 2O9AA 5GHXA 4X55A 4LV0A 4HH2A 4BBUA 4Z9QA 4Y3IA 2GDNA 2WGIA 4MNRA 2B02A 1K38A 2W3DA 2Y8HA 3PHYA 3A3EA 3SS4A 2ZMAA 2Q0OA 3V67A 3WS1A 4GHIA 3VP1A 1TDGA 3GTCA 1AWIA 3SH8A 1P97A 3ZNYA 5C5KA 1JTGA 1RGYA 2D01A 4D2OA 5F5YA 5J4EA 3BQAA 5FQJA 3BRMA 3IH9A 1YMSA 1QMFA 4QHCA 1KE0A 4ME4A 2H0YA 2XH9A 4GDNA 2LB5A 4PM6A 2W3GA 5FI2A 1EI5A 5F6AA 1SKOB 4GCZA 3CJMA 4E3IA 4KZ9A 4Y17A 1PZOA 3PR6A 4BBTA 3OBFA 5K5BA 3M6BA 3H7WB 3BW6A 1PW1A 3DAVA 4GN2A 1XA7A 1XGJA 2M7UA 1ONHA 4MDZA 5F1FA 3K2NA 3G34A 1PYYA 4R0QA 3GRJA 3IH8A 4PM5A 2WKPA 1KOUA 4OP5A 5HWTA 3NULA 4BL3A 1KGEA 5F68A 2BTFP 2Y2PA 3UDFA 3SW1A 4ID4A 4Q8IA 1F5MA 3A0RA 4OQHA 4O0PA 1ZG6A 4DN0A 2K2NA 3HUOA 4KG6A 1UWPX 5L09A 4GNUA 3RFBA 5CXWA 4R38A 1LLBA 1FCMA 5DTKA 1OMEA 2WAFA 3F1OA 4HI4A 5A93A 2WYXA 1H0MA 3FZCA 3M6HA 3CUEC 5HD3A 4HJ4A 2IWDA 2P7JA 3MMHA 5FAQA 1LSWA 2H28A 4LCLA 4DDYA 2ZM2A 3HLCA 2G2UA 3C4OA 3E98A 3NOPC 4KZ5A 2PT7A 2XF3A 4I39A 4DE0A 4HNBA 1K54C 1CEFA 2XDMA 1DY6A 3F1NB 1VEUA 4Z1WA 4PM9A 2WGWB 5EOEA 3S1YA 1YQSA 2VV7A 1XA1A 3B3XA 3IF6A 2ZOHA 3NI9A 2J3TD 1EROA 4FSFA 4I3AA 3W4PA 4UA6A 5CTNA 2WZZA 1KVMA 5FAOA 1T1BA 4BBVA 1BTLA 1K4FA 3DTIA 1ERMA 4P6ZS 2WAEA 3DWZA 4WUJA 2QMIA 3PBTA 4LV2A 3Q81A 4FCFA 2K7SA 5HPIA 3HCYA 2WKIA 2ZMFA 2HDUA 3EQVA 3VOZA 3VOYA 3TG9A 4S2LA 4HIAA 4GB7A 3NHQA 2O0YA 3C8CA 4N1HA 1Q2QA 4LCMA 2WADA 4PM8A 4EESA 3KSFA 1FSWA 3OCLA 2INWA 5CHJA 4C6YA 3E2KA 5TJJA 2VLGA 4B88A 2A24A 4E04A 4ZJ3A 4R3JA 4HP9A 1M6KA 2RCXA 4XT2A 1YSPA 2ZC5B 2V1ZA 4K0XA 3IXBA 3V3SA 3G2ZA 2XROA 5HAPA 2QKPA 3O87A 2RL3A 3VMAA 3NOUC 1BLSA 2PU4A 3PYPA 5HFOA 3KYZA 1DRMA 4RQ9A 2OLUA 2Q9NA 2WK0A 1K56A 1KE4A 2EFXA 3LY3A 3ZVWA 3EGXC 2L0WA 1VETB 1PWGA 1CK3A 4MN5A 2JKRM 4Y0TA 3SOIA 4KQQA 5FEGA 1MWTA 1K57A 2QYBA 5CGWA 1AXBA 5FL3A 3ZG8B 5EOOA 1H8YA 3LR0A 1XJ3A 3T50A 1P9RA 3JYIA 3V3RA 4QWOA 3DBAA 2IA2A 1BULA 1E25A 1LL9A 1BSGA 1SZVA 4XUXA 1V9ZA 3IHAA 3V39A 2EXBA 2HZ5A 4L9GA 3T4SA 4HHDA 1I5QA 5DF8A 3P01A 2OLVA 1EWZA 3QP5A 3ZDJA 2QHKA 4YWZA 4X1LA 4HBTA 2Z2LB 4BD1A 5AVFA 4BJPA 2P08A 3E4PA 3R4KA 1XKZA 5D3OA 4S2IA 3LEZA 1DJCA 4R4RA 5A92A 3LR5A 1VM1A 4X1MA 3LO7A 4N92A 1K0KA 2ZOIA 3FKVA 3GVBA 4R4SA 3IXDA 2X01A 1GSVA 3MXSA 1Z6FA 1MKMA 4X69A 5EUAA 4JXVA 2P9VB 3Q1FA 2EWWA 4K08A 4MN6A 2LB9A 3LIBA 1OTIA 5F69A 4UQIS 1FR1A 2EWVA 2XD1A 3CZDA 3GMWA 5HPFA 5KMWA 3KSIA 3CPTB 1BYWA 3O88A 1FIKA 2XD5A 4EBLA 4YINA 3U4LP 2O9CA 1NLZA 3G2YA 1L0FA 4JF4A 1ZKJA 1TF1A 2PD7A 1HZOA 4R23A 1KGFA 2V1AA 3D72A 1JWPA 3PBRA 3BQ8A 5EPHA 2KLIA 4JXWA 1W63M 4NXEA 3CWFA 2IWBA 3HJKA 4FH2A 3LCEA 1ZG4A 3SZTA 3PBNA 5KZHA 2UWXA 2ZC7A 3U2AA 4E3KA 3NIAA 4EERA 5TR7A 3UE6A 2WUQA 5KSCA 3LI9A 3VP2A 2Y2NA 5CECA 3BFDA 3UE3A 3MQQA 1FSYA 2QWSA 3I7JA 1K55C 4MEZA 4RX2A 5AQAA 3LUQA 3A3JA 5M1AA 3T4QA 4ZJ1A 5FI6A 5DF9A 1E4DA 1MC0A 4U0XA 1F98A 3BFCA 1L0DA 2PHYA 3G32A 2JCHA 3N6IA 1ES3A 1KDWA 1MXOA 5DTSA 4B9OA 4JGOA 4P6ZM 5LBRA 4OVDA 4EETB 2Y2KA 3T4OA 4JXGA 5AQ7A 3BEBA 5GL9A 4KQRA 5HWVA 5DF7A 2YKFA 5L2FA 4BLMA 4CPKA 1YSQA 4HEFA 3CHWP 4M4XA 3P09A 4L9EA 3VOLA 4RVAA 1IYSA 1NRJA 3UN7A 3C2WA 1ES5A 5E2EA 1GA9A 3M2KA 3SH9A 3NC8A 2JC7A 1XJ2A 3LIEA 3F1NA 3C4PA 4JXSA 2EX2A 5FQMA 1TS7A 3UPPA 2JKTI 3OZHA 5E2FA 2PYPA 3CAXA 4G3WA 1S4RA 2HP5A 1W5DA 3G30A 1K54A 3LYXA 3UB5P 1E3UA 1T1AA 2VZWA 4JF5A 1ZTUA 1MZUA 4Y0OA 1NZOA 4PMAA 3B33A 4MN7A 2HPBA 2Y55A 3A3DA 2WGVA 3TW8A 3P98A 3R7WA 4R3AA 2V20A 5M18A 4EEPA 1ERQA 2H5SA 4XUZA 4P6BA 1TS8A 1UWNX 1BUEA 5TBMB 4GOGA 1NYYA 4EBPA 4UAAA 3ZNTA 3UMDA 2ZQDA 3O5YA 4WEJA 3TRCA 3RJUA 3C7UA 3H82B 1K56D 1NXYA 4BENA 2Z2MB
chains in the Genus database with same CATH topology
