2AVXA

Solution structure of e coli sdia1-171
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
171
structure length
171
Chain Sequence
b'MSDKDFFSWRRTMLLRFQRMETAEEVYHEIELQAQQLEYDYYSLCVRHPVPFTRPKVAFYTNYPEAWVSYYQAKNFLAIDPVLNPENFSQGHLMWNDDLFSEAQPLWEAARAHGLRRGVTQYLMLPERALGFLSFSRCSAREIPILSDELQLKMQLLVRESLMALMRLNDE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Regulatory protein sdiA
publication title Structure of the Escherichia coli quorum sensing protein SdiA: activation of the folding switch by acyl homoserine lactones.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 49
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2005-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03472 Autoind_bind Autoinducer binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.80 Alpha Beta 2-Layer Sandwich Beta-Lactamase Transcription factor LuxR-like, autoinducer-binding domain 2avxA00
2UV0E 4Y15A 3IX8A 3JPUA 4LFUA 5L07A 3IX3A 4NG2A 3QP8A 3QP6A 3QP1A 4Y13A 3QP5A 4LGWA 5L10A 4Y17A 1L3LA 3IX4A 3QP4A 2Q0OA 1H0MA 3SZTA 5L09A 3QP2A 2AVXA
chains in the Genus database with same CATH superfamily
5F6AA 1UWPX 1NLYA 2B18A 5IS1A 5KIZA 1ZKJA 1E25A 3ZGAB 1XJ6A 4LLOB 2ZBBA 4ME4A 3KYQA 3N4IA 1VEUA 3MXRA 2J80A 5FDSA 1Y54A 3UPNA 1FCOA 3VSKA 4DMZA 4DF6A 2EX8A 4GD8A 1IYQA 3HVFA 3UO9A 3NHQA 4OPYA 3ZG8B 2H28A 4HH3A 1BLCA 3VE3A 3MKFA 1YLPA 3JPUA 4OP8A 2XD5A 4UHUA 2VJWA 1YSQA 1BLHA 4EQIA 3R7WA 3CAXA 1NZOA 3MZFA 5CECA 4PMAA 2VA0A 5A8BA 2G7UA 4KQOA 2H0YA 4RX3A 4EUZA 3QNBA 1VHMA 1HD8A 1X0OA 4DKIA 1M6KA 3AGFA 2WAEA 1W63Q 1YM1A 2PD7A 1LSVA 1DP9A 2PBDP 4CJNA 3UE0A 4JXWA 4L9EA 3IHBA 4E3MA 5HDCA 2EWVA 2HV1A 2XR0A 2ZQ7A 1Z6FA 4EESA 1H8YA 1ZC2A 1T18A 4BWIA 2ZC6B 4JBFA 5DFYA 1TS0A 4ZTKA 3MFDA 5A93A 4N9LA 2UV0E 4Y5FA 3PR6A 5J7EA 2A24A 4Y2FA 3DBAA 1LLBA 3MZEA 2JN7A 3TSGA 1SKFA 3JYIA 1S1YA 4LRYC 5E2EA 1PFLA 3F1OA 2X02A 4LCMA 3ITBA 1A0KA 1ONGA 3C2WA 2XSSA 4MNRA 4PKYG 5FSRA 1BULA 3G4PA 1ZG6A 1K4EA 1FQGA 3P09A 4E3NA 3UY6A 2J3WA 3MJQA 3VOZA 3IWQA 4PAUA 4QWOA 2HP6A 1DJCA 4U0TA 1PW1A 4Y0TA 4HP9A 4MBFA 4R4RA 1NLZA 5E2HA 3UDXA 3NJAA 3T12B 5FI7A 1N9OA 3N8RA 3WS0A 3OPHA 1NYYA 1CJFA 5EPHA 5CEDA 3LUQA 4WYYA 5HD3A 4E3LA 4OPQA 5LBRA 2VGKA 4OVDA 1I2SA 3PXPA 1K6SA 3OCNA 4CLCC 2Z2MB 2GX5A 4EV4A 3VFHA 1XA1A 2VX8A 3T4OA 1L3LA 3VV4A 2HZ5A 3V5MA 2ZD8A 3MBZA 3DWZA 4KZ4A 2WKRA 1OTEA 2CC1A 1F5MA 3VE4A 4IBRA 3LIDA 5TBMA 4DE3A 2J8YA 4GNUA 1JWZA 3IS2A 2ZQCA 4I3JA 1GA9A 2O9BA 3P98A 5FQQA 3LGOA 2B02A 5TJJA 3HLCA 4JXGA 4X1LA 2R9WA 5F69A 2V9AA 3NECA 1OPXA 2G2WA 2I72A 4OH0A 2G2UA 3C4PA 3S22A 4JKTA 2GDNA 3BLMA 2H10A 4GN2A 3NY4A 3HJIA 4Q0JA 2VLGA 1OTIA 1ESUA 5K5BA 2VGJA 1T1CA 2XH9A 4UA6A 1KGEA 3C38A 2ZMAA 3FKWA 3UB9A 3ZG9B 4I3IA 4RX2A 5KSCA 4IVIA 2XGNA 2JKTI 1W8YA 1D7EA 1ONHA 4YWZA 2Z6CA 5EECA 4I39A 3K3DA 4BL3A 1RCJA 4DXBA 4X1MA 1TEMA 1CI8A 4B88A 1PWDA 3WRZA 3A3EA 5FATA 3BFGA 2Q9NA 2ZQ8A 4JGPA 4PM5A 5G18A 2HJEA 2P08A 3IXBA 2ZL1B 1IFQA 2HDSA 5DF7A 3CMZA 4Y13A 4QJGA 5DFXA 3ICYA 3WWXA 4NXFA 1LI0A 3T50A 5CTMA 4ARZB 2Q0OA 1MPLA 3RTYA 4PM7A 1XX2A 4MLLA 3GSGA 1KVLA 3CUEA 3UB8A 1VEUB 4KZ5A 2L1MA 2ZM0A 5FAPA 3WS2A 3VFFA 4F3LA 4I5SA 5M18A 1OT6A 2PR5A 1OJGA 4KG6A 3TG9A 5EUAA 2WAFA 3HLDA 3R7WB 1YT4A 3O3VA 4GDBA 4R4SA 4P0MA 1P9WA 5GHZA 1HTZA 3UNWA 1KOUA 3WRTA 3CWFA 5F1FA 3G30A 2EX6A 1F2KA 2M7UA 3S4XA 2QMIA 4E3JA 2V8FA 1E4DA 4WLAA 4HY8A 3EEHA 