2AVXA

Solution structure of e coli sdia1-171
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
171
structure length
171
Chain Sequence
MSDKDFFSWRRTMLLRFQRMETAEEVYHEIELQAQQLEYDYYSLCVRHPVPFTRPKVAFYTNYPEAWVSYYQAKNFLAIDPVLNPENFSQGHLMWNDDLFSEAQPLWEAARAHGLRRGVTQYLMLPERALGFLSFSRCSAREIPILSDELQLKMQLLVRESLMALMRLNDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Regulatory protein sdiA
publication title Structure of the Escherichia coli quorum sensing protein SdiA: activation of the folding switch by acyl homoserine lactones.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 49
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2005-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03472 Autoind_bind Autoinducer binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.80 Alpha Beta 2-Layer Sandwich Beta-Lactamase Transcription factor LuxR-like, autoinducer-binding domain 2avxA00
3QP4A 3QP1A 5L09A 4Y17A 2AVXA 3QP5A 2Q0OA 3JPUA 3QP8A 5L07A 4LGWA 4Y15A 3QP6A 3IX4A 3QP2A 4Y13A 4LFUA 2UV0E 3SZTA 1H0MA 3IX8A 3IX3A 1L3LA 5L10A 4NG2A
chains in the Genus database with same CATH superfamily
2W1TA 4OQGA 3D72A 1G28A 1MKIA 2W3GA 2X01A 3IX4A 2R78A 2W0NA 2JKFA 2HDUA 1K57C 3Q7ZA 3KSGA 4RX3A 3WS1A 3E4OA 4MLLA 3IBJA 1Y28A 4EV4A 4OOMA 3SOIA 4YOFA 1S1ZA 2A49A 4I3AA 2VGLS 4CLCB 2P04A 1AWIA 4N92A 4B93A 3M6BA 5FQQA 2M1CA 4OP8A 4P6ZS 3WRZA 1K38A 4EXOA 3VMAA 4R3AA 1CI9A 3FZCA 5DFXA 2Y4AA 1PNEA 5HDSA 4EU0A 1DJAA 1I2WA 4ZJ3A 4DE2A 5CEBA 1FCMA 3A0SA 4RQ9A 1HD8A 2O9AA 1PW1A 1L2SA 3T1SA 1BYWA 3NI9A 4Q0JA 4XXRA 5HDCA 3NOPC 1MC0A 4R23A 1IELA 2HJEA 4E3KA 4QU3A 3KYQA 3SH8A 3CUEC 5KSCA 3ITAA 4H6JB 4HH2A 3MMHA 5J3WA 2WK0A 3E2LA 2HDQA 5I5LA 4ETZA 5HFOA 2IWCA 2Q9NA 4HHDA 4F3LB 4MN6A 1XGIA 1LSVA 2WKPA 3VOLA 2JKTM 1STZA 4IUKA 1IKIA 4WEKA 3BQAA 5GLCA 3K3DA 4PAUA 5BOHA 2ZL1B 1DJBA 4EUVA 2OAP1 5G18A 2O99A 4PM8A 2EX9A 3MKFA 3BFEA 1OTBA 4HI4A 2JE5A 4NXEA 3S7QA 5E43A 1MWRA 3N4IA 3MXRA 2VEAA 2EXAA 3DTEA 1PWCA 1W79A 4NXBA 4JF6A 3PXPA 5DJTA 4ZDXA 4PM9A 2O9BA 4OOLA 2DNSA 1Q2PA 1YKDA 3OCLA 5EPHA 3LO7A 4AFIA 3NHQA 4IVIA 5DTTA 5EFWA 2OWHA 4YNRA 3T1RA 3IS2B 2XFSA 3F1PA 3ISGA 3P7NA 5FA7A 4P85A 1EI5A 1K56D 3H7WB 4EBPA 5HWVA 5HPFA 3IF6A 3PYPA 2Y2QA 2Z6DA 3DAVA 3T4KA 4WMCA 3DWKA 4E3LA 3Q81A 2ZQ8A 4P6BA 1ALQA 1UWPX 4S2MA 1FSYA 4HJ3A 2Y2MA 5K5BA 3VP0A 4L0LA 1MWUA 1SZVA 5EVEA 5GLDA 5FI2A 4K08A 4HJ4A 2IWBA 1BLHA 3MQQA 4CQHA 4IJGA 5EVIB 3F1NA 3FKVA 2Y2LA 4UA9A 1W63M 5GLAA 2O0YA 1FCOA 1GCEA 4I38A 1ZG4A 4L9FA 1VEUA 2D02A 3SS4A 4GS9B 1T19A 3IX8A 2P08A 1OMEA 3S7PA 2BLSA 2B18A 3M2KA 3LY4A 4GDBA 1K54A 3TRCA 3EQVA 1PFLA 3MFXA 1TS0A 1IYPA 3B47A 3IH9A 2QWSA 3O5YA 1TF1A 4R70A 3PBTA 3G31A 3T1XA 3FG8A 1N4OA 2PYPA 3QNCA 3ZQ5A 2EX8A 5FATA 4N9KA 3EWKA 2J8YA 1DP6A 4KG5A 1K55A 4U0TA 1MWTA 4E04A 4YFMA 4MN7A 1C3BA 2HDRA 1FQGA 1M6KA 1V9ZA 2Z6CA 1NLZA 1GA9A 1KE3A 3WWXA 1N9BA 5LBRA 4LV0A 5F83A 1ESUA 4P87A 3OPHA 3GDIA 2VGKA 2XSSA 2W3EA 1LL9A 4U3TA 3OC2A 4LRXC 5F6AA 5AQ9A 3B33A 3MJQA 2GDNA 1F5MA 4BD1A 3KSFA 1MKMA 4BLMA 4EERA 3MBZA 3FKWA 3LR5A 3V67A 5EM1A 1WE4A 2IA2A 3S7OA 4X55A 4R3BA 2MJ6A 3LIAA 2ZQAA 1PI4A 3DTMA 4KZ5A 3T4JA 2NUTC 3N6IA 1YAXA 3UPNA 5EOEA 2GNXA 3DTIA 2PAVP 1JWVA 3Q07A 2EFXA 4IHQA 1OT6A 5HARA 3EGDC 1ES5A 2XD1A 4Y17A 3CPTA 1E3UA 4EBLA 1HLUP 1GA0A 3ZHHA 1GSWA 3SH7A 5TBMA 4S2IA 4MCWA 4KG6A 1N9OA 5L8MA 4BENA 4LPZA 3UNWA 5KZHA 