2AVXA

Solution structure of e coli sdia1-171
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
171
structure length
171
Chain Sequence
MSDKDFFSWRRTMLLRFQRMETAEEVYHEIELQAQQLEYDYYSLCVRHPVPFTRPKVAFYTNYPEAWVSYYQAKNFLAIDPVLNPENFSQGHLMWNDDLFSEAQPLWEAARAHGLRRGVTQYLMLPERALGFLSFSRCSAREIPILSDELQLKMQLLVRESLMALMRLNDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Regulatory protein sdiA
publication title Structure of the Escherichia coli quorum sensing protein SdiA: activation of the folding switch by acyl homoserine lactones.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 49
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2005-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03472 Autoind_bind Autoinducer binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.80 Alpha Beta 2-Layer Sandwich Beta-Lactamase Transcription factor LuxR-like, autoinducer-binding domain 2avxA00
3IX3A 5L07A 5L10A 4LGWA 1L3LA 3QP4A 3QP6A 4Y13A 2Q0OA 2AVXA 4Y15A 3QP2A 4Y17A 5L09A 3IX8A 2UV0E 3IX4A 3QP5A 1H0MA 4LFUA 3JPUA 3QP8A 3QP1A 3SZTA 4NG2A
chains in the Genus database with same CATH superfamily
2Y8HA 3P7NA 3UDIA 4S2OA 3IWIA 5HPIA 4GDNA 3FZCA 3ZNTA 4PM5A 3BYDA 1MY8A 2YKHA 1YLYA 5E43A 3V5MA 1OTAA 2HGVA 1NYMA 3DTIA 1U60A 3LEQA 1SDNA 3ZG9B 4OPRA 2VGLS 5EPHA 2Y2GA 1BLPA 3GSGA 1N9OA 1SDEA 2I72A 1DY6A 3B33A 1NY0A 3C8CA 5JYPA 4PM7A 5D3OA 1TDLA 4QHCA 1GSVA 3CWFA 4OPZA 4WMCA 1QMEA 3PBSA 1STZA 5DTSA 3S4XA 2Q9MA 3NOUC 1W63Q 2AVXA 2Y2IA 1K6SA 3WS2A 3PBNA 4NXBA 5TFQA 2O99A 4O7DA 2FZ0A 4IBXA 2E8JA 3CG5A 3VE3A 1YMSA 3BEBA 3VSLA 3UB8A 2VK3A 4S2KA 4MCWA 3A0SA 2PU2A 2PBYA 4K0XA 4HH2A 4Y13A 5HAQA 4WEJA 3LIBA 4Y0TA 4EUVA 2IWDA 3BFEA 2WUQA 4MBHA 4GW9A 4UA6A 4OQIA 5DKLA 4WEKA 3WWXA 4NG2A 3N8SA 2XF3A 2XEPA 2M7UA 1F2KA 2KX6A 5KZHA 3HUOA 3VP4A 5EUAA 5KSHA 2HDUA 3BY9A 2R9XA 4MEZA 2ACGA 3KSIA 4LFUA 3ULFA 4CLCE 5KIZA 3A3DA 3G35A 5IHVA 1ES5A 3W4QA 3ZFZA 1I5QA 3GECA 2W1TA 4KENB 3G2ZA 1NZOA 4BWIA 2LB5A 3DWKA 4OONA 2Y4AA 3GDIA 4AFIA 1PI4A 2ZC3B 5DTTA 1NXYA 3NOPC 3FV7A 3FWLA 1PIOA 1UWNX 2PYRA 1ESIA 4HI4A 4OP8A 1E4DA 2HZ5A 5FQKA 4DXBA 2B18A 2X01A 3QP6A 4QD4A 5HDDA 4QWOA 3OZHA 1OTEA 3MXRA 2EWWA 2HV1A 4R3AA 3KO6A 1RCJA 3WS5A 5GHXA 4DF6A 1YKDA 1FR6A 1W63M 1FOFA 1PRQA 4XUXA 1PYYA 3U2AA 3ZHHA 4E3OA 2KLIA 1KVLA 4LV0A 2Z6DA 2WKRA 3O5YA 4GZBA 4PPRA 3D72A 3PTEA 3KSHA 3OPHA 2J3TC 3CI6A 4Y0OA 1H8YA 4JXSA 3JYIA 4P6BA 3B47A 3VE4A 4JGQA 3VV4A 4WLAA 1BSGA 2HDSA 1CEGA 3GMWA 1T1CA 2YKFA 3LY3A 3VP1A 3CMZA 3TG9A 4HNBA 1JWPA 4QY6A 3H9WA 1KE4A 1J3WA 1PWCA 1H8ZA 2XFSA 3SH9A 4E3NA 3RXXA 1G28A 1T1AA 2VX8A 3QP8A 5DF9A 2PBDP 2VZWA 3CUEC 2J9PA 4OH0A 3AGDA 1BYWA 2PAVP 4MBKA 4MMNA 4U0TA 2W27A 2Y2LA 4KZ8A 1TDGA 3ZCZA 5F82A 2ZD8A 3N6IA 1XKZA 2V8FA 4EQIA 4B4XA 4MBFA 5EE8A 3UDFA 4EESA 5CGXA 5F1FA 5CXWA 4Q0HA 3DBAA 3WRZA 2UV0E 3BLMA 3I7JA 4LRYC 1EWZA 3U4LP 1BZAA 3QHYA 4ARZA 5DJUA 3VP0A 3LGOA 2WAFA 4HEFA 2V1BA 4LLOB 4WBGA 1N9NA 3G2YA 4EUZA 4L9GA 2JKFA 1XA1A 2JE5A 4WMCD 5HPFA 1YSQA 3TRCA 3LUQA 3LEZA 4CLCB 3MZEA 1ESUA 4BBTA 3NBLA 3S7PA 5DTKA 1JVJA 1MWRA 1K55C 1W79A 4HJ4A 4GLQA 2QYBA 3CITA 3MBZA 4FUWA 4QJGA 1PWDA 4UAAA 3OCNA 1XP4A 3UB6A 3UPOA 3UDXA 3JVVA 1CEFA 4B88A 4G3WA 3FG8A 2VLGA 1JNUA 1KVMA 2Y2JA 2FH5A 2IWCA 2W3HA 3MZFA 3PR6A 3MS6A 1XJ3A 3FC7A 5AJGA 4S2IA 4L0LA 1E25A 1MWTA 5FQMA 4HH3A 3QP4A 1WYCA 4HHDA 2ZMAA 2WKEA 3GRJA 2VGLM 2Z2LB 