1SKOA

Mp1-p14 complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
119
structure length
119
Chain Sequence
GSADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLPLVVSFIASSSANTGLIVSLEKELAPLFEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Mitogen-activated protein kinase kinase 1 interacting protei
publication title The structure of the MAP kinase scaffold MP1 bound to its partner p14: a complex with a critical role in endosomal MAP kinase signaling
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08923 MAPKK1_Int Mitogen-activated protein kinase kinase 1 interacting
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 1skoA00
5EM0A 4X25A 3T1SA 1PNEA 2ZL1A 1PFLA 1HLUP 1FILA 5FDSA 1VEUB 3T1RA 5EVEA 1A0KA 3NECA 3DAVA 2V8FA 2E8JA 3L9KA 2ZL1B 1PRQA 1FIKA 4FTXA 1Z09A 2PAVP 3D9YA 2JKGA 3MSHA 4X1MA 3T12B 1Y4OA 2V8CA 1CJFA 3L7HA 3T1XA 5FEFA 1SKOA 3UB5P 3U4LP 1CF0A 3LGOA 3T1QB 2BTFP 1CQAA 1F2KA 2B95A 1D1JA 1J3WA 1ACFA 3LEQA 1YPRA 1G5UA 2PRFA 4D60A 2ACGA 5EM1A 1AWIA 3MS6A 5EV0A 2HZ5A 1K0KA 4X1LA 4ESPA 4QWOA 3CPTA 4FUWA 1VETA 3NULA 2PBDP 3CHWP 1SKOB 1VEUA 5FEGA 2JKFA 2VK3A 3CPTB 1SZVA 3KYEA 1VETB
chains in the Genus database with same CATH superfamily
3NY4A 4E6WA 4ZDXA 1I2SA 3BYDA 2ZQCA 2HP6A 2PDRA 4OQIA 3OPHA 1HLUP 1EWZA 2O9BA 3P7NA 2GDNA 3B47A 4HJ4A 4C75A 2VKSA 2K7SA 3IX4A 4GS9A 2QMIA 4RYEA 3OZHA 3UB9A 2V9AA 4XXRA 1FOFA 5HDCA 3DTKA 1FIKA 2X02A 3ZFZA 3BQAA 2I72A 1ERMA 4EXOA 3RFBA 2NUPC 2GZAA 3S22A 1OPXA 1L0FA 4MMNA 3UPOA 3IXHA 5L8MA 4DF6A 3SZTA 1KDWA 4OLGA 2L0WA 1GHMA 5BOHA 5AJGA 1CQAA 5K5BA 4KENB 2O9AA 1GA9A 5CTMA 3IS2B 3N4IA 2YKHA 4R23A 3MBZA 2ACGA 2QZ6A 1Z6FA 1SDEA 1AWIA 2Y2MA 3RXXA 4MCWA 4I39A 4M3KA 4DE2A 2JE5A 4X1LA 4Y0TA 3JYIA 3PHYA 4JF6A 5EFWA 4OKPA 5CHMA 4II7A 5F68A 3NULA 3OPRA 3QP2A 5GLCA 1DP9A 3O3VA 3A3FA 3NDGA 2WUQA 2DRWA 4OP5A 2CC1A 3LY3A 3FPVA 3GSGA 1DP6A 5HSQA 5KIZA 2M7UA 4Y2FA 3F1OA 5GLBA 4EETB 4O8GA 1BULA 5HD5A 2P04A 3LR5A 3R7WB 1DJCA 1VEUB 5EVLA 2B02A 4KZAA 3PYPA 4A5RA 3ZG8B 3F1NB 1KGEA 1MKMA 4N92A 3DBAA 2ZL1B 4RVAA 1K25A 1PRQA 3IX3A 4JF5A 3O86A 5DFXA 3UE3A 3M2JA 4NXFA 4PM6A 4UQIS 4OPRA 3LIAA 3K3CA 3O5YA 2PR6A 2WGVA 3UB5P 4MBHA 5J4EA 4QY5A 3WS1A 1D1JA 1YLYA 3G2YA 4KZ7A 5FAPA 3LYXA 3Q7VA 4R38A 3LCEA 4MEZA 4IVIA 3N8LA 1YSPA 3MFXA 5AQ9A 1GHPA 4JGPA 5FQKA 2J80A 3F1NA 3ISGA 3AGFA 4ESPA 4QWOA 1M40A 4HP4A 4NXEA 3ZCZA 3TOIA 3PBTA 3CITA 5G18A 1VM1A 1H3QA 2HV1A 2VV8A 4Q0IA 2D01A 4Y13A 2VX8A 1NWZA 1S1YA 1QMEA 3CPTB 3C8CA 2EFUA 4RX3A 5L2FA 4HJ6A 4PKYG 4IUHA 3BRMA 5E2EA 4K0XA 3WWXA 4OLDA 5GLDA 2WZZA 2RCXA 2J9PA 3TG9A 1KDSA 2H0TA 3VFFA 1WYBA 2V0WA 3G31A 4QHCA 3SH7A 5G4ZA 4GNUA 5HAQA 5KSHA 1TDGA 4X55A 3HUMA 1XJ6A 2J8YA 5M19A 4I3IA 3MF0A 1ZG4A 4E3JA 4YINA 3HJIA 5M18A 4G3WA 3N6IA 3PBRA 2R78A 1BLPA 4NXBA 4WZ4A 3A0VA 4R3AA 2XK1A 5CEBA 3UNWA 4PPRA 3VV4A 3EEHA 3IBJA 2EX6A 4DXCA 4BL2A 1RGZA 4HOIA 3TJZC 2H10A 3NJAA 3ZHHA 3C2WA 4L0LA 3LIEA 3G6OA 2WGWB 1T18A 1V9YA 3GQZA 4D60A 5DTKA 3MKEA 1BLCA 4Q0HA 5IHVA 3BM6A 2KOIA 2Y8HA 1YLZA 3VE3A 1H8MA 5E2FA 4ME4A 5CERA 1ZTUA 4UAAA 2OAP1 4MBFA 3RXWA 4ARZA 5CTNA 3SW1A 4U0XA 2Y2OA 3CAXA 3DTMA 5FEGA 2P08A 2IWDA 2FH5A 4UEYA 1FR1A 5CGSA 4S2NA 3W8KA 2JKTI 3DWZA 5IS1A 4X68A 2VGLS 5IT5A 2XA7M 4HH3A 1UWNX 3IWOA 4IJGA 4EERA 3CMZA 2HDRA 4DN0A 2I9VA 2WGWA 4LENA 3BJNA 3PBOA 4R4SA 1MWRA 3UMDA 3H82B 2QJ5A 1VQQA 2PHYA 1T1AA 4EQIA 4FTXA 1ES4A 4NEED 3E0YA 3IF6B 3G35A 3VP2A 2DCFA 3PR6A 3MSHA 5CXWA 1CI8A 4K91A 1DRMA 3HREA 3IHBA 3MQQA 3OPLA 5IU1A 4OOLA 4GOGA 4OQHA 3MQOA 3IXBA 4S2NC 2ZBBA 3E4PA 4B4ZA 4PKYA 