1SKOA

Mp1-p14 complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
119
structure length
119
Chain Sequence
GSADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLPLVVSFIASSSANTGLIVSLEKELAPLFEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase kinase 1 interacting protei
publication title The structure of the MAP kinase scaffold MP1 bound to its partner p14: a complex with a critical role in endosomal MAP kinase signaling
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 33
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08923 MAPKK1_Int Mitogen-activated protein kinase kinase 1 interacting
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 1skoA00
1HLUP 1VETB 1PRQA 1VETA 4ESPA 2PRFA 4FTXA 2JKFA 5FDSA 4X1MA 3UB5P 2JKGA 3NECA 1F2KA 2BTFP 1FIKA 4FUWA 5FEGA 1Z09A 3U4LP 3L9KA 5EM1A 1PNEA 2VK3A 1CJFA 3T1SA 3T1XA 1AWIA 2ZL1B 2ZL1A 2E8JA 1SZVA 1ACFA 1CQAA 1A0KA 2V8FA 3LGOA 2B95A 3CPTB 3T1RA 1J3WA 3CPTA 3T12B 2ACGA 4X1LA 1D1JA 1SKOA 5EVEA 1PFLA 3L7HA 1G5UA 3KYEA 3MS6A 1YPRA 4QWOA 4D60A 2PBDP 3CHWP 3DAVA 1SKOB 4X25A 1Y4OA 2HZ5A 5EV0A 2PAVP 1FILA 1VEUB 1VEUA 3D9YA 5EM0A 1CF0A 3T1QB 2V8CA 3NULA 1K0KA 5FEFA 3LEQA 3MSHA
chains in the Genus database with same CATH superfamily
4ARZA 4R38A 1CEFA 3JPUA 4EEPA 5HDCA 4I39A 4G3KA 5FDSA 3BY9A 2X01A 2XLNA 3ITAA 3OCNA 3ZHHA 1LLBA 1N4OA 4WYYA 1KE4A 1ERMA 4Y2FA 3IX3A 2A3UA 3SH9A 2PYRA 2UWXA 3PAEA 1FCOA 4HNBA 5CHJA 1SCWA 5FEGA 1L0DA 4DXCA 1ES4A 4P0MA 3H9WA 1MBLA 3OBFA 4ZAMA 2IWDA 1ES3A 3ZG0A 2BG1A 2VK3A 4GZBA 3HJIA 1BYWA 2ZL1B 3DWKA 1MPLA 4X69A 4YWZA 3QP8A 2XQZA 1GSVA 3R7WB 5HARA 2HP6A 3IXHA 4EXOA 2ZOIA 3MBZA 3CPTA 1YT4A 2WZZA 4X1LA 1D1JA 5HWWA 4WLAA 2EWVA 4E3KA 2P04A 3A0VA 1BLPA 1L0GA 4BBUA 1BUEA 5DTSA 3NY4A 1ERQA 4A5RA 1PWDA 3FKVA 4KENB 3FPWA 2XD1A 4PAUA 4O01A 1I2WA 3QNBA 3DWZA 2Z2LB 1OT9A 3N8LA 1Y4OA 3BFCA 4LV0A 2PAVP 3A3IA 5FI7A 3VE4A 2P74A 4C75A 4R4SA 4FH2A 1YLWA 4HH2A 1ONGA 2L1MA 3JVUA 2B02A 3LR3A 4LGWA 2WKHA 1PZPA 1SHVA 3MSHA 3B42A 4OONA 1N9OA 1IYSA 3P98A 2PRFA 3FZCA 5HAQA 5FDHA 4JGPA 4E3MA 4P6ZM 2QZ6A 3DTIA 2O0YA 3MFXA 2JKGA 2ZJ9A 4KZ9A 1YLZA 3VSKA 1KGEA 4FCFA 4S2NA 2PYPA 3W4QA 5E43A 2M1CA 1I5QA 4GLQA 1VHMA 2VEAA 1XKZA 5TBMB 3ULFA 3FC7A 3M2JA 4GOGA 3B33A 3C4PA 4P6ZS 2ZL1A 3A0RA 1QMEA 2HJ9C 5E2FA 3DTEA 3PYPA 4Y0OA 1D7EA 1WYCA 2H0YA 2ACGA 2ZC7A 1JWZA 2E8IA 3GQZA 5AJGA 1ZG6A 3O88A 4OQ0A 5JYPA 4MBFA 3HREA 4Z1WA 1H3QA 5GHZA 3S7OA 4HI4A 2ZBBA 3CG5A 2I72A 4JF6A 1FOFA 2XDMA 1CEGA 2PBDP 5M1AA 2HV1A 4EEUA 2Y2JA 4I3IA 2KLIA 2D02A 5AQ7A 3UDIA 1VEUB 1XPBA 5E2HA 4JGQA 4KZ6A 5F5YA 3IH8A 5I5LA 4ETXA 2HGVA 4HH3A 4X68A 4DJ3A 1MZUA 3SS3A 1FSWA 2O9AA 4IBXA 2J3TD 1LSXA 2JKRI 4S2PA 1STZA 5HSQA 1PI4A 2WK0A 3PBTA 3MZDA 1XFNA 4R3JA 4ID4A 4M4XA 3VP2A 1LSWA 1XP4A 2I9VA 5TBMA 4WF0A 4U3TA 4KQOA 5IU1A 4OVDA 2J3WA 2LB9A 2QJ7A 1EW0A 1YAXA 4QU3A 1OTEA 2XSSA 3VP0A 1S4SA 1W7FA 1KVLA 1W63Q 1T19A 2Y59A 3NOUC 1D06A 3QP4A 1HVBA 1K56A 4UA7A 2Y4AA 2W3DA 2UV0E 3IHBA 5GHXA 2LB5A 1YMXA 1VEUA 1NYMA 4CLCE 3T1QB 4DKIA 2X02A 2V2FF 3IS2B 2WKRA 1GHIA 1H5XA 2Z6CA 1L2SA 4GD8A 3T50A 3CAXA 2L4RA 2RL3A 2V0UA 3KSGA 2W1RA 3G6OA 2OAP1 4ETZA 1GA0A 1S66L 1MC0A 3OZHA 4NEED 3HJKA 3NECA 4OP5A 4S2NC 3NI9A 2WKEA 1JVJA 2R9XA 3QP2A 5FAPA 5J8XA 1NRJA 5G4ZA 4BL2A 1BLHA 3A3JA 5E2GA 4E3OA 4PMAA 3T4KA 4OLDA 3U2AA 3UPOA 4UA9A 2P7JA 4S2JA 5KZHA 4LFUA 3SW1A 1HTZA 3PR6A 3FWLA 4F94A 3KSFA 4O7DA 1TVFA 1Z6FA 3IHAA 1ALQA 2CMNA 1S1YA 3LI9A 1XJ6A 3MQOA 1G5UA 1PW8A 4EWFA 5HD5A 1L0EA 3ZGAB 1RGZA 3NIAA 2JC7A 1OTAA 3ZVWA 4D60A 1ESIA 1V9ZA 2Y79A 1YSPA 2Y2LA 