4JGOA

The crystal structure of sporulation kinase d sensor domain from bacillus subtilis subsp.
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
206
structure length
206
Chain Sequence
EKDTIAAEHKQEASVLLNLHRNKINYLIGETMARMTSLSIAIDRPVDIKKMQSILEKTFDSEPRFSGLYFLNAKGDVTASTTELKTKVNLADRSFFIKAKETKKTVISDSYSSRITGQPIFTICVPVLDSKRNVTDYLVAAIQIDYLKNLINLLSPDVYIEVVNQDGKMIFASGQASHAEDQKPVSGYLDDISWNMKVYPNPVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Sporulation kinase D
publication title Insight into the sporulation phosphorelay: Crystal structure of the sensor domain of Bacillus subtilis histidine kinase, KinD.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
total genus 56
structure length 206
sequence length 206
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2013-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4jgoA02
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4jgoA01
3SW1A 2ZOIA 5HDDA 5G4YA 4HJ6A 2A24B 4I38A 2EA9A 2I9VA 3ICYA 1G28A 2W27A 3H9WA 3E4PA 1LSXA 2WKQA 1XJ2A 2OOLA 4R70A 5G4ZA 4HP9A 5DJUA 1TS8A 4EERA 3F1NA 3EEHA 4I39A 1OJ5A 4LLOB 1GSXA 3MQOA 3D72A 2KDKA 2V1BA 4HH2A 4NXBA 1XFQA 4HQAA 3B33A 1TS6A 3RH8B 4EXOA 2V1AA 3UE6A 3FG8A 3P7NA 1DRMA 3UB7A 1GSVA 2CMNA 1XFNA 4BBVA 2YKFA 4L9GA 1S4SA 1EW0A 2D02A 3F1OA 2VV6A 1S66L 4GHIB 2WKPA 2VEAA 2W0NA 1X0OA 4NXGA 4WLAA 5TBMA 3UB6A 2INWA 5F68A 1D06A 1VB6A 3NOTC 4NXFA 4EEUA 2PDRA 4NXEA 5J7EA 1Y28A 4I3IA 3LIBA 4EETB 1OT6A 3ZQ5A 4GS9A 2PD8A 3E4OA 2PYRA 2H28A 1T18A 1LT0A 3LUQA 3IS2B 5IS1A 4L9FA 2KX6A 3F1PB 5HDSA 3NJAA 1KOUA 5J3WA 5HWWA 4H6JB 3H7WA 1OTDA 4I3JA 1D7EA 1S1ZA 4BBUA 4WUJA 2V0UA 3UMDA 3HJKA 1LSWA 2V0WA 4EW7A 1S4RA 3LYXA 5F69A 4LPZA 5AVEA 3MXQA 1LL8A 2JN7A 2ZBBA 4XT2B 4F3LB 2OWHA 1BYWA 2PD7A 3LIEA 3FC7A 5IU1A 4GW9A 4JGRA 5DKLA 3LIDA 3BY8A 4HOIA 2WKRA 1JNUA 3VOLA 2JHEA 4BBTA 3UMEA 2Z6CA 1UWPX 2A24A 2GJ3A 1GSWA 4JGOA 3VE4A 3KX0X 5AVFA 4EESA 1T1CA 4WN5A 2PR5A 3C8CA 1OTIA 2Z6DA 2OWJA 4GCZA 3IBRA 4HJ3A 1MZUA 1DP8A 4JGPA 1XJ6A 3GDIA 1V9YA 4HI4A 4R38A 3RTYA 1OTEA 4HIAA 3F1OB 5HSQA 3NHQA 4I5SA 3MQQA 5TBMB 3MR0A 3H82B 2P7JA 1UGUA 1F9IA 4WL9A 1NWZA 3LI8A 1OTBA 3LIAA 1UWNX 4KQDA 3C2WA 5EFWA 2QJ5A 5HWTA 3LIFA 3OLOA 1N9OA 1TS0A 4PKYG 4R6LA 1N9LA 2VV8A 1S1YA 3G6OA 3LI9A 1P0ZA 1T19A 3CLOA 3T50A 2QWSA 2QKPA 3IS2A 4KUKA 5HD3A 3F1PA 4WF0A 4L9EA 4H6JA 1XJ4A 1LSVA 5KIZA 2V9AA 3NOPC 2L0WA 5HD5A 3A0SA 1DP9A 2B02A 4YWZA 4E04A 4MN6A 3F1NB 4LRZE 5A8BA 4M4XA 5HDCA 3K3DA 3PHYA 4XT2A 4F3LA 1V9ZA 1N9NA 5DJTA 3A0RA 2K7SA 1OT9A 3VE3A 4HY8A 3CAXA 1TS7A 1OTAA 2D01A 2L4RA 3CWFA 3BWLA 2PHYA 1T1BA 3LICA 4EEPA 3K3CA 4R3AA 2QJ7A 1OJGA 2BASA 4HHDA 2YKHA 2QHKA 4PKYA 2VLGA 2ZOHA 1S67L 2PR6A 4MN5A 5HWVA 1XJ3A 4DJ3A 3BY9A 5I5LA 1P97A 3UB8A 5DKKA 4GS9B 3UB9A 4GHIA 4JGQA 4HH3A 4LRXC 2HV1A 3E4QA 1F98A 4K08A 4B9OA 3H82A 4EQ1A 4I3AA 3ULFA 1WA9A 3EWKA 3NOUC 3H7WB 1DP6A 4KUOA 5F6AA 2VV7A 5F5YA 4RQ9A 2J80A 1ODVA 2R78A 3HJIA 4HP4A 3A0VA 4HJ4A 4DJ2A 4LRYC 2PYPA 5HZHA 3MJQA 2M1CA 3MFXA 2L1MA 4HNBA 5J4EA 3GECA 3PYPA 1T1AA
chains in the Genus database with same CATH superfamily
2ZM2A 3SW1A 5HDDA 3S4XA 3T1QB 1VETA 3HLBA 4HJ6A 3TJZC 1ESUA 2A24B 4DE0A 3ICYA 2W3HA 1G28A 2W27A 2VGKA 4WMCD 1F5MA 3SS5A 3WS5A 3H9WA 4UEYA 1LI9A 3Q7VB 4FTXA 2ZQAA 5FSRA 1KE4A 1E3UD 3OCNA 4R70A 1L3LA 5JYOA 3UY6A 4IVIA 5CEDA 3DW0A 4B4XA 1G68A 1K57C 3HL9A 3IF6C 2O9AA 2JKTM 2V1BA 4HH2A 3BYDA 3IT9A 5CTMA 4K0XA 4HQAA 3LR0A 3IF5A 3L9KA 3P7NA 1U60A 1KE0A 5LBRA 3UB7A 2CMNA 3O86A 3V3SA 3PXPA 4IEDA 3O87A 4GB7A 5FI2A 3SH9A 3RXXA 3KO6A 3EGXC 4FUWA 3ZDJA 3DTMA 4MMNA 1S4SA 1EW0A 1SCWA 3TG9A 4CLCB 2D02A 3EQUA 3FYZA 3D9YA 5EECA 4FH2A 1LL9A 1Y54A 1GHIA 1YM1A 2P08A 4KZ4A 2IWBA 3HCYA 3NOTC 1H8MA 2XA7M 4NXFA 3QP1A 1PWDA 1K57A 3IWIA 1Y28A 3IF6A 3QP6A 1VQQA 3LIBA 4QD4A 4EETB 3N8SA 4GS9A 1XPBA 3ZQ5A 2ZMAA 2PD8A 3V5MA 4OP8A 5EVIC 5KMWA 1LT0A 2W3EA 4ZRRA 3A3IA 5KSCA 3K2NA 5EM1A 4L9FA 1K56D 4CJNA 2X71A 4E6WA 3C5AA 5HDSA 2X01A 2P74A 3IQAA 3H7WA 4I3JA 3M2JA 4Y13A 3HJKA 3HVFA 1YT4A 4EW7A 1P9WA 2HF6A 4U3TA 4QHCA 2ZJ9A 3A3EA 2QYBA 3JPUA 4P85A 5IU1A 1CJFA 4WBGA 3IX8A 2WADA 5HL1A 3T1XA 5FASA 3BY8A 1L0DA 4HOIA 3BW6A 2WKRA 3SS4A 2JHEA 3FKWA 2GJ3A 2Y91A 2XQZA 4OLGA 4MBHA 3KX0X 3MS6A 3VP2A 1T1CA 1Q2QA 2PT7A 4JXWA 1FIKA 4ETXA 3IH8A 1ZTUA 3UPPA 4FH4A 5DTTA 3IXBA 2OSUA 2Z6DA 3EEAA 5A93A 3NI9A 4OOMA 4Y2FA 1PFLA 3IHAA 1DP8A 1IKGA 4JGPA 1XJ6A 5TR7A 3AGFA 5FQMA 1RCJA 3RTYA 2FH5A 3T4SA 2JKTI 4HIAA 5HSQA 3NHQA 2UWXA 5M1AA 3QHYA 3RJUA 1NYMA 3H82B 1UGUA 4WL9A 3G32A 1SKFA 2ZC5B 5G18A 4KZ7A 1S6RA 2Y55A 3HLFA 4MCWA 1KDWA 1GA0A 4ARZB 4NETA 2XRNA 3IX4A 1N9OA 1AWIA 3L7HA 1TS0A 4GLQA 5FDSA 3LR5A 4UQIM 1EWZA 3G6OA 2V8FA 4LCLA 5FQ9A 2ZQ8A 4NG2A 1XXMA 1WE4A 4WEJA 3T50A 4QY6A 3N8RA 4KZ8A 4HESA 4KUKA 3LR3A 4KZ5A 1FSWA 3PR6A 4H6JA 1XJ4A 1LSVA 3G4PA 2L0WA 5FQQA 4OH0A 1TDLA 3A0SA 4YWZA 4E04A 3ZG8B 3F1NB 3IWOA 4M4XA 1FR6A 3QP8A 1BSGA 4F3LA 1SKOA 4XUZA 3BRMA 2Y2HA 5CGXA 2XROA 3NC8A 5CECA 1OT9A 4HY8A 3O3VA 3QP4A 3CAXA 4L0LA 3UDFA 3P01A 3BECA 1F2KA 5EPHA 4JKTA 3PBQA 4ZDXA 3ITBA 4X25A 5L8MA 2W1TB 3LICA 4EEPA 4R3AA 5J8XA 2QJ7A 3BEBA 1YLTA 3EOIA 1OJGA 