2AVXA

Solution structure of e coli sdia1-171
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
171
structure length
171
Chain Sequence
MSDKDFFSWRRTMLLRFQRMETAEEVYHEIELQAQQLEYDYYSLCVRHPVPFTRPKVAFYTNYPEAWVSYYQAKNFLAIDPVLNPENFSQGHLMWNDDLFSEAQPLWEAARAHGLRRGVTQYLMLPERALGFLSFSRCSAREIPILSDELQLKMQLLVRESLMALMRLNDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Regulatory protein sdiA
publication title Structure of the Escherichia coli quorum sensing protein SdiA: activation of the folding switch by acyl homoserine lactones.
pubmed doi rcsb
source organism Escherichia coli
total genus 49
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2005-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03472 Autoind_bind Autoinducer binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.80 Alpha Beta 2-Layer Sandwich Beta-Lactamase Transcription factor LuxR-like, autoinducer-binding domain 2avxA00
4Y17A 4Y13A 3QP8A 4LFUA 4Y15A 2Q0OA 1H0MA 3IX3A 3IX4A 3QP4A 4LGWA 1L3LA 3QP5A 3SZTA 3QP6A 2UV0E 3IX8A 4NG2A 3QP2A 5L09A 5L07A 3QP1A 5L10A 2AVXA 3JPUA
chains in the Genus database with same CATH superfamily
3ITAA 1CK3A 1IYPA 4G3VA 3M6HA 4B4XA 2CMNA 4BENA 5I94A 3LI9A 4II7A 5I5LA 3MFDA 5GHZA 3CPTA 1MPLA 5L2FA 4JF5A 5GLDA 4H6JB 1F98A 3OBFA 4X69A 1PW1A 3BFDA 2IWDA 3MJQA 4HBTA 2Q9MA 3FG8A 4B93A 1TS0A 4M4XA 4OONA 2Q9NA 2XLNA 1J3WA 2PRFA 3V3SA 4DKIA 1VM1A 3D4FA 3TRCA 5J4EA 3CITA 1N9LA 1OMEA 5TJJA 4EXOA 4Y0OA 2HV1A 5IS1A 2WKRA 1IYQA 4ZAMA 2H0YA 3T1RA 1SKOB 5FQ9A 3MFXA 1TS8A 3SH7A 3WS1A 1VEUB 1K54C 1Y54A 4U0XA 4B9OA 5FATA 3UPNA 2G7UA 4WN5A 2Z6CA 3SZTA 5J7EA 1KDSA 3LICA 2PD8A 4KZ6A 1NZOA 2PR6A 3MKEA 4HIAA 1EI5A 2VJWA 4FTXA 2NUTC 1I5QA 3VP2A 4MBHA 4MN6A 2PYPA 3ZGAB 2P04A 1TEMA 2WZXA 5G4YA 4QU3A 4HQAA 5EM0A 4Y0TA 5FAQA 3BECA 4KG6A 2GZAA 4LV0A 2Y2OA 4OPYA 4ETXA 4PPRA 4Y5FA 4IJGA 1I2WA 2EX2A 5F6AA 4GD8A 1XFNA 4FSFA 3QP5A 2Y2HA 4Z9QA 3Q7VB 1CI8A 5G4ZA 3ZQ5A 3HBRA 3HCYA 3PBRA 2O9AA 1FSWA 3Q1FA 3OOVA 4EUZA 3Q07A 5KIZA 4E04A 4O8GA 3LR4A 4FH2A 3LIFA 4S2MA 3VP3A 3V39A 4DE1A 3IS2B 4XUXA 3HLWA 4JXSA 3G32A 2ZM8A 4OQHA 3QP6A 3A3FA 2M7VA 3UPOA 2HP6A 2ZQAA 3G35A 4DE3A 5DFYA 3G4PA 4EQIA 1J9MA 2WZZA 4RYEA 3M6BA 3S7QA 5TFQA 3LEQA 3PAEA 1LSVA 3IX4A 4S2PA 4MLLA 4E3MA 4NKPA 1VHMA 3P7NA 4KZBA 3BEBA 3QNCA 3R7WB 3EGXC 2O9BA 3PBQA 3ZDJA 1K57A 3V5MA 1OJ5A 3UB7A 4HJ6A 4RVAA 4JF4A 3JVUA 1E3UD 1TVFA 3O88A 4HJ4A 3CLOA 1W7FA 5TBMB 1WA9A 3T12B 1ALQA 4PM6A 4FOFA 5CGXA 4CLCE 1XP4A 2PDRA 2OWHA 3B47A 3BQAA 1SDEA 4L9FA 3ICYA 4X6TA 1K6RA 4LFUA 1XPBA 2RCXA 4D2OA 1YKDA 1CJFA 3CPTB 4FUWA 3ZYTA 1BUEA 3OCNA 2VGKA 2ZBBA 4EQ1A 2QJ5A 1M6KA 2CC1A 5L07A 4OQIA 1LL9A 2WYXA 4GCZA 3FYZA 5CTNA 5FQKA 1K4FA 4E6XA 3CJMA 3IXGA 2L0WA 2ZMFA 2VGLS 3LEZA 2Y2JA 2XD1A 1XX2A 4FD8A 3NJAA 1NYYA 5AVEA 2B95A 1GHIA 3M2KA 5CGSA 5FDSA 1CQAA 1L0DA 3ZG7B 1YLWA 1PI4A 3QP1A 1MY8A 2HP9A 3ZFZA 3EQUA 1EROA 3W4QA 2VEAA 3G30A 4JGQA 5FI6A 3CAXA 5DKKA 3NECA 4OOLA 4RQ9A 2VGJA 2YKHA 4EU0A 5JYPA 1KGGA 2J9OA 3BJNA 3FPVA 2W3GA 1W8QA 4PMAA 3IXHA 4MMNA 5HDSA 2J3TC 4HNBA 1BYWA 4IUKA 4GNUA 5HDDA 3G6OA 4BL2A 1MXOA 1JVJA 1EWZA 4MEZA 2DNSA 4C75A 3TW8A 3VFHA 4KUOA 4BBTA 4B88A 3BY8A 1PWCA 3E0YA 1YAXA 3T1XA 1ZG4A 1W63M 2P08A 3GTCA 4KG5A 3WS5A 2UV0E 1ES5A 3B42A 4I39A 1T18A 2OAQ1 3NDGA 2WKIA 5E2GA 3UNWA 2EXBA 3JPUA 3OLOA 4E3LA 4MN5A 3ZG9B 4DE0A 1S67L 3UE3A 2GDNA 4GJ4A 1BLHA 1LSWA 