3DWZA 5M19A 1LSVA 3M2JA 3IHBA 5EM1A 4X56A 5F5YA 1XJ2A 3PYPA 3T4JA 1ZHHB 4LPZA 3HUNA 4MN6A 2ZM0A 1IYQA 1ES4A 1XFQA 5FAPA 4PM6A 5HDSA 4OPYA 2WGWB 3O86A 4HY8A 2XD1A 4O01A 2G7UA 3IH9A 4ZDXA 2VJWA 4PHTA 1P9RA 4OKPA 2A49A 3M6BA 1XX2A 1GHPA 2DCFA 3WS0A 2Q0OA 1CF0A 4OOMA 4NEED 4JGOA 4OOYA 2ZL1A 1M6KA 3P09A 4Y0UA 4E3IA 2WKPA 3T1XA 1Z09A 1I2SA 2JBFA 3CLOA 3RJUA 3TSGA 3ZG5A 2D01A 1Z6FA 1I2WA 4IHQA 2XROA 4E3JA 1DRMA 4E6WA 2K7SA 1S0WA 1IEMA 4KZ7A 3EWKA 4IUHA 5CECA 1TS0A 3G6OA 4DRTA 1GA0A 3ITAA 3QP5A 4X55A 1YQSA 4LRZE 1BLSA 4EEPA 4HJ3A 3ZG8B 1O07A 4ETXA 2J3WA 4MNRA 1GSWA 2JCHA 5CTMA 4GKUA 3S7OA 4A5RA 3IS2B 4NXGA 3IBRA 4I3IA 3M6HA 4KZ3A 3LI9A 4EBNA 1LLBA 4E3LA 5J4EA 3CPTA 1BTLA 2QWSA 1IYSA 4WL9A 4F3LB 2VA0A 2KOIA 2V0UA 3MQ0A 4KZ6A 3F1PB 3SOIA 3NI9A 5I5LA 3OBFA 3V50A 3FYZA 4S2NA 3VMAA 2WADA 4JF5A 1NZUA 3BQAA 3ISGA 3GV9A 3NDGA 5EOOA 3T4LA 5A90A 5EM0A 5EVIA 5FQJA 3BFDA 2C5WB 3IXGA 4GS9B 3NDEA 3OC2A 1MKIA 3IXBA 2ZJ9A 3IHAA 1ONHA 4Q0JA 1TD5A 2H10A 2FFYA 5CRFA 1WYBA 2V1ZA 4BMWA 3SH8A 4BD0A 4N92A 3A3JA 2VV7A 4FD8A 2XQZA 2J9OA 3KYZA 5EECA 2JKRM 3MQQA 3UPNA 3H7WB 3UMEA 4GB7A 4FSFA 1LT0A 2P74A 4G3VA 2V2FF 1K25A 1JTDA 3PBQA 5KSCA 2QPNA 4IJGA 5EVIB 3IF6A 1IOUA 1CI8A 1S1ZA 2NUTC 4ZJ2A 3O3VA 3HREA 2IWBA 2HF6A 3ZYTA 5FI7A 3T4QA 3H82B 1K56D 3Q1FA 2ZLYA 2INWA 5HZHA 2ZC7A 3CAXA 4FCFA 1N9BA 2XLNA 4OLGA 3G32A 4UA7A 3S7QA 1CQAA 4R4SA 1FSWA 4GDBA 4DXCA 2XRNA 1WE4A 3IF6B 3UY6A 4Y5FA 1T19A 3C38A 4DDSA 3HLGA 3K3CA 1FILA 2A24B 1RP5A 3C7UA 1KGEA 2JKRI 4S2MA 4E6XA 1FSYA 3CZDA 2RCXA 3O88A 4ZRRA 1IFQA 1W5DA 4PM9A 3UE0A 3FKVA 1DP9A 4EQ1A 3UMDA 2XA7S 5HL1A 3KYEA 3N8RA 3NOTC 5JYOA 4DMZA 3EOIA 4R1GA 3Q07A 4ME4A 4LRXC 2PT7A 5DVAA 4Q8IA 4M4XA 2XR0A 4YINA 1LL5A 5CEDA 2HDQA 2P9VA 2FFFB 5TBMA 2Z6CA 4Y3IA 3UB9A 3BFGA 3NULA 2O0YA 4FTXA 3S1YA 4I38A 3CHWP 2Y2HA 4QY5A 3UB7A 5EV0A 4KQDA 1RGYA 1VQQA 4LGWA 4HQAA 1XA7A 2W1RA 4RA7A 1KGFA 5DFYA 3VP2A 2Y55A 5E2FA 2OLUA 3DTKA 1BULA 4Q0IA 3C4OA 3C5AA 3MKFA 2ZBBA 5FI2A 3MJQA 3SS4A 1TS6A 3O87A 5GHYA 2A2LA 2P9VB 2VGJA 4EWFA 5TBMB 2QJ7A 1OJ5A 1S4RA 1TF1A 3RXWA 3S22A 2C6WB 4QU3A 3NCKA 4O8GA 1MWUA 3T4TA 2W3EA 5GLAA 1YLPA 4C6YA 3B3XA 2J80A 2EFUA 2OOLA 5HX9A 2JN7A 4OOLA 3KX0X 4P6ZS 2W0NA 4HBUA 3SS3A 4EETB 3F1NA 3MXSA 2H5SA 3QP1A 3D3OA 1YLTA 1TVFA 4G3KA 4MDZA 1TEMA 2ZQAA 2VV8A 4X53A 3ZGAB 1GCEA 2EX8A 4ZJ3A 2HP9A 3A0RA 3T1QB 3ZG7B 1MZUA 3A3EA 4PM8A 1OTIA 2W3FA 1H5XA 1JTGA 2GX5A 4MN7A 5HSQA 2DMWA 4EEUA 1Y4OA 3PBRA 3A3FA 1ZG6A 5F6AA 5M1AA 4H8RA 3TOIA 1LL8A 4I39A 1JWVA 3TJZC 3N4IA 3N8LA 2VGKA 1W8QA 3GVBA 4X25A 4GD8A 3F1NB 2G2UA 4R0QA 1UWPX 4CLCA 4BQMA 2B5RA 3K3DA 3A0VA 2WAEA 3RH8B 3IBJA 5C5KA 4RYEA 4WF0A 1XXMA 2LB9A 4OPQA 5DFXA 2BG1A 2B95A 2BTFP 3G34A 2PYPA 5FAOA 5CGWA 4EW7A 4B9OA 4S2JA 3T1SA 3UN7A 3RFBA 3UE1A 3HUMA 5MC7A 1AXBA 1OTBA 1GHMA 2XK1A 4RVAA 3T50A 3FPVA 1P0ZA 2WKHA 3MFDA 2IA2A 4R70A 4DE3A 5CX7A 2Y79A 2Y2NA 2GZAA 3W8KA 4KQOA 5L09A 3R4KA 1K6RA 4EBLA 1YMXA 4CPKA 4LV2A 5A8BA 3MSHA 2ZM8A 2MJ6A 2EFXA 1HVBA 3W4OA 5DF7A 4X69A 4BL2A 3TW8A 4I3AA 1DJCA 2HP5A 4BBVA 2ZOHA 3BQ8A 2Y91A 1PI5A 5DF8A 1DJBA 1FCOA 1L0GA 3T4KA 1O7EA 1H3QA 1S4SA 3BW6A 4D2OA 2WGWA 3QNCA 5F68A 4N9LA 4EERA 3P01A 3E0YA 4ZAMA 3EQUA 2H0YA 1L3LA 4HP4A 5CHUA 3E2KA 1F9IA 1YLZA 1K0KA 4HBTA 4OQHA 4YFMA 1V9YA 4N1XA 3IQAA 5FDHA 1ES3A 2O9AA 3LIEA 4EXOA 2ZQ9A 3MMHA 3ZVWA 3GR2A 2HP6A 2W3DA 4GD6A 5GHZA 3MFXA 1YM1A 4JF4A 2WZXA 3HLEA 4X6TA 