1KGFA 4KENB 3NC8A 2Y2NA 3LI9A 3KSHA 4X1MA 1VB6A 5L09A 5DVAA 2JC7A 3JYIA 4ZAMA 1LL8A 4GW9A 4QPRA 3CITA 2ZC6B 3LIBA 4PHTA 4PPRA 2PD7A 4Y13A 5FDHA 2WAEA 5E2EA 1L0EA 4JBFA 4X1LA 4XT2A 4MDZA 2FFYA 1NRFA 4NG2A 3GECA 5FEFA 1KVLA 2QJ5A 3RJUA 3ZNYA 2ZJ9A 1VQQA 1FR6A 2UWXA 4QY6A 4HNBA 1BUEA 2K31A 2QHKA 1XJ4A 1JTDA 2A24B 2J80A 2P9VA 4IUHA 1G5UA 5FSRA 1Y4OA 5KSHA 3LEZA 1J9MA 5FI6A 4QWOA 1W8YA 1AXBA 4WZ5C 5EVIC 3LIEA 4B88A 1HZOA 1O7EA 5F69A 3UY6A 3NY4A 3V5MA 2Y2GA 1S67L 3HBRA 3MKEA 1TDGA 1U60A 5F1GA 1KE0A 4X6TA 3EGXC 5J4EA 4KZ4A 4HEFA 4HIAA 5CTMA 3S7NA 2PYRA 5CRFA 3C4OA 2WKIA 5L2FA 3TJZC 2ZD8A 1J3WA 1IYOA 4IVKA 3DW0A 5HWTA 5CERA 4OQHA 4Y2FA 5GHZA 4S2LA 3V39A 4KQRA 1IYQA 2I9VA 3MS6A 3TW8A 4WF0A 1XA7A 2PBDP 2H28A 3JPUA 3FYZA 4S2NC 3UPPA 3FV7A 4KQQA 1YLJA 1PW8A 1XKZA 5GL9A 3S22A 4QJGA 2WZZA 3HREA 3Q7VA 3T4OA 2HJ9C 4OP5A 4QD4A 3IBRA 1K25A 5E2GA 3CJMA 1JWPA 4N1HA 4LV3A 1Y54A 3ZDJA 3LY3A 3W2ZA 2ZLYA 1P0ZA 3UO9A 2WADA 3WS4A 1CEFA 1S0WA 4UQIM 4Y0OA 5GHYA 2PR5A 3BY8A 3F1PB 1YLZA 3G2YA 4EW7A 3LCEA 1UWNX 1XPBA 1PI5A 4LFUA 3VOYA 4D2OA 1XXMA 3FPWA 4R38A 1L3LA 1BLSA 3IF6B 4JGRA 2J3WA 1ODVA 2J9OA 2Q0OA 4GJ4A 2M7UA 1WA9A 3BWLA 5AVFA 3LR3A 3OZHA 3UDIA 3ZG8B 2W3DA 4K0WA 4Q0HA 3CUEA 3GQZA 5DF8A 2WKRA 3PBRA 2HP9A 4YINA 2B5RA 5D3OA 2Y59A 4JF5A 1VEUB 4N1XA 1IEMA 3T4SA 4BJPA 5A93A 3E4PA 4KZ8A 4L9GA 3IH8A 1RCJA 3NJAA 1K0KA 1BTLA 3MR0A 3RXXA 1DY6A 4GZBA 3LR0A 1MPLA 2OWJA 2X71A 2Q9MA 1NWZA 4HBTA 3CHWP 3EQUA 2KLIA 3M2JA 3N8SA 2W3HA 3ZGAB 4ZRRA 1VETA 1SKOA 3VV4A 1BULA 3ITBA 1TD5A 5IU1A 1ACFA 1ESIA 3WRTA 2PU2A 3HUNA 3B42A 1CK3A 3BRMA 4Y0TA 3NOTC 3L9KA 2JKTI 3IWIA 2W3FA 4CJNA 3SS5A 5KIZA 4B9OA 5FQJA 5MC7A 3NBLA 3IXDA 5DTSA 3LYXA 4FD8A 3HLBA 1OTDA 3LEQA 4M3KA 2XGNA 3G30A 4UEYA 3HJKA 1IKGA 1FILA 5IT5A 4UQIS 3HLCA 5HL6A 2DMWA 2FFFB 4JGPA 4ME4A 4NK3A 2XRNA 3CZDA 2CC1A 3QHYA 2VA0A 2Y2IA 2Y55A 1SHVA 4K91A 5TR7A 5C5KA 4BBTA 4QHCA 1JWZA 1K56A 4P0MA 4M4XA 2PHYA 3RH8B 2H0YA 2V2FF 3C8CA 5IS1A 1ZC2A 4NXFA 4ESPA 1ERMA 4WBGA 1T18A 4KZ7A 4LCLA 1IFQA 3L7HA 4WLAA 1N9NA 4LGWA 3PBOA 4OOYA 3BLMA 2WUQA 4KZAA 1TS8A 2QMIA 3HUOA 3MZDA 5M18A 2LB9A 1A0KA 5TBMB 1LI0A 3IT9A 5CHJA 3UB9A 1NYMA 4C75A 3BW6A 2XD5A 3PBSA 4OPRA 4HESA 3A3JA 4HH3A 1LSWA 3EEAA 3O86A 3K2NA 4ZTKA 4BQMA 4QB8A 3D9YA 2IWDA 4LRYC 1X0OA 5JYOA 1JVJA 1RGZA 2A2LA 3DBAA 3QP5A 3O3VA 2XF3A 1WYCA 3HL9A 3O87A 3SH9A 3Q1FA 2HP6A 4R6LA 4GLQA 5HSQA 3G32A 2Z2MB 3KYZA 4XT2B 5DF7A 1TS7A 5FQMA 5F82A 4O0PA 1K6SA 2V1AA 3FC7A 1OJGA 2ZC4B 4LV2A 3MZEA 5E2FA 3W4QA 2Y2HA 5DJUA 2PBYA 3IXHA 2QJ7A 4DKIA 4DN0A 4E6WA 4RA7A 1G6OA 4Y15A 4EQ1A 2P9VB 1FCNA 4WN5A 4X56A 4CLCC 2PR6A 3I7JA 3N7WA 1GSVA 2ZOHA 1I5QA 1XGJA 2V9AA 4ZJ2A 3MF0A 3ZG0A 2ZM0A 3GMWA 2R9XA 5TFQA 3C38A 4WELA 3ZYTA 3GV9A 1ERQA 4F3LA 4MEZA 4WYYA 4I3IA 2J7VA 4K0XA 3SZTA 1K54C 2JKGA 2BASA 4FUWA 4R4RA 5G4YA 4ETXA 3G35A 4EWFA 3PTEA 3QP4A 3PR6A 3UE1A 1KE4A 5TGFA 1P97A 2W1RA 2QKPA 2H5SA 1MWSA 5CGWA 2INWA 2BG1A 3T4LA 1FR1A 4GDNA 3ZVTA 4G3KA 1YMSA 3ZG5A 5AJGA 2O9CA 3C5AA 3NCKA 4DDYA 3UE6A 4ARZA 3H82B 3QNBA 1XP4A 2OOLA 2OV5A 4Y5FA 3IQAA 5FASA 3T4TA 5A92A 4E3OA 5EECA 4JKTA 3C30A 3KYEA 3MFDA 2PU4A 2E8IA 4FTXA 4YWZA 3BJNA 3EOIA 2K7SA 3Q7VB 1CI8A 4R1GA 5A90A 4GHIA 3TE8A 2V1BA 4WZ4A 2XK1A 1O07A 1OJ5A 3PHYA 4JGQA 3UMDA 2VLGA 2H0TA 1XJ6A 4MNRA 1SDNA 2W1TB 2G7UA 1SDEA 4EETB 1TEMA 4PM5A 5FL3A 3BEBA 2H10A 1K4FA 3AGFA 2ZMAA 2E8JA 1XX2A 4R0QA 3HLFA 4ZBEA 