1GCEA 5EE8A 2Y2QA 5HPFA 2O99A 5DF8A 3IHAA 3UMEA 2R78A 4GKUA 4R3BA 4EESA 4KZ5A 4S2KA 5HDCA 4BBUA 2KOIA 4WL9A 3OPPA 4WUJA 1ACFA 4K0XA 4UAAA 2QWSA 3SH8A 3S4XA 3PBTA 3C38A 4OPZA 3MZEA 4D60A 1G6AA 1OTBA 4WYYA 2XROA 5KZHA 1K54A 5CXWA 2VV7A 5GL9A 4ZBEA 5DF7A 4HH2A 3ULFA 3CZDA 2K2NA 3K3CA 4R4SA 3LIAA 3IH9A 5HSQA 1FOFA 3RXXA 2IA2A 1PYYA 3VE3A 4HBUA 5GLBA 3P98A 3IXDA 4N92A 1PRQA 1XFQA 1H3QA 4GHIA 2JKTI 4Q0HA 4CJNA 1GA9A 1JWVA 1XJ6A 1FCNA 4X56A 2HDQA 1H0MA 1GSXA 4JGRA 4HJ3A 1UWPX 5FA7A 2W27A 4EEPA 4OH0A 2HDRA 3VOLA 3AGFA 1VB6A 3UDFA 3N8SA 4O7DA 1YM1A 3SS4A 1NLYA 3BLMA 2WGVA 4JPMA 3VMAA 2W1TA 5HWVA 3ZG8B 4XT2A 2B5RA 1K0KA 3HLCA 3LIEA 2XGNA 4WMCA 1NWZA 4G3WA 4OOYA 5EVEA 2FFFB 1ESUA 3LY4A 1QMFA 3SH9A 5EOOA 1QMEA 5A92A 2Y79A 3R4KA 5F5YA 3N6IA 5CEDA 3BFEA 2ZLYA 1YQSA 4UA9A 5J8XA 3A0RA 3T1SA 5HW3A 3L9KA 2WKPA 4LRZE 4GOGA 4CLCA 1WYBA 2D01A 4P6ZM 3VV4A 5HAPA 2A2LA 1XJ4A 4PAUA 5DTSA 5G18A 3NOUC 1JWPA 2VX8A 4YOFA 3TOIA 3T4QA 4UHUA 1ERMA 1OTDA 4U0TA 4LCLA 3WS2A 3PBNA 1MC0A 1DP9A 4YNRA 2Y4AA 5GHYA 3TSGA 5CECA 4HP4A 4LV1A 1OTIA 4EETB 1S0WA 2QYBA 2G2WA 2ZQ8A 2EX6A 2X01A 1L2SA 2XQZA 4EWFA 2EFXA 1PW8A 2KX6A 2XSSA 3ISGA 4MBKA 3LYXA 4KQQA 1DP6A 5EV0A 2V8FA 3MBZA 4R4RA 2AVXA 2HDSA 2QMIA 1BLSA 3Q82A 1UWNX 2H0TA 1G28A 2ZC7A 2KLIA 1CEFA 4YWZA 2V20A 5IHVA 4YINA 4M3KA 4R1GA 3OZHA 3ZHHA 4E3OA 4HH3A 4ID4A 4JBFA 2W0NA 1BLCA 1L0EA 2EWWA 1GSWA 3NBLA 2ZM2A 1NXYA 4QY6A 3DWKA 2GX5A 2VA0A 1F2KA 4S2JA 2WKHA 3FKWA 3GV9A 3L7HA 3MXQA 5BOHA 3M2JA 4RA7A 5U47A 1FR1A 3CWFA 4GZBA 2EA9A 5HL1A 3VOZA 3K2NA 3WRZA 3VFFA 1HD8A 3T50A 4PKYG 5CGWA 1DP8A 5AVFA 3D72A 4QY5A 2ZL1A 3OC2A 4WLAA 3LY3A 4DF6A 5E2HA 2ZOHA 3HLBA 1W5DA 4GHIB 2ZMVA 4Q0IA 2ZJ9A 3O86A 3C7VA 1TF1A 2GNXA 3WS0A 4H8RA 2PAVP 3BWLA 2EX9A 3LCEA 1S6RA 3MXRA 4DJ2A 3I7JA 4MBFA 2INWA 1HTZA 4WF0A 2VKSA 4PM9A 3T4SA 3KYZA 3HJKA 1W79A 3BLSA 1RCJA 2QZ6A 3CI6A 2W1TB 5HARA 4XT2B 1T19A 4R3AA 4O01A 5DTTA 3T1QB 5FAOA 1P0ZA 3HLEA 1SDNA 2VK3A 2Z2MB 3V3RA 1D7EA 3NC8A 1YLYA 3DTIA 4KQRA 5M1AA 3KYQA 5IT5A 4EW7A 2J7VA 4A5RA 2V1AA 3P01A 5GHXA 5L10A 2IWBA 3MQ0A 5KSCA 3BFCA 2PT7A 2FFYA 1M40A 4CLCC 4WZ4A 4LV2A 5J3WA 4P85A 2WGWA 1FCOA 4CLCB 5GLCA 5HAIA 4UQIS 1Z09A 2P9VA 3WS4A 3HUOA 4NK3A 1YLZA 5HD5A 1ZC2A 4Y0UA 1IKGA 4GDNA 1BLPA 4Y17A 3U2AA 1NY0A 3ZNTA 5CTMA 2VV8A 1N9BA 1E3UA 1H8MA 1ZG6A 4NXEA 1N4OA 2XEPA 4WEKA 4GLQA 3IWOA 1KGEA 2R9XA 4NXFA 4OPRA 5CHUA 1XA7A 3ZG5A 3VP0A 3HJIA 3E2KA 2JKRI 3HLDA 5D3OA 1IYOA 1YSPA 2PD7A 2A3UA 3KSHA 1IFQA 3QP4A 2X71A 3CUEC 2HGVA 4HEFA 2G2UA 2OSUA 3IH8A 2W1RA 5EVID 3MMHA 2ZD8A 2OLUA 1LL8A 1BT5A 4UA6A 3UE1A 4KQDA 1FCMA 1YLPA 2E8JA 1ES3A 2XD5A 1EW0A 4BL3A 4I3JA 3EEAA 1IYSA 3UN7A 1K6SA 2VLGA 2LB9A 4HHDA 5F69A 5HPIA 4KG2A 3GECA 2DMWA 4E6WA 1YSQA 3VP4A 3UB5P 3ZVWA 4MCWA 2WKQA 2B02A 4JGPA 1AWIA 1TD5A 4OLGA 1BTLA 2A24A 3PBSA 4R3JA 1PFLA 1HVBA 2I72A 5HD3A 2L1MA 5LBRA 5E2EA 2JC7A 1LSXA 2J80A 2B18A 4HOIA 5FQMA 4FCFA 3UB6A 3QP8A 1ESIA 2D02A 1FIKA 1N9NA 3IX3A 1V9ZA 2BTFP 2JKFA 3E4OA 2L4RA 3LR0A 4Y2FA 3FKVA 4EEUA 4CQHA 1PIOA 5FEGA 4RX3A 2R9WA 3MZFA 4DE2A 1PZOA 2XA7M 3ZG0A 2KDKA 3PR6A 3T4JA 3UB8A 1K25A 3DAVA 4CPKA 1Y4OA 5FSRA 3VSKA 3W4OA 3AGDA 4S2NA 5DFXA 3HUNA 2HJEA 2M7UA 4AFIA 3MQOA 4XUZA 2K7SA 3GDIA 3RH8B 4EERA 1YLTA 1NZUA 2JKRM 1FSYA 3IQAA 4QD4A 2Z6DA 5A91A 2H28A 1MWTA 3NHQA 1DJCA 3PAGA 2PU4A 2Y59A 2OV5A 2HZ5A 1IOUA 4ZRRA 5L8MA 4S2LA 4C3QA 4EBLA 4JLFA 5A90A 1D1JA 1L3LA 