1W8QA 5JYPA 4QWOA 5FAQA 1FOFA 4PKYA 3KSFA 3OC2A 4LENA 3SS3A 3T4QA 3D4FA 1K6SA 2PR6A 4MN5A 5L09A 5FI7A 1DY6A 5DF9A 4Y5FA 2ZC4B 3C30A 3NY4A 4DJ3A 3OCLA 3G30A 3LY4A 2ZQ9A 2WKEA 1HTZA 3UN7A 3GTCA 4Q0JA 5DKKA 1L0FA 4NKPA 4GD8A 4YFMA 1MKMA 3HLEA 4YINA 3E4QA 4GOGA 5GL9A 1YQSA 1PRQA 4B9OA 1H8YA 1WA9A 2XGNA 3V39A 4S2KA 5L2FA 5A92A 1G6AA 2Z2MB 3UPNA 1MWUA 1L2SA 2ZD8A 1CF0A 2H0YA 3VSKA 4PM5A 2J80A 3HJIA 2LB5A 4HP4A 3NULA 4Y0UA 4LRYC 3DWZA 3TE8A 3MFXA 4HNBA 2Y2JA 4AFIA 2ZC7A 4Z1WA 2FFYA 3MSHA 3A3FA 1FQGA 1NXYA 1E3UA 3T4JA 5AQ7A 1SDNA 1HD8A 1E4DA 4JLFA 5F82A 1W7FA 4KZAA 1XJ2A 2A3UA 2EX9A 4KZ6A 1XKZA 4HP9A 2K31A 3QP5A 4QU3A 4I39A 3B47A 4WELA 1OJ5A 3IX3A 4P87A 1OPXA 2J8YA 1MBLA 1GSXA 1FCOA 3MQOA 3GR2A 1BZAA 3RXWA 2WKHA 3UDIA 4R0QA 1YKDA 4Q0IA 2FFFB 4Q0HA 5HPIA 4O0PA 5FQKA 1XGJA 4GDBA 5HX9A 2ZM0A 1W63Q 1XA1A 5FA7A 4OVDA 5FAPA 3FPWA 3FPVA 4S2NA 3N4IA 1BTLA 2X02A 2VV6A 4UQIS 1PNEA 3R4KA 2W0NA 3SH8A 2G2WA 1X0OA 4OLDA 3ZG7B 5TBMA 3UB6A 1BT5A 2INWA 5F68A 2EWWA 3GVBA 4H8RA 1I5QA 4E3LA 3CI6A 4NXEA 2XFSA 1C3BA 3QNCA 5AJGA 4JF4A 3E4OA 3ZG5A 2PYRA 4PHTA 2LB9A 1T18A 4NK3A 1IELA 3LUQA 1Q2PA 1ACFA 3OPHA 4S2JA 2P9VB 5IS1A 1ES5A 2Y2LA 4G3WA 3NJAA 5J3WA 3HLWA 1D7EA 1S1ZA 1VHMA 1H3QA 3ISGA 4WUJA 2V0UA 3UMDA 1LSWA 3PBRA 3NIAA 1TF1A 1FILA 1Y4OA 3CHWP 1IKIA 5E2GA 5AVEA 3MXQA 1XA7A 4MN7A 1LL8A 2JN7A 2HP6A 1BYWA 2PD7A 3UDXA 3BQ8A 5DVAA 3FC7A 4EBPA 2HDQA 3QP2A 5DKLA 5TJJA 4QB8A 3UE3A 1JNUA 3VOLA 4ZJ2A 3RFBA 2UV0E 3VP1A 4N92A 4UHUA 4JGOA 5AVFA 5EVLA 3V3RA 1O07A 4BL2A 3BFCA 1FCMA 3CUEC 3MZFA 4ZAMA 4IUKA 2PBDP 5GHZA 2DRWA 3WS1A 2Y59A 2PU4A 2WGVA 1MZUA 4P0MA 1IOUA 3GDIA 3S7QA 2WGWA 3NECA 1CQAA 4HI4A 3UPOA 3UE1A 3ZNYA 2GNXA 4KZBA 1BLPA 3ZFZA 3IXGA 3KYEA 1NJ4A 4Q8IA 1K55C 4I5SA 4F94A 3WWXA 3CPTB 1IEMA 3S22A 1YLPA 5HPFA 5EOEA 5TBMB 4X55A 3PAGA 2G2UA 2ZL1B 2Y2OA 1F9IA 5E2FA 4PPRA 4EUVA 3LI8A 1YLJA 3LIAA 3IXDA 2EX8A 2WGIA 3Q82A 4UA6A 5HL6A 4DF6A 1E25A 3PBTA 4R4SA 4ETZA 4LV2A 2O0YA 1CEGA 5CTNA 3O5YA 4DDYA 4CLCD 4KG6A 3EGDC 2VKSA 1N9LA 1KGEA 2OAQ1 4G3KA 1P0ZA 4K91A 1VETB 2Y79A 2PAVP 4BWIA 3JVUA 3IS2A 3PBNA 4KG2A 1CEFA 3WS4A 4OPZA 3F1PA 2BG1A 3LR4A 3IWQA 4KQQA 4U0TA 4IHQA 1K54C 2KLIA 3NOPC 1YMSA 5HD5A 4OPQA 1NZUA 1DP9A 2B02A 5GLBA 1ESIA 4LRZE 5F83A 4S2IA 1BULA 1PWCA 2OLVA 4U0XA 4XT2A 1V9ZA 3BM6A 5EVIA 1G6OA 4JXVA 4QPRA 5DJTA 2K7SA 3MKEA 3G34A 1GHPA 3FZCA 3T1SA 3E0YA 1NLYA 3ZNTA 4IUHA 3MQ0A 2H10A 4OQGA 2D01A 2XR0A 3CWFA 1H0MA 3W2ZA 2RCXA 1J9MA 3LGOA 1T1BA 3BLSA 4X53A 4ESPA 2BASA 2XLNA 2DNSA 4GD6A 3G2YA 2YKHA 2XSSA 4FD8A 2O9BA 2QHKA 2EX6A 3MZDA 5HAQA 3VFHA 1S67L 3E2LA 5EV0A 1HVBA 5HWVA 1S0WA 3UE0A 3B42A 1XJ3A 3PBOA 5AQ9A 4KQRA 3UB5P 2E8IA 5I5LA 2ZQ7A 4G3VA 3IF6B 4P6BA 3G31A 3UB8A 1LLBA 4GS9B 4BJPA 4JGQA 2HV1A 2IA2A 2Y2GA 2XEPA 4OONA 3ULFA 3TOIA 2BLSA 2J9OA 4JXSA 3C4PA 3NOUC 1FCNA 2DMWA 3H7WB 3S7PA 2ACGA 4LCMA 5DF8A 4KUOA 4II7A 5F5YA 4RQ9A 2R78A 4HJ4A 4DJ2A 2Y4AA 2PYPA 5EM0A 3KSIA 3W4PA 3CZDA 1J3WA 3BJNA 4X56A 3VOYA 5CEBA 3UNWA 5G4YA 2VX8A 1ERMA 3HUNA 4PMAA 2WAFA 4FOFA 5HARA 5GHYA 4UA9A 4I38A 4Y0OA 3ZG9B 4WZ5C 1I2SA 2JKRI 3ZVTA 3E4PA 3M6HA 1LSXA 4OKPA 2WKQA 5AQBA 4DXCA 1TD5A 3GMWA 1JVJA 1YLZA 3TRCA 1KGGA 1TS8A 1VEUA 4EERA 3EEHA 3N7WA 2ZQDA 3ZG0A 1O7EA 1GHMA 3W8KA 1L0EA 1QMEA 2JKFA 2WKIA 2KDKA 4NXBA 1RP5A 4OQIA 1XFQA 1ZC2A 3BFFA 4OOLA 1NYYA 1OMEA 5FATA 4B93A 3CJMA 5A90A 4GZBA 4BD1A 1BLSA 2XA7S 4E6XA 1GSVA 5F1GA 1N9BA 1RGYA 3KSHA 1NY0A 2HGVA 5FEGA 1YLWA 3DTIA 2HDRA 3C4OA 4WZ5A 1TVFA 3F1OA 3LFVA 3U4LP 1S66L 2P04A 4R4RA 1ES4A 3VP3A 1H5XA 2WKPA 2VEAA 4IVKA 3T4TA 4NXGA 3MMHA 4LFUA 1D06A 5IT5A 1VB6A 3JYIA 4EEUA 5J7EA 2KOIA 4A5RA 2B95A 1OT6A 1K4EA 1K4FA 1BUEA 4BENA 2H28A 2Y2IA 4R1GA 4JPMA 2J9PA 2J7VA 4DN0A 3HLCA 3CMZA 3WS2A 3WS0A 4JF5A 1RGZA 1KOUA 4H6JB 1OTDA 4C6YA 3MFDA 1IYPA 3PTEA 4WMCA 1KGFA 4BBUA 2PRFA 1EROA 2Q9MA 2WZZA 4Y3IA 2V0WA 3C7UA 1S4RA 5DTKA 3LYXA 4HBTA 4X69A 2GX5A 4F3LB 2OWHA 3LIEA 1SKOB 2J3WA 3OPLA 4GW9A 1WYBA 2HDSA 3LIDA 1WYCA 2M7UA 4ZTKA 5IHVA 3KYQA 1MC0A 1STZA 4BBTA 2A24A 3OBFA 4S2PA 2JCHA 4RX2A 1DJBA 2V1ZA 1NRFA 4YOFA 4CLCC 3VE4A 5D3OA 1M40A 4EESA 3Q7VA 2ZMVA 1JTGA 2JKGA 3LEQA 5HFOA 2PR5A 2W3DA 3C8CA 1JWZA 1OTIA 4DE1A 1ZHHB 3DWKA 3E2KA 2EXBA 4GCZA 2XH9A 2J3TD 4JBFA 3DTKA 2CC1A 1SHVA 1IYQA 4R38A 2XF3A 2QMIA 1OTEA 3SOIA 1NLZA 3C38A 3F1OB 3MZEA 5FDHA 1FSYA 3Q7ZA 4N9KA 5CXWA 4PM6A 4MEZA 2P7JA 3MXSA 1BLHA 1K56A 3LY3A 4CLCA 4EBLA 3E98A 4RX3A 3G35A 1TEMA 4LV0A 2HJ9C 3C2WA 2QJ5A 1ZKJA 5HWTA 1XP4A 3LIFA 3N6IA 3EQVA 3MKFA 2PU2A 2R9XA 4PKYG 3CITA 4E3MA 4R6LA 4MLLA 2XDMA 1MPLA 3AGEA 4R3JA 2A49A 3UO9A 4RYEA 2QKPA 4D60A 2IWDA 3P09A 3PBSA 3VV4A 1LHYA 4L9EA 1MWSA 4EBNA 5KIZA 4DE3A 4HEFA 2V9AA 4DXBA 3T4LA 5M18A 1LL5A 4GJ4A 4B88A 2C6WB 5AQAA 5L07A 3S7OA 4EWFA 4MN6A 5A91A 3ZCZA 2B5RA 5A8BA 3B3XA 4GDNA 2Z2LB 5HDCA 3K3DA 3U2AA 1P9RA 3PHYA 3BFGA 1BLCA 2QZ6A 2VJWA 3W4OA 4BMWA 5CHMA 2R9WA 3A0RA 1ONGA 2JE5A 4R3BA 2W1RA 5DFYA 1K6RA 1KVMA 1TS7A 5FQIA 4CPKA 3QNBA 3IH9A 2EFUA 2M7VA 1W79A 4WZ4A 5I94A 2HPBA 2WK0A 4EV4A 4Y0TA 3T4KA 3ZGAB 2VGLM 2XK1A 2AVXA 5FL3A 4CLCE 1YSPA 2ZC3B 4O8GA 4UAAA 1XGIA 3OOVA 3IBJA 2ZLYA 3HREA 4OOYA 1H8ZA 3TW8A 