1SKOA

Mp1-p14 complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
119
structure length
119
Chain Sequence
GSADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLPLVVSFIASSSANTGLIVSLEKELAPLFEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of the MAP kinase scaffold MP1 bound to its partner p14: a complex with a critical role in endosomal MAP kinase signaling
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Mitogen-activated protein kinase kinase 1 interacting protei
total genus 33
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08923 MAPKK1_Int Mitogen-activated protein kinase kinase 1 interacting
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 1skoA00
3T1QB 1G5UA 3T1XA 1CJFA 3T12B 1J3WA 2V8FA 3LGOA 4X25A 1ACFA 5FEGA 2BTFP 1FIKA 5EV0A 4D60A 1F2KA 1YPRA 2B95A 1D1JA 2PRFA 5EVEA 3CPTB 3UB5P 1HLUP 1SKOB 3CHWP 3KYEA 3MSHA 1VETB 3CPTA 1VEUB 1VEUA 3NULA 3T1SA 2PAVP 4X1MA 3U4LP 5FDSA 5FEFA 4ESPA 3DAVA 5EM0A 1CQAA 1FILA 3L9KA 1K0KA 2ZL1A 4X1LA 2E8JA 3MS6A 5EM1A 3LEQA 4FUWA 2ZL1B 2VK3A 3D9YA 3T1RA 1SZVA 1PNEA 1AWIA 1Y4OA 2ACGA 3L7HA 1VETA 2JKFA 1PFLA 1A0KA 2JKGA 1CF0A 1SKOA 4QWOA 1Z09A 3NECA 2HZ5A 2V8CA 2PBDP 1PRQA 4FTXA
chains in the Genus database with same CATH superfamily
4OQGA 1K25A 1OT6A 4WMCA 3LUQA 1D1JA 2EX9A 1O07A 4NXFA 1ERQA 1IOUA 4WL9A 1STZA 4P6ZM 2W3HA 3P01A 2PD7A 4WZ4A 4EUZA 4Q0HA 5A90A 4KUKA 1K57A 5L09A 3CI6A 4PM9A 2JN7A 1UGUA 3HLEA 1E4DA 4N9KA 4N1HA 1NLYA 3T4LA 4Y13A 3PHYA 1XKZA 3UE0A 3QP5A 4RVAA 3UE1A 4S2NC 4XUZA 4H8RA 1OT9A 2HZ5A 2EX6A 4WEJA 3LGOA 1BUEA 4Y5FA 1CK3A 4JGOA 5DJTA 4KZ6A 2K7SA 5AQAA 4KZ8A 1WA9A 3RH8B 4JXSA 1NWZA 4E6XA 3W4PA 4YWZA 4OPQA 3ISGA 3M2KA 3LO7A 1UWPX 3SS5A 3WWXA 2WKHA 3CLOA 4XUXA 3SH9A 2EWWA 4LGWA 4IBRA 3D3OA 1OPXA 2XA7S 3E4PA 1MWUA 4KQRA 3H7WB 2V0UA 5EM1A 1DJAA 5EFWA 2G2UA 1YT4A 2P08A 4JBFA 2A24B 5FAPA 4WF0A 3KO6A 3AGDA 3MKEA 3LY3A 4YINA 5L07A 3BLMA 2HPBA 3K2NA 3DBAA 5FASA 5E2FA 3LEQA 4FUWA 3EEHA 3JPUA 2J8YA 4HH2A 5E2HA 2OLUA 5HARA 5DKKA 3S1YA 3DW0A 1EWZA 3BFFA 4HOIA 3GRJA 4EUVA 1K55A 3ZNYA 5F1GA 1H0MA 3BLSA 3HLWA 1XJ4A 3PR6A 1H5XA 2QJ7A 5CEDA 4LFUA 5CTMA 1SDNA 2B18A 5FI2A 5HWWA 5TBMB 1PWGA 3QP4A 4NK3A 2EWVA 2Z6DA 4UEYA 2M7VA 2Y2PA 3GQZA 2JKGA 5JYOA 4DN0A 1D7EA 4DRTA 5HDDA 2GJ3A 3BYDA 1K6SA 4EW7A 3FPWA 1L2SA 4GD8A 5F1FA 4ZJ2A 4PM5A 3BFDA 4WZ5C 3O3VA 4EQ1A 1BULA 2D01A 1VM1A 4E3IA 1L3LA 2PYPA 4GDBA 5FQKA 4X6TA 2PBDP 2H28A 2PU2A 3DWKA 2Z2LB 3OLOA 4GKUA 4XT2A 3HLFA 2Y2NA 3Q7VA 4ESPA 1VQQA 3N4IA 4E3LA 2ZC5B 3PBOA 4BMWA 1NYYA 1W5DA 3T4QA 3NDGA 1M6KA 3KX0X 3G6OA 1J3WA 1XGJA 3IH9A 1H8MA 1GSVA 2FFFB 5E43A 1K56A 4Z1WA 2WKQA 1VEUA 4ID4A 3GR2A 1H3QA 5EVLA 1TEMA 2FFYA 1NRFA 2Y2MA 4E3KA 4L9EA 4O7DA 1HVBA 4JF4A 1ES3A 4HJ4A 1JVJA 1G68A 1FSWA 2INWA 3GVBA 2XSSA 2JCHA 2WUQA 3IQAA 1OTIA 4CLCD 4KZ4A 4L9FA 5FDSA 5CHJA 4XT2B 5L2FA 4WMCD 3SS3A 1Y28A 3N8RA 3GECA 3HL9A 4X25A 5EOEA 3P09A 1LL9A 1XP4A 3BWLA 1W8QA 2Y79A 4BJPA 1NYMA 2WGWB 1LSVA 3HLDA 1BSGA 5AJGA 5J3WA 1IEMA 2L0WA 3HJKA 4BBUA 4BBTA 3CPTB 2D02A 1BTLA 4KZ9A 3HUOA 3A3FA 5TBMA 5HDCA 3UMEA 4R0QA 1MWTA 3CWFA 3VMAA 2XEPA 5HAIA 1N9OA 3D4FA 3WS2A 1ES4A 2W27A 1E3UD 2JKTM 4M4XA 3P98A 4OH0A 3VP0A 3NCKA 2A24A 3MXSA 4MNRA 4MMNA 1XJ3A 1WYCA 3IF6C 2VKSA 4CLCE 3A3JA 3F1PA 3S7OA 5FI7A 2HGVA 2ZBBA 3Q82A 4EBPA 1YLZA 4OOMA 4DKIA 1MWRA 4NXEA 4JKTA 3JYIA 4ZRRA 4GOGA 2VX8A 3E98A 1YPRA 1F5MA 3WRTA 4OPZA 1MZUA 1IYPA 3GSGA 4IVIA 1ALQA 3TG9A 3OCLA 1TD5A 3JVUA 3IWIA 1PFLA 2VGLM 3O88A 2ZQAA 1NZOA 5CGSA 1CJFA 2WGVA 4MBHA 1L0DA 5I94A 4R23A 3T4JA 2C6WB 3LI8A 3G4PA 4E3NA 