2VV6A 4CLCC 1XFNA 3K3CA 4WUJA 1IOUA 3PBTA 5HPIA 4CLCD 2D02A 2K7SA 2W27A 3HCYA 2ZMFA 4CLCE 4EEUA 5KIZA 3MJQA 1TS6A 3EQVA 2J3WA 3NOTC 1S67L 4HIAA 4EXOA 5G4ZA 2Z6DA 1P9WA 1S1YA 3NHQA 2EA9A 2O0YA 3VV4A 3C8CA 1DP8A 2HJEA 2K31A 2PYRA 4EESA 3KSFA 3OCLA 3PXPA 4H6JB 3UB7A 2INWA 4CLCB 1ZHHB 2VEAA 3OOVA 2XA7M 3W2ZA 3JVVA 2I9VA 5TJJA 4L0LA 3BJNA 2VLGA 4LPZA 3GDIA 1T18A 4QPRA 4DMZA 2A24A 4E04A 3A0VA 4PHTA 5HDDA 5TBMA 1Y28A 4HP9A 2HF6A 5IT5A 4KQOA 4WN5A 4NXBA 4ZRRA 3CUEA 1OTDA 1DP9A 4XT2A 4L9FA 1DP6A 1P0ZA 1YSPA 3TE8A 4ARZA 4I5SA 2V9AA 4NXGA 3H82A 4FOFA 3RH8B 2XROA 1JNUA 5KSHA 3OCNA 2OWHA 3E4OA 2A2LA 4GS9B 4EQ1A 4UQIM 2QKPA 1OTEA 3FC7A 4I3JA 3B42A 3LICA 4GLQA 3MQOA 3NOUC 4IUKA 3EWKA 1OJGA 3KYQA 3PYPA 2GX5A 2KDKA 3PBQA 3IBJA 1DRMA 3KYZA 4KUKA 4RQ9A 5DFXA 3OLOA 4NEED 1OT6A 1S1ZA 4OOMA 3EGXC 3HJIA 2L0WA 3IS2B 4H6JA 4JGQA 3GECA 2O9BA 3LR4A 5AJGA 4CLCA 4MN5A 2JKRM 2WKRA 2J80A 2QYBA 4KUOA 2GNXA 5FL3A 1OT9A 2G7UA 2W3HA 2HJ9C 1GSWA 3LR0A 1T19A 1XJ3A 2PR5A 1UGUA 3T50A 1W63Q 3MQ0A 1P9RA 2J3TC 4IUHA 1XJ6A 3DBAA 3VE4A 4PAUA 2IA2A 3EOIA 3VE3A 4PKYG 3KX0X 3KSHA 1N9NA 5J3WA 1V9ZA 4YOFA 4PKYA 3D3OA 4O01A 4WEKA 2VGLM 4HQAA 3K3DA 2L4RA 4L9GA 2W1TB 3C38A 4HHDA 1EW0A 3T4SA 1OTAA 4MCWA 3EEAA 4GS9A 5A8BA 4DJ3A 3P01A 2O99A 2QJ5A 4MMNA 3EGDC 3T4LA 3CITA 2QHKA 3C30A 4YWZA 1TS0A 5I5LA 5HWWA 3B47A 3TJZC 1LSVA 4HJ3A 5AVFA 2P08A 2Z6CA 3E4PA 3F1PB 5DJTA 2VJWA 4BJPA 3R4KA 4R70A 2VX8A 3LR3A 3T4TA 3ZQ5A 4DJ2A 1OPXA 4I38A 2V0UA 4KQDA 4WLAA 1LSXA 2WKQA 2VA0A 1VB6A 2XA7S 3LI8A 2NUPC 3S7QA 1OJ5A 4NKPA 4WL9A 5HL6A 3LR5A 4EW7A 5G4YA 2V0WA 2M7VA 1LT0A 3IS2A 1NLYA 2DMWA 4NXFA 4CQHA 3OC2A 1N9OA 2ZOIA 3EEHA 4F3LB 3MF0A 3NJAA 1GSVA 1ODVA 4Q0IA 3FPWA 2XRNA 2W3FA 1MKMA 2PDRA 3P7NA 1D06A 4GW9A 1D7EA 1TD5A 2L1MA 4GHIB 4EUVA 4LRZE 2EWWA 2OAQ1 4K08A 1S66L 2FH5A 2P04A 1GSXA 4MN6A 4LLOB 4LRYC 3MXQA 2LB9A 3LIBA 1OTIA 5F69A 4UQIS 2EWVA 2VKSA 5HPFA 5DKKA 3UB9A 4ETZA 3CI6A 2OOLA 3KSIA 2W1TA 3EQUA 1BYWA 2ZMVA 1H8MA 2KX6A 2PD8A 1STZA 1XFQA 3FG8A 4EU0A 2O9CA 1NLZA 4G3VA 2O9AA 3E0YA 3F1PA 1TF1A 2PD7A 3LFVA 1WA9A 2HV1A 2M1CA 3ICYA 1NWZA 2V1AA 3D72A 4B93A 3PBRA 4HH2A 3BQ8A 1F9IA 2KLIA 3H9WA 1W63M 4HOIA 4NXEA 3CWFA 4BBUA 4Y3IA 3PBSA 3HJKA 4WF0A 5J7EA 2PR6A 4HH3A 2QJ7A 2B02A 2W3EA 2W3DA 2Y8HA 4F3LA 3PHYA 2CMNA 3PBNA 2VV8A 2FZ0A 3E4QA 2W0NA 3KO6A 3KSGA 4HJ6A 3U2AA 3V67A 2Y79A 4EERA 3T4KA 1V9YA 1XJ4A 2HGVA 4GHIA 3UE6A 2VGLS 1YKDA 1P97A 3LIDA 3BY9A 3LI9A 2XSSA 3JVUA 5C5KA 2GZAA 2NUTC 4IHQA 3UE3A 3MQQA 2D01A 2QWSA 4BWIA 5F5YA 5MC7A 2BASA 3BQAA 5HD5A 5J4EA 3LIFA 5AVEA 5DFYA 1X0OA 5IU1A 1YAXA 3T4JA 4ME4A 3LUQA 3T4QA 4II7A 1T1CA 5IS1A 2LB5A 5DF9A 5DJUA 5EFWA 2W3GA 1MC0A 1F98A 1VHMA 2ZBBA 2OAP1 5F6AA 2PHYA 4GCZA 4I3IA 4ETXA 3MR0A 3PR6A 4BBTA 2JHEA 4B9OA 4JGOA 4P6ZM 5LBRA 3F1OB 3S7PA 3BWLA 3OBFA 4G3KA 4EETB 5K5BA 3T4OA 3H7WB 2R78A 3BW6A 3MFXA 5HZHA 2KOIA 2M7UA 5HWVA 2YKFA 4MDZA 3K2NA 3G6OA 1YSQA 4M4XA 4L9EA 3VOLA 2WKPA 4YNRA 3R7WB 3UMEA 1KOUA 2YKHA 1NRJA 5HWTA 4UEYA 3ZYTA 1G6OA 3C2WA 5F68A 5CX7A 2V1BA 4Y5FA 2JKRI 3SW1A 1OTBA 4WELA 1F5MA 1XJ2A 3LIAA 3UB8A 3A0RA 3LIEA 3F1NA 4O0PA 4DN0A 2K2NA 5DKLA 1UWPX 2JN7A 4BMWA 1TS7A 2W1RA 2JKTI 3RFBA 1IFQA 4O8GA 3A0SA 1S4SA 2B18A 4LRXC 3UB6A 2PYPA 4HY8A 3CAXA 4Y2FA 4R38A 4G3WA 1S4RA 5HSQA 4JGRA 1LL8A 3IBRA 3LYXA 4Q0HA 4HI4A 3F1OA 1N9LA 4IJGA 3H7WA 1T1AA 2VZWA 2GJ3A 1ZTUA 3CUEC 1MZUA 4AFIA 5HD3A 4HJ4A 3ULFA 2P7JA 3MMHA 4HP4A 3B33A 1LSWA 2H28A 4MN7A 3E98A 3S7OA 3TW8A 4JGPA 3R7WA 4R3AA 3NOPC 2OWJA 4EEPA 2PT7A 5L8MA 1H3QA 3S7NA 4I39A 4HNBA 2A24B 1TS8A 1UWNX 3FPVA 5TBMB 4R6LA 5HDCA 3F1NB 4Z1WA 3PBOA 2VV7A 2ZOHA 2JKTM 2J3TD 3UMDA 4XT2B 3RTYA 4FSFA 3BY8A 4ARZB 5HDSA 4I3AA 3O5YA 2MJ6A 4WEJA 3TRCA 3H82B 1T1BA 1G28A 4BBVA 4OOLA 3CLOA 4GJ4A 4Q0JA 4P6ZS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VV6 A;  1XFN A;  3K3C A;  4WUJ A;  2D02 A;  2K7S A;  2W27 A;  4EEU A;  5KIZ A;  3MJQ A;  1TS6 A;  3NOT C;  1S67 L;  4HIA A;  4EXO A;  5G4Z A;  2Z6D A;  1S1Y A;  3NHQ A;  2EA9 A;  3C8C A;  1DP8 A;  2PYR A;  4EES A;  4H6J B;  3UB7 A;  2INW A;  2VEA A;  2I9V A;  2VLG A;  4LPZ A;  3GDI A;  1T18 A;  2A24 A;  4E04 A;  3A0V A;  5HDD A;  5TBM A;  1Y28 A;  4HP9 A;  4WN5 A;  4NXB A;  1OTD A;  1DP9 A;  4XT2 A;  4L9F A;  1DP6 A;  1P0Z A;  4I5S