4WZ5A 1MXOA 3NDEA 5HZHA 3ZCZA 2A3UA 3A3FA 4KQDA 4I39A 5CX7A 3R7WA 2OSUA 3T1QB 5EVID 4A5RA 4B4ZA 4DE3A 5FAQA 2Y8HA 2XH9A 4DF6A 5GLBA 1NRJA 2DRWA 4QY5A 3D3OA 2VJWA 1PRQA 2ZOIA 1Z09A 2DCFA 1H0MA 1KDSA 2PT7A 3LI8A 3W8KA 2XA7M 3MQ0A 5A8BA 3HLEA 5G4ZA 1ES4A 3C7UA 2XFTA 4MBKA 1H3QA 4MBHA 4UAAA 2P74A 2BTFP 2W27A 3E98A 3AGDA 4PKYG 3GVBA 3JVUA 1BZAA 3QP6A 5EE8A 2OLVA 4GOGA 4S2NA 1JTGA 1LHYA 4EUZA 5F1FA 4X68A 1ES2A 2WKHA 4LV1A 4N9LA 3CAXA 4OPZA 1VETB 4FSFA 5EVLA 2HP5A 1SKOB 5EOOA 1ZTUA 3B3XA 2M7VA 1CJFA 4HY8A 4KQOA 3UDXA 4DE0A 3G34A 5FQIA 3DWZA 1QMFA 2Z2LB 3BY9A 2Y2JA 4F94A 1GHPA 3UB8A 1W8QA 1YMXA 4LENA 3VP4A 3KO6A 1YLWA 3WS0A 3BFCA 1NZUA 1TVFA 3BQ8A 3CMZA 1K57A 1D06A 1WYBA 1PIOA 4KG2A 4IBRA 4MMNA 2ACGA 3ZVWA 3A0RA 1LT0A 4FH2A 3QP2A 1BLCA 2EX2A 4EESA 3RTYA 5HAPA 2K2NA 4KZBA 3W4PA 1F98A 1TS6A 4GB7A 5FEGA 4C6YA 2Y2OA 1HVBA 1MY8A 4R3JA 3G2ZA 3G4PA 3T12B 1HTZA 4PM7A 5AQ7A 4OONA 3ULFA 1NLYA 4JXSA 4DXCA 4JGOA 1DRMA 2ZMFA 3LR4A 4PM6A 5DKLA 4KUKA 1S6RA 3OCNA 3TSGA 1DP9A 3N8LA 2XA7S 2V20A 5HW3A 1RGYA 2I72A 1P9RA 2HV1A 3LGOA 4HOIA 1T1CA 4G3VA 3HLWA 2VX8A 2WAFA 2WGWA 1LI9A 4JXVA 3F1NB 1YSPA 2GZAA 2KOIA 3LIDA 5DTKA 1E25A 4GD8A 1Q2QA 5HX9A 3BM6A 1ONHA 3OOVA 3CI6A 2B95A 3UB5P 1VHMA 1W7FA 3IWQA 5A91A 2XR0A 2A24A 4CPKA 4PMAA 5HAQA 2KDKA 2OLUA 3K3CA 4X25A 2X02A 2L4RA 3ZNTA 3R4KA 4IEDA 5DFYA 1N9LA 4S2OA 4EQIA 1BT5A 3VE4A 3IWOA 1NYYA 1MZUA 3MQOA 4XUXA 4RX2A 2ZM2A 1OT9A 3HLGA 4X69A 3IXGA 1GSXA 4X53A 4E3JA 4E3IA 5F5YA 1H8MA 3LIFA 4OVDA 2Y2KA 2QZ6A 5FQ9A 2FH5A 3U4LP 2EFUA 2EWVA 4E6XA 3VSLA 3A0VA 3UE0A 4I5SA 3OBFA 5CHUA 4Z9QA 1ZG6A 1LSXA 4DRTA 4GCZA 4L9EA 2JCHA 1JNUA 3ZFZA 4DJ2A 5F68A 4EBNA 4GN2A 1K6RA 4NXGA 3UE3A 3T50A 4DXBA 3PAGA 1YLPA 1IOUA 3MXQA 4LRZE 3T4QA 2D01A 4O7DA 4ARZB 5HPIA 4S2KA 2ZBBA 1V9YA 3SW1A 3TOIA 5DKKA 1PYYA 4ID4A 5CECA 3F1OA 1YM1A 4HP9A 1XFNA 1SCWA 3H9WA 1EWZA 5CTNA 5AQBA 3BYDA 4RYEA 1OPXA 4GHIB 3HUMA 5I94A 2J9PA 4GD6A 2ZC5B 4HJ6A 3CPTB 3HVFA 3BFDA 3QP1A 4LCMA 2AVXA 3GRJA 3QP8A 3BFGA 3VE3A 2XLNA 3S1YA 4I3JA 4JLFA 2XQZA 2VK3A 2XEPA 4WMCD 3KX0X 4CLCA 3HCYA 3JVVA 2YKFA 4OPYA 2FZ0A 4R4SA 3VFHA 2VV6A 3MXSA 4OKPA 2VKSA 2ZC3B 3N8RA 4CLCD 1TDLA 3ZG9B 2ZM8A 3ZG7B 1BSGA 1D1JA 1OTAA 4II7A 4WEJA 1XJ2A 4FH4A 3R7WB 1S4SA 4PKYA 1YPRA 2PRFA 2LB5A 4G3WA 3C2WA 1P9WA 3KSIA 4Q0IA 2B02A 4GNUA 3IF6C 2GX5A 4Y7PA 1LLBA 2RCXA 3GSGA 4OLGA 2RL3A 5HL1A 3VOZA 3VP3A 3BFFA 1S1YA 5AQAA 3O88A 2ZQDA 1L0DA 4WM9A 1CEGA 4U0XA 3MSHA 3C7VA 5EUAA 3DTKA 2L0WA 5U47A 1RP5A 5EM0A 4H6JA 4JPMA 1CF0A 5FAPA 1H5XA 3GR2A 3NECA 5M19A 3V50A 5FI7A 1G6AA 3CLOA 2G2WA 3GTCA 4JF4A 1YLTA 5HAIA 4UA7A 1XJ3A 2Y91A 3P01A 2ZL1A 3FWLA 5HD3A 4UHUA 3OPLA 5L07A 2XDMA 3G6OA 4D60A 2C6WB 1NXYA 3PBNA 3PAEA 2V0WA 1YLYA 1Z6FA 4BMWA 3MZFA 4E3MA 4RVAA 4BL2A 4JXWA 2VV7A 4NETA 1GHMA 1ZKJA 4NEED 2WYXA 3OPRA 3E4QA 2JKRI 1NJ4A 3NIAA 3HJIA 1FSWA 3LFVA 2JKRM 4BL3A 1K55C 1L0GA 3UB6A 2V8CA 4LLOB 1YSQA 1KOUA 3CWFA 1ONGA 4HQAA 5FQKA 3UN7A 5M1AA 2V8FA 4B4XA 4BBUA 2OAQ1 3IS2A 3FPVA 2L1MA 1W63Q 5E2HA 1G68A 5AVEA 1YT4A 3H7WA 4DE1A 2VZWA 2QYBA 2GJ3A 2HPBA 3ICYA 3D4FA 1W5DA 4DMZA 1QMEA 3A3EA 1K4EA 4HP4A 2NUPC 1YQSA 2ZMVA 2V0UA 3TG9A 2QPNA 1NY0A 2VGJA 4Y0UA 2ZQ7A 2EA9A 2P7JA 3E2KA 3VP1A 3OLOA 2WGVA 1E3UD 2ZC7A 1PZOA 3LUQA 4WUJA 4OPQA 1S4RA 5EVIA 3VFFA 3A3IA 3RFBA 3BLSA 3NOUC 4S2JA 1NZOA 1VM1A 2WKQA 3AGEA 4GS9A 2C5WB 4IBXA 1FIKA 4JXGA 3V3RA 1PZPA 4NKPA 3A3DA 3VP2A 