4JBFA 5FQ9A 1KE0A 1XJ4A 2H0TA 3JVUA 3L9KA 5J8XA 1T1BA 3W2ZA 2WGIA 3V39A 1M40A 3C4PA 3GTCA 3C2WA 5L07A 1S66L 5F69A 4DDYA 3N7WA 2EXBA 1A0KA 2PHYA 1LSWA 4C3QA 2XDMA 4S2NC 3IS2A 4Y17A 2XA7M 1SKOA 1XGJA 4F94A 1LI0A 1S6RA 2A3UA 5FDSA 3W4PA 2P08A 4GNUA 1G5UA 4RX2A 5TR7A 2OV5A 4WELA 1F5MA 4HIAA 3NECA 2XFTA 4F3LA 5FATA 3SH7A 3D4FA 3AGFA 5J3WA 1XJ6A 3F1PA 1HD8A 3DW0A 2PR6A 2M7VA 2Y2MA 3EGDC 3E2LA 4FH2A 2KDKA 5A92A 2WGVA 3BFFA 4UHUA 2QMIA 4DE2A 1EROA 1BT5A 1YT4A 5EOEA 3E4OA 4KZBA 3NIAA 4II7A 4D60A 1K38A 4GS9A 2EX2A 4KUKA 4X1LA 3RTYA 1SKOB 3QP2A 4P87A 1MWSA 3E4PA 1KGGA 5CHMA 3UE6A 5AQBA 3IF6C 1L0DA 5FEGA 3LFVA 4U0XA 3UO9A 4OVDA 5IU1A 3T4OA 3NY4A 1L0FA 1ACFA 3H7WA 4Y15A 5BOHA 5HD5A 3HLCA 5I94A 4I3JA 3HVFA 2K2NA 2JHEA 1H0MA 1Q2QA 3P98A 2ZQ7A 4XT2A 1G6OA 3SS5A 3LR4A 2JC7A 2ZMFA 5HWTA 1EW0A 4CLCD 2Y59A 2JKTI 4R4RA 5G4YA 4JXGA 4H6JA 1BLCA 1OT6A 2O9CA 2OWHA 5AQAA 2I9VA 3DTMA 3H82A 2D02A 3HJKA 1RGZA 4QB8A 3WS4A 4KZAA 4P6ZM 5HWWA 5GLDA 3T4SA 1LHYA 1YLJA 1X0OA 1NJ4A 1NWZA 4Z1WA 5HARA 5GLBA 1YAXA 2X71A 4XT2B 1FIKA 4PAUA 3MQOA 4WZ5A 5DJTA 2HJ9C 4YWZA 4UA9A 3R7WB 4CJNA 4MN5A 4RQ9A 5TJJA 4JLFA 3M2KA 3ZNYA 4H6JB 4IVKA 1KDWA 1N4OA 2A24A 4WN5A 1VEUB 3LYXA 1OT9A 1F98A 1OMEA 2EX9A 1DJAA 3PBTA 2HPBA 2X02A 3HJIA 3OPPA 4Y2FA 5E2HA 3OLOA 1PZOA 5AVEA 1ZG4A 3F1OB 1K54A 2QKPA 3OCLA 1TS7A 1PW1A 5CGSA 3IX4A 2ZMVA 3UE3A 1NLYA 3MKEA 3IF5A 1QMFA 4KZ4A 1K57A 4LCLA 3LIFA 3Q7VA 2OAQ1 1H8MA 1CJFA 1VB6A 3V67A 4K08A 2L1MA 3IWOA 3PXPA 4JXVA 1HZOA 4IBRA 4E04A 1DP8A 1MC0A 3LICA 4GJ4A 1P9WA 1OPXA 2PRFA 4WM9A 1V9ZA 4YNRA 5TGFA 3T12B 1N9LA 4KQRA 5FL3A 5G4ZA 5HFOA 2ZQ8A 4GOGA 1GA9A 3GQZA 1KDSA 3KYQA 3PAGA 4L9EA 5FQQA 5L8MA 5DKKA 4KG5A 1IKGA 1CK3A 2CMNA 3LCEA 1ZTUA 3Q7VB 4LENA 1OTDA 2ZQDA 2QZ6A 2JKGA 2J8YA 1YLWA 1ZC2A 3LY4A 1T18A 3WRTA 3VOYA 2BASA 2HDRA 2PDRA 3LR0A 3T1RA 5IT5A 4EU0A 2WKIA 3D9YA 4PKYG 4R6LA 2O9BA 2ZM2A 4JKTA 2Y2KA 5HW3A 4R3JA 4M3KA 1G68A 2DRWA 5M18A 1VM1A 4KZ9A 4IUKA 1WA9A 5E2GA 3VOLA 4R3BA 2L0WA 4UQIS 5F83A 3G31A 3HL9A 3IWQA 1KE3A 3NC8A 1P97A 5FQIA 2V1AA 3G30A 3MZDA 4WZ4A 1XFNA 4P85A 3EGXC 2K31A 4XXRA 3UNWA 1PW8A 4OQ0A 3HCYA 4NXFA 4K91A 5A91A 2R78A 4WYYA 2H28A 1D1JA 4BBUA 4E3MA 4CLCC 4ID4A 4DKIA 4S2LA 4BJPA 3HLDA 4DJ3A 1SHVA 2EA9A 2WKQA 1Q2PA 2OAP1 5L2FA 4RX3A 4B93A 2VEAA 5EVID 3PAEA 4DN0A 2R9WA 4KQQA 3LR5A 2W1TB 1HLUP 4CQHA 3IT9A 4HESA 1L2SA 2EWVA 3ZDJA 4BLMA 3UPPA 2V0WA 4Y7PA 5LBRA 5IS1A 3HLWA 3SZTA 4ZTKA 3DTEA 5GL9A 2Y2QA 4R23A 1ODVA 5CTNA 3VOZA 4JPMA 1ES2A 4N1HA 2RL3A 3ICYA 1YSPA 3S7NA 5FSRA 4MLLA 1YPRA 4QPRA 1PNEA 1W7FA 1BUEA 1AWIA 3EEHA 1OJGA 1C3BA 3LI8A 4KUOA 4OLDA 1D06A 4HOIA 3TE8A 3G4PA 1SCWA 2OLVA 2CC1A 2V9AA 1EI5A 5CEBA 4EBPA 1LL9A 5KMWA 4ZBEA 3ZG0A 3IXDA 1ALQA 4X1MA 1L0EA 3KSGA 2HJEA 5CERA 1SKFA 2QHKA 3UB5P 3AGEA 1D7EA 3V3SA 4FH4A 3ZVTA 1XPBA 2WK0A 1ZKJA 3LO7A 1S1YA 2PU4A 3Q7ZA 2GJ3A 2VV6A 4JF6A 3JPUA 3QNBA 2WYXA 2XD5A 5HAPA 2P7JA 3HLBA 2WZZA 1JWZA 1E3UA 3MR0A 5F1GA 4N9KA 2M1CA 2B02A 4HP9A 1W8YA 5GLCA 5EVEA 2ZC4B 4HJ6A 2ZC5B 2ZQCA 3K2NA 5AVFA 4XUZA 3EEAA 2XGNA 1IELA 4PMAA 1ONGA 4YOFA 1K56A 4WUJA 3DAVA 4LCMA 3CUEA 4B4ZA 2PR5A 5E2EA 3ITBA 1BLHA 1FCMA 1KOUA 4KZ5A 3E4QA 1K4FA 4ARZB 4IEDA 3VFFA 3LIDA 4K0WA 3VP3A 4E3KA 3IX3A 3FKWA 5L10A 3HLFA 3KSFA 2QJ5A 2Y2OA 5CHJA 5HD3A 4KG2A 1CI9A 1MBLA 1IYOA 1Y28A 5FA7A 3BFCA 3MXQA 4GCZA 4L9FA 5HL6A 1PWGA 4S2PA 2J7VA 2P04A 2PD7A 2W3GA 4OP5A 4FOFA 2DNSA 