A;  2V9A A;  4NXG A;  3H82 A;  3RH8 B;  1JNU A;  2OWH A;  3E4O A;  4GS9 B;  4EQ1 A;  2QKP A;  1OTE A;  3FC7 A;  4I3J A;  3LIC A;  3MQO A;  3NOU C;  3EWK A;  1OJG A;  3PYP A;  2KDK A;  1DRM A;  4KUK A;  4RQ9 A;  3OLO A;  1OT6 A;  1S1Z A;  3HJI A;  2L0W A;  3IS2 B;  4H6J A;  4JGQ A;  3GEC A;  4MN5 A;  2WKR A;  2J80 A;  4KUO A;  1OT9 A;  1GSW A;  1T19 A;  1XJ3 A;  2PR5 A;  1UGU A;  3T50 A;  1XJ6 A;  3VE4 A;  3VE3 A;  4PKY G;  3KX0 X;  1N9N A;  5J3W A;  1V9Z A;  4PKY A;  4HQA A;  3K3D A;  2L4R A;  4L9G A;  4HHD A;  1EW0 A;  1OTA A;  4GS9 A;  5A8B A;  4DJ3 A;  2QJ5 A;  2QHK A;  4YWZ A;  1TS0 A;  5I5L A;  5HWW A;  5AVF A;  1LSV A;  4HJ3 A;  2Z6C A;  3E4P A;  3F1P B;  5DJT A;  4R70 A;  3ZQ5 A;  4DJ2 A;  4I38 A;  2V0U A;  4WLA A;  4KQD A;  1LSX A;  2WKQ A;  1VB6 A;  3LI8 A;  1OJ5 A;  4WL9 A;  4EW7 A;  5G4Y A;  2V0W A;  1LT0 A;  3IS2 A;  4NXF A;  1N9O A;  2ZOI A;  3EEH A;  4F3L B;  3NJA A;  1GSV A;  1ODV A;  2PDR A;  3P7N A;  1D06 A;  4GW9 A;  1D7E A;  2L1M A;  4GHI B;  4LRZ E;  4K08 A;  1S66 L;  1GSX A;  4MN6 A;  4LLO B;  4LRY C;  3MXQ A;  3LIB A;  1OTI A;  5F69 A;  5DKK A;  3UB9 A;  2OOL A;  1BYW A;  2KX6 A;  2PD8 A;  1XFQ A;  3FG8 A;  3F1P A;  2PD7 A;  1WA9 A;  2HV1 A;  2M1C A;  3ICY A;  1NWZ A;  2V1A A;  3D72 A;  4HH2 A;  1F9I A;  3H9W A;  4HOI A;  4NXE A;  3CWF A;  4BBU A;  3HJK A;  4WF0 A;  5J7E A;  2PR6 A;  4HH3 A;  2QJ7 A;  2B02 A;  4F3L A;  3PHY A;  2CMN A;  2VV8 A;  3E4Q A;  2W0N A;  4HJ6 A;  4EER A;  1V9Y A;  1XJ4 A;  4GHI A;  3UE6 A;  1P97 A;  3LID A;  3BY9 A;  3LI9 A;  3MQQ A;  2D01 A;  2QWS A;  5F5Y A;  2BAS A;  5HD5 A;  5J4E A;  3LIF A;  5AVE A;  1X0O A;  5IU1 A;  3LUQ A;  1T1C A;  5IS1 A;  5DJU A;  5EFW A;  1F98 A;  2ZBB A;  5F6A A;  2PHY A;  4GCZ A;  4I3I A;  3MR0 A;  4BBT A;  2JHE A;  4B9O A;  4JGO A;  3F1O B;  3BWL A;  4EET B;  3H7W B;  2R78 A;  3MFX A;  5HZH A;  5HWV A;  2YKF A;  3G6O A;  4M4X A;  4L9E A;  3VOL A;  2WKP A;  3UME A;  1KOU A;  2YKH A;  5HWT A;  3C2W A;  5F68 A;  2V1B A;  3SW1 A;  1OTB A;  1XJ2 A;  3LIA A;  3UB8 A;  3A0R A;  3LIE A;  3F1N A;  5DKL A;  1UWP X;  2JN7 A;  1TS7 A;  3A0S A;  1S4S A;  4LRX C;  3UB6 A;  2PYP A;  4HY8 A;  3CAX A;  4R38 A;  1S4R A;  5HSQ A;  4JGR A;  1LL8 A;  3IBR A;  3LYX A;  4HI4 A;  3F1O A;  1N9L A;  3H7W A;  1T1A A;  2GJ3 A;  1MZU A;  5HD3 A;  4HJ4 A;  3ULF A;  2P7J A;  4HP4 A;  3B33 A;  1LSW A;  2H28 A;  4JGP A;  4R3A A;  3NOP C;  2OWJ A;  4EEP A;  4I39 A;  4HNB A;  2A24 B;  1TS8 A;  1UWN X;  5TBM B;  4R6L A;  5HDC A;  3F1N B;  2VV7 A;  2ZOH A;  3UMD A;  4XT2 B;  3RTY A;  3BY8 A;  5HDS A;  4I3A A;  3H82 B;  1T1B A;  1G28 A;  4BBV A;  3CLO A; 
#chains in the Genus database with same CATH topology
 2VV6 A;  4NK3 A;  1A0K A;  4DE2 A;  3K3C A;  2JKF A;  2D02 A;  1PWD A;  4EEU A;  4K91 A;  3AGF A;  1L2S A;  2J3W A;  3NOT C;  5EVI A;  2VGJ A;  2UV0 E;  5EM1 A;  3HUM A;  3ZHH A;  1P9W A;  4EUZ A;  2ZM0 A;  2EA9 A;  3JPU A;  4YFM A;  3T1Q B;  2PAV P;  1IYQ A;  1SDN A;  3UB7 A;  3OOV A;  1BT5 A;  4ZJ2 A;  2V2F F;  2VGK A;  4BD0 A;  4F94 A;  3BJN A;  4FH4 A;  2IWC A;  1D1J A;  1T18 A;  4QPR A;  4FUW A;  2FFF B;  1WYB A;  3A0V A;  5HDD A;  5FDS A;  3QNC A;  3QP8 A;  4S2K A;  1TEM A;  1CI8 A;  3MFD A;  2HF6 A;  4KQO A;  4WN5 A;  4NXB A;  1DP9 A;  1S6R A;  2WKH A;  4ARZ A;  4I5S A;  4NXG A;  3RH8 B;  1JNU A;  2HDQ A;  3ZG5 A;  3E4O A;  3GSG A;  4GS9 B;  4UQI M;  3NDE A;  1MBL A;  2XQZ A;  3ITB A;  3MQO A;  3UPO A;  3OPH A;  3KYQ A;  3FYZ A;  1SCW A;  2GX5 A;  2QPN A;  3NEC A;  3PBQ A;  3IBJ A;  3HLB A;  3OLO A;  1S1Z A;  5FEF A;  2ZD8 A;  4U0T A;  5CTM A;  4H6J A;  3W4Q A;  4JGQ A;  4A5R A;  3GEC A;  4CLC A;  2WKR A;  2GNX A;  4WZ5 A;  3BFE A;  2G7U A;  3HVF A;  1Y54 A;  4ZDX A;  4E6X A;  4R3B A;  4DF6 A;  4MBH A;  3CMZ A;  1W63 Q;  2ZM8 A;  4NET A;  1IEL A;  3O86 A;  5HAI A;  4PAU A;  3EOI A;  3VE3 A;  2PRF