2OV5A 5J3WA 4M4XA 4DDYA 1G5UA 3KX0X 4MDZA 2PR5A 5GHZA 3HUOA 1OTIA 1DJAA 1K6RA 2HP9A 1FCNA 5EV0A 3CLOA 4DKIA 4L9FA 2HDQA 2ZQ9A 4DE3A 3NI9A 4YFMA 3IF6A 3C5AA 5M1AA 4JXWA 3PTEA 3HBRA 4BBTA 4RX2A 5E2HA 1DP8A 1YLJA 2VK3A 3LR3A 1YLPA 3TRCA 3UO9A 2XH9A 1TDLA 2BLSA 5EVIA 2R9XA 3LFVA 5HDSA 3I7JA 4EQ1A 2V8FA 1ZHHB 3VP4A 3IH9A 2Z6CA 4P6ZM 4Z9QA 5L07A 4P85A 3NHQA 2IA2A 2BG1A 2EX2A 4I3JA 1YT4A 3JVUA 5FQMA 3W4OA 1EROA 3Q07A 3IF6C 3OBFA 3Q7ZA 4F3LB 2Y2JA 4CQHA 3UY6A 1FQGA 1VB6A 3IXGA 2XFSA 2H28A 4MN6A 5L10A 3E98A 4EEPA 1S66L 1KE3A 3IXDA 1T1CA 4IEDA 5DF9A 3VOLA 1ZKJA 2HDSA 4S2PA 5HW3A 3D4FA 1RP5A 1P97A 3LEZA 5EVIC 3ZQ5A 1D06A 4BBUA 1CI9A 1G28A 3VOYA 1XFNA 5FQJA 3P09A 5CECA 3EQUA 3JVVA 1PW1A 2VA0A 3QNCA 3G2ZA 3UN7A 4HH2A 3V5MA 4BWIA 5HARA 5FQIA 1PWDA 1S6RA 4KG5A 3C4PA 4LGWA 4DDSA 4K0WA 4OPYA 4L9EA 2JHEA 4AFIA 3SH9A 4KZ4A 3RH8B 2UV0E 3BQ8A 3O87A 5FAOA 4IBRA 1LSVA 5CEDA 2LB5A 3T1SA 3FV7A 5EOOA 2OAQ1 4IHQA 5GLAA 1PW8A 5DJTA 2V0UA 2XD5A 2XGNA 4X69A 4QY6A 1NYMA 2XLNA 3WS5A 4WBGA 3OCLA 2HP5A 4PM9A 4HNBA 2IWCA 3NECA 3V67A 1Y28A 1PI4A 2ZLYA 4LRYC 2VEAA 2ZMFA 3E4OA 4ZJ1A 5HWTA 3KYQA 4GB7A 4HY8A 1GSVA 3ZG5A 1DY6A 1Q2PA 3ITAA 4WM9A 2Z2MB 1G6OA 4MNRA 4ETZA 1IYOA 5DFYA 1BUEA 1ZC2A 3NBLA 3A3JA 3UE6A 3T1XA 3ZGAB 1TS8A 1S4RA 1TS7A 4WEKA 2Y4AA 5F6AA 3T50A 1ERQA 2R9WA 4ID4A 3KSHA 1X0OA 3GDIA 1EW0A 2OWHA 1E4DA 3SOIA 5D3OA 3GVBA 1G68A 3WRTA 2ZC7A 1N4OA 4WL9A 1LL5A 4OOYA 4HJ3A 2W0NA 1XA7A 4PHTA 3CUEA 5EE8A 4BL3A 2GNXA 1G6AA 2EFXA 1YM1A 5CGXA 5JYPA 3BECA 2A49A 5HX9A 1SKOB 3ZG9B 4GCZA 2W3GA 1H8ZA 3W2ZA 2EWWA 1XFQA 3UDIA 5A93A 3EGDC 4JXGA 5TFQA 4BBVA 3BEBA 1YSQA 3FC7A 2EX8A 3QHYA 1FILA 4Y0OA 3T4SA 4BLMA 3QP5A 2WAFA 3D72A 4KQQA 1JTDA 1MWUA 4NKPA 1MBLA 1ESUA 3P98A 3PXPA 3VOZA 3CUEC 5A91A 3BFGA 1HD8A 1WA9A 3GR2A 1BLHA 3LO7A 4WEJA 1OT6A 4DXBA 3E2KA 3IS2A 1EI5A 3C7VA 1XXMA 3V50A 1IEMA 1SKOA 2QJ7A 2O9CA 1K6SA 2M7VA 4UQIM 4KZ6A 3QP8A 1HTZA 1BT5A 2O99A 4U3TA 1YMXA 5HD3A 4ZTKA 1H5XA 4OPQA 4C3QA 1YAXA 4GD8A 4O7DA 3R4KA 4E3IA 1T19A 4D2OA 1IYSA 1XX2A 1W63Q 3MS6A 3S7NA 4G3VA 4I3AA 4CLCB 2HZ5A 1M6KA 3UB7A 3JPUA 1KGFA 3TSGA 1S67L 3MJQA 2Q9MA 2J3TC 1TS0A 4KG6A 4S2IA 4PM7A 3CHWP 3H9WA 2P74A 2ZC6B 1K57A 5L09A 1I5QA 3R7WA 1VEUA 1PWCA 1MY8A 4Y17A 3UE1A 2JKFA 4N9LA 4KQOA 3HLFA 3M6BA 2Y79A 2DNSA 1UGUA 4JKTA 1S4SA 3RTYA 4B9OA 4EUZA 2ZL1A 1PFLA 1PIOA 3HLCA 3LIDA 4OH0A 5HAIA 5EVEA 4E3NA 1BTLA 2A2LA 1AXBA 4MBKA 2Z6DA 2ZC5B 3NIAA 4IVKA 2Y2PA 3T4KA 4LRXC 2JKGA 2RL3A 3EWKA 1K57C 1TD5A 3VSKA 3S7OA 4IBXA 3UB8A 3P01A 5A8BA 1IFQA 4KQRA 1KVLA 3T4LA 4XT2B 4EBPA 2HGVA 4FH2A 2WKPA 3UDFA 5HWWA 1XPBA 3IX8A 4BD1A 1SKFA 4KZ8A 1GSWA 1ONGA 4OQ0A 1LL9A 2ZQ7A 3A3IA 3NCKA 1XKZA 4BD0A 3CPTA 4B88A 3UPNA 1P9WA 3CJMA 2WKIA 1OJ5A 1XJ2A 1S0WA 2PBDP 5E2GA 1L2SA 1SCWA 1ES5A 3MKFA 4QB8A 3T4TA 1XJ3A 3GECA 1ALQA 2NUTC 4NETA 4FSFA 3KSIA 2WKRA 1FCMA 3KYEA 5AQAA 2W1TB 4HHDA 4X25A 2KLIA 4EBLA 4ETXA 1K4EA 4E3OA 4N1XA 3NOUC 4JF4A 4GZBA 3IBRA 1ZG6A 1XA1A 2VGLM 4KZ3A 1YQSA 5F83A 1FR6A 3VSLA 5FI6A 4ZRRA 2XROA 4R6LA 5FQQA 1YLWA 1MWSA 2L1MA 3BLSA 4QPRA 4LCMA 2J7VA 3QP4A 2H5SA 3WRZA 2FZ0A 3SS4A 4HEFA 5GHYA 3KO6A 2EXAA 4NXGA 4Y7PA 1NRJA 4KZ9A 1LT0A 3MMHA 4P87A 4LPZA 2V2FF 4L9GA 1F9IA 3PBSA 2VGJA 3UDXA 4XUZA 2YKFA 2A24B 1JVJA 4S2KA 1ACFA 5CX7A 5EVID 2W3EA 1L3LA 5F5YA 1KE0A 3KSGA 3MZFA 3KYZA 1RCJA 2JCHA 3ZYTA 2QPNA 4S2LA 2XA7S 5HZHA 3N7WA 4KG2A 3HCYA 5LBRA 4EW7A 4GD6A 1QMFA 3IWQA 3C4OA 1NLZA 5HDDA 4GDNA 4S2JA 5EECA 2WZXA 3WS4A 3HUNA 3LR4A 3K2NA 5F1FA 4N9KA 1E3UA 1N9NA 3HVFA 2QYBA 2HF6A 2VV7A 1MKIA 2WKEA 2Y2HA 3EQVA 3SS5A 3IH8A 2HPBA 