5A8BA 4KQQA 2HV1A 5G18A 3OOVA 4GDNA 1FQGA 4OONA 5F5YA 5JYPA 3TSGA 3BRMA 4X55A 1MXOA 5FQ9A 3H9WA 5DTSA 2M7UA 4WM9A 1W79A 4JGRA 4OP8A 5BOHA 4B88A 2IWCA 1DJCA 3C4PA 3BEBA 3M6HA 3PYPA 2QZ6A 3MXQA 4HP4A 3SW1A 4LENA 4R4RA 5F6AA 2G2WA 1PYYA 1S1ZA 4MEZA 4OQ0A 3B3XA 1G6OA 2W3GA 2UWXA 4QY6A 2JE5A 3Q1FA 4O01A 1PW1A 3FYZA 1YLPA 4UHUA 4LCLA 3IWOA 4UAAA 5M18A 1IKIA 4Y0UA 2ZLYA 4WUJA 4BBVA 1ZTUA 3DTEA 4QD4A 1PIOA 1W63M 5CHUA 5F69A 4X68A 3TJZC 1Q2QA 2HJEA 4EBLA 3EGXC 3HBRA 3HUMA 3MMHA 3D9YA 3MFXA 4JPMA 3HVFA 4HBUA 1SKOA 2BLSA 1KE4A 1HTZA 3IBJA 1N9NA 4A5RA 4IEDA 4KENB 4KQDA 1FCMA 3IX8A 2X71A 1IYOA 4LRYC 1TVFA 3UB8A 1T19A 1TDGA 3DWZA 4DDSA 1K55C 2WKIA 1FR1A 1MC0A 3MQOA 2R9XA 1KVLA 4I39A 3Q7VB 3F1NA 3V67A 1F9IA 4GD6A 4S2IA 1XJ2A 2Y8HA 4Y7PA 3VFHA 5HZHA 4KUOA 4S2PA 2O9BA 5TR7A 3VFFA 4H6JB 3K3CA 2GZAA 4OQHA 3BFEA 4Y0OA 4HHDA 1J9MA 3LR4A 1XXMA 3UMDA 4DE2A 3O86A 3T1RA 4CLCA 3NOUC 4FH2A 3UY6A 3NOPC 5FSRA 5GLAA 2V2FF 2XFSA 4OP5A 4PKYA 5E2EA 3E2LA 3B47A 4R3AA 4S2LA 4B4XA 3MQQA 5EVIC 4S2OA 2EX2A 3S22A 4C75A 4KZ7A 1HZOA 1FR6A 4M3KA 3L7HA 3G30A 1TS6A 2OAP1 2FH5A 3M6BA 3MBZA 5GHYA 5DF9A 5EVEA 2QKPA 2RL3A 3A3EA 3IXBA 5TJJA 3SZTA 3IHAA 3ULFA 1ZG4A 3ZVWA 1LHYA 1TS7A 4QJGA 4I3AA 5HPFA 2WAEA 1JTDA 2W3EA 4JGQA 4X1LA 5EVID 3OPRA 4KQOA 4EBNA 5GLCA 2ZC3B 2H0TA 2ZQ7A 3D72A 2H5SA 3Q7ZA 4QPRA 3V3SA 2PU4A 2J3WA 3F1PB 3IBRA 4MN5A 4KZ5A 2P9VA 5I5LA 3ZG7B 2OLVA 2ZC6B 3CJMA 1XA7A 5TFQA 2E8JA 3UB6A 3MZFA 5FQQA 4GW9A 1H8ZA 1U60A 3MFDA 4KZBA 4S2KA 2M1CA 1YLJA 4HJ3A 4MN6A 1YLTA 2XLNA 2Y91A 4OLDA 4P85A 5EPHA 3UDFA 1CEGA 1ONHA 1N9BA 2V1AA 5F82A 5AQBA 5EOOA 1YAXA 4D2OA 3LR5A 3WS4A 2PD8A 1Y54A 3H82B 4HQAA 1L0FA 1T18A 3I7JA 2WZXA 2JKRI 3UPNA 2WYXA 1YMXA 3HJIA 4CQHA 1GA0A 3A0RA 1KDWA 2Y59A 3MS6A 2ZL1B 1P0ZA 1Y4OA 2VGJA 1EROA 4JF5A 4X53A 3ZYTA 2NUPC 3LIBA 5CGWA 5HPIA 3HLCA 4D60A 1I5QA 5GHXA 1IFQA 4UA6A 1JWVA 2C5WB 3HLGA 1V9ZA 3LEZA 5CHMA 2J80A 2ZM2A 2Y2JA 2JC7A 3V5MA 3R7WB 1XPBA 4ZBEA 3C8CA 2HJ9C 2WGIA 4Q0IA 1WE4A 1K38A 1KVMA 4JXGA 5C5KA 4DJ3A 3K3DA 2Y2KA 2PHYA 3LIAA 1VETB 1VEUB 3BQAA 5HL1A 4PM6A 5FEFA 3CITA 3WS5A 2PT7A 5HW3A 2ZM8A 3A0VA 1KGGA 2KLIA 1PNEA 4GNUA 3ZG0A 5FQMA 5M1AA 2IWDA 2Y2IA 2KOIA 4BLMA 1L0EA 4YNRA 4UQIM 3MF0A 2O0YA 5A91A 4F94A 3N6IA 5HDSA 3DTKA 2RCXA 4H6JA 4QY5A 4YFMA 1OJ5A 3G31A 1BLPA 3F1OA 3ZGAB 3QNCA 4RX3A 1D06A 4U0XA 4G3KA 4PAUA 2O99A 4MBKA 3NOTC 2XFTA 4FCFA 2X02A 1XA1A 1BT5A 2Q0OA 4OOYA 1KOUA 3IF5A 2ZQ9A 1SZVA 5DF7A 3AGFA 2P04A 3N8LA 3NC8A 5FA7A 2QMIA 1M40A 3NJAA 4GLQA 3UB5P 4NETA 1HLUP 3IXDA 3MZDA 4NEED 3CPTA 4F3LB 5DJUA 1G6AA 3UE3A 2Y2HA 1KE0A 2FZ0A 4ZJ1A 4EEUA 4NG2A 2XH9A 1CF0A 4NXBA 4Y17A 4S2MA 4X69A 1DRMA 1W8YA 5DF8A 3ITAA 5HD5A 2ZMAA 1P97A 2VA0A 3NULA 2IWBA 5GLDA 2A2LA 3RXWA 4PMAA 3A3DA 4EU0A 1T1CA 4UA7A 3ZQ5A 4R3JA 3EQVA 4II7A 4EXOA 1TDLA 4RYEA 5EECA 3HREA 2HDRA 4LV3A 4O0PA 5HX9A 4BD1A 4WZ5A 5HFOA 2Q9MA 3PBNA 1F98A 3FWLA 3CG5A 4S2NA 5G4YA 2XROA 2WKRA 1NRJA 4CJNA 2I72A 2OV5A 3QP6A 4G3WA 2KX6A 3W8KA 3RJUA 5HAQA 3MSHA 4R70A 2YKFA 1BZAA 3MZEA 3AGEA 4CPKA 3ZDJA 4XXRA 2Y4AA 2P7JA 2JKTI 1GA9A 2ZQCA 3G2YA 1LSXA 2PDRA 3MR0A 4NXGA 2ZQ8A 2WZZA 1ODVA 4OVDA 4X1MA 5CERA 4RX2A 1YSQA 1NZUA 4HEFA 3U2AA 3PBTA 2HDUA 1S4RA 1S0WA 2VK3A 2L1MA 3BQ8A 5EVIB 5G4ZA 2OOLA 1G28A 4R4SA 1YLYA 1VB6A 5HAPA 2JHEA 5U47A 3P7NA 3IF6B 3WRZA 3ZNTA 4HH3A 5AVEA 2WAFA 4Y15A 1E25A 4LRXC 1RGZA 4LV1A 2YKHA 1Z09A 2QPNA 3MJQA 4B4ZA 1SDEA 4P6BA 5DFXA 3A0SA 1G5UA 3VOLA 1EI5A 1K4EA 5EV0A 5EUAA 3UB7A 3BECA 3OPPA 4HBTA 3UNWA 1OTEA 4CLCB 3T1SA 4R6LA 3LIDA 3O87A 2I9VA 2X01A 1CI8A 2ZL1A 4E3OA 5FQJA 3A3IA 3NIAA 