4C75A 1FQGA 1NLZA 1MKMA 2G2WA 3BECA 1LSXA 2BLSA 1SZVA 4GN2A 3BM6A 1PZPA 4JGPA 4NXEA 1VETA 4U3TA 4JGRA 2ZOIA 2EX6A 3Q82A 5HAIA 3HBRA 5J7EA 2JKTM 2Y2PA 4LV1A 3OPRA 5EVIC 1K55A 4NKPA 3V3RA 3B42A 3WS1A 5K5BA 4JXWA 5AQ9A 3E98A 5G18A 2Q9NA 3NHQA 1FR1A 3VFHA 5EVLA 4BENA 2V8CA 1K4EA 4OQGA 2UWXA 1TS8A 4GHIA 4LV3A 4Z9QA 2NUPC 5HDCA 2GDNA 2E8IA 3SW1A 1Y54A 2XSSA 2XH9A 5AQ7A 4NK3A 3PBOA 4ESPA 1S67L 2L4RA 1DP6A 2OWJA 3CJMA 1VHMA 4X68A 1VETB 3BY8A 4ETZA 3IH8A 4WZ5C 1LI9A 1FCNA 1NYYA 4UQIM 1XGIA 2PD8A 3L7HA 4R38A 1NRJA 2ZC6B 3BLSA 3BWLA 4DE0A 2ZL1B 4KG6A 4GHIB 4UEYA 4P0MA 1J9MA 2EXAA 3C7VA 3BRMA 1NRFA 4ZJ1A 3FPWA 3MF0A 3BJNA 1UGUA 2OSUA 1G6AA 3PHYA 2GNXA 3R7WA 1K54C 4BD1A 4O0PA 2VKSA 3LR3A 3IX8A 3ZQ5A 5A93A 1PFLA 1ERQA 1VEUA 5FI6A 4BL3A 2V20A 1IYPA 1MXOA 4DE1A 4I5SA 2Z2MB 3NJAA 1K57C 4NETA 5U47A 5FASA 4PKYA 3F1OA 3CPTB 1MPLA 1GHIA 1GSXA 5HWVA 3EQVA 2J3TD 3IXHA 4DJ2A 4EV4A 5FEFA 3VSKA 3LIAA 4IVIA 3C30A 1E3UD 1IKIA 3Q81A 3OOVA 1HTZA 3A3IA 3OPLA 1ERMA 5FAQA 5EFWA
chains in the Genus database with same CATH topology
3IX3A 5L07A 5L10A 4LGWA 1L3LA 3QP4A 3QP6A 4Y13A 2Q0OA 2AVXA 4Y15A 3QP2A 4Y17A 5L09A 3IX8A 2UV0E 3IX4A 3QP5A 1H0MA 4LFUA 3JPUA 3QP8A 3QP1A 3SZTA 4NG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IX3 A;  5L07 A;  5L10 A;  4LGW A;  1L3L A;  3QP4 A;  3QP6 A;  4Y13 A;  2Q0O A;  2AVX A;  4Y15 A;  3QP2 A;  4Y17 A;  5L09 A;  3IX8 A;  2UV0 E;  3IX4 A;  3QP5 A;  1H0M A;  4LFU A;  3JPU A;  3QP8 A;  3QP1 A;  3SZT A;  4NG2 A; 
#chains in the Genus database with same CATH topology
 2Y8H A;  3P7N A;  3UDI A;  4S2O A;  3IWI A;  5HPI A;  4GDN A;  3FZC A;  3ZNT A;  4PM5 A;  3BYD A;  1MY8 A;  2YKH A;  1YLY A;  5E43 A;  3V5M A;  1OTA A;  2HGV A;  1NYM A;  3DTI A;  1U60 A;  3LEQ A;  1SDN A;  3ZG9 B;  4OPR A;  2VGL S;  5EPH A;  2Y2G A;  1BLP A;  3GSG A;  1N9O A;  1SDE A;  2I72 A;  1DY6 A;  3B33 A;  1NY0 A;  3C8C A;  5JYP A;  4PM7 A;  5D3O A;  1TDL A;  4QHC A;  1GSV A;  3CWF A;  4OPZ A;  4WMC A;  1QME A;  3PBS A;  1STZ A;  5DTS A;  3S4X A;  2Q9M A;  3NOU C;  1W63 Q;  2AVX A;  2Y2I A;  1K6S A;  3WS2 A;  3PBN A;  4NXB A;  5TFQ A;  2O99 A;  4O7D A;  2FZ0 A;  4IBX A;  2E8J A;  3CG5 A;  3VE3 A;  1YMS A;  3BEB A;  3VSL A;  3UB8 A;  2VK3 A;  4S2K A;  4MCW A;  3A0S A;  2PU2 A;  2PBY A;  4K0X A;  4HH2 A;  4Y13 A;  5HAQ A;  4WEJ A;  3LIB A;  4Y0T A;  4EUV A;  2IWD A;  3BFE A;  2WUQ A;  4MBH A;  4GW9 A;  4UA6 A;  4OQI A;  5DKL A;  4WEK A;  3WWX A;  4NG2 A;  3N8S A;  2XF3 A;  2XEP A;  2M7U A;  1F2K A;  2KX6 A;  5KZH A;  3HUO A;  3VP4 A;  5EUA A;  5KSH A;  2HDU A;  3BY9 A;  2R9X A;  4MEZ A;  2ACG A;  3KSI A;  4LFU A;  3ULF A;  4CLC E;  5KIZ A;  3A3D A;  3G35 A;  5IHV A;  1ES5 A;  3W4Q A;  3ZFZ A;  1I5Q A;  3GEC A;  2W1T A;  4KEN B;  3G2Z A;  1NZO A;  4BWI A;  2LB5 A;  3DWK A;  4OON A;  2Y4A A;  3GDI A;  4AFI A;  1PI4 A;  2ZC3 B;  5DTT A;  1NXY A;  3NOP C;  3FV7 A;  3FWL A;  1PIO A;  1UWN X;  2PYR A;  1ESI A;  4HI4 A;  4OP8 A;  1E4D A;  2HZ5 A;  5FQK A;  4DXB A;  2B18 A;  2X01 A;  3QP6 A;  4QD4 A;  5HDD A;  4QWO A;  3OZH A;  1OTE A;  3MXR A;  2EWW A;  2HV1 A;  4R3A A;  3KO6 A;  1RCJ A;  3WS5 A;  5GHX A;  4DF6 A;  1YKD A;  1FR6 A;  1W63 M;  1FOF A;  1PRQ A;  4XUX A;  1PYY A;  3U2A A;  3ZHH A;  4E3O A;  2KLI A;  1KVL A;  4LV0 A;  2Z6D A;  2WKR A;  3O5Y A;  4GZB A;  4PPR A;  3D72 A;  3PTE A;  3KSH