4JGOA

The crystal structure of sporulation kinase d sensor domain from bacillus subtilis subsp.
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
206
structure length
206
Chain Sequence
EKDTIAAEHKQEASVLLNLHRNKINYLIGETMARMTSLSIAIDRPVDIKKMQSILEKTFDSEPRFSGLYFLNAKGDVTASTTELKTKVNLADRSFFIKAKETKKTVISDSYSSRITGQPIFTICVPVLDSKRNVTDYLVAAIQIDYLKNLINLLSPDVYIEVVNQDGKMIFASGQASHAEDQKPVSGYLDDISWNMKVYPNPVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sporulation kinase D
publication title Insight into the sporulation phosphorelay: Crystal structure of the sensor domain of Bacillus subtilis histidine kinase, KinD.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Transferase
total genus 56
structure length 206
sequence length 206
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2013-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4jgoA02
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4jgoA01
5AVFA 1OTIA 3K3CA 4B9OA 2V9AA 3H9WA 5HDCA 4XT2B 4H6JB 4R3AA 2JHEA 3VE4A 1GSXA 2H28A 4NXFA 4PKYA 3UB8A 4MN5A 4GS9B 4E04A 1T1CA 3EEHA 3NJAA 2PD8A 3UMDA 3LICA 1S66L 1X0OA 2WKRA 2Z6DA 4K08A 4DJ3A 2INWA 1OT9A 3H82A 1G28A 4R70A 3MFXA 1S1ZA 5J4EA 3P7NA 1OT6A 4KUOA 3NOTC 2L1MA 2VV8A 4LLOB 1P97A 1GSVA 5DKKA 3LIBA 4JGPA 3E4OA 3BY8A 5TBMA 4WLAA 4M4XA 2QHKA 1F98A 4NXBA 1XJ2A 5G4ZA 1XJ6A 3CLOA 5HZHA 1XFQA 1D06A 5HWWA 3E4QA 4KQDA 4I39A 4I38A 1OJGA 1LSXA 1ODVA 3H7WA 4HQAA 1LSVA 1LSWA 4KUKA 2OWHA 5HDSA 3NOUC 4BBTA 3UE6A 4WUJA 2V1AA 2PDRA 3BY9A 3SW1A 2EA9A 1OTEA 3MQQA 3MXQA 2JN7A 2QJ5A 3RTYA 1TS8A 1T1AA 2B02A 3F1OA 2YKFA 1DP8A 4I3JA 2V0UA 4I5SA 5A8BA 1DRMA 4NXEA 3BWLA 3VE3A 5F5YA 5F68A 4F3LB 4R38A 3E4PA 2HV1A 2PHYA 4BBUA 1S4RA 2WKPA 3MJQA 4XT2A 2A24A 1JNUA 5J3WA 1WA9A 3HJKA 3ULFA 4EW7A 4WF0A 4WL9A 4GS9A 1S4SA 2QKPA 5HSQA 3LYXA 2M1CA 3ICYA 5DJTA 2KX6A 3LIAA 2ZBBA 4HJ6A 2VLGA 2W27A 4EERA 5HDDA 4EEUA 3F1NB 4R6LA 2KDKA 2QWSA 3ZQ5A 1N9NA 4HJ4A 2J80A 3CAXA 3OLOA 1N9OA 2VV7A 2V1BA 3LIFA 4I3AA 1OJ5A 4LRXC 3NOPC 2BASA 3A0VA 3UB7A 3UB6A 2P7JA 3UMEA 3A0SA 4EETB 4JGQA 4GHIB 2PD7A 1D7EA 1UWPX 5HWVA 1XJ3A 3G6OA 2VV6A 1Y28A 1OTBA 3CWFA 2GJ3A 1OTDA 3T50A 3GECA 3LI8A 3IBRA 3H7WB 4EESA 4HI4A 4EQ1A 3IS2A 3B33A 3NHQA 4WN5A 3VOLA 5DJUA 1GSWA 3F1PB 2YKHA 3MR0A 3FC7A 3UB9A 1LT0A 4HP9A 1T1BA 3LIEA 4F3LA 4MN6A 4HP4A 1DP6A 4H6JA 2Z6CA 5DKLA 3C2WA 1N9LA 1XFNA 5AVEA 3D72A 2QJ7A 2A24B 4GCZA 5I5LA 1TS6A 3HJIA 4JGOA 1S67L 1VB6A 4L9GA 2D02A 2I9VA 1T18A 4NXGA 4L9FA 5HD3A 2PR5A 4EEPA 3PYPA 3PHYA 1V9ZA 5HWTA 2ZOIA 2W0NA 3F1NA 3H82B 3MQOA 1S1YA 3KX0X 2OWJA 1EW0A 1MZUA 1V9YA 2R78A 1KOUA 1NWZA 2VEAA 5J7EA 2CMNA 2PYPA 1XJ4A 3A0RA 3GDIA 1UWNX 3C8CA 3K3DA 3RH8B 1TS7A 4HH2A 4RQ9A 5F69A 4LRYC 2PR6A 4GW9A 5TBMB 4I3IA 4HIAA 2WKQA 4HOIA 3EWKA 4DJ2A 1P0ZA 4L9EA 1LL8A 2K7SA 2PYRA 4GHIA 1DP9A 3FG8A 4PKYG 1UGUA 5F6AA 5IS1A 5IU1A 4JGRA 4BBVA 5G4YA 4YWZA 2V0WA 2L4RA 4LRZE 1TS0A 4HY8A 3LI9A 4HH3A 3LIDA 2ZOHA 4LPZA 5KIZA 2D01A 4EXOA 3IS2B 3F1PA 3F1OB 4HHDA 3LUQA 5EFWA 4HNBA 1BYWA 2L0WA 5HD5A 1T19A 4HJ3A 1OTAA 1F9IA 2OOLA
chains in the Genus database with same CATH superfamily
5AQ9A 5FQJA 1J9MA 3VSKA 3TOIA 1YAXA 2Y2NA 4B9OA 3MKFA 1LL5A 4XT2B 3G2ZA 4R4RA 2JHEA 1GSXA 2B5RA 3CITA 3V3SA 2UV0E 5HAPA 4PKYA 2HZ5A 4EV4A 3QNCA 3D9YA 2G7UA 2VGJA 2ZQ9A 5E2HA 1K57C 4WYYA 4D2OA 1BLCA 3VP3A 1X0OA 4N9LA 4DDYA 4DDSA 2Z6DA 2ZD8A 4X69A 4FOFA 4S2KA 3FYZA 3H82A 4HBUA 2ZC6B 3UPPA 2ZQAA 4GDBA 4Q0JA 2V1ZA 2V2FF 1N9BA 5CTNA 2L1MA 4BD1A 1JWVA 3DWZA 5FEFA 4ZJ2A 5E2GA 4QHCA 2B18A 2Y2QA 5TR7A 4BMWA 5DKKA 5M18A 1I5QA 1H5XA 4JGPA 1EI5A 2HJEA 3BY8A 1MBLA 2HF6A 4X25A 1K57A 4Y5FA 3S7NA 1YLJA 3JVVA 3KYQA 1RGZA 1XJ2A 2W1TA 2DCFA 5EPHA 4ZRRA 3UY6A 1KE0A 3MF0A 5HZHA 3IF5A 1PIOA 1ERMA 3ZNYA 4UA6A 1CEGA 4ZJ1A 1LSXA 3VSLA 1LSVA 5HDSA 4Q8IA 4ZBEA 3L9KA 2VZWA 3HREA 1VETB 3N4IA 4BBTA 4B93A 3TW8A 5TGFA 3IXDA 2PT7A 5A90A 2PDRA 4CLCB 5F1GA 5CHMA 3SOIA 2JC7A 3DTEA 1HLUP 3IQAA 3JVUA 3RTYA 1Q2QA 4S2LA 1OMEA 2XGNA 4B4XA 1DP8A 2WGIA 4MDZA 3BFGA 3C7VA 1MKIA 4GLQA 4S2IA 4KQQA 3U2AA 4E3OA 1JWPA 1YMSA 3E4PA 3CPTA 1BLSA 4GKUA 1KVMA 3G34A 2WKIA 3MJQA 3T4QA 2ZC3B 1H8YA 3FV7A 3AGEA 1PRQA 1ZG4A 4WF0A 3R7WA 2JKGA 4NG2A 4NEED 4LENA 4WZ5C 1FSYA 3IWQA 5HSQA 3FKWA 5GLBA 3ITBA 3ICYA 2IA2A 1HVBA 2X71A 4Z9QA 2ZBBA 3LEQA 4D60A 3HUMA 4OQIA 1ESUA 1G68A 2W27A 4EERA 1NRFA 3ZQ5A 4BQMA 2P08A 4OQHA 1CJFA 1W79A 3DTIA 2HGVA 2Y2OA 5LBRA 4CQHA 4B88A 4WZ5A 2KLIA 3N7WA 3TRCA 1U60A 1J3WA 1EWZA 3WRTA 3VOZA 4OLGA 3NOPC 2BASA 2J9PA 4DF6A 4N1XA 3UB7A 3QP1A 2EWWA 2ZMFA 1PWGA 3A0SA 4K0XA 4E3JA 3MXSA 5HFOA 4S2PA 5L07A 5HWVA 1JTDA 1IEMA 2AVXA 1OTBA 5G18A 3CWFA 1DJBA 4KG5A 5AQBA 1HZOA 1GA0A 3H7WB 4EESA 2W3FA 5F1FA 1Z6FA 2Z2MB 3M6HA 3KSIA 1BUEA 1PW1A 3B33A 3BM6A 1E3UD 5EVEA 1YLZA 5DJUA 2XROA 3O5YA 4ID4A 3GRJA 4LV0A 3UB9A 5AQAA 4QPRA 1VEUB 4MN6A 4KZAA 3MZDA 2O9BA 4S2OA 5DTSA 4Y17A 1DJAA 2Z6CA 5DKLA 4JXGA 3C2WA 4P6ZS 1RP5A 4DE2A 1ZC2A 2XRNA 2A24B 4GCZA 1KGGA 3TSGA 1I2WA 3NDEA 1VB6A 1K54C 3DWKA 4IVIA 4L9GA 2EXBA 3T4JA 2I9VA 5C5KA 1T18A 3S4XA 1NLZA 4U0XA 4EEPA 3PYPA 3PHYA 1NRJA 1FQGA 4U3TA 2OAP1 4MLLA 3ITAA 3H82B 1F2KA 3SS3A 2QPNA 3LY3A 