3E4PA 1VB6A 5HL6A 4NKPA 5F82A 4N1HA 4KZAA 1YLJA 1BUEA 5DTTA 5J8XA 3GDIA 5J4EA 3ZG0A 1BTLA 1CEGA 3KYEA 3OOVA 3SZTA 4EEUA 4Z1WA 2W27A 1LL5A 3HREA 3HUMA 1JTDA 1L0FA 1XP4A 3MQOA 4PM6A 3PBSA 1PZOA 2KDKA 4BMWA 1VETB 1MKIA 1WA9A 2Q9MA 3BYDA 3TJZC 1G6OA 1IOUA 4P6ZM 2O99A 2VK3A 3BLSA 2HDQA 4HH2A 2V8CA 1NRFA 4BLMA 3DAVA 4LPZA 1K38A 5AJGA 3T1RA 3C7UA 3GECA 1LHYA 3E2LA 5CRFA 3TRCA 3NIAA 1ES5A 3F1OB 3UMDA 1I5QA 3BJNA 3UB7A 4HQAA 4K0WA 2WK0A 1YAXA 1N4OA 3L9KA 4O0PA 1DY6A 1CEFA 4OPRA 3Q07A 1J3WA 1P97A 1S4SA 4OLDA 1K57A 4RVAA 4XXRA 3C4OA 3Q7ZA 1ESIA 2NUTC 2CMNA 1OTBA 3OCLA 1K56D 4Y7PA 5TR7A 1LL9A 2KX6A 2Y59A 3VP0A 2Z6DA 1FCMA 3RFBA 1GCEA 3NBLA 3KSGA 3KSHA 4DJ2A 4JPMA 5DKKA 5CERA 3MKEA 1NJ4A 2PRFA 1ERQA 1ZG4A 2XK1A 2HPBA 1FSYA 3U2AA 4S2LA 2HP5A 1BSGA 1FOFA 2K2NA 2MJ6A 3R4KA 4BBTA 3Q1FA 4HBUA 2L0WA 1O7EA 1GHIA 3JVVA 3KX0X 4GJ4A 1T19A 3EQVA 3IHAA 2ZM2A 3NOTC 3ZHHA 5HPIA 3C7VA 4LFUA 1H5XA 1NZUA 5L07A 3F1NA 2WGIA 4WZ4A 2J3TC 3HLEA 1TS6A 1H0MA 4U3TA 2YKHA 4GKUA 3A0SA 2PD8A 1LSXA 5E2FA 3NC8A 4OQHA 1QMFA 2JKGA 4EXOA 3ZQ5A 4N1XA 3D3OA 4Y0OA 3LR4A 3IWIA 3LY3A 2ZJ9A 2VGLM 3B33A 1MKMA 5KMWA 1DJAA 3MS6A 2LB9A 1DP8A 4KZ8A 5GLAA 5TFQA 5CEBA 4CLCD 5EVEA 4ARZA 3D72A 4GCZA 5HAPA 5EVIA 3PBOA 1RGZA 4PM9A 4DRTA 2K7SA 4WM9A 1PW8A 1MC0A 2QJ7A 1YMSA 4MDZA 4QY6A 3FPWA 3RH8B 3B47A 5M1AA 2ZQAA 1K6RA 2ZC4B 2PU4A 4H8RA 4KZ9A 2ZC3B 1LT0A 1TDLA 2GNXA 1L0DA 2W0NA 3G34A 3ZVTA 1DJBA 5CXWA 4R38A 5A90A 4E3KA 3EWKA 2QHKA 1BLPA 5HX9A 1PI5A 1SHVA 4DDYA 3PBQA 4L9FA 3HUOA 3C5AA 1BLSA 4U0XA 2XDMA 2K31A 3HLGA 2JKFA 5HWTA 3T1SA 3O88A 3ZG7B 2XFSA 1FCNA 2W3GA 4KENB 2ZMVA 4KQQA 1ES2A 1JTGA 2ZC7A 4F3LB 2ZLYA 4CPKA 4R0QA 3SS3A 5FAQA 1JWVA 4Q0IA 3OZHA 2ACGA 3IH9A 3T4KA 3C30A 3HL9A 1CF0A 1VETA 2V20A 3DTKA 4JGRA 1PZPA 4KZ3A 5AQBA 3GRJA 1SCWA 1Q2QA 4NETA 3IXDA 2EA9A 2KOIA 3T4JA 3ZCZA 2Y2JA 3PBTA 2XQZA 2Y4AA 2B5RA 2V2FF 4WZ5A 4JXSA 4JF6A 3EGXC 2ZC5B 3ZNTA 5EV0A 1EROA 4PKYA 4A5RA 3CUEC 2OSUA 4MN7A 4B4ZA 4LRZE 1XPBA 2HDUA 4G3WA 3T4LA 4BBVA 1J9MA 1W8QA 4MBHA 3N8SA 4LCLA 3WS1A 2XLNA 3W2ZA 4BL2A 4BD1A 1JVJA 3G2YA 3IF6A 3BFCA 4IHQA 4ZAMA 1XGIA 5CTNA 3OPRA 4HP4A 5E2GA 2PR6A 2IWBA 3PBRA 1EWZA 4RA7A 3BQ8A 4RYEA 4ETXA 1KDSA 3LIFA 2ZMFA 3HUNA 3LR0A 2GZAA 1LI9A 1MXOA 1PWCA 5HWWA 5JYPA 1FR1A 1V9ZA 5DTKA 5GHXA 2D01A 3LFVA 4KUKA 5DF9A 1ACFA 3SW1A 4WUJA 3E98A 4ETZA 3LI8A 1KDWA 1W63M 2OV5A 1H3QA 1QMEA 5GLDA 1D1JA 4S2PA 4OONA 1SZVA 3EQUA 3ZG5A 2PYRA 4JGQA 4FD8A 1XJ2A 2H0TA 2ZOIA 4WEJA 4WEKA 1XJ4A 4S2OA 1CQAA 4OOYA 2Y55A 4L0LA 3OC2A 5C5KA 1NY0A 2VKSA 4HEFA 1SKOA 4FOFA 3PYPA 3CG5A 5HL1A 4O8GA 4MBKA 4EWFA 2A2LA 2EX9A 5AQ9A 4K0XA 4EW7A 3QP4A 2J9OA 2JC7A 1S1ZA 3S1YA 3KSIA 1K55A 4E6XA 3E2KA 1YSPA 2WKEA 1IKIA 2B95A 2XD1A 1PRQA 2QPNA 1K54A 2Z2LB 3NOUC 2YKFA 4UQIM 5M19A 3JVUA 3E4QA 2JE5A 3F1NB 4X68A 4EETB 3QHYA 1NYMA 2PAVP 2HF6A 4P6ZS 2A3UA 2WKHA 1P9RA 4K08A 4E6WA 1SDEA 3UDFA 2J7VA 4X25A 4O7DA 5EOEA 3Q7VA 4C6YA 3GMWA 1MWTA 2C5WB 3MR0A 3FYZA 5HAIA 4L9GA 4B9OA 4DDSA 4II7A 2Y2OA 3UN7A 5DVAA 4XUZA 4UAAA 4GB7A 4NEED 5F68A 3ZDJA 5EVIB 1F98A 5FDHA 3MQ0A 4Q8IA 3G6OA 5L2FA 4GS9A 4XT2B 3FWLA 2WGWB 3A0VA 3H9WA 1E3UA 3PHYA 2PBYA 1G68A 3QP6A 4IBXA 3VSLA 3BW6A 1MWUA 2J3TD 1ODVA 2P74A 5FEGA 3DTIA 2FFYA 3L7HA 3E4OA 1IELA 3IWOA 3O5YA 1XFQA 4HNBA 3IXHA 3IQAA 3LEZA 3AGDA 5FA7A 3HLWA 1LSWA 1BT5A 3LR5A 4UA9A 1PYYA 2XA7M 1IYPA 4GZBA 3ZFZA 1L0GA 3CITA 3EGDC 4OOLA 5L10A 3FZCA 