1BZAA 2Y91A 3K3DA 2PYRA 4MN7A 5AQBA 4LENA 5F1FA 1JNUA 4KZAA 1YLJA 3RXWA 2I9VA 3GSGA 1H5XA 2Y2LA 2WGWB 3NIAA 1VEUA 4YFMA 1RGYA 2HDUA 2OOLA 3O5YA 3C4PA 1FILA 2RL3A 4OKPA 1TS6A 4OQGA 1PI5A 4UEYA 4I3IA 4DRTA 4IBXA 3ZNYA 5CEBA 5HL6A 4WM9A 4ZJ2A 3IBJA 1RGZA 4DN0A 4LV3A 3VOYA 4E3KA 2Z2LB 2BG1A 1W63Q 4OPQA 5KSHA 3OPLA 4E3IA 3UE6A 5FAPA 4N9KA 1LL5A 3BQ8A 1TDLA 3KX0X 3A0VA 3MF0A 2VV6A 2Y2PA 5AQAA 2ZQCA 1WYCA 2QHKA 3E4PA 3MSHA 2WK0A 1LLBA 2WKEA 2BLSA 3V50A 3S7OA 3TJZC 4MDZA 1XXMA 5F68A 2H10A 3BYDA 5FASA 2WAFA 4L9EA 1ZHHB 3H82A 1STZA 1KVLA 3UB9A 5DF9A 1OTAA 4JXGA 3KSIA 3IBRA 3UDIA 3IT9A 3B33A 2WGIA 4U3TA 3HUMA 3NY4A 4WZ5A 1N9OA 3WWXA 1WE4A 4WEJA 3TE8A 2V1BA 1ZKJA 3PXPA 3RTYA 1KOUA 1L0FA 3EOIA 2ZMAA 2VZWA 4DJ3A 3LGOA 4P87A 5FQQA 1K55A 1FQGA 4KZ7A 4E3JA 4JGOA 4GS9A 5HFOA 3TG9A 5GLAA 3G2YA 5M19A 3F1NA 4HY8A 3NOPC 4I3AA 1JTGA 3LI8A 1TDGA 3SW1A 5FI2A 1K4EA 3ZCZA 3LFVA 2ZC4B 3LIDA 3IWIA 4EBPA 1RP5A 2XDMA 1K56D 3S1YA 1DJBA 1OPXA 1ONHA 5TBMA 1NJ4A 3VE4A 5AQ9A 1P9WA 4JKTA 2Y2KA 3S7NA 3BW6A 3DBAA 3CUEA 1G5UA 1ES4A 2JKTM 3PYPA 4S2NC 3F1OA 5FQIA 5HWWA 1GA0A 1KE4A 3LIBA 4ARZA 2XFSA 3IWQA 2V1ZA 5EPHA 1G68A 1S4SA 4KZ3A 2LB5A 3ITBA 3ZVTA 4ETZA 1YMSA 1PZPA 4GB7A 4I5SA 4IBRA 2W3HA 4KENB 4Q8IA 2PHYA 5K5BA 3IX8A 1Q2QA 2P7JA 3O3VA 3T4KA 1Y28A 3T4TA 1NYMA 1SHVA 2ZC6B 3T4OA 2H5SA 4K08A 4UQIM 1K38A 1ONGA 3G31A 5TR7A 3UPPA 3UE0A 1VETA 4QPRA 3C8CA 5C5KA 4JXWA 4LCMA 2YKFA 4IHQA 2V2FF 1XGIA 2E8IA 3KSGA 1IELA 1ZTUA 4EUVA 1O7EA 1JTDA 4OP8A 1IKIA 3NOTC 4FH4A 4P6ZS 4PHTA 5DKLA 4JF6A 5E2FA 1KE0A 3LR5A 1W8YA 3B3XA 5KMWA 1KVMA 1GHMA 2J3TD 1XA1A 2Y8HA 4R70A 4WBGA 5EECA 2W3DA 4Y3IA 2XH9A 1KDWA 1YT4A 3IXBA 3MZDA 2O9CA 3IF6A 5E43A 1VQQA 3E4QA 4NXBA 2JHEA 3A3DA 5A93A 4GN2A 2Y2IA 2V8CA 1Z6FA 2ZM0A 2PBDP 2VGLM 5FQJA 4GDBA 5DTKA 2QKPA 4K91A 4C6YA 3H7WA 4P6BA 4LRYC 4RX2A 1YMXA 1X0OA 2WADA 3N7WA 3MKFA 3DTKA 3CMZA 2OAP1 3H82B 2XRNA 3C7UA 4PM5A 3C5AA 4QWOA 4ESPA 2HJ9C 3DWZA 4WZ5C 3DTMA 1PNEA 1LHYA 4N1HA 1F9IA 1BSGA 1XJ2A 3CG5A 1T1AA 1XJ3A 1KGFA 2HF6A 3O87A 1A0KA 2V0WA 1S66L 2ZOIA 3QP2A 4Z1WA 5JYOA 2QJ7A 1K55C 3OPHA 2OWJA 2XFTA 3GMWA 4XXRA 2WAEA 2Y2MA 3GVBA 4F3LA 4K0WA 4OOMA 4KUKA 4OVDA 3AGEA 1T1CA 4GS9B 3T4LA 3LO7A 3F1NB 3JYIA 3EQVA 4DXCA 3LUQA 3HVFA 1T1BA 3PBOA 1L0GA 1V9YA 2A49A 1MWRA 3F1PA 3PHYA 2P74A 2FH5A 1S1ZA 1HZOA 1CF0A 1P9RA 2JBFA 1KE3A 2Y2NA 4QB8A 1GHPA 2ZC3B 2ZC5B 4HESA 3PTEA 4IEDA 1IEMA 4B4ZA 3UMDA 1D06A 3N4IA 3NDEA 3DTEA 3WRTA 1PWGA 3C2WA 4LLOB 1S1YA 2HPBA 3NI9A 3VSLA 4EBNA 4ZJ1A 4ZTKA 5F83A 3QHYA 1JWZA 5EVIA 2GJ3A 1ERQA 2EXAA 4PKYA 3F1OB 4OQ0A 2V9AA 4ARZB 5HZHA 2V0UA 2XR0A 1H8YA 1OT9A 3IHBA 2PU2A 2Y2GA 5L09A 4BD0A 1S4RA 2DRWA 1ODVA 5EUAA 2PR5A 2JCHA 1DJAA 4PM8A 3FPWA 4Y15A 4L0LA 4PM7A 4Y7PA 1MWUA 4BLMA 5DVAA 3A3JA 3FC7A 4O0PA 5FEFA 4X1MA 2JN7A 4R38A 3W8KA 3LR3A 5A8BA 1VETB 5CRFA 5CX7A 3BFFA 3S22A 4DXBA 4HI4A 3MQQA 2ZL1B 4KZ9A 4DMZA 1LT0A 3OCLA 1MBLA 4X25A 1SCWA 1GSVA 1XGJA 1OT6A 2QPNA 1U60A 3FV7A 3HLGA 2JKGA 4OLDA 1MKMA 3MR0A 3S7PA 4Y13A 3IF5A 3FZCA 3IF6C 1G6OA 3W2ZA 4JXVA 3G2ZA 5FDHA 1PWDA 3IF6B 3FWLA 1NLZA 4F94A 3D3OA 1E25A 1CI9A 2NUPC 1OTEA 4LRXC 1O07A 4H6JA 2MJ6A 1LI0A 3E2LA 1H8ZA 5EM1A 3BM6A 1AXBA 3NCKA 2ZQDA 1ES2A 1E4DA 4X68A 5HWTA 1TS7A 2EX8A 3MS6A 3KYEA 4Q0JA 3W4PA 3CHWP 3C4OA 1HLUP 3H7WB 4I38A 2IWCA 4DDYA 4LGWA 1MKIA 3KSFA 3MXSA 4IUHA 1XKZA 1F5MA 3E98A 3UDXA 1MWSA 3P09A 2J8YA 1DRMA 5CHJA 5M18A 