5A91A 4FD8A 1PWCA 1FR6A 3E4OA 3V3RA 4HOIA 4WEKA 2C5WB 2HJEA 3IS2A 2P08A 5DVAA 3P01A 1RP5A 4NXBA 4KQQA 1Q2PA 3MF0A 3BM6A 3OCLA 1P0ZA 3MZEA 3IWQA 2WKIA 5A92A 4ESPA 4QB8A 2XH9A 1F5MA 1XX2A 2D01A 1DP9A 4L9GA 3Q1FA 3WRZA 4QJGA 3MZFA 4MDZA 3QP1A 3T4JA 1TS7A 3PBOA 4R70A 4ARZB 4MBHA 1GA9A 4WZ5A 5FAQA 2B18A 4WM9A 2XF3A 3UN7A 5DFXA 5LBRA 4EBNA 3LO7A 1CJFA 3NBLA 1XFQA 4PKYG 1SZVA 3N8RA 4R0QA 5CEDA 2HPBA 3WWXA 4WMCD 3T4OA 4EBLA 3HUMA 4MEZA 3PBQA 1S6RA 2VA0A 5M18A 3UMEA 3GRJA 3E0YA 1PWGA 4QY6A 3HUNA 5KIZA 2XGNA 4K91A 2WGVA 4BL3A 2VGJA 1WA9A 4E3NA 2A24B 2KDKA 4XUXA 3LICA 4Y0UA 2V1ZA 1XJ3A 3EOIA 1OMEA 1O7EA 2L0WA 3F1PB 4ZJ3A 5FQ9A 2H28A 2J7VA 3LIDA 1EROA 3BQ8A 1ESUA 2A2LA 4FH4A 1FILA 2Q9MA 1VQQA 3VE3A 3UY6A 4EERA 3GMWA 4BLMA 2VGKA 2WGIA 4OPYA 5K5BA 3EWKA 4GB7A 4EU0A 3NCKA 3I7JA 1K55A 2QJ5A 4I3AA 4EW7A 3B3XA 3O87A 3V5MA 3W8KA 2G2UA 3S7NA 1G6AA 4GJ4A 3LY3A 1VM1A 2XA7M 2ZQAA 4ME4A 5L8MA 2OAQ1 1BULA 1L0FA 3T4LA 5HPIA 3CZDA 4Y5FA 4B4ZA 4IVKA 2PR6A 3T1SA 5C5KA 2PBYA 1J9MA 1CQAA 4B9OA 1A0KA 3E4PA 3ICYA 5D3OA 1E4DA 1BT5A 4JXWA 1SKOA 2OSUA 2QKPA 2XA7S 4JBFA 2W3EA 1UWPX 5FAOA 1N9LA 3E2KA 4K0XA 4S2IA 1K6RA 3KYQA 3IF6A 3PBRA 2A24A 2PD7A 4LRXC 4MBKA 3UB7A 3MJQA 1NYYA 3CHWP 5EVIB 1M40A 3F1PA 3M6HA 1XA1A 3E98A 3EGDC 4DN0A 3D9YA 3BFDA 3IX8A 4R6LA 4Y17A 1LL5A 5FL3A 3P7NA 1IFQA 3AGDA 4RYEA 3SH7A 2XFTA 4ZTKA 3NDEA 3G30A 2FH5A 5GL9A 2Y2QA 2GZAA 2JE5A 2W3FA 3UB5P 3G4PA 3BFEA 5TGFA 4FSFA 2OLUA 5AVEA 1TF1A 2NUPC 4R23A 1W8QA 3MXQA 3W4OA 4HJ4A 4WZ5C 4WN5A 3CITA 1TDGA 1K38A 2XK1A 5CHUA 2Y2NA 3GECA 4HEFA 4K0WA 3CMZA 3LIFA 2ZC6B 4DDSA 4EV4A 2BLSA 1DRMA 1YM1A 2B95A 4RQ9A 4F3LA 2J9OA 2H10A 4N1HA 3ZG7B 5CEBA 5HAPA 3IXDA 1PFLA 2HP5A 1UWNX 3CUEA 2B5RA 1TDLA 5HL1A 4DMZA 2HP9A 4QWOA 5HL6A 3GR2A 5EVIA 3UE0A 1MWSA 3C5AA 5I94A 1CF0A 1GHPA 3UB6A 2QYBA 4ZBEA 4Y15A 3C8CA 5KSCA 2W3HA 2EXBA 1K4FA 2W1TB 3F1OA 1K55C 4GHIB 4E3JA 4PM7A 3UPPA 4FTXA 3RXWA 2ZC3B 1C3BA 2Y91A 1MWUA 5GHYA 3MQQA 3LY4A 4YINA 2BASA 4D2OA 5TFQA 1NXYA 3AGEA 1K57C 3WS5A 1ES2A 3P09A 3FPVA 1DJCA 2VZWA 1FIKA 3PTEA 2ZM8A 1FSYA 1K56D 5F83A 2ZM0A 4LPZA 3V50A 3ISGA 4ZRRA 5EM1A 2V1BA 1DP6A 1YLJA 2WYXA 1KDWA 5FQKA 2EX9A 4Q0HA 3HLCA 2JHEA 4EESA 3VFHA 3WS2A 4JXSA 5DKLA 5HDSA 3JVVA 3UNWA 4OOLA 2DNSA 4Z9QA 1PI5A 1W5DA 4OQIA 3ZFZA 1YKDA 2V0WA 2O99A 3BECA 1G6OA 5HWTA 1P9RA 3IF6C 4GKUA 4E3IA 2ZQCA 2YKHA 2PHYA 3BQAA 1MWTA 1IYPA 3KX0X 3N7WA 5CERA 4YNRA 3UE3A 1OT6A 2HDRA 1SDEA 1EI5A 3RXXA 4KQRA 3GV9A 2OWJA 2HF6A 3BY8A 1N9BA 3LR5A 3SS5A 5DF9A 5EM0A 4BBVA 3H7WB 1QMFA 4NKPA 5IT5A 4ZJ2A 5FI6A 3ZCZA 1OPXA 4CLCB 3UE1A 4KZAA 1JWVA 3A3FA 3EQVA 5FEFA 3SS4A 1BTLA 1P97A 4E04A 4P6BA 1ONHA 1RGYA 2W1TA 5EECA 4GHIA 3UMDA 1Y28A 4UA6A 5DTTA 4X1MA 4UQIM 2ZQ9A 4DXBA 3S7PA 3MFDA 1BLCA 1U60A 3WS4A 3SOIA 4UHUA 3IXBA 1ZKJA 4K08A 4EQ1A 3T4QA 2ZQ8A 2EA9A 3LR0A 3IBJA 5FASA 2NUTC 5FQIA 3IWIA 3D3OA 4UQIS 1AWIA 1BZAA 1RCJA 4N9KA 4LRYC 4X56A 2VLGA 3ITBA 3VOYA 2WGWB 1V9YA 1MXOA 3QP5A 1OTBA 4EUZA 1TEMA 4Y7PA 3T12B 3CUEC 5HAIA 4Y3IA 5F68A 1BSGA 3Q7ZA 3H82B 5L2FA 4OPQA 4MNRA 5AQBA 3UDFA 1UGUA 3VMAA 4XUZA 3TG9A 2Q9NA 5EVIC 4MLLA 5MC7A 3TOIA 3EEHA 3UB9A 4GDNA 4H6JB 1DY6A 2HDSA 1YLPA 1AXBA 3H7WA 3HLEA 2HDUA 3PBNA 3LEZA 2J80A 5IS1A 2KX6A 2VV8A 4DDYA 2DCFA 4CLCA 3TW8A 3OLOA 4XXRA 5GLBA 3LEQA 4UAAA 2VV6A 5FSRA 3NOTC 1L3LA 3M2KA 3KSIA 3HLDA 2ZM2A 4BJPA 2X71A 4WBGA 3HLGA 2JKRM 3TJZC 5TR7A 4C6YA 3K3DA 5FATA 1MKIA 3LYXA 3ZDJA 3C30A 4MMNA 3EEAA 4BQMA 1DJAA 4CQHA 3L9KA 1S67L 3C38A 3D4FA 3BRMA 3LIAA 3S22A 2ZQ7A 1CK3A 4HY8A 1W8YA 2WGWA 4JLFA 2ZOHA 4HESA 5A93A 3SZTA 5CGWA 4JGRA 4RA7A 