3C8CA 2P7JA 3IX4A 4X69A 5HD5A 4MN5A 4OPZA 3Q82A 4ZJ2A 3IT9A 2VV6A 1N9NA 1BYWA 2WYXA 4MEZA 4FCFA 4PPRA 4EBLA 4QB8A 1TDGA 4LENA 3M6HA 3PAGA 5IU1A 4Y17A 4EUVA 3MF0A 4Y0UA 4R23A 5CX7A 4BENA 4EQ1A 2JBFA 4EEPA 2ZOHA 4KQDA 2VGLS 1PIOA 3S7NA 2Y2QA 3EEAA 4RQ9A 1CI9A 4QHCA 4OKPA 5HSQA 3SOIA 1YKDA 1WE4A 4WF0A 1XFNA 1LL8A 5GL9A 4QPRA 5HZHA 4WBGA 2QZ6A 2QJ5A 2WGVA 1YPRA 2H5SA 2O0YA 1XGJA 1STZA 1IEMA 5HWVA 3LCEA 3NI9A 1RGYA 3G35A 4D60A 2EFXA 1NWZA 4P87A 4IEDA 1YLZA 3IF6B 3V39A 3GQZA 1C3BA 5AQAA 1V9YA 4HOIA 3BEBA 2INWA 4NG2A 2OWJA 1Q2PA 3ULFA 3T1QB 5IT5A 1FR6A 2QYBA 3VP1A 3RXWA 3W4QA 1TS7A 3DTMA 4DE2A 3IF5A 2QWSA 4WZ5C 3V3RA 3BFFA 3BWLA 2VZWA 3H82B 3UDIA 3KO6A 5HPFA 1KE3A 2V0WA 3LO7A 4IJGA 3MQQA 3K2NA 2W1TB 4H6JB 3H7WB 2M7VA 2Y2PA 1NRJA 1W79A 2Y2KA 2Y2MA 1K4FA 2RL3A 1HZOA 2IA2A 1PWGA 3T4QA 2FFFB 3QP1A 3LR3A 2XROA 4F94A 2E8IA 2WZXA 4X53A 1SKOB 3RXXA 2DMWA 1MWSA 4EERA 3KYZA 3A3FA 3IBJA 1KGFA 3RJUA 1T1BA 2JKRM 3SH7A 1XJ3A 2R9XA 4FH4A 2A49A 3LICA 5D3OA 3KSFA 2VV8A 4S2NA 4YOFA 4YINA 2EFUA 2QKPA 3FV7A 3W4PA 2WKPA 1MWRA 4WELA 4JXVA 4NXBA 3LY4A 3VOYA 4YFMA 2VV7A 1S67L 2NUPC 4FSFA 3A3IA 4GLQA 4XT2A 4HJ3A 2WGWA 4ESPA 2W3FA 2Y91A 5HARA 5HAQA 4EU0A 5GLBA 4ZDXA 1GHMA 2IWCA 3FC7A 5U47A 5EFWA 2RCXA 4QD4A 1WYBA 1ALQA 4WMCD 3Q7VB 5HFOA 3UE6A 1OTAA 1K55C 4DE0A 3AGEA 1DP6A 1IKGA 4Y3IA 5CHJA 1EI5A 4HBTA 3OPPA 4K91A 1GA0A 4EBNA 5BOHA 4OQ0A 3UE1A 1EW0A 3P7NA 1K54C 4S2JA 4FH2A 1L0EA 4GS9B 2O9CA 2HGVA 3WS4A 1O07A 1G6AA 2PT7A 5CGXA 4C75A 5EVLA 2ZM8A 3A3JA 1VQQA 3UB5P 1YMXA 2V0UA 5F83A 3VP2A 5HDDA 4X6TA 2BG1A 4Q0HA 3BFEA 3W4OA 4QY5A 3MXSA 4E3OA 3M2KA 3NOPC 4R70A 4NXEA 1ZHHB 1KE4A 1OTDA 3MFXA 4HJ4A 4G3VA 5G4YA 1HVBA 1KGGA 2X71A 4UQIS 4LGWA 1CK3A 3U4LP 2OAP1 3IXGA 3FG8A 4ZBEA 1YLYA 3A0RA 4M4XA 3OLOA 5GHYA 3GTCA 3FKVA 3S7QA 1Y28A 3MXQA 3B42A 4PM8A 3MMHA 4Z9QA 4HHDA 2WKQA 4S2KA 1JWPA 5DKLA 4OP5A 4DJ3A 3G2ZA 3T1XA 3QNCA 4G3KA 1IYSA 1OT9A 4MCWA 3IBRA 3HLFA 2V1BA 2P9VA 4BJPA 1HLUP 2IWDA 4CQHA 4UEYA 4QU3A 4CLCB 3CHWP 3W8KA 1VM1A 3BRMA 4GD6A 3D9YA 1BZAA 3UB6A 4R6LA 5HDSA 1AWIA 5HW3A 5G4ZA 4B93A 3G32A 4ZRRA 5EVID 2W1RA 4N9KA 5EOOA 3H82A 2M1CA 1DRMA 3IH8A 3FPVA 4M3KA 3P01A 4H6JA 2W1TA 2FZ0A 3F1PA 2W3EA 3BY9A 1GHPA 3H7WA 4GW9A 5FI6A 2Y2GA 4XUXA 1D06A 4UA7A 1TVFA 3GV9A 1XA7A 5EM1A 1UGUA 5FL3A 3TOIA 2PYPA 4OLGA 2XA7S 2Y79A 2FH5A 3LYXA 2C6WB 2EWWA 4AFIA 2XF3A 5TGFA 1MBLA 2V1ZA 1FIKA 4MN6A 1K0KA 1TS8A 5A91A 1ERMA 3ISGA 1S6RA 4LRXC 3UE3A 1OJ5A 2OAQ1 1ES3A 1KVMA 3CPTA 2DRWA 3IX3A 5FQ9A 1Y4OA 2P04A 4YNRA 3BECA 3MSHA 4GDNA 1ZTUA 2Y2NA 1K57C 1IYOA 3SS5A 3GVBA 1RP5A 3N8LA 5E43A 3B3XA 3CI6A 5FQJA 4BD0A 5JYOA 2X01A 3NDGA 3UPPA 3K3CA 4E04A 3TW8A 2UWXA 3M2JA 2WADA 4HI4A 1S0WA 3G31A 2WZZA 3ITAA 4KZ6A 2PDRA 1FSWA 4S2IA 3ZNYA 1OMEA 4JLFA 4NK3A 4LV2A 3SS4A 4LV1A 4IVKA 3NULA 2BTFP 1UWNX 5FEFA 2JKRI 3DTEA 5CHUA 4PHTA 1N9LA 3DWKA 3QP5A 2HDRA 3ZYTA 3SH9A 1K56A 2JCHA 4ZJ3A 5EM0A 2OLUA 4R1GA 4GHIB 4R3JA 3CZDA 3BY8A 4IUHA 1Z09A 2OWHA 1F9IA 4DXCA 4FTXA 5KZHA 4FUWA 3A3DA 1N9BA 5L8MA 4N92A 2D02A 4S2MA 3N7WA 4X56A 1XXMA 1TD5A 5DF8A 1SDNA 2I9VA 5IHVA 1H8MA 2J9PA 4I38A 1P0ZA 2EXBA 1H8ZA 2V1AA 3PAEA 1U60A 3T4TA 5CHMA 5MC7A 3UMEA 4I3AA 3MZDA 3VOLA 2PHYA 5FQMA 4KZBA 5FI2A 3LIAA 4S2NC 2KLIA 1AXBA 5FASA 3QP2A 5I94A 5F5YA 5EVIC 3HCYA 4OQIA 2EXAA 1K25A 2WUQA 1XKZA 2Y8HA 1YLTA 3V50A 1KE0A 2BLSA 4MMNA 4P6BA 3CJMA 3O87A 4NXGA 4OQGA 5L09A 4KG2A 4R3AA 3WS5A 