A;  3VSK A;  1SKF A;  3KSH A;  5J3W A;  4YOF A;  4S2N C;  2L4R A;  1WYC A;  2R9W A;  2XK1 A;  1OTA A;  4ESP A;  5A8B A;  2O99 A;  3EGD C;  3T4L A;  3CIT A;  3C30 A;  3WRZ A;  1TS0 A;  3N8S A;  3B47 A;  1PZP A;  2VJW A;  1HD8 A;  1KVL A;  3QP2 A;  5IHV A;  4R70 A;  3LR3 A;  1O7E A;  1OPX A;  3VFF A;  2V0U A;  1LSX A;  2VA0 A;  2XA7 S;  5E2G A;  2WZX A;  4WL9 A;  3IXH A;  4OQI A;  3V5M A;  2M7V A;  1LT0 A;  3IS2 A;  4NXF A;  4OPY A;  1PNE A;  4CQH A;  1N9O A;  5FQK A;  4QY5 A;  3VP3 A;  1ODV A;  2W3F A;  3ZG0 A;  3FKW A;  1J3W A;  1ES2 A;  1LL5 A;  3N8R A;  1NY0 A;  4GHI B;  3O3V A;  2OAQ 1;  1S66 L;  2P04 A;  1GSX A;  4OQG A;  3HLD A;  3D4F A;  3MXQ A;  1K6R A;  3PAG A;  4OPZ A;  2VKS A;  1DJA A;  3UB9 A;  3UDX A;  4ETZ A;  2Y4A A;  2W1T A;  3EQU A;  4DRT A;  1G68 A;  1DJB A;  2ZMV A;  2PD8 A;  1STZ A;  1XFQ A;  1HVB A;  3Q82 A;  4G3V A;  4OH0 A;  3F1P A;  5BOH A;  3DTM A;  2ZQ7 A;  1KGG A;  1L3L A;  5FSR A;  4ZTK A;  4B93 A;  1NWZ A;  1S0W A;  1F9I A;  1XPB A;  2ZLY A;  3OPL A;  3V50 A;  3RXX A;  1K55 A;  4WF0 A;  4H8R A;  4F3L A;  3VP0 A;  5GLB A;  2FZ0 A;  3G4P A;  2W0N A;  2ZL1 A;  3KSG A;  2PBD P;  3T4K A;  1V9Y A;  3Q07 A;  1PI5 A;  3BEC A;  2VGL S;  3LID A;  3BY9 A;  4BL2 A;  2NUT C;  4IHQ A;  4HBU A;  5FQQ A;  4BWI A;  5CER A;  3LIF A;  5AVE A;  3QP4 A;  5DFY A;  2DRW A;  4P85 A;  3T4J A;  4FD8 A;  2JKG A;  1E3U D;  4Y15 A;  4II7 A;  2XLN A;  1O07 A;  1T1C A;  3PTE A;  2Y91 A;  5IS1 A;  3ZGA B;  2ACG A;  5GLA A;  5FAS A;  3TSG A;  4JBF A;  5G18 A;  3OPR A;  3L9K A;  1RGZ A;  3C5A A;  5HL1 A;  1MWR A;  4LEN A;  3ZVT A;  3HLW A;  3MR0 A;  4E3O A;  1CI9 A;  3BYD A;  3F1O B;  3S7P A;  3BWL A;  1XXM A;  2R78 A;  3MZF A;  3IF6 C;  4OKP A;  4X6T A;  4WMC A;  1Z09 A;  3HLF A;  2EX8 A;  3G6O A;  1XP4 A;  3A3F A;  4IVI A;  2ZJ9 A;  2YKH A;  3NY4 A;  3FWL A;  5CX7 A;  2V1B A;  5FDH A;  2JKR I;  5EVI D;  1VEU B;  1OTB A;  3IF6 B;  5JYP A;  5DKL A;  3UDI A;  2JN7 A;  4BMW A;  3S22 A;  1KDS A;  4B4X A;  3A0S A;  4B4Z A;  5I94 A;  2B18 A;  4LRX C;  1GCE A;  4PPR A;  1SKO A;  4Y2F A;  5HSQ A;  4JGR A;  4GZB A;  1LL8 A;  4Q0H A;  4IJG A;  1K6S A;  3H7W A;  4IED A;  2EX6 A;  4KZA A;  2PU2 A;  4IVK A;  3ULF A;  4HP4 A;  3A3I A;  3WS2 A;  4LV1 A;  4KEN B;  4C75 A;  4DXC A;  4JGP A;  4PM7 A;  2OWJ A;  3S7N A;  1ESU A;  2XR0 A;  4K0W A;  1LHY A;  2A24 B;  2J8Y A;  3ZFZ A;  3Q7V B;  3NDG A;  1BLC A;  3PBO A;  1MWU A;  1FCO A;  4OOY A;  2ZQ9 A;  2JKT M;  4EBN A;  4XT2 B;  3RTY A;  3BY8 A;  1RP5 A;  5HDS A;  3LEQ A;  4DDS A;  2MJ6 A;  1IYO A;  4E3L A;  2ZQ8 A;  1G28 A;  4OLG A;  3CLO A;  4GJ4 A;  4Q0J A;  4KZB A;  1GHP A;  4UEY A;  2C6W B;  2XEP A;  1U60 A;  2DNS A;  1IOU A;  4CLC D;  5KIZ A;  3MJQ A;  1TS6 A;  2E8J A;  1FCN A;  4Y0U A;  3IX4 A;  4GD6 A;  5G4Z A;  2Z6D A;  1S1Y A;  4KZ6 A;  3VV4 A;  2JE5 A;  5DVA A;  2HJE A;  4OPR A;  4O7D A;  4MBF A;  3PXP A;  4KG2 A;  4HES A;  2HDS A;  4U3T A;  1YLZ A;  1IKI A;  1GA0 A;  4S2O A;  1ZHH B;  2XA7 M;  1SDE A;  3JVV A;  3MZD A;  4L0L A;  3W8K A;  3GDI A;  4DMZ A;  3D9Y A;  5GLC A;  5F83 A;  1Y28 A;  4E3N A;  2WGW A;  4QB8 A;  4ZRR A;  3CUE A;  1OTD A;  4L9F A;  2V8F A;  1P0Z A;  5HW3 A;  2V9A A;  4FOF A;  5KSH A;  3OCN A;  2OWH A;  4X25 A;  1GHI A;  2Y2G A;  1OTE A;  3FC7 A;  4I3J A;  3LIC A;  4GLQ A;  4IUK A;  1OJG A;  4OLD A;  1W7F A;  1FR6 A;  1I2W A;  4KUK A;  2R9X A;  1TDL A;  4NEE D;  1IKG A;  1OT6 A;  1FQG A;  1CQA A;  1LI0 A;  3HJI A;  3IF5 A;  4E3M A;  1PIO A;  3G35 A;  5AQ9 A;  4S2N A;  2J80 A;  4KUO A;  1OT9 A;  2W3H A;  2HJ9 C;  5FA7 A;  1FOF A;  1GSW A;  3C7V A;  1T19 A;  1UGU A;  1N9B A;  2J3T C;  4Y7P A;  5TGF A;  3VE4 A;  1BZA A;  3HBR A;  1NYM A;  2JBF A;  3MKE A;  4PKY G;  3KX0 X;  3MS6 A;  4PKY A;  4E6W A;  4O01 A;  3AGE A;  3E2L A;  1HTZ A;  2VGL M;  4HQA A;  3DW0 A;  5M19 A;  4S2P A;  3WWX A;  5CGX