4ZDXA

Structure of oxa-51 beta-lactamase
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
241
structure length
240
Chain Sequence
SDEKAEKIKNLFNEVHTTGVLVIQQGQTQQSYGNDLARASTEYVPASTFMLNALIGLEHHKATTTEVFKWDGQKRLFPEWEKDMTLGDAMKASAIPVYQDLARRIGLELMSKEVKRVGYGNADIGTQVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSPKVQDEVQSMLFIEEKNGNKIYAKSGWGWDVDPQVGWLTGWVVQPQGNIVAFSLNLEMKKGIPSSVRKEITYKSLEQLGIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Structural Basis for Enhancement of Carbapenemase Activity in the OXA-51 Family of Class D beta-Lactamases.
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Hydrolase
total genus 76
structure length 240
sequence length 241
ec nomenclature
pdb deposition date 2015-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4zdxA00
4H8RA 1TDLA 1IELA 1I2WA 2E8IA 3UE1A 4QY6A 3VP0A 1YLZA 1MWUA 3VOZA 5CHMA 4Y0UA 3C7VA 1Z6FA 1ONHA 3HLBA 3P98A 4N1XA 4UA6A 3G2ZA 2XLNA 3A3JA 4UA9A 4B88A 5F1GA 3O86A 4FSFA 4QJGA 5JYPA 3VP1A 1DY6A 3MXRA 4OLGA 5TGFA 4DRTA 1ES4A 4S2MA 4DDYA 1FQGA 3BFCA 1DJCA 4ZBEA 3S22A 2R9WA 3SS4A 3VP4A 4XUZA 1GCEA 4GDBA 3BLSA 4OKPA 5KSCA 5G18A 3GR2A 4QHCA 4X6TA 2JE5A 3C5AA 3O88A 2H5SA 1LL9A 3HLWA 5E2FA 2C6WB 3IXGA 1SDEA 2WUQA 3ZG8B 4BJPA 5GHZA 4BD1A 1MY8A 5EE8A 2EX9A 3WWXA 4CPKA 4MBFA 5DTTA 1FR1A 3IF6C 2ZC5B 4U0XA 1BLHA 4OOMA 4XUXA 1M6KA 5AQ7A 1XP4A 1WYCA 2Y2MA 3IWQA 1ES2A 4WEKA 3TSGA 1XA7A 3AGEA 4EV4A 4Q8IA 2X71A 2ZM0A 4OQ0A 4S2KA 4WBGA 2HDQA 1DJAA 1O07A 2FFYA 4KZ7A 4P87A 3E2LA 2XFTA 3N8RA 1E25A 4OP8A 1J9MA 3GQZA 1FSWA 4LV2A 2ZC4B 4S2NC 4PM5A 3DWZA 1KDSA 2HPBA 3IXHA 5EVIC 1K57A 4Z9QA 1N4OA 2Z2MB 1EROA 3CJMA 4JKTA 2A3UA 3G4PA 3NCKA 5M19A 1KDWA 3G2YA 3ZNYA 2DNSA 3C7UA 1XA1A 1BLCA 3MFDA 3IF5A 3NI9A 4MBHA 4BENA 2PU4A 3VFFA 3AGDA 3A3IA 1KGEA 3O87A 4FH4A 3G30A 3EQUA 2WKIA 5CRFA 4KG6A 3N4IA 3WS1A 4L0LA 3ZG0A 1CK3A 4OP5A 2OLVA 4PM7A 2ZC6B 4R3JA 2XQZA 4WMCD 1MXOA 3ZFZA 1FOFA 1NRFA 4X56A 1S0WA 