4KUOA 4GOGA 1YQSA 5AQ7A 5DJTA 3LEQA 4O01A 3S7PA 4LV0A 4JF5A 4CLCA 1PNEA 4DN0A 5CGSA 2HP9A 1S66L 3BM6A 4EBPA 4CLCE 3I7JA 4Y15A 3IX8A 3D4FA 3UPOA 2DNSA 1GSVA 1NXYA 5DTSA 2DCFA 3V3SA 2BASA 5FQKA 3BQAA 2Y2LA 2ZQDA 3PBNA 3HJKA 2JHEA 3NCKA 3PTEA 2A24B 4E3IA 2OOLA 2XFTA 4JGOA 4R3BA 2VEAA 4WMCA 4BBUA 3OBFA 1GSXA 3VP4A 5KSHA 2L4RA 1TF1A 2Y2IA 3BFDA 3TE8A 4D2OA 2W3DA 2O9AA 3N6IA 3T4SA 2P9VB 4B4XA 1G5UA 2PU2A 1MY8A 3OPLA 4KZ7A 1FILA 5AVEA 2ZQ9A 3CLOA 3LIBA 2E8JA 3HLBA 5FAOA 3S7OA 3LI9A 4OOMA 2LB5A 2R78A 1G28A 3NDEA 3ZVWA 1PI4A 3LIEA 4KG5A 4LV3A 4HESA 3F1PB 3VP3A 1E3UD 2AVXA 2GJ3A 5DJUA 1YLWA 1ES4A 3SH8A 1W7FA 1S4RA 4ID4A 5I5LA 3IF6C 4JF4A 3VMAA 4KQRA 1WYCA 4HIAA 5EE8A 3O86A 1M40A 3V67A 4IUKA 1L2SA 4DE1A 3EOIA 5FQIA 2JKTM 1MZUA 3E0YA 1T1AA 2XRNA 3DW0A 1GSWA 4X55A 5AVFA 2XEPA 4HJ6A 2WKIA 5J3WA 2EX2A 4BQMA 5A92A 5TBMB 3CPTB 1I2WA 3HBRA 4WL9A 5GLCA 3IS2B 3M6BA 2Y2HA 1JNUA 3QP8A 2HJ9C 2W3HA 4ZJ1A 4GHIA 4C3QA 3Q81A 1W5DA 5F1GA 4WN5A 4P85A 2ZL1A 3GR2A 2OLVA 5CGWA
chains in the Genus database with same CATH topology
2UV0E 4Y15A 3IX8A 3JPUA 4LFUA 5L07A 3IX3A 4NG2A 3QP8A 3QP6A 3QP1A 4Y13A 3QP5A 4LGWA 5L10A 4Y17A 1L3LA 3IX4A 3QP4A 2Q0OA 1H0MA 3SZTA 5L09A 3QP2A 2AVXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UV0 E;  4Y15 A;  3IX8 A;  3JPU A;  4LFU A;  5L07 A;  3IX3 A;  4NG2 A;  3QP8 A;  3QP6 A;  3QP1 A;  4Y13 A;  3QP5 A;  4LGW A;  5L10 A;  4Y17 A;  1L3L A;  3IX4 A;  3QP4 A;  2Q0O A;  1H0M A;  3SZT A;  5L09 A;  3QP2 A;  2AVX A; 
#chains in the Genus database with same CATH topology
 5F6A A;  1UWP X;  1NLY A;  2B18 A;  5IS1 A;  5KIZ A;  1ZKJ A;  1E25 A;  3ZGA B;  1XJ6 A;  4LLO B;  2ZBB A;  4ME4 A;  3KYQ A;  3N4I A;  1VEU A;  3MXR A;  2J80 A;  5FDS A;  1Y54 A;  3UPN A;  1FCO A;  3VSK A;  4DMZ A;  4DF6 A;  2EX8 A;  4GD8 A;  1IYQ A;  3HVF A;  3UO9 A;  3NHQ A;  4OPY A;  3ZG8 B;  2H28 A;  4HH3 A;  1BLC A;  3VE3 A;  3MKF A;  1YLP A;  3JPU A;  4OP8 A;  2XD5 A;  4UHU A;  2VJW A;  1YSQ A;  1BLH A;  4EQI A;  3R7W A;  3CAX A;  1NZO A;  3MZF A;  5CEC A;  4PMA A;  2VA0 A;  5A8B A;  2G7U A;  4KQO A;  2H0Y A;  4RX3 A;  4EUZ A;  3QNB A;  1VHM A;  1HD8 A;  1X0O A;  4DKI A;  1M6K A;  3AGF A;  2WAE A;  1W63 Q;  1YM1 A;  2PD7 A;  1LSV A;  1DP9 A;  2PBD P;  4CJN A;  3UE0 A;  4JXW A;  4L9E A;  3IHB A;  4E3M A;  5HDC A;  2EWV A;  2HV1 A;  2XR0 A;  2ZQ7 A;  1Z6F A;  4EES A;  1H8Y A;  1ZC2 A;  1T18 A;  4BWI A;  2ZC6 B;  4JBF A;  5DFY A;  1TS0 A;  4ZTK A;  3MFD A;  5A93 A;  4N9L A;  2UV0 E;  4Y5F A;  3PR6 A;  5J7E A;  2A24 A;  4Y2F A;  3DBA A;  1LLB A;  3MZE A;  2JN7 A;  3TSG A;  1SKF A;  3JYI A;  1S1Y A;  4LRY C;  5E2E A;  1PFL A;  3F1O A;  2X02 A;  4LCM A;  3ITB A;  1A0K A;  1ONG A;  3C2W A;  2XSS A;  4MNR A;  4PKY G;  5FSR A;  1BUL A;  3G4P A;  1ZG6 A;  1K4E A;  1FQG A;  3P09 A;  4E3N A;  3UY6 A;  2J3W A;  3MJQ A;  3VOZ A;  3IWQ A;  4PAU A;  4QWO A;  2HP6 A;  1DJC A;  4U0T A;  1PW1 A;  4Y0T A;  4HP9 A;  4MBF A;  4R4R A;  1NLZ A;  5E2H A;  3UDX A;  3NJA A;  3T12 B;  5FI7 A;  1N9O A;  3N8R A;  3WS0 A;  3OPH A;  1NYY A;  1CJF A;  5EPH A;  5CED A;  3LUQ A;  4WYY A;  5HD3 A;  4E3L A;  4OPQ A;  5LBR A;  2VGK A;  4OVD A;  1I2S A;  3PXP A;  1K6S A;  3OCN A;  4CLC C;  2Z2M B;  2GX5 A;  4EV4 A;  3VFH A;  1XA1 A;  2VX8 A;  3T4O A;  1L3L A;  3VV4 A;  2HZ5 A;  3V5M A;  2ZD8 A;  3MBZ A;  3DWZ A;  4KZ4 A;  2WKR