A;  2CC1 A;  3SS3 A;  4X53 A;  3EEA A;  4MMN A;  4S2M A;  5HWW A;  3TJZ C;  2V8C A;  1LSV A;  4HJ3 A;  1CF0 A;  2Y2Q A;  5DJT A;  3T12 B;  2VX8 A;  2XFS A;  4I38 A;  4WLA A;  4C3Q A;  2WKQ A;  1OJ5 A;  1H8Z A;  4DKI A;  3IT9 A;  5G4Y A;  2V0W A;  1VET A;  3IQA A;  3EEH A;  3TOI A;  1Q2P A;  2X71 A;  3MF0 A;  5DTT A;  3LY4 A;  3FPW A;  2XRN A;  2G2W A;  2PDR A;  3HUN A;  3FV7 A;  4GW9 A;  1TD5 A;  4EUV A;  1VQQ A;  4LLO B;  4LRY C;  4WBG A;  4KZ8 A;  3N7W A;  2Y2J A;  5GHZ A;  3IX3 A;  3KYE A;  2OOL A;  2Y59 A;  5F82 A;  4QU3 A;  3VFH A;  4GD8 A;  3ZG9 B;  4WYY A;  3Q7Z A;  3BLS A;  4CJN A;  5AQB A;  4WMC D;  4DXB A;  4EU0 A;  4WZ4 A;  4N9L A;  3E0Y A;  2DCF A;  4GKU A;  3DWK A;  3IWO A;  1JWZ A;  2ZQA A;  3LFV A;  5E43 A;  1WA9 A;  2HV1 A;  4OP8 A;  2M1C A;  3ICY A;  3HL9 A;  5HX9 A;  3H9W A;  4HOI A;  3T1X A;  1GHM A;  3PBS A;  3QP1 A;  5J7E A;  2PR6 A;  4HH3 A;  2QJ7 A;  2WKE A;  2W3E A;  3IHB A;  4LGW A;  2CMN A;  4QD4 A;  2VV8 A;  1CJF A;  1KE3 A;  3E4Q A;  3KO6 A;  1W8Y A;  4HJ6 A;  1YM1 A;  2Y79 A;  3VSL A;  1XJ4 A;  2P9V A;  2HGV A;  2PBY A;  3MSH A;  1YKD A;  1ALQ A;  5A90 A;  2XSS A;  3JVU A;  2GZA A;  4S2J A;  3QHY A;  3RXW A;  5MC7 A;  2BAS A;  2C5W B;  5HD5 A;  5A91 A;  3HLE A;  1H5X A;  1F2K A;  5TFQ A;  1X0O A;  5FAT A;  1YAX A;  5IU1 A;  3CPT A;  2BG1 A;  2EXA A;  4UA9 A;  5DJU A;  5EFW A;  5U47 A;  3ZG7 B;  3ITA A;  3MZE A;  1VHM A;  4QJG A;  3GR2 A;  2ZBB A;  2OAP 1;  4I3I A;  1PRQ A;  3HRE A;  1M40 A;  1Y4O A;  1MPL A;  4ETX A;  5CGS A;  2JHE A;  1IYP A;  1MKI A;  4R1G A;  4G3K A;  4JPM A;  5F1G A;  4RX3 A;  5CHM A;  1N4O A;  4MBK A;  2Y2M A;  3MFX A;  5CED A;  1PI4 A;  5HZH A;  2KOI A;  3DTK A;  5JYO A;  2QZ6 A;  2ZC4 B;  3WRT A;  3CG5 A;  3NBL A;  4ZAM A;  3UNW A;  2HDR A;  4YNR A;  2E8I A;  5CHU A;  3R7W B;  3UME A;  3M2J A;  3ZYT A;  1G6O A;  2BLS A;  2Q9M A;  5EVI C;  4Y5F A;  3MBZ A;  4WEL A;  3N8L A;  3Q7V A;  3LIA A;  2I72 A;  3UB8 A;  3UPN A;  1G5U A;  1YLP A;  5FQI A;  1I2S A;  2W1R A;  1IFQ A;  4O8G A;  4M3K A;  4KZ3 A;  3SH7 A;  2HP6 A;  1S4S A;  2EFU A;  3UB6 A;  2HP9 A;  3IWQ A;  4HY8 A;  3WS5 A;  5EVL A;  1YLY A;  5EVI B;  4JF6 A;  4RYE A;  3IBR A;  1N9L A;  1PW8 A;  1JWV A;  1ESI A;  2A49 A;  1XGI A;  4OPQ A;  2GJ3 A;  4EV4 A;  3OPP A;  4AFI A;  2P74 A;  3UE0 A;  4D60 A;  1HLU P;  4QY6 A;  3S7O A;  1ES4 A;  1TVF A;  5L8M A;  4NG2 A;  1H3Q A;  4RA7 A;  3FPV A;  4MLL A;  4R6L A;  5HDC A;  5EVE A;  3T1R A;  3AGD A;  1YPR A;  3UE1 A;  1K4E A;  4ARZ B;  1C3B A;  1QME A;  4KZ7 A;  4FTX A;  4OOL A;  1K25 A;  4N9K A;  1NZU A;  5L07 A;  4E3J A;  4EWF A;  4CLC C;  1XFN A;  3T1S A;  2W27 A;  4WZ5 C;  2AVX A;  4CLC E;  5FAP A;  2ZC6 B;  4IBX A;  1S67 L;  2FFY A;  1XX2 A;  1BLP A;  1FIL A;  4EQI A;  3L7H A;  3IWI A;  4EXO A;  5E2H A;  4X56 A;  1YLJ A;  5HAR A;  1DP8 A;  3MXR A;  3PAE A;  2K31 A;  2PYR A;  4JLF A;  4GDB A;  1W8Q A;  1L0E A;  4H6J B;  4CLC B;  2VEA A;  2B95 A;  4KG5 A;  3W2Z A;  4BQM A;  1CEG A;  4OQ0 A;  2I9V A;  4LV3 A;  3W4O A;  1YT4 A;  2XFT A;  1MWS A;  4LPZ A;  4ZBE A;  1RCJ A;  4P0M A;  4PHT A;  5TBM A;  3MKF A;  5GLD A;  1ONG A;  1PFL A;  1WE4 A;  5EV0 A;  5IT5 A;  1SHV A;  2Y2O A;  3WS4 A;  1DP6 A;  3TE8 A;  2X02 A;  4UHU A;  3H82 A;  2H10 A;  1JVJ A;  2A2L A;  2A3U A;  4EQ1 A;  2Y2I A;  3G31 A;  1NRF A;  3B42 A;  3WS0 A;  5CRF A;  4UA7 A;  1IEM A;  3EWK A;  5J8X A;  1MY8 A;  3SS5 A;  1YLT A;  4WM9 A;  2KDK A;  3ZCZ A;  3DTE A;  3BFF A;  1J9M A;  5DFX A;  4P87 A;  1W79 A;  1YLW A;  4OOM A;  3BLM A;  3N4I A;  4DE1 A;  2OV5 A;  3IS2 B;  5FI7 A;  2O9B A;  3LR4 A;  2ZQC A;  5AJG A;  3HLG A;  2VK3 A;  3UO9 A;  5EE8 A;  5GHY A;  3BM6 A;  3UY6 A;  2PR5 A;  1NJ4 A;  3MQ0 A;  4IUH A;  1XJ6 A;  4Y13 A;  5L10 A;  4JKT A;  3NCK A;  5CEB A;  1N9N A;  4N1X A;  3D3O A;  4WEK A;  3K3D A;  2W1T B;  1K57 C;  3C38 A;  1EW0 