1ZG6A 2DCFA 4N1HA 4GNUA 2JC7A 4WEKA 5FEFA 3O88A 4ME4A 3C7VA 4ZJ3A 1ERQA 2ZMFA 3BY9A 2B18A 3V50A 3BLMA 2VZWA 1P97A 5L10A 2VA0A 4XXRA 3S7NA 3UB9A 4GHIA 4B4ZA 4LRXC 1IFQA 3GQZA 5GLCA 3CUEA 4KZ9A 1F98A 4K08A 4P6ZM 3H82A 4EQ1A 1YAXA 3S1YA 5EE8A 1KE3A 1FR1A 2ZQCA 1PZPA 1KDSA 4C3QA 1MWTA 1KVLA 5EVEA 4DDSA 5U47A 2WUQA 3BQAA 4QY5A 1HZOA 1YPRA 2VV7A 2JKRM 4N9LA 4ARZA 1ODVA 3Q07A 2W3GA 4KG5A 3A0VA 4OQHA 4EQIA 1GCEA 4S2MA 2C5WB 5HZHA 1K55A 1HLUP 2L1MA 4KENB 5J4EA 4Y7PA 3GECA 4IBXA 1PIOA 3JVVA 2XD5A 2ZOIA 1I2WA 3DTEA 3GRJA 5E2EA 2EA9A 2I9VA 1ONHA 4C75A 4WYYA 3MXRA 2ZM8A 2EFXA 2OOLA 5G4ZA 5DJUA 1YSQA 3HBRA 1AXBA 4KZ3A 3F1NA 3BFEA 3VFFA 4LLOB 2MJ6A 3D72A 1JWPA 3GV9A 4GKUA 2WGWB 3B33A 4BQMA 1TS6A 3RH8B 4EXOA 2V1AA 4EU0A 3UE6A 3FG8A 3I7JA 3LEZA 5HAPA 2V2FF 3VMAA 3VSLA 5M19A 1DRMA 1K54A 2IWCA 4E3JA 3R7WA 4FSFA 4JF6A 1XFNA 3KYZA 4BBVA 3HUMA 4MDZA 2YKFA 4NEED 3WRZA 2W1TA 4L9GA 2HZ5A 4N1XA 4GHIB 1MXOA 4OP5A 5GLDA 4LV1A 3CG5A 3OZHA 4FCFA 2OAP1 4WLAA 2O99A 2OV5A 3ITAA 3GSGA 5KSHA 2PDRA 3NBLA 3ZYTA 2FZ0A 4I3IA 5FAOA 1IYSA 1DJCA 3T12B 5HAIA 2Y2NA 5CRFA 5DFXA 2A2LA 3IS2B 2J3TC 2KX6A 3F1PB 2PBYA 1NZOA 4K0WA 2W3FA 5HWWA 1SDEA 4BL3A 4PM9A 2ZC6B 2NUTC 4CQHA 2H5SA 2OLUA 5F69A 5MC7A 4LPZA 2ZBBA 4UA7A 4XT2B 3T4OA 4X68A 5EVIB 1W5DA 5K5BA 3TSGA 3NDEA 4DRTA 1YLYA 3OPRA 4ZJ1A 4JGRA 3DAVA 1JWVA 1K25A 3Q81A 2VGLS 3AGDA 4S2OA 3UMEA 2Z6CA 1UWPX 1GSWA 3D3OA 1LI0A 1GA9A 5DTSA 3A3JA 4IJGA 4KQOA 1XX2A 1CI8A 1PYYA 3P98A 4LV3A 4O01A 2Y8HA 4WN5A 1TDGA 3FKVA 4R23A 1ES2A 1ES3A 5EVID 3ZHHA 2OWJA 4PAUA 3HUOA 2EWVA 4Y17A 4DE2A 3IBRA 4HJ3A 3R7WB 3NDGA 1CI9A 5CERA 1V9YA 3ZVWA 1PW1A 4M3KA 4EUZA 2HDUA 2V8CA 3HLDA 3MBZA 4P6ZS 4ZBEA 2GZAA 4DKIA 3WRTA 3V67A 3DBAA 3SH7A 1PI4A 3MQQA 1CK3A 4PM8A 1A0KA 3IXHA 5CGWA 2K2NA 3MR0A 2Q9NA 4Z9QA 4WM9A 1NWZA 1MWRA 4X1MA 1PWGA 1OTBA 4RA7A 1UWNX 5GLAA 4OPYA 3OPPA 4KQDA 4E3IA 2XD1A 4BLMA 1PW8A 2H0TA 5EFWA 1SZVA 1PZOA 3OLOA 1EI5A 3N8LA 5DF7A 3IHBA 4OQ0A 4X1LA 2VV8A 1S1YA 4LGWA 2HP9A 2WZXA 3Q1FA 5TGFA 3LI9A 5FI6A 3G2ZA 1T19A 1G5UA 2G7UA 3FV7A 3CLOA 5EUAA 1K0KA 4QJGA 5TFQA 2QWSA 2JBFA 2P9VA 2Q0OA 3BFDA 5HD3A 4WF0A 3LO7A 4DMZA 1YMXA 2Y2PA 5CHJA 4MBKA 3PAEA 3VP0A 3W4QA 4E3NA 2V20A 3NCKA 3LCEA 1Z6FA 2RL3A 1VEUB 5EOOA 4BD0A 4O7DA 5E2HA 2Y2KA 2QPNA 2I72A 4E3OA 1DJAA 3VOZA 4S2NC 2WAEA 1N9NA 1K38A 2XFTA 3VP4A 3M6BA 1IYOA 2WYXA 2Y2QA 3VE3A 4PM7A 4RVAA 1OTAA 1W63M 3KSGA 4HBUA 4E3KA 2L4RA 4OPRA 1PI5A 3A3DA 3BWLA 2PHYA 2E8JA 5BOHA 1VM1A 1ZG4A 2HJEA 1L0GA 4MNRA 2Y2MA 3K3CA 2GDNA 2HP5A 5CHUA 5E43A 4HHDA 4MBFA 3HLGA 4XUXA 1N4OA 4JXGA 1MY8A 2O9CA 2VLGA 1Z09A 2ZOHA 3T1RA 2VGJA 5GHXA 1MKIA 4Y15A 1D1JA 5KZHA 1QMFA 5HW3A 1JTDA 4IBRA 4X6TA 3CPTA 4HH3A 1W8YA 5CX7A 5C5KA 2ZL1A 4I3AA 3EWKA 1NRJA 4ID4A 2BTFP 4S2LA 1DP6A 5F6AA 3MF0A 2VK3A 2EX2A 1M6KA 4YNRA 2NUPC 2EXAA 3MJQA 4GN2A 2M1CA 5FQJA 3M2KA 5F1FA 4D2OA 3SZTA 3FWLA 3PYPA 5CGSA 1T1AA 1ALQA
chains in the Genus database with same CATH topology
3SW1A 2ZOIA 5HDDA 5G4YA 2VX8A 4HJ6A 3TJZC 4FOFA 3T4JA 2A24B 4I38A 2EA9A 2I9VA 2W3HA 1G28A 2W27A 3ICYA 2JKRI 1F5MA 3H9WA 3E4PA 1LSXA 2WKQA 4UEYA 1TD5A 1XJ2A 2OOLA 3OCNA 4R70A 5G4ZA 3TRCA 4HP9A 2K31A 5DJUA 1TS8A 1YSQA 4EERA 3F1NA 3EEHA 4I39A 3B47A 4WELA 1OJ5A 4LLOB 1OPXA 2MJ6A 2O9AA 1GSXA 3MQOA 3D72A 2JKTM 2KDKA 2V1BA 4HH2A 4NXBA 1XFQA 4HQAA 3B33A 4OOLA 3LR0A 1TS6A 3RH8B 4B93A 2V1AA 4EU0A 3UE6A 4EXOA 3FG8A 3P7NA 1YKDA 2XA7S 1DRMA 5LBRA 3UB7A 4Q0IA 1GSVA 2CMNA 4Q0HA 5HPIA 4O0PA 3PXPA 3R7WA 4FSFA 3KSHA 1XFNA 2HGVA 3KYZA 4BBVA 3KO6A 3EGXC 4MDZA 2YKFA 4NEED 2W1TA 1W63Q 4MMNA 4L9GA 1S4SA 1EW0A 4CLCB 2D02A 3EQUA 3FPWA 3FPVA 3F1OA 3LFVA 2VV6A 1S66L 4GHIB 2P04A 4UQIS 2WKPA 2VEAA 3R4KA 2W0NA 1X0OA 2OAP1 3T4TA 4NXGA 4WLAA 2O99A 3MMHA 5TBMA 3UB6A 2INWA 5F68A 2EWWA 5KSHA 1D06A 5IT5A 2P08A 1VB6A 3CI6A 3HCYA 1H8MA 2XA7M 3NOTC 4NXFA 4EEUA 2PDRA 4NXEA 5J7EA 3ZYTA 2FZ0A 5AJGA 1Y28A 4I3IA 3LIBA 2KOIA 4EETB 1OT6A 3ZQ5A 4GS9A 2PD8A 3E4OA 2PYRA 4PHTA 2H28A 2LB9A 1T18A 1LT0A 2W3EA 3LUQA 4DN0A 4ZRRA 5DFXA 2A2LA 3IS2B 5IS1A 2J3TC 3K2NA 4L9FA 2KX6A 3F1PB 4G3WA 5HDSA 3NJAA 1KOUA 5J3WA 2W3FA 4H6JB 5HWWA 3H7WA 1OTDA 4I3JA 1D7EA 1S1ZA 4BBUA 1VHMA 1H3QA 4WUJA 4Y3IA 2V0UA 3UMDA 2NUTC 4CQHA 3HJKA 1LSWA 2V0WA 3PBRA 1TF1A 4EW7A 1S4RA 1P9WA 2HF6A 3LYXA 5F69A 5MC7A 4LPZA 5AVEA 3MXQA 4MN7A 1LL8A 2JN7A 2GX5A 2ZBBA 4XT2B 4F3LB 3T4OA 2OWHA 1BYWA 2PD7A 3LIEA 5K5BA 3BQ8A 3FC7A 2QYBA 2J3WA 5IU1A 4GW9A 4JGRA 5DKLA 5TJJA 3LIDA 3BY8A 2M7UA 4HOIA 3BW6A 2WKRA 3UE3A 3KYQA 1JNUA 2VGLS 3VOLA 2JHEA 1MC0A 1STZA 3RFBA 4BBTA 3UMEA 2Z6CA 1UWPX 2A24A 2GJ3A 3OBFA 4YOFA 4CLCC 1GSWA 4JGOA 3D3OA 3VE4A 3KX0X 5AVFA 4EESA 1T1CA 2PT7A 4IJGA 4KQOA 2ZMVA 4O01A 4ETXA 2Y8HA 4WN5A 2PR5A 2W3DA 3CUEC 1ZTUA 3C8CA 4IUKA 1OTIA 1ZHHB 2Z6DA 2OWJA 3EEAA 4PAUA 4OOMA 4GCZA 4Y2FA 2EWVA 3IBRA 4HJ3A 3R7WB 1MZUA 1DP8A 2J3TD 4JGPA 1XJ6A 1IOUA 3GDIA 1V9YA 3S7QA 4HI4A 4R38A 3RTYA 2FH5A 2GNXA 1OTEA 3T4SA 2JKTI 4P6ZS 2GZAA 4HIAA 1NLZA 3C38A 3F1OB 3V67A 5HSQA 3NHQA 3DBAA 4I5SA 4Z1WA 3MQQA 5HPFA 5TBMB 2K2NA 3MR0A 3H82B 2P7JA 1UGUA 1F9IA 4WL9A 1NWZA 4EUVA 3LI8A 4CLCA 3E98A 1OTBA 3LIAA 1UWNX 4MCWA 4KQDA 4ARZB 5HL6A 2HJ9C 