A;  3OPH A;  2J3T C;  3CI6 A;  4Y0O A;  1H8Y A;  4JXS A;  3JYI A;  4P6B A;  3B47 A;  3VE4 A;  4JGQ A;  3VV4 A;  4WLA A;  1BSG A;  2HDS A;  1CEG A;  3GMW A;  1T1C A;  2YKF A;  3LY3 A;  3VP1 A;  3CMZ A;  3TG9 A;  4HNB A;  1JWP A;  4QY6 A;  3H9W A;  1KE4 A;  1J3W A;  1PWC A;  1H8Z A;  2XFS A;  3SH9 A;  4E3N A;  3RXX A;  1G28 A;  1T1A A;  2VX8 A;  3QP8 A;  5DF9 A;  2PBD P;  2VZW A;  3CUE C;  2J9P A;  4OH0 A;  3AGD A;  1BYW A;  2PAV P;  4MBK A;  4MMN A;  4U0T A;  2W27 A;  2Y2L A;  4KZ8 A;  1TDG A;  3ZCZ A;  5F82 A;  2ZD8 A;  3N6I A;  1XKZ A;  2V8F A;  4EQI A;  4B4X A;  4MBF A;  5EE8 A;  3UDF A;  4EES A;  5CGX A;  5F1F A;  5CXW A;  4Q0H A;  3DBA A;  3WRZ A;  2UV0 E;  3BLM A;  3I7J A;  4LRY C;  1EWZ A;  3U4L P;  1BZA A;  3QHY A;  4ARZ A;  5DJU A;  3VP0 A;  3LGO A;  2WAF A;  4HEF A;  2V1B A;  4LLO B;  4WBG A;  1N9N A;  3G2Y A;  4EUZ A;  4L9G A;  2JKF A;  1XA1 A;  2JE5 A;  4WMC D;  5HPF A;  1YSQ A;  3TRC A;  3LUQ A;  3LEZ A;  4CLC B;  3MZE A;  1ESU A;  4BBT A;  3NBL A;  3S7P A;  5DTK A;  1JVJ A;  1MWR A;  1K55 C;  1W79 A;  4HJ4 A;  4GLQ A;  2QYB A;  3CIT A;  3MBZ A;  4FUW A;  4QJG A;  1PWD A;  4UAA A;  3OCN A;  1XP4 A;  3UB6 A;  3UPO A;  3UDX A;  3JVV A;  1CEF A;  4B88 A;  4G3W A;  3FG8 A;  2VLG A;  1JNU A;  1KVM A;  2Y2J A;  2FH5 A;  2IWC A;  2W3H A;  3MZF A;  3PR6 A;  3MS6 A;  1XJ3 A;  3FC7 A;  5AJG A;  4S2I A;  4L0L A;  1E25 A;  1MWT A;  5FQM A;  4HH3 A;  3QP4 A;  1WYC A;  4HHD A;  2ZMA A;  2WKE A;  3GRJ A;  2VGL M;  2Z2L B;  3DWZ A;  5M19 A;  1LSV A;  3M2J A;  3IHB A;  5EM1 A;  4X56 A;  5F5Y A;  1XJ2 A;  3PYP A;  3T4J A;  1ZHH B;  4LPZ A;  3HUN A;  4MN6 A;  2ZM0 A;  1IYQ A;  1ES4 A;  1XFQ A;  5FAP A;  4PM6 A;  5HDS A;  4OPY A;  2WGW B;  3O86 A;  4HY8 A;  2XD1 A;  4O01 A;  2G7U A;  3IH9 A;  4ZDX A;  2VJW A;  4PHT A;  1P9R A;  4OKP A;  2A49 A;  3M6B A;  1XX2 A;  1GHP A;  2DCF A;  3WS0 A;  2Q0O A;  1CF0 A;  4OOM A;  4NEE D;  4JGO A;  4OOY A;  2ZL1 A;  1M6K A;  3P09 A;  4Y0U A;  4E3I A;  2WKP A;  3T1X A;  1Z09 A;  1I2S A;  2JBF A;  3CLO A;  3RJU A;  3TSG A;  3ZG5 A;  2D01 A;  1Z6F A;  1I2W A;  4IHQ A;  2XRO A;  4E3J A;  1DRM A;  4E6W A;  2K7S A;  1S0W A;  1IEM A;  4KZ7 A;  3EWK A;  4IUH A;  5CEC A;  1TS0 A;  3G6O A;  4DRT A;  1GA0 A;  3ITA A;  3QP5 A;  4X55 A;  1YQS A;  4LRZ E;  1BLS A;  4EEP A;  4HJ3 A;  3ZG8 B;  1O07 A;  4ETX A;  2J3W A;  4MNR A;  1GSW A;  2JCH A;  5CTM A;  4GKU A;  3S7O A;  4A5R A;  3IS2 B;  4NXG A;  3IBR A;  4I3I A;  3M6H A;  4KZ3 A;  3LI9 A;  4EBN A;  1LLB A;  4E3L A;  5J4E A;  3CPT A;  1BTL A;  2QWS A;  1IYS A;  4WL9 A;  4F3L B;  2VA0 A;  2KOI A;  2V0U A;  3MQ0 A;  4KZ6 A;  3F1P B;  3SOI A;  3NI9 A;  5I5L A;  3OBF A;  3V50 A;  3FYZ A;  4S2N A;  3VMA A;  2WAD A;  4JF5 A;  1NZU A;  3BQA A;  3ISG A;  3GV9 A;  3NDG A;  5EOO A;  3T4L A;  5A90 A;  5EM0 A;  5EVI A;  5FQJ A;  3BFD A;  2C5W B;  3IXG A;  4GS9 B;  3NDE A;  3OC2 A;  1MKI A;  3IXB A;  2ZJ9 A;  3IHA A;  1ONH A;  4Q0J A;  1TD5 A;  2H10 A;  2FFY A;  5CRF A;  1WYB A;  2V1Z A;  4BMW A;  3SH8 A;  4BD0 A;  4N92 A;  3A3J A;  2VV7 A;  4FD8 A;  2XQZ A;  2J9O A;  3KYZ A;  5EEC A;  2JKR M;  3MQQ A;  3UPN A;  3H7W B;  3UME A;  4GB7 A;  4FSF A;  1LT0 A;  2P74 A;  4G3V A;  2V2F F;  1K25 A;  1JTD A;  3PBQ A;  5KSC A;  2QPN A;  4IJG A;  5EVI B;  3IF6 A;  1IOU A;  1CI8 A;  1S1Z A;  2NUT C;  4ZJ2 A;  3O3V A;  