2BASA 3SOIA 3G35A 4HESA 4Y2FA 1PRQA 4HI4A 2XGNA 1P9WA 4L9GA 2A3UA 1IYQA 1RGYA 3H82A 5IHVA 3SS4A 1BLSA 4RQ9A 4KG5A 3C7VA 4JF6A 4O8GA 1K4FA 4LCMA 5AVFA 2OAQ1 4GS9B 5HWVA 2JKFA 4ZJ3A 4OKPA 3S4XA 2JKRM 3F1OB 5LBRA 4Y0TA 3FG8A 3UE6A 2GX5A 3KYQA 3ZCZA 1KGEA 2PBYA 2K31A 2OWJA 4KZAA 5CECA 2O9AA 3O5YA 2XQZA 3VE4A 1DJBA 2V1ZA 3IT9A 1KDSA 2R9WA 3CMZA 4K0WA 4E3MA 2DRWA 1WYBA 4MLLA 3FZCA 5A93A 3T4TA 4FTXA 4GS9A 3NI9A 3H7WA 3LICA 4LV2A 3IXGA 4LV0A 2J3TD 4X56A 4BD0A 3PBSA 2HDSA 3ZFZA 2ZJ9A 4CLCC 3T4OA 4U3TA 3RTYA 3QP8A 4P6ZS 1KE3A 5FL3A 3T1QB 4IBXA 2W1TB 1DY6A 1RCJA 1GCEA 3PXPA 3N7WA 1HD8A 4JGPA 2IA2A 3E4OA 4DDYA 3C7UA 1MPLA 4BL2A 2E8IA 3EOIA 3NHQA 3FKVA 4U0TA 4Z9QA 1NXYA 4IUHA 3EWKA 5J4EA 2WK0A 2PRFA 3EQUA 4K0XA 3IS2B 2WADA 4PHTA 3U4LP 3ZG8B 3DAVA 1JWPA 4HJ6A 2UV0E 3M2JA 2GNXA 4P87A 1S1YA 3PAGA 3KYZA 3T4KA 4ARZA 3BY9A 3G34A 4L0LA 2EX8A 3E0YA 4FOFA 5FQIA 3GDIA 1LLBA 1ERMA 5M19A 3MKFA 3UDXA 3G2ZA 4JLFA 5CTNA 3VE3A 2V0WA 4EV4A 4DE0A 2XA7M 4PM8A 3DTMA 1OMEA 1Z6FA 4DMZA 4G3VA 5K5BA 3VOZA 3TOIA 3WS1A 1GHMA 1I2WA 2NUTC 2XD1A 2O9CA 4KG2A 3F1NB 2ZC4B 1XX2A 1FSYA 1PZOA 5FATA 1YKDA 2DMWA 3VP3A 4BL3A 1PZPA 3IH8A 5CRFA 4FSFA 3ZHHA 2PR5A 3OPLA 4DJ2A 5FEGA 4WLAA 3LCEA 2R78A 3T50A 3LY4A 5HSQA 3GMWA 1SKOB 3C5AA 1K56D 1DP6A 5FDHA 2PYRA 4R38A 1MBLA 2EA9A 4N1XA 4S2JA 3IX3A 3UPPA 3IS2A 4P0MA 4R3BA 1CI9A 1IYSA 3G32A 2HP9A 5MC7A 3KSGA 4ARZB 1LL8A 2V1BA 5L8MA 3LI9A 5KZHA 5A92A 2BG1A 4OOLA 3C4OA 4BENA 5HL6A 3OZHA 2VV6A 3T12B 3VP1A 5FAOA 1O7EA 1K6RA 2QHKA 5GL9A 3QHYA 1S6RA 1PWDA 3RXXA 2MJ6A 3T1XA 4LLOB 1ACFA 1ZC2A 5F83A 4B9OA 2CC1A 2ZM0A 1GHIA 4BWIA 2XDMA 3IF6A 1N4OA 2A49A 4MDZA 3GV9A 3QNBA 3V50A 1NLZA 4QB8A 1GSXA 1BLCA 5CXWA 2VEAA 3W2ZA 2XF3A 2Y2GA 3LFVA 1E3UA 1T1AA 3TRCA 4HY8A 4HNBA 1KGFA 1XFQA 1FILA 3IX4A 4OLGA 2W0NA 1K54C 3HCYA 4ZDXA 1CEFA 3IWQA 1YMSA 4DE3A 2V8CA 4I3IA 4LRZE 1NY0A 4DXCA 4DXBA 1ESIA 2DCFA 3ZG5A 4GCZA 2B95A 4R1GA 1QMEA 3UB9A 1SHVA 4YOFA 4QU3A 5EM0A 3PTEA 1K0KA 1BYWA 3WS0A 1K57C 1LI0A 5J8XA 3JVVA 5E2GA 2Y2QA 1A0KA 4PM7A 2GDNA 1OTDA 3OCNA 4ME4A 2QYBA 1SKFA 3R7WA 2XRNA 1ES2A 5DTTA 5J7EA 1LSWA 2K2NA 1MWSA 1FCNA 5FAQA 3B42A 5F68A 5GHZA 2QJ5A 4AFIA 1EW0A 2ZOIA 3VP2A 3T4SA 4Q0JA 5KIZA 3IXHA 3LR0A 2B5RA 3UO9A 2G7UA 2WGWA 2QWSA 3IHBA 3V3RA 4I3JA 3EGDC 5EVIA 3VOYA 1ZG6A 4OPYA 5EE8A 4HP9A 3CAXA 1AWIA 1W7FA 2V20A 5DFYA 2J9PA 1QMFA 2W1RA 2W1TA 4HIAA 3BY8A 3GTCA 1S4SA 2Z6CA 2KDKA 4C3QA 5KSHA 4GB7A 3BFCA 3ICYA 1C3BA 3PBRA 4E3JA 4WELA 2PR6A 2HDQA 1XGIA 4C6YA 4QWOA 4MBFA 3MQ0A 3W4QA 4ZAMA 1I2SA 4GHIA 3CUEA 2HF6A 3NBLA 1JWZA 3E4QA 4WN5A 3R4KA 1X0OA 4ZTKA 3LIEA 3ZG9B 1YM1A 3S7PA 5IU1A 1SCWA 5CGXA 3OC2A 2WKEA 4EEPA 3UN7A 1BLHA 1ZHHB 5D3OA 2EFUA 4K91A 1TS0A 5KMWA 5AQ9A 2VGKA 1T1BA 2XK1A 4OPRA 3E2KA 5KSCA 1NJ4A 2V8FA 3PBQA 2OWHA 3CHWP 5TGFA 3C2WA 3VP4A 2LB5A 4WBGA 3VSLA 2CMNA 3NDEA 4WYYA 1IELA 3SH7A 2ACGA 1OJGA 4F3LA 3NY4A 1H8YA 4GN2A 4I5SA 4LPZA 3LIFA 1OTBA 1FIKA 3KYEA 3N8SA 2W3FA 4GZBA 2JBFA 2H0YA 1LI9A 3TW8A 3CZDA 4EETB 1OTAA 1ONGA 1YSPA 4EWFA 1K54A 1LT0A 4Q8IA 4IUKA 4I38A 3EEAA 3BJNA 1GSWA 5HD3A 4ETXA 2EXBA 3FPVA 3ZVTA 1Q2PA 4IJGA 5DKLA 3Q07A 2ZQDA 5HWTA 1IKGA 4N92A 4DE1A 2Y2LA 3SH8A 3TE8A 1MY8A 3VV4A 4EQIA 1ES5A 2LB9A 5CEBA 1UWNX 1PI5A 2ZMFA 5DTKA 2V9AA 2B02A 1L0GA 3DTIA 2EFXA 1PI4A 4ETZA 1N9LA 3Q81A 4IVKA 4OQIA 2VGLS 2VZWA 1ZKJA 3V39A 2HP6A 2ZOHA 1VHMA 4BQMA 4E04A 3KSHA 1JNUA 2AVXA 4E6WA 2WKPA 1YLWA 1FCOA 1F2KA 4IHQA 5FI6A 4WEKA 4FD8A 1PW8A 1P9RA 1CQAA 2XD5A 5AQ7A 4B93A 3HLBA 4GHIB 2P9VB 3UPOA 4JXWA 3QP1A 3W4OA 3KSIA 2DNSA 1VETA 1XJ6A 5L10A 1AXBA 4PPRA 3KSFA 3UDIA 