1SKOA 4BQMA 4ZDXA 4GD6A 3JVVA 4GW9A 4BBVA 1NRFA 5F82A 4E3NA 5AQ7A 2P9VB 3A3IA 3N8LA 3EGDC 4R23A 3NULA 4F3LB 1MZUA 3HREA 2W3EA 4IVIA 1NRJA 3QNBA 3BRMA 2J3WA 5DJUA 3VP1A 3HLFA 1K57C 2K31A 1OJGA 1C3BA 1SZVA 3KO6A 5IU1A 4X55A 1UGUA 2J9PA 3F1PB 5AJGA 1DY6A 4N1XA 3A3EA 3EEHA 4BWIA 2ZQ7A 4G3KA 2Y55A 1Q2PA 5EFWA 2EWVA 4S2OA 3GR2A 5EVIC 2EFUA 2DCFA 3BY9A 4KZ8A 4ME4A 5HAQA 3D9YA 5EVIB 2FZ0A 4QJGA 3V67A 2ACGA 1LI9A 4R0QA 3UO9A 3Q7VA 4LPZA 3SS5A 4UA7A 4KZ4A 5CHMA 4OP5A 2XA7S 4L9GA 3EWKA 2OLVA 2XF3A 4BJPA 4HP9A 4WMCD 4BMWA 4IVKA 4P0MA 2X02A 3GQZA 4X1LA 3SOIA 3BFGA 3HL9A 2XK1A 3IS2A 5HX9A 1YPRA 2W3FA 4BD1A 2WUQA 4NEED 1P97A 3GRJA 3C30A 3DW0A 3RFBA 2BASA 4EV4A 1CEGA 2A24B 4R6LA 4ZJ3A 3SS3A 3H9WA 5EOEA 2M1CA 4X53A 2O0YA 4KQOA 2C5WB 5FI7A 1BULA 5F1GA 2PBYA 5CERA 4CLCD 4QHCA 1FR6A 3A0SA 2C6WB 5FL3A 4MNRA 3R7WA 5EVLA 4N9LA 3U4LP 4S2IA 3Q7ZA 3OPRA 2Q0OA 3G34A 3Q81A 1I2SA 4WELA 3N8RA 2JE5A 1SKFA 2UWXA 3UY6A 5DJTA 1K56A 4NG2A 4NXGA 5MC7A 4DDSA 2ZQ9A 5TGFA 4NETA 3RJUA 2HP5A
chains in the Genus database with same CATH topology
4Y17A 4Y13A 3QP8A 4LFUA 4Y15A 2Q0OA 1H0MA 3IX3A 3IX4A 3QP4A 4LGWA 1L3LA 3QP5A 3SZTA 3QP6A 2UV0E 3IX8A 4NG2A 3QP2A 5L09A 5L07A 3QP1A 5L10A 2AVXA 3JPUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y17 A;  4Y13 A;  3QP8 A;  4LFU A;  4Y15 A;  2Q0O A;  1H0M A;  3IX3 A;  3IX4 A;  3QP4 A;  4LGW A;  1L3L A;  3QP5 A;  3SZT A;  3QP6 A;  2UV0 E;  3IX8 A;  4NG2 A;  3QP2 A;  5L09 A;  5L07 A;  3QP1 A;  5L10 A;  2AVX A;  3JPU A; 
#chains in the Genus database with same CATH topology
 3ITA A;  1CK3 A;  1IYP A;  4G3V A;  3M6H A;  4B4X A;  2CMN A;  4BEN A;  5I94 A;  3LI9 A;  4II7 A;  5I5L A;  3MFD A;  5GHZ A;  3CPT A;  1MPL A;  5L2F A;  4JF5 A;  5GLD A;  4H6J B;  1F98 A;  3OBF A;  4X69 A;  1PW1 A;  3BFD A;  2IWD A;  3MJQ A;  4HBT A;  2Q9M A;  3FG8 A;  4B93 A;  1TS0 A;  4M4X A;  4OON A;  2Q9N A;  2XLN A;  1J3W A;  2PRF A;  3V3S A;  4DKI A;  1VM1 A;  3D4F A;  3TRC A;  5J4E A;  3CIT A;  1N9L A;  1OME A;  5TJJ A;  4EXO A;  4Y0O A;  2HV1 A;  5IS1 A;  2WKR A;  1IYQ A;  4ZAM A;  2H0Y A;  3T1R A;  1SKO B;  5FQ9 A;  3MFX A;  1TS8 A;  3SH7 A;  3WS1 A;  1VEU B;  1K54 C;  1Y54 A;  4U0X A;  4B9O A;  5FAT A;  3UPN A;  2G7U A;  4WN5 A;  2Z6C A;  3SZT A;  5J7E A;  1KDS A;  3LIC A;  2PD8 A;  4KZ6 A;  1NZO A;  2PR6 A;  3MKE A;  4HIA A;  1EI5 A;  2VJW A;  4FTX A;  2NUT C;  1I5Q A;  3VP2 A;  4MBH A;  4MN6 A;  2PYP A;  3ZGA B;  2P04 A;  1TEM A;  2WZX A;  5G4Y A;  4QU3 A;  4HQA A;  5EM0 A;  4Y0T A;  5FAQ A;  3BEC A;  4KG6 A;  2GZA A;  4LV0 A;  2Y2O A;  4OPY A;  4ETX A;  4PPR A;  4Y5F A;  4IJG A;  1I2W A;  2EX2 A;  5F6A A;  4GD8 A;  1XFN A;  4FSF A;  3QP5 A;  2Y2H A;  4Z9Q A;  3Q7V B;  1CI8 A;  5G4Z A;  3ZQ5 A;  3HBR A;  3HCY A;  3PBR A;  2O9A A;  1FSW A;  3Q1F A;  3OOV A;  4EUZ A;  3Q07 A;  5KIZ A;  4E04 A;  4O8G A;  3LR4 A;  4FH2 A;  3LIF A;  4S2M A;  3VP3 A;  3V39 A;  4DE1 A;  3IS2 B;  4XUX A;  3HLW A;  4JXS A;  3G32 A;  2ZM8 A;  4OQH A;  3QP6 A;  3A3F A;  2M7V A;  3UPO A;  2HP6 A;  2ZQA A;  3G35 A;  4DE3 A;  5DFY A;  3G4P A;  4EQI A;  1J9M A;  2WZZ A;  4RYE A;  3M6B A;  3S7Q A;  5TFQ A;  3LEQ A;  3PAE A;  1LSV A;  3IX4 A;  4S2P A;  4MLL A;  4E3M A;  4NKP A;  1VHM A;  3P7N A;  4KZB A;  3BEB A;  3QNC A;  3R7W B;  3EGX C;  2O9B A;  3PBQ A;  3ZDJ A;  1K57 A;  3V5M A;  1OJ5 A;  3UB7 A;  4HJ6 A;  