A;  4MCW A;  4GS9 A;  5EM0 A;  5FQ9 A;  2ZC3 B;  4DJ3 A;  2QJ5 A;  3VP4 A;  3IXG A;  4XXR A;  5EEC A;  1BLH A;  2EX9 A;  5I5L A;  3ISG A;  2Z6C A;  3F1P B;  3ZQ5 A;  3T4T A;  4DJ2 A;  2XGN A;  4KQD A;  1ZC2 A;  1VB6 A;  3LI8 A;  2NUP C;  3S7Q A;  4NKP A;  5HL6 A;  3S4X A;  1L0G A;  3LGO A;  4EW7 A;  3IX8 A;  1NLY A;  2DMW A;  3OC2 A;  4F3L B;  3NJA A;  4X68 A;  2ZL1 B;  4Q0I A;  4KZ4 A;  3P7N A;  1D06 A;  1D7E A;  2L1M A;  4OON A;  4LRZ E;  1PWC A;  2FH5 A;  3QP6 A;  4DE3 A;  2Y2H A;  2J7V A;  4IBR A;  2Y2L A;  5DKK A;  5HAQ A;  1ACF A;  3CI6 A;  1YMX A;  2OSU A;  2B5R A;  1G6A A;  2J9O A;  2J9P A;  3QNB A;  3GQZ A;  1H8M A;  2KX6 A;  3FG8 A;  2H0T A;  1JTD A;  3BFG A;  4LFU A;  1LI9 A;  3GV9 A;  2O9A A;  5GHX A;  4X55 A;  4LV0 A;  4HH2 A;  4BBU A;  4Z9Q A;  4Y3I A;  2GDN A;  2WGI A;  4MNR A;  2B02 A;  1K38 A;  2W3D A;  2Y8H A;  3PHY A;  3A3E A;  3SS4 A;  2ZMA A;  2Q0O A;  3V67 A;  3WS1 A;  4GHI A;  3VP1 A;  1TDG A;  3GTC A;  1AWI A;  3SH8 A;  1P97 A;  3ZNY A;  5C5K A;  1JTG A;  1RGY A;  2D01 A;  4D2O A;  5F5Y A;  5J4E A;  3BQA A;  5FQJ A;  3BRM A;  3IH9 A;  1YMS A;  1QMF A;  4QHC A;  1KE0 A;  4ME4 A;  2H0Y A;  2XH9 A;  4GDN A;  2LB5 A;  4PM6 A;  2W3G A;  5FI2 A;  1EI5 A;  5F6A A;  1SKO B;  4GCZ A;  3CJM A;  4E3I A;  4KZ9 A;  4Y17 A;  1PZO A;  3PR6 A;  4BBT A;  3OBF A;  5K5B A;  3M6B A;  3H7W B;  3BW6 A;  1PW1 A;  3DAV A;  4GN2 A;  1XA7 A;  1XGJ A;  2M7U A;  1ONH A;  4MDZ A;  5F1F A;  3K2N A;  3G34 A;  1PYY A;  4R0Q A;  3GRJ A;  3IH8 A;  4PM5 A;  2WKP A;  1KOU A;  4OP5 A;  5HWT A;  3NUL A;  4BL3 A;  1KGE A;  5F68 A;  2BTF P;  2Y2P A;  3UDF A;  3SW1 A;  4ID4 A;  4Q8I A;  1F5M A;  3A0R A;  4OQH A;  4O0P A;  1ZG6 A;  4DN0 A;  2K2N A;  3HUO A;  4KG6 A;  1UWP X;  5L09 A;  4GNU A;  3RFB A;  5CXW A;  4R38 A;  1LLB A;  1FCM A;  5DTK A;  1OME A;  2WAF A;  3F1O A;  4HI4 A;  5A93 A;  2WYX A;  1H0M A;  3FZC A;  3M6H A;  3CUE C;  5HD3 A;  4HJ4 A;  2IWD A;  2P7J A;  3MMH A;  5FAQ A;  1LSW A;  2H28 A;  4LCL A;  4DDY A;  2ZM2 A;  3HLC A;  2G2U A;  3C4O A;  3E98 A;  3NOP C;  4KZ5 A;  2PT7 A;  2XF3 A;  4I39 A;  4DE0 A;  4HNB A;  1K54 C;  1CEF A;  2XDM A;  1DY6 A;  3F1N B;  1VEU A;  4Z1W A;  4PM9 A;  2WGW B;  5EOE A;  3S1Y A;  1YQS A;  2VV7 A;  1XA1 A;  3B3X A;  3IF6 A;  2ZOH A;  3NI9 A;  2J3T D;  1ERO A;  4FSF A;  4I3A A;  3W4P A;  4UA6 A;  5CTN A;  2WZZ A;  1KVM A;  5FAO A;  1T1B A;  4BBV A;  1BTL A;  1K4F A;  3DTI A;  1ERM A;  4P6Z S;  2WAE A;  3DWZ A;  4WUJ A;  2QMI A;  3PBT A;  4LV2 A;  3Q81 A;  4FCF A;  2K7S A;  5HPI A;  3HCY A;  2WKI A;  2ZMF A;  2HDU A;  3EQV A;  3VOZ A;  3VOY A;  3TG9 A;  4S2L A;  4HIA A;  4GB7 A;  3NHQ A;  2O0Y A;  3C8C A;  4N1H A;  1Q2Q A;  4LCM A;  2WAD A;  4PM8 A;  4EES A;  3KSF A;  1FSW A;  3OCL A;  2INW A;  5CHJ A;  4C6Y A;  3E2K A;  5TJJ A;  2VLG A;  4B88 A;  2A24 A;  4E04 A;  4ZJ3 A;  4R3J A;  4HP9 A;  1M6K A;  2RCX A;  4XT2 A;  1YSP A;  2ZC5 B;  2V1Z A;  4K0X A;  3IXB A;  3V3S A;  3G2Z A;  2XRO A;  5HAP A;  2QKP A;  3O87 A;  2RL3 A;  3VMA A;  3NOU C;  1BLS A;  2PU4 A;  3PYP A;  5HFO A;  3KYZ A;  1DRM A;  4RQ9 A;  2OLU A;  2Q9N A;  2WK0 A;  1K56 A;  1KE4 A;  2EFX A;  3LY3 A;  3ZVW A;  3EGX C;  2L0W A;  1VET B;  1PWG A;  1CK3 A;  4MN5 A;  2JKR M;  4Y0T A;  3SOI A;  4KQQ A;  5FEG A;  1MWT A;  1K57 A;  2QYB A;  5CGW A;  1AXB A;  5FL3 A;  3ZG8 B;  5EOO A;  1H8Y A;  3LR0 A;  1XJ3 A;  3T50 A;  1P9R A;  3JYI A;  3V3R A;  4QWO A;  3DBA A;  2IA2 A;  1BUL A;  1E25 A;  1LL9 A;  1BSG A;  1SZV A;  4XUX A;  1V9Z A;  3IHA A;  3V39 A;  2EXB A;  2HZ5 A;  4L9G A;  3T4S A;  4HHD A;  1I5Q A;  5DF8 A;  3P01 A;  2OLV A;  1EWZ A;  3QP5 A;  3ZDJ A;  2QHK A;  4YWZ A;  4X1L A;  4HBT A;  2Z2L B;  4BD1 A;  5AVF A;  4BJP A;  2P08 A;  3E4P A;  3R4K A;  1XKZ A;  5D3O A;  4S2I A;  3LEZ A;  1DJC A;  4R4R A;  5A92 A;  3LR5 A;  1VM1 A;  4X1M A;  3LO7 A;  4N92 A;  1K0K A;  