3BW6A 2ZC7A 4MN7A 1S66L 3BM6A 1S67L 2L4RA 2OSUA 1YQSA 4KZ3A 3OBFA 4EESA 5GLBA 4RA7A 3VSKA 2VV7A 2J3TC 4JXVA 2Y55A 3B33A 3FC7A 3OPHA 4DF6A 4MCWA 2BTFP 3S7QA 3LYXA 2XR0A 3CUEC 4Y3IA 4FH4A 2H10A 2HP5A 3HUNA 4UA9A 1PWCA 3LR3A 3L9KA 1FOFA 2EXAA 3BFGA 4K08A 5CX7A 1TF1A 1W63Q 2J9OA 4NKPA 1V9YA 4PKYG 3RFBA 1LL5A 4KG6A 3FKWA 1DP8A 2PAVP 2Q9NA 4GJ4A 1RP5A 5IS1A 3QP2A 2Z2MB 2Y2OA 1XFNA 3MXRA 4QHCA 4N9LA 5DVAA 3NECA 2VLGA 3S7NA 3C38A 2P74A 1JTGA 2VV8A 2VJWA 2W3DA 1DP9A 4UQIS 5IT5A 3PAEA 1MKMA 4EERA 1MKIA 3C30A 2ZD8A 1TS8A 3FV7A 1GHPA 3ITBA 1ESUA 2ZMVA 2J7VA
chains in the Genus database with same CATH topology
3T1QB 1G5UA 3T1XA 1CJFA 3T12B 1J3WA 2V8FA 3LGOA 4X25A 1ACFA 5FEGA 2BTFP 1FIKA 5EV0A 4D60A 1F2KA 1YPRA 2B95A 1D1JA 2PRFA 5EVEA 3CPTB 3UB5P 1HLUP 1SKOB 3CHWP 3KYEA 3MSHA 1VETB 3CPTA 1VEUB 1VEUA 3NULA 3T1SA 2PAVP 4X1MA 3U4LP 5FDSA 5FEFA 4ESPA 3DAVA 5EM0A 1CQAA 1FILA 3L9KA 1K0KA 2ZL1A 4X1LA 2E8JA 3MS6A 5EM1A 3LEQA 4FUWA 2ZL1B 2VK3A 3D9YA 3T1RA 1SZVA 1PNEA 1AWIA 1Y4OA 2ACGA 3L7HA 1VETA 2JKFA 1PFLA 1A0KA 2JKGA 1CF0A 1SKOA 4QWOA 1Z09A 3NECA 2HZ5A 2V8CA 2PBDP 1PRQA 4FTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T1Q B;  1G5U A;  3T1X A;  1CJF A;  3T12 B;  1J3W A;  2V8F A;  3LGO A;  4X25 A;  1ACF A;  5FEG A;  2BTF P;  1FIK A;  5EV0 A;  4D60 A;  1F2K A;  1YPR A;  2B95 A;  1D1J A;  2PRF A;  5EVE A;  3CPT B;  3UB5 P;  1HLU P;  1SKO B;  3CHW P;  3KYE A;  3MSH A;  1VET B;  3CPT A;  1VEU B;  1VEU A;  3NUL A;  3T1S A;  2PAV P;  4X1M A;  3U4L P;  5FDS A;  5FEF A;  4ESP A;  3DAV A;  5EM0 A;  1CQA A;  1FIL A;  3L9K A;  1K0K A;  2ZL1 A;  4X1L A;  2E8J A;  3MS6 A;  5EM1 A;  3LEQ A;  4FUW A;  2ZL1 B;  2VK3 A;  3D9Y A;  3T1R A;  1SZV A;  1PNE A;  1AWI A;  1Y4O A;  2ACG A;  3L7H A;  1VET A;  2JKF A;  1PFL A;  1A0K A;  2JKG A;  1CF0 A;  1SKO A;  4QWO A;  1Z09 A;  3NEC A;  2HZ5 A;  2V8C A;  2PBD P;  1PRQ A;  4FTX A; 
#chains in the Genus database with same CATH topology
 4OQG A;  1K25 A;  1OT6 A;  4WMC A;  3LUQ A;  1D1J A;  2EX9 A;  1O07 A;  4NXF A;  1ERQ A;  1IOU A;  4WL9 A;  1STZ A;  4P6Z M;  2W3H A;  3P01 A;  2PD7 A;  4WZ4 A;  4EUZ A;  4Q0H A;  5A90 A;  4KUK A;  1K57 A;  5L09 A;  3CI6 A;  4PM9 A;  2JN7 A;  1UGU A;  3HLE A;  1E4D A;  4N9K A;  4N1H A;  1NLY A;  3T4L A;  4Y13 A;  3PHY A;  1XKZ A;  3UE0 A;  3QP5 A;  4RVA A;  3UE1 A;  4S2N C;  4XUZ A;  4H8R A;  1OT9 A;  2HZ5 A;  2EX6 A;  4WEJ A;  3LGO A;  1BUE A;  4Y5F A;  1CK3 A;  4JGO A;  5DJT A;  4KZ6 A;  2K7S A;  5AQA A;  4KZ8 A;  1WA9 A;  3RH8 B;  4JXS A;  1NWZ A;  4E6X A;  3W4P A;  4YWZ A;  4OPQ A;  3ISG A;  3M2K A;  3LO7 A;  1UWP X;  3SS5 A;  3WWX A;  2WKH A;  3CLO A;  4XUX A;  3SH9 A;  2EWW A;  4LGW A;  4IBR A;  3D3O A;  1OPX A;  2XA7 S;  3E4P A;  1MWU A;  4KQR A;  3H7W B;  2V0U A;  5EM1 A;  1DJA A;  5EFW A;  2G2U A;  1YT4 A;  2P08 A;  4JBF A;  2A24 B;  5FAP A;  4WF0 A;  3KO6 A;  3AGD A;  3MKE A;  3LY3 A;  4YIN A;  5L07 A;  3BLM A;  2HPB A;  3K2N A;  3DBA A;  5FAS A;  5E2F A;  3LEQ A;  4FUW A;  3EEH A;  3JPU A;  2J8Y A;  4HH2 A;  5E2H A;  2OLU A;  5HAR A;  5DKK A;  3S1Y A;  3DW0 A;  1EWZ A;  3BFF A;  4HOI A;  3GRJ A;  4EUV A;  1K55 A;  3ZNY A;  5F1G A;  1H0M A;  3BLS A;  3HLW A;  1XJ4 A;  3PR6 A;  1H5X A;  2QJ7 A;  5CED A;  4LFU A;  5CTM A;  1SDN A;  2B18 A;  5FI2 A;  5HWW A;  5TBM B;  1PWG A;  3QP4 A;  4NK3 A;  2EWV A;  2Z6D A;  4UEY A;  2M7V A;  2Y2P A;  3GQZ A;  2JKG A;  5JYO A;  4DN0 A;  1D7E A;  4DRT A;  5HDD A;  2GJ3 A;  3BYD A;  1K6S A;  4EW7 A;  3FPW A;  1L2S A;  4GD8 A;  5F1F A;  4ZJ2 