3WRZA 3HLEA 4MEZA 2OSUA 5CGSA 4P85A 5FATA 4OQHA 2CC1A 4OPYA 2QMIA 1K55C 2Y2JA 3BYDA 1FCNA 3IHAA 2DRWA 2WKHA 4WEJA 5F83A 4BQMA 3C4OA 1LHYA 1YLWA 1ZC2A 5EVID 2IWBA 3VFHA 4LENA 3G34A 3BM6A 4WZ4A 4OQIA 1GHMA 1PZPA 3GVBA 5GLCA 5L2FA 1FCMA 3IQAA 2Y55A 2OV5A 1BTLA 1FR6A 1M40A 2Y2QA 1HZOA 4EBLA 3W8KA 2XEPA 4RYEA 2JC7A 3BRMA 4WELA 1AXBA 4Y0OA 5DTKA 1W79A 4N9KA 4BL2A 1QMEA 5FAOA 4E3KA 3V50A 4C3QA 1G68A 3GV9A 4K91A 3NC8A 1K54C 1PW8A 1NZOA 4GN2A 1E3UD 1ZG6A 3ZCZA 1BULA 1L0EA 5KSHA 1OMEA 1MWSA 4ZJ3A 4FD8A 2Y4AA 3G32A 2ZM8A 1LI0A 3OPLA 3EQVA 2R9XA 1Y54A 3HLGA 3A3FA 2WAFA 2XFSA 1NZUA 3PBRA 3FYZA 4S2OA 5CHUA 3OCLA 3LEZA 3WS2A 3SH7A 2G2UA 3DTMA 1SCWA 4WZ5A 3CMZA 1YLTA 1IYSA 2V1ZA 3M2KA 3ZGAB 2JBFA 4DE3A 1IYQA 4QB8A 2WAEA 4LV3A 5GLBA 3UDXA 4PMAA 3WS0A 3GMWA 3HVFA 2J9PA 3Q81A 2XF3A 4KQOA 1CI8A 1PZOA 2J9OA 4B4XA 2EFUA 1BT5A 2P9VA 1W8QA 5E2HA 3VSKA 4HEFA 3VSLA 1WYBA 5FQ9A 4EUZA 4LCLA 5DVAA 1KGFA 2C5WB 4R3BA 2EXAA 3C4PA 1H8YA 3M2JA 1C3BA 4FCFA 1XGJA 5FI7A 1L0DA 2HDSA 2JCHA 3IF6B 3LY4A 5EPHA 2X02A 5FDHA 5CXWA 3OZHA 1H5XA 2ZC3B 3VOYA 4N9LA 4MLLA 4DXCA 4E3NA 1BUEA 5E2EA 1LL5A 4N92A 3NIAA 3O3VA 4UA7A 1BSGA 3VP3A 4JXWA 2DCFA 1ALQA 4ZAMA 5CERA 4YINA 5BOHA 5EVIB 2J8YA 1XGIA 4KZAA 1BZAA 4OH0A 2RL3A 4PM8A 4RX3A 3IF6A 2Z2LB 1Q2QA 1K4EA 4WMCA 4HESA 3D4FA 5TFQA 2IWDA 5FASA 1L0GA 3FKVA 1I2SA 3ZVTA 1TDGA 4F94A 1W5DA 1MPLA 4DE0A 1TVFA 4RX2A 2XD5A 4KENB 4NETA 3WRTA 3JYIA 1JWPA 3ITAA 5I94A 1BLPA 1ESIA 4E3JA 1K57C 1YT4A 2WGWA 4LV0A 4S2NA 3HUNA 2WYXA 3QHYA 3SH8A 5A92A 5EVIA 1E4DA 3IT9A 3PAEA 1IEMA 1EI5A 1PYYA 3Q82A 4GNUA 4RVAA 4S2LA 3HLCA 1MKIA 3VP2A 2PBYA 2ZQ8A 3OC2A 5GL9A 4EQIA 3UE3A 3OPRA 1DJBA 2BG1A 2EX2A 3LCEA 5FQQA 2HP9A 5AQ9A 2WADA 1ONGA 3BFEA 3HUMA 4IEDA 3SOIA 1LI9A 1NYYA 5FSRA 2H0YA 1GHIA 3RJUA 3S1YA 1PI4A 4E6WA 3I7JA 1W8YA 4DF6A 4EWFA 3MKFA 3Q1FA 4ZJ2A 4LV1A 3QNCA 3GRJA 2PU2A 4K0WA 3PBOA 1GHPA 4U0TA 4GB7A 1E3UA 5DF9A 1BLSA 4M3KA 1PWGA 4KZBA 4DKIA 3ITBA 3W4OA 1XX2A 