1IYQA 3IF5A 3F1PB 4RQ9A 3H82A 4HP9A 3AGEA 2OSUA 3NOPC 2W3FA 2FFYA 2HJ9C 2B18A 3LUQA 2FFFB 4CPKA 1GA0A 1LL8A 1T1BA 1W5DA 1IKGA 1PI5A 1KE4A 1WE4A 1LI9A 3BWLA 1TEMA 1W8YA 3L7HA 4KQDA 5FEFA 5EPHA 3LGOA 4WF0A 4KZ5A 4LV2A 5TGFA 4GN2A 4G3KA 1ONHA 1JTGA 4R70A 2EXBA 2PYPA 1RGYA 3LEQA 4YOFA 3OCNA 1MWTA 3B42A 1K54A 2PRFA 4S2OA 4X6TA 3IQAA 3CZDA 2GJ3A 5CRFA 3PBQA 1NYYA 3BFCA 4WZ5A 2W3HA 4QD4A 1K0KA 2OOLA 2C6WB 2ZM2A 1OJGA 3T4OA 5HPFA 3ZG0A 4BENA 3MZDA 4UA6A 1PZPA 2QWSA 3S7QA 3MXQA 5TBMB 3OC2A 5DTTA 4EV4A 1VETB 5I94A 2L4RA 1E25A 5A90A 1STZA 4DRTA 5KMWA 3MFDA 2J9OA 4OVDA 5FL3A 3S1YA 1K54C 5FATA 2PBYA 3S7PA 4H6JB 3V39A 2OLVA 5CGWA 4BJPA 1LI0A 4WZ5C 3SH8A 3QNBA 4F3LA 2G2UA 1NY0A 2D02A 1HZOA 3MZEA 1MZUA 2V1ZA 4EWFA 4EUVA 3BY9A 1K55A 2OLUA 2P9VB 3T4JA 4GS9B 3EGXC 5HPIA 2EWVA 2W27A 5CHUA 1W63M 4WYYA 4WMCD 2CMNA 4C6YA 3D3OA 3IT9A 2ZOHA 4ZJ3A 1J9MA 2VV6A 3T1QB 2J3WA 1K56D 3V3RA 1C3BA 5AVEA 5TJJA 1W7FA 2Y55A 2Y2KA 1NZOA 4Y0UA 2OWJA 1V9ZA 2K2NA 2VLGA 2VJWA 1L0EA 1XGIA 1F5MA 4R1GA 4H6JA 3SS3A 2H0YA 1TF1A 4PMAA 2ZC4B 2J3TD 4I38A 3LIBA 2ZM0A 4EBNA 1K55C 4LRZE 4WUJA 3GMWA 1NLYA 2JBFA 1GHIA 2XEPA 1IOUA 3FYZA 2P9VA 2UWXA 3WS0A 5F1GA 3DW0A 2INWA 1SZVA 4MN7A 5EM0A 1KVMA 1PZOA 4NG2A 4ZJ2A 3OOVA 1PNEA 3VP0A 3VP3A 1OTDA 4JGRA 4S2MA 1NJ4A 3VFHA 3K3DA 1UWPX 3T1RA 1GCEA 1Q2QA 4DMZA 3DAVA 3F1OB 4YNRA 2V1BA 1XP4A 3PBNA 4WMCA 4NK3A 4U0TA 5FDHA 4FOFA 3T4QA 1OTAA 1P9RA 1WYCA 5AQBA 4GLQA 1K56A 3ZNTA 3T12B 2Y2QA 1Y4OA 5F69A 3Q81A 1JWZA 2PU4A 3DTEA 4DE1A 3W4PA 1CF0A 3PAEA 3AGDA 3FKVA 1F2KA 2ZC3B 3BW6A 1J3WA 3HLDA 3TW8A 5U47A 3ZVTA 1YPRA 3FPWA 1JNUA 4P6BA 1FCOA 5HL6A 5EM1A 4YWZA 3W4QA 4F94A 1BYWA 4X56A 4CLCD 5TR7A 4HIAA 2JN7A 2DMWA 3LIFA 2QKPA 3Q7VB 5EUAA 1NXYA 4JGOA 1S1ZA 3VMAA 2ZQ8A 1L0GA 1MC0A 4H8RA 2B5RA 5FI7A 4RA7A 4LLOB 1ES3A 3M2KA 3A0RA 2JC7A 2KX6A 4GKUA 1YLTA 3C7UA 4LV0A 4QU3A 1OTBA 3A0SA 3LY4A 4N1HA 2ZJ9A 2LB9A 5DTSA 3ULFA 1L0DA 5FDSA 4BQMA 4R4RA 2XQZA 1NZUA 2C5WB 5J7EA 1A0KA 4CJNA 4KUOA 2V1AA 3A3DA 3G34A 2E8JA 2M1CA 4Y15A 4Q0JA 3MXRA 2JKRI 3UMEA 2MJ6A 4B93A 4E04A 3ITBA 4Y5FA 2XRNA 2PU2A 3BY8A 3LI8A 1YMSA 4PM5A 4CLCA 5FI2A 1SDNA 4HI4A 1FSYA 3NOTC 2ZMAA 4WELA 3HLEA 4LV1A 1SHVA 5C5KA 3LI9A 2Y2NA 4E3LA 2W1RA 3ZVWA 3ZNYA 5FSRA 3ZDJA 3DTIA 3N8RA 4HESA 4O0PA 2A3UA 4MLLA 5HFOA 5FAQA 1Y54A 5EOEA 1BSGA 2XFTA 3HL9A 4EESA 1I2WA 2ZOIA 1KOUA 4OOMA 1CEGA 5GL9A 4CLCC 4ARZB 4E6XA 5J8XA 5KSCA 1TVFA 2K31A 4IUKA 2PD7A 3G30A 5CHJA 4DJ3A 1LLBA 4FCFA 2ZQAA 2Q0OA 4P0MA 4QJGA 4WLAA 5DKKA 3GRJA 4JXSA 3S4XA 1E3UD 4XT2A 5F82A 1MXOA 3FKWA 3WS2A 4JPMA 2PD8A 3NC8A 2Q9NA 3EEAA 4BMWA 1DJBA 4UA7A 1F98A 1CEFA 1CK3A 4Z1WA 1K4FA 2Z2LB 1XJ4A 4O01A 2BTFP 2IWBA 4OP8A 2B95A 4JGQA 2EA9A 4E3KA 2ZQDA 3MXSA 2WKQA 3GTCA 3TE8A 3UB6A 5MC7A 3VP1A 1NRFA 2G7UA 5E43A 1KGGA 3HLGA 2VGKA 2XSSA 2QHKA 3H7WB 3CWFA 3MR0A 4K08A 3BFFA 2AVXA 1N9LA 3HJKA 4FUWA 2W1TA 4OONA 2WGIA 3IHAA 1OT9A 3EOIA 4WN5A 5HAPA 1LSWA 1FSWA 3HLWA 4B4XA 3QP1A 1OTEA 1N9BA 4DJ2A 4UHUA 2Y2LA 3C30A 3FWLA 4LCLA 3C38A 3MQ0A 4ZBEA 1JWVA 4UA9A 4KZBA 5DJUA 2HDUA 3B33A 1GSXA 3G32A 2WAEA 4HQAA 4EU0A 3V3SA 3ICYA 1HVBA 1PWGA 5DF8A 1MPLA 4R0QA 2ZM8A 2JKRM 3UE0A 1H8YA 1P0ZA 2WYXA 3H7WA 3E2LA 4I5SA 3BLMA 3A3EA 2A24A 5DF7A 5EVIB 1U60A 4OPZA 4PM8A 1D7EA 2PT7A 2V8CA 3U2AA 2XD1A 2WK0A 2KDKA 5A92A 1O07A 3U4LP 2Y91A 3GV9A 3G4PA 2XR0A 2E8IA 3LICA 4EEUA 4R3BA 5I5LA 2GX5A 3OLOA 2HJEA 2Y59A 4LFUA 1TS6A 2G2WA 3M6HA 4GJ4A 4KUKA 4GW9A 3OPPA 2O0YA 2X01A 1BLSA 3CG5A 3Q82A 4R3JA 4FH4A 4ZAMA 3F1PA 2WKHA 4LV3A 4JXVA 2BASA 2Y2IA 2VZWA 4JLFA 4MN5A 5AQ7A 5FASA 3QP6A 4HBTA 5KZHA 1O7EA 