A;  4PM5 A;  3BFD A;  4WZ5 C;  3O3V A;  4EQ1 A;  1BUL A;  2D01 A;  1VM1 A;  4E3I A;  1L3L A;  2PYP A;  4GDB A;  5FQK A;  4X6T A;  2PBD P;  2H28 A;  2PU2 A;  3DWK A;  2Z2L B;  3OLO A;  4GKU A;  4XT2 A;  3HLF A;  2Y2N A;  3Q7V A;  4ESP A;  1VQQ A;  3N4I A;  4E3L A;  2ZC5 B;  3PBO A;  4BMW A;  1NYY A;  1W5D A;  3T4Q A;  3NDG A;  1M6K A;  3KX0 X;  3G6O A;  1J3W A;  1XGJ A;  3IH9 A;  1H8M A;  1GSV A;  2FFF B;  5E43 A;  1K56 A;  4Z1W A;  2WKQ A;  1VEU A;  4ID4 A;  3GR2 A;  1H3Q A;  5EVL A;  1TEM A;  2FFY A;  1NRF A;  2Y2M A;  4E3K A;  4L9E A;  4O7D A;  1HVB A;  4JF4 A;  1ES3 A;  4HJ4 A;  1JVJ A;  1G68 A;  1FSW A;  2INW A;  3GVB A;  2XSS A;  2JCH A;  2WUQ A;  3IQA A;  1OTI A;  4CLC D;  4KZ4 A;  4L9F A;  5FDS A;  5CHJ A;  4XT2 B;  5L2F A;  4WMC D;  3SS3 A;  1Y28 A;  3N8R A;  3GEC A;  3HL9 A;  4X25 A;  5EOE A;  3P09 A;  1LL9 A;  1XP4 A;  3BWL A;  1W8Q A;  2Y79 A;  4BJP A;  1NYM A;  2WGW B;  1LSV A;  3HLD A;  1BSG A;  5AJG A;  5J3W A;  1IEM A;  2L0W A;  3HJK A;  4BBU A;  4BBT A;  3CPT B;  2D02 A;  1BTL A;  4KZ9 A;  3HUO A;  3A3F A;  5TBM A;  5HDC A;  3UME A;  4R0Q A;  1MWT A;  3CWF A;  3VMA A;  2XEP A;  5HAI A;  1N9O A;  3D4F A;  3WS2 A;  1ES4 A;  2W27 A;  1E3U D;  2JKT M;  4M4X A;  3P98 A;  4OH0 A;  3VP0 A;  3NCK A;  2A24 A;  3MXS A;  4MNR A;  4MMN A;  1XJ3 A;  1WYC A;  3IF6 C;  2VKS A;  4CLC E;  3A3J A;  3F1P A;  3S7O A;  5FI7 A;  2HGV A;  2ZBB A;  3Q82 A;  4EBP A;  1YLZ A;  4OOM A;  4DKI A;  1MWR A;  4NXE A;  4JKT A;  3JYI A;  4ZRR A;  4GOG A;  2VX8 A;  3E98 A;  1YPR A;  1F5M A;  3WRT A;  4OPZ A;  1MZU A;  1IYP A;  3GSG A;  4IVI A;  1ALQ A;  3TG9 A;  3OCL A;  1TD5 A;  3JVU A;  3IWI A;  1PFL A;  2VGL M;  3O88 A;  2ZQA A;  1NZO A;  5CGS A;  1CJF A;  2WGV A;  4MBH A;  1L0D A;  5I94 A;  4R23 A;  3T4J A;  2C6W B;  3LI8 A;  3G4P A;  4E3N A;  5A8B A;  4KQQ A;  2HV1 A;  5G18 A;  3OOV A;  4GDN A;  1FQG A;  4OON A;  5F5Y A;  5JYP A;  3TSG A;  3BRM A;  4X55 A;  1MXO A;  5FQ9 A;  3H9W A;  5DTS A;  2M7U A;  4WM9 A;  1W79 A;  4JGR A;  4OP8 A;  5BOH A;  4B88 A;  2IWC A;  1DJC A;  3C4P A;  3BEB A;  3M6H A;  3PYP A;  2QZ6 A;  3MXQ A;  4HP4 A;  3SW1 A;  4LEN A;  4R4R A;  5F6A A;  2G2W A;  1PYY A;  1S1Z A;  4MEZ A;  4OQ0 A;  3B3X A;  1G6O A;  2W3G A;  2UWX A;  4QY6 A;  2JE5 A;  3Q1F A;  4O01 A;  1PW1 A;  3FYZ A;  1YLP A;  4UHU A;  4LCL A;  3IWO A;  4UAA A;  5M18 A;  1IKI A;  4Y0U A;  2ZLY A;  4WUJ A;  4BBV A;  1ZTU A;  3DTE A;  4QD4 A;  1PIO A;  1W63 M;  5CHU A;  5F69 A;  4X68 A;  3TJZ C;  1Q2Q A;  2HJE A;  4EBL A;  3EGX C;  3HBR A;  3HUM A;  3MMH A;  3D9Y A;  3MFX A;  4JPM A;  3HVF A;  4HBU A;  1SKO A;  2BLS A;  1KE4 A;  1HTZ A;  3IBJ A;  1N9N A;  4A5R A;  4IED A;  4KEN B;  4KQD A;  1FCM A;  3IX8 A;  2X71 A;  1IYO A;  4LRY C;  1TVF A;  3UB8 A;  1T19 A;  1TDG A;  3DWZ A;  4DDS A;  1K55 C;  2WKI A;  1FR1 A;  1MC0 A;  3MQO A;  2R9X A;  1KVL A;  4I39 A;  3Q7V B;  3F1N A;  3V67 A;  1F9I A;  4GD6 A;  4S2I A;  1XJ2 A;  2Y8H A;  4Y7P A;  3VFH A;  5HZH A;  4KUO A;  4S2P A;  2O9B A;  5TR7 A;  3VFF A;  4H6J B;  3K3C A;  2GZA A;  4OQH A;  3BFE A;  4Y0O A;  4HHD A;  1J9M A;  3LR4 A;  1XXM A;  3UMD A;  4DE2 A;  3O86 A;  3T1R A;  4CLC A;  3NOU C;  4FH2 A;  3UY6 A;  3NOP C;  5FSR A;  5GLA A;  2V2F F;  2XFS A;  4OP5 A;  4PKY A;  5E2E A;  3E2L A;  3B47 A;  4R3A A;  4S2L A;  4B4X A;  3MQQ A;  5EVI C;  4S2O A;  2EX2 A;  3S22 A;  4C75 A;  4KZ7 A;  1HZO A;  1FR6 A;  4M3K A;  3L7H A;  3G30 A;  1TS6 A;  2OAP 1;  2FH5 A;  3M6B A;  3MBZ A;  5GHY A;  5DF9 A;  5EVE A;  2QKP A;  2RL3 