3KX0X 2FFFB 4MBFA 3BEBA 3MZEA 2XR0A 4KG6A 4WM9A 1NWZA 5HAIA 5J7EA 2JCHA 5FATA 4EBLA 5FI2A 4XUXA 3RXXA 2BG1A 4HH2A 1K54A 5F82A 2PR6A 3FPVA 4LCLA 4BWIA 3PXPA 5DF7A 4I3IA 1BZAA 4HOIA 1MC0A 1S0WA 2W1TB 5AJGA 3K2NA 1W7FA 2IWDA 1S6RA 2K7SA 4JKTA 5FI7A 4GHIA 1Z09A 1UGUA 5IS1A 2Y2JA 3CI6A 5EOEA 4Y7PA 5DF9A 3FWLA 2Z2LB 2XFSA 2E8JA 4BL2A 2EXAA 4WELA 5GLDA 4N1HA 2Y79A 5DTKA 4X55A 4DMZA 1ES5A 4HY8A 3HLWA 3P01A 4HH3A 4ZDXA 3LIDA 3UNWA 4UAAA 2J9OA 3A3DA 3LUQA 5DF8A 4NK3A 1P9WA 2Y59A 4E3IA 4HNBA 2O9AA 2EX8A 4OOLA 4DE1A 1HTZA 3S7OA 3FZCA 1F9IA 1IKIA 3VP1A 2OOLA 4ME4A 1GHMA 1OTIA 2GX5A 3K3CA 1K4FA 4E3KA 3RXWA 4P6BA 3G32A 2V9AA 5HX9A 2WUQA 3IBJA 3ZG5A 2H28A 3T1RA 5HL1A 3JYIA 3LR5A 1T1CA 4X53A 2O0YA 5FQKA 3EEHA 3NJAA 3VV4A 2LB9A 3HLBA 3LICA 1MWSA 4QJGA 3ZG0A 1NYYA 3SH8A 4P87A 4OPQA 4K08A 4DJ3A 4BD0A 2X01A 2ZC4B 3V50A 1G28A 1TDLA 2IWBA 5J4EA 3WS5A 4X1MA 3V3RA 4CLCE 3HBRA 4KUOA 3NOTC 3ZYTA 1SKFA 3P09A 2VV8A 4QY5A 2XF3A 1P97A 1BSGA 1YSPA 3EQVA 2P04A 3ZHHA 1PI4A 4LV1A 1W8QA 3PBNA 4ARZA 4Y15A 3ZVWA 2VGLM 4LGWA 2XA7S 3O87A 2XFTA 4WZ4A 1YQSA 5G4ZA 5MC7A 5A92A 2ZM0A 2FH5A 1XFQA 1D06A 5HWWA 2G2UA 4OONA 1XGJA 3MMHA 1A0KA 1VHMA 3OPLA 2BTFP 1IYSA 3H7WA 1K56A 1LSWA 2OWHA 3DAVA 2M7VA 1DY6A 3NOUC 4GZBA 2V1AA 3B42A 4X1LA 4WEJA 4WBGA 4B4ZA 3T12B 3SS4A 2JN7A 5FEGA 1TS8A 1T1AA 2B02A 4PM9A 1LI9A 1GHIA 3HCYA 1VEUA 2V0UA 4I3JA 4I5SA 5A8BA 1DRMA 2V8CA 3OCNA 3VE3A 2K2NA 1PFLA 4R38A 1BT5A 3DBAA 2XEPA 3B3XA 1CEFA 3OPHA 5EM1A 2OLVA 2A24A 1WA9A 1WYBA 1STZA 1QMFA 4EW7A 3E2KA 3S7PA 4RVAA 2E8IA 3WWXA 4GS9A 5EUAA 2M1CA 1TVFA 2ZC7A 3GQZA 5DJTA 2KX6A 1E3UA 3HLCA 4ESPA 5CGXA 3Q7ZA 2J7VA 4IBRA 3VFFA 4HESA 4HJ6A 2G2WA 2HP5A 5F83A 4QU3A 3ZGAB 5HDDA 4OQGA 2PAVP 4HJ4A 1SKOA 1I2SA 2O9CA 3OLOA 2KOIA 2R9WA 5IHVA 4Y0UA 1CQAA 2V1BA 1EROA 4IVKA 5DVAA 1PWDA 4I3AA 3CMZA 5EOOA 3T4LA 1M6KA 3A0VA 1E25A 5EE8A 4OPRA 5CHUA 2P9VA 3UB6A 4QB8A 3W4QA 2IWCA 4KZ6A 2EX2A 3EGXC 4GHIB 1XP4A 1UWPX 2B95A 4BJPA 5HPFA 2VV6A 1IYPA 2ZQDA 3HLGA 3S1YA 2ZMVA 1OTDA 1ES3A 3ISGA 3T50A 3QP6A 4DXCA 3GECA 5FASA 1O07A 3QP2A 1L3LA 4EQ1A 3KSHA 2ACGA 4DXBA 5DFXA 5FQIA 3HLFA 3NHQA 4GN2A 4WN5A 3VOLA 1GSWA 3PAGA 3VP2A 3MR0A 1NYMA 3W4PA 5E2FA 2XDMA 2NUTC 3BJNA 2DMWA 4HP4A 1FCOA 3PBTA 4II7A 2C5WB 2Y91A 2WGWB 2J8YA 2EWVA 1KVLA 1N9LA 5FDHA 3ZVTA 3E0YA 3T1QB 2QJ7A 4UQIM 1NJ4A 5I5LA 4MBHA 3UB5P 1FR1A 3JPUA 3VP0A 1S67L 5E2EA 4GOGA 3QP5A 3GSGA 5HAQA 3E2LA 1XGIA 4HBTA 1JTGA 2D02A 3ZG8B 1ESIA 5GHXA 3UN7A 5EVID 2J3TD 5HWTA 4OQ0A 2ZOIA 1YPRA 1VM1A 5U47A 2ZJ9A 1PW8A 1FILA 1IFQA 3MQOA 5FAQA 3IX8A 3SZTA 2OWJA 3T4OA 2QZ6A 5TFQA 5CXWA 3PTEA 5FQMA 2LB5A 1D1JA 2CMNA 4KZBA 2ZQ7A 3EOIA 1XJ4A 3A0RA 3A3IA 1UWNX 4EWFA 4OKPA 3K3DA 1TS7A 3RH8B 4RQ9A 4XUZA 4BL3A 1CI9A 4ARZB 4G3WA 3IWOA 3DTMA 4GW9A 1AXBA 3UPOA 4DJ2A 3BFEA 1P0ZA 4L9EA 4C75A 4OOYA 2PYRA 4PM6A 1LL9A 2XD5A 2EX6A 4FTXA 1BTLA 4BBVA 4BLMA 3ZG7B 1YLWA 1TD5A 2WZXA 1CF0A 1KE4A 2ZC5B 2OLUA 4KZ9A 1ALQA 1ZTUA 4N92A 5JYPA 4LPZA 2PU4A 3V39A 5L10A 4A5RA 1FOFA 5KZHA 1SZVA 4WMCA 3IS2B 3KYZA 2W3GA 2VGLS 5FSRA 1NZOA 2Y8HA 3F1PA 1ZG6A 5EFWA 4FH4A 3BECA 3O3VA 4NETA 2Y4AA 5EECA 1T19A 4HJ3A 1CI8A 5CTMA 3OBFA 1PNEA 2OSUA 4AFIA 3PAEA 5HDCA 2WKEA 4Y3IA 2A3UA 4FD8A 4GJ4A 5KSCA 1PWCA 4R3AA 2H5SA 3VE4A 3UO9A 3QHYA 1YSQA 4NXFA 4NKPA 2FZ0A 3IHAA 4GS9B 3RJUA 2Y2IA 2EX9A 3G31A 2Q0OA 5GHYA 4OPYA 1JWZA 4KQOA 4PAUA 4MCWA 2INWA 3BFDA 1OT9A 4DN0A 3IF6B 3MFXA 1S1ZA 1KDWA 2JKFA 1C3BA 4FSFA 1OT6A 3A3JA 5L09A 1SKOB 3T4SA 4LLOB 1N4OA 3R4KA 5I94A 1GSVA 4JBFA 1Y54A 3E4OA 1PI5A 4M3KA 1SDEA 5TBMA 5JYOA 4L0LA 4M4XA 2GDNA 3V67A 1BLPA 2P9VB 4RX2A 4S2NA 5HARA 5CERA 4ZTKA 3HVFA 4IBXA 2C6WB 3CLOA 4K0WA 4FUWA 2JKTI 3LFVA 4X68A 4KQDA 5GHZA 2WADA 4I38A 2FFYA 1GHPA 1L0EA 3U4LP 3LEZA 3OPRA 3UE6A 4WUJA 1RCJA 2ZL1A 3BY9A 3Q81A 3D3OA 2GNXA 4BENA 5GL9A 3BRMA 5CEBA 3MXQA 3C30A 1ZHHB 5D3OA 1H3QA 3UDIA 2YKFA 1LLBA 4NXEA 1ERQA 3BWLA 5CHJA 4PM5A 2JKRM 3KSGA 2HV1A 4Y0OA 2WGWA 4G3KA 2WKPA 3LCEA 2Y55A 1L0FA 1XPBA 3MS6A 4PMAA 4WL9A 5GLAA 3G30A 4KZ8A 2QKPA 4WEKA 1YKDA 1RGYA 4PM7A 4X56A 5KMWA 4ETZA 4EUVA 1SCWA 4E3NA 4EQIA 3CJMA 2XK1A 3BQ8A 1L0DA 4R6LA 1NLYA 4RX3A 3CZDA 1N9NA 2J80A 4U0TA 1ES4A 3GR2A 2J3TC 2NUPC 2VV7A 3LY4A 3OOVA 3LIFA 2EFXA 3IXHA 1SDNA 1OJ5A 2A49A 1OPXA 3BYDA 4LRXC 5KSHA 1M40A 2EFUA 3EQUA 4P0MA 1CK3A 1IKGA 2P7JA 2PRFA 3W2ZA 3UMEA 3IX4A 1FR6A 4YINA 4EETB 3N8RA 1FSWA 3IH8A 4MBKA 3G6OA 4IUHA 4YOFA 1Y28A 2H0YA 4JXVA 1PZOA 1NY0A 1VQQA 2HPBA 1XA7A 1W8YA 3NC8A 3IBRA 4PHTA 2ZM8A 4P6ZM 4JXSA 4LFUA 3IS2A 2HP9A 3SH9A 2VGKA 4E3LA 2WKHA 3WRZA 1H8ZA 3HUNA 2M7UA 2Y2KA 5K5BA 3F1PB 3LR4A 4CJNA 2UWXA 3CUEC 5IT5A 1LT0A 1T1BA 3LIEA 2XD1A 4F3LA 2X02A 4R4SA 3RFBA 4E3MA 3IF6C 4IHQA 3NECA 1K0KA 5FDSA 1XFNA 4OVDA 3GV9A 3LO7A 3N6IA 4JXWA 4QY6A 3HLDA 4CPKA 1TS6A 1ONGA 3D4FA 3OC2A 1XX2A 3IXGA 3NCKA 1GCEA 3CUEA 3TE8A 4E6XA 4G3VA 3L7HA 5HD3A 1NXYA 2PR5A 3IF6A 1K6RA 3PBQA 3O86A 4Y0TA 3IX3A 4Z1WA 4DKIA 2W0NA 3F1NA 1EW0A 2MJ6A 1MZUA 1V9YA 2XQZA 2R78A 2W3DA 1KOUA 2HJ9C 3C4OA 4CLCD 2BLSA 3S7QA 4Y2FA 5F69A 2ZM2A 4LRYC 3T4TA 2P74A 5TBMB 4HIAA 1F5MA 2WKQA 2RCXA 3EWKA 1W5DA 4EBNA 2Q9NA 2ZQCA 5TJJA 2JKTM 3A3EA 2OAQ1 3NIAA 1YLYA 