1F9IA 1SDNA 3A0SA 4LLOB 1NY0A 3N8SA 2XR0A 4KZ3A 2EX8A 3QNCA 3H82A 1FCMA 4G3WA 3VP1A 3VOLA 3OC2A 2XEPA 3Q7VB 4KG2A 4H6JA 1SKOB 4HHDA 4X53A 4MN6A 4P85A 3PHYA 2QMIA 3CLOA 3PXPA 2GX5A 3G35A 5L07A 2EX2A 1S4RA 3IF6B 5GLAA 3CJMA 2QWSA 1K0KA 2INWA 1ZC2A 5G18A 4DRTA 1H8YA 2WKPA 4OKPA 4QPRA 1K25A 4QHCA 1ZTUA 4RVAA 4OLGA 4S2OA 3R4KA 3DTMA 4ZDXA 5CX7A 2OOLA 2WAEA 4JXVA 2K7SA 1E3UA 3HBRA 2YKFA 2BTFP 1CI8A 4IEDA 4FUWA 1PYYA 4OQHA 3LI8A 5EE8A 4IHQA 4MN7A 3V3SA 2M7UA 3V67A 1W63M 5DKKA 3BW6A 3W4PA 1MKMA 3IT9A 1LSVA 5DFYA 3O3VA 1K6SA 4DF6A 1LHYA 4PHTA 1FQGA 2ZMVA 3TRCA 1KE0A 2EFXA 1K57A 4CJNA 4L9EA 1J3WA 1ZG4A 4HQAA 1HD8A 4KZ4A 1LI9A 5JYOA 4Q0JA 3BYDA 3C7UA 3GVBA 3K2NA 5F69A 5BOHA 3KO6A 1YQSA 3LCEA 3IXGA 4JGOA 1P9WA 2JKTI 1F98A 3S7QA 1YLYA 4KZ7A 5EOOA 4F3LB 4PPRA 3NDGA 3GDIA 4OPZA 3DAVA 3Q7VA 2JCHA 3RJUA 4X25A 2HZ5A 2V1AA 1KOUA 1YLTA 5CECA 2PT7A 3E2LA 3G31A 4DE2A 4ZJ1A 1WE4A 4BD1A 4CLCC 3FYZA 3PBSA 5IHVA 2V8CA 2RCXA 2KOIA 1H0MA 5U47A 4U0XA 2Y2MA 4EETB 1HLUP 1XJ2A 2PU4A 5HX9A 1VB6A 1E25A 3S4XA 4GN2A 5EFWA 3Q81A 4WUJA 4LRZE 3NHQA 3G32A 4DE1A 2V20A 3BLSA 3VSLA 2DRWA 3C4OA 2G2WA 3F1OB 4DJ2A 4QY5A 5HPFA 3LUQA 3WRTA 1TS8A 5EVID 1GHMA 1I2SA 3OPPA 3T1XA 4IBRA 4EBPA 3ZG9B 4BBTA 1ACFA 4B88A 1NZUA 4KQDA 1GSXA 2WADA 5DF8A 3IBRA 4HBTA 3MR0A 2XFSA 1EWZA 3RTYA 2M7VA 3L7HA 3G34A 4DE3A 2K2NA 4OPRA 1YPRA 1OTDA 4WELA 5EPHA 1TS0A 4LV2A 4HP4A 4LV3A 1LT0A 4G3VA 2DMWA 3BWLA 4JPMA 2R78A 3B47A 5FQQA 4LENA 4RX3A 2CC1A 4B93A 3K3CA 2IWCA 4NXFA 1XJ4A 4HIAA 5HZHA 4OP8A 2JBFA 4KUKA 3UDXA 4EQIA 5F1FA 2W0NA 2ZC5B 2FZ0A 4LV1A 4YFMA 1M6KA 3IX4A 3UE6A 4JXGA 2ZMAA 3O86A 5DF7A 1PIOA 2A49A 4II7A 4GS9B 4BENA 3R7WA 1KGGA 3VOZA 4HBUA 3IQAA 3QP6A 4PM5A 4KUOA 2WZXA 4MN5A 5DTKA 3UO9A 5FI2A 4I38A 3RH8B 5AQ9A 4I3JA 5HW3A 4PM8A 1WYBA 2XRNA 2JKTM 2V8FA 3LGOA 2O9CA 5DJUA 4U0TA 1ZHHB 2K31A 3ZNTA 2Y2PA 2JN7A 4MCWA 2W3GA 1OJ5A 2QHKA 2ZD8A 1IYQA 4PM6A 3T4SA 1ODVA 3N4IA 1FR1A 1GSWA 4I5SA 3LIEA 2FFFB 5J7EA 4KZBA 1IOUA 4HP9A 3VV4A 3DW0A 5EV0A 5HFOA 2ZQDA 3G2ZA 1IEMA 3UB8A 3JYIA 3OPLA 3DTKA 3C2WA 4R3AA 3NULA 3BJNA 2AVXA 5HDDA 4IJGA 1VETB 1JWPA 2PU2A 3OPHA 3FV7A 4KZ5A 3DBAA 3Q07A 3FG8A 2WAFA 4E6XA 4PKYA 5FQJA 1T1BA 1SKFA 2Z6DA 4GS9A 1PZOA 4N9LA 3VP3A 1ES5A 3LIBA 2ZLYA 5KMWA 2Q0OA 2G7UA 3BFFA 1BLSA 3FKWA 1LL8A 1Z09A 3C7VA 4S2MA 4WEJA 1KGFA 1OTIA 5HD3A 1CI9A 1W79A 2PDRA 4P87A 4L0LA 5CRFA 2QPNA 1K54A 3HUOA 1IKGA 4PM9A 4RX2A 3LFVA 4Y0TA 3CWFA 1DJBA 2FFYA 4CLCD 1MY8A 3IH9A 3ZG5A 5EVEA 2H0TA 2V9AA 1OJGA 5FQMA 4OH0A 4FOFA 2MJ6A 1JTGA 1X0OA 3IF5A 1PW1A 2PR5A 2VKSA 3KYEA 5FA7A 3M6BA 4X55A 2VGLM 2P9VB 3QHYA 3BFGA 1IELA 4EUVA 3G2YA 3LR4A 4LCLA 4BD0A 4R1GA 4L9FA 1Y54A 1N9NA 4OQGA 2ZC4B 2EX6A 4UEYA 4GNUA 3GTCA 5L10A 2Y2KA 1NWZA 5F6AA 2GDNA 4KG6A 1Q2QA 5EUAA 4XT2B 1G28A 1S0WA 5TJJA 3CI6A 2O9BA 2PD8A 2VGLS 4GDBA 4S2LA 4JF5A 4R4RA 5HWVA 3Q82A 1VETA 4WL9A 4NK3A 3KYZA 2JKFA 5CHMA 3E4QA 5EOEA 3BEBA 4N1XA 4GW9A 5F1GA 2Y8HA 5J3WA 3ZNYA 1HZOA 4M3KA 1NZOA 2IWBA 3V39A 3HCYA 4JKTA 4B4XA 5GLCA 1NLZA 2R9WA 4Y13A 1H8ZA 4IVIA 4N92A 4AFIA 1FCNA 1TS6A 1XGIA 3A3DA 2HDQA 3U4LP 3F1NB 5M19A 5AVFA 1K4EA 2VX8A 1PNEA 4HJ3A 1IYOA 4R3BA 1YMSA 1T18A 2E8JA 3RFBA 4DE0A 1XGJA 2OV5A 2Y2IA 5CGSA 3ZYTA 5L09A 1T1CA 3VP4A 3WS0A 3T1RA 4NETA 5A90A 3MKEA 5AQAA 1IKIA 1GCEA 1JNUA 5EVLA 3MKFA 4Q0IA 3GSGA 5G4YA 3S1YA 3NC8A 2XROA 2GJ3A 2OLVA 1KE3A 1LI0A 2P9VA 1NLYA 4BMWA 3D72A 3MXSA 3KSHA 4BWIA 1E3UD 3HLFA 1O07A 3MQ0A 3HLWA 4YOFA 1DP8A 2OWHA 5KSHA 1T1AA 5E2EA 4XT2A 3ZQ5A 5CGXA 1KDSA 2VJWA 5GLDA 1KVMA 4JF4A 3HL9A 1PRQA 2W27A 3PAGA 2Y2OA 3WS1A 3MXRA 2GNXA 3IWOA 