A;  3A3E A;  3IXB A;  5TJJ A;  3SZT A;  3IHA A;  3ULF A;  1ZG4 A;  3ZVW A;  1LHY A;  1TS7 A;  4QJG A;  4I3A A;  5HPF A;  2WAE A;  1JTD A;  2W3E A;  4JGQ A;  4X1L A;  5EVI D;  3OPR A;  4KQO A;  4EBN A;  5GLC A;  2ZC3 B;  2H0T A;  2ZQ7 A;  3D72 A;  2H5S A;  3Q7Z A;  4QPR A;  3V3S A;  2PU4 A;  2J3W A;  3F1P B;  3IBR A;  4MN5 A;  4KZ5 A;  2P9V A;  5I5L A;  3ZG7 B;  2OLV A;  2ZC6 B;  3CJM A;  1XA7 A;  5TFQ A;  2E8J A;  3UB6 A;  3MZF A;  5FQQ A;  4GW9 A;  1H8Z A;  1U60 A;  3MFD A;  4KZB A;  4S2K A;  2M1C A;  1YLJ A;  4HJ3 A;  4MN6 A;  1YLT A;  2XLN A;  2Y91 A;  4OLD A;  4P85 A;  5EPH A;  3UDF A;  1CEG A;  1ONH A;  1N9B A;  2V1A A;  5F82 A;  5AQB A;  5EOO A;  1YAX A;  4D2O A;  3LR5 A;  3WS4 A;  2PD8 A;  1Y54 A;  3H82 B;  4HQA A;  1L0F A;  1T18 A;  3I7J A;  2WZX A;  2JKR I;  3UPN A;  2WYX A;  1YMX A;  3HJI A;  4CQH A;  1GA0 A;  3A0R A;  1KDW A;  2Y59 A;  3MS6 A;  2ZL1 B;  1P0Z A;  1Y4O A;  2VGJ A;  1ERO A;  4JF5 A;  4X53 A;  3ZYT A;  2NUP C;  3LIB A;  5CGW A;  5HPI A;  3HLC A;  4D60 A;  1I5Q A;  5GHX A;  1IFQ A;  4UA6 A;  1JWV A;  2C5W B;  3HLG A;  1V9Z A;  3LEZ A;  5CHM A;  2J80 A;  2ZM2 A;  2Y2J A;  2JC7 A;  3V5M A;  3R7W B;  1XPB A;  4ZBE A;  3C8C A;  2HJ9 C;  2WGI A;  4Q0I A;  1WE4 A;  1K38 A;  1KVM A;  4JXG A;  5C5K A;  4DJ3 A;  3K3D A;  2Y2K A;  2PHY A;  3LIA A;  1VET B;  1VEU B;  3BQA A;  5HL1 A;  4PM6 A;  5FEF A;  3CIT A;  3WS5 A;  2PT7 A;  5HW3 A;  2ZM8 A;  3A0V A;  1KGG A;  2KLI A;  1PNE A;  4GNU A;  3ZG0 A;  5FQM A;  5M1A A;  2IWD A;  2Y2I A;  2KOI A;  4BLM A;  1L0E A;  4YNR A;  4UQI M;  3MF0 A;  2O0Y A;  5A91 A;  4F94 A;  3N6I A;  5HDS A;  3DTK A;  2RCX A;  4H6J A;  4QY5 A;  4YFM A;  1OJ5 A;  3G31 A;  1BLP A;  3F1O A;  3ZGA B;  3QNC A;  4RX3 A;  1D06 A;  4U0X A;  4G3K A;  4PAU A;  2O99 A;  4MBK A;  3NOT C;  2XFT A;  4FCF A;  2X02 A;  1XA1 A;  1BT5 A;  2Q0O A;  4OOY A;  1KOU A;  3IF5 A;  2ZQ9 A;  1SZV A;  5DF7 A;  3AGF A;  2P04 A;  3N8L A;  3NC8 A;  5FA7 A;  2QMI A;  1M40 A;  3NJA A;  4GLQ A;  3UB5 P;  4NET A;  1HLU P;  3IXD A;  3MZD A;  4NEE D;  3CPT A;  4F3L B;  5DJU A;  1G6A A;  3UE3 A;  2Y2H A;  1KE0 A;  2FZ0 A;  4ZJ1 A;  4EEU A;  4NG2 A;  2XH9 A;  1CF0 A;  4NXB A;  4Y17 A;  4S2M A;  4X69 A;  1DRM A;  1W8Y A;  5DF8 A;  3ITA A;  5HD5 A;  2ZMA A;  1P97 A;  2VA0 A;  3NUL A;  2IWB A;  5GLD A;  2A2L A;  3RXW A;  4PMA A;  3A3D A;  4EU0 A;  1T1C A;  4UA7 A;  3ZQ5 A;  4R3J A;  3EQV A;  4II7 A;  4EXO A;  1TDL A;  4RYE A;  5EEC A;  3HRE A;  2HDR A;  4LV3 A;  4O0P A;  5HX9 A;  4BD1 A;  4WZ5 A;  5HFO A;  2Q9M A;  3PBN A;  1F98 A;  3FWL A;  3CG5 A;  4S2N A;  5G4Y A;  2XRO A;  2WKR A;  1NRJ A;  4CJN A;  2I72 A;  2OV5 A;  3QP6 A;  4G3W A;  2KX6 A;  3W8K A;  3RJU A;  5HAQ A;  3MSH A;  4R70 A;  2YKF A;  1BZA A;  3MZE A;  3AGE A;  4CPK A;  3ZDJ A;  4XXR A;  2Y4A A;  2P7J A;  2JKT I;  1GA9 A;  2ZQC A;  3G2Y A;  1LSX A;  2PDR A;  3MR0 A;  4NXG A;  2ZQ8 A;  2WZZ A;  1ODV A;  4OVD A;  4X1M A;  5CER A;  4RX2 A;  1YSQ A;  1NZU A;  4HEF A;  3U2A A;  3PBT A;  2HDU A;  1S4R A;  1S0W A;  2VK3 A;  2L1M A;  3BQ8 A;  5EVI B;  5G4Z A;  2OOL A;  1G28 A;  4R4S A;  1YLY A;  1VB6 A;  5HAP A;  2JHE A;  5U47 A;  3P7N A;  3IF6 B;  3WRZ A;  3ZNT A;  4HH3 A;  5AVE A;  2WAF A;  4Y15 A;  1E25 A;  4LRX C;  1RGZ A;  4LV1 A;  2YKH A;  1Z09 A;  2QPN A;  3MJQ A;  4B4Z A;  1SDE A;  4P6B A;  5DFX A;  3A0S A;  1G5U A;  3VOL A;  1EI5 A;  1K4E A;  5EV0 A;  5EUA A;  3UB7 A;  3BEC A;  3OPP A;  4HBT A;  3UNW A;  1OTE A;  4CLC B;  3T1S A;  4R6L A;  3LID A;  3O87 A;  2I9V A;  