5HL1A 3PAGA 3O88A 2XF3A 2P7JA 4JBFA 2EX9A 2W3DA 4XUXA 3FG8A 1PYYA 3CI6A 3KSFA 1W8QA 4Q8IA 3ZG7B 4P6ZS 3LR0A 3B3XA 1H0MA 3NDEA 4PAUA 4GHIB 5HWVA 3VE4A 3L9KA 3N8SA 5JYOA 1IKIA 1Z09A 2PAVP 1IELA 5GHXA 2ZMVA 3D9YA 4X1MA 1ODVA 1YKDA 4FD8A 1VHMA 3HLBA 3FZCA 4Y3IA 1W79A 1CJFA 3E4QA 1K38A 1ESIA 2ZD8A 5FQ9A 4OQGA 4DE0A 1JWPA 3Q1FA 4HBUA 3UPPA 1LHYA 1LSXA 4E3MA 2Y2GA 2PYRA 5DKLA 2JKTM 5DVAA 4GDBA 4CLCE 1ES2A 4X53A 2XDMA 5TBMA 2WADA 2X71A 4GHIA 3BFDA 1OMEA 1IYPA 3RJUA 1VETA 5AVFA 1N9OA 5G4YA 5FA7A 2V20A 1XGJA 3IWIA 1BZAA 3DWKA 3BFEA
chains in the Genus database with same CATH topology
5EM0A 4X25A 3T1SA 1PNEA 2ZL1A 1PFLA 1HLUP 1FILA 5FDSA 1VEUB 3T1RA 5EVEA 1A0KA 3NECA 3DAVA 2V8FA 2E8JA 3L9KA 2ZL1B 1PRQA 1FIKA 4FTXA 1Z09A 2PAVP 3D9YA 2JKGA 3MSHA 4X1MA 3T12B 1Y4OA 2V8CA 1CJFA 3L7HA 3T1XA 5FEFA 1SKOA 3UB5P 3U4LP 1CF0A 3LGOA 3T1QB 2BTFP 1CQAA 1F2KA 2B95A 1D1JA 1J3WA 1ACFA 3LEQA 1YPRA 1G5UA 2PRFA 4D60A 2ACGA 5EM1A 1AWIA 3MS6A 5EV0A 2HZ5A 1K0KA 4X1LA 4ESPA 4QWOA 3CPTA 4FUWA 1VETA 3NULA 2PBDP 3CHWP 1SKOB 1VEUA 5FEGA 2JKFA 2VK3A 3CPTB 1SZVA 3KYEA 1VETB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EM0 A;  4X25 A;  3T1S A;  1PNE A;  2ZL1 A;  1PFL A;  1HLU P;  1FIL A;  5FDS A;  1VEU B;  3T1R A;  5EVE A;  1A0K A;  3NEC A;  3DAV A;  2V8F A;  2E8J A;  3L9K A;  2ZL1 B;  1PRQ A;  1FIK A;  4FTX A;  1Z09 A;  2PAV P;  3D9Y A;  2JKG A;  3MSH A;  4X1M A;  3T12 B;  1Y4O A;  2V8C A;  1CJF A;  3L7H A;  3T1X A;  5FEF A;  1SKO A;  3UB5 P;  3U4L P;  1CF0 A;  3LGO A;  3T1Q B;  2BTF P;  1CQA A;  1F2K A;  2B95 A;  1D1J A;  1J3W A;  1ACF A;  3LEQ A;  1YPR A;  1G5U A;  2PRF A;  4D60 A;  2ACG A;  5EM1 A;  1AWI A;  3MS6 A;  5EV0 A;  2HZ5 A;  1K0K A;  4X1L A;  4ESP A;  4QWO A;  3CPT A;  4FUW A;  1VET A;  3NUL A;  2PBD P;  3CHW P;  1SKO B;  1VEU A;  5FEG A;  2JKF A;  2VK3 A;  3CPT B;  1SZV A;  3KYE A;  1VET B; 
#chains in the Genus database with same CATH topology
 3NY4 A;  4E6W A;  4ZDX A;  1I2S A;  3BYD A;  2ZQC A;  2HP6 A;  2PDR A;  4OQI A;  3OPH A;  1HLU P;  1EWZ A;  2O9B A;  3P7N A;  2GDN A;  3B47 A;  4HJ4 A;  4C75 A;  2VKS A;  2K7S A;  3IX4 A;  4GS9 A;  2QMI A;  4RYE A;  3OZH A;  3UB9 A;  2V9A A;  4XXR A;  1FOF A;  5HDC A;  3DTK A;  1FIK A;  2X02 A;  3ZFZ A;  3BQA A;  2I72 A;  1ERM A;  4EXO A;  3RFB A;  2NUP C;  2GZA A;  3S22 A;  1OPX A;  1L0F A;  4MMN A;  3UPO A;  3IXH A;  5L8M A;  4DF6 A;  3SZT A;  1KDW A;  4OLG A;  2L0W A;  1GHM A;  5BOH A;  5AJG A;  1CQA A;  5K5B A;  4KEN B;  2O9A A;  1GA9 A;  5CTM A;  3IS2 B;  3N4I A;  2YKH A;  4R23 A;  3MBZ A;  2ACG A;  2QZ6 A;  1Z6F A;  1SDE A;  1AWI A;  2Y2M A;  3RXX A;  4MCW A;  4I39 A;  4M3K A;  4DE2 A;  2JE5 A;  4X1L A;  4Y0T A;  3JYI A;  3PHY A;  4JF6 A;  5EFW A;  4OKP A;  5CHM A;  4II7 A;  5F68 A;  3NUL A;  3OPR A;  3QP2 A;  5GLC A;  1DP9 A;  3O3V A;  3A3F A;  3NDG A;  2WUQ A;  2DRW A;  4OP5 A;  2CC1 A;  3LY3 A;  3FPV A;  3GSG A;  1DP6 A;  5HSQ A;  5KIZ A;  2M7U A;  4Y2F A;  3F1O A;  5GLB A;  4EET B;  4O8G A;  1BUL A;  5HD5 A;  2P04 A;  3LR5 A;  3R7W B;  1DJC A;  1VEU B;  5EVL A;  2B02 A;  4KZA A;  3PYP A;  4A5R A;  3ZG8 B;  3F1N B;  1KGE A;  1MKM A;  4N92 A;  3DBA A;  2ZL1 B;  4RVA A;  1K25 A;  1PRQ A;  3IX3 A;  4JF5 A;  3O86 A;  5DFX A;  3UE3 A;  3M2J A;  4NXF A;  4PM6 A;  4UQI S;  4OPR A;  3LIA A;  3K3C A;  3O5Y A;  2PR6 A;  2WGV A;  3UB5 P;  4MBH A;  5J4E A;  4QY5 A;  3WS1 A;  1D1J A;  1YLY A;  3G2Y A;  4KZ7 A;  5FAP A;  3LYX A;  3Q7V A;  4R38 A;  3LCE A;  4MEZ A;  4IVI A;  3N8L A;  1YSP A;  3MFX A;  5AQ9 A;  