2Y2GA 1LL9A 4NXGA 5CXWA 2Y55A 1H8MA 4OOYA 1NRFA 1G68A 1TD5A 1F2KA 2J9PA 4KG5A 3HVFA 5CTMA 2EFUA 4X6TA 3EGXC 1XA7A 3F1NA 3UPNA 1K54C 3EQUA 4CPKA 3BLMA 4KZ8A 2EWWA 3NJAA 4C3QA 4E3LA 3A3EA 4WZ4A 2Y2HA 3SH8A 2J3TC 2J8YA 3ZG8B 2XD5A 3N6IA 3VFFA 3CPTB 3TE8A 4QD4A 5A8BA 2Z2MB 2IA2A 3T4TA 1JTDA 5DJTA 2ZMFA 3NOPC 1XXMA 4NXEA 4S2KA 4IUHA 3TSGA 1NJ4A 3MS6A 4LCMA 3ZVTA 4O0PA 4GD6A 3O5YA 4Q8IA 4HJ6A 4GCZA 3MMHA 4H8RA 1S1ZA 1MWRA 3W2ZA 2WKQA 2EXAA 4O8GA 2WUQA 3AGFA 3OPRA 2VV7A 5CTNA 5F82A 4WMCA 4OOMA 4NG2A 5J4EA 3HLBA 1YSQA 2C6WB 3OOVA 2H5SA 4IUKA 4E6WA
chains in the Genus database with same CATH topology
1HLUP 1VETB 1PRQA 1VETA 4ESPA 2PRFA 4FTXA 2JKFA 5FDSA 4X1MA 3UB5P 2JKGA 3NECA 1F2KA 2BTFP 1FIKA 4FUWA 5FEGA 1Z09A 3U4LP 3L9KA 5EM1A 1PNEA 2VK3A 1CJFA 3T1SA 3T1XA 1AWIA 2ZL1B 2ZL1A 2E8JA 1SZVA 1ACFA 1CQAA 1A0KA 2V8FA 3LGOA 2B95A 3CPTB 3T1RA 1J3WA 3CPTA 3T12B 2ACGA 4X1LA 1D1JA 1SKOA 5EVEA 1PFLA 3L7HA 1G5UA 3KYEA 3MS6A 1YPRA 4QWOA 4D60A 2PBDP 3CHWP 3DAVA 1SKOB 4X25A 1Y4OA 2HZ5A 5EV0A 2PAVP 1FILA 1VEUB 1VEUA 3D9YA 5EM0A 1CF0A 3T1QB 2V8CA 3NULA 1K0KA 5FEFA 3LEQA 3MSHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HLU P;  1VET B;  1PRQ A;  1VET A;  4ESP A;  2PRF A;  4FTX A;  2JKF A;  5FDS A;  4X1M A;  3UB5 P;  2JKG A;  3NEC A;  1F2K A;  2BTF P;  1FIK A;  4FUW A;  5FEG A;  1Z09 A;  3U4L P;  3L9K A;  5EM1 A;  1PNE A;  2VK3 A;  1CJF A;  3T1S A;  3T1X A;  1AWI A;  2ZL1 B;  2ZL1 A;  2E8J A;  1SZV A;  1ACF A;  1CQA A;  1A0K A;  2V8F A;  3LGO A;  2B95 A;  3CPT B;  3T1R A;  1J3W A;  3CPT A;  3T12 B;  2ACG A;  4X1L A;  1D1J A;  1SKO A;  5EVE A;  1PFL A;  3L7H A;  1G5U A;  3KYE A;  3MS6 A;  1YPR A;  4QWO A;  4D60 A;  2PBD P;  3CHW P;  3DAV A;  1SKO B;  4X25 A;  1Y4O A;  2HZ5 A;  5EV0 A;  2PAV P;  1FIL A;  1VEU B;  1VEU A;  3D9Y A;  5EM0 A;  1CF0 A;  3T1Q B;  2V8C A;  3NUL A;  1K0K A;  5FEF A;  3LEQ A;  3MSH A; 
#chains in the Genus database with same CATH topology
 4ARZ A;  4R38 A;  1CEF A;  3JPU A;  4EEP A;  5HDC A;  4I39 A;  4G3K A;  5FDS A;  3BY9 A;  2X01 A;  2XLN A;  3ITA A;  3OCN A;  3ZHH A;  1LLB A;  1N4O A;  4WYY A;  1KE4 A;  1ERM A;  4Y2F A;  3IX3 A;  2A3U A;  3SH9 A;  2PYR A;  2UWX A;  3PAE A;  1FCO A;  4HNB A;  5CHJ A;  1SCW A;  5FEG A;  1L0D A;  4DXC A;  1ES4 A;  4P0M A;  3H9W A;  1MBL A;  3OBF A;  4ZAM A;  2IWD A;  1ES3 A;  3ZG0 A;  2BG1 A;  2VK3 A;  4GZB A;  3HJI A;  1BYW A;  2ZL1 B;  3DWK A;  1MPL A;  4X69 A;  4YWZ A;  3QP8 A;  2XQZ A;  1GSV A;  3R7W B;  5HAR A;  2HP6 A;  3IXH A;  4EXO A;  2ZOI A;  3MBZ A;  3CPT A;  1YT4 A;  2WZZ A;  4X1L A;  1D1J A;  5HWW A;  4WLA A;  2EWV A;  4E3K A;  2P04 A;  3A0V A;  1BLP A;  1L0G A;  4BBU A;  1BUE A;  5DTS A;  3NY4 A;  1ERQ A;  4A5R A;  1PWD A;  3FKV A;  4KEN B;  3FPW A;  2XD1 A;  4PAU A;  4O01 A;  1I2W A;  3QNB A;  3DWZ A;  2Z2L B;  1OT9 A;  3N8L A;  1Y4O A;  3BFC A;  4LV0 A;  2PAV P;  3A3I A;  5FI7 A;  3VE4 A;  2P74 A;  4C75 A;  4R4S A;  4FH2 A;  1YLW A;  4HH2 A;  1ONG A;  2L1M A;  3JVU A;  2B02 A;  3LR3 A;  4LGW A;  2WKH A;  1PZP A;  1SHV A;  3MSH A;  3B42 A;  4OON A;  1N9O A;  1IYS A;  3P98 A;  2PRF A;  3FZC A;  5HAQ A;  5FDH A;  4JGP A;  4E3M A;  4P6Z M;  2QZ6 A;  3DTI A;  2O0Y A;  3MFX A;  2JKG A;  2ZJ9 A;  4KZ9 A;  1YLZ A;  3VSK A;  1KGE A;  4FCF A;  4S2N A;  2PYP A;  3W4Q A;  5E43 A;  2M1C A;  1I5Q A;  4GLQ A;  1VHM A;  2VEA A;  1XKZ A;  5TBM B;  3ULF A;  3FC7 A;  3M2J A;  4GOG A;  3B33 A;  3C4P A;  4P6Z S;  2ZL1 A;  3A0R A;  1QME A;  2HJ9 C;  5E2F A;  3DTE A;  3PYP A;  4Y0O A;  1D7E A;  