3HRE A;  2IWB A;  2HF6 A;  3ZYT A;  5FI7 A;  3T4Q A;  3H82 B;  1K56 D;  3Q1F A;  2ZLY A;  2INW A;  5HZH A;  2ZC7 A;  3CAX A;  4FCF A;  1N9B A;  2XLN A;  4OLG A;  3G32 A;  4UA7 A;  3S7Q A;  1CQA A;  4R4S A;  1FSW A;  4GDB A;  4DXC A;  2XRN A;  1WE4 A;  3IF6 B;  3UY6 A;  4Y5F A;  1T19 A;  3C38 A;  4DDS A;  3HLG A;  3K3C A;  1FIL A;  2A24 B;  1RP5 A;  3C7U A;  1KGE A;  2JKR I;  4S2M A;  4E6X A;  1FSY A;  3CZD A;  2RCX A;  3O88 A;  4ZRR A;  1IFQ A;  1W5D A;  4PM9 A;  3UE0 A;  3FKV A;  1DP9 A;  4EQ1 A;  3UMD A;  2XA7 S;  5HL1 A;  3KYE A;  3N8R A;  3NOT C;  5JYO A;  4DMZ A;  3EOI A;  4R1G A;  3Q07 A;  4ME4 A;  4LRX C;  2PT7 A;  5DVA A;  4Q8I A;  4M4X A;  2XR0 A;  4YIN A;  1LL5 A;  5CED A;  2HDQ A;  2P9V A;  2FFF B;  5TBM A;  2Z6C A;  4Y3I A;  3UB9 A;  3BFG A;  3NUL A;  2O0Y A;  4FTX A;  3S1Y A;  4I38 A;  3CHW P;  2Y2H A;  4QY5 A;  3UB7 A;  5EV0 A;  4KQD A;  1RGY A;  1VQQ A;  4LGW A;  4HQA A;  1XA7 A;  2W1R A;  4RA7 A;  1KGF A;  5DFY A;  3VP2 A;  2Y55 A;  5E2F A;  2OLU A;  3DTK A;  1BUL A;  4Q0I A;  3C4O A;  3C5A A;  3MKF A;  2ZBB A;  5FI2 A;  3MJQ A;  3SS4 A;  1TS6 A;  3O87 A;  5GHY A;  2A2L A;  2P9V B;  2VGJ A;  4EWF A;  5TBM B;  2QJ7 A;  1OJ5 A;  1S4R A;  1TF1 A;  3RXW A;  3S22 A;  2C6W B;  4QU3 A;  3NCK A;  4O8G A;  1MWU A;  3T4T A;  2W3E A;  5GLA A;  1YLP A;  4C6Y A;  3B3X A;  2J80 A;  2EFU A;  2OOL A;  5HX9 A;  2JN7 A;  4OOL A;  3KX0 X;  4P6Z S;  2W0N A;  4HBU A;  3SS3 A;  4EET B;  3F1N A;  3MXS A;  2H5S A;  3QP1 A;  3D3O A;  1YLT A;  1TVF A;  4G3K A;  4MDZ A;  1TEM A;  2ZQA A;  2VV8 A;  4X53 A;  3ZGA B;  1GCE A;  2EX8 A;  4ZJ3 A;  2HP9 A;  3A0R A;  3T1Q B;  3ZG7 B;  1MZU A;  3A3E A;  4PM8 A;  1OTI A;  2W3F A;  1H5X A;  1JTG A;  2GX5 A;  4MN7 A;  5HSQ A;  2DMW A;  4EEU A;  1Y4O A;  3PBR A;  3A3F A;  1ZG6 A;  5F6A A;  5M1A A;  4H8R A;  3TOI A;  1LL8 A;  4I39 A;  1JWV A;  3TJZ C;  3N4I A;  3N8L A;  2VGK A;  1W8Q A;  3GVB A;  4X25 A;  4GD8 A;  3F1N B;  2G2U A;  4R0Q A;  1UWP X;  4CLC A;  4BQM A;  2B5R A;  3K3D A;  3A0V A;  2WAE A;  3RH8 B;  3IBJ A;  5C5K A;  4RYE A;  4WF0 A;  1XXM A;  2LB9 A;  4OPQ A;  5DFX A;  2BG1 A;  2B95 A;  2BTF P;  3G34 A;  2PYP A;  5FAO A;  5CGW A;  4EW7 A;  4B9O A;  4S2J A;  3T1S A;  3UN7 A;  3RFB A;  3UE1 A;  3HUM A;  5MC7 A;  1AXB A;  1OTB A;  1GHM A;  2XK1 A;  4RVA A;  3T50 A;  3FPV A;  1P0Z A;  2WKH A;  3MFD A;  2IA2 A;  4R70 A;  4DE3 A;  5CX7 A;  2Y79 A;  2Y2N A;  2GZA A;  3W8K A;  4KQO A;  5L09 A;  3R4K A;  1K6R A;  4EBL A;  1YMX A;  4CPK A;  4LV2 A;  5A8B A;  3MSH A;  2ZM8 A;  2MJ6 A;  2EFX A;  1HVB A;  3W4O A;  5DF7 A;  4X69 A;  4BL2 A;  3TW8 A;  4I3A A;  1DJC A;  2HP5 A;  4BBV A;  2ZOH A;  3BQ8 A;  2Y91 A;  1PI5 A;  5DF8 A;  1DJB A;  1FCO A;  1L0G A;  3T4K A;  1O7E A;  1H3Q A;  1S4S A;  3BW6 A;  4D2O A;  2WGW A;  3QNC A;  5F68 A;  4N9L A;  4EER A;  3P01 A;  3E0Y A;  4ZAM A;  3EQU A;  2H0Y A;  1L3L A;  4HP4 A;  5CHU A;  3E2K A;  1F9I A;  1YLZ A;  1K0K A;  4HBT A;  4OQH A;  4YFM A;  1V9Y A;  4N1X A;  3IQA A;  5FDH A;  1ES3 A;  2O9A A;  3LIE A;  4EXO A;  2ZQ9 A;  3MMH A;  3ZVW A;  3GR2 A;  2HP6 A;  2W3D A;  4GD6 A;  5GHZ A;  3MFX A;  1YM1 A;  4JF4 A;  2WZX A;  3HLE A;  4X6T A;  4JBF A;  5FQ9 A;  1KE0 A;  1XJ4 A;  2H0T A;  3JVU A;  3L9K A;  5J8X A;  1T1B A;  3W2Z A;  2WGI A;  3V39 A;  1M40 A;  3C4P A;  3GTC A;  3C2W A;  5L07 A;  1S66 