4RVA A;  4JF4 A;  3JVU A;  1E3U D;  1TVF A;  3O88 A;  4HJ4 A;  3CLO A;  1W7F A;  5TBM B;  1WA9 A;  3T12 B;  1ALQ A;  4PM6 A;  4FOF A;  5CGX A;  4CLC E;  1XP4 A;  2PDR A;  2OWH A;  3B47 A;  3BQA A;  1SDE A;  4L9F A;  3ICY A;  4X6T A;  1K6R A;  4LFU A;  1XPB A;  2RCX A;  4D2O A;  1YKD A;  1CJF A;  3CPT B;  4FUW A;  3ZYT A;  1BUE A;  3OCN A;  2VGK A;  2ZBB A;  4EQ1 A;  2QJ5 A;  1M6K A;  2CC1 A;  5L07 A;  4OQI A;  1LL9 A;  2WYX A;  4GCZ A;  3FYZ A;  5CTN A;  5FQK A;  1K4F A;  4E6X A;  3CJM A;  3IXG A;  2L0W A;  2ZMF A;  2VGL S;  3LEZ A;  2Y2J A;  2XD1 A;  1XX2 A;  4FD8 A;  3NJA A;  1NYY A;  5AVE A;  2B95 A;  1GHI A;  3M2K A;  5CGS A;  5FDS A;  1CQA A;  1L0D A;  3ZG7 B;  1YLW A;  1PI4 A;  3QP1 A;  1MY8 A;  2HP9 A;  3ZFZ A;  3EQU A;  1ERO A;  3W4Q A;  2VEA A;  3G30 A;  4JGQ A;  5FI6 A;  3CAX A;  5DKK A;  3NEC A;  4OOL A;  4RQ9 A;  2VGJ A;  2YKH A;  4EU0 A;  5JYP A;  1KGG A;  2J9O A;  3BJN A;  3FPV A;  2W3G A;  1W8Q A;  4PMA A;  3IXH A;  4MMN A;  5HDS A;  2J3T C;  4HNB A;  1BYW A;  4IUK A;  4GNU A;  5HDD A;  3G6O A;  4BL2 A;  1MXO A;  1JVJ A;  1EWZ A;  4MEZ A;  2DNS A;  4C75 A;  3TW8 A;  3VFH A;  4KUO A;  4BBT A;  4B88 A;  3BY8 A;  1PWC A;  3E0Y A;  1YAX A;  3T1X A;  1ZG4 A;  1W63 M;  2P08 A;  3GTC A;  4KG5 A;  3WS5 A;  2UV0 E;  1ES5 A;  3B42 A;  4I39 A;  1T18 A;  2OAQ 1;  3NDG A;  2WKI A;  5E2G A;  3UNW A;  2EXB A;  3JPU A;  3OLO A;  4E3L A;  4MN5 A;  3ZG9 B;  4DE0 A;  1S67 L;  3UE3 A;  2GDN A;  4GJ4 A;  1BLH A;  1LSW A;  1GCE A;  5EE8 A;  2Y2Q A;  5HPF A;  2O99 A;  5DF8 A;  3IHA A;  3UME A;  2R78 A;  4GKU A;  4R3B A;  4EES A;  4KZ5 A;  4S2K A;  5HDC A;  4BBU A;  2KOI A;  4WL9 A;  3OPP A;  4WUJ A;  1ACF A;  4K0X A;  4UAA A;  2QWS A;  3SH8 A;  3S4X A;  3PBT A;  3C38 A;  4OPZ A;  3MZE A;  4D60 A;  1G6A A;  1OTB A;  4WYY A;  2XRO A;  5KZH A;  1K54 A;  5CXW A;  2VV7 A;  5GL9 A;  4ZBE A;  5DF7 A;  4HH2 A;  3ULF A;  3CZD A;  2K2N A;  3K3C A;  4R4S A;  3LIA A;  3IH9 A;  5HSQ A;  1FOF A;  3RXX A;  2IA2 A;  1PYY A;  3VE3 A;  4HBU A;  5GLB A;  3P98 A;  3IXD A;  4N92 A;  1PRQ A;  1XFQ A;  1H3Q A;  4GHI A;  2JKT I;  4Q0H A;  4CJN A;  1GA9 A;  1JWV A;  1XJ6 A;  1FCN A;  4X56 A;  2HDQ A;  1H0M A;  1GSX A;  4JGR A;  4HJ3 A;  1UWP X;  5FA7 A;  2W27 A;  4EEP A;  4OH0 A;  2HDR A;  3VOL A;  3AGF A;  1VB6 A;  3UDF A;  3N8S A;  4O7D A;  1YM1 A;  3SS4 A;  1NLY A;  3BLM A;  2WGV A;  4JPM A;  3VMA A;  2W1T A;  5HWV A;  3ZG8 B;  4XT2 A;  2B5R A;  1K0K A;  3HLC A;  3LIE A;  2XGN A;  4WMC A;  1NWZ A;  4G3W A;  4OOY A;  5EVE A;  2FFF B;  1ESU A;  3LY4 A;  1QMF A;  3SH9 A;  5EOO A;  1QME A;  5A92 A;  2Y79 A;  3R4K A;  5F5Y A;  3N6I A;  5CED A;  3BFE A;  2ZLY A;  1YQS A;  4UA9 A;  5J8X A;  3A0R A;  3T1S A;  5HW3 A;  3L9K A;  2WKP A;  4LRZ E;  4GOG A;  4CLC A;  1WYB A;  2D01 A;  4P6Z M;  3VV4 A;  5HAP A;  2A2L A;  1XJ4 A;  4PAU A;  5DTS A;  5G18 A;  3NOU C;  1JWP A;  2VX8 A;  4YOF A;  3TOI A;  3T4Q A;  4UHU A;  1ERM A;  1OTD A;  4U0T A;  4LCL A;  3WS2 A;  3PBN A;  1MC0 A;  1DP9 A;  4YNR A;  2Y4A A;  5GHY A;  3TSG A;  5CEC A;  4HP4 A;  4LV1 A;  1OTI A;  4EET B;  1S0W A;  2QYB A;  2G2W A;  2ZQ8 A;  2EX6 A;  2X01 A;  1L2S A;  2XQZ A;  4EWF A;  2EFX A;  1PW8 A;  2KX6 A;  2XSS A;  3ISG A;  4MBK A;  3LYX A;  4KQQ A;  1DP6 A;  5EV0 A;  2V8F A;  3MBZ A;  4R4R A;  2AVX A;  2HDS A;  2QMI A;  1BLS A;  3Q82 A;  