3PBTA 3C2WA 5EFWA 4ETZA 2XRNA 2QJ5A 5HWTA 3LIFA 3OLOA 2O0YA 1N9OA 3O5YA 4CLCD 3EQVA 1TS0A 4PKYG 3EGDC 4GLQA 2VKSA 3CITA 4R6LA 1N9LA 3LR5A 4UQIM 2OAQ1 1S1YA 2VV8A 3G6OA 4G3KA 3LI9A 1P0ZA 1T19A 2G7UA 4WEJA 3CLOA 3T50A 2Y79A 2QWSA 4BWIA 3JVUA 2QKPA 3IS2A 3PBNA 4KUKA 5HD3A 3LR3A 3F1PA 4WF0A 3LR4A 3PBSA 3VV4A 3PR6A 4DMZA 4L9EA 4H6JA 1XJ4A 4IHQA 1LSVA 5KIZA 2KLIA 2V9AA 3NOPC 2L0WA 3T4LA 5HD5A 4GJ4A 3A0SA 1DP9A 2B02A 4YWZA 3S7OA 4E04A 4MN6A 3F1NB 4LRZE 5A8BA 4M4XA 5HDCA 3K3DA 3U2AA 1P9RA 3PHYA 4XT2A 2VJWA 4F3LA 4BMWA 1V9ZA 1G6OA 1N9NA 4QPRA 5DJTA 2XROA 3A0RA 2K7SA 1OT9A 3E0YA 1NLYA 3VE3A 4HY8A 2W1RA 4IUHA 5DFYA 3CAXA 4L0LA 3MQ0A 3P01A 1TS7A 1OTAA 1W63M 3PBQA 3KSGA 2D01A 2L4RA 3CWFA 3BWLA 2M7VA 2PHYA 5L8MA 3W2ZA 3T4KA 2HJEA 1T1BA 2VGLM 2W1TB 3LICA 4EEPA 3K3CA 4R3AA 2QJ7A 5FL3A 4CLCE 1YSPA 1OJGA 3EOIA 4O8GA 2BASA 4HHDA 3OOVA 2YKHA 2XSSA 3IBJA 2O9BA 2QHKA 4PKYA 3TW8A 3KSFA 3OC2A 3T4QA 2O9CA 2VLGA 2ZOHA 1S67L 4WEKA 2PR6A 4MN5A 5HWVA 4ME4A 3B42A 1XJ3A 5DF9A 4Y5FA 3PBOA 3C30A 4DJ3A 2ZMFA 3BY9A 2B18A 3OCLA 2VZWA 5I5LA 4G3VA 1P97A 3UB8A 2VA0A 4Q0JA 5DKKA 3S7NA 4GS9B 4NKPA 3UB9A 4GHIA 4BJPA 1MKMA 4JGQA 4HH3A 4LRXC 1IFQA 2HV1A 2IA2A 3E4QA 3CUEA 5CX7A 1F98A 4K08A 4P6ZM 5C5KA 3H82A 4B9OA 4EQ1A 1YAXA 4I3AA 3ULFA 1WA9A 3EWKA 3NOUC 1NRJA 2DMWA 3H7WB 3S7PA 3BQAA 1DP6A 4KUOA 5F6AA 2VV7A 3MF0A 2JKRM 4ARZA 4II7A 5F5YA 4RQ9A 2J80A 1ODVA 2R78A 3HJIA 2LB5A 4HP4A 2W3GA 4YNRA 3A0VA 2NUPC 4HJ4A 4DJ2A 4LRYC 2PYPA 5HZHA 3KSIA 3MJQA 3TE8A 2M1CA 3MFXA 2L1MA 4HNBA 5J4EA 4AFIA 3GECA 3BJNA 3PYPA 3JVVA 1T1AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SW1 A;  2ZOI A;  5HDD A;  5G4Y A;  4HJ6 A;  2A24 B;  4I38 A;  2EA9 A;  2I9V A;  3ICY A;  1G28 A;  2W27 A;  3H9W A;  3E4P A;  1LSX A;  2WKQ A;  1XJ2 A;  2OOL A;  4R70 A;  5G4Z A;  4HP9 A;  5DJU A;  1TS8 A;  4EER A;  3F1N A;  3EEH A;  4I39 A;  1OJ5 A;  4LLO B;  1GSX A;  3MQO A;  3D72 A;  2KDK A;  2V1B A;  4HH2 A;  4NXB A;  1XFQ A;  4HQA A;  3B33 A;  1TS6 A;  3RH8 B;  4EXO A;  2V1A A;  3UE6 A;  3FG8 A;  3P7N A;  1DRM A;  3UB7 A;  1GSV A;  2CMN A;  1XFN A;  4BBV A;  2YKF A;  4L9G A;  1S4S A;  1EW0 A;  2D02 A;  3F1O A;  2VV6 A;  1S66 L;  4GHI B;  2WKP A;  2VEA A;  2W0N A;  1X0O A;  4NXG A;  4WLA A;  5TBM A;  3UB6 A;  2INW A;  5F68 A;  1D06 A;  1VB6 A;  3NOT C;  4NXF A;  4EEU A;  2PDR A;  4NXE A;  5J7E A;  1Y28 A;  4I3I A;  3LIB A;  4EET B;  1OT6 A;  3ZQ5 A;  4GS9 A;  2PD8 A;  3E4O A;  2PYR A;  2H28 A;  1T18 A;  1LT0 A;  3LUQ A;  3IS2 B;  5IS1 A;  4L9F A;  2KX6 A;  3F1P B;  5HDS A;  3NJA A;  1KOU A;  5J3W A;  5HWW A;  4H6J B;  3H7W A;  1OTD A;  4I3J A;  1D7E A;  1S1Z A;  4BBU A;  4WUJ A;  2V0U A;  3UMD A;  3HJK A;  1LSW A;  2V0W A;  4EW7 A;  1S4R A;  3LYX A;  5F69 A;  4LPZ A;  5AVE A;  3MXQ A;  1LL8 A;  2JN7 A;  2ZBB A;  4XT2 B;  4F3L B;  2OWH A;  1BYW A;  2PD7 A;  3LIE A;  3FC7 A;  5IU1 A;  4GW9 A;  4JGR A;  5DKL A;  3LID A;  3BY8 A;  4HOI A;  2WKR A;  1JNU A;  3VOL A;  2JHE A;  4BBT A;  3UME A;  2Z6C A;  1UWP X;  2A24 A;  2GJ3 A;  1GSW A;  4JGO A;  3VE4 A;  3KX0 X;  5AVF A;  4EES A;  1T1C A;  4WN5 A;  2PR5 A;  3C8C A;  1OTI A;  2Z6D A;  2OWJ A;  4GCZ A;  3IBR A;  4HJ3 A;  1MZU A;  1DP8 A;  4JGP A;  1XJ6 A;  3GDI A;  1V9Y A;  4HI4 A;  4R38 A;  3RTY A;  1OTE A;  4HIA A;  3F1O B;  5HSQ A;  3NHQ A;  4I5S A;  3MQQ A;  5TBM B;  3MR0 A;  3H82 B;  2P7J A;  1UGU A;  1F9I A;  4WL9 A;  1NWZ A;  3LI8 A;  1OTB A;  3LIA A;  1UWN X;  4KQD A;  3C2W A;  5EFW A;  2QJ5 A;  5HWT A;  3LIF A;  3OLO A;  1N9O A;  1TS0 A;  4PKY G;  4R6L A;  1N9L A;  2VV8 A;  1S1Y A;  3G6O A;  3LI9 A;  1P0Z A;  1T19 A;  3CLO A;  3T50 A;  2QWS A;  2QKP A;  3IS2 A;  4KUK A;  5HD3 A;  3F1P A;  4WF0 A;  4L9E A;  4H6J A;  1XJ4 A;  1LSV A;  5KIZ A;  2V9A A;  3NOP C;  2L0W A;  5HD5 A;  3A0S A;  1DP9 A;  2B02 A;  4YWZ A;  4E04 A;  4MN6 A;  3F1N B;  4LRZ E;  5A8B A;  4M4X A;  5HDC A;  3K3D A;  3PHY A;  4XT2 A;  4F3L A;  1V9Z A;  1N9N A;  5DJT A;  3A0R A;  2K7S A;  1OT9 A;  3VE3 A;  4HY8 A;  3CAX A;  1TS7 A;  1OTA A;  2D01 A;  2L4R A;  3CWF A;  3BWL A;  2PHY A;  1T1B A;  3LIC A;  4EEP A;  3K3C A;  4R3A A;  2QJ7 A;  1OJG A;  2BAS A;  4HHD A;  2YKH A;  2QHK A;  4PKY A;  2VLG A;  2ZOH A;  1S67 L;  2PR6 A;  4MN5 A;  5HWV A;  1XJ3 A;  4DJ3 A;  3BY9 A;  5I5L A;  1P97 A;  3UB8 A;  5DKK A;  4GS9 B;  3UB9 A;  4GHI A;  4JGQ A;  4HH3 A;  4LRX C;  2HV1 A;  3E4Q A;  1F98 A;  4K08 A;  4B9O A;  3H82 A;  4EQ1 A;  4I3A A;  3ULF A;  1WA9 A;  3EWK A;  3NOU C;  3H7W B;  1DP6 A;  4KUO A;  5F6A A;  2VV7 A;  5F5Y A;  4RQ9 A;  2J80 A;  1ODV A;  2R78 A;  3HJI A;  4HP4 A;  3A0V A;  4HJ4 A;  4DJ2 A;  4LRY C;  2PYP A;  5HZH A;  3MJQ A;  2M1C A;  3MFX A;  2L1M A;  4HNB A;  5J4E A;  3GEC A;  3PYP A;  1T1A A; 
#chains in the Genus database with same CATH topology