1GHP A;  4JGP A;  5FQK A;  2J80 A;  3F1N A;  3ISG A;  3AGF A;  4ESP A;  4QWO A;  1M40 A;  4HP4 A;  4NXE A;  3ZCZ A;  3TOI A;  3PBT A;  3CIT A;  5G18 A;  1VM1 A;  1H3Q A;  2HV1 A;  2VV8 A;  4Q0I A;  2D01 A;  4Y13 A;  2VX8 A;  1NWZ A;  1S1Y A;  1QME A;  3CPT B;  3C8C A;  2EFU A;  4RX3 A;  5L2F A;  4HJ6 A;  4PKY G;  4IUH A;  3BRM A;  5E2E A;  4K0X A;  3WWX A;  4OLD A;  5GLD A;  2WZZ A;  2RCX A;  2J9P A;  3TG9 A;  1KDS A;  2H0T A;  3VFF A;  1WYB A;  2V0W A;  3G31 A;  4QHC A;  3SH7 A;  5G4Z A;  4GNU A;  5HAQ A;  5KSH A;  1TDG A;  4X55 A;  3HUM A;  1XJ6 A;  2J8Y A;  5M19 A;  4I3I A;  3MF0 A;  1ZG4 A;  4E3J A;  4YIN A;  3HJI A;  5M18 A;  4G3W A;  3N6I A;  3PBR A;  2R78 A;  1BLP A;  4NXB A;  4WZ4 A;  3A0V A;  4R3A A;  2XK1 A;  5CEB A;  3UNW A;  4PPR A;  3VV4 A;  3EEH A;  3IBJ A;  2EX6 A;  4DXC A;  4BL2 A;  1RGZ A;  4HOI A;  3TJZ C;  2H10 A;  3NJA A;  3ZHH A;  3C2W A;  4L0L A;  3LIE A;  3G6O A;  2WGW B;  1T18 A;  1V9Y A;  3GQZ A;  4D60 A;  5DTK A;  3MKE A;  1BLC A;  4Q0H A;  5IHV A;  3BM6 A;  2KOI A;  2Y8H A;  1YLZ A;  3VE3 A;  1H8M A;  5E2F A;  4ME4 A;  5CER A;  1ZTU A;  4UAA A;  2OAP 1;  4MBF A;  3RXW A;  4ARZ A;  5CTN A;  3SW1 A;  4U0X A;  2Y2O A;  3CAX A;  3DTM A;  5FEG A;  2P08 A;  2IWD A;  2FH5 A;  4UEY A;  1FR1 A;  5CGS A;  4S2N A;  3W8K A;  2JKT I;  3DWZ A;  5IS1 A;  4X68 A;  2VGL S;  5IT5 A;  2XA7 M;  4HH3 A;  1UWN X;  3IWO A;  4IJG A;  4EER A;  3CMZ A;  2HDR A;  4DN0 A;  2I9V A;  2WGW A;  4LEN A;  3BJN A;  3PBO A;  4R4S A;  1MWR A;  3UMD A;  3H82 B;  2QJ5 A;  1VQQ A;  2PHY A;  1T1A A;  4EQI A;  4FTX A;  1ES4 A;  4NEE D;  3E0Y A;  3IF6 B;  3G35 A;  3VP2 A;  2DCF A;  3PR6 A;  3MSH A;  5CXW A;  1CI8 A;  4K91 A;  1DRM A;  3HRE A;  3IHB A;  3MQQ A;  3OPL A;  5IU1 A;  4OOL A;  4GOG A;  4OQH A;  3MQO A;  3IXB A;  4S2N C;  2ZBB A;  3E4P A;  4B4Z A;  4PKY A;  2OV5 A;  5J3W A;  4M4X A;  4DDY A;  1G5U A;  3KX0 X;  4MDZ A;  2PR5 A;  5GHZ A;  3HUO A;  1OTI A;  1DJA A;  1K6R A;  2HP9 A;  1FCN A;  5EV0 A;  3CLO A;  4DKI A;  4L9F A;  2HDQ A;  2ZQ9 A;  4DE3 A;  3NI9 A;  4YFM A;  3IF6 A;  3C5A A;  5M1A A;  4JXW A;  3PTE A;  3HBR A;  4BBT A;  4RX2 A;  5E2H A;  1DP8 A;  1YLJ A;  2VK3 A;  3LR3 A;  1YLP A;  3TRC A;  3UO9 A;  2XH9 A;  1TDL A;  2BLS A;  5EVI A;  2R9X A;  3LFV A;  5HDS A;  3I7J A;  4EQ1 A;  2V8F A;  1ZHH B;  3VP4 A;  3IH9 A;  2Z6C A;  4P6Z M;  4Z9Q A;  5L07 A;  4P85 A;  3NHQ A;  2IA2 A;  2BG1 A;  2EX2 A;  4I3J A;  1YT4 A;  3JVU A;  5FQM A;  3W4O A;  1ERO A;  3Q07 A;  3IF6 C;  3OBF A;  3Q7Z A;  4F3L B;  2Y2J A;  4CQH A;  3UY6 A;  1FQG A;  1VB6 A;  3IXG A;  2XFS A;  2H28 A;  4MN6 A;  5L10 A;  3E98 A;  4EEP A;  1S66 L;  1KE3 A;  3IXD A;  1T1C A;  4IED A;  5DF9 A;  3VOL A;  1ZKJ A;  2HDS A;  4S2P A;  5HW3 A;  3D4F A;  1RP5 A;  1P97 A;  3LEZ A;  5EVI C;  3ZQ5 A;  1D06 A;  4BBU A;  1CI9 A;  1G28 A;  3VOY A;  1XFN A;  5FQJ A;  3P09 A;  5CEC A;  3EQU A;  3JVV A;  1PW1 A;  2VA0 A;  3QNC A;  3G2Z A;  3UN7 A;  4HH2 A;  3V5M A;  4BWI A;  5HAR A;  5FQI A;  1PWD A;  1S6R A;  4KG5 A;  3C4P A;  4LGW A;  4DDS A;  4K0W A;  4OPY A;  4L9E A;  2JHE A;  4AFI A;  3SH9 A;  4KZ4 A;  3RH8 B;  2UV0 E;  3BQ8 A;  3O87 A;  5FAO A;  4IBR A;  1LSV A;  5CED A;  2LB5 A;  3T1S A;  3FV7 A;  5EOO A;  2OAQ 1;  4IHQ A;  5GLA A;  1PW8 A;  5DJT A;  2V0U A;  2XD5 A;  2XGN A;  4X69 A;  4QY6 A;  1NYM A;  2XLN A;  3WS5 A;  4WBG A;  3OCL A;  2HP5 A;  4PM9 A;  4HNB A;  2IWC A;  3NEC A;  3V67 A;  1Y28 A;  1PI4 A;  2ZLY A;  4LRY C;  2VEA A;  2ZMF A;  3E4O A;  4ZJ1 A;  5HWT A;  