3FG8A 3HLEA 4JGRA 4LV2A 3T4KA 2WZZA 4KQRA 3A3FA 3OCLA 4YWZA 2V0WA 3C4PA 4R23A 4EU0A 3SH7A 2A2LA 2ZLYA 3T1XA 1YLPA 5CECA 1TS0A 3NBLA 5J8XA 4C3QA 1ES2A 3LI9A 2ZL1B 2ZOHA 4OOMA 5KIZA 4H8RA 3UE1A 3N8SA 4FH2A 5BOHA 3TG9A 4O01A 5HPIA 2ZQ8A 5FQQA 2Y2MA 2L0WA 1XA1A 1O7EA 2JKRI 3EEAA 5AVFA 2HDQA 2K31A 2W3EA 3H9WA 4UA7A 3IHBA 3C38A 2R9XA 1L0GA 4H6JB 3QP4A 3ZG9B 4OP8A 3IH9A 3UE0A 4MN7A 4IJGA 3UB8A 3FKVA 2CC1A 4MN5A 2O99A 3PBRA 4E04A 3MKEA 3BQAA 4QWOA 1WE4A 3NULA 2PD8A 3UMDA 5FAOA 1G6AA 1S66L 2VX8A 2JE5A 2XA7M 3BLMA 4GD6A 2WKRA 4OPZA 4S2MA 3CG5A 4OH0A 4R70A 2QMIA 4DRTA 3N8LA 3P7NA 1DJCA 3DW0A 1K56D 3Q7VB 1BLHA 4JF5A 3LIBA 3UDFA 3IWIA 4OP5A 5L8MA 3GMWA 3GVBA 3IXBA 4WLAA 2QHKA 4KZ7A 1F98A 2W3HA 4NXBA 1K6SA 3MQ0A 1W63Q 5CRFA 3UDXA 1MWRA 4O0PA 1XJ6A 4O7DA 1FIKA 4JF6A 3I7JA 1IYOA 5EVIB 3E4QA 2DNSA 1ACFA 4IUKA 4I39A 1OJGA 1ZKJA 3KO6A 1ODVA 4HQAA 4KUKA 1YLTA 1LI0A 4GDNA 5HL6A 1K4EA 3NI9A 3BFFA 4JLFA 4Q0IA 3SW1A 2EA9A 4IEDA 1OTEA 3MQQA 3G35A 4ZJ3A 4KZ4A 1PYYA 4KG2A 2QJ5A 5EV0A 2Y2GA 2ZMAA 3F1OA 5E43A 1NZUA 3NY4A 3SS5A 1YT4A 2XSSA 1G5UA 2Q9MA 5F5YA 5F68A 2Y2PA 4F3LB 3VP4A 5A93A 1HD8A 3OZHA 2PHYA 4BBUA 1S4RA 1H0MA 4UA9A 4Q0HA 2JBFA 2WK0A 4XT2A 1JNUA 5J3WA 3MXRA 3ZCZA 3HJKA 3UE3A 3ULFA 1KGEA 2RL3A 1K55C 2HP6A 1LHYA 1S4SA 2XLNA 3KYEA 3Q1FA 3DTKA 3LYXA 2VKSA 3PR6A 2WGVA 3LR3A 4X6TA 3E98A 4S2NC 1W63M 3AGFA 3BLSA 3LIAA 3MSHA 1IYQA 4DE0A 2H0TA 2VLGA 5EVLA 4R1GA 2WAFA 4EEUA 3W4OA 3F1NB 2VA0A 2KDKA 2QWSA 4JF4A 3WS1A 3WS4A 4E6WA 1MWUA 3CAXA 1E4DA 1N9OA 4F94A 1K55A 4XXRA 3M2JA 3PBOA 3UPNA 2J3WA 1K38A 3VFHA 3BW6A 4GB7A 2PBYA 1MXOA 4CLCC 1MWTA 1TF1A 3V5MA 3ZFZA 1G6OA 5CGSA 4MEZA 4PM8A 3IT9A 3Q82A 4JGQA 3PBSA 3C5AA 2PD7A 4EUZA 1D7EA 4HEFA 1XJ3A 5GLCA 4DE3A 3O88A 3HUOA 2Y2HA 2W1RA 2GJ3A 5M19A 4R3JA 1K25A 2VJWA 1VETA 3LI8A 3LR0A 3ZDJA 4HI4A 2WAEA 4KENB 1TEMA 2HDRA 2DRWA 5FL3A 4CLCA 4MNRA 3CHWP 3QNBA 2WYXA 1TDGA 4GD8A 1MY8A 2YKHA 5FA7A 2PU2A 1WYCA 3FC7A 3Q07A 3MZFA 1H8MA 1XXMA 4HP9A 4GNUA 3G2YA 1MKMA 4YNRA 1DP6A 4H6JA 2Y2LA 1KGFA 3HL9A 4N9KA 3CPTB 3MBZA 4RYEA 4KZ3A 1YM1A 5AVEA 5FAPA 3D72A 5A91A 2PBDP 4EBPA 3OPPA 3HJIA 3M2KA 4ETXA 4JGOA 5DTTA 4Y13A 3R7WB 4FCFA 3WS2A 4JPMA 2V8FA 3BFCA 2VK3A 5L2FA 4NXGA 4L9FA 5EM0A 1Y4OA 3QP8A 1JVJA 1P9RA 1V9ZA 3NDGA 5EVIC 4LV3A 1KE3A 4RA7A 1S1YA 2V20A 3VOYA 1KDSA 3Q7VA 2HDUA 3T1SA 4YFMA 2VEAA 2QYBA 4UQIS 4R3BA 2PYPA 4C6YA 3GDIA 1SHVA 1MPLA 5FI6A 3C8CA 3EGDC 1BULA 4S2JA 1Q2PA 3LGOA 3GTCA 4PPRA 4O8GA 1AWIA 1PZPA 2XH9A 4WMCD 1IOUA 1YMXA 2H10A 3P98A 5AQ7A 4ZAMA 5EVIA 1LL8A 1GA9A 1DP9A 4PKYG 4KZ5A 1FCMA 1FCNA 5F6AA 4LCMA 5CGWA 5IU1A 3TJZC 1IELA 3KSFA 4UEYA 5G4YA 5CEDA 1L2SA 1ONHA 2L4RA 4LRZE 1QMEA 4QD4A 5DFYA 5M1AA 4R0QA 3M6BA 2GZAA 4OLDA 3FPWA 3WS0A 3VMAA 4P85A 2OV5A 2I72A 2D01A 4EXOA 3MFDA 3AGDA 2HDSA 3F1OB 4K91A 4HHDA 3ZNTA 4UHUA 4MMNA 5FQ9A 3W8KA 3C7UA 5CX7A 1BYWA 5HD5A 5HW3A 1XKZA 1OTAA 3G4PA 3B47A 3S22A
chains in the Genus database with same CATH topology
4ME4A 5AVFA 1OTIA 2GX5A 2K31A 4AFIA 3K3CA 1YAXA 2W3EA 4B9OA 2V9AA 3H9WA 5HDCA 4XT2B 4Y3IA 3C38A 4GJ4A 4H6JB 4R3AA 2JHEA 3VE4A 1GSXA 3IBJA 1YSQA 2H28A 4NXFA 3CITA 4NKPA 4MN7A 4IJGA 2FZ0A 4PKYA 3UB8A 4MN5A 2O99A 3PBRA 4GS9B 4E04A 3LR5A 3BQAA 1T1CA 2O0YA 3EEHA 3NJAA 3VV4A 2G7UA 2LB9A 2PD8A 3UMDA 3LICA 1S66L 2VX8A 2XA7M 1X0OA 4KQOA 2WKRA 4PAUA 4MCWA 2Z6DA 4K08A 4DJ3A 4FOFA 2INWA 1OT9A 3H82A 1G28A 4R70A 4DN0A 3MFXA 1S1ZA 4Q0JA 5J4EA 3P7NA 4FSFA 1OT6A 4CLCE 4KUOA 3NOTC 3ZYTA 3T4SA 2L1MA 2VV8A 4LLOB 1P97A 3R4KA 1YSPA 2B18A 3EQVA 4BMWA 2P04A 1GSVA 5DKKA 3LIBA 4JGPA 3E4OA 2HJEA 3BY8A 5L8MA 2HF6A 3PBNA 4ARZA 5TBMA 4WLAA 4L0LA 2QHKA 4M4XA 3V67A 2VGLM 4Y5FA 3S7NA 3JVVA 2XA7S 1F98A 2W3HA 4NXBA 3KYQA 1XJ2A 2W1TA 5G4ZA 3MQ0A 4ZRRA 1W63Q 5MC7A 3MF0A 4O0PA 1XJ6A 3CLOA 5HZHA 2FH5A 1XFQA 1D06A 5HWWA 3E4QA 2JKTI 3MMHA 3LFVA 1VHMA 4IUKA 4KQDA 1OJGA 1LSXA 4I38A 4I39A 3KO6A 1ODVA 3H7WA 4HQAA 1LSVA 1LSWA 4KUKA 2OWHA 5HDSA 5HL6A 2M7VA 2VZWA 3NOUC 4BBTA 4B93A 3UE6A 4WUJA 3TW8A 2PT7A 2V1AA 3B42A 2PDRA 3BY9A 4CLCB 4Q0IA 3D3OA 4WEJA 2EA9A 3SW1A 2GNXA 1OTEA 3MQQA 3MXQA 3C30A 2JN7A 1ZHHB 3JVUA 2QJ5A 3RTYA 1TS8A 1T1AA 1H3QA 2B02A 3F1OA 2YKFA 3HCYA 1DP8A 4I3JA 2V0UA 4MDZA 4I5SA 5A8BA 4GLQA 1DRMA 2XSSA 3OCNA 4NXEA 3U2AA 3BWLA 3VE3A 2K2NA 5F5YA 2JKRM 5F68A 3KSGA 4R38A 4F3LB 3E4PA 3DBAA 2HV1A 2PHYA 4BBUA 1S4RA 4G3KA 2WKPA 3MJQA 3T4QA 4Q0HA 4XT2A 1JNUA 2A24A 5J3WA 1WA9A 1STZA 3HJKA 3UE3A 3ULFA 4EW7A 4WF0A 4WL9A 3R7WA 3S7PA 4NEED 4GS9A 1S4SA 2QKPA 5HSQA 4WEKA 3LYXA 1YKDA 2M1CA 2VKSA 3PR6A 3LR3A 3ICYA 5DJTA 4ETZA 2KX6A 2IA2A 4EUVA 3E98A 1W63M 3LIAA 2ZBBA 4HJ6A 2VLGA 2W27A 4EERA 5HDDA 3BQ8A 4EEUA 3F1NB 2VA0A 2KDKA 2QWSA 4R6LA 1NLYA 3ZQ5A 1N9NA 4HJ4A 2J80A 3CAXA 2O9CA 2P08A 2KOIA 3OLOA 1N9OA 2J3TC 2NUPC 2VV7A 3OOVA 5LBRA 2HGVA 4CQHA 2V1BA 3LIFA 4I3AA 3PBOA 2KLIA 1OJ5A 3TRCA 1OPXA 2J3WA 4LRXC 3T4LA 5KSHA 3BW6A 3NOPC 2BASA 3A0VA 3EQUA 4CLCC 3UB7A 1TF1A 2EWWA 1G6OA 2ZMFA 3UB6A 2P7JA 3EGXC 3W2ZA 3UMEA 3A0SA 4EETB 4JGQA 3PBSA 4GHIB 2PD7A 1UWPX 1D7EA 5HWVA 1XJ3A 3G6OA 4BJPA 5HPFA 2VV6A 4IUHA 4YOFA 1Y28A 1OTBA 3CWFA 2W1RA 2GJ3A 2ZMVA 1OTDA 3T50A 2VJWA 3GECA 3LI8A 3IBRA 