1WYC A;  2H0Y A;  2ACG A;  2ZC7 A;  1JWZ A;  2E8I A;  3GQZ A;  5AJG A;  1ZG6 A;  3O88 A;  4OQ0 A;  5JYP A;  4MBF A;  3HRE A;  4Z1W A;  1H3Q A;  5GHZ A;  3S7O A;  4HI4 A;  2ZBB A;  3CG5 A;  2I72 A;  4JF6 A;  1FOF A;  2XDM A;  1CEG A;  2PBD P;  5M1A A;  2HV1 A;  4EEU A;  2Y2J A;  4I3I A;  2KLI A;  2D02 A;  5AQ7 A;  3UDI A;  1VEU B;  1XPB A;  5E2H A;  4JGQ A;  4KZ6 A;  5F5Y A;  3IH8 A;  5I5L A;  4ETX A;  2HGV A;  4HH3 A;  4X68 A;  4DJ3 A;  1MZU A;  3SS3 A;  1FSW A;  2O9A A;  4IBX A;  2J3T D;  1LSX A;  2JKR I;  4S2P A;  1STZ A;  5HSQ A;  1PI4 A;  2WK0 A;  3PBT A;  3MZD A;  1XFN A;  4R3J A;  4ID4 A;  4M4X A;  3VP2 A;  1LSW A;  1XP4 A;  2I9V A;  5TBM A;  4WF0 A;  4U3T A;  4KQO A;  5IU1 A;  4OVD A;  2J3W A;  2LB9 A;  2QJ7 A;  1EW0 A;  1YAX A;  4QU3 A;  1OTE A;  2XSS A;  3VP0 A;  1S4S A;  1W7F A;  1KVL A;  1W63 Q;  1T19 A;  2Y59 A;  3NOU C;  1D06 A;  3QP4 A;  1HVB A;  1K56 A;  4UA7 A;  2Y4A A;  2W3D A;  2UV0 E;  3IHB A;  5GHX A;  2LB5 A;  1YMX A;  1VEU A;  1NYM A;  4CLC E;  3T1Q B;  4DKI A;  2X02 A;  2V2F F;  3IS2 B;  2WKR A;  1GHI A;  1H5X A;  2Z6C A;  1L2S A;  4GD8 A;  3T50 A;  3CAX A;  2L4R A;  2RL3 A;  2V0U A;  3KSG A;  2W1R A;  3G6O A;  2OAP 1;  4ETZ A;  1GA0 A;  1S66 L;  1MC0 A;  3OZH A;  4NEE D;  3HJK A;  3NEC A;  4OP5 A;  4S2N C;  3NI9 A;  2WKE A;  1JVJ A;  2R9X A;  3QP2 A;  5FAP A;  5J8X A;  1NRJ A;  5G4Z A;  4BL2 A;  1BLH A;  3A3J A;  5E2G A;  4E3O A;  4PMA A;  3T4K A;  4OLD A;  3U2A A;  3UPO A;  4UA9 A;  2P7J A;  4S2J A;  5KZH A;  4LFU A;  3SW1 A;  1HTZ A;  3PR6 A;  3FWL A;  4F94 A;  3KSF A;  4O7D A;  1TVF A;  1Z6F A;  3IHA A;  1ALQ A;  2CMN A;  1S1Y A;  3LI9 A;  1XJ6 A;  3MQO A;  1G5U A;  1PW8 A;  4EWF A;  5HD5 A;  1L0E A;  3ZGA B;  1RGZ A;  3NIA A;  2JC7 A;  1OTA A;  3ZVW A;  4D60 A;  1ESI A;  1V9Z A;  2Y79 A;  1YSP A;  2Y2L A;  5A91 A;  4FD8 A;  1PWC A;  1FR6 A;  3E4O A;  3V3R A;  4HOI A;  4WEK A;  2C5W B;  2HJE A;  3IS2 A;  2P08 A;  5DVA A;  3P01 A;  1RP5 A;  4NXB A;  4KQQ A;  1Q2P A;  3MF0 A;  3BM6 A;  3OCL A;  1P0Z A;  3MZE A;  3IWQ A;  2WKI A;  5A92 A;  4ESP A;  4QB8 A;  2XH9 A;  1F5M A;  1XX2 A;  2D01 A;  1DP9 A;  4L9G A;  3Q1F A;  3WRZ A;  4QJG A;  3MZF A;  4MDZ A;  3QP1 A;  3T4J A;  1TS7 A;  3PBO A;  4R70 A;  4ARZ B;  4MBH A;  1GA9 A;  4WZ5 A;  5FAQ A;  2B18 A;  4WM9 A;  2XF3 A;  3UN7 A;  5DFX A;  5LBR A;  4EBN A;  3LO7 A;  1CJF A;  3NBL A;  1XFQ A;  4PKY G;  1SZV A;  3N8R A;  4R0Q A;  5CED A;  2HPB A;  3WWX A;  4WMC D;  3T4O A;  4EBL A;  3HUM A;  4MEZ A;  3PBQ A;  1S6R A;  2VA0 A;  5M18 A;  3UME A;  3GRJ A;  3E0Y A;  1PWG A;  4QY6 A;  3HUN A;  5KIZ A;  2XGN A;  4K91 A;  2WGV A;  4BL3 A;  2VGJ A;  1WA9 A;  4E3N A;  2A24 B;  2KDK A;  4XUX A;  3LIC A;  4Y0U A;  2V1Z A;  1XJ3 A;  3EOI A;  1OME A;  1O7E A;  2L0W A;  3F1P B;  4ZJ3 A;  5FQ9 A;  2H28 A;  2J7V A;  3LID A;  1ERO A;  3BQ8 A;  1ESU A;  2A2L A;  4FH4 A;  1FIL A;  2Q9M A;  1VQQ A;  3VE3 A;  3UY6 A;  4EER A;  3GMW A;  4BLM A;  2VGK A;  2WGI A;  4OPY A;  5K5B A;  3EWK A;  4GB7 A;  4EU0 A;  3NCK A;  3I7J A;  1K55 A;  2QJ5 A;  4I3A A;  4EW7 A;  3B3X A;  3O87 A;  3V5M A;  3W8K A;  2G2U A;  3S7N A;  1G6A A;  4GJ4 A;  3LY3 A;  1VM1 A;  2XA7 M;  2ZQA A;  4ME4 A;  5L8M A;  2OAQ 1;  1BUL A;  1L0F A;  3T4L A;  5HPI A;  3CZD A;  4Y5F A;  4B4Z A;  4IVK A;  2PR6 A;  3T1S A;  5C5K A;  2PBY A;  1J9M A;  1CQA A;  4B9O A;  1A0K A;  3E4P A;  3ICY A;  5D3O A;  1E4D A;  1BT5 A;  4JXW A;  1SKO A;  2OSU A;  2QKP A;  2XA7 S;  4JBF A;  2W3E A;  1UWP X;  5FAO A;  1N9L A;  3E2K A;  4K0X A;  