3KYQ A;  4GB7 A;  4HY8 A;  1GSV A;  3ZG5 A;  1DY6 A;  1Q2P A;  3ITA A;  4WM9 A;  2Z2M B;  1G6O A;  4MNR A;  4ETZ A;  1IYO A;  5DFY A;  1BUE A;  1ZC2 A;  3NBL A;  3A3J A;  3UE6 A;  3T1X A;  3ZGA B;  1TS8 A;  1S4R A;  1TS7 A;  4WEK A;  2Y4A A;  5F6A A;  3T50 A;  1ERQ A;  2R9W A;  4ID4 A;  3KSH A;  1X0O A;  3GDI A;  1EW0 A;  2OWH A;  1E4D A;  3SOI A;  5D3O A;  3GVB A;  1G68 A;  3WRT A;  2ZC7 A;  1N4O A;  4WL9 A;  1LL5 A;  4OOY A;  4HJ3 A;  2W0N A;  1XA7 A;  4PHT A;  3CUE A;  5EE8 A;  4BL3 A;  2GNX A;  1G6A A;  2EFX A;  1YM1 A;  5CGX A;  5JYP A;  3BEC A;  2A49 A;  5HX9 A;  1SKO B;  3ZG9 B;  4GCZ A;  2W3G A;  1H8Z A;  3W2Z A;  2EWW A;  1XFQ A;  3UDI A;  5A93 A;  3EGD C;  4JXG A;  5TFQ A;  4BBV A;  3BEB A;  1YSQ A;  3FC7 A;  2EX8 A;  3QHY A;  1FIL A;  4Y0O A;  3T4S A;  4BLM A;  3QP5 A;  2WAF A;  3D72 A;  4KQQ A;  1JTD A;  1MWU A;  4NKP A;  1MBL A;  1ESU A;  3P98 A;  3PXP A;  3VOZ A;  3CUE C;  5A91 A;  3BFG A;  1HD8 A;  1WA9 A;  3GR2 A;  1BLH A;  3LO7 A;  4WEJ A;  1OT6 A;  4DXB A;  3E2K A;  3IS2 A;  1EI5 A;  3C7V A;  1XXM A;  3V50 A;  1IEM A;  1SKO A;  2QJ7 A;  2O9C A;  1K6S A;  2M7V A;  4UQI M;  4KZ6 A;  3QP8 A;  1HTZ A;  1BT5 A;  2O99 A;  4U3T A;  1YMX A;  5HD3 A;  4ZTK A;  1H5X A;  4OPQ A;  4C3Q A;  1YAX A;  4GD8 A;  4O7D A;  3R4K A;  4E3I A;  1T19 A;  4D2O A;  1IYS A;  1XX2 A;  1W63 Q;  3MS6 A;  3S7N A;  4G3V A;  4I3A A;  4CLC B;  2HZ5 A;  1M6K A;  3UB7 A;  3JPU A;  1KGF A;  3TSG A;  1S67 L;  3MJQ A;  2Q9M A;  2J3T C;  1TS0 A;  4KG6 A;  4S2I A;  4PM7 A;  3CHW P;  3H9W A;  2P74 A;  2ZC6 B;  1K57 A;  5L09 A;  1I5Q A;  3R7W A;  1VEU A;  1PWC A;  1MY8 A;  4Y17 A;  3UE1 A;  2JKF A;  4N9L A;  4KQO A;  3HLF A;  3M6B A;  2Y79 A;  2DNS A;  1UGU A;  4JKT A;  1S4S A;  3RTY A;  4B9O A;  4EUZ A;  2ZL1 A;  1PFL A;  1PIO A;  3HLC A;  3LID A;  4OH0 A;  5HAI A;  5EVE A;  4E3N A;  1BTL A;  2A2L A;  1AXB A;  4MBK A;  2Z6D A;  2ZC5 B;  3NIA A;  4IVK A;  2Y2P A;  3T4K A;  4LRX C;  2JKG A;  2RL3 A;  3EWK A;  1K57 C;  1TD5 A;  3VSK A;  3S7O A;  4IBX A;  3UB8 A;  3P01 A;  5A8B A;  1IFQ A;  4KQR A;  1KVL A;  3T4L A;  4XT2 B;  4EBP A;  2HGV A;  4FH2 A;  2WKP A;  3UDF A;  5HWW A;  1XPB A;  3IX8 A;  4BD1 A;  1SKF A;  4KZ8 A;  1GSW A;  1ONG A;  4OQ0 A;  1LL9 A;  2ZQ7 A;  3A3I A;  3NCK A;  1XKZ A;  4BD0 A;  3CPT A;  4B88 A;  3UPN A;  1P9W A;  3CJM A;  2WKI A;  1OJ5 A;  1XJ2 A;  1S0W A;  2PBD P;  5E2G A;  1L2S A;  1SCW A;  1ES5 A;  3MKF A;  4QB8 A;  3T4T A;  1XJ3 A;  3GEC A;  1ALQ A;  2NUT C;  4NET A;  4FSF A;  3KSI A;  2WKR A;  1FCM A;  3KYE A;  5AQA A;  2W1T B;  4HHD A;  4X25 A;  2KLI A;  4EBL A;  4ETX A;  1K4E A;  4E3O A;  4N1X A;  3NOU C;  4JF4 A;  4GZB A;  3IBR A;  1ZG6 A;  1XA1 A;  2VGL M;  4KZ3 A;  1YQS A;  5F83 A;  1FR6 A;  3VSL A;  5FI6 A;  4ZRR A;  2XRO A;  4R6L A;  5FQQ A;  1YLW A;  1MWS A;  2L1M A;  3BLS A;  4QPR A;  4LCM A;  2J7V A;  3QP4 A;  2H5S A;  3WRZ A;  2FZ0 A;  3SS4 A;  4HEF A;  5GHY A;  3KO6 A;  2EXA A;  4NXG A;  4Y7P A;  1NRJ A;  4KZ9 A;  1LT0 A;  3MMH A;  4P87 A;  4LPZ A;  2V2F F;  4L9G A;  1F9I A;  3PBS A;  2VGJ A;  3UDX A;  4XUZ A;  2YKF A;  2A24 B;  1JVJ A;  4S2K A;  1ACF A;  5CX7 A;  5EVI D;  2W3E A;  1L3L A;  5F5Y A;  1KE0 A;  3KSG A;  3MZF A;  3KYZ A;  1RCJ A;  2JCH A;  3ZYT A;  2QPN A;  4S2L A;  2XA7 S;  5HZH A;  3N7W A;  4KG2 A;  3HCY A;  5LBR A;  4EW7 A;  4GD6 A;  1QMF A;  3IWQ A;  3C4O A;  1NLZ A;  5HDD A;  4GDN A;  4S2J A;  5EEC A;  2WZX A;  3WS4 A;  3HUN A;  3LR4 A;  3K2N A;  5F1F A;  4N9K A;  1E3U A;  1N9N A;  3HVF A;  2QYB