2X01 A;  1CI8 A;  2ZL1 A;  4E3O A;  5FQJ A;  3A3I A;  3NIA A;  2BAS A;  3SOI A;  3G35 A;  4HES A;  4Y2F A;  1PRQ A;  4HI4 A;  2XGN A;  1P9W A;  4L9G A;  2A3U A;  1IYQ A;  1RGY A;  3H82 A;  5IHV A;  3SS4 A;  1BLS A;  4RQ9 A;  4KG5 A;  3C7V A;  4JF6 A;  4O8G A;  1K4F A;  4LCM A;  5AVF A;  2OAQ 1;  4GS9 B;  5HWV A;  2JKF A;  4ZJ3 A;  4OKP A;  3S4X A;  2JKR M;  3F1O B;  5LBR A;  4Y0T A;  3FG8 A;  3UE6 A;  2GX5 A;  3KYQ A;  3ZCZ A;  1KGE A;  2PBY A;  2K31 A;  2OWJ A;  4KZA A;  5CEC A;  2O9A A;  3O5Y A;  2XQZ A;  3VE4 A;  1DJB A;  2V1Z A;  3IT9 A;  1KDS A;  2R9W A;  3CMZ A;  4K0W A;  4E3M A;  2DRW A;  1WYB A;  4MLL A;  3FZC A;  5A93 A;  3T4T A;  4FTX A;  4GS9 A;  3NI9 A;  3H7W A;  3LIC A;  4LV2 A;  3IXG A;  4LV0 A;  2J3T D;  4X56 A;  4BD0 A;  3PBS A;  2HDS A;  3ZFZ A;  2ZJ9 A;  4CLC C;  3T4O A;  4U3T A;  3RTY A;  3QP8 A;  4P6Z S;  1KE3 A;  5FL3 A;  3T1Q B;  4IBX A;  2W1T B;  1DY6 A;  1RCJ A;  1GCE A;  3PXP A;  3N7W A;  1HD8 A;  4JGP A;  2IA2 A;  3E4O A;  4DDY A;  3C7U A;  1MPL A;  4BL2 A;  2E8I A;  3EOI A;  3NHQ A;  3FKV A;  4U0T A;  4Z9Q A;  1NXY A;  4IUH A;  3EWK A;  5J4E A;  2WK0 A;  2PRF A;  3EQU A;  4K0X A;  3IS2 B;  2WAD A;  4PHT A;  3U4L P;  3ZG8 B;  3DAV A;  1JWP A;  4HJ6 A;  2UV0 E;  3M2J A;  2GNX A;  4P87 A;  1S1Y A;  3PAG A;  3KYZ A;  3T4K A;  4ARZ A;  3BY9 A;  3G34 A;  4L0L A;  2EX8 A;  3E0Y A;  4FOF A;  5FQI A;  3GDI A;  1LLB A;  1ERM A;  5M19 A;  3MKF A;  3UDX A;  3G2Z A;  4JLF A;  5CTN A;  3VE3 A;  2V0W A;  4EV4 A;  4DE0 A;  2XA7 M;  4PM8 A;  3DTM A;  1OME A;  1Z6F A;  4DMZ A;  4G3V A;  5K5B A;  3VOZ A;  3TOI A;  3WS1 A;  1GHM A;  1I2W A;  2NUT C;  2XD1 A;  2O9C A;  4KG2 A;  3F1N B;  2ZC4 B;  1XX2 A;  1FSY A;  1PZO A;  5FAT A;  1YKD A;  2DMW A;  3VP3 A;  4BL3 A;  1PZP A;  3IH8 A;  5CRF A;  4FSF A;  3ZHH A;  2PR5 A;  3OPL A;  4DJ2 A;  5FEG A;  4WLA A;  3LCE A;  2R78 A;  3T50 A;  3LY4 A;  5HSQ A;  3GMW A;  1SKO B;  3C5A A;  1K56 D;  1DP6 A;  5FDH A;  2PYR A;  4R38 A;  1MBL A;  2EA9 A;  4N1X A;  4S2J A;  3IX3 A;  3UPP A;  3IS2 A;  4P0M A;  4R3B A;  1CI9 A;  1IYS A;  3G32 A;  2HP9 A;  5MC7 A;  3KSG A;  4ARZ B;  1LL8 A;  2V1B A;  5L8M A;  3LI9 A;  5KZH A;  5A92 A;  2BG1 A;  4OOL A;  3C4O A;  4BEN A;  5HL6 A;  3OZH A;  2VV6 A;  3T12 B;  3VP1 A;  5FAO A;  1O7E A;  1K6R A;  2QHK A;  5GL9 A;  3QHY A;  1S6R A;  1PWD A;  3RXX A;  2MJ6 A;  3T1X A;  4LLO B;  1ACF A;  1ZC2 A;  5F83 A;  4B9O A;  2CC1 A;  2ZM0 A;  1GHI A;  4BWI A;  2XDM A;  3IF6 A;  1N4O A;  2A49 A;  4MDZ A;  3GV9 A;  3QNB A;  3V50 A;  1NLZ A;  4QB8 A;  1GSX A;  1BLC A;  5CXW A;  2VEA A;  3W2Z A;  2XF3 A;  2Y2G A;  3LFV A;  1E3U A;  1T1A A;  3TRC A;  4HY8 A;  4HNB A;  1KGF A;  1XFQ A;  1FIL A;  3IX4 A;  4OLG A;  2W0N A;  1K54 C;  3HCY A;  4ZDX A;  1CEF A;  3IWQ A;  1YMS A;  4DE3 A;  2V8C A;  4I3I A;  4LRZ E;  1NY0 A;  4DXC A;  4DXB A;  1ESI A;  2DCF A;  3ZG5 A;  4GCZ A;  2B95 A;  4R1G A;  1QME A;  3UB9 A;  1SHV A;  4YOF A;  4QU3 A;  5EM0 A;  3PTE A;  1K0K A;  1BYW A;  3WS0 A;  1K57 C;  1LI0 A;  5J8X A;  3JVV A;  5E2G A;  2Y2Q A;  1A0K A;  4PM7 A;  2GDN A;  1OTD A;  3OCN A;  4ME4 A;  2QYB A;  1SKF A;  3R7W A;  2XRN A;  1ES2 A;  5DTT A;  5J7E A;  1LSW A;  2K2N A;  1MWS A;  1FCN A;  5FAQ A;  3B42 A;  5F68 A;  5GHZ A;  2QJ5 A;  4AFI A;  1EW0 A;  2ZOI A;  3VP2 A;  3T4S A;  4Q0J A;  5KIZ A;  3IXH A;  3LR0 A;  2B5R A;  3UO9 A;  2G7U A;  2WGW A;  2QWS A;  3IHB A;  3V3R A;  4I3J A;  3EGD C;  5EVI A;  3VOY A;  1ZG6 A;  4OPY A;  5EE8 A;  4HP9 A;  3CAX A;  1AWI A;  1W7F A;  2V20 A;  