 2ZM2 A;  3SW1 A;  5HDD A;  3S4X A;  3T1Q B;  1VET A;  3HLB A;  4HJ6 A;  3TJZ C;  1ESU A;  2A24 B;  4DE0 A;  3ICY A;  2W3H A;  1G28 A;  2W27 A;  2VGK A;  4WMC D;  1F5M A;  3SS5 A;  3WS5 A;  3H9W A;  4UEY A;  1LI9 A;  3Q7V B;  4FTX A;  2ZQA A;  5FSR A;  1KE4 A;  1E3U D;  3OCN A;  4R70 A;  1L3L A;  5JYO A;  3UY6 A;  4IVI A;  5CED A;  3DW0 A;  4B4X A;  1G68 A;  1K57 C;  3HL9 A;  3IF6 C;  2O9A A;  2JKT M;  2V1B A;  4HH2 A;  3BYD A;  3IT9 A;  5CTM A;  4K0X A;  4HQA A;  3LR0 A;  3IF5 A;  3L9K A;  3P7N A;  1U60 A;  1KE0 A;  5LBR A;  3UB7 A;  2CMN A;  3O86 A;  3V3S A;  3PXP A;  4IED A;  3O87 A;  4GB7 A;  5FI2 A;  3SH9 A;  3RXX A;  3KO6 A;  3EGX C;  4FUW A;  3ZDJ A;  3DTM A;  4MMN A;  1S4S A;  1EW0 A;  1SCW A;  3TG9 A;  4CLC B;  2D02 A;  3EQU A;  3FYZ A;  3D9Y A;  5EEC A;  4FH2 A;  1LL9 A;  1Y54 A;  1GHI A;  1YM1 A;  2P08 A;  4KZ4 A;  2IWB A;  3HCY A;  3NOT C;  1H8M A;  2XA7 M;  4NXF A;  3QP1 A;  1PWD A;  1K57 A;  3IWI A;  1Y28 A;  3IF6 A;  3QP6 A;  1VQQ A;  3LIB A;  4QD4 A;  4EET B;  3N8S A;  4GS9 A;  1XPB A;  3ZQ5 A;  2ZMA A;  2PD8 A;  3V5M A;  4OP8 A;  5EVI C;  5KMW A;  1LT0 A;  2W3E A;  4ZRR A;  3A3I A;  5KSC A;  3K2N A;  5EM1 A;  4L9F A;  1K56 D;  4CJN A;  2X71 A;  4E6W A;  3C5A A;  5HDS A;  2X01 A;  2P74 A;  3IQA A;  3H7W A;  4I3J A;  3M2J A;  4Y13 A;  3HJK A;  3HVF A;  1YT4 A;  4EW7 A;  1P9W A;  2HF6 A;  4U3T A;  4QHC A;  2ZJ9 A;  3A3E A;  2QYB A;  3JPU A;  4P85 A;  5IU1 A;  1CJF A;  4WBG A;  3IX8 A;  2WAD A;  5HL1 A;  3T1X A;  5FAS A;  3BY8 A;  1L0D A;  4HOI A;  3BW6 A;  2WKR A;  3SS4 A;  2JHE A;  3FKW A;  2GJ3 A;  2Y91 A;  2XQZ A;  4OLG A;  4MBH A;  3KX0 X;  3MS6 A;  3VP2 A;  1T1C A;  1Q2Q A;  2PT7 A;  4JXW A;  1FIK A;  4ETX A;  3IH8 A;  1ZTU A;  3UPP A;  4FH4 A;  5DTT A;  3IXB A;  2OSU A;  2Z6D A;  3EEA A;  5A93 A;  3NI9 A;  4OOM A;  4Y2F A;  1PFL A;  3IHA A;  1DP8 A;  1IKG A;  4JGP A;  1XJ6 A;  5TR7 A;  3AGF A;  5FQM A;  1RCJ A;  3RTY A;  2FH5 A;  3T4S A;  2JKT I;  4HIA A;  5HSQ A;  3NHQ A;  2UWX A;  5M1A A;  3QHY A;  3RJU A;  1NYM A;  3H82 B;  1UGU A;  4WL9 A;  3G32 A;  1SKF A;  2ZC5 B;  5G18 A;  4KZ7 A;  1S6R A;  2Y55 A;  3HLF A;  4MCW A;  1KDW A;  1GA0 A;  4ARZ B;  4NET A;  2XRN A;  3IX4 A;  1N9O A;  1AWI A;  3L7H A;  1TS0 A;  4GLQ A;  5FDS A;  3LR5 A;  4UQI M;  1EWZ A;  3G6O A;  2V8F A;  4LCL A;  5FQ9 A;  2ZQ8 A;  4NG2 A;  1XXM A;  1WE4 A;  4WEJ A;  3T50 A;  4QY6 A;  3N8R A;  4KZ8 A;  4HES A;  4KUK A;  3LR3 A;  4KZ5 A;  1FSW A;  3PR6 A;  4H6J A;  1XJ4 A;  1LSV A;  3G4P A;  2L0W A;  5FQQ A;  4OH0 A;  1TDL A;  3A0S A;  4YWZ A;  4E04 A;  3ZG8 B;  3F1N B;  3IWO A;  4M4X A;  1FR6 A;  3QP8 A;  1BSG A;  4F3L A;  1SKO A;  4XUZ A;  3BRM A;  2Y2H A;  5CGX A;  2XRO A;  3NC8 A;  5CEC A;  1OT9 A;  4HY8 A;  3O3V A;  3QP4 A;  3CAX A;  4L0L A;  3UDF A;  3P01 A;  3BEC A;  1F2K A;  5EPH A;  4JKT A;  3PBQ A;  4ZDX A;  3ITB A;  4X25 A;  5L8M A;  2W1T B;  3LIC A;  4EEP A;  4R3A A;  5J8X A;  2QJ7 A;  3BEB A;  1YLT A;  3EOI A;  1OJG A;  1W8Q A;  5JYP A;  4QWO A;  5FAQ A;  1FOF A;  4PKY A;  3KSF A;  3OC2 A;  4LEN A;  3SS3 A;  3T4Q A;  3D4F A;  1K6S A;  2PR6 A;  4MN5 A;  5L09 A;  5FI7 A;  1DY6 A;  5DF9 A;  4Y5F A;  2ZC4 B;  3C30 A;  3NY4 A;  4DJ3 A;  3OCL A;  3G30 A;  3LY4 A;  2ZQ9 A;  2WKE A;  1HTZ A;  3UN7 A;  3GTC A;  4Q0J A;  5DKK A;  1L0F A;  4NKP A;  4GD8 A;  4YFM A;  1MKM A;  3HLE A;  4YIN A;  3E4Q A;  4GOG A;  5GL9 A;  1YQS A;  1PRQ A;  4B9O A;  1H8Y A;  1WA9 A;  2XGN A;  3V39 A;  4S2K A;  5L2F A;  5A92 A;  1G6A A;  2Z2M B;  3UPN A;  1MWU A;  1L2S A;  2ZD8 A;  1CF0 A;  2H0Y A;  3VSK A;  4PM5 A;  2J80 A;  3HJI A;  2LB5 A;  4HP4 A;  3NUL A;  4Y0U A;  4LRY C;  3DWZ A;  3TE8 A;  3MFX A;  4HNB A;  2Y2J A;  4AFI A;  2ZC7 A;  4Z1W A;  2FFY A;  3MSH A;  3A3F A;  1FQG A;  1NXY A;  1E3U A;  3T4J A;  5AQ7 A;  1SDN A;  1HD8 A;  1E4D A;  4JLF A;  5F82 A;  1W7F A;  4KZA A;  1XJ2 A;  2A3U A;  2EX9 A;  4KZ6 A;  1XKZ A;  4HP9 A;  2K31 A;  3QP5 A;  4QU3 A;  4I39 A;  3B47 A;  4WEL A;  1OJ5 A;  3IX3 A;  4P87 A;  1OPX A;  2J8Y A;  1MBL A;  1GSX A;  1FCO A;  3MQO A;  3GR2 A;  1BZA A;  3RXW A;  2WKH A;  3UDI A;  4R0Q A;  1YKD A;  4Q0I A;  2FFF B;  4Q0H A;  5HPI A;  4O0P A;  5FQK A;  1XGJ A;  4GDB A;  5HX9 A;  2ZM0 A;  1W63 Q;  1XA1 A;  5FA7 A;  4OVD A;  5FAP A;  3FPW A;  3FPV A;  4S2N A;  3N4I A;  1BTL A;  2X02 A;  2VV6 A;  4UQI S;  1PNE A;  3R4K A;  2W0N A;  3SH8 A;  2G2W A;  1X0O A;  4OLD A;  3ZG7 B;  5TBM A;  3UB6 A;  1BT5 A;  2INW A;  5F68 A;  2EWW A;  3GVB A;  4H8R A;  1I5Q A;  4E3L A;  3CI6 A;  4NXE A;  2XFS A;  1C3B A;  3QNC A;  5AJG A;  4JF4 A;  3E4O A;  3ZG5 A;  2PYR A;  4PHT A;  2LB9 A;  1T18 A;  4NK3 A;  1IEL A;  3LUQ A;  1Q2P A;  1ACF A;  3OPH A;  4S2J A;  2P9V B;  5IS1 A;  1ES5 A;  2Y2L A;  4G3W A;  3NJA A;  5J3W A;  3HLW A;  1D7E A;  1S1Z A;  1VHM A;  1H3Q A;  3ISG A;  4WUJ A;  2V0U A;  3UMD A;  1LSW A;  3PBR A;  3NIA A;  1TF1 A;  1FIL A;  1Y4O A;  3CHW P;  1IKI A;  5E2G A;  5AVE A;  3MXQ A;  1XA7 A;  4MN7 A;  1LL8 A;  2JN7 A;  2HP6 A;  1BYW A;  2PD7 A;  3UDX A;  3BQ8 A;  5DVA A;  3FC7 A;  4EBP A;  2HDQ A;  3QP2 A;  5DKL A;  5TJJ A;  4QB8 A;  3UE3 A;  1JNU A;  3VOL A;  4ZJ2 A;  3RFB A;  2UV0 E;  3VP1 A;  4N92 A;  4UHU A;  4JGO A;  5AVF A;  5EVL A;  3V3R A;  1O07 A;  4BL2 A;  3BFC A;  1FCM A;  3CUE C;  3MZF A;  4ZAM A;  4IUK A;  2PBD P;  5GHZ A;  2DRW A;  3WS1 