1K55A 5CGXA 2WZZA 1KE4A 3HLFA 4KZ6A 4QY5A 5EOOA 2A49A 3ZNTA 1FCOA 3WS5A 3FV7A 3ZG5A 4X68A 3MZEA 4JXVA 3Q7VA 4KZ3A 4RA7A 5E43A 4BLMA 2XGNA 1SDNA 4JPMA 1YM1A 3CG5A 4HBTA 2Y2KA 5FAPA 1VQQA 4B4ZA 1GA9A 1Q2PA 2UWXA 4PPRA 5FA7A 5HL1A 5CECA 1JVJA 1YMSA 2WGVA 5AQBA 3V3RA 2EFXA 2Y59A 4LCMA 1K56D 3PBTA 4S2IA 1YLPA 1MWTA 1VM1A 2ZQ7A 3FZCA 4X53A 4R1GA 2ZM2A 3TG9A 1MBLA 5FQMA 5HW3A 1IYOA 1K38A 1S6RA 4OONA 1H8ZA 2EXBA 2V2FF 4GKUA 2WGIA 3N6IA 3MXSA 4OLDA 3ZVWA 4S2PA 4E3MA 2QPNA 5CTMA 1K54A 3UPNA 2P9VB 4KZ4A 2VGKA 1PWDA 1L2SA 4PM9A 3OCNA 3W4PA 1JWVA 3GTCA 3IHBA 1K6RA 3PAGA 5KMWA 3MZDA 4X69A 2Q9MA 3IH8A 3BFGA 2Y2HA 1RP5A 3OPPA 3AGFA 1K25A 4C6YA 3B3XA 4ID4A 5A90A 1KVLA 2XH9A 2ZQ9A 1SKFA 4OPQA 5AQAA 4UAAA 5HARA 5IHVA 4EBPA 3QNBA 4IBXA 2XDMA 1RGYA 5HAIA 4BL3A 5FAQA 2X01A 3Q07A 4KZ5A 4GD8A 4GZBA 3SH9A 4KZ9A 2HP5A 4FH2A 4DDSA 2ZMAA 4E3OA 5F82A 3A3DA 3IH9A 3NDEA 3CZDA 3NDGA 4IVIA 3SS3A 5F1FA 4QD4A 1PW1A 3S4XA 2Y2GA 1NYMA 2HDRA 4JXSA 4R0QA 2ZQDA 5HAQA 2HDUA 1WE4A 5GLDA 3LO7A 4OOLA 2RCXA 5CEBA 3A3EA 4IVKA 4P6BA 5D3OA 5DTSA 2EX8A 3V39A 4JF4A 1YLYA 2WKEA 3G31A 5E2GA 4NK3A 4GOGA 4U3TA 2B5RA 1U60A 1W7FA 5HAPA 1I5QA 2WGWB 3UN7A 1ZG4A 4OOYA 4C75A 1CEFA 2H0TA 5CHJA 4WYYA 3W4QA 1HVBA 2FFFB 2IWCA 4Y7PA 4R4SA 2Y2PA 4UHUA 3TOIA 3FKWA 3BECA 4YFMA 1FSYA 3N8LA 3IXBA 3P09A 3PBQA 1K6SA 3UE0A 1JWZA 4GDNA 3RXXA 1XPBA 1ES5A 3UY6A 2H10A 4E3IA 4Y0TA 5EOEA 4OVDA 4BD0A 5GHXA 3E2KA 1EWZA 4R23A 4DE2A 4QU3A 1K4FA 5M1AA 1GA0A 2ZQCA 4PM6A 3V5MA 3G35A 4KG5A 5JYOA 3IXDA 1ESUA 4JBFA 4IBRA 4D2OA 2ZQAA 4E6XA 1SHVA 1ZKJA 1HTZA 3M6HA 5CEDA 5M18A 5GHYA 3NY4A 4DXBA 3OPHA 1YMXA 4KQQA 2Y91A 2XR0A 3VMAA 3M6BA 4X55A 2XK1A 2WK0A 4P0MA 3ZDJA 3FWLA 2Y2IA 1TEMA 1NY0A 3Q7VB 1KE0A 2Y2LA 1KVMA 3UPOA 1LLBA 2G2WA 4MNRA 1YQSA 5EECA 4OPRA 1YLJA 1ES3A 2ZJ9A 4OQGA 3IWOA 2I72A 5HFOA 3PBSA 1K56A 2VGJA 3PBNA 5A91A 1N9BA 2WZXA 4N1HA 4GD6A 5EUAA 2Y2OA 1O7EA 5EVLA 4WM9A 4ZTKA 3ISGA 5FQIA 3HL9A 3V3SA 5J8XA 3IWIA 