L;  5F69 A;  4DDY A;  3N7W A;  2EXB A;  1A0K A;  2PHY A;  1LSW A;  4C3Q A;  2XDM A;  4S2N C;  3IS2 A;  4Y17 A;  2XA7 M;  1SKO A;  1XGJ A;  4F94 A;  1LI0 A;  1S6R A;  2A3U A;  5FDS A;  3W4P A;  2P08 A;  4GNU A;  1G5U A;  4RX2 A;  5TR7 A;  2OV5 A;  4WEL A;  1F5M A;  4HIA A;  3NEC A;  2XFT A;  4F3L A;  5FAT A;  3SH7 A;  3D4F A;  3AGF A;  5J3W A;  1XJ6 A;  3F1P A;  1HD8 A;  3DW0 A;  2PR6 A;  2M7V A;  2Y2M A;  3EGD C;  3E2L A;  4FH2 A;  2KDK A;  5A92 A;  2WGV A;  3BFF A;  4UHU A;  2QMI A;  4DE2 A;  1ERO A;  1BT5 A;  1YT4 A;  5EOE A;  3E4O A;  4KZB A;  3NIA A;  4II7 A;  4D60 A;  1K38 A;  4GS9 A;  2EX2 A;  4KUK A;  4X1L A;  3RTY A;  1SKO B;  3QP2 A;  4P87 A;  1MWS A;  3E4P A;  1KGG A;  5CHM A;  3UE6 A;  5AQB A;  3IF6 C;  1L0D A;  5FEG A;  3LFV A;  4U0X A;  3UO9 A;  4OVD A;  5IU1 A;  3T4O A;  3NY4 A;  1L0F A;  1ACF A;  3H7W A;  4Y15 A;  5BOH A;  5HD5 A;  3HLC A;  5I94 A;  4I3J A;  3HVF A;  2K2N A;  2JHE A;  1H0M A;  1Q2Q A;  3P98 A;  2ZQ7 A;  4XT2 A;  1G6O A;  3SS5 A;  3LR4 A;  2JC7 A;  2ZMF A;  5HWT A;  1EW0 A;  4CLC D;  2Y59 A;  2JKT I;  4R4R A;  5G4Y A;  4JXG A;  4H6J A;  1BLC A;  1OT6 A;  2O9C A;  2OWH A;  5AQA A;  2I9V A;  3DTM A;  3H82 A;  2D02 A;  3HJK A;  1RGZ A;  4QB8 A;  3WS4 A;  4KZA A;  4P6Z M;  5HWW A;  5GLD A;  3T4S A;  1LHY A;  1YLJ A;  1X0O A;  1NJ4 A;  1NWZ A;  4Z1W A;  5HAR A;  5GLB A;  1YAX A;  2X71 A;  4XT2 B;  1FIK A;  4PAU A;  3MQO A;  4WZ5 A;  5DJT A;  2HJ9 C;  4YWZ A;  4UA9 A;  3R7W B;  4CJN A;  4MN5 A;  4RQ9 A;  5TJJ A;  4JLF A;  3M2K A;  3ZNY A;  4H6J B;  4IVK A;  1KDW A;  1N4O A;  2A24 A;  4WN5 A;  1VEU B;  3LYX A;  1OT9 A;  1F98 A;  1OME A;  2EX9 A;  1DJA A;  3PBT A;  2HPB A;  2X02 A;  3HJI A;  3OPP A;  4Y2F A;  5E2H A;  3OLO A;  1PZO A;  5AVE A;  1ZG4 A;  3F1O B;  1K54 A;  2QKP A;  3OCL A;  1TS7 A;  1PW1 A;  5CGS A;  3IX4 A;  2ZMV A;  3UE3 A;  1NLY A;  3MKE A;  3IF5 A;  1QMF A;  4KZ4 A;  1K57 A;  4LCL A;  3LIF A;  3Q7V A;  2OAQ 1;  1H8M A;  1CJF A;  1VB6 A;  3V67 A;  4K08 A;  2L1M A;  3IWO A;  3PXP A;  4JXV A;  1HZO A;  4IBR A;  4E04 A;  1DP8 A;  1MC0 A;  3LIC A;  4GJ4 A;  1P9W A;  1OPX A;  2PRF A;  4WM9 A;  1V9Z A;  4YNR A;  5TGF A;  3T12 B;  1N9L A;  4KQR A;  5FL3 A;  5G4Z A;  5HFO A;  2ZQ8 A;  4GOG A;  1GA9 A;  3GQZ A;  1KDS A;  3KYQ A;  3PAG A;  4L9E A;  5FQQ A;  5L8M A;  5DKK A;  4KG5 A;  1IKG A;  1CK3 A;  2CMN A;  3LCE A;  1ZTU A;  3Q7V B;  4LEN A;  1OTD A;  2ZQD A;  2QZ6 A;  2JKG A;  2J8Y A;  1YLW A;  1ZC2 A;  3LY4 A;  1T18 A;  3WRT A;  3VOY A;  2BAS A;  2HDR A;  2PDR A;  3LR0 A;  3T1R A;  5IT5 A;  4EU0 A;  2WKI A;  3D9Y A;  4PKY G;  4R6L A;  2O9B A;  2ZM2 A;  4JKT A;  2Y2K A;  5HW3 A;  4R3J A;  4M3K A;  1G68 A;  2DRW A;  5M18 A;  1VM1 A;  4KZ9 A;  4IUK A;  1WA9 A;  5E2G A;  3VOL A;  4R3B A;  2L0W A;  4UQI S;  5F83 A;  3G31 A;  3HL9 A;  3IWQ A;  1KE3 A;  3NC8 A;  1P97 A;  5FQI A;  2V1A A;  3G30 A;  3MZD A;  4WZ4 A;  1XFN A;  4P85 A;  3EGX C;  2K31 A;  4XXR A;  3UNW A;  1PW8 A;  4OQ0 A;  3HCY A;  4NXF A;  4K91 A;  5A91 A;  2R78 A;  4WYY A;  2H28 A;  1D1J A;  4BBU A;  4E3M A;  4CLC C;  4ID4 A;  4DKI A;  4S2L A;  4BJP A;  3HLD A;  4DJ3 A;  1SHV A;  2EA9 A;  2WKQ A;  1Q2P A;  2OAP 1;  5L2F A;  4RX3 A;  4B93 A;  2VEA A;  5EVI D;  3PAE A;  4DN0 A;  2R9W A;  4KQQ A;  3LR5 A;  2W1T B;  1HLU P;  4CQH A;  3IT9 A;  4HES A;  1L2S A;  2EWV A;  