3LR0A 3H7WB 4EESA 4HI4A 4PHTA 2W3FA 4P6ZM 5FL3A 4CLCA 4EQ1A 3KSHA 3IS2A 5DFXA 3KSIA 2M7UA 3B33A 3NHQA 4WN5A 3VOLA 5DJUA 2XROA 3O5YA 5K5BA 1GSWA 3F1PB 2YKHA 3MR0A 3LR4A 3FC7A 3CUEC 3UB9A 5IT5A 1H8MA 1LT0A 2NUTC 3BJNA 4QPRA 4HP9A 1T1BA 2DMWA 3LIEA 4F3LA 4MN6A 4HP4A 3RFBA 2O9BA 1MKMA 3OBFA 4YNRA 4IHQA 3PBTA 1DP6A 4H6JA 2Z6CA 5DKLA 4II7A 3C2WA 2EWVA 4P6ZS 1N9LA 1XFNA 5AVEA 3D72A 3E0YA 2QJ7A 4UQIM 2XRNA 2A24B 4GCZA 5I5LA 1TS6A 3HJIA 4ETXA 4JGOA 1S67L 3OC2A 3R7WB 1VB6A 3CUEA 3TE8A 4L9GA 2D02A 3T4JA 2I9VA 5C5KA 1T18A 4G3VA 4NXGA 4L9FA 1NLZA 5HD3A 1P9RA 2PR5A 4EEPA 3PYPA 3PHYA 2J3TD 1NRJA 1V9ZA 3PBQA 5HWTA 2ZOIA 4Z1WA 2OAP1 2W0NA 3F1NA 3H82B 1IFQA 3MQOA 1S1YA 3KX0X 2OWJA 3T4OA 1EW0A 2MJ6A 1MZUA 1V9YA 2R78A 2W3DA 1KOUA 1NWZA 2HJ9C 2VEAA 5J7EA 2QYBA 2LB5A 2CMNA 4UQIS 4CLCD 3EOIA 2PYPA 1XJ4A 3A0RA 3GDIA 3S7QA 4Y2FA 1UWNX 3C8CA 3EGDC 3K3DA 1TS7A 4HH2A 5F69A 4RQ9A 3RH8B 4LRYC 3T4TA 2PR6A 4ARZB 4G3WA 3FPVA 4O8GA 4GW9A 4BWIA 3PXPA 5TBMB 4I3IA 4HIAA 1F5MA 2WKQA 4HOIA 1IOUA 3EWKA 1MC0A 4DJ2A 1P0ZA 2W1TB 5AJGA 3K2NA 5TJJA 2JKTM 4L9EA 2OAQ1 1LL8A 2K7SA 2PYRA 4GHIA 1DP9A 3FG8A 4PKYG 1UGUA 5F6AA 5IS1A 3CI6A 5IU1A 5DF9A 3TJZC 3KSFA 4JGRA 3T4KA 4UEYA 4BBVA 5G4YA 1TD5A 3OCLA 4YWZA 2V0WA 2L4RA 4LRZE 5DFYA 4EU0A 4WELA 2A2LA 2Y79A 2GZAA 3FPWA 4DMZA 1TS0A 4HY8A 3P01A 1ZTUA 3LI9A 4HH3A 3LIDA 2ZOHA 4LPZA 4OOMA 2D01A 5KIZA 4EXOA 3IS2B 3KYZA 2W3GA 2VGLS 4O01A 2Y8HA 3F1PA 3F1OB 5HPIA 4HHDA 3LUQA 5EFWA 4MMNA 1P9WA 4HNBA 5CX7A 1BYWA 2L0WA 5HD5A 2O9AA 4OOLA 1T19A 4HJ3A 1OTAA 3S7OA 2JKRI 3EEAA 1F9IA 3B47A 2OOLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AVF A;  1OTI A;  3K3C A;  4B9O A;  2V9A A;  3H9W A;  5HDC A;  4XT2 B;  4H6J B;  4R3A A;  2JHE A;  3VE4 A;  1GSX A;  2H28 A;  4NXF A;  4PKY A;  3UB8 A;  4MN5 A;  4GS9 B;  4E04 A;  1T1C A;  3EEH A;  3NJA A;  2PD8 A;  3UMD A;  3LIC A;  1S66 L;  1X0O A;  2WKR A;  2Z6D A;  4K08 A;  4DJ3 A;  2INW A;  1OT9 A;  3H82 A;  1G28 A;  4R70 A;  3MFX A;  1S1Z A;  5J4E A;  3P7N A;  1OT6 A;  4KUO A;  3NOT C;  2L1M A;  2VV8 A;  4LLO B;  1P97 A;  1GSV A;  5DKK A;  3LIB A;  4JGP A;  3E4O A;  3BY8 A;  5TBM A;  4WLA A;  4M4X A;  2QHK A;  1F98 A;  4NXB A;  1XJ2 A;  5G4Z A;  1XJ6 A;  3CLO A;  5HZH A;  1XFQ A;  1D06 A;  5HWW A;  3E4Q A;  4KQD A;  4I39 A;  4I38 A;  1OJG A;  1LSX A;  1ODV A;  3H7W A;  4HQA A;  1LSV A;  1LSW A;  4KUK A;  2OWH A;  5HDS A;  3NOU C;  4BBT A;  3UE6 A;  4WUJ A;  2V1A A;  2PDR A;  3BY9 A;  3SW1 A;  2EA9 A;  1OTE A;  3MQQ A;  3MXQ A;  2JN7 A;  2QJ5 A;  3RTY A;  1TS8 A;  1T1A A;  2B02 A;  3F1O A;  2YKF A;  1DP8 A;  4I3J A;  2V0U A;  4I5S A;  5A8B A;  1DRM A;  4NXE A;  3BWL A;  3VE3 A;  5F5Y A;  5F68 A;  4F3L B;  4R38 A;  3E4P A;  2HV1 A;  2PHY A;  4BBU A;  1S4R A;  2WKP A;  3MJQ A;  4XT2 A;  2A24 A;  1JNU A;  5J3W A;  1WA9 A;  3HJK A;  3ULF A;  4EW7 A;  4WF0 A;  4WL9 A;  4GS9 A;  1S4S A;  2QKP A;  5HSQ A;  3LYX A;  2M1C A;  3ICY A;  5DJT A;  2KX6 A;  3LIA A;  2ZBB A;  4HJ6 A;  2VLG A;  2W27 A;  4EER A;  5HDD A;  4EEU A;  3F1N B;  4R6L A;  2KDK A;  2QWS A;  3ZQ5 A;  1N9N A;  4HJ4 A;  2J80 A;  3CAX A;  3OLO A;  1N9O A;  2VV7 A;  2V1B A;  3LIF A;  4I3A A;  1OJ5 A;  4LRX C;  3NOP C;  2BAS A;  3A0V A;  3UB7 A;  3UB6 A;  2P7J A;  3UME A;  3A0S A;  4EET B;  4JGQ A;  4GHI B;  2PD7 A;  1D7E A;  1UWP X;  5HWV A;  1XJ3 A;  3G6O A;  2VV6 A;  1Y28 A;  1OTB A;  3CWF A;  2GJ3 A;  1OTD A;  3T50 A;  3GEC A;  3LI8 A;  3IBR A;  3H7W B;  4EES A;  4HI4 A;  4EQ1 A;  3IS2 A;  3B33 A;  3NHQ A;  4WN5 A;  3VOL A;  5DJU A;  1GSW A;  3F1P B;  2YKH A;  3MR0 A;  3FC7 A;  3UB9 A;  1LT0 A;  4HP9 A;  1T1B A;  3LIE A;  4F3L A;  4MN6 A;  4HP4 A;  1DP6 A;  4H6J A;  2Z6C A;  5DKL A;  3C2W A;  1N9L A;  1XFN A;  5AVE A;  3D72 A;  2QJ7 A;  2A24 B;  4GCZ A;  5I5L A;  1TS6 A;  3HJI A;  4JGO A;  1S67 L;  1VB6 A;  4L9G A;  2D02 A;  2I9V A;  1T18 A;  4NXG A;  4L9F A;  5HD3 A;  2PR5 A;  4EEP A;  3PYP A;  3PHY A;  1V9Z A;  5HWT A;  2ZOI A;  2W0N A;  3F1N A;  3H82 B;  3MQO A;  1S1Y A;  3KX0 X;  2OWJ A;  1EW0 A;  1MZU A;  1V9Y A;  2R78 A;  1KOU A;  1NWZ A;  2VEA A;  5J7E A;  2CMN A;  2PYP A;  1XJ4 A;  3A0R A;  3GDI A;  1UWN X;  3C8C A;  3K3D A;  3RH8 B;  1TS7 A;  4HH2 A;  4RQ9 A;  5F69 A;  4LRY C;  2PR6 A;  4GW9 A;  5TBM B;  4I3I A;  4HIA A;  2WKQ A;  4HOI A;  3EWK A;  4DJ2 A;  1P0Z A;  4L9E A;  1LL8 A;  2K7S A;  2PYR A;  4GHI A;  1DP9 A;  3FG8 A;  4PKY G;  1UGU A;  5F6A A;  5IS1 A;  5IU1 A;  4JGR A;  4BBV A;  5G4Y A;  4YWZ A;  2V0W A;  2L4R A;  4LRZ E;  1TS0 A;  4HY8 A;  3LI9 A;  4HH3 A;  3LID A;  2ZOH A;  4LPZ A;  5KIZ A;  2D01 A;  4EXO A;  3IS2 B;  3F1P A;  3F1O B;  4HHD A;  3LUQ A;  5EFW A;  4HNB A;  1BYW A;  2L0W A;  5HD5 A;  1T19 A;  4HJ3 A;  1OTA A;  1F9I A;  2OOL A; 
#chains in the Genus database with same CATH topology