4S2I A;  1K6R A;  3KYQ A;  3IF6 A;  3PBR A;  2A24 A;  2PD7 A;  4LRX C;  4MBK A;  3UB7 A;  3MJQ A;  1NYY A;  3CHW P;  5EVI B;  1M40 A;  3F1P A;  3M6H A;  1XA1 A;  3E98 A;  3EGD C;  4DN0 A;  3D9Y A;  3BFD A;  3IX8 A;  4R6L A;  4Y17 A;  1LL5 A;  5FL3 A;  3P7N A;  1IFQ A;  3AGD A;  4RYE A;  3SH7 A;  2XFT A;  4ZTK A;  3NDE A;  3G30 A;  2FH5 A;  5GL9 A;  2Y2Q A;  2GZA A;  2JE5 A;  2W3F A;  3UB5 P;  3G4P A;  3BFE A;  5TGF A;  4FSF A;  2OLU A;  5AVE A;  1TF1 A;  2NUP C;  4R23 A;  1W8Q A;  3MXQ A;  3W4O A;  4HJ4 A;  4WZ5 C;  4WN5 A;  3CIT A;  1TDG A;  1K38 A;  2XK1 A;  5CHU A;  2Y2N A;  3GEC A;  4HEF A;  4K0W A;  3CMZ A;  3LIF A;  2ZC6 B;  4DDS A;  4EV4 A;  2BLS A;  1DRM A;  1YM1 A;  2B95 A;  4RQ9 A;  4F3L A;  2J9O A;  2H10 A;  4N1H A;  3ZG7 B;  5CEB A;  5HAP A;  3IXD A;  1PFL A;  2HP5 A;  1UWN X;  3CUE A;  2B5R A;  1TDL A;  5HL1 A;  4DMZ A;  2HP9 A;  4QWO A;  5HL6 A;  3GR2 A;  5EVI A;  3UE0 A;  1MWS A;  3C5A A;  5I94 A;  1CF0 A;  1GHP A;  3UB6 A;  2QYB A;  4ZBE A;  4Y15 A;  3C8C A;  5KSC A;  2W3H A;  2EXB A;  1K4F A;  2W1T B;  3F1O A;  1K55 C;  4GHI B;  4E3J A;  4PM7 A;  3UPP A;  4FTX A;  3RXW A;  2ZC3 B;  1C3B A;  2Y91 A;  1MWU A;  5GHY A;  3MQQ A;  3LY4 A;  4YIN A;  2BAS A;  4D2O A;  5TFQ A;  1NXY A;  3AGE A;  1K57 C;  3WS5 A;  1ES2 A;  3P09 A;  3FPV A;  1DJC A;  2VZW A;  1FIK A;  3PTE A;  2ZM8 A;  1FSY A;  1K56 D;  5F83 A;  2ZM0 A;  4LPZ A;  3V50 A;  3ISG A;  4ZRR A;  5EM1 A;  2V1B A;  1DP6 A;  1YLJ A;  2WYX A;  1KDW A;  5FQK A;  2EX9 A;  4Q0H A;  3HLC A;  2JHE A;  4EES A;  3VFH A;  3WS2 A;  4JXS A;  5DKL A;  5HDS A;  3JVV A;  3UNW A;  4OOL A;  2DNS A;  4Z9Q A;  1PI5 A;  1W5D A;  4OQI A;  3ZFZ A;  1YKD A;  2V0W A;  2O99 A;  3BEC A;  1G6O A;  5HWT A;  1P9R A;  3IF6 C;  4GKU A;  4E3I A;  2ZQC A;  2YKH A;  2PHY A;  3BQA A;  1MWT A;  1IYP A;  3KX0 X;  3N7W A;  5CER A;  4YNR A;  3UE3 A;  1OT6 A;  2HDR A;  1SDE A;  1EI5 A;  3RXX A;  4KQR A;  3GV9 A;  2OWJ A;  2HF6 A;  3BY8 A;  1N9B A;  3LR5 A;  3SS5 A;  5DF9 A;  5EM0 A;  4BBV A;  3H7W B;  1QMF A;  4NKP A;  5IT5 A;  4ZJ2 A;  5FI6 A;  3ZCZ A;  1OPX A;  4CLC B;  3UE1 A;  4KZA A;  1JWV A;  3A3F A;  3EQV A;  5FEF A;  3SS4 A;  1BTL A;  1P97 A;  4E04 A;  4P6B A;  1ONH A;  1RGY A;  2W1T A;  5EEC A;  4GHI A;  3UMD A;  1Y28 A;  4UA6 A;  5DTT A;  4X1M A;  4UQI M;  2ZQ9 A;  4DXB A;  3S7P A;  3MFD A;  1BLC A;  1U60 A;  3WS4 A;  3SOI A;  4UHU A;  3IXB A;  1ZKJ A;  4K08 A;  4EQ1 A;  3T4Q A;  2ZQ8 A;  2EA9 A;  3LR0 A;  3IBJ A;  5FAS A;  2NUT C;  5FQI A;  3IWI A;  3D3O A;  4UQI S;  1AWI A;  1BZA A;  1RCJ A;  4N9K A;  4LRY C;  4X56 A;  2VLG A;  3ITB A;  3VOY A;  2WGW B;  1V9Y A;  1MXO A;  3QP5 A;  1OTB A;  4EUZ A;  1TEM A;  4Y7P A;  3T12 B;  3CUE C;  5HAI A;  4Y3I A;  5F68 A;  1BSG A;  3Q7Z A;  3H82 B;  5L2F A;  4OPQ A;  4MNR A;  5AQB A;  3UDF A;  1UGU A;  3VMA A;  4XUZ A;  3TG9 A;  2Q9N A;  5EVI C;  4MLL A;  5MC7 A;  3TOI A;  3EEH A;  3UB9 A;  4GDN A;  4H6J B;  1DY6 A;  2HDS A;  1YLP A;  1AXB A;  3H7W A;  3HLE A;  2HDU A;  3PBN A;  3LEZ A;  2J80 A;  5IS1 A;  2KX6 A;  2VV8 A;  4DDY A;  2DCF A;  4CLC A;  3TW8 A;  3OLO A;  4XXR A;  5GLB A;  3LEQ A;  4UAA A;  2VV6 A;  5FSR A;  3NOT C;  1L3L A;  3M2K A;  3KSI A;  3HLD A;  2ZM2 A;  4BJP A;  2X71 A;  4WBG A;  3HLG A;  2JKR M;  3TJZ C;  5TR7 A;  4C6Y A;  3K3D A;  5FAT A;  1MKI A;  3LYX A;  3ZDJ A;  3C30 A;  4MMN A;  3EEA A;  4BQM A;  1DJA A;  4CQH A;  3L9K A;  1S67 L;  3C38 A;  3D4F A;  3BRM A;  3LIA A;  3S22 A;  2ZQ7 A;  1CK3 A;  4HY8 A;  1W8Y A;  2WGW A;  4JLF