3EEHA 3UMEA 1IYSA 1D7EA 4MBFA 2WGWB 1PWDA 5GHXA 2Y79A 4EEUA 3U2AA 2PD8A 1T1BA 5L10A 1F9IA 2EX6A 4Q8IA 2EWWA 1CQAA 1GHIA 3HLDA 1I2SA 1M40A 1PWGA 2HDSA 5HDDA 2XROA 1OTEA 2EXBA 3UPOA 4UA6A 2HF6A 4EEPA 3WS2A 5CEDA 1SKFA 2G2UA 2VGLM 5IHVA 2J3TD 3E0YA 4WL9A 1S66L 3S4XA 4XUZA 1UGUA 1EW0A 1F2KA 4GKUA 4H8RA 5TJJA 2WKEA 1KGEA 3Q82A 1FOFA 3IHBA 3NDGA 4KZ3A 4P6ZM 1ES3A 4CLCE 1EROA 4O8GA 4KZ9A 4HBUA 3P98A 2HGVA 5KMWA 4S2PA 5HWWA 2JHEA 3M6HA 5FDSA 3IF5A 4KZ6A 4FCFA 4OLDA 3W4OA 5DF9A 5J7EA 4MN5A 5EV0A 2J3TC 1OTIA 4ZJ1A 4BWIA 4DJ3A 2HZ5A 4KUOA 1XA1A 3WS5A 2CMNA 3SS3A 3RXWA 5J8XA 3IX3A 5CGSA 2WGIA 5CXWA 3UB7A 5FAOA 1BLPA 4C3QA 3NULA 3PBQA 3OPPA 1MBLA 2JBFA 5CGXA 1DP8A 3UDFA 3H82A 4OQIA 4OQ0A 2YKHA 4Z1WA 4Y3IA 1T1AA 2V1ZA 3IXBA 3VSKA 1DJCA 2Y2PA 3V3SA 4OH0A 2UV0E 2JN7A 2VV8A 4O01A 4BD0A 4E3NA 5JYPA 1L0FA 1XFQA 4FOFA 1E4DA 1KGGA 3BECA 2PDRA 4DDSA 2ZQCA 4BBVA 2R9WA 2WZXA 1H8YA 3C4PA 5HD5A 3IHAA 1LL5A 1ZHHB 3P09A 2KX6A 3LICA 5CHMA 3CG5A 2ZQ9A 1H8ZA 3F1OB 1KDWA 1KVMA
chains in the Genus database with same CATH topology
3QP4A 3QP1A 5L09A 4Y17A 2AVXA 3QP5A 2Q0OA 3JPUA 3QP8A 5L07A 4LGWA 4Y15A 3QP6A 3IX4A 3QP2A 4Y13A 4LFUA 2UV0E 3SZTA 1H0MA 3IX8A 3IX3A 1L3LA 5L10A 4NG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QP4 A;  3QP1 A;  5L09 A;  4Y17 A;  2AVX A;  3QP5 A;  2Q0O A;  3JPU A;  3QP8 A;  5L07 A;  4LGW A;  4Y15 A;  3QP6 A;  3IX4 A;  3QP2 A;  4Y13 A;  4LFU A;  2UV0 E;  3SZT A;  1H0M A;  3IX8 A;  3IX3 A;  1L3L A;  5L10 A;  4NG2 A; 
#chains in the Genus database with same CATH topology
 2W1T A;  4OQG A;  3D72 A;  1G28 A;  1MKI A;  2W3G A;  2X01 A;  3IX4 A;  2R78 A;  2W0N A;  2JKF A;  2HDU A;  1K57 C;  3Q7Z A;  3KSG A;  4RX3 A;  3WS1 A;  3E4O A;  4MLL A;  3IBJ A;  1Y28 A;  4EV4 A;  4OOM A;  3SOI A;  4YOF A;  1S1Z A;  2A49 A;  4I3A A;  2VGL S;  4CLC B;  2P04 A;  1AWI A;  4N92 A;  4B93 A;  3M6B A;  5FQQ A;  2M1C A;  4OP8 A;  4P6Z S;  3WRZ A;  1K38 A;  4EXO A;  3VMA A;  4R3A A;  1CI9 A;  3FZC A;  5DFX A;  2Y4A A;  1PNE A;  5HDS A;  4EU0 A;  1DJA A;  1I2W A;  4ZJ3 A;  4DE2 A;  5CEB A;  1FCM A;  3A0S A;  4RQ9 A;  1HD8 A;  2O9A A;  1PW1 A;  1L2S A;  3T1S A;  1BYW A;  3NI9 A;  4Q0J A;  4XXR A;  5HDC A;  3NOP C;  1MC0 A;  4R23 A;  1IEL A;  2HJE A;  4E3K A;  4QU3 A;  3KYQ A;  3SH8 A;  3CUE C;  5KSC A;  3ITA A;  4H6J B;  4HH2 A;  3MMH A;  5J3W A;  2WK0 A;  3E2L A;  2HDQ A;  5I5L A;  4ETZ A;  5HFO A;  2IWC A;  2Q9N A;  4HHD A;  4F3L B;  4MN6 A;  1XGI A;  1LSV A;  2WKP A;  3VOL A;  2JKT M;  1STZ A;  4IUK A;  1IKI A;  4WEK A;  3BQA A;  5GLC A;  3K3D A;  4PAU A;  5BOH A;  2ZL1 B;  1DJB A;  4EUV A;  2OAP 1;  5G18 A;  2O99 A;  4PM8 A;  2EX9 A;  3MKF A;  3BFE A;  1OTB A;  4HI4 A;  2JE5 A;  4NXE A;  3S7Q A;  5E43 A;  1MWR A;  3N4I A;  3MXR A;  2VEA A;  2EXA A;  3DTE A;  1PWC A;  1W79 A;  4NXB A;  4JF6 A;  3PXP A;  5DJT A;  4ZDX A;  4PM9 A;  2O9B A;  4OOL A;  2DNS A;  1Q2P A;  1YKD A;  3OCL A;  5EPH A;  3LO7 A;  4AFI A;  3NHQ A;  4IVI A;  5DTT A;  5EFW A;  2OWH A;  4YNR A;  3T1R A;  3IS2 B;  2XFS A;  3F1P A;  3ISG A;  3P7N A;  5FA7 A;  4P85 A;  1EI5 A;  1K56 D;  3H7W B;  4EBP A;  5HWV A;  5HPF A;  3IF6 A;  3PYP A;  2Y2Q A;  2Z6D A;  3DAV A;  3T4K A;  4WMC A;  3DWK A;  4E3L A;  3Q81 A;  2ZQ8 A;  4P6B A;  1ALQ A;  1UWP X;  4S2M A;  1FSY A;  4HJ3 A;  2Y2M A;  5K5B A;  3VP0 A;  4L0L A;  1MWU A;  1SZV