4KQRA 5FI2A 5CGWA 5HX9A 4CJNA 1HD8A 5GLAA 3UDFA 2V20A 3BLMA 3N7WA 4K0XA 2Y2NA 1KGGA 1JTDA 3MBZA 2Q9NA 3UDIA 3LY3A 4XXRA 3Q7ZA 1PWCA 4O7DA 5DF8A 5TR7A 4ZDXA 5FQKA 3UNWA 4EBNA 1IYPA 3ZG9B 4OPZA 5DF7A 1ERMA 5FQJA 5U47A 2J7VA 2GDNA 2ZLYA 3HUOA 3N8SA 3SS5A 1MWRA 3HBRA 1XXMA 3MKEA 1CEGA 4E3LA 1IKIA 4ZJ1A 2ZD8A 5KZHA 1ERQA 2BLSA 3ZHHA 5FI6A 3HLDA 4HBUA 4JF6A 3ZG7B 4JLFA 4R4RA 3HREA 4MBKA 3PTEA 1RCJA 3UO9A 3BEBA 2QZ6A 1L0FA 1RGZA 3UPPA 1NXYA 3DWKA 4A5RA 3GSGA 2HP6A 3RXWA 1NJ4A 1G6AA 4JF5A 1IKGA 1JTGA 3WS4A 3MZFA 4WZ5C 1XKZA 4DE1A 2ZC7A 3BFDA 2XD1A 1CI9A 1KE3A 1PI5A 5A93A 4KG2A 4S2JA 2OLUA 1QMFA 5CTNA 3DW0A 3NBLA 4KZ8A 2P74A 3BFFA 1PIOA 4JXGA 2EX6A
chains in the Genus database with same CATH superfamily
1TDLA 1I2WA 1OT6A 3VP0A 1YLZA 3U4LP 4Y0UA 3C7VA 1ONHA 3HLBA 3A3JA 3O86A 4FSFA 2O0YA 3G6OA 1D06A 2JKRM 1OTDA 3T1SA 3SS4A 4GDBA 4NXBA 3NHQA 3BLSA 4QHCA 4X6TA 1DRMA 1SZVA 2H5SA 4AFIA 5GHZA 1MY8A 4CPKA 3KYEA 2MJ6A 4MBFA 1BLHA 5AQ7A 1WYCA 3K2NA 2ZM0A 4OQ0A 3E2LA 2XFTA 1FSWA 4PM5A 2Z6CA 3IXHA 1K57A 3ICYA 3OOVA 3CJMA 5HD5A 5IU1A 5M19A 1KDWA 3G2YA 3C7UA 4G3VA 2V8FA 3EWKA 4MBHA 2AVXA 1LT0A 1DP6A 1KGEA 1OJ5A 3O87A 3EQUA 5CRFA 3DAVA 4L0LA 4ZRRA 1CK3A 3ZG0A 2OLVA 2HJEA 2ZC6B 3ZFZA 1NRFA 3TRCA 3HLEA 2A24B 5CGSA 4P85A 4OQHA 2CC1A 1K55C 5F83A 1YLWA 3EOIA 2INWA 4WN5A 4WZ4A 3VE4A 5L8MA 2VGLM 4F3LA 2XEPA 4RYEA 4WELA 4E04A 5TBMB 4LLOB 5J3WA 3LR5A 3V50A 1G68A 4K91A 3NC8A 3ZCZA 1L0EA 4FD8A 2W3HA 3G32A 4WL9A 2ZM8A 3BY8A 3LEQA 1Y54A 3HLGA 3A3FA 3PBRA 1NZUA 2B95A 3OCLA 5TBMA 3WS2A 2G2UA 4LRYC 1YLTA 3M2KA 1DP8A 1VEUB 2HF6A 1MZUA 3GMWA 2J9PA 1T1CA 2XF3A 1MKMA 3DTKA 4I5SA 1OTIA 4LCLA 5DVAA 4Y2FA 4GS9B 3C4PA 1H8YA 3CUEA 1F9IA 4I3IA 4HIAA 3LY4A 2QHKA 5FDHA 2Y79A 4DXCA 1H5XA 1T1BA 4WLAA 2FZ0A 4EUVA 2DCFA 1ALQA 4ZAMA 5CERA 2D01A 5CX7A 4OH0A 1Q2QA 1K4EA 3D4FA 3FKVA 4M4XA 3ZVTA 1TDGA 4F94A 4DE0A 1YSPA 4KENB 4I38A 1JWPA 4S2NA 2O9BA 3QHYA 4XT2B 1E4DA 3IT9A 1EI5A 4GNUA 2PBYA 