5DFY A;  2J9P A;  1QMF A;  2W1R A;  2W1T A;  4HIA A;  3BY8 A;  3GTC A;  1S4S A;  2Z6C A;  2KDK A;  4C3Q A;  5KSH A;  4GB7 A;  3BFC A;  3ICY A;  1C3B A;  3PBR A;  4E3J A;  4WEL A;  2PR6 A;  2HDQ A;  1XGI A;  4C6Y A;  4QWO A;  4MBF A;  3MQ0 A;  3W4Q A;  4ZAM A;  1I2S A;  4GHI A;  3CUE A;  2HF6 A;  3NBL A;  1JWZ A;  3E4Q A;  4WN5 A;  3R4K A;  1X0O A;  4ZTK A;  3LIE A;  3ZG9 B;  1YM1 A;  3S7P A;  5IU1 A;  1SCW A;  5CGX A;  3OC2 A;  2WKE A;  4EEP A;  3UN7 A;  1BLH A;  1ZHH B;  5D3O A;  2EFU A;  4K91 A;  1TS0 A;  5KMW A;  5AQ9 A;  2VGK A;  1T1B A;  2XK1 A;  4OPR A;  3E2K A;  5KSC A;  1NJ4 A;  2V8F A;  3PBQ A;  2OWH A;  3CHW P;  5TGF A;  3C2W A;  3VP4 A;  2LB5 A;  4WBG A;  3VSL A;  2CMN A;  3NDE A;  4WYY A;  1IEL A;  3SH7 A;  2ACG A;  1OJG A;  4F3L A;  3NY4 A;  1H8Y A;  4GN2 A;  4I5S A;  4LPZ A;  3LIF A;  1OTB A;  1FIK A;  3KYE A;  3N8S A;  2W3F A;  4GZB A;  2JBF A;  2H0Y A;  1LI9 A;  3TW8 A;  3CZD A;  4EET B;  1OTA A;  1ONG A;  1YSP A;  4EWF A;  1K54 A;  1LT0 A;  4Q8I A;  4IUK A;  4I38 A;  3EEA A;  3BJN A;  1GSW A;  5HD3 A;  4ETX A;  2EXB A;  3FPV A;  3ZVT A;  1Q2P A;  4IJG A;  5DKL A;  3Q07 A;  2ZQD A;  5HWT A;  1IKG A;  4N92 A;  4DE1 A;  2Y2L A;  3SH8 A;  3TE8 A;  1MY8 A;  3VV4 A;  4EQI A;  1ES5 A;  2LB9 A;  5CEB A;  1UWN X;  1PI5 A;  2ZMF A;  5DTK A;  2V9A A;  2B02 A;  1L0G A;  3DTI A;  2EFX A;  1PI4 A;  4ETZ A;  1N9L A;  3Q81 A;  4IVK A;  4OQI A;  2VGL S;  2VZW A;  1ZKJ A;  3V39 A;  2HP6 A;  2ZOH A;  1VHM A;  4BQM A;  4E04 A;  3KSH A;  1JNU A;  2AVX A;  4E6W A;  2WKP A;  1YLW A;  1FCO A;  1F2K A;  4IHQ A;  5FI6 A;  4WEK A;  4FD8 A;  1PW8 A;  1P9R A;  1CQA A;  2XD5 A;  5AQ7 A;  4B93 A;  3HLB A;  4GHI B;  2P9V B;  3UPO A;  4JXW A;  3QP1 A;  3W4O A;  3KSI A;  2DNS A;  1VET A;  1XJ6 A;  5L10 A;  1AXB A;  4PPR A;  3KSF A;  3UDI A;  3BW6 A;  2ZC7 A;  4MN7 A;  1S66 L;  3BM6 A;  1S67 L;  2L4R A;  2OSU A;  1YQS A;  4KZ3 A;  3OBF A;  4EES A;  5GLB A;  4RA7 A;  3VSK A;  2VV7 A;  2J3T C;  4JXV A;  2Y55 A;  3B33 A;  3FC7 A;  3OPH A;  4DF6 A;  4MCW A;  2BTF P;  3S7Q A;  3LYX A;  2XR0 A;  3CUE C;  4Y3I A;  4FH4 A;  2H10 A;  2HP5 A;  3HUN A;  4UA9 A;  1PWC A;  3LR3 A;  3L9K A;  1FOF A;  2EXA A;  3BFG A;  4K08 A;  5CX7 A;  1TF1 A;  1W63 Q;  2J9O A;  4NKP A;  1V9Y A;  4PKY G;  3RFB A;  1LL5 A;  4KG6 A;  3FKW A;  1DP8 A;  2PAV P;  2Q9N A;  4GJ4 A;  1RP5 A;  5IS1 A;  3QP2 A;  2Z2M B;  2Y2O A;  1XFN A;  3MXR A;  4QHC A;  4N9L A;  5DVA A;  3NEC A;  2VLG A;  3S7N A;  3C38 A;  2P74 A;  1JTG A;  2VV8 A;  2VJW A;  2W3D A;  1DP9 A;  4UQI S;  5IT5 A;  3PAE A;  1MKM A;  4EER A;  1MKI A;  3C30 A;  2ZD8 A;  1TS8 A;  3FV7 A;  1GHP A;  3ITB A;  1ESU A;  2ZMV A;  2J7V A; 
#chains in the Genus database with same CATH homology
 3T1Q B;  1G5U A;  3T1X A;  1CJF A;  3T12 B;  1J3W A;  2V8F A;  3LGO A;  4X25 A;  1ACF A;  5FEG A;  2BTF P;  1FIK A;  5EV0 A;  4D60 A;  1F2K A;  1YPR A;  2B95 A;  1D1J A;  2PRF A;  5EVE A;  3CPT B;  3UB5 P;  1HLU P;  1SKO B;  3CHW P;  3KYE A;  3MSH A;  1VET B;  3CPT A;  1VEU B;  1VEU A;  3NUL A;  3T1S A;  2PAV P;  4X1M A;  3U4L P;  5FDS A;  5FEF A;  4ESP A;  3DAV A;  5EM0 A;  1CQA A;  1FIL A;  3L9K A;  1K0K A;  2ZL1 A;  4X1L A;  2E8J A;  3MS6 A;  5EM1 A;  3LEQ A;  4FUW A;  2ZL1 B;  2VK3 A;  3D9Y A;  3T1R A;  1SZV A;  1PNE A;  1AWI A;  1Y4O A;  2ACG A;  3L7H A;  1VET A;  2JKF A;  1PFL A;  1A0K A;  2JKG A;  1CF0 A;  1SKO A;  4QWO A;  1Z09 A;  3NEC A;  2HZ5 A;  2V8C A;  2PBD P;  1PRQ A;  4FTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...