A;  2Y59 A;  2PU4 A;  2WGV A;  1MZU A;  4P0M A;  1IOU A;  3GDI A;  3S7Q A;  2WGW A;  3NEC A;  1CQA A;  4HI4 A;  3UPO A;  3UE1 A;  3ZNY A;  2GNX A;  4KZB A;  1BLP A;  3ZFZ A;  3IXG A;  3KYE A;  1NJ4 A;  4Q8I A;  1K55 C;  4I5S A;  4F94 A;  3WWX A;  3CPT B;  1IEM A;  3S22 A;  1YLP A;  5HPF A;  5EOE A;  5TBM B;  4X55 A;  3PAG A;  2G2U A;  2ZL1 B;  2Y2O A;  1F9I A;  5E2F A;  4PPR A;  4EUV A;  3LI8 A;  1YLJ A;  3LIA A;  3IXD A;  2EX8 A;  2WGI A;  3Q82 A;  4UA6 A;  5HL6 A;  4DF6 A;  1E25 A;  3PBT A;  4R4S A;  4ETZ A;  4LV2 A;  2O0Y A;  1CEG A;  5CTN A;  3O5Y A;  4DDY A;  4CLC D;  4KG6 A;  3EGD C;  2VKS A;  1N9L A;  1KGE A;  2OAQ 1;  4G3K A;  1P0Z A;  4K91 A;  1VET B;  2Y79 A;  2PAV P;  4BWI A;  3JVU A;  3IS2 A;  3PBN A;  4KG2 A;  1CEF A;  3WS4 A;  4OPZ A;  3F1P A;  2BG1 A;  3LR4 A;  3IWQ A;  4KQQ A;  4U0T A;  4IHQ A;  1K54 C;  2KLI A;  3NOP C;  1YMS A;  5HD5 A;  4OPQ A;  1NZU A;  1DP9 A;  2B02 A;  5GLB A;  1ESI A;  4LRZ E;  5F83 A;  4S2I A;  1BUL A;  1PWC A;  2OLV A;  4U0X A;  4XT2 A;  1V9Z A;  3BM6 A;  5EVI A;  1G6O A;  4JXV A;  4QPR A;  5DJT A;  2K7S A;  3MKE A;  3G34 A;  1GHP A;  3FZC A;  3T1S A;  3E0Y A;  1NLY A;  3ZNT A;  4IUH A;  3MQ0 A;  2H10 A;  4OQG A;  2D01 A;  2XR0 A;  3CWF A;  1H0M A;  3W2Z A;  2RCX A;  1J9M A;  3LGO A;  1T1B A;  3BLS A;  4X53 A;  4ESP A;  2BAS A;  2XLN A;  2DNS A;  4GD6 A;  3G2Y A;  2YKH A;  2XSS A;  4FD8 A;  2O9B A;  2QHK A;  2EX6 A;  3MZD A;  5HAQ A;  3VFH A;  1S67 L;  3E2L A;  5EV0 A;  1HVB A;  5HWV A;  1S0W A;  3UE0 A;  3B42 A;  1XJ3 A;  3PBO A;  5AQ9 A;  4KQR A;  3UB5 P;  2E8I A;  5I5L A;  2ZQ7 A;  4G3V A;  3IF6 B;  4P6B A;  3G31 A;  3UB8 A;  1LLB A;  4GS9 B;  4BJP A;  4JGQ A;  2HV1 A;  2IA2 A;  2Y2G A;  2XEP A;  4OON A;  3ULF A;  3TOI A;  2BLS A;  2J9O A;  4JXS A;  3C4P A;  3NOU C;  1FCN A;  2DMW A;  3H7W B;  3S7P A;  2ACG A;  4LCM A;  5DF8 A;  4KUO A;  4II7 A;  5F5Y A;  4RQ9 A;  2R78 A;  4HJ4 A;  4DJ2 A;  2Y4A A;  2PYP A;  5EM0 A;  3KSI A;  3W4P A;  3CZD A;  1J3W A;  3BJN A;  4X56 A;  3VOY A;  5CEB A;  3UNW A;  5G4Y A;  2VX8 A;  1ERM A;  3HUN A;  4PMA A;  2WAF A;  4FOF A;  5HAR A;  5GHY A;  4UA9 A;  4I38 A;  4Y0O A;  3ZG9 B;  4WZ5 C;  1I2S A;  2JKR I;  3ZVT A;  3E4P A;  3M6H A;  1LSX A;  4OKP A;  2WKQ A;  5AQB A;  4DXC A;  1TD5 A;  3GMW A;  1JVJ A;  1YLZ A;  3TRC A;  1KGG A;  1TS8 A;  1VEU A;  4EER A;  3EEH A;  3N7W A;  2ZQD A;  3ZG0 A;  1O7E A;  1GHM A;  3W8K A;  1L0E A;  1QME A;  2JKF A;  2WKI A;  2KDK A;  4NXB A;  1RP5 A;  4OQI A;  1XFQ A;  1ZC2 A;  3BFF A;  4OOL A;  1NYY A;  1OME A;  5FAT A;  4B93 A;  3CJM A;  5A90 A;  4GZB A;  4BD1 A;  1BLS A;  2XA7 S;  4E6X A;  1GSV A;  5F1G A;  1N9B A;  1RGY A;  3KSH A;  1NY0 A;  2HGV A;  5FEG A;  1YLW A;  3DTI A;  2HDR A;  3C4O A;  4WZ5 A;  1TVF A;  3F1O A;  3LFV A;  3U4L P;  1S66 L;  2P04 A;  4R4R A;  1ES4 A;  3VP3 A;  1H5X A;  2WKP A;  2VEA A;  4IVK A;  3T4T A;  4NXG A;  3MMH A;  4LFU A;  1D06 A;  5IT5 A;  1VB6 A;  3JYI A;  4EEU A;  5J7E A;  2KOI A;  4A5R A;  2B95 A;  1OT6 A;  1K4E A;  1K4F A;  1BUE A;  4BEN A;  2H28 A;  2Y2I A;  4R1G A;  4JPM A;  2J9P A;  2J7V A;  4DN0 A;  3HLC A;  3CMZ A;  3WS2 A;  3WS0 A;  4JF5 A;  1RGZ A;  1KOU A;  4H6J B;  1OTD A;  4C6Y A;  3MFD A;  1IYP A;  3PTE A;  4WMC A;  1KGF A;  4BBU A;  2PRF A;  1ERO A;  2Q9M A;  2WZZ A;  4Y3I A;  2V0W A;  3C7U A;  1S4R A;  5DTK A;  3LYX A;  4HBT A;  4X69 A;  2GX5 A;  4F3L B;  2OWH A;  3LIE A;  1SKO B;  2J3W A;  3OPL A;  4GW9 A;  1WYB A;  2HDS A;  3LID A;  1WYC A;  2M7U A;  4ZTK A;  5IHV A;  3KYQ A;  1MC0 A;  1STZ A;  4BBT A;  2A24 A;  3OBF A;  4S2P A;  2JCH A;  4RX2 A;  1DJB A;  2V1Z A;  1NRF A;  4YOF A;  4CLC C;  3VE4 A;  5D3O A;  1M40 A;  4EES A;  3Q7V A;  2ZMV A;  1JTG A;  2JKG A;  3LEQ A;  5HFO A;  2PR5 A;  2W3D A;  3C8C A;  1JWZ A;  1OTI A;  4DE1 A;  1ZHH B;  3DWK A;  3E2K A;  2EXB A;  4GCZ A;  2XH9 A;  2J3T D;  4JBF A;  3DTK A;  2CC1 A;  1SHV A;  1IYQ A;  4R38 A;  2XF3 A;  2QMI A;  1OTE A;  3SOI A;  1NLZ A;  3C38 A;  3F1O B;  3MZE A;  5FDH A;  1FSY A;  3Q7Z A;  4N9K A;  5CXW A;  4PM6 A;  4MEZ A;  2P7J A;  3MXS A;  1BLH A;  1K56 A;  3LY3 A;  4CLC A;  4EBL A;  3E98 A;  4RX3 A;  3G35 A;  1TEM A;  4LV0 A;  2HJ9 C;  3C2W A;  2QJ5 A;  1ZKJ A;  5HWT A;  1XP4 A;  3LIF A;  3N6I A;  3EQV A;  3MKF A;  2PU2 A;  2R9X A;  4PKY G;  3CIT A;  4E3M A;  4R6L A;  4MLL A;  2XDM A;  1MPL A;  3AGE A;  4R3J A;  2A49 A;  3UO9 A;  4RYE A;  2QKP A;  4D60 A;  2IWD A;  3P09 A;  3PBS A;  3VV4 A;  1LHY A;  4L9E A;  1MWS A;  4EBN A;  5KIZ A;  4DE3 A;  4HEF A;  2V9A A;  4DXB A;  3T4L A;  5M18 A;  1LL5 A;  4GJ4 A;  4B88 A;  2C6W B;  5AQA A;  5L07 A;  3S7O A;  4EWF A;  4MN6 A;  5A91 A;  3ZCZ A;  2B5R A;  5A8B A;  3B3X A;  4GDN A;  2Z2L B;  5HDC A;  3K3D A;  3U2A A;  1P9R A;  3PHY A;  3BFG A;  1BLC A;  2QZ6 A;  2VJW A;  3W4O A;  4BMW A;  5CHM A;  2R9W A;  3A0R A;  1ONG A;  2JE5 A;  4R3B A;  2W1R A;  5DFY A;  1K6R A;  1KVM A;  1TS7 A;  5FQI A;  4CPK A;  3QNB A;  3IH9 A;  2EFU A;  2M7V A;  1W79 A;  4WZ4 A;  5I94 A;  2HPB A;  2WK0 A;  4EV4 A;  4Y0T A;  3T4K A;  3ZGA