 5AQ9 A;  5FQJ A;  1J9M A;  3VSK A;  3TOI A;  1YAX A;  2Y2N A;  4B9O A;  3MKF A;  1LL5 A;  4XT2 B;  3G2Z A;  4R4R A;  2JHE A;  1GSX A;  2B5R A;  3CIT A;  3V3S A;  2UV0 E;  5HAP A;  4PKY A;  2HZ5 A;  4EV4 A;  3QNC A;  3D9Y A;  2G7U A;  2VGJ A;  2ZQ9 A;  5E2H A;  1K57 C;  4WYY A;  4D2O A;  1BLC A;  3VP3 A;  1X0O A;  4N9L A;  4DDY A;  4DDS A;  2Z6D A;  2ZD8 A;  4X69 A;  4FOF A;  4S2K A;  3FYZ A;  3H82 A;  4HBU A;  2ZC6 B;  3UPP A;  2ZQA A;  4GDB A;  4Q0J A;  2V1Z A;  2V2F F;  1N9B A;  5CTN A;  2L1M A;  4BD1 A;  1JWV A;  3DWZ A;  5FEF A;  4ZJ2 A;  5E2G A;  4QHC A;  2B18 A;  2Y2Q A;  5TR7 A;  4BMW A;  5DKK A;  5M18 A;  1I5Q A;  1H5X A;  4JGP A;  1EI5 A;  2HJE A;  3BY8 A;  1MBL A;  2HF6 A;  4X25 A;  1K57 A;  4Y5F A;  3S7N A;  1YLJ A;  3JVV A;  3KYQ A;  1RGZ A;  1XJ2 A;  2W1T A;  2DCF A;  5EPH A;  4ZRR A;  3UY6 A;  1KE0 A;  3MF0 A;  5HZH A;  3IF5 A;  1PIO A;  1ERM A;  3ZNY A;  4UA6 A;  1CEG A;  4ZJ1 A;  1LSX A;  3VSL A;  1LSV A;  5HDS A;  4Q8I A;  4ZBE A;  3L9K A;  2VZW A;  3HRE A;  1VET B;  3N4I A;  4BBT A;  4B93 A;  3TW8 A;  5TGF A;  3IXD A;  2PT7 A;  5A90 A;  2PDR A;  4CLC B;  5F1G A;  5CHM A;  3SOI A;  2JC7 A;  3DTE A;  1HLU P;  3IQA A;  3JVU A;  3RTY A;  1Q2Q A;  4S2L A;  1OME A;  2XGN A;  4B4X A;  1DP8 A;  2WGI A;  4MDZ A;  3BFG A;  3C7V A;  1MKI A;  4GLQ A;  4S2I A;  4KQQ A;  3U2A A;  4E3O A;  1JWP A;  1YMS A;  3E4P A;  3CPT A;  1BLS A;  4GKU A;  1KVM A;  3G34 A;  2WKI A;  3MJQ A;  3T4Q A;  2ZC3 B;  1H8Y A;  3FV7 A;  3AGE A;  1PRQ A;  1ZG4 A;  4WF0 A;  3R7W A;  2JKG A;  4NG2 A;  4NEE D;  4LEN A;  4WZ5 C;  1FSY A;  3IWQ A;  5HSQ A;  3FKW A;  5GLB A;  3ITB A;  3ICY A;  2IA2 A;  1HVB A;  2X71 A;  4Z9Q A;  2ZBB A;  3LEQ A;  4D60 A;  3HUM A;  4OQI A;  1ESU A;  1G68 A;  2W27 A;  4EER A;  1NRF A;  3ZQ5 A;  4BQM A;  2P08 A;  4OQH A;  1CJF A;  1W79 A;  3DTI A;  2HGV A;  2Y2O A;  5LBR A;  4CQH A;  4B88 A;  4WZ5 A;  2KLI A;  3N7W A;  3TRC A;  1U60 A;  1J3W A;  1EWZ A;  3WRT A;  3VOZ A;  4OLG A;  3NOP C;  2BAS A;  2J9P A;  4DF6 A;  4N1X A;  3UB7 A;  3QP1 A;  2EWW A;  2ZMF A;  1PWG A;  3A0S A;  4K0X A;  4E3J A;  3MXS A;  5HFO A;  4S2P A;  5L07 A;  5HWV A;  1JTD A;  1IEM A;  2AVX A;  1OTB A;  5G18 A;  3CWF A;  1DJB A;  4KG5 A;  5AQB A;  1HZO A;  1GA0 A;  3H7W B;  4EES A;  2W3F A;  5F1F A;  1Z6F A;  2Z2M B;  3M6H A;  3KSI A;  1BUE A;  1PW1 A;  3B33 A;  3BM6 A;  1E3U D;  5EVE A;  1YLZ A;  5DJU A;  2XRO A;  3O5Y A;  4ID4 A;  3GRJ A;  4LV0 A;  3UB9 A;  5AQA A;  4QPR A;  1VEU B;  4MN6 A;  4KZA A;  3MZD A;  2O9B A;  4S2O A;  5DTS A;  4Y17 A;  1DJA A;  2Z6C A;  5DKL A;  4JXG A;  3C2W A;  4P6Z S;  1RP5 A;  4DE2 A;  1ZC2 A;  2XRN A;  2A24 B;  4GCZ A;  1KGG A;  3TSG A;  1I2W A;  3NDE A;  1VB6 A;  1K54 C;  3DWK A;  4IVI A;  4L9G A;  2EXB A;  3T4J A;  2I9V A;  5C5K A;  1T18 A;  3S4X A;  1NLZ A;  4U0X A;  4EEP A;  3PYP A;  3PHY A;  1NRJ A;  1FQG A;  4U3T A;  2OAP 1;  4MLL A;  3ITA A;  3H82 B;  1F2K A;  3SS3 A;  2QPN A;  3LY3 A;  3KX0 X;  2FFF B;  4MBF A;  3BEB A;  3MZE A;  2XR0 A;  4KG6 A;  4WM9 A;  1NWZ A;  5HAI A;  5J7E A;  2JCH A;  5FAT A;  4EBL A;  5FI2 A;  4XUX A;  3RXX A;  2BG1 A;  4HH2 A;  1K54 A;  5F82 A;  2PR6 A;  3FPV A;  4LCL A;  4BWI A;  3PXP A;  5DF7 A;  4I3I A;  1BZA A;  4HOI A;  1MC0 A;  1S0W A;  2W1T B;  5AJG A;  3K2N A;  1W7F A;  2IWD A;  1S6R A;  2K7S A;  4JKT A;  5FI7 A;  4GHI A;  1Z09 A;  1UGU A;  5IS1 A;  2Y2J A;  3CI6 A;  5EOE A;  4Y7P A;  5DF9 A;  3FWL A;  2Z2L B;  2XFS A;  2E8J A;  4BL2 A;  2EXA A;  4WEL A;  5GLD A;  4N1H A;  2Y79 A;  5DTK A;  4X55 A;  4DMZ A;  1ES5 A;  4HY8 A;  3HLW A;  3P01 A;  4HH3 A;  4ZDX A;  3LID A;  3UNW A;  4UAA A;  2J9O A;  3A3D A;  3LUQ A;  5DF8 A;  4NK3 A;  1P9W A;  2Y59 A;  4E3I A;  4HNB A;  2O9A A;  2EX8 A;  4OOL A;  4DE1 A;  1HTZ A;  3S7O A;  3FZC A;  1F9I A;  1IKI A;  3VP1 A;  2OOL A;  4ME4 A;  1GHM A;  1OTI A;  2GX5 A;  3K3C A;  1K4F A;  4E3K A;  3RXW A;  4P6B A;  3G32 A;  2V9A A;  5HX9 A;  2WUQ A;  3IBJ A;  3ZG5 A;  2H28 A;  3T1R A;  5HL1 A;  3JYI A;  3LR5 A;  1T1C A;  4X53 A;  2O0Y A;  5FQK A;  3EEH A;  3NJA A;  3VV4 A;  2LB9 A;  3HLB A;  3LIC A;  1MWS A;  4QJG A;  3ZG0 A;  1NYY A;  3SH8 A;  4P87 A;  4OPQ A;  4K08 A;  4DJ3 A;  4BD0 A;  2X01 A;  2ZC4 B;  3V50 A;  1G28 A;  1TDL A;  2IWB A;  5J4E A;  3WS5 A;  4X1M A;  3V3R A;  4CLC E;  3HBR A;  4KUO A;  3NOT C;  3ZYT A;  1SKF A;  3P09 A;  2VV8 A;  4QY5 A;  2XF3 A;  1P97 A;  1BSG A;  1YSP A;  3EQV A;  2P04 A;  3ZHH A;  1PI4 A;  4LV1 A;  1W8Q A;  3PBN A;  4ARZ A;  4Y15 A;  3ZVW A;  2VGL M;  4LGW A;  2XA7 S;  3O87 A;  2XFT A;  4WZ4 A;  1YQS A;  5G4Z A;  5MC7 A;  5A92 A;  2ZM0 A;  2FH5 A;  1XFQ A;  1D06 A;  5HWW A;  2G2U A;  4OON A;  1XGJ A;  3MMH A;  1A0K A;  1VHM A;  3OPL A;  2BTF P;  1IYS A;  3H7W A;  1K56 A;  1LSW A;  2OWH A;  3DAV A;  2M7V A;  1DY6 A;  3NOU C;  4GZB A;  2V1A A;  3B42 A;  4X1L A;  4WEJ A;  4WBG A;  4B4Z A;  3T12 B;  3SS4 A;  2JN7 A;  5FEG A;  1TS8 A;  1T1A A;  2B02 A;  4PM9 A;  1LI9 A;  1GHI A;  3HCY A;  1VEU A;  2V0U A;  4I3J A;  4I5S A;  5A8B A;  1DRM A;  2V8C A;  3OCN A;  3VE3 A;  2K2N A;  1PFL A;  4R38 A;  1BT5 A;  3DBA A;  2XEP A;  3B3X A;  1CEF A;  3OPH A;  5EM1 A;  2OLV A;  2A24 A;  1WA9 A;  1WYB A;  1STZ A;  1QMF A;  4EW7 A;  3E2K A;  3S7P A;  4RVA A;  2E8I A;  3WWX A;  4GS9 A;  5EUA A;  2M1C A;  1TVF A;  2ZC7 A;  3GQZ A;  5DJT A;  