1UWN X;  2H0T A;  1G28 A;  2ZC7 A;  2KLI A;  1CEF A;  4YWZ A;  2V20 A;  5IHV A;  4YIN A;  4M3K A;  4R1G A;  3OZH A;  3ZHH A;  4E3O A;  4HH3 A;  4ID4 A;  4JBF A;  2W0N A;  1BLC A;  1L0E A;  2EWW A;  1GSW A;  3NBL A;  2ZM2 A;  1NXY A;  4QY6 A;  3DWK A;  2GX5 A;  2VA0 A;  1F2K A;  4S2J A;  2WKH A;  3FKW A;  3GV9 A;  3L7H A;  3MXQ A;  5BOH A;  3M2J A;  4RA7 A;  5U47 A;  1FR1 A;  3CWF A;  4GZB A;  2EA9 A;  5HL1 A;  3VOZ A;  3K2N A;  3WRZ A;  3VFF A;  1HD8 A;  3T50 A;  4PKY G;  5CGW A;  1DP8 A;  5AVF A;  3D72 A;  4QY5 A;  2ZL1 A;  3OC2 A;  4WLA A;  3LY3 A;  4DF6 A;  5E2H A;  2ZOH A;  3HLB A;  1W5D A;  4GHI B;  2ZMV A;  4Q0I A;  2ZJ9 A;  3O86 A;  3C7V A;  1TF1 A;  2GNX A;  3WS0 A;  4H8R A;  2PAV P;  3BWL A;  2EX9 A;  3LCE A;  1S6R A;  3MXR A;  4DJ2 A;  3I7J A;  4MBF A;  2INW A;  1HTZ A;  4WF0 A;  2VKS A;  4PM9 A;  3T4S A;  3KYZ A;  3HJK A;  1W79 A;  3BLS A;  1RCJ A;  2QZ6 A;  3CI6 A;  2W1T B;  5HAR A;  4XT2 B;  1T19 A;  4R3A A;  4O01 A;  5DTT A;  3T1Q B;  5FAO A;  1P0Z A;  3HLE A;  1SDN A;  2VK3 A;  2Z2M B;  3V3R A;  1D7E A;  3NC8 A;  1YLY A;  3DTI A;  4KQR A;  5M1A A;  3KYQ A;  5IT5 A;  4EW7 A;  2J7V A;  4A5R A;  2V1A A;  3P01 A;  5GHX A;  5L10 A;  2IWB A;  3MQ0 A;  5KSC A;  3BFC A;  2PT7 A;  2FFY A;  1M40 A;  4CLC C;  4WZ4 A;  4LV2 A;  5J3W A;  4P85 A;  2WGW A;  1FCO A;  4CLC B;  5GLC A;  5HAI A;  4UQI S;  1Z09 A;  2P9V A;  3WS4 A;  3HUO A;  4NK3 A;  1YLZ A;  5HD5 A;  1ZC2 A;  4Y0U A;  1IKG A;  4GDN A;  1BLP A;  4Y17 A;  3U2A A;  1NY0 A;  3ZNT A;  5CTM A;  2VV8 A;  1N9B A;  1E3U A;  1H8M A;  1ZG6 A;  4NXE A;  1N4O A;  2XEP A;  4WEK A;  4GLQ A;  3IWO A;  1KGE A;  2R9X A;  4NXF A;  4OPR A;  5CHU A;  1XA7 A;  3ZG5 A;  3VP0 A;  3HJI A;  3E2K A;  2JKR I;  3HLD A;  5D3O A;  1IYO A;  1YSP A;  2PD7 A;  2A3U A;  3KSH A;  1IFQ A;  3QP4 A;  2X71 A;  3CUE C;  2HGV A;  4HEF A;  2G2U A;  2OSU A;  3IH8 A;  2W1R A;  5EVI D;  3MMH A;  2ZD8 A;  2OLU A;  1LL8 A;  1BT5 A;  4UA6 A;  3UE1 A;  4KQD A;  1FCM A;  1YLP A;  2E8J A;  1ES3 A;  2XD5 A;  1EW0 A;  4BL3 A;  4I3J A;  3EEA A;  1IYS A;  3UN7 A;  1K6S A;  2VLG A;  2LB9 A;  4HHD A;  5F69 A;  5HPI A;  4KG2 A;  3GEC A;  2DMW A;  4E6W A;  1YSQ A;  3VP4 A;  3UB5 P;  3ZVW A;  4MCW A;  2WKQ A;  2B02 A;  4JGP A;  1AWI A;  1TD5 A;  4OLG A;  1BTL A;  2A24 A;  3PBS A;  4R3J A;  1PFL A;  1HVB A;  2I72 A;  5HD3 A;  2L1M A;  5LBR A;  5E2E A;  2JC7 A;  1LSX A;  2J80 A;  2B18 A;  4HOI A;  5FQM A;  4FCF A;  3UB6 A;  3QP8 A;  1ESI A;  2D02 A;  1FIK A;  1N9N A;  3IX3 A;  1V9Z A;  2BTF P;  2JKF A;  3E4O A;  2L4R A;  3LR0 A;  4Y2F A;  3FKV A;  4EEU A;  4CQH A;  1PIO A;  5FEG A;  4RX3 A;  2R9W A;  3MZF A;  4DE2 A;  1PZO A;  2XA7 M;  3ZG0 A;  2KDK A;  3PR6 A;  3T4J A;  3UB8 A;  1K25 A;  3DAV A;  4CPK A;  1Y4O A;  5FSR A;  3VSK A;  3W4O A;  3AGD A;  4S2N A;  5DFX A;  3HUN A;  2HJE A;  2M7U A;  4AFI A;  3MQO A;  4XUZ A;  2K7S A;  3GDI A;  3RH8 B;  4EER A;  1YLT A;  1NZU A;  2JKR M;  1FSY A;  3IQA A;  4QD4 A;  2Z6D A;  5A91 A;  2H28 A;  1MWT A;  3NHQ A;  1DJC A;  3PAG A;  2PU4 A;  2Y59 A;  2OV5 A;  2HZ5 A;  1IOU A;  4ZRR A;  5L8M A;  4S2L A;  4C3Q A;  4EBL A;  4JLF A;  5A90 A;  1D1J A;  1L3L A;  1BZA A;  2Y91 A;  3K3D A;  2PYR A;  4MN7 A;  5AQB A;  4LEN A;  5F1F A;  1JNU A;  4KZA A;  1YLJ A;  3RXW A;  2I9V A;  3GSG A;  1H5X A;  2Y2L A;  2WGW B;  3NIA A;  1VEU