A;  1OTE A;  2CC1 A;  1F5M A;  3VE4 A;  4IBR A;  3LID A;  5TBM A;  4DE3 A;  2J8Y A;  4GNU A;  1JWZ A;  3IS2 A;  2ZQC A;  4I3J A;  1GA9 A;  2O9B A;  3P98 A;  5FQQ A;  3LGO A;  2B02 A;  5TJJ A;  3HLC A;  4JXG A;  4X1L A;  2R9W A;  5F69 A;  2V9A A;  3NEC A;  1OPX A;  2G2W A;  2I72 A;  4OH0 A;  2G2U A;  3C4P A;  3S22 A;  4JKT A;  2GDN A;  3BLM A;  2H10 A;  4GN2 A;  3NY4 A;  3HJI A;  4Q0J A;  2VLG A;  1OTI A;  1ESU A;  5K5B A;  2VGJ A;  1T1C A;  2XH9 A;  4UA6 A;  1KGE A;  3C38 A;  2ZMA A;  3FKW A;  3UB9 A;  3ZG9 B;  4I3I A;  4RX2 A;  5KSC A;  4IVI A;  2XGN A;  2JKT I;  1W8Y A;  1D7E A;  1ONH A;  4YWZ A;  2Z6C A;  5EEC A;  4I39 A;  3K3D A;  4BL3 A;  1RCJ A;  4DXB A;  4X1M A;  1TEM A;  1CI8 A;  4B88 A;  1PWD A;  3WRZ A;  3A3E A;  5FAT A;  3BFG A;  2Q9N A;  2ZQ8 A;  4JGP A;  4PM5 A;  5G18 A;  2HJE A;  2P08 A;  3IXB A;  2ZL1 B;  1IFQ A;  2HDS A;  5DF7 A;  3CMZ A;  4Y13 A;  4QJG A;  5DFX A;  3ICY A;  3WWX A;  4NXF A;  1LI0 A;  3T50 A;  5CTM A;  4ARZ B;  2Q0O A;  1MPL A;  3RTY A;  4PM7 A;  1XX2 A;  4MLL A;  3GSG A;  1KVL A;  3CUE A;  3UB8 A;  1VEU B;  4KZ5 A;  2L1M A;  2ZM0 A;  5FAP A;  3WS2 A;  3VFF A;  4F3L A;  4I5S A;  5M18 A;  1OT6 A;  2PR5 A;  1OJG A;  4KG6 A;  3TG9 A;  5EUA A;  2WAF A;  3HLD A;  3R7W B;  1YT4 A;  3O3V A;  4GDB A;  4R4S A;  4P0M A;  1P9W A;  5GHZ A;  1HTZ A;  3UNW A;  1KOU A;  3WRT A;  3CWF A;  5F1F A;  3G30 A;  2EX6 A;  1F2K A;  2M7U A;  3S4X A;  2QMI A;  4E3J A;  2V8F A;  1E4D A;  4WLA A;  4HY8 A;  3EEH A;  3E4P A;  1VB6 A;  5HL6 A;  4NKP A;  5F82 A;  4N1H A;  4KZA A;  1YLJ A;  1BUE A;  5DTT A;  5J8X A;  3GDI A;  5J4E A;  3ZG0 A;  1BTL A;  1CEG A;  3KYE A;  3OOV A;  3SZT A;  4EEU A;  4Z1W A;  2W27 A;  1LL5 A;  3HRE A;  3HUM A;  1JTD A;  1L0F A;  1XP4 A;  3MQO A;  4PM6 A;  3PBS A;  1PZO A;  2KDK A;  4BMW A;  1VET B;  1MKI A;  1WA9 A;  2Q9M A;  3BYD A;  3TJZ C;  1G6O A;  1IOU A;  4P6Z M;  2O99 A;  2VK3 A;  3BLS A;  2HDQ A;  4HH2 A;  2V8C A;  1NRF A;  4BLM A;  3DAV A;  4LPZ A;  1K38 A;  5AJG A;  3T1R A;  3C7U A;  3GEC A;  1LHY A;  3E2L A;  5CRF A;  3TRC A;  3NIA A;  1ES5 A;  3F1O B;  3UMD A;  1I5Q A;  3BJN A;  3UB7 A;  4HQA A;  4K0W A;  2WK0 A;  1YAX A;  1N4O A;  3L9K A;  4O0P A;  1DY6 A;  1CEF A;  4OPR A;  3Q07 A;  1J3W A;  1P97 A;  1S4S A;  4OLD A;  1K57 A;  4RVA A;  4XXR A;  3C4O A;  3Q7Z A;  1ESI A;  2NUT C;  2CMN A;  1OTB A;  3OCL A;  1K56 D;  4Y7P A;  5TR7 A;  1LL9 A;  2KX6 A;  2Y59 A;  3VP0 A;  2Z6D A;  1FCM A;  3RFB A;  1GCE A;  3NBL A;  3KSG A;  3KSH A;  4DJ2 A;  4JPM A;  5DKK A;  5CER A;  3MKE A;  1NJ4 A;  2PRF A;  1ERQ A;  1ZG4 A;  2XK1 A;  2HPB A;  1FSY A;  3U2A A;  4S2L A;  2HP5 A;  1BSG A;  1FOF A;  2K2N A;  2MJ6 A;  3R4K A;  4BBT A;  3Q1F A;  4HBU A;  2L0W A;  1O7E A;  1GHI A;  3JVV A;  3KX0 X;  4GJ4 A;  1T19 A;  3EQV A;  3IHA A;  2ZM2 A;  3NOT C;  3ZHH A;  5HPI A;  3C7V A;  4LFU A;  1H5X A;  1NZU A;  5L07 A;  3F1N A;  2WGI A;  4WZ4 A;  2J3T C;  3HLE A;  1TS6 A;  1H0M A;  4U3T A;  2YKH A;  4GKU A;  3A0S A;  2PD8 A;  1LSX A;  5E2F A;  3NC8 A;  4OQH A;  1QMF A;  2JKG A;  4EXO A;  3ZQ5 A;  4N1X A;  3D3O A;  4Y0O A;  3LR4 A;  3IWI A;  3LY3 A;  2ZJ9 A;  2VGL M;  3B33 A;  1MKM A;  5KMW A;  1DJA A;  3MS6 A;  2LB9 A;  1DP8 A;  4KZ8 A;  5GLA A;  5TFQ A;  5CEB A;  4CLC D;  5EVE A;  4ARZ A;  3D72 A;  4GCZ A;  5HAP A;  5EVI A;  3PBO A;  1RGZ A;  