2KX6 A;  1E3U A;  3HLC A;  4ESP A;  5CGX A;  3Q7Z A;  2J7V A;  4IBR A;  3VFF A;  4HES A;  4HJ6 A;  2G2W A;  2HP5 A;  5F83 A;  4QU3 A;  3ZGA B;  5HDD A;  4OQG A;  2PAV P;  4HJ4 A;  1SKO A;  1I2S A;  2O9C A;  3OLO A;  2KOI A;  2R9W A;  5IHV A;  4Y0U A;  1CQA A;  2V1B A;  1ERO A;  4IVK A;  5DVA A;  1PWD A;  4I3A A;  3CMZ A;  5EOO A;  3T4L A;  1M6K A;  3A0V A;  1E25 A;  5EE8 A;  4OPR A;  5CHU A;  2P9V A;  3UB6 A;  4QB8 A;  3W4Q A;  2IWC A;  4KZ6 A;  2EX2 A;  3EGX C;  4GHI B;  1XP4 A;  1UWP X;  2B95 A;  4BJP A;  5HPF A;  2VV6 A;  1IYP A;  2ZQD A;  3HLG A;  3S1Y A;  2ZMV A;  1OTD A;  1ES3 A;  3ISG A;  3T50 A;  3QP6 A;  4DXC A;  3GEC A;  5FAS A;  1O07 A;  3QP2 A;  1L3L A;  4EQ1 A;  3KSH A;  2ACG A;  4DXB A;  5DFX A;  5FQI A;  3HLF A;  3NHQ A;  4GN2 A;  4WN5 A;  3VOL A;  1GSW A;  3PAG A;  3VP2 A;  3MR0 A;  1NYM A;  3W4P A;  5E2F A;  2XDM A;  2NUT C;  3BJN A;  2DMW A;  4HP4 A;  1FCO A;  3PBT A;  4II7 A;  2C5W B;  2Y91 A;  2WGW B;  2J8Y A;  2EWV A;  1KVL A;  1N9L A;  5FDH A;  3ZVT A;  3E0Y A;  3T1Q B;  2QJ7 A;  4UQI M;  1NJ4 A;  5I5L A;  4MBH A;  3UB5 P;  1FR1 A;  3JPU A;  3VP0 A;  1S67 L;  5E2E A;  4GOG A;  3QP5 A;  3GSG A;  5HAQ A;  3E2L A;  1XGI A;  4HBT A;  1JTG A;  2D02 A;  3ZG8 B;  1ESI A;  5GHX A;  3UN7 A;  5EVI D;  2J3T D;  5HWT A;  4OQ0 A;  2ZOI A;  1YPR A;  1VM1 A;  5U47 A;  2ZJ9 A;  1PW8 A;  1FIL A;  1IFQ A;  3MQO A;  5FAQ A;  3IX8 A;  3SZT A;  2OWJ A;  3T4O A;  2QZ6 A;  5TFQ A;  5CXW A;  3PTE A;  5FQM A;  2LB5 A;  1D1J A;  2CMN A;  4KZB A;  2ZQ7 A;  3EOI A;  1XJ4 A;  3A0R A;  3A3I A;  1UWN X;  4EWF A;  4OKP A;  3K3D A;  1TS7 A;  3RH8 B;  4RQ9 A;  4XUZ A;  4BL3 A;  1CI9 A;  4ARZ B;  4G3W A;  3IWO A;  3DTM A;  4GW9 A;  1AXB A;  3UPO A;  4DJ2 A;  3BFE A;  1P0Z A;  4L9E A;  4C75 A;  4OOY A;  2PYR A;  4PM6 A;  1LL9 A;  2XD5 A;  2EX6 A;  4FTX A;  1BTL A;  4BBV A;  4BLM A;  3ZG7 B;  1YLW A;  1TD5 A;  2WZX A;  1CF0 A;  1KE4 A;  2ZC5 B;  2OLU A;  4KZ9 A;  1ALQ A;  1ZTU A;  4N92 A;  5JYP A;  4LPZ A;  2PU4 A;  3V39 A;  5L10 A;  4A5R A;  1FOF A;  5KZH A;  1SZV A;  4WMC A;  3IS2 B;  3KYZ A;  2W3G A;  2VGL S;  5FSR A;  1NZO A;  2Y8H A;  3F1P A;  1ZG6 A;  5EFW A;  4FH4 A;  3BEC A;  3O3V A;  4NET A;  2Y4A A;  5EEC A;  1T19 A;  4HJ3 A;  1CI8 A;  5CTM A;  3OBF A;  1PNE A;  2OSU A;  4AFI A;  3PAE A;  5HDC A;  2WKE A;  4Y3I A;  2A3U A;  4FD8 A;  4GJ4 A;  5KSC A;  1PWC A;  4R3A A;  2H5S A;  3VE4 A;  3UO9 A;  3QHY A;  1YSQ A;  4NXF A;  4NKP A;  2FZ0 A;  3IHA A;  4GS9 B;  3RJU A;  2Y2I A;  2EX9 A;  3G31 A;  2Q0O A;  5GHY A;  4OPY A;  1JWZ A;  4KQO A;  4PAU A;  4MCW A;  2INW A;  3BFD A;  1OT9 A;  4DN0 A;  3IF6 B;  3MFX A;  1S1Z A;  1KDW A;  2JKF A;  1C3B A;  4FSF A;  1OT6 A;  3A3J A;  5L09 A;  1SKO B;  3T4S A;  4LLO B;  1N4O A;  3R4K A;  5I94 A;  1GSV A;  4JBF A;  1Y54 A;  3E4O A;  1PI5 A;  4M3K A;  1SDE A;  5TBM A;  5JYO A;  4L0L A;  4M4X A;  2GDN A;  3V67 A;  1BLP A;  2P9V B;  4RX2 A;  4S2N A;  5HAR A;  5CER A;  4ZTK A;  3HVF A;  4IBX A;  2C6W B;  3CLO A;  4K0W A;  4FUW A;  2JKT I;  3LFV A;  4X68 A;  4KQD A;  5GHZ A;  2WAD A;  4I38 A;  2FFY A;  1GHP A;  1L0E A;  3U4L P;  3LEZ A;  3OPR A;  3UE6 A;  4WUJ A;  1RCJ A;  2ZL1 A;  3BY9 A;  3Q81 A;  3D3O A;  2GNX A;  4BEN A;  5GL9 A;  3BRM A;  5CEB A;  3MXQ A;  3C30 A;  1ZHH B;  5D3O A;  1H3Q A;  3UDI A;  2YKF A;  1LLB A;  4NXE A;  1ERQ A;  3BWL A;  5CHJ A;  4PM5 A;  2JKR M;  3KSG A;  2HV1 A;  4Y0O A;  2WGW A;  4G3K A;  2WKP A;  3LCE A;  2Y55 A;  1L0F A;  1XPB A;  3MS6 A;  4PMA A;  4WL9 A;  5GLA A;  3G30 A;  4KZ8 A;  2QKP A;  4WEK A;  1YKD A;  1RGY A;  4PM7 A;  4X56 A;  5KMW A;  4ETZ A;  4EUV A;  1SCW A;  4E3N A;  4EQI A;  3CJM A;  2XK1 A;  3BQ8 A;  1L0D A;  4R6L A;  1NLY A;  4RX3 A;  3CZD A;  1N9N A;  2J80 A;  4U0T A;  1ES4 A;  3GR2 A;  2J3T C;  2NUP C;  2VV7 A;  3LY4 A;  3OOV A;  3LIF A;  2EFX A;  3IXH A;  1SDN A;  1OJ5 A;  2A49 A;  1OPX A;  3BYD A;  4LRX C;  5KSH A;  1M40 A;  2EFU A;  3EQU A;  4P0M A;  1CK3 A;  1IKG A;  2P7J A;  2PRF A;  3W2Z A;  3UME A;  3IX4 A;  1FR6 A;  4YIN A;  4EET B;  3N8R A;  1FSW A;  3IH8 A;  4MBK A;  3G6O A;  4IUH A;  4YOF A;  1Y28 A;  2H0Y A;  4JXV A;  1PZO A;  1NY0 A;  1VQQ A;  2HPB A;  1XA7 A;  1W8Y A;  3NC8 A;  3IBR A;  4PHT A;  2ZM8 A;  4P6Z M;  4JXS A;  4LFU A;  3IS2 A;  2HP9 A;  3SH9 A;  2VGK A;  4E3L A;  2WKH A;  3WRZ A;  1H8Z A;  3HUN A;  2M7U A;  2Y2K A;  5K5B A;  3F1P B;  3LR4 A;  4CJN A;  2UWX A;  3CUE C;  5IT5 A;  1LT0 A;  1T1B A;  3LIE A;  2XD1 A;  4F3L A;  2X02 A;  4R4S A;  3RFB A;  4E3M A;  3IF6 C;  4IHQ A;  3NEC A;  1K0K A;  5FDS A;  1XFN A;  4OVD A;  3GV9 A;  3LO7 A;  3N6I A;  4JXW A;  4QY6 A;  3HLD A;  4CPK A;  1TS6 A;  1ONG A;  3D4F A;  3OC2 A;  1XX2 A;  3IXG A;  3NCK A;  1GCE A;  3CUE A;  3TE8 A;  4E6X A;  4G3V A;  3L7H A;  5HD3 A;  1NXY A;  2PR5 A;  3IF6 A;  1K6R A;  3PBQ A;  3O86 A;  4Y0T A;  3IX3 A;  4Z1W A;  4DKI A;  2W0N A;  3F1N A;  1EW0 A;  2MJ6 A;  1MZU A;  1V9Y A;  2XQZ A;  2R78 A;  2W3D A;  1KOU A;  2HJ9 C;  3C4O A;  4CLC D;  2BLS A;  3S7Q A;  4Y2F A;  5F69 A;  2ZM2 A;  4LRY C;  3T4T A;  