2ZOI A;  3FKV A;  3GVB A;  4R4S A;  3IXD A;  2X01 A;  1GSV A;  3MXS A;  1Z6F A;  1MKM A;  4X69 A;  5EUA A;  4JXV A;  2P9V B;  3Q1F A;  2EWW A;  4K08 A;  4MN6 A;  2LB9 A;  3LIB A;  1OTI A;  5F69 A;  4UQI S;  1FR1 A;  2EWV A;  2XD1 A;  3CZD A;  3GMW A;  5HPF A;  5KMW A;  3KSI A;  3CPT B;  1BYW A;  3O88 A;  1FIK A;  2XD5 A;  4EBL A;  4YIN A;  3U4L P;  2O9C A;  1NLZ A;  3G2Y A;  1L0F A;  4JF4 A;  1ZKJ A;  1TF1 A;  2PD7 A;  1HZO A;  4R23 A;  1KGF A;  2V1A A;  3D72 A;  1JWP A;  3PBR A;  3BQ8 A;  5EPH A;  2KLI A;  4JXW A;  1W63 M;  4NXE A;  3CWF A;  2IWB A;  3HJK A;  4FH2 A;  3LCE A;  1ZG4 A;  3SZT A;  3PBN A;  5KZH A;  2UWX A;  2ZC7 A;  3U2A A;  4E3K A;  3NIA A;  4EER A;  5TR7 A;  3UE6 A;  2WUQ A;  5KSC A;  3LI9 A;  3VP2 A;  2Y2N A;  5CEC A;  3BFD A;  3UE3 A;  3MQQ A;  1FSY A;  2QWS A;  3I7J A;  1K55 C;  4MEZ A;  4RX2 A;  5AQA A;  3LUQ A;  3A3J A;  5M1A A;  3T4Q A;  4ZJ1 A;  5FI6 A;  5DF9 A;  1E4D A;  1MC0 A;  4U0X A;  1F98 A;  3BFC A;  1L0D A;  2PHY A;  3G32 A;  2JCH A;  3N6I A;  1ES3 A;  1KDW A;  1MXO A;  5DTS A;  4B9O A;  4JGO A;  4P6Z M;  5LBR A;  4OVD A;  4EET B;  2Y2K A;  3T4O A;  4JXG A;  5AQ7 A;  3BEB A;  5GL9 A;  4KQR A;  5HWV A;  5DF7 A;  2YKF A;  5L2F A;  4BLM A;  4CPK A;  1YSQ A;  4HEF A;  3CHW P;  4M4X A;  3P09 A;  4L9E A;  3VOL A;  4RVA A;  1IYS A;  1NRJ A;  3UN7 A;  3C2W A;  1ES5 A;  5E2E A;  1GA9 A;  3M2K A;  3SH9 A;  3NC8 A;  2JC7 A;  1XJ2 A;  3LIE A;  3F1N A;  3C4P A;  4JXS A;  2EX2 A;  5FQM A;  1TS7 A;  3UPP A;  2JKT I;  3OZH A;  5E2F A;  2PYP A;  3CAX A;  4G3W A;  1S4R A;  2HP5 A;  1W5D A;  3G30 A;  1K54 A;  3LYX A;  3UB5 P;  1E3U A;  1T1A A;  2VZW A;  4JF5 A;  1ZTU A;  1MZU A;  4Y0O A;  1NZO A;  4PMA A;  3B33 A;  4MN7 A;  2HPB A;  2Y55 A;  3A3D A;  2WGV A;  3TW8 A;  3P98 A;  3R7W A;  4R3A A;  2V20 A;  5M18 A;  4EEP A;  1ERQ A;  2H5S A;  4XUZ A;  4P6B A;  1TS8 A;  1UWN X;  1BUE A;  5TBM B;  4GOG A;  1NYY A;  4EBP A;  4UAA A;  3ZNT A;  3UMD A;  2ZQD A;  3O5Y A;  4WEJ A;  3TRC A;  3RJU A;  3C7U A;  3H82 B;  1K56 D;  1NXY A;  4BEN A;  2Z2M B; 
#chains in the Genus database with same CATH homology
 2VV6 A;  4CLC C;  1XFN A;  3K3C A;  4WUJ A;  1IOU A;  3PBT A;  5HPI A;  4CLC D;  2D02 A;  2K7S A;  2W27 A;  3HCY A;  2ZMF A;  4CLC E;  4EEU A;  5KIZ A;  3MJQ A;  1TS6 A;  3EQV A;  2J3W A;  3NOT C;  1S67 L;  4HIA A;  4EXO A;  5G4Z A;  2Z6D A;  1P9W A;  1S1Y A;  3NHQ A;  2EA9 A;  2O0Y A;  3VV4 A;  3C8C A;  1DP8 A;  2HJE A;  2K31 A;  2PYR A;  4EES A;  3KSF A;  3OCL A;  3PXP A;  4H6J B;  3UB7 A;  2INW A;  4CLC B;  1ZHH B;  2VEA A;  3OOV A;  2XA7 M;  3W2Z A;  3JVV A;  2I9V A;  5TJJ A;  4L0L A;  3BJN A;  2VLG A;  4LPZ A;  3GDI A;  1T18 A;  4QPR A;  4DMZ A;  2A24 A;  4E04 A;  3A0V A;  4PHT A;  5HDD A;  5TBM A;  1Y28 A;  4HP9 A;  2HF6 A;  5IT5 A;  4KQO A;  4WN5 A;  4NXB A;  4ZRR A;  3CUE A;  1OTD A;  1DP9 A;  4XT2 A;  4L9F A;  1DP6 A;  1P0Z A;  1YSP A;  3TE8 A;  4ARZ A;  4I5S A;  2V9A A;  4NXG A;  3H82 A;  4FOF A;  3RH8 B;  2XRO A;  1JNU A;  5KSH A;  3OCN A;  2OWH A;  3E4O A;  2A2L A;  4GS9 B;  4EQ1 A;  4UQI M;  2QKP A;  1OTE A;  3FC7 A;  4I3J A;  3B42 A;  3LIC A;  4GLQ A;  3MQO A;  3NOU C;  4IUK A;  3EWK A;  1OJG A;  3KYQ A;  3PYP A;  2GX5 A;  2KDK A;  3PBQ A;  3IBJ A;  1DRM A;  3KYZ A;  4KUK A;  4RQ9 A;  5DFX A;  3OLO A;  4NEE D;  1OT6 A;  1S1Z A;  4OOM A;  3EGX C;  3HJI A;  2L0W A;  3IS2 B;  4H6J A;  4JGQ A;  3GEC A;  2O9B A;  3LR4 A;  5AJG A;  4CLC A;  4MN5 A;  2JKR M;  2WKR A;  2J80 A;  2QYB A;  4KUO A;  2GNX A;  5FL3 A;  1OT9 A;  2G7U A;  2W3H A;  2HJ9 C;  1GSW A;  3LR0 A;  1T19 A;  1XJ3 A;  2PR5 A;  1UGU A;  3T50 A;  1W63 Q;  3MQ0 A;  1P9R A;  2J3T C;  4IUH A;  1XJ6 A;  3DBA A;  3VE4 A;  4PAU A;  2IA2 A;  3EOI A;  3VE3 A;  4PKY G;  3KX0 X;  3KSH A;  1N9N A;  5J3W A;  1V9Z A;  4YOF A;  4PKY A;  3D3O A;  4O01 A;  4WEK A;  2VGL M;  4HQA A;  3K3D A;  