A;  4YFM A;  1RGY A;  2HDU A;  2OOL A;  3O5Y A;  3C4P A;  1FIL A;  2RL3 A;  4OKP A;  1TS6 A;  4OQG A;  1PI5 A;  4UEY A;  4I3I A;  4DRT A;  4IBX A;  3ZNY A;  5CEB A;  5HL6 A;  4WM9 A;  4ZJ2 A;  3IBJ A;  1RGZ A;  4DN0 A;  4LV3 A;  3VOY A;  4E3K A;  2Z2L B;  2BG1 A;  1W63 Q;  4OPQ A;  5KSH A;  3OPL A;  4E3I A;  3UE6 A;  5FAP A;  4N9K A;  1LL5 A;  3BQ8 A;  1TDL A;  3KX0 X;  3A0V A;  3MF0 A;  2VV6 A;  2Y2P A;  5AQA A;  2ZQC A;  1WYC A;  2QHK A;  3E4P A;  3MSH A;  2WK0 A;  1LLB A;  2WKE A;  2BLS A;  3V50 A;  3S7O A;  3TJZ C;  4MDZ A;  1XXM A;  5F68 A;  2H10 A;  3BYD A;  5FAS A;  2WAF A;  4L9E A;  1ZHH B;  3H82 A;  1STZ A;  1KVL A;  3UB9 A;  5DF9 A;  1OTA A;  4JXG A;  3KSI A;  3IBR A;  3UDI A;  3IT9 A;  3B33 A;  2WGI A;  4U3T A;  3HUM A;  3NY4 A;  4WZ5 A;  1N9O A;  3WWX A;  1WE4 A;  4WEJ A;  3TE8 A;  2V1B A;  1ZKJ A;  3PXP A;  3RTY A;  1KOU A;  1L0F A;  3EOI A;  2ZMA A;  2VZW A;  4DJ3 A;  3LGO A;  4P87 A;  5FQQ A;  1K55 A;  1FQG A;  4KZ7 A;  4E3J A;  4JGO A;  4GS9 A;  5HFO A;  3TG9 A;  5GLA A;  3G2Y A;  5M19 A;  3F1N A;  4HY8 A;  3NOP C;  4I3A A;  1JTG A;  3LI8 A;  1TDG A;  3SW1 A;  5FI2 A;  1K4E A;  3ZCZ A;  3LFV A;  2ZC4 B;  3LID A;  3IWI A;  4EBP A;  1RP5 A;  2XDM A;  1K56 D;  3S1Y A;  1DJB A;  1OPX A;  1ONH A;  5TBM A;  1NJ4 A;  3VE4 A;  5AQ9 A;  1P9W A;  4JKT A;  2Y2K A;  3S7N A;  3BW6 A;  3DBA A;  3CUE A;  1G5U A;  1ES4 A;  2JKT M;  3PYP A;  4S2N C;  3F1O A;  5FQI A;  5HWW A;  1GA0 A;  1KE4 A;  3LIB A;  4ARZ A;  2XFS A;  3IWQ A;  2V1Z A;  5EPH A;  1G68 A;  1S4S A;  4KZ3 A;  2LB5 A;  3ITB A;  3ZVT A;  4ETZ A;  1YMS A;  1PZP A;  4GB7 A;  4I5S A;  4IBR A;  2W3H A;  4KEN B;  4Q8I A;  2PHY A;  5K5B A;  3IX8 A;  1Q2Q A;  2P7J A;  3O3V A;  3T4K A;  1Y28 A;  3T4T A;  1NYM A;  1SHV A;  2ZC6 B;  3T4O A;  2H5S A;  4K08 A;  4UQI M;  1K38 A;  1ONG A;  3G31 A;  5TR7 A;  3UPP A;  3UE0 A;  1VET A;  4QPR A;  3C8C A;  5C5K A;  4JXW A;  4LCM A;  2YKF A;  4IHQ A;  2V2F F;  1XGI A;  2E8I A;  3KSG A;  1IEL A;  1ZTU A;  4EUV A;  1O7E A;  1JTD A;  4OP8 A;  1IKI A;  3NOT C;  4FH4 A;  4P6Z S;  4PHT A;  5DKL A;  4JF6 A;  5E2F A;  1KE0 A;  3LR5 A;  1W8Y A;  3B3X A;  5KMW A;  1KVM A;  1GHM A;  2J3T D;  1XA1 A;  2Y8H A;  4R70 A;  4WBG A;  5EEC A;  2W3D A;  4Y3I A;  2XH9 A;  1KDW A;  1YT4 A;  3IXB A;  3MZD A;  2O9C A;  3IF6 A;  5E43 A;  1VQQ A;  3E4Q A;  4NXB A;  2JHE A;  3A3D A;  5A93 A;  4GN2 A;  2Y2I A;  2V8C A;  1Z6F A;  2ZM0 A;  2PBD P;  2VGL M;  5FQJ A;  4GDB A;  5DTK A;  2QKP A;  4K91 A;  4C6Y A;  3H7W A;  4P6B A;  4LRY C;  4RX2 A;  1YMX A;  1X0O A;  2WAD A;  3N7W A;  3MKF A;  3DTK A;  3CMZ A;  2OAP 1;  3H82 B;  2XRN A;  3C7U A;  4PM5 A;  3C5A A;  4QWO A;  4ESP A;  2HJ9 C;  3DWZ A;  4WZ5 C;  3DTM A;  1PNE A;  1LHY A;  4N1H A;  1F9I A;  1BSG A;  1XJ2 A;  3CG5 A;  1T1A A;  1XJ3 A;  1KGF A;  2HF6 A;  3O87 A;  1A0K A;  2V0W A;  1S66 L;  2ZOI A;  3QP2 A;  4Z1W A;  5JYO A;  2QJ7 A;  1K55 C;  3OPH A;  2OWJ A;  2XFT A;  3GMW A;  4XXR A;  2WAE A;  2Y2M A;  3GVB A;  4F3L A;  4K0W A;  4OOM A;  4KUK A;  4OVD A;  3AGE A;  1T1C A;  4GS9 B;  3T4L A;  3LO7 A;  3F1N B;  3JYI A;  3EQV A;  4DXC A;  3LUQ A;  3HVF A;  1T1B A;  3PBO A;  1L0G A;  1V9Y A;  2A49 A;  1MWR A;  3F1P A;  3PHY A;  2P74 A;  2FH5 A;  1S1Z A;  1HZO A;  1CF0 A;  1P9R A;  2JBF A;  1KE3 A;  2Y2N A;  4QB8 A;  1GHP A;  2ZC3 B;  2ZC5 B;  