2P74 A;  5TBM B;  4HIA A;  1F5M A;  2WKQ A;  2RCX A;  3EWK A;  1W5D A;  4EBN A;  2Q9N A;  2ZQC A;  5TJJ A;  2JKT M;  3A3E A;  2OAQ 1;  3NIA A;  1YLY A;  3FG8 A;  3HLE A;  4JGR A;  4LV2 A;  3T4K A;  2WZZ A;  4KQR A;  3A3F A;  3OCL A;  4YWZ A;  2V0W A;  3C4P A;  4R23 A;  4EU0 A;  3SH7 A;  2A2L A;  2ZLY A;  3T1X A;  1YLP A;  5CEC A;  1TS0 A;  3NBL A;  5J8X A;  4C3Q A;  1ES2 A;  3LI9 A;  2ZL1 B;  2ZOH A;  4OOM A;  5KIZ A;  4H8R A;  3UE1 A;  3N8S A;  4FH2 A;  5BOH A;  3TG9 A;  4O01 A;  5HPI A;  2ZQ8 A;  5FQQ A;  2Y2M A;  2L0W A;  1XA1 A;  1O7E A;  2JKR I;  3EEA A;  5AVF A;  2HDQ A;  2K31 A;  2W3E A;  3H9W A;  4UA7 A;  3IHB A;  3C38 A;  2R9X A;  1L0G A;  4H6J B;  3QP4 A;  3ZG9 B;  4OP8 A;  3IH9 A;  3UE0 A;  4MN7 A;  4IJG A;  3UB8 A;  3FKV A;  2CC1 A;  4MN5 A;  2O99 A;  3PBR A;  4E04 A;  3MKE A;  3BQA A;  4QWO A;  1WE4 A;  3NUL A;  2PD8 A;  3UMD A;  5FAO A;  1G6A A;  1S66 L;  2VX8 A;  2JE5 A;  2XA7 M;  3BLM A;  4GD6 A;  2WKR A;  4OPZ A;  4S2M A;  3CG5 A;  4OH0 A;  4R70 A;  2QMI A;  4DRT A;  3N8L A;  3P7N A;  1DJC A;  3DW0 A;  1K56 D;  3Q7V B;  1BLH A;  4JF5 A;  3LIB A;  3UDF A;  3IWI A;  4OP5 A;  5L8M A;  3GMW A;  3GVB A;  3IXB A;  4WLA A;  2QHK A;  4KZ7 A;  1F98 A;  2W3H A;  4NXB A;  1K6S A;  3MQ0 A;  1W63 Q;  5CRF A;  3UDX A;  1MWR A;  4O0P A;  1XJ6 A;  4O7D A;  1FIK A;  4JF6 A;  3I7J A;  1IYO A;  5EVI B;  3E4Q A;  2DNS A;  1ACF A;  4IUK A;  4I39 A;  1OJG A;  1ZKJ A;  3KO6 A;  1ODV A;  4HQA A;  4KUK A;  1YLT A;  1LI0 A;  4GDN A;  5HL6 A;  1K4E A;  3NI9 A;  3BFF A;  4JLF A;  4Q0I A;  3SW1 A;  2EA9 A;  4IED A;  1OTE A;  3MQQ A;  3G35 A;  4ZJ3 A;  4KZ4 A;  1PYY A;  4KG2 A;  2QJ5 A;  5EV0 A;  2Y2G A;  2ZMA A;  3F1O A;  5E43 A;  1NZU A;  3NY4 A;  3SS5 A;  1YT4 A;  2XSS A;  1G5U A;  2Q9M A;  5F5Y A;  5F68 A;  2Y2P A;  4F3L B;  3VP4 A;  5A93 A;  1HD8 A;  3OZH A;  2PHY A;  4BBU A;  1S4R A;  1H0M A;  4UA9 A;  4Q0H A;  2JBF A;  2WK0 A;  4XT2 A;  1JNU A;  5J3W A;  3MXR A;  3ZCZ A;  3HJK A;  3UE3 A;  3ULF A;  1KGE A;  2RL3 A;  1K55 C;  2HP6 A;  1LHY A;  1S4S A;  2XLN A;  3KYE A;  3Q1F A;  3DTK A;  3LYX A;  2VKS A;  3PR6 A;  2WGV A;  3LR3 A;  4X6T A;  3E98 A;  4S2N C;  1W63 M;  3AGF A;  3BLS A;  3LIA A;  3MSH A;  1IYQ A;  4DE0 A;  2H0T A;  2VLG A;  5EVL A;  4R1G A;  2WAF A;  4EEU A;  3W4O A;  3F1N B;  2VA0 A;  2KDK A;  2QWS A;  4JF4 A;  3WS1 A;  3WS4 A;  4E6W A;  1MWU A;  3CAX A;  1E4D A;  1N9O A;  4F94 A;  1K55 A;  4XXR A;  3M2J A;  3PBO A;  3UPN A;  2J3W A;  1K38 A;  3VFH A;  3BW6 A;  4GB7 A;  2PBY A;  1MXO A;  4CLC C;  1MWT A;  1TF1 A;  3V5M A;  3ZFZ A;  1G6O A;  5CGS A;  4MEZ A;  4PM8 A;  3IT9 A;  3Q82 A;  4JGQ A;  3PBS A;  3C5A A;  2PD7 A;  4EUZ A;  1D7E A;  4HEF A;  1XJ3 A;  5GLC A;  4DE3 A;  3O88 A;  3HUO A;  2Y2H A;  2W1R A;  2GJ3 A;  5M19 A;  4R3J A;  1K25 A;  2VJW A;  1VET A;  3LI8 A;  3LR0 A;  3ZDJ A;  4HI4 A;  2WAE A;  4KEN B;  1TEM A;  2HDR A;  2DRW A;  5FL3 A;  4CLC A;  4MNR A;  3CHW P;  3QNB A;  2WYX A;  1TDG A;  4GD8 A;  1MY8 A;  2YKH A;  5FA7 A;  2PU2 A;  1WYC A;  3FC7 A;  3Q07 A;  3MZF A;  1H8M A;  1XXM A;  4HP9 A;  4GNU A;  3G2Y A;  1MKM A;  4YNR A;  1DP6 A;  4H6J A;  2Y2L A;  1KGF A;  3HL9 A;  4N9K A;  3CPT B;  3MBZ A;  4RYE A;  4KZ3 A;  1YM1 A;  5AVE A;  5FAP A;  3D72 A;  5A91 A;  2PBD P;  4EBP A;  3OPP A;  3HJI A;  3M2K A;  4ETX A;  4JGO A;  5DTT A;  4Y13 A;  3R7W B;  4FCF A;  3WS2 A;  4JPM A;  2V8F A;  3BFC A;  2VK3 A;  5L2F A;  4NXG A;  4L9F A;  5EM0 A;  1Y4O A;  3QP8 A;  1JVJ A;  1P9R A;  1V9Z A;  3NDG A;  5EVI C;  4LV3 A;  1KE3 A;  4RA7 A;  1S1Y A;  2V20 A;  3VOY A;  1KDS A;  3Q7V A;  2HDU A;  3T1S A;  4YFM A;  2VEA A;  2QYB A;  4UQI S;  4R3B A;  2PYP A;  4C6Y A;  3GDI A;  1SHV A;  1MPL A;  5FI6 A;  3C8C A;  3EGD C;  1BUL A;  4S2J A;  1Q2P A;  3LGO A;  3GTC A;  4PPR A;  4O8G A;  1AWI A;  1PZP A;  2XH9 A;  4WMC D;  1IOU A;  1YMX A;  2H10 A;  3P98 A;  5AQ7 A;  4ZAM A;  5EVI A;  1LL8 A;  1GA9 A;  1DP9 A;  4PKY G;  4KZ5 A;  1FCM A;  1FCN A;  5F6A A;  4LCM A;  5CGW A;  5IU1 A;  3TJZ C;  1IEL A;  3KSF A;  4UEY A;  5G4Y A;  5CED A;  1L2S A;  1ONH A;  2L4R A;  4LRZ E;  1QME A;  4QD4 A;  5DFY A;  5M1A A;  4R0Q A;  3M6B A;  2GZA A;  4OLD A;  3FPW A;  3WS0 A;  3VMA A;  4P85 A;  2OV5 A;  2I72 A;  2D01 A;  4EXO A;  3MFD A;  3AGD A;  2HDS A;  3F1O B;  4K91 A;  4HHD A;  3ZNT A;  4UHU A;  4MMN A;  5FQ9 A;  3W8K A;  3C7U A;  5CX7 A;  1BYW A;  5HD5 A;  5HW3 A;  1XKZ A;  1OTA A;  3G4P A;  3B47 A;  3S22 A; 
#chains in the Genus database with same CATH homology