B;  2VGL M;  2XK1 A;  2AVX A;  5FL3 A;  4CLC E;  1YSP A;  2ZC3 B;  4O8G A;  4UAA A;  1XGI A;  3OOV A;  3IBJ A;  2ZLY A;  3HRE A;  4OOY A;  1H8Z A;  3TW8 A;  1ZG6 A;  2DCF A;  4N1H A;  4GNU A;  2JC7 A;  4WEK A;  5FEF A;  3O88 A;  4ME4 A;  3C7V A;  4ZJ3 A;  1ERQ A;  2ZMF A;  3BY9 A;  2B18 A;  3V50 A;  3BLM A;  2VZW A;  1P97 A;  5L10 A;  2VA0 A;  4XXR A;  3S7N A;  3UB9 A;  4GHI A;  4B4Z A;  4LRX C;  1IFQ A;  3GQZ A;  5GLC A;  3CUE A;  4KZ9 A;  1F98 A;  4K08 A;  4P6Z M;  3H82 A;  4EQ1 A;  1YAX A;  3S1Y A;  5EE8 A;  1KE3 A;  1FR1 A;  2ZQC A;  1PZP A;  1KDS A;  4C3Q A;  1MWT A;  1KVL A;  5EVE A;  4DDS A;  5U47 A;  2WUQ A;  3BQA A;  4QY5 A;  1HZO A;  1YPR A;  2VV7 A;  2JKR M;  4N9L A;  4ARZ A;  1ODV A;  3Q07 A;  2W3G A;  4KG5 A;  3A0V A;  4OQH A;  4EQI A;  1GCE A;  4S2M A;  2C5W B;  5HZH A;  1K55 A;  1HLU P;  2L1M A;  4KEN B;  5J4E A;  4Y7P A;  3GEC A;  4IBX A;  1PIO A;  3JVV A;  2XD5 A;  2ZOI A;  1I2W A;  3DTE A;  3GRJ A;  5E2E A;  2EA9 A;  2I9V A;  1ONH A;  4C75 A;  4WYY A;  3MXR A;  2ZM8 A;  2EFX A;  2OOL A;  5G4Z A;  5DJU A;  1YSQ A;  3HBR A;  1AXB A;  4KZ3 A;  3F1N A;  3BFE A;  3VFF A;  4LLO B;  2MJ6 A;  3D72 A;  1JWP A;  3GV9 A;  4GKU A;  2WGW B;  3B33 A;  4BQM A;  1TS6 A;  3RH8 B;  4EXO A;  2V1A A;  4EU0 A;  3UE6 A;  3FG8 A;  3I7J A;  3LEZ A;  5HAP A;  2V2F F;  3VMA A;  3VSL A;  5M19 A;  1DRM A;  1K54 A;  2IWC A;  4E3J A;  3R7W A;  4FSF A;  4JF6 A;  1XFN A;  3KYZ A;  4BBV A;  3HUM A;  4MDZ A;  2YKF A;  4NEE D;  3WRZ A;  2W1T A;  4L9G A;  2HZ5 A;  4N1X A;  4GHI B;  1MXO A;  4OP5 A;  5GLD A;  4LV1 A;  3CG5 A;  3OZH A;  4FCF A;  2OAP 1;  4WLA A;  2O99 A;  2OV5 A;  3ITA A;  3GSG A;  5KSH A;  2PDR A;  3NBL A;  3ZYT A;  2FZ0 A;  4I3I A;  5FAO A;  1IYS A;  1DJC A;  3T12 B;  5HAI A;  2Y2N A;  5CRF A;  5DFX A;  2A2L A;  3IS2 B;  2J3T C;  2KX6 A;  3F1P B;  2PBY A;  1NZO A;  4K0W A;  2W3F A;  5HWW A;  1SDE A;  4BL3 A;  4PM9 A;  2ZC6 B;  2NUT C;  4CQH A;  2H5S A;  2OLU A;  5F69 A;  5MC7 A;  4LPZ A;  2ZBB A;  4UA7 A;  4XT2 B;  3T4O A;  4X68 A;  5EVI B;  1W5D A;  5K5B A;  3TSG A;  3NDE A;  4DRT A;  1YLY A;  3OPR A;  4ZJ1 A;  4JGR A;  3DAV A;  1JWV A;  1K25 A;  3Q81 A;  2VGL S;  3AGD A;  4S2O A;  3UME A;  2Z6C A;  1UWP X;  1GSW A;  3D3O A;  1LI0 A;  1GA9 A;  5DTS A;  3A3J A;  4IJG A;  4KQO A;  1XX2 A;  1CI8 A;  1PYY A;  3P98 A;  4LV3 A;  4O01 A;  2Y8H A;  4WN5 A;  1TDG A;  3FKV A;  4R23 A;  1ES2 A;  1ES3 A;  5EVI D;  3ZHH A;  2OWJ A;  4PAU A;  3HUO A;  2EWV A;  4Y17 A;  4DE2 A;  3IBR A;  4HJ3 A;  3R7W B;  3NDG A;  1CI9 A;  5CER A;  1V9Y A;  3ZVW A;  1PW1 A;  4M3K A;  4EUZ A;  2HDU A;  2V8C A;  3HLD A;  3MBZ A;  4P6Z S;  4ZBE A;  2GZA A;  4DKI A;  3WRT A;  3V67 A;  3DBA A;  3SH7 A;  1PI4 A;  3MQQ A;  1CK3 A;  4PM8 A;  1A0K A;  3IXH A;  5CGW A;  2K2N A;  3MR0 A;  2Q9N A;  4Z9Q A;  4WM9 A;  1NWZ A;  1MWR A;  4X1M A;  1PWG A;  1OTB A;  4RA7 A;  1UWN X;  5GLA A;  4OPY A;  3OPP A;  4KQD A;  4E3I A;  2XD1 A;  4BLM A;  1PW8 A;  2H0T A;  5EFW A;  1SZV A;  1PZO A;  3OLO A;  1EI5 A;  3N8L A;  5DF7 A;  3IHB A;  4OQ0 A;  4X1L A;  2VV8 A;  1S1Y A;  4LGW A;  2HP9 A;  2WZX A;  3Q1F A;  5TGF A;  3LI9 A;  5FI6 A;  3G2Z A;  1T19 A;  1G5U A;  2G7U A;  3FV7 A;  3CLO A;  5EUA A;  1K0K A;  4QJG A;  5TFQ A;  2QWS A;  2JBF A;  2P9V A;  2Q0O A;  3BFD A;  5HD3 A;  4WF0 A;  3LO7 A;  4DMZ A;  1YMX A;  2Y2P A;  5CHJ A;  4MBK A;  3PAE A;  3VP0 A;  3W4Q A;  4E3N A;  2V20 A;  3NCK A;  3LCE A;  1Z6F A;  2RL3 A;  1VEU B;  5EOO A;  4BD0 A;  4O7D A;  5E2H A;  2Y2K A;  2QPN A;  2I72 A;  4E3O A;  1DJA A;  3VOZ A;  4S2N C;  2WAE A;  1N9N A;  1K38 A;  2XFT A;  3VP4 A;  3M6B A;  1IYO A;  2WYX A;  2Y2Q A;  3VE3 A;  4PM7 A;  4RVA A;  1OTA A;  1W63 M;  3KSG A;  4HBU A;  4E3K A;  2L4R A;  4OPR A;  1PI5 A;  3A3D A;  3BWL A;  2PHY A;  2E8J A;  5BOH A;  1VM1 A;  1ZG4 A;  2HJE A;  1L0G A;  4MNR A;  2Y2M A;  3K3C A;  2GDN A;  2HP5 A;  5CHU A;  5E43 A;  4HHD A;  4MBF A;  3HLG A;  4XUX A;  1N4O A;  4JXG A;  1MY8 A;  2O9C A;  2VLG A;  1Z09 A;  2ZOH A;  3T1R A;  2VGJ A;  5GHX A;  1MKI A;  4Y15 A;  1D1J A;  5KZH A;  1QMF A;  5HW3 A;  1JTD A;  4IBR A;  4X6T A;  3CPT A;  4HH3 A;  1W8Y A;  5CX7 A;  5C5K A;  2ZL1 A;  4I3A A;  3EWK A;  1NRJ A;  4ID4 A;  2BTF P;  4S2L A;  1DP6 A;  5F6A A;  3MF0 A;  2VK3 A;  2EX2 A;  1M6K A;  4YNR A;  2NUP C;  2EXA A;  3MJQ A;  4GN2 A;  2M1C A;  5FQJ A;  3M2K A;  5F1F A;  4D2O A;  3SZT A;  3FWL A;  3PYP A;  5CGS A;  1T1A A;  1ALQ A; 
#chains in the Genus database with same CATH homology