A;  2HF6 A;  2VV7 A;  1MKI A;  2WKE A;  2Y2H A;  3EQV A;  3SS5 A;  3IH8 A;  2HPB A;  1IYQ A;  3IF5 A;  3F1P B;  4RQ9 A;  3H82 A;  4HP9 A;  3AGE A;  2OSU A;  3NOP C;  2W3F A;  2FFY A;  2HJ9 C;  2B18 A;  3LUQ A;  2FFF B;  4CPK A;  1GA0 A;  1LL8 A;  1T1B A;  1W5D A;  1IKG A;  1PI5 A;  1KE4 A;  1WE4 A;  1LI9 A;  3BWL A;  1TEM A;  1W8Y A;  3L7H A;  4KQD A;  5FEF A;  5EPH A;  3LGO A;  4WF0 A;  4KZ5 A;  4LV2 A;  5TGF A;  4GN2 A;  4G3K A;  1ONH A;  1JTG A;  4R70 A;  2EXB A;  2PYP A;  1RGY A;  3LEQ A;  4YOF A;  3OCN A;  1MWT A;  3B42 A;  1K54 A;  2PRF A;  4S2O A;  4X6T A;  3IQA A;  3CZD A;  2GJ3 A;  5CRF A;  3PBQ A;  1NYY A;  3BFC A;  4WZ5 A;  2W3H A;  4QD4 A;  1K0K A;  2OOL A;  2C6W B;  2ZM2 A;  1OJG A;  3T4O A;  5HPF A;  3ZG0 A;  4BEN A;  3MZD A;  4UA6 A;  1PZP A;  2QWS A;  3S7Q A;  3MXQ A;  5TBM B;  3OC2 A;  5DTT A;  4EV4 A;  1VET B;  5I94 A;  2L4R A;  1E25 A;  5A90 A;  1STZ A;  4DRT A;  5KMW A;  3MFD A;  2J9O A;  4OVD A;  5FL3 A;  3S1Y A;  1K54 C;  5FAT A;  2PBY A;  3S7P A;  4H6J B;  3V39 A;  2OLV A;  5CGW A;  4BJP A;  1LI0 A;  4WZ5 C;  3SH8 A;  3QNB A;  4F3L A;  2G2U A;  1NY0 A;  2D02 A;  1HZO A;  3MZE A;  1MZU A;  2V1Z A;  4EWF A;  4EUV A;  3BY9 A;  1K55 A;  2OLU A;  2P9V B;  3T4J A;  4GS9 B;  3EGX C;  5HPI A;  2EWV A;  2W27 A;  5CHU A;  1W63 M;  4WYY A;  4WMC D;  2CMN A;  4C6Y A;  3D3O A;  3IT9 A;  2ZOH A;  4ZJ3 A;  1J9M A;  2VV6 A;  3T1Q B;  2J3W A;  1K56 D;  3V3R A;  1C3B A;  5AVE A;  5TJJ A;  1W7F A;  2Y55 A;  2Y2K A;  1NZO A;  4Y0U A;  2OWJ A;  1V9Z A;  2K2N A;  2VLG A;  2VJW A;  1L0E A;  1XGI A;  1F5M A;  4R1G A;  4H6J A;  3SS3 A;  2H0Y A;  1TF1 A;  4PMA A;  2ZC4 B;  2J3T D;  4I38 A;  3LIB A;  2ZM0 A;  4EBN A;  1K55 C;  4LRZ E;  4WUJ A;  3GMW A;  1NLY A;  2JBF A;  1GHI A;  2XEP A;  1IOU A;  3FYZ A;  2P9V A;  2UWX A;  3WS0 A;  5F1G A;  3DW0 A;  2INW A;  1SZV A;  4MN7 A;  5EM0 A;  1KVM A;  1PZO A;  4NG2 A;  4ZJ2 A;  3OOV A;  1PNE A;  3VP0 A;  3VP3 A;  1OTD A;  4JGR A;  4S2M A;  1NJ4 A;  3VFH A;  3K3D A;  1UWP X;  3T1R A;  1GCE A;  1Q2Q A;  4DMZ A;  3DAV A;  3F1O B;  4YNR A;  2V1B A;  1XP4 A;  3PBN A;  4WMC A;  4NK3 A;  4U0T A;  5FDH A;  4FOF A;  3T4Q A;  1OTA A;  1P9R A;  1WYC A;  5AQB A;  4GLQ A;  1K56 A;  3ZNT A;  3T12 B;  2Y2Q A;  1Y4O A;  5F69 A;  3Q81 A;  1JWZ A;  2PU4 A;  3DTE A;  4DE1 A;  3W4P A;  1CF0 A;  3PAE A;  3AGD A;  3FKV A;  1F2K A;  2ZC3 B;  3BW6 A;  1J3W A;  3HLD A;  3TW8 A;  5U47 A;  3ZVT A;  1YPR A;  3FPW A;  1JNU A;  4P6B A;  1FCO A;  5HL6 A;  5EM1 A;  4YWZ A;  3W4Q A;  4F94 A;  1BYW A;  4X56 A;  4CLC D;  5TR7 A;  4HIA A;  2JN7 A;  2DMW A;  3LIF A;  2QKP A;  3Q7V B;  5EUA A;  1NXY A;  4JGO A;  1S1Z A;  3VMA A;  2ZQ8 A;  1L0G A;  1MC0 A;  4H8R A;  2B5R A;  5FI7 A;  4RA7 A;  4LLO B;  1ES3 A;  3M2K A;  3A0R A;  2JC7 A;  2KX6 A;  4GKU A;  1YLT A;  3C7U A;  4LV0 A;  4QU3 A;  1OTB A;  3A0S A;  3LY4 A;  4N1H A;  2ZJ9 A;  2LB9 A;  5DTS A;  3ULF A;  1L0D A;  5FDS A;  4BQM A;  4R4R A;  2XQZ A;  1NZU A;  2C5W B;  5J7E A;  1A0K A;  4CJN A;  4KUO A;  2V1A A;  3A3D A;  3G34 A;  2E8J A;  2M1C A;  4Y15 A;  4Q0J A;  3MXR A;  2JKR I;  3UME A;  2MJ6 A;  4B93 A;  4E04 A;  3ITB A;  4Y5F A;  2XRN A;  2PU2 A;  3BY8 A;  3LI8 A;  1YMS A;  4PM5 A;  4CLC A;  5FI2 A;  1SDN A;  4HI4 A;  1FSY A;  3NOT C;  2ZMA A;  4WEL A;  3HLE A;  4LV1 A;  1SHV A;  5C5K A;  3LI9 A;  2Y2N A;  4E3L A;  2W1R A;  3ZVW A;  3ZNY A;  5FSR A;  3ZDJ A;  3DTI A;  3N8R A;  4HES A;  4O0P A;  2A3U A;  4MLL A;  5HFO A;  5FAQ A;  1Y54 A;  5EOE A;  1BSG A;  2XFT