4PM9 A;  4DRT A;  2K7S A;  4WM9 A;  1PW8 A;  1MC0 A;  2QJ7 A;  1YMS A;  4MDZ A;  4QY6 A;  3FPW A;  3RH8 B;  3B47 A;  5M1A A;  2ZQA A;  1K6R A;  2ZC4 B;  2PU4 A;  4H8R A;  4KZ9 A;  2ZC3 B;  1LT0 A;  1TDL A;  2GNX A;  1L0D A;  2W0N A;  3G34 A;  3ZVT A;  1DJB A;  5CXW A;  4R38 A;  5A90 A;  4E3K A;  3EWK A;  2QHK A;  1BLP A;  5HX9 A;  1PI5 A;  1SHV A;  4DDY A;  3PBQ A;  4L9F A;  3HUO A;  3C5A A;  1BLS A;  4U0X A;  2XDM A;  2K31 A;  3HLG A;  2JKF A;  5HWT A;  3T1S A;  3O88 A;  3ZG7 B;  2XFS A;  1FCN A;  2W3G A;  4KEN B;  2ZMV A;  4KQQ A;  1ES2 A;  1JTG A;  2ZC7 A;  4F3L B;  2ZLY A;  4CPK A;  4R0Q A;  3SS3 A;  5FAQ A;  1JWV A;  4Q0I A;  3OZH A;  2ACG A;  3IH9 A;  3T4K A;  3C30 A;  3HL9 A;  1CF0 A;  1VET A;  2V20 A;  3DTK A;  4JGR A;  1PZP A;  4KZ3 A;  5AQB A;  3GRJ A;  1SCW A;  1Q2Q A;  4NET A;  3IXD A;  2EA9 A;  2KOI A;  3T4J A;  3ZCZ A;  2Y2J A;  3PBT A;  2XQZ A;  2Y4A A;  2B5R A;  2V2F F;  4WZ5 A;  4JXS A;  4JF6 A;  3EGX C;  2ZC5 B;  3ZNT A;  5EV0 A;  1ERO A;  4PKY A;  4A5R A;  3CUE C;  2OSU A;  4MN7 A;  4B4Z A;  4LRZ E;  1XPB A;  2HDU A;  4G3W A;  3T4L A;  4BBV A;  1J9M A;  1W8Q A;  4MBH A;  3N8S A;  4LCL A;  3WS1 A;  2XLN A;  3W2Z A;  4BL2 A;  4BD1 A;  1JVJ A;  3G2Y A;  3IF6 A;  3BFC A;  4IHQ A;  4ZAM A;  1XGI A;  5CTN A;  3OPR A;  4HP4 A;  5E2G A;  2PR6 A;  2IWB A;  3PBR A;  1EWZ A;  4RA7 A;  3BQ8 A;  4RYE A;  4ETX A;  1KDS A;  3LIF A;  2ZMF A;  3HUN A;  3LR0 A;  2GZA A;  1LI9 A;  1MXO A;  1PWC A;  5HWW A;  5JYP A;  1FR1 A;  1V9Z A;  5DTK A;  5GHX A;  2D01 A;  3LFV A;  4KUK A;  5DF9 A;  1ACF A;  3SW1 A;  4WUJ A;  3E98 A;  4ETZ A;  3LI8 A;  1KDW A;  1W63 M;  2OV5 A;  1H3Q A;  1QME A;  5GLD A;  1D1J A;  4S2P A;  4OON A;  1SZV A;  3EQU A;  3ZG5 A;  2PYR A;  4JGQ A;  4FD8 A;  1XJ2 A;  2H0T A;  2ZOI A;  4WEJ A;  4WEK A;  1XJ4 A;  4S2O A;  1CQA A;  4OOY A;  2Y55 A;  4L0L A;  3OC2 A;  5C5K A;  1NY0 A;  2VKS A;  4HEF A;  1SKO A;  4FOF A;  3PYP A;  3CG5 A;  5HL1 A;  4O8G A;  4MBK A;  4EWF A;  2A2L A;  2EX9 A;  5AQ9 A;  4K0X A;  4EW7 A;  3QP4 A;  2J9O A;  2JC7 A;  1S1Z A;  3S1Y A;  3KSI A;  1K55 A;  4E6X A;  3E2K A;  1YSP A;  2WKE A;  1IKI A;  2B95 A;  2XD1 A;  1PRQ A;  2QPN A;  1K54 A;  2Z2L B;  3NOU C;  2YKF A;  4UQI M;  5M19 A;  3JVU A;  3E4Q A;  2JE5 A;  3F1N B;  4X68 A;  4EET B;  3QHY A;  1NYM A;  2PAV P;  2HF6 A;  4P6Z S;  2A3U A;  2WKH A;  1P9R A;  4K08 A;  4E6W A;  1SDE A;  3UDF A;  2J7V A;  4X25 A;  4O7D A;  5EOE A;  3Q7V A;  4C6Y A;  3GMW A;  1MWT A;  2C5W B;  3MR0 A;  3FYZ A;  5HAI A;  4L9G A;  4B9O A;  4DDS A;  4II7 A;  2Y2O A;  3UN7 A;  5DVA A;  4XUZ A;  4UAA A;  4GB7 A;  4NEE D;  5F68 A;  3ZDJ A;  5EVI B;  1F98 A;  5FDH A;  3MQ0 A;  4Q8I A;  3G6O A;  5L2F A;  4GS9 A;  4XT2 B;  3FWL A;  2WGW B;  3A0V A;  3H9W A;  1E3U A;  3PHY A;  2PBY A;  1G68 A;  3QP6 A;  4IBX A;  3VSL A;  3BW6 A;  1MWU A;  2J3T D;  1ODV A;  2P74 A;  5FEG A;  3DTI A;  2FFY A;  3L7H A;  3E4O A;  1IEL A;  3IWO A;  3O5Y A;  1XFQ A;  4HNB A;  3IXH A;  3IQA A;  3LEZ A;  3AGD A;  5FA7 A;  3HLW A;  1LSW A;  1BT5 A;  3LR5 A;  4UA9 A;  1PYY A;  2XA7 M;  1IYP A;  4GZB A;  3ZFZ A;  1L0G A;  3CIT A;  3EGD C;  4OOL A;  5L10 A;  3FZC A;  3C8C A;  2P7J A;  3IX4 A;  4X69 A;  5HD5 A;  4MN5 A;  4OPZ A;  3Q82 A;  4ZJ2 A;  3IT9 A;  2VV6 A;  1N9N A;  1BYW A;  2WYX A;  4MEZ A;  4FCF A;  4PPR A;  4EBL A;  4QB8 A;  1TDG A;  4LEN A;  3M6H A;  3PAG A;  5IU1 A;  4Y17 A;  4EUV A;  3MF0 A;  4Y0U A;  4R23 A;  5CX7 A;  4BEN A;  4EQ1 A;  2JBF A;  4EEP A;  2ZOH A;  4KQD A;  2VGL S;  1PIO A;  3S7N A;  2Y2Q A;  3EEA A;  4RQ9 A;  1CI9 A;  4QHC A;  4OKP A;  5HSQ A;  3SOI A;  1YKD A;  1WE4 A;  4WF0 A;  1XFN A;  1LL8 A;  5GL9 A;  4QPR A;  5HZH A;  4WBG A;  2QZ6 A;  2QJ5 A;  2WGV A;  1YPR A;  2H5S A;  2O0Y A;  1XGJ A;  1STZ A;  1IEM A;  5HWV A;  3LCE A;  3NI9 A;  1RGY A;  3G35 A;  4D60 A;  2EFX A;  1NWZ A;  4P87 A;  4IED A;  1YLZ A;  3IF6 B;  3V39 A;  3GQZ A;  1C3B A;  5AQA A;  1V9Y A;  4HOI A;  3BEB A;  2INW A;  4NG2 A;  2OWJ A;  1Q2P A;  3ULF A;  3T1Q B;  5IT5 A;  1FR6 A;  2QYB A;  3VP1 A;  3RXW A;  3W4Q A;  1TS7 A;  3DTM A;  4DE2 A;  3IF5 A;  2QWS A;  4WZ5 C;  3V3R A;  3BFF A;  3BWL A;  2VZW A;  3H82 B;  3UDI A;  3KO6 A;  5HPF A;  1KE3 A;  2V0W A;  3LO7 A;  4IJG A;  3MQQ A;  3K2N A;  2W1T B;  4H6J B;  3H7W B;  2M7V A;  2Y2P A;  1NRJ A;  1W79 A;  2Y2K A;  2Y2M A;  1K4F A;  2RL3 A;  1HZO A;  2IA2 A;  1PWG A;  3T4Q A;  2FFF B;  3QP1 A;  3LR3 A;  2XRO A;  4F94 A;  2E8I A;  2WZX A;  4X53 A;  1SKO B;  3RXX A;  2DMW A;  1MWS A;  4EER A;  3KYZ A;  3A3F A;  3IBJ A;  1KGF A;  3RJU A;  1T1B A;  2JKR M;  3SH7 A;  1XJ3 A;  2R9X A;  4FH4 A;  2A49 A;  3LIC A;  5D3O A;  3KSF A;  2VV8 A;  4S2N A;  4YOF A;  4YIN A;  2EFU A;  2QKP A;  3FV7 A;  3W4P A;  2WKP A;  1MWR A;  4WEL A;  4JXV A;  4NXB A;  3LY4 A;  3VOY A;  4YFM A;  2VV7 A;  1S67 L;  2NUP C;  4FSF A;  3A3I A;  4GLQ A;  4XT2 A;  4HJ3 A;  2WGW A;  4ESP A;  2W3F A;  2Y91 A;  5HAR A;  5HAQ A;  4EU0 A;  5GLB A;  4ZDX A;  1GHM A;  2IWC A;  3FC7 A;  5U47 A;  5EFW A;  2RCX A;  4QD4 A;  1WYB A;  1ALQ A;  4WMC D;  3Q7V B;  5HFO A;  3UE6 A;  1OTA A;  1K55 C;  4DE0 A;  3AGE A;  1DP6 A;  1IKG A;  4Y3I A;  5CHJ A;  1EI5 A;  4HBT A;  3OPP A;  4K91 A;  1GA0 A;  4EBN A;  5BOH A;  4OQ0 A;  3UE1 A;  1EW0 A;  3P7N A;  1K54 C;  4S2J A;  4FH2 A;  1L0E A;  4GS9 B;  2O9C A;  2HGV A;  3WS4 A;  1O07 A;  1G6A A;  2PT7 A;  5CGX A;  4C75 A;  5EVL A;  2ZM8 A;  3A3J A;  1VQQ A;  3UB5 P;  1YMX A;  2V0U A;  5F83 A;  3VP2 A;  5HDD A;  4X6T A;  2BG1 A;  4Q0H A;  3BFE A;  3W4O A;  4QY5 A;  3MXS A;  4E3O A;  3M2K A;  3NOP C;  4R70 A;  4NXE A;  1ZHH B;  1KE4 A;  1OTD A;  3MFX A;  4HJ4 A;  4G3V A;  5G4Y A;  1HVB A;  1KGG A;  2X71 A;  4UQI S;  4LGW A;  1CK3 A;  3U4L P;  2OAP 1;  3IXG A;  3FG8 A;  4ZBE A;  1YLY A;  3A0R A;  4M4X A;  3OLO A;  5GHY A;  3GTC A;  3FKV A;  3S7Q A;  1Y28 A;  3MXQ A;  3B42 A;  4PM8 A;  3MMH A;  4Z9Q A;  4HHD A;  2WKQ A;  4S2K A;  1JWP A;  5DKL A;  4OP5 A;  4DJ3 A;  3G2Z A;  3T1X A;  3QNC A;  4G3K A;  1IYS A;  1OT9 A;  4MCW A;  3IBR A;  3HLF A;  2V1B A;  2P9V A;  4BJP A;  1HLU P;  2IWD A;  4CQH A;  4UEY A;  4QU3 A;  4CLC B;  3CHW P;  3W8K A;  1VM1 A;  3BRM A;  4GD6 A;  3D9Y A;  1BZA A;  3UB6 A;  4R6L A;  5HDS A;  1AWI A;  5HW3 A;  5G4Z A;  4B93 A;  3G32 A;  4ZRR A;  5EVI D;  2W1R A;  4N9K A;  5EOO A;  3H82 A;  2M1C A;  1DRM A;  3IH8 A;  3FPV A;  4M3K A;  3P01 A;  4H6J A;  2W1T A;  2FZ0 A;  3F1P A;  2W3E A;  3BY9 A;  1GHP A;  3H7W A;  4GW9 A;  5FI6 A;  2Y2G A;  4XUX A;  1D06 A;  4UA7 A;  1TVF A;  3GV9 A;  1XA7 A;  5EM1 A;  1UGU A;  5FL3 A;  3TOI A;  2PYP A;  4OLG A;  2XA7 S;  2Y79 A;  2FH5 A;  3LYX A;  2C6W B;  2EWW A;  4AFI A;  2XF3 A;  5TGF A;  1MBL A;  