 4ME4 A;  5AVF A;  1OTI A;  2GX5 A;  2K31 A;  4AFI A;  3K3C A;  1YAX A;  2W3E A;  4B9O A;  2V9A A;  3H9W A;  5HDC A;  4XT2 B;  4Y3I A;  3C38 A;  4GJ4 A;  4H6J B;  4R3A A;  2JHE A;  3VE4 A;  1GSX A;  3IBJ A;  1YSQ A;  2H28 A;  4NXF A;  3CIT A;  4NKP A;  4MN7 A;  4IJG A;  2FZ0 A;  4PKY A;  3UB8 A;  4MN5 A;  2O99 A;  3PBR A;  4GS9 B;  4E04 A;  3LR5 A;  3BQA A;  1T1C A;  2O0Y A;  3EEH A;  3NJA A;  3VV4 A;  2G7U A;  2LB9 A;  2PD8 A;  3UMD A;  3LIC A;  1S66 L;  2VX8 A;  2XA7 M;  1X0O A;  4KQO A;  2WKR A;  4PAU A;  4MCW A;  2Z6D A;  4K08 A;  4DJ3 A;  4FOF A;  2INW A;  1OT9 A;  3H82 A;  1G28 A;  4R70 A;  4DN0 A;  3MFX A;  1S1Z A;  4Q0J A;  5J4E A;  3P7N A;  4FSF A;  1OT6 A;  4CLC E;  4KUO A;  3NOT C;  3ZYT A;  3T4S A;  2L1M A;  2VV8 A;  4LLO B;  1P97 A;  3R4K A;  1YSP A;  2B18 A;  3EQV A;  4BMW A;  2P04 A;  1GSV A;  5DKK A;  3LIB A;  4JGP A;  3E4O A;  2HJE A;  3BY8 A;  5L8M A;  2HF6 A;  3PBN A;  4ARZ A;  5TBM A;  4WLA A;  4L0L A;  2QHK A;  4M4X A;  3V67 A;  2VGL M;  4Y5F A;  3S7N A;  3JVV A;  2XA7 S;  1F98 A;  2W3H A;  4NXB A;  3KYQ A;  1XJ2 A;  2W1T A;  5G4Z A;  3MQ0 A;  4ZRR A;  1W63 Q;  5MC7 A;  3MF0 A;  4O0P A;  1XJ6 A;  3CLO A;  5HZH A;  2FH5 A;  1XFQ A;  1D06 A;  5HWW A;  3E4Q A;  2JKT I;  3MMH A;  3LFV A;  1VHM A;  4IUK A;  4KQD A;  1OJG A;  1LSX A;  4I38 A;  4I39 A;  3KO6 A;  1ODV A;  3H7W A;  4HQA A;  1LSV A;  1LSW A;  4KUK A;  2OWH A;  5HDS A;  5HL6 A;  2M7V A;  2VZW A;  3NOU C;  4BBT A;  4B93 A;  3UE6 A;  4WUJ A;  3TW8 A;  2PT7 A;  2V1A A;  3B42 A;  2PDR A;  3BY9 A;  4CLC B;  4Q0I A;  3D3O A;  4WEJ A;  2EA9 A;  3SW1 A;  2GNX A;  1OTE A;  3MQQ A;  3MXQ A;  3C30 A;  2JN7 A;  1ZHH B;  3JVU A;  2QJ5 A;  3RTY A;  1TS8 A;  1T1A A;  1H3Q A;  2B02 A;  3F1O A;  2YKF A;  3HCY A;  1DP8 A;  4I3J A;  2V0U A;  4MDZ A;  4I5S A;  5A8B A;  4GLQ A;  1DRM A;  2XSS A;  3OCN A;  4NXE A;  3U2A A;  3BWL A;  3VE3 A;  2K2N A;  5F5Y A;  2JKR M;  5F68 A;  3KSG A;  4R38 A;  4F3L B;  3E4P A;  3DBA A;  2HV1 A;  2PHY A;  4BBU A;  1S4R A;  4G3K A;  2WKP A;  3MJQ A;  3T4Q A;  4Q0H A;  4XT2 A;  1JNU A;  2A24 A;  5J3W A;  1WA9 A;  1STZ A;  3HJK A;  3UE3 A;  3ULF A;  4EW7 A;  4WF0 A;  4WL9 A;  3R7W A;  3S7P A;  4NEE D;  4GS9 A;  1S4S A;  2QKP A;  5HSQ A;  4WEK A;  3LYX A;  1YKD A;  2M1C A;  2VKS A;  3PR6 A;  3LR3 A;  3ICY A;  5DJT A;  4ETZ A;  2KX6 A;  2IA2 A;  4EUV A;  3E98 A;  1W63 M;  3LIA A;  2ZBB A;  4HJ6 A;  2VLG A;  2W27 A;  4EER A;  5HDD A;  3BQ8 A;  4EEU A;  3F1N B;  2VA0 A;  2KDK A;  2QWS A;  4R6L A;  1NLY A;  3ZQ5 A;  1N9N A;  4HJ4 A;  2J80 A;  3CAX A;  2O9C A;  2P08 A;  2KOI A;  3OLO A;  1N9O A;  2J3T C;  2NUP C;  2VV7 A;  3OOV A;  5LBR A;  2HGV A;  4CQH A;  2V1B A;  3LIF A;  4I3A A;  3PBO A;  2KLI A;  1OJ5 A;  3TRC A;  1OPX A;  2J3W A;  4LRX C;  3T4L A;  5KSH A;  3BW6 A;  3NOP C;  2BAS A;  3A0V A;  3EQU A;  4CLC C;  3UB7 A;  1TF1 A;  2EWW A;  1G6O A;  2ZMF A;  3UB6 A;  2P7J A;  3EGX C;  3W2Z A;  3UME A;  3A0S A;  4EET B;  4JGQ A;  3PBS A;  4GHI B;  2PD7 A;  1UWP X;  1D7E A;  5HWV A;  1XJ3 A;  3G6O A;  4BJP A;  5HPF A;  2VV6 A;  4IUH A;  4YOF A;  1Y28 A;  1OTB A;  3CWF A;  2W1R A;  2GJ3 A;  2ZMV A;  1OTD A;  3T50 A;  2VJW A;  3GEC A;  3LI8 A;  3IBR A;  3LR0 A;  3H7W B;  4EES A;  4HI4 A;  4PHT A;  2W3F A;  4P6Z M;  5FL3 A;  4CLC A;  4EQ1 A;  3KSH A;  3IS2 A;  5DFX A;  3KSI A;  2M7U A;  3B33 A;  3NHQ A;  4WN5 A;  3VOL A;  5DJU A;  2XRO A;  3O5Y A;  5K5B A;  1GSW A;  3F1P B;  2YKH A;  3MR0 A;  3LR4 A;  3FC7 A;  3CUE C;  3UB9 A;  5IT5 A;  1H8M A;  1LT0 A;  2NUT C;  3BJN A;  4QPR A;  4HP9 A;  1T1B A;  2DMW A;  3LIE A;  4F3L A;  4MN6 A;  4HP4 A;  3RFB A;  2O9B A;  1MKM A;  3OBF A;  4YNR A;  4IHQ A;  3PBT A;  1DP6 A;  4H6J A;  2Z6C A;  5DKL A;  4II7 A;  3C2W A;  2EWV A;  4P6Z S;  1N9L A;  1XFN A;  5AVE A;  3D72 A;  3E0Y A;  2QJ7 A;  4UQI M;  2XRN A;  2A24 B;  4GCZ A;  5I5L A;  1TS6 A;  3HJI A;  4ETX A;  4JGO A;  1S67 L;  3OC2 A;  3R7W B;  1VB6 A;  3CUE A;  3TE8 A;  4L9G A;  2D02 A;  3T4J A;  2I9V A;  5C5K A;  1T18 A;  4G3V A;  4NXG A;  4L9F A;  1NLZ A;  5HD3 A;  1P9R A;  2PR5 A;  4EEP A;  3PYP A;  3PHY A;  2J3T D;  1NRJ A;  1V9Z A;  3PBQ A;  5HWT A;  2ZOI A;  4Z1W A;  2OAP 1;  2W0N A;  3F1N A;  3H82 B;  1IFQ A;  3MQO A;  1S1Y A;  3KX0 X;  2OWJ A;  3T4O A;  1EW0 A;  2MJ6 A;  1MZU A;  1V9Y A;  2R78 A;  2W3D A;  1KOU A;  1NWZ A;  2HJ9 C;  2VEA A;  5J7E A;  2QYB A;  2LB5 A;  2CMN A;  4UQI S;  4CLC D;  3EOI A;  2PYP A;  1XJ4 A;  3A0R A;  3GDI A;  3S7Q A;  4Y2F A;  1UWN X;  3C8C A;  3EGD C;  3K3D A;  1TS7 A;  4HH2 A;  5F69 A;  4RQ9 A;  3RH8 B;  4LRY C;  3T4T A;  2PR6 A;  4ARZ B;  4G3W A;  3FPV A;  4O8G A;  4GW9 A;  4BWI A;  3PXP A;  5TBM B;  4I3I A;  4HIA A;  1F5M A;  2WKQ A;  4HOI A;  1IOU A;  3EWK A;  1MC0 A;  4DJ2 A;  1P0Z A;  2W1T B;  5AJG A;  3K2N A;  5TJJ A;  2JKT M;  4L9E A;  2OAQ 1;  1LL8 A;  2K7S A;  2PYR A;  4GHI A;  1DP9 A;  3FG8 A;  4PKY G;  1UGU A;  5F6A A;  5IS1 A;  3CI6 A;  5IU1 A;  5DF9 A;  3TJZ C;  3KSF A;  4JGR A;  3T4K A;  4UEY A;  4BBV A;  5G4Y A;  1TD5 A;  3OCL A;  4YWZ A;  2V0W A;  2L4R A;  4LRZ E;  5DFY A;  4EU0 A;  4WEL A;  2A2L A;  2Y79 A;  2GZA A;  3FPW A;  4DMZ A;  1TS0 A;  4HY8 A;  3P01 A;  1ZTU A;  3LI9 A;  4HH3 A;  3LID A;  2ZOH A;  4LPZ A;  4OOM A;  2D01 A;  5KIZ A;  4EXO A;  3IS2 B;  3KYZ A;  2W3G A;  2VGL S;  4O01 A;  2Y8H A;  3F1P A;  3F1O B;  5HPI A;  4HHD A;  3LUQ A;  5EFW A;  4MMN A;  1P9W A;  4HNB A;  5CX7 A;  1BYW A;  2L0W A;  5HD5 A;  2O9A A;  4OOL A;  1T19 A;  4HJ3 A;  1OTA A;  3S7O A;  2JKR I;  3EEA A;  1F9I A;  3B47 A;  2OOL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...