2L4R A;  4L9G A;  2W1T B;  3C38 A;  4HHD A;  1EW0 A;  3T4S A;  1OTA A;  4MCW A;  3EEA A;  4GS9 A;  5A8B A;  4DJ3 A;  3P01 A;  2O99 A;  2QJ5 A;  4MMN A;  3EGD C;  3T4L A;  3CIT A;  2QHK A;  3C30 A;  4YWZ A;  1TS0 A;  5I5L A;  5HWW A;  3B47 A;  3TJZ C;  1LSV A;  4HJ3 A;  5AVF A;  2P08 A;  2Z6C A;  3E4P A;  3F1P B;  5DJT A;  2VJW A;  4BJP A;  3R4K A;  4R70 A;  2VX8 A;  3LR3 A;  3T4T A;  3ZQ5 A;  4DJ2 A;  1OPX A;  4I38 A;  2V0U A;  4KQD A;  4WLA A;  1LSX A;  2WKQ A;  2VA0 A;  1VB6 A;  2XA7 S;  3LI8 A;  2NUP C;  3S7Q A;  1OJ5 A;  4NKP A;  4WL9 A;  5HL6 A;  3LR5 A;  4EW7 A;  5G4Y A;  2V0W A;  2M7V A;  1LT0 A;  3IS2 A;  1NLY A;  2DMW A;  4NXF A;  4CQH A;  3OC2 A;  1N9O A;  2ZOI A;  3EEH A;  4F3L B;  3MF0 A;  3NJA A;  1GSV A;  1ODV A;  4Q0I A;  3FPW A;  2XRN A;  2W3F A;  1MKM A;  2PDR A;  3P7N A;  1D06 A;  4GW9 A;  1D7E A;  1TD5 A;  2L1M A;  4GHI B;  4EUV A;  4LRZ E;  2EWW A;  2OAQ 1;  4K08 A;  1S66 L;  2FH5 A;  2P04 A;  1GSX A;  4MN6 A;  4LLO B;  4LRY C;  3MXQ A;  2LB9 A;  3LIB A;  1OTI A;  5F69 A;  4UQI S;  2EWV A;  2VKS A;  5HPF A;  5DKK A;  3UB9 A;  4ETZ A;  3CI6 A;  2OOL A;  3KSI A;  2W1T A;  3EQU A;  1BYW A;  2ZMV A;  1H8M A;  2KX6 A;  2PD8 A;  1STZ A;  1XFQ A;  3FG8 A;  4EU0 A;  2O9C A;  1NLZ A;  4G3V A;  2O9A A;  3E0Y A;  3F1P A;  1TF1 A;  2PD7 A;  3LFV A;  1WA9 A;  2HV1 A;  2M1C A;  3ICY A;  1NWZ A;  2V1A A;  3D72 A;  4B93 A;  3PBR A;  4HH2 A;  3BQ8 A;  1F9I A;  2KLI A;  3H9W A;  1W63 M;  4HOI A;  4NXE A;  3CWF A;  4BBU A;  4Y3I A;  3PBS A;  3HJK A;  4WF0 A;  5J7E A;  2PR6 A;  4HH3 A;  2QJ7 A;  2B02 A;  2W3E A;  2W3D A;  2Y8H A;  4F3L A;  3PHY A;  2CMN A;  3PBN A;  2VV8 A;  2FZ0 A;  3E4Q A;  2W0N A;  3KO6 A;  3KSG A;  4HJ6 A;  3U2A A;  3V67 A;  2Y79 A;  4EER A;  3T4K A;  1V9Y A;  1XJ4 A;  2HGV A;  4GHI A;  3UE6 A;  2VGL S;  1YKD A;  1P97 A;  3LID A;  3BY9 A;  3LI9 A;  2XSS A;  3JVU A;  5C5K A;  2GZA A;  2NUT C;  4IHQ A;  3UE3 A;  3MQQ A;  2D01 A;  2QWS A;  4BWI A;  5F5Y A;  5MC7 A;  2BAS A;  3BQA A;  5HD5 A;  5J4E A;  3LIF A;  5AVE A;  5DFY A;  1X0O A;  5IU1 A;  1YAX A;  3T4J A;  4ME4 A;  3LUQ A;  3T4Q A;  4II7 A;  1T1C A;  5IS1 A;  2LB5 A;  5DF9 A;  5DJU A;  5EFW A;  2W3G A;  1MC0 A;  1F98 A;  1VHM A;  2ZBB A;  2OAP 1;  5F6A A;  2PHY A;  4GCZ A;  4I3I A;  4ETX A;  3MR0 A;  3PR6 A;  4BBT A;  2JHE A;  4B9O A;  4JGO A;  4P6Z M;  5LBR A;  3F1O B;  3S7P A;  3BWL A;  3OBF A;  4G3K A;  4EET B;  5K5B A;  3T4O A;  3H7W B;  2R78 A;  3BW6 A;  3MFX A;  5HZH A;  2KOI A;  2M7U A;  5HWV A;  2YKF A;  4MDZ A;  3K2N A;  3G6O A;  1YSQ A;  4M4X A;  4L9E A;  3VOL A;  2WKP A;  4YNR A;  3R7W B;  3UME A;  1KOU A;  2YKH A;  1NRJ A;  5HWT A;  4UEY A;  3ZYT A;  1G6O A;  3C2W A;  5F68 A;  5CX7 A;  2V1B A;  4Y5F A;  2JKR I;  3SW1 A;  1OTB A;  4WEL A;  1F5M A;  1XJ2 A;  3LIA A;  3UB8 A;  3A0R A;  3LIE A;  3F1N A;  4O0P A;  4DN0 A;  2K2N A;  5DKL A;  1UWP X;  2JN7 A;  4BMW A;  1TS7 A;  2W1R A;  2JKT I;  3RFB A;  1IFQ A;  4O8G A;  3A0S A;  1S4S A;  2B18 A;  4LRX C;  3UB6 A;  2PYP A;  4HY8 A;  3CAX A;  4Y2F A;  4R38 A;  4G3W A;  1S4R A;  5HSQ A;  4JGR A;  1LL8 A;  3IBR A;  3LYX A;  4Q0H A;  4HI4 A;  3F1O A;  1N9L A;  4IJG A;  3H7W A;  1T1A A;  2VZW A;  2GJ3 A;  1ZTU A;  3CUE C;  1MZU A;  4AFI A;  5HD3 A;  4HJ4 A;  3ULF A;  2P7J A;  3MMH A;  4HP4 A;  3B33 A;  1LSW A;  2H28 A;  4MN7 A;  3E98 A;  3S7O A;  3TW8 A;  4JGP A;  3R7W A;  4R3A A;  3NOP C;  2OWJ A;  4EEP A;  2PT7 A;  5L8M A;  1H3Q A;  3S7N A;  4I39 A;  4HNB A;  2A24 B;  1TS8 A;  1UWN X;  3FPV A;  5TBM B;  4R6L A;  5HDC A;  3F1N B;  4Z1W A;  3PBO A;  2VV7 A;  2ZOH A;  2JKT M;  2J3T D;  3UMD A;  4XT2 B;  3RTY A;  4FSF A;  3BY8 A;  4ARZ B;  5HDS A;  4I3A A;  3O5Y A;  2MJ6 A;  4WEJ A;  3TRC A;  3H82 B;  1T1B A;  1G28 A;  4BBV A;  4OOL A;  3CLO A;  4GJ4 A;  4Q0J A;  4P6Z S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...