A;  5EVE A;  5GLD A;  5FI2 A;  4K08 A;  4HJ4 A;  2IWB A;  1BLH A;  3MQQ A;  4CQH A;  4IJG A;  5EVI B;  3F1N A;  3FKV A;  2Y2L A;  4UA9 A;  1W63 M;  5GLA A;  2O0Y A;  1FCO A;  1GCE A;  4I38 A;  1ZG4 A;  4L9F A;  1VEU A;  2D02 A;  3SS4 A;  4GS9 B;  1T19 A;  3IX8 A;  2P08 A;  1OME A;  3S7P A;  2BLS A;  2B18 A;  3M2K A;  3LY4 A;  4GDB A;  1K54 A;  3TRC A;  3EQV A;  1PFL A;  3MFX A;  1TS0 A;  1IYP A;  3B47 A;  3IH9 A;  2QWS A;  3O5Y A;  1TF1 A;  4R70 A;  3PBT A;  3G31 A;  3T1X A;  3FG8 A;  1N4O A;  2PYP A;  3QNC A;  3ZQ5 A;  2EX8 A;  5FAT A;  4N9K A;  3EWK A;  2J8Y A;  1DP6 A;  4KG5 A;  1K55 A;  4U0T A;  1MWT A;  4E04 A;  4YFM A;  4MN7 A;  1C3B A;  2HDR A;  1FQG A;  1M6K A;  1V9Z A;  2Z6C A;  1NLZ A;  1GA9 A;  1KE3 A;  3WWX A;  1N9B A;  5LBR A;  4LV0 A;  5F83 A;  1ESU A;  4P87 A;  3OPH A;  3GDI A;  2VGK A;  2XSS A;  2W3E A;  1LL9 A;  4U3T A;  3OC2 A;  4LRX C;  5F6A A;  5AQ9 A;  3B33 A;  3MJQ A;  2GDN A;  1F5M A;  4BD1 A;  3KSF A;  1MKM A;  4BLM A;  4EER A;  3MBZ A;  3FKW A;  3LR5 A;  3V67 A;  5EM1 A;  1WE4 A;  2IA2 A;  3S7O A;  4X55 A;  4R3B A;  2MJ6 A;  3LIA A;  2ZQA A;  1PI4 A;  3DTM A;  4KZ5 A;  3T4J A;  2NUT C;  3N6I A;  1YAX A;  3UPN A;  5EOE A;  2GNX A;  3DTI A;  2PAV P;  1JWV A;  3Q07 A;  2EFX A;  4IHQ A;  1OT6 A;  5HAR A;  3EGD C;  1ES5 A;  2XD1 A;  4Y17 A;  3CPT A;  1E3U A;  4EBL A;  1HLU P;  1GA0 A;  3ZHH A;  1GSW A;  3SH7 A;  5TBM A;  4S2I A;  4MCW A;  4KG6 A;  1N9O A;  5L8M A;  4BEN A;  4LPZ A;  3UNW A;  5KZH A;  1KGF A;  4KEN B;  3NC8 A;  2Y2N A;  3LI9 A;  3KSH A;  4X1M A;  1VB6 A;  5L09 A;  5DVA A;  2JC7 A;  3JYI A;  4ZAM A;  1LL8 A;  4GW9 A;  4QPR A;  3CIT A;  2ZC6 B;  3LIB A;  4PHT A;  4PPR A;  2PD7 A;  4Y13 A;  5FDH A;  2WAE A;  5E2E A;  1L0E A;  4JBF A;  4X1L A;  4XT2 A;  4MDZ A;  2FFY A;  1NRF A;  4NG2 A;  3GEC A;  5FEF A;  1KVL A;  2QJ5 A;  3RJU A;  3ZNY A;  2ZJ9 A;  1VQQ A;  1FR6 A;  2UWX A;  4QY6 A;  4HNB A;  1BUE A;  2K31 A;  2QHK A;  1XJ4 A;  1JTD A;  2A24 B;  2J80 A;  2P9V A;  4IUH A;  1G5U A;  5FSR A;  1Y4O A;  5KSH A;  3LEZ A;  1J9M A;  5FI6 A;  4QWO A;  1W8Y A;  1AXB A;  4WZ5 C;  5EVI C;  3LIE A;  4B88 A;  1HZO A;  1O7E A;  5F69 A;  3UY6 A;  3NY4 A;  3V5M A;  2Y2G A;  1S67 L;  3HBR A;  3MKE A;  1TDG A;  1U60 A;  5F1G A;  1KE0 A;  4X6T A;  3EGX C;  5J4E A;  4KZ4 A;  4HEF A;  4HIA A;  5CTM A;  3S7N A;  2PYR A;  5CRF A;  3C4O A;  2WKI A;  5L2F A;  3TJZ C;  2ZD8 A;  1J3W A;  1IYO A;  4IVK A;  3DW0 A;  5HWT A;  5CER A;  4OQH A;  4Y2F A;  5GHZ A;  4S2L A;  3V39 A;  4KQR A;  1IYQ A;  2I9V A;  3MS6 A;  3TW8 A;  4WF0 A;  1XA7 A;  2PBD P;  2H28 A;  3JPU A;  3FYZ A;  4S2N C;  3UPP A;  3FV7 A;  4KQQ A;  1YLJ A;  1PW8 A;  1XKZ A;  5GL9 A;  3S22 A;  4QJG A;  2WZZ A;  3HRE A;  3Q7V A;  3T4O A;  2HJ9 C;  4OP5 A;  4QD4 A;  3IBR A;  1K25 A;  5E2G A;  3CJM A;  1JWP A;  4N1H A;  4LV3 A;  1Y54 A;  3ZDJ A;  3LY3 A;  3W2Z A;  2ZLY A;  1P0Z A;  3UO9 A;  2WAD A;  3WS4 A;  1CEF A;  1S0W A;  4UQI M;  4Y0O A;  5GHY A;  2PR5 A;  3BY8 A;  3F1P B;  1YLZ A;  3G2Y A;  4EW7 A;  3LCE A;  1UWN X;  1XPB A;  1PI5 A;  4LFU A;  3VOY A;  4D2O A;  1XXM A;  3FPW A;  4R38 A;  1L3L A;  1BLS A;  3IF6 B;  4JGR A;  2J3W A;  1ODV A;  2J9O A;  2Q0O A;  4GJ4 A;  2M7U A;  1WA9 A;  3BWL A;  5AVF A;  3LR3 A;  3OZH A;  3UDI A;  3ZG8 B;  2W3D A;  4K0W A;  4Q0H A;  3CUE A;  3GQZ A;  5DF8 A;  