2V1Z A;  1FIK A;  4MN6 A;  1K0K A;  1TS8 A;  5A91 A;  1ERM A;  3ISG A;  1S6R A;  4LRX C;  3UE3 A;  1OJ5 A;  2OAQ 1;  1ES3 A;  1KVM A;  3CPT A;  2DRW A;  3IX3 A;  5FQ9 A;  1Y4O A;  2P04 A;  4YNR A;  3BEC A;  3MSH A;  4GDN A;  1ZTU A;  2Y2N A;  1K57 C;  1IYO A;  3SS5 A;  3GVB A;  1RP5 A;  3N8L A;  5E43 A;  3B3X A;  3CI6 A;  5FQJ A;  4BD0 A;  5JYO A;  2X01 A;  3NDG A;  3UPP A;  3K3C A;  4E04 A;  3TW8 A;  2UWX A;  3M2J A;  2WAD A;  4HI4 A;  1S0W A;  3G31 A;  2WZZ A;  3ITA A;  4KZ6 A;  2PDR A;  1FSW A;  4S2I A;  3ZNY A;  1OME A;  4JLF A;  4NK3 A;  4LV2 A;  3SS4 A;  4LV1 A;  4IVK A;  3NUL A;  2BTF P;  1UWN X;  5FEF A;  2JKR I;  3DTE A;  5CHU A;  4PHT A;  1N9L A;  3DWK A;  3QP5 A;  2HDR A;  3ZYT A;  3SH9 A;  1K56 A;  2JCH A;  4ZJ3 A;  5EM0 A;  2OLU A;  4R1G A;  4GHI B;  4R3J A;  3CZD A;  3BY8 A;  4IUH A;  1Z09 A;  2OWH A;  1F9I A;  4DXC A;  4FTX A;  5KZH A;  4FUW A;  3A3D A;  1N9B A;  5L8M A;  4N92 A;  2D02 A;  4S2M A;  3N7W A;  4X56 A;  1XXM A;  1TD5 A;  5DF8 A;  1SDN A;  2I9V A;  5IHV A;  1H8M A;  2J9P A;  4I38 A;  1P0Z A;  2EXB A;  1H8Z A;  2V1A A;  3PAE A;  1U60 A;  3T4T A;  5CHM A;  5MC7 A;  3UME A;  4I3A A;  3MZD A;  3VOL A;  2PHY A;  5FQM A;  4KZB A;  5FI2 A;  3LIA A;  4S2N C;  2KLI A;  1AXB A;  5FAS A;  3QP2 A;  5I94 A;  5F5Y A;  5EVI C;  3HCY A;  4OQI A;  2EXA A;  1K25 A;  2WUQ A;  1XKZ A;  2Y8H A;  1YLT A;  3V50 A;  1KE0 A;  2BLS A;  4MMN A;  4P6B A;  3CJM A;  3O87 A;  4NXG A;  4OQG A;  5L09 A;  4KG2 A;  4R3A A;  3WS5 A;  4KUO A;  4GOG A;  1YQS A;  5AQ7 A;  5DJT A;  3LEQ A;  4O01 A;  3S7P A;  4LV0 A;  4JF5 A;  4CLC A;  1PNE A;  4DN0 A;  5CGS A;  2HP9 A;  1S66 L;  3BM6 A;  4EBP A;  4CLC E;  3I7J A;  4Y15 A;  3IX8 A;  3D4F A;  3UPO A;  2DNS A;  1GSV A;  1NXY A;  5DTS A;  2DCF A;  3V3S A;  2BAS A;  5FQK A;  3BQA A;  2Y2L A;  2ZQD A;  3PBN A;  3HJK A;  2JHE A;  3NCK A;  3PTE A;  2A24 B;  4E3I A;  2OOL A;  2XFT A;  4JGO A;  4R3B A;  2VEA A;  4WMC A;  4BBU A;  3OBF A;  1GSX A;  3VP4 A;  5KSH A;  2L4R A;  1TF1 A;  2Y2I A;  3BFD A;  3TE8 A;  4D2O A;  2W3D A;  2O9A A;  3N6I A;  3T4S A;  2P9V B;  4B4X A;  1G5U A;  2PU2 A;  1MY8 A;  3OPL A;  4KZ7 A;  1FIL A;  5AVE A;  2ZQ9 A;  3CLO A;  3LIB A;  2E8J A;  3HLB A;  5FAO A;  3S7O A;  3LI9 A;  4OOM A;  2LB5 A;  2R78 A;  1G28 A;  3NDE A;  3ZVW A;  1PI4 A;  3LIE A;  4KG5 A;  4LV3 A;  4HES A;  3F1P B;  3VP3 A;  1E3U D;  2AVX A;  2GJ3 A;  5DJU A;  1YLW A;  1ES4 A;  3SH8 A;  1W7F A;  1S4R A;  4ID4 A;  5I5L A;  3IF6 C;  4JF4 A;  3VMA A;  4KQR A;  1WYC A;  4HIA A;  5EE8 A;  3O86 A;  1M40 A;  3V67 A;  4IUK A;  1L2S A;  4DE1 A;  3EOI A;  5FQI A;  2JKT M;  1MZU A;  3E0Y A;  1T1A A;  2XRN A;  3DW0 A;  1GSW A;  4X55 A;  5AVF A;  2XEP A;  4HJ6 A;  2WKI A;  5J3W A;  2EX2 A;  4BQM A;  5A92 A;  5TBM B;  3CPT B;  1I2W A;  3HBR A;  4WL9 A;  5GLC A;  3IS2 B;  3M6B A;  2Y2H A;  1JNU A;  3QP8 A;  2HJ9 C;  2W3H A;  4ZJ1 A;  4GHI A;  4C3Q A;  3Q81 A;  1W5D A;  5F1G A;  4WN5 A;  4P85 A;  2ZL1 A;  3GR2 A;  2OLV A;  5CGW A; 
#chains in the Genus database with same CATH homology
 2UV0 E;  4Y15 A;  3IX8 A;  3JPU A;  4LFU A;  5L07 A;  3IX3 A;  4NG2 A;  3QP8 A;  3QP6 A;  3QP1 A;  4Y13 A;  3QP5 A;  4LGW A;  5L10 A;  4Y17 A;  1L3L A;  3IX4 A;  3QP4 A;  2Q0O A;  1H0M A;  3SZT A;  5L09 A;  3QP2 A;  2AVX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...