4HES A;  3PTE A;  4IED A;  1IEM A;  4B4Z A;  3UMD A;  1D06 A;  3N4I A;  3NDE A;  3DTE A;  3WRT A;  1PWG A;  3C2W A;  4LLO B;  1S1Y A;  2HPB A;  3NI9 A;  3VSL A;  4EBN A;  4ZJ1 A;  4ZTK A;  5F83 A;  3QHY A;  1JWZ A;  5EVI A;  2GJ3 A;  1ERQ A;  2EXA A;  4PKY A;  3F1O B;  4OQ0 A;  2V9A A;  4ARZ B;  5HZH A;  2V0U A;  2XR0 A;  1H8Y A;  1OT9 A;  3IHB A;  2PU2 A;  2Y2G A;  5L09 A;  4BD0 A;  1S4R A;  2DRW A;  1ODV A;  5EUA A;  2PR5 A;  2JCH A;  1DJA A;  4PM8 A;  3FPW A;  4Y15 A;  4L0L A;  4PM7 A;  4Y7P A;  1MWU A;  4BLM A;  5DVA A;  3A3J A;  3FC7 A;  4O0P A;  5FEF A;  4X1M A;  2JN7 A;  4R38 A;  3W8K A;  3LR3 A;  5A8B A;  1VET B;  5CRF A;  5CX7 A;  3BFF A;  3S22 A;  4DXB A;  4HI4 A;  3MQQ A;  2ZL1 B;  4KZ9 A;  4DMZ A;  1LT0 A;  3OCL A;  1MBL A;  4X25 A;  1SCW A;  1GSV A;  1XGJ A;  1OT6 A;  2QPN A;  1U60 A;  3FV7 A;  3HLG A;  2JKG A;  4OLD A;  1MKM A;  3MR0 A;  3S7P A;  4Y13 A;  3IF5 A;  3FZC A;  3IF6 C;  1G6O A;  3W2Z A;  4JXV A;  3G2Z A;  5FDH A;  1PWD A;  3IF6 B;  3FWL A;  1NLZ A;  4F94 A;  3D3O A;  1E25 A;  1CI9 A;  2NUP C;  1OTE A;  4LRX C;  1O07 A;  4H6J A;  2MJ6 A;  1LI0 A;  3E2L A;  1H8Z A;  5EM1 A;  3BM6 A;  1AXB A;  3NCK A;  2ZQD A;  1ES2 A;  1E4D A;  4X68 A;  5HWT A;  1TS7 A;  2EX8 A;  3MS6 A;  3KYE A;  4Q0J A;  3W4P A;  3CHW P;  3C4O A;  1HLU P;  3H7W B;  4I38 A;  2IWC A;  4DDY A;  4LGW A;  1MKI A;  3KSF A;  3MXS A;  4IUH A;  1XKZ A;  1F5M A;  3E98 A;  3UDX A;  1MWS A;  3P09 A;  2J8Y A;  1DRM A;  5CHJ A;  5M18 A;  1SKO A;  4BQM A;  4ZDX A;  4GD6 A;  3JVV A;  4GW9 A;  4BBV A;  1NRF A;  5F82 A;  4E3N A;  5AQ7 A;  2P9V B;  3A3I A;  3N8L A;  3EGD C;  4R23 A;  3NUL A;  4F3L B;  1MZU A;  3HRE A;  2W3E A;  4IVI A;  1NRJ A;  3QNB A;  3BRM A;  2J3W A;  5DJU A;  3VP1 A;  3HLF A;  1K57 C;  2K31 A;  1OJG A;  1C3B A;  1SZV A;  3KO6 A;  5IU1 A;  4X55 A;  1UGU A;  2J9P A;  3F1P B;  5AJG A;  1DY6 A;  4N1X A;  3A3E A;  3EEH A;  4BWI A;  2ZQ7 A;  4G3K A;  2Y55 A;  1Q2P A;  5EFW A;  2EWV A;  4S2O A;  3GR2 A;  5EVI C;  2EFU A;  2DCF A;  3BY9 A;  4KZ8 A;  4ME4 A;  5HAQ A;  3D9Y A;  5EVI B;  2FZ0 A;  4QJG A;  3V67 A;  2ACG A;  1LI9 A;  4R0Q A;  3UO9 A;  3Q7V A;  4LPZ A;  3SS5 A;  4UA7 A;  4KZ4 A;  5CHM A;  4OP5 A;  2XA7 S;  4L9G A;  3EWK A;  2OLV A;  2XF3 A;  4BJP A;  4HP9 A;  4WMC D;  4BMW A;  4IVK A;  4P0M A;  2X02 A;  3GQZ A;  4X1L A;  3SOI A;  3BFG A;  3HL9 A;  2XK1 A;  3IS2 A;  5HX9 A;  1YPR A;  2W3F A;  4BD1 A;  2WUQ A;  4NEE D;  1P97 A;  3GRJ A;  3C30 A;  3DW0 A;  3RFB A;  2BAS A;  4EV4 A;  1CEG A;  2A24 B;  4R6L A;  4ZJ3 A;  3SS3 A;  3H9W A;  5EOE A;  2M1C A;  4X53 A;  2O0Y A;  4KQO A;  2C5W B;  5FI7 A;  1BUL A;  5F1G A;  2PBY A;  5CER A;  4CLC D;  4QHC A;  1FR6 A;  3A0S A;  2C6W B;  5FL3 A;  4MNR A;  3R7W A;  5EVL A;  4N9L A;  3U4L P;  4S2I A;  3Q7Z A;  3OPR A;  2Q0O A;  3G34 A;  3Q81 A;  1I2S A;  4WEL A;  3N8R A;  2JE5 A;  1SKF A;  2UWX A;  3UY6 A;  5DJT A;  1K56 A;  4NG2 A;  4NXG A;  5MC7 A;  4DDS A;  2ZQ9 A;  5TGF A;  4NET A;  3RJU A;  2HP5 A; 
#chains in the Genus database with same CATH homology
 4Y17 A;  4Y13 A;  3QP8 A;  4LFU A;  4Y15 A;  2Q0O A;  1H0M A;  3IX3 A;  3IX4 A;  3QP4 A;  4LGW A;  1L3L A;  3QP5 A;  3SZT A;  3QP6 A;  2UV0 E;  3IX8 A;  4NG2 A;  3QP2 A;  5L09 A;  5L07 A;  3QP1 A;  5L10 A;  2AVX A;  3JPU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...