2WKR A;  3PBR A;  2HP9 A;  4YIN A;  2B5R A;  5D3O A;  2Y59 A;  4JF5 A;  1VEU B;  4N1X A;  1IEM A;  3T4S A;  4BJP A;  5A93 A;  3E4P A;  4KZ8 A;  4L9G A;  3IH8 A;  1RCJ A;  3NJA A;  1K0K A;  1BTL A;  3MR0 A;  3RXX A;  1DY6 A;  4GZB A;  3LR0 A;  1MPL A;  2OWJ A;  2X71 A;  2Q9M A;  1NWZ A;  4HBT A;  3CHW P;  3EQU A;  2KLI A;  3M2J A;  3N8S A;  2W3H A;  3ZGA B;  4ZRR A;  1VET A;  1SKO A;  3VV4 A;  1BUL A;  3ITB A;  1TD5 A;  5IU1 A;  1ACF A;  1ESI A;  3WRT A;  2PU2 A;  3HUN A;  3B42 A;  1CK3 A;  3BRM A;  4Y0T A;  3NOT C;  3L9K A;  2JKT I;  3IWI A;  2W3F A;  4CJN A;  3SS5 A;  5KIZ A;  4B9O A;  5FQJ A;  5MC7 A;  3NBL A;  3IXD A;  5DTS A;  3LYX A;  4FD8 A;  3HLB A;  1OTD A;  3LEQ A;  4M3K A;  2XGN A;  3G30 A;  4UEY A;  3HJK A;  1IKG A;  1FIL A;  5IT5 A;  4UQI S;  3HLC A;  5HL6 A;  2DMW A;  2FFF B;  4JGP A;  4ME4 A;  4NK3 A;  2XRN A;  3CZD A;  2CC1 A;  3QHY A;  2VA0 A;  2Y2I A;  2Y55 A;  1SHV A;  4K91 A;  5TR7 A;  5C5K A;  4BBT A;  4QHC A;  1JWZ A;  1K56 A;  4P0M A;  4M4X A;  2PHY A;  3RH8 B;  2H0Y A;  2V2F F;  3C8C A;  5IS1 A;  1ZC2 A;  4NXF A;  4ESP A;  1ERM A;  4WBG A;  1T18 A;  4KZ7 A;  4LCL A;  1IFQ A;  3L7H A;  4WLA A;  1N9N A;  4LGW A;  3PBO A;  4OOY A;  3BLM A;  2WUQ A;  4KZA A;  1TS8 A;  2QMI A;  3HUO A;  3MZD A;  5M18 A;  2LB9 A;  1A0K A;  5TBM B;  1LI0 A;  3IT9 A;  5CHJ A;  3UB9 A;  1NYM A;  4C75 A;  3BW6 A;  2XD5 A;  3PBS A;  4OPR A;  4HES A;  3A3J A;  4HH3 A;  1LSW A;  3EEA A;  3O86 A;  3K2N A;  4ZTK A;  4BQM A;  4QB8 A;  3D9Y A;  2IWD A;  4LRY C;  1X0O A;  5JYO A;  1JVJ A;  1RGZ A;  2A2L A;  3DBA A;  3QP5 A;  3O3V A;  2XF3 A;  1WYC A;  3HL9 A;  3O87 A;  3SH9 A;  3Q1F A;  2HP6 A;  4R6L A;  4GLQ A;  5HSQ A;  3G32 A;  2Z2M B;  3KYZ A;  4XT2 B;  5DF7 A;  1TS7 A;  5FQM A;  5F82 A;  4O0P A;  1K6S A;  2V1A A;  3FC7 A;  1OJG A;  2ZC4 B;  4LV2 A;  3MZE A;  5E2F A;  3W4Q A;  2Y2H A;  5DJU A;  2PBY A;  3IXH A;  2QJ7 A;  4DKI A;  4DN0 A;  4E6W A;  4RA7 A;  1G6O A;  4Y15 A;  4EQ1 A;  2P9V B;  1FCN A;  4WN5 A;  4X56 A;  4CLC C;  2PR6 A;  3I7J A;  3N7W A;  1GSV A;  2ZOH A;  1I5Q A;  1XGJ A;  2V9A A;  4ZJ2 A;  3MF0 A;  3ZG0 A;  2ZM0 A;  3GMW A;  2R9X A;  5TFQ A;  3C38 A;  4WEL A;  3ZYT A;  3GV9 A;  1ERQ A;  4F3L A;  4MEZ A;  4WYY A;  4I3I A;  2J7V A;  4K0X A;  3SZT A;  1K54 C;  2JKG A;  2BAS A;  4FUW A;  4R4R A;  5G4Y A;  4ETX A;  3G35 A;  4EWF A;  3PTE A;  3QP4 A;  3PR6 A;  3UE1 A;  1KE4 A;  5TGF A;  1P97 A;  2W1R A;  2QKP A;  2H5S A;  1MWS A;  5CGW A;  2INW A;  2BG1 A;  3T4L A;  1FR1 A;  4GDN A;  3ZVT A;  4G3K A;  1YMS A;  3ZG5 A;  5AJG A;  2O9C A;  3C5A A;  3NCK A;  4DDY A;  3UE6 A;  4ARZ A;  3H82 B;  3QNB A;  1XP4 A;  2OOL A;  2OV5 A;  4Y5F A;  3IQA A;  5FAS A;  3T4T A;  5A92 A;  4E3O A;  5EEC A;  4JKT A;  3C30 A;  3KYE A;  3MFD A;  2PU4 A;  2E8I A;  4FTX A;  4YWZ A;  3BJN A;  3EOI A;  2K7S A;  3Q7V B;  1CI8 A;  4R1G A;  5A90 A;  4GHI A;  3TE8 A;  2V1B A;  4WZ4 A;  2XK1 A;  1O07 A;  1OJ5 A;  3PHY A;  4JGQ A;  3UMD A;  2VLG A;  2H0T A;  1XJ6 A;  4MNR A;  1SDN A;  2W1T B;  2G7U A;  1SDE A;  4EET B;  1TEM A;  4PM5 A;  5FL3 A;  3BEB A;  2H10 A;  1K4F A;  3AGF A;  2ZMA A;  2E8J A;  1XX2 A;  4R0Q A;  3HLF A;  4ZBE A;  4WZ5 A;  1MXO A;  3NDE A;  5HZH A;  3ZCZ A;  2A3U A;  3A3F A;  4KQD A;  4I39 A;  5CX7 A;  3R7W A;  2OSU A;  3T1Q B;  5EVI D;  4A5R A;  4B4Z A;  4DE3 A;  5FAQ A;  2Y8H A;  2XH9 A;  4DF6 A;  5GLB A;  1NRJ A;  2DRW A;  4QY5 A;  3D3O A;  2VJW A;  1PRQ A;  2ZOI A;  1Z09 A;  2DCF A;  1H0M A;  1KDS A;  2PT7 A;  3LI8 A;  3W8K A;  2XA7 M;  3MQ0 A;  5A8B A;  3HLE A;  5G4Z A;  1ES4 A;  3C7U A;  2XFT A;  4MBK A;  1H3Q A;  4MBH A;  4UAA A;  2P74 A;  2BTF P;  2W27 A;  3E98 A;  3AGD A;  4PKY G;  3GVB A;  3JVU A;  1BZA A;  3QP6 A;  5EE8 A;  2OLV A;  4GOG A;  4S2N A;  1JTG A;  1LHY A;  4EUZ A;  5F1F A;  4X68 A;  1ES2 A;  2WKH A;  4LV1 A;  4N9L A;  3CAX A;  4OPZ A;  1VET B;  4FSF A;  5EVL A;  2HP5 A;  1SKO B;  5EOO A;  1ZTU A;  3B3X A;  2M7V A;  1CJF A;  4HY8 A;  4KQO A;  3UDX A;  4DE0 A;  3G34 A;  5FQI A;  3DWZ A;  1QMF A;  2Z2L B;  3BY9 A;  2Y2J A;  4F94 A;  1GHP A;  3UB8 A;  1W8Q A;  1YMX A;  4LEN A;  3VP4 A;  3KO6 A;  1YLW A;  3WS0 A;  3BFC A;  1NZU A;  1TVF A;  3BQ8 A;  3CMZ A;  1K57 A;  1D06 A;  1WYB A;  1PIO A;  4KG2 A;  4IBR A;  4MMN A;  2ACG A;  3ZVW A;  3A0R A;  1LT0 A;  4FH2 A;  3QP2 A;  1BLC A;  2EX2 A;  4EES A;  3RTY A;  5HAP A;  2K2N A;  4KZB A;  3W4P A;  1F98 A;  1TS6 A;  4GB7 A;  5FEG A;  4C6Y A;  2Y2O A;  1HVB A;  1MY8 A;  4R3J A;  3G2Z A;  3G4P A;  3T12 B;  1HTZ A;  4PM7 A;  5AQ7 A;  4OON A;  3ULF A;  1NLY A;  4JXS A;  4DXC A;  4JGO A;  1DRM A;  2ZMF A;  3LR4 A;  4PM6 A;  5DKL A;  4KUK A;  1S6R A;  3OCN A;  3TSG A;  1DP9 A;  3N8L A;  2XA7 S;  2V20 A;  5HW3 A;  1RGY A;  2I72 A;  1P9R A;  2HV1 A;  3LGO A;  4HOI A;  1T1C A;  4G3V A;  3HLW A;  2VX8 A;  2WAF A;  2WGW A;  1LI9 A;  4JXV A;  3F1N B;  1YSP A;  2GZA A;  2KOI A;  3LID A;  5DTK A;  1E25 A;  4GD8 A;  1Q2Q A;  5HX9 A;  3BM6 A;  1ONH A;  3OOV A;  3CI6 A;  2B95 A;  3UB5 P;  1VHM A;  1W7F A;  3IWQ A;  5A91 A;  2XR0 A;  2A24 A;  4CPK A;  4PMA A;  5HAQ A;  2KDK A;  2OLU A;  3K3C A;  4X25 A;  2X02 A;  2L4R A;  3ZNT A;  3R4K A;  4IED A;  5DFY A;  1N9L A;  4S2O A;  4EQI A;  1BT5 A;  3VE4 A;  3IWO A;  1NYY A;  1MZU A;  3MQO A;  4XUX A;  4RX2 A;  2ZM2 A;  1OT9 A;  3HLG A;  4X69 A;  3IXG A;  1GSX A;  4X53 A;  4E3J A;  4E3I A;  5F5Y A;  1H8M A;  3LIF A;  4OVD A;  2Y2K A;  2QZ6 A;  5FQ9 A;  2FH5 A;  3U4L P;  2EFU A;  2EWV A;  4E6X A;  3VSL A;  3A0V A;  3UE0 A;  4I5S A;  3OBF A;  5CHU A;  4Z9Q A;  1ZG6 A;  1LSX A;  4DRT A;  4GCZ A;  4L9E A;  2JCH A;  1JNU A;  3ZFZ A;  4DJ2 A;  5F68 A;  4EBN A;  4GN2 A;  1K6R A;  4NXG A;  3UE3 A;  3T50 A;  4DXB A;  3PAG A;  1YLP A;  1IOU A;  3MXQ A;  4LRZ E;  3T4Q A;  2D01 A;  4O7D A;  4ARZ B;  5HPI A;  4S2K A;  2ZBB A;  1V9Y A;  3SW1 A;  3TOI A;  5DKK A;  1PYY A;  4ID4 A;  5CEC A;  3F1O A;  1YM1 A;  4HP9 A;  1XFN A;  1SCW A;  3H9W A;  1EWZ A;  5CTN A;  5AQB A;  3BYD A;  4RYE A;  1OPX A;  4GHI B;  3HUM A;  5I94 A;  2J9P A;  4GD6 A;  2ZC5 B;  4HJ6 A;  3CPT B;  3HVF A;  3BFD A;  3QP1 A;  4LCM A;  2AVX A;  3GRJ A;  3QP8 A;  3BFG A;  3VE3 A;  2XLN A;  3S1Y A;  4I3J A;  4JLF A;  2XQZ A;  2VK3 A;  2XEP A;  4WMC D;  3KX0 X;  4CLC A;  3HCY A;  3JVV A;  2YKF A;  4OPY A;  2FZ0 A;  4R4S A;  3VFH A;  2VV6 A;  3MXS A;  4OKP A;  2VKS A;  2ZC3 B;  3N8R A;  4CLC D;  1TDL A;  3ZG9 B;  2ZM8 A;  3ZG7 B;  1BSG A;  1D1J A;  1OTA A;  4II7 A;  4WEJ A;  1XJ2 A;  4FH4 A;  3R7W B;  1S4S A;  4PKY A;  1YPR A;  2PRF A;  2LB5 A;  4G3W A;  3C2W A;  1P9W A;  3KSI A;  4Q0I A;  2B02 A;  4GNU A;  3IF6 C;  2GX5 A;  4Y7P A;  1LLB A;  2RCX A;  3GSG A;  4OLG A;  2RL3 A;  5HL1 A;  