A;  3HL9 A;  4EES A;  1I2W A;  2ZOI A;  1KOU A;  4OOM A;  1CEG A;  5GL9 A;  4CLC C;  4ARZ B;  4E6X A;  5J8X A;  5KSC A;  1TVF A;  2K31 A;  4IUK A;  2PD7 A;  3G30 A;  5CHJ A;  4DJ3 A;  1LLB A;  4FCF A;  2ZQA A;  2Q0O A;  4P0M A;  4QJG A;  4WLA A;  5DKK A;  3GRJ A;  4JXS A;  3S4X A;  1E3U D;  4XT2 A;  5F82 A;  1MXO A;  3FKW A;  3WS2 A;  4JPM A;  2PD8 A;  3NC8 A;  2Q9N A;  3EEA A;  4BMW A;  1DJB A;  4UA7 A;  1F98 A;  1CEF A;  1CK3 A;  4Z1W A;  1K4F A;  2Z2L B;  1XJ4 A;  4O01 A;  2BTF P;  2IWB A;  4OP8 A;  2B95 A;  4JGQ A;  2EA9 A;  4E3K A;  2ZQD A;  3MXS A;  2WKQ A;  3GTC A;  3TE8 A;  3UB6 A;  5MC7 A;  3VP1 A;  1NRF A;  2G7U A;  5E43 A;  1KGG A;  3HLG A;  2VGK A;  2XSS A;  2QHK A;  3H7W B;  3CWF A;  3MR0 A;  4K08 A;  3BFF A;  2AVX A;  1N9L A;  3HJK A;  4FUW A;  2W1T A;  4OON A;  2WGI A;  3IHA A;  1OT9 A;  3EOI A;  4WN5 A;  5HAP A;  1LSW A;  1FSW A;  3HLW A;  4B4X A;  3QP1 A;  1OTE A;  1N9B A;  4DJ2 A;  4UHU A;  2Y2L A;  3C30 A;  3FWL A;  4LCL A;  3C38 A;  3MQ0 A;  4ZBE A;  1JWV A;  4UA9 A;  4KZB A;  5DJU A;  2HDU A;  3B33 A;  1GSX A;  3G32 A;  2WAE A;  4HQA A;  4EU0 A;  3V3S A;  3ICY A;  1HVB A;  1PWG A;  5DF8 A;  1MPL A;  4R0Q A;  2ZM8 A;  2JKR M;  3UE0 A;  1H8Y A;  1P0Z A;  2WYX A;  3H7W A;  3E2L A;  4I5S A;  3BLM A;  3A3E A;  2A24 A;  5DF7 A;  5EVI B;  1U60 A;  4OPZ A;  4PM8 A;  1D7E A;  2PT7 A;  2V8C A;  3U2A A;  2XD1 A;  2WK0 A;  2KDK A;  5A92 A;  1O07 A;  3U4L P;  2Y91 A;  3GV9 A;  3G4P A;  2XR0 A;  2E8I A;  3LIC A;  4EEU A;  4R3B A;  5I5L A;  2GX5 A;  3OLO A;  2HJE A;  2Y59 A;  4LFU A;  1TS6 A;  2G2W A;  3M6H A;  4GJ4 A;  4KUK A;  4GW9 A;  3OPP A;  2O0Y A;  2X01 A;  1BLS A;  3CG5 A;  3Q82 A;  4R3J A;  4FH4 A;  4ZAM A;  3F1P A;  2WKH A;  4LV3 A;  4JXV A;  2BAS A;  2Y2I A;  2VZW A;  4JLF A;  4MN5 A;  5AQ7 A;  5FAS A;  3QP6 A;  4HBT A;  5KZH A;  1O7E A;  5HL1 A;  3PAG A;  3O88 A;  2XF3 A;  2P7J A;  4JBF A;  2EX9 A;  2W3D A;  4XUX A;  3FG8 A;  1PYY A;  3CI6 A;  3KSF A;  1W8Q A;  4Q8I A;  3ZG7 B;  4P6Z S;  3LR0 A;  3B3X A;  1H0M A;  3NDE A;  4PAU A;  4GHI B;  5HWV A;  3VE4 A;  3L9K A;  3N8S A;  5JYO A;  1IKI A;  1Z09 A;  2PAV P;  1IEL A;  5GHX A;  2ZMV A;  3D9Y A;  4X1M A;  1ODV A;  1YKD A;  4FD8 A;  1VHM A;  3HLB A;  3FZC A;  4Y3I A;  1W79 A;  1CJF A;  3E4Q A;  1K38 A;  1ESI A;  2ZD8 A;  5FQ9 A;  4OQG A;  4DE0 A;  1JWP A;  3Q1F A;  4HBU A;  3UPP A;  1LHY A;  1LSX A;  4E3M A;  2Y2G A;  2PYR A;  5DKL A;  2JKT M;  5DVA A;  4GDB A;  4CLC E;  1ES2 A;  4X53 A;  2XDM A;  5TBM A;  2WAD A;  2X71 A;  4GHI A;  3BFD A;  1OME A;  1IYP A;  3RJU A;  1VET A;  5AVF A;  1N9O A;  5G4Y A;  5FA7 A;  2V20 A;  1XGJ A;  3IWI A;  1BZA A;  3DWK A;  3BFE A; 
#chains in the Genus database with same CATH homology
 5EM0 A;  4X25 A;  3T1S A;  1PNE A;  2ZL1 A;  1PFL A;  1HLU P;  1FIL A;  5FDS A;  1VEU B;  3T1R A;  5EVE A;  1A0K A;  3NEC A;  3DAV A;  2V8F A;  2E8J A;  3L9K A;  2ZL1 B;  1PRQ A;  1FIK A;  4FTX A;  1Z09 A;  2PAV P;  3D9Y A;  2JKG A;  3MSH A;  4X1M A;  3T12 B;  1Y4O A;  2V8C A;  1CJF A;  3L7H A;  3T1X A;  5FEF A;  1SKO A;  3UB5 P;  3U4L P;  1CF0 A;  3LGO A;  3T1Q B;  2BTF P;  1CQA A;  1F2K A;  2B95 A;  1D1J A;  1J3W A;  1ACF A;  3LEQ A;  1YPR A;  1G5U A;  2PRF A;  4D60 A;  2ACG A;  5EM1 A;  1AWI A;  3MS6 A;  5EV0 A;  2HZ5 A;  1K0K A;  4X1L A;  4ESP A;  4QWO A;  3CPT A;  4FUW A;  1VET A;  3NUL A;  2PBD P;  3CHW P;  1SKO B;  1VEU A;  5FEG A;  2JKF A;  2VK3 A;  3CPT B;  1SZV A;  3KYE A;  1VET B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...