3ZDJ A;  4BLM A;  3UPP A;  2V0W A;  4Y7P A;  5LBR A;  5IS1 A;  3HLW A;  3SZT A;  4ZTK A;  3DTE A;  5GL9 A;  2Y2Q A;  4R23 A;  1ODV A;  5CTN A;  3VOZ A;  4JPM A;  1ES2 A;  4N1H A;  2RL3 A;  3ICY A;  1YSP A;  3S7N A;  5FSR A;  4MLL A;  1YPR A;  4QPR A;  1PNE A;  1W7F A;  1BUE A;  1AWI A;  3EEH A;  1OJG A;  1C3B A;  3LI8 A;  4KUO A;  4OLD A;  1D06 A;  4HOI A;  3TE8 A;  3G4P A;  1SCW A;  2OLV A;  2CC1 A;  2V9A A;  1EI5 A;  5CEB A;  4EBP A;  1LL9 A;  5KMW A;  4ZBE A;  3ZG0 A;  3IXD A;  1ALQ A;  4X1M A;  1L0E A;  3KSG A;  2HJE A;  5CER A;  1SKF A;  2QHK A;  3UB5 P;  3AGE A;  1D7E A;  3V3S A;  4FH4 A;  3ZVT A;  1XPB A;  2WK0 A;  1ZKJ A;  3LO7 A;  1S1Y A;  2PU4 A;  3Q7Z A;  2GJ3 A;  2VV6 A;  4JF6 A;  3JPU A;  3QNB A;  2WYX A;  2XD5 A;  5HAP A;  2P7J A;  3HLB A;  2WZZ A;  1JWZ A;  1E3U A;  3MR0 A;  5F1G A;  4N9K A;  2M1C A;  2B02 A;  4HP9 A;  1W8Y A;  5GLC A;  5EVE A;  2ZC4 B;  4HJ6 A;  2ZC5 B;  2ZQC A;  3K2N A;  5AVF A;  4XUZ A;  3EEA A;  2XGN A;  1IEL A;  4PMA A;  1ONG A;  4YOF A;  1K56 A;  4WUJ A;  3DAV A;  4LCM A;  3CUE A;  4B4Z A;  2PR5 A;  5E2E A;  3ITB A;  1BLH A;  1FCM A;  1KOU A;  4KZ5 A;  3E4Q A;  1K4F A;  4ARZ B;  4IED A;  3VFF A;  3LID A;  4K0W A;  3VP3 A;  4E3K A;  3IX3 A;  3FKW A;  5L10 A;  3HLF A;  3KSF A;  2QJ5 A;  2Y2O A;  5CHJ A;  5HD3 A;  4KG2 A;  1CI9 A;  1MBL A;  1IYO A;  1Y28 A;  5FA7 A;  3BFC A;  3MXQ A;  4GCZ A;  4L9F A;  5HL6 A;  1PWG A;  4S2P A;  2J7V A;  2P04 A;  2PD7 A;  2W3G A;  4OP5 A;  4FOF A;  2DNS A;  4C75 A;  1FQG A;  1NLZ A;  1MKM A;  2G2W A;  3BEC A;  1LSX A;  2BLS A;  1SZV A;  4GN2 A;  3BM6 A;  1PZP A;  4JGP A;  4NXE A;  1VET A;  4U3T A;  4JGR A;  2ZOI A;  2EX6 A;  3Q82 A;  5HAI A;  3HBR A;  5J7E A;  2JKT M;  2Y2P A;  4LV1 A;  3OPR A;  5EVI C;  1K55 A;  4NKP A;  3V3R A;  3B42 A;  3WS1 A;  5K5B A;  4JXW A;  5AQ9 A;  3E98 A;  5G18 A;  2Q9N A;  3NHQ A;  1FR1 A;  3VFH A;  5EVL A;  4BEN A;  2V8C A;  1K4E A;  4OQG A;  2UWX A;  1TS8 A;  4GHI A;  4LV3 A;  4Z9Q A;  2NUP C;  5HDC A;  2GDN A;  2E8I A;  3SW1 A;  1Y54 A;  2XSS A;  2XH9 A;  5AQ7 A;  4NK3 A;  3PBO A;  4ESP A;  1S67 L;  2L4R A;  1DP6 A;  2OWJ A;  3CJM A;  1VHM A;  4X68 A;  1VET B;  3BY8 A;  4ETZ A;  3IH8 A;  4WZ5 C;  1LI9 A;  1FCN A;  1NYY A;  4UQI M;  1XGI A;  2PD8 A;  3L7H A;  4R38 A;  1NRJ A;  2ZC6 B;  3BLS A;  3BWL A;  4DE0 A;  2ZL1 B;  4KG6 A;  4GHI B;  4UEY A;  4P0M A;  1J9M A;  2EXA A;  3C7V A;  3BRM A;  1NRF A;  4ZJ1 A;  3FPW A;  3MF0 A;  3BJN A;  1UGU A;  2OSU A;  1G6A A;  3PHY A;  2GNX A;  3R7W A;  1K54 C;  4BD1 A;  4O0P A;  2VKS A;  3LR3 A;  3IX8 A;  3ZQ5 A;  5A93 A;  1PFL A;  1ERQ A;  1VEU A;  5FI6 A;  4BL3 A;  2V20 A;  1IYP A;  1MXO A;  4DE1 A;  4I5S A;  2Z2M B;  3NJA A;  1K57 C;  4NET A;  5U47 A;  5FAS A;  4PKY A;  3F1O A;  3CPT B;  1MPL A;  1GHI A;  1GSX A;  5HWV A;  3EQV A;  2J3T D;  3IXH A;  4DJ2 A;  4EV4 A;  5FEF A;  3VSK A;  3LIA A;  4IVI A;  3C30 A;  1E3U D;  1IKI A;  3Q81 A;  3OOV A;  1HTZ A;  3A3I A;  3OPL A;  1ERM A;  5FAQ A;  5EFW A; 
#chains in the Genus database with same CATH homology
 3IX3 A;  5L07 A;  5L10 A;  4LGW A;  1L3L A;  3QP4 A;  3QP6 A;  4Y13 A;  2Q0O A;  2AVX A;  4Y15 A;  3QP2 A;  4Y17 A;  5L09 A;  3IX8 A;  2UV0 E;  3IX4 A;  3QP5 A;  1H0M A;  4LFU A;  3JPU A;  3QP8 A;  3QP1 A;  3SZT A;  4NG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...