3VOZ A;  3VP3 A;  3BFF A;  1S1Y A;  5AQA A;  3O88 A;  2ZQD A;  1L0D A;  4WM9 A;  1CEG A;  4U0X A;  3MSH A;  3C7V A;  5EUA A;  3DTK A;  2L0W A;  5U47 A;  1RP5 A;  5EM0 A;  4H6J A;  4JPM A;  1CF0 A;  5FAP A;  1H5X A;  3GR2 A;  3NEC A;  5M19 A;  3V50 A;  5FI7 A;  1G6A A;  3CLO A;  2G2W A;  3GTC A;  4JF4 A;  1YLT A;  5HAI A;  4UA7 A;  1XJ3 A;  2Y91 A;  3P01 A;  2ZL1 A;  3FWL A;  5HD3 A;  4UHU A;  3OPL A;  5L07 A;  2XDM A;  3G6O A;  4D60 A;  2C6W B;  1NXY A;  3PBN A;  3PAE A;  2V0W A;  1YLY A;  1Z6F A;  4BMW A;  3MZF A;  4E3M A;  4RVA A;  4BL2 A;  4JXW A;  2VV7 A;  4NET A;  1GHM A;  1ZKJ A;  4NEE D;  2WYX A;  3OPR A;  3E4Q A;  2JKR I;  1NJ4 A;  3NIA A;  3HJI A;  1FSW A;  3LFV A;  2JKR M;  4BL3 A;  1K55 C;  1L0G A;  3UB6 A;  2V8C A;  4LLO B;  1YSQ A;  1KOU A;  3CWF A;  1ONG A;  4HQA A;  5FQK A;  3UN7 A;  5M1A A;  2V8F A;  4B4X A;  4BBU A;  2OAQ 1;  3IS2 A;  3FPV A;  2L1M A;  1W63 Q;  5E2H A;  1G68 A;  5AVE A;  1YT4 A;  3H7W A;  4DE1 A;  2VZW A;  2QYB A;  2GJ3 A;  2HPB A;  3ICY A;  3D4F A;  1W5D A;  4DMZ A;  1QME A;  3A3E A;  1K4E A;  4HP4 A;  2NUP C;  1YQS A;  2ZMV A;  2V0U A;  3TG9 A;  2QPN A;  1NY0 A;  2VGJ A;  4Y0U A;  2ZQ7 A;  2EA9 A;  2P7J A;  3E2K A;  3VP1 A;  3OLO A;  2WGV A;  1E3U D;  2ZC7 A;  1PZO A;  3LUQ A;  4WUJ A;  4OPQ A;  1S4R A;  5EVI A;  3VFF A;  3A3I A;  3RFB A;  3BLS A;  3NOU C;  4S2J A;  1NZO A;  1VM1 A;  2WKQ A;  3AGE A;  4GS9 A;  2C5W B;  4IBX A;  1FIK A;  4JXG A;  3V3R A;  1PZP A;  4NKP A;  3A3D A;  3VP2 A;  3EEH A;  3UME A;  1IYS A;  1D7E A;  4MBF A;  2WGW B;  1PWD A;  5GHX A;  2Y79 A;  4EEU A;  3U2A A;  2PD8 A;  1T1B A;  5L10 A;  1F9I A;  2EX6 A;  4Q8I A;  2EWW A;  1CQA A;  1GHI A;  3HLD A;  1I2S A;  1M40 A;  1PWG A;  2HDS A;  5HDD A;  2XRO A;  1OTE A;  2EXB A;  3UPO A;  4UA6 A;  2HF6 A;  4EEP A;  3WS2 A;  5CED A;  1SKF A;  2G2U A;  2VGL M;  5IHV A;  2J3T D;  3E0Y A;  4WL9 A;  1S66 L;  3S4X A;  4XUZ A;  1UGU A;  1EW0 A;  1F2K A;  4GKU A;  4H8R A;  5TJJ A;  2WKE A;  1KGE A;  3Q82 A;  1FOF A;  3IHB A;  3NDG A;  4KZ3 A;  4P6Z M;  1ES3 A;  4CLC E;  1ERO A;  4O8G A;  4KZ9 A;  4HBU A;  3P98 A;  2HGV A;  5KMW A;  4S2P A;  5HWW A;  2JHE A;  3M6H A;  5FDS A;  3IF5 A;  4KZ6 A;  4FCF A;  4OLD A;  3W4O A;  5DF9 A;  5J7E A;  4MN5 A;  5EV0 A;  2J3T C;  1OTI A;  4ZJ1 A;  4BWI A;  4DJ3 A;  2HZ5 A;  4KUO A;  1XA1 A;  3WS5 A;  2CMN A;  3SS3 A;  3RXW A;  5J8X A;  3IX3 A;  5CGS A;  2WGI A;  5CXW A;  3UB7 A;  5FAO A;  1BLP A;  4C3Q A;  3NUL A;  3PBQ A;  3OPP A;  1MBL A;  2JBF A;  5CGX A;  1DP8 A;  3UDF A;  3H82 A;  4OQI A;  4OQ0 A;  2YKH A;  4Z1W A;  4Y3I A;  1T1A A;  2V1Z A;  3IXB A;  3VSK A;  1DJC A;  2Y2P A;  3V3S A;  4OH0 A;  2UV0 E;  2JN7 A;  2VV8 A;  4O01 A;  4BD0 A;  4E3N A;  5JYP A;  1L0F A;  1XFQ A;  4FOF A;  1E4D A;  1KGG A;  3BEC A;  2PDR A;  4DDS A;  2ZQC A;  4BBV A;  2R9W A;  2WZX A;  1H8Y A;  3C4P A;  5HD5 A;  3IHA A;  1LL5 A;  1ZHH B;  3P09 A;  2KX6 A;  3LIC A;  5CHM A;  3CG5 A;  2ZQ9 A;  1H8Z A;  3F1O B;  1KDW A;  1KVM A; 
#chains in the Genus database with same CATH homology
 3QP4 A;  3QP1 A;  5L09 A;  4Y17 A;  2AVX A;  3QP5 A;  2Q0O A;  3JPU A;  3QP8 A;  5L07 A;  4LGW A;  4Y15 A;  3QP6 A;  3IX4 A;  3QP2 A;  4Y13 A;  4LFU A;  2UV0 E;  3SZT A;  1H0M A;  3IX8 A;  3IX3 A;  1L3L A;  5L10 A;  4NG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...