A;  2ZOH A;  4HES A;  5A93 A;  3SZT A;  5CGW A;  4JGR A;  4RA7 A;  1F9I A;  1SDN A;  3A0S A;  4LLO B;  1NY0 A;  3N8S A;  2XR0 A;  4KZ3 A;  2EX8 A;  3QNC A;  3H82 A;  1FCM A;  4G3W A;  3VP1 A;  3VOL A;  3OC2 A;  2XEP A;  3Q7V B;  4KG2 A;  4H6J A;  1SKO B;  4HHD A;  4X53 A;  4MN6 A;  4P85 A;  3PHY A;  2QMI A;  3CLO A;  3PXP A;  2GX5 A;  3G35 A;  5L07 A;  2EX2 A;  1S4R A;  3IF6 B;  5GLA A;  3CJM A;  2QWS A;  1K0K A;  2INW A;  1ZC2 A;  5G18 A;  4DRT A;  1H8Y A;  2WKP A;  4OKP A;  4QPR A;  1K25 A;  4QHC A;  1ZTU A;  4RVA A;  4OLG A;  4S2O A;  3R4K A;  3DTM A;  4ZDX A;  5CX7 A;  2OOL A;  2WAE A;  4JXV A;  2K7S A;  1E3U A;  3HBR A;  2YKF A;  2BTF P;  1CI8 A;  4IED A;  4FUW A;  1PYY A;  4OQH A;  3LI8 A;  5EE8 A;  4IHQ A;  4MN7 A;  3V3S A;  2M7U A;  3V67 A;  1W63 M;  5DKK A;  3BW6 A;  3W4P A;  1MKM A;  3IT9 A;  1LSV A;  5DFY A;  3O3V A;  1K6S A;  4DF6 A;  1LHY A;  4PHT A;  1FQG A;  2ZMV A;  3TRC A;  1KE0 A;  2EFX A;  1K57 A;  4CJN A;  4L9E A;  1J3W A;  1ZG4 A;  4HQA A;  1HD8 A;  4KZ4 A;  1LI9 A;  5JYO A;  4Q0J A;  3BYD A;  3C7U A;  3GVB A;  3K2N A;  5F69 A;  5BOH A;  3KO6 A;  1YQS A;  3LCE A;  3IXG A;  4JGO A;  1P9W A;  2JKT I;  1F98 A;  3S7Q A;  1YLY A;  4KZ7 A;  5EOO A;  4F3L B;  4PPR A;  3NDG A;  3GDI A;  4OPZ A;  3DAV A;  3Q7V A;  2JCH A;  3RJU A;  4X25 A;  2HZ5 A;  2V1A A;  1KOU A;  1YLT A;  5CEC A;  2PT7 A;  3E2L A;  3G31 A;  4DE2 A;  4ZJ1 A;  1WE4 A;  4BD1 A;  4CLC C;  3FYZ A;  3PBS A;  5IHV A;  2V8C A;  2RCX A;  2KOI A;  1H0M A;  5U47 A;  4U0X A;  2Y2M A;  4EET B;  1HLU P;  1XJ2 A;  2PU4 A;  5HX9 A;  1VB6 A;  1E25 A;  3S4X A;  4GN2 A;  5EFW A;  3Q81 A;  4WUJ A;  4LRZ E;  3NHQ A;  3G32 A;  4DE1 A;  2V20 A;  3BLS A;  3VSL A;  2DRW A;  3C4O A;  2G2W A;  3F1O B;  4DJ2 A;  4QY5 A;  5HPF A;  3LUQ A;  3WRT A;  1TS8 A;  5EVI D;  1GHM A;  1I2S A;  3OPP A;  3T1X A;  4IBR A;  4EBP A;  3ZG9 B;  4BBT A;  1ACF A;  4B88 A;  1NZU A;  4KQD A;  1GSX A;  2WAD A;  5DF8 A;  3IBR A;  4HBT A;  3MR0 A;  2XFS A;  1EWZ A;  3RTY A;  2M7V A;  3L7H A;  3G34 A;  4DE3 A;  2K2N A;  4OPR A;  1YPR A;  1OTD A;  4WEL A;  5EPH A;  1TS0 A;  4LV2 A;  4HP4 A;  4LV3 A;  1LT0 A;  4G3V A;  2DMW A;  3BWL A;  4JPM A;  2R78 A;  3B47 A;  5FQQ A;  4LEN A;  4RX3 A;  2CC1 A;  4B93 A;  3K3C A;  2IWC A;  4NXF A;  1XJ4 A;  4HIA A;  5HZH A;  4OP8 A;  2JBF A;  4KUK A;  3UDX A;  4EQI A;  5F1F A;  2W0N A;  2ZC5 B;  2FZ0 A;  4LV1 A;  4YFM A;  1M6K A;  3IX4 A;  3UE6 A;  4JXG A;  2ZMA A;  3O86 A;  5DF7 A;  1PIO A;  2A49 A;  4II7 A;  4GS9 B;  4BEN A;  3R7W A;  1KGG A;  3VOZ A;  4HBU A;  3IQA A;  3QP6 A;  4PM5 A;  4KUO A;  2WZX A;  4MN5 A;  5DTK A;  3UO9 A;  5FI2 A;  4I38 A;  3RH8 B;  5AQ9 A;  4I3J A;  5HW3 A;  4PM8 A;  1WYB A;  2XRN A;  2JKT M;  2V8F A;  3LGO A;  2O9C A;  5DJU A;  4U0T A;  1ZHH B;  2K31 A;  3ZNT A;  2Y2P A;  2JN7 A;  4MCW A;  2W3G A;  1OJ5 A;  2QHK A;  2ZD8 A;  1IYQ A;  4PM6 A;  3T4S A;  1ODV A;  3N4I A;  1FR1 A;  1GSW A;  4I5S A;  3LIE A;  2FFF B;  5J7E A;  4KZB A;  1IOU A;  4HP9 A;  3VV4 A;  3DW0 A;  5EV0 A;  5HFO A;  2ZQD A;  3G2Z A;  1IEM A;  3UB8 A;  3JYI A;  3OPL A;  3DTK A;  3C2W A;  4R3A A;  3NUL A;  3BJN A;  2AVX A;  5HDD A;  4IJG A;  1VET B;  1JWP A;  2PU2 A;  3OPH A;  3FV7 A;  4KZ5 A;  3DBA A;  3Q07 A;  3FG8 A;  2WAF A;  4E6X A;  4PKY A;  5FQJ A;  1T1B A;  1SKF A;  2Z6D A;  4GS9 A;  1PZO A;  4N9L A;  3VP3 A;  1ES5 A;  3LIB A;  2ZLY A;  5KMW A;  2Q0O A;  2G7U A;  3BFF A;  1BLS A;  3FKW A;  1LL8 A;  1Z09 A;  3C7V A;  4S2M A;  4WEJ A;  1KGF A;  1OTI A;  5HD3 A;  