 3SW1 A;  2ZOI A;  5HDD A;  5G4Y A;  2VX8 A;  4HJ6 A;  3TJZ C;  4FOF A;  3T4J A;  2A24 B;  4I38 A;  2EA9 A;  2I9V A;  2W3H A;  1G28 A;  2W27 A;  3ICY A;  2JKR I;  1F5M A;  3H9W A;  3E4P A;  1LSX A;  2WKQ A;  4UEY A;  1TD5 A;  1XJ2 A;  2OOL A;  3OCN A;  4R70 A;  5G4Z A;  3TRC A;  4HP9 A;  2K31 A;  5DJU A;  1TS8 A;  1YSQ A;  4EER A;  3F1N A;  3EEH A;  4I39 A;  3B47 A;  4WEL A;  1OJ5 A;  4LLO B;  1OPX A;  2MJ6 A;  2O9A A;  1GSX A;  3MQO A;  3D72 A;  2JKT M;  2KDK A;  2V1B A;  4HH2 A;  4NXB A;  1XFQ A;  4HQA A;  3B33 A;  4OOL A;  3LR0 A;  1TS6 A;  3RH8 B;  4B93 A;  2V1A A;  4EU0 A;  3UE6 A;  4EXO A;  3FG8 A;  3P7N A;  1YKD A;  2XA7 S;  1DRM A;  5LBR A;  3UB7 A;  4Q0I A;  1GSV A;  2CMN A;  4Q0H A;  5HPI A;  4O0P A;  3PXP A;  3R7W A;  4FSF A;  3KSH A;  1XFN A;  2HGV A;  3KYZ A;  4BBV A;  3KO6 A;  3EGX C;  4MDZ A;  2YKF A;  4NEE D;  2W1T A;  1W63 Q;  4MMN A;  4L9G A;  1S4S A;  1EW0 A;  4CLC B;  2D02 A;  3EQU A;  3FPW A;  3FPV A;  3F1O A;  3LFV A;  2VV6 A;  1S66 L;  4GHI B;  2P04 A;  4UQI S;  2WKP A;  2VEA A;  3R4K A;  2W0N A;  1X0O A;  2OAP 1;  3T4T A;  4NXG A;  4WLA A;  2O99 A;  3MMH A;  5TBM A;  3UB6 A;  2INW A;  5F68 A;  2EWW A;  5KSH A;  1D06 A;  5IT5 A;  2P08 A;  1VB6 A;  3CI6 A;  3HCY A;  1H8M A;  2XA7 M;  3NOT C;  4NXF A;  4EEU A;  2PDR A;  4NXE A;  5J7E A;  3ZYT A;  2FZ0 A;  5AJG A;  1Y28 A;  4I3I A;  3LIB A;  2KOI A;  4EET B;  1OT6 A;  3ZQ5 A;  4GS9 A;  2PD8 A;  3E4O A;  2PYR A;  4PHT A;  2H28 A;  2LB9 A;  1T18 A;  1LT0 A;  2W3E A;  3LUQ A;  4DN0 A;  4ZRR A;  5DFX A;  2A2L A;  3IS2 B;  5IS1 A;  2J3T C;  3K2N A;  4L9F A;  2KX6 A;  3F1P B;  4G3W A;  5HDS A;  3NJA A;  1KOU A;  5J3W A;  2W3F A;  4H6J B;  5HWW A;  3H7W A;  1OTD A;  4I3J A;  1D7E A;  1S1Z A;  4BBU A;  1VHM A;  1H3Q A;  4WUJ A;  4Y3I A;  2V0U A;  3UMD A;  2NUT C;  4CQH A;  3HJK A;  1LSW A;  2V0W A;  3PBR A;  1TF1 A;  4EW7 A;  1S4R A;  1P9W A;  2HF6 A;  3LYX A;  5F69 A;  5MC7 A;  4LPZ A;  5AVE A;  3MXQ A;  4MN7 A;  1LL8 A;  2JN7 A;  2GX5 A;  2ZBB A;  4XT2 B;  4F3L B;  3T4O A;  2OWH A;  1BYW A;  2PD7 A;  3LIE A;  5K5B A;  3BQ8 A;  3FC7 A;  2QYB A;  2J3W A;  5IU1 A;  4GW9 A;  4JGR A;  5DKL A;  5TJJ A;  3LID A;  3BY8 A;  2M7U A;  4HOI A;  3BW6 A;  2WKR A;  3UE3 A;  3KYQ A;  1JNU A;  2VGL S;  3VOL A;  2JHE A;  1MC0 A;  1STZ A;  3RFB A;  4BBT A;  3UME A;  2Z6C A;  1UWP X;  2A24 A;  2GJ3 A;  3OBF A;  4YOF A;  4CLC C;  1GSW A;  4JGO A;  3D3O A;  3VE4 A;  3KX0 X;  5AVF A;  4EES A;  1T1C A;  2PT7 A;  4IJG A;  4KQO A;  2ZMV A;  4O01 A;  4ETX A;  2Y8H A;  4WN5 A;  2PR5 A;  2W3D A;  3CUE C;  1ZTU A;  3C8C A;  4IUK A;  1OTI A;  1ZHH B;  2Z6D A;  2OWJ A;  3EEA A;  4PAU A;  4OOM A;  4GCZ A;  4Y2F A;  2EWV A;  3IBR A;  4HJ3 A;  3R7W B;  1MZU A;  1DP8 A;  2J3T D;  4JGP A;  1XJ6 A;  1IOU A;  3GDI A;  1V9Y A;  3S7Q A;  4HI4 A;  4R38 A;  3RTY A;  2FH5 A;  2GNX A;  1OTE A;  3T4S A;  2JKT I;  4P6Z S;  2GZA A;  4HIA A;  1NLZ A;  3C38 A;  3F1O B;  3V67 A;  5HSQ A;  3NHQ A;  3DBA A;  4I5S A;  4Z1W A;  3MQQ A;  5HPF A;  5TBM B;  2K2N A;  3MR0 A;  3H82 B;  2P7J A;  1UGU A;  1F9I A;  4WL9 A;  1NWZ A;  4EUV A;  3LI8 A;  4CLC A;  3E98 A;  1OTB A;  3LIA A;  1UWN X;  4MCW A;  4KQD A;  4ARZ B;  5HL6 A;  2HJ9 C;  3PBT A;  3C2W A;  5EFW A;  4ETZ A;  2XRN A;  2QJ5 A;  5HWT A;  3LIF A;  3OLO A;  2O0Y A;  1N9O A;  3O5Y A;  4CLC D;  3EQV A;  1TS0 A;  4PKY G;  3EGD C;  4GLQ A;  2VKS A;  3CIT A;  4R6L A;  1N9L A;  3LR5 A;  4UQI M;  2OAQ 1;  1S1Y A;  2VV8 A;  3G6O A;  4G3K A;  3LI9 A;  1P0Z A;  1T19 A;  2G7U A;  4WEJ A;  3CLO A;  3T50 A;  2Y79 A;  2QWS A;  4BWI A;  3JVU A;  2QKP A;  3IS2 A;  3PBN A;  4KUK A;  5HD3 A;  3LR3 A;  3F1P A;  4WF0 A;  3LR4 A;  3PBS A;  3VV4 A;  3PR6 A;  4DMZ A;  4L9E A;  4H6J A;  1XJ4 A;  4IHQ A;  1LSV A;  5KIZ A;  2KLI A;  2V9A A;  3NOP C;  2L0W A;  3T4L A;  5HD5 A;  4GJ4 A;  3A0S A;  1DP9 A;  2B02 A;  4YWZ A;  3S7O A;  4E04 A;  4MN6 A;  3F1N B;  4LRZ E;  5A8B A;  4M4X A;  5HDC A;  3K3D A;  3U2A A;  1P9R A;  3PHY A;  4XT2 A;  2VJW A;  4F3L A;  4BMW A;  1V9Z A;  1G6O A;  1N9N A;  4QPR A;  5DJT A;  2XRO A;  3A0R A;  2K7S A;  1OT9 A;  3E0Y A;  1NLY A;  3VE3 A;  4HY8 A;  2W1R A;  4IUH A;  5DFY A;  3CAX A;  4L0L A;  3MQ0 A;  3P01 A;  1TS7 A;  1OTA A;  1W63 M;  3PBQ A;  3KSG A;  2D01 A;  2L4R A;  3CWF A;  3BWL A;  2M7V A;  2PHY A;  5L8M A;  3W2Z A;  3T4K A;  2HJE A;  1T1B A;  2VGL M;  2W1T B;  3LIC A;  4EEP A;  3K3C A;  4R3A A;  2QJ7 A;  5FL3 A;  4CLC E;  1YSP A;  1OJG A;  3EOI A;  4O8G A;  2BAS A;  4HHD A;  3OOV A;  2YKH A;  2XSS A;  3IBJ A;  2O9B A;  2QHK A;  4PKY A;  3TW8 A;  3KSF A;  3OC2 A;  3T4Q A;  2O9C A;  2VLG A;  2ZOH A;  1S67 L;  4WEK A;  2PR6 A;  4MN5 A;  5HWV A;  4ME4 A;  3B42 A;  1XJ3 A;  5DF9 A;  4Y5F A;  3PBO A;  3C30 A;  4DJ3 A;  2ZMF A;  3BY9 A;  2B18 A;  3OCL A;  2VZW A;  5I5L A;  4G3V A;  1P97 A;  3UB8 A;  2VA0 A;  4Q0J A;  5DKK A;  3S7N A;  4GS9 B;  4NKP A;  3UB9 A;  4GHI A;  4BJP A;  1MKM A;  4JGQ A;  4HH3 A;  4LRX C;  1IFQ A;  2HV1 A;  2IA2 A;  3E4Q A;  3CUE A;  5CX7 A;  1F98 A;  4K08 A;  4P6Z M;  5C5K A;  3H82 A;  4B9O A;  4EQ1 A;  1YAX A;  4I3A A;  3ULF A;  1WA9 A;  3EWK A;  3NOU C;  1NRJ A;  2DMW A;  3H7W B;  3S7P A;  3BQA A;  1DP6 A;  4KUO A;  5F6A A;  2VV7 A;  3MF0 A;  2JKR M;  4ARZ A;  4II7 A;  5F5Y A;  4RQ9 A;  2J80 A;  1ODV A;  2R78 A;  3HJI A;  2LB5 A;  4HP4 A;  2W3G A;  4YNR A;  3A0V A;  2NUP C;  4HJ4 A;  4DJ2 A;  4LRY C;  2PYP A;  5HZH A;  3KSI A;  3MJQ A;  3TE8 A;  2M1C A;  3MFX A;  2L1M A;  4HNB A;  5J4E A;  4AFI A;  3GEC A;  3BJN A;  3PYP A;  3JVV A;  1T1A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...