1CI9 A;  1W79 A;  2PDR A;  4P87 A;  4L0L A;  5CRF A;  2QPN A;  1K54 A;  3HUO A;  1IKG A;  4PM9 A;  4RX2 A;  3LFV A;  4Y0T A;  3CWF A;  1DJB A;  2FFY A;  4CLC D;  1MY8 A;  3IH9 A;  3ZG5 A;  5EVE A;  2H0T A;  2V9A A;  1OJG A;  5FQM A;  4OH0 A;  4FOF A;  2MJ6 A;  1JTG A;  1X0O A;  3IF5 A;  1PW1 A;  2PR5 A;  2VKS A;  3KYE A;  5FA7 A;  3M6B A;  4X55 A;  2VGL M;  2P9V B;  3QHY A;  3BFG A;  1IEL A;  4EUV A;  3G2Y A;  3LR4 A;  4LCL A;  4BD0 A;  4R1G A;  4L9F A;  1Y54 A;  1N9N A;  4OQG A;  2ZC4 B;  2EX6 A;  4UEY A;  4GNU A;  3GTC A;  5L10 A;  2Y2K A;  1NWZ A;  5F6A A;  2GDN A;  4KG6 A;  1Q2Q A;  5EUA A;  4XT2 B;  1G28 A;  1S0W A;  5TJJ A;  3CI6 A;  2O9B A;  2PD8 A;  2VGL S;  4GDB A;  4S2L A;  4JF5 A;  4R4R A;  5HWV A;  3Q82 A;  1VET A;  4WL9 A;  4NK3 A;  3KYZ A;  2JKF A;  5CHM A;  3E4Q A;  5EOE A;  3BEB A;  4N1X A;  4GW9 A;  5F1G A;  2Y8H A;  5J3W A;  3ZNY A;  1HZO A;  4M3K A;  1NZO A;  2IWB A;  3V39 A;  3HCY A;  4JKT A;  4B4X A;  5GLC A;  1NLZ A;  2R9W A;  4Y13 A;  1H8Z A;  4IVI A;  4N92 A;  4AFI A;  1FCN A;  1TS6 A;  1XGI A;  3A3D A;  2HDQ A;  3U4L P;  3F1N B;  5M19 A;  5AVF A;  1K4E A;  2VX8 A;  1PNE A;  4HJ3 A;  1IYO A;  4R3B A;  1YMS A;  1T18 A;  2E8J A;  3RFB A;  4DE0 A;  1XGJ A;  2OV5 A;  2Y2I A;  5CGS A;  3ZYT A;  5L09 A;  1T1C A;  3VP4 A;  3WS0 A;  3T1R A;  4NET A;  5A90 A;  3MKE A;  5AQA A;  1IKI A;  1GCE A;  1JNU A;  5EVL A;  3MKF A;  4Q0I A;  3GSG A;  5G4Y A;  3S1Y A;  3NC8 A;  2XRO A;  2GJ3 A;  2OLV A;  1KE3 A;  1LI0 A;  2P9V A;  1NLY A;  4BMW A;  3D72 A;  3MXS A;  3KSH A;  4BWI A;  1E3U D;  3HLF A;  1O07 A;  3MQ0 A;  3HLW A;  4YOF A;  1DP8 A;  2OWH A;  5KSH A;  1T1A A;  5E2E A;  4XT2 A;  3ZQ5 A;  5CGX A;  1KDS A;  2VJW A;  5GLD A;  1KVM A;  4JF4 A;  3HL9 A;  1PRQ A;  2W27 A;  3PAG A;  2Y2O A;  3WS1 A;  3MXR A;  2GNX A;  3IWO A;  2Y2G A;  1LL9 A;  4NXG A;  5CXW A;  2Y55 A;  1H8M A;  4OOY A;  1NRF A;  1G68 A;  1TD5 A;  1F2K A;  2J9P A;  4KG5 A;  3HVF A;  5CTM A;  2EFU A;  4X6T A;  3EGX C;  1XA7 A;  3F1N A;  3UPN A;  1K54 C;  3EQU A;  4CPK A;  3BLM A;  4KZ8 A;  2EWW A;  3NJA A;  4C3Q A;  4E3L A;  3A3E A;  4WZ4 A;  2Y2H A;  3SH8 A;  2J3T C;  2J8Y A;  3ZG8 B;  2XD5 A;  3N6I A;  3VFF A;  3CPT B;  3TE8 A;  4QD4 A;  5A8B A;  2Z2M B;  2IA2 A;  3T4T A;  1JTD A;  5DJT A;  2ZMF A;  3NOP C;  1XXM A;  4NXE A;  4S2K A;  4IUH A;  3TSG A;  1NJ4 A;  3MS6 A;  4LCM A;  3ZVT A;  4O0P A;  4GD6 A;  3O5Y A;  4Q8I A;  4HJ6 A;  4GCZ A;  3MMH A;  4H8R A;  1S1Z A;  1MWR A;  3W2Z A;  2WKQ A;  2EXA A;  4O8G A;  2WUQ A;  3AGF A;  3OPR A;  2VV7 A;  5CTN A;  5F82 A;  4WMC A;  4OOM A;  4NG2 A;  5J4E A;  3HLB A;  1YSQ A;  2C6W B;  3OOV A;  2H5S A;  4IUK A;  4E6W A; 
#chains in the Genus database with same CATH homology
 1HLU P;  1VET B;  1PRQ A;  1VET A;  4ESP A;  2PRF A;  4FTX A;  2JKF A;  5FDS A;  4X1M A;  3UB5 P;  2JKG A;  3NEC A;  1F2K A;  2BTF P;  1FIK A;  4FUW A;  5FEG A;  1Z09 A;  3U4L P;  3L9K A;  5EM1 A;  1PNE A;  2VK3 A;  1CJF A;  3T1S A;  3T1X A;  1AWI A;  2ZL1 B;  2ZL1 A;  2E8J A;  1SZV A;  1ACF A;  1CQA A;  1A0K A;  2V8F A;  3LGO A;  2B95 A;  3CPT B;  3T1R A;  1J3W A;  3CPT A;  3T12 B;  2ACG A;  4X1L A;  1D1J A;  1SKO A;  5EVE A;  1PFL A;  3L7H A;  1G5U A;  3KYE A;  3MS6 A;  1YPR A;  4QWO A;  4D60 A;  2PBD P;  3CHW P;  3DAV A;  1SKO B;  4X25 A;  1Y4O A;  2HZ5 A;  5EV0 A;  2PAV P;  1FIL A;  1VEU B;  1VEU A;  3D9Y A;  5EM0 A;  1CF0 A;  3T1Q B;  2V8C A;  3NUL A;  1K0K A;  5FEF A;  3LEQ A;  3MSH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...