2ZQ8A 3E4PA 3OPRA 1ONGA 1LI9A 1VETB 5FSRA 3UE6A 3VV4A 1W8YA 3MKFA 4ZJ2A 5EFWA 2W3DA 1PWGA 3FPWA 4R38A 3ITBA 1VETA 4IUKA 3UB6A 3HLFA 1KE4A 3ZNTA 4MDZA 3WS5A 3FV7A 3ZG5A 5E43A 2XGNA 4JPMA 1CJFA 3CG5A 1VQQA 4LRXC 2HV1A 2W3EA 1GA9A 2BASA 2Q0OA 5AQBA 2OWJA 3FG8A 2EFXA 2Y59A 5AJGA 3PBTA 3CPTB 3HJIA 1VM1A 3MMHA 2OWHA 2JKGA 3LR4A 4MN6A 5HW3A 1N9LA 3LIDA 2EXBA 3MXSA 3QP8A 3JVUA 5CTMA 3UPNA 2JN7A 2P9VB 4YWZA 2QJ5A 2BTFP 5A8BA 1RP5A 5EM0A 3AGFA 3LR0A 3B3XA 3R7WB 2Y8HA 2ZQ9A 1SKFA 4OPQA 4UAAA 5HARA 4FTXA 4X1LA 5HAIA 2LB9A 4G3KA 3PR6A 2X01A 4GZBA 2HP5A 5F82A 3FC7A 3SS3A 3NDEA 3CZDA 4IVIA 5F1FA 4QD4A 3R7WA 2ZQDA 1TF1A 1WE4A 4X1MA 2RCXA 4RQ9A 2WKEA 5E2GA 4NK3A 2PBDP 4Y3IA 2WGWB 4PKYA 4ARZA 4DJ2A 4WYYA 2ZOIA 2PT7A 1HVBA 4I3JA 3TOIA 3T12B 1S66L 3FKWA 3N8LA 1JNUA 3T4JA 3UY6A 4E3IA 5EOEA 5GHXA 1EWZA 3EEAA 1YSQA 5JYOA 2W0NA 4KG5A 2D02A 1ZTUA 3CAXA 4E6XA 4B93A 2UV0E 2WKPA 3NY4A 3OPHA 4KQQA 2XR0A 1EW0A 2WK0A 3ZDJA 1KVMA 2JKFA 4LGWA 1UWNX 2G2WA 4MNRA 2JHEA 1YLJA 1ES3A 5HFOA 4I39A 5A91A 2WZXA 4GD6A 4WM9A 3ISGA 3HL9A 4QPRA 3IWIA 4KQRA 3BLMA 2Y2NA 3MBZA 1DP9A 3LY3A 3LUQA 1PWCA 4ZDXA 3B47A 4EU0A 3UNWA 1IYPA 4OPZA 2YKHA 2W3GA 2ZD8A 5KZHA 4DJ3A 3ZHHA 1FIKA 5FI6A 3HLDA 3ZG7B 4MBKA 3UO9A 3PTEA 4GW9A 4GCZA 3DWKA 3V67A 3RXWA 1IKGA 3WS4A 1CQAA 4NEED 4WZ5C 4DE1A 5A93A 3DBAA 4S2JA 3T4LA 3DW0A 2P74A 3BFFA 4JXGA 2EX6A 3UMEA 3H9WA 2ZMVA 2E8IA 2ZMFA 4N1XA 3C38A 3G2ZA 3DTIA 1OT9A 3FPVA 4L9EA 1P97A 4ZBEA 3NECA 1DJCA 2R9WA 4XUZA 1GCEA 4OKPA 5KSCA 1F5MA 3GR2A 2JE5A 3O88A 4BD1A 3A0SA 5EE8A 5DTTA 3IF6C 2ZC5B 4CLCE 4OOMA 4XUXA 1M6KA 4D60A 5HPFA 2VX8A 4BMWA 1ES2A 3TSGA 4EV4A 4JGOA 1O07A 2FFYA 4OP8A 2ZC4B 3DWZA 1KDSA 5EVIC 5F6AA 3T1QB 2A3UA 4UQIS 2QJ7A 4KUKA 3NI9A 3S7QA 3MFXA 2PU4A 1KOUA 2WKIA 3K3DA 4KG6A 3N4IA 3WS1A 4GHIB 5G4ZA 4R3JA 4WMCD 1MXOA 1FOFA 1S0WA 4Q0HA 2OSUA 5FATA 2LB5A 3JPUA 1TD5A 3P7NA 2Y2JA 3BYDA 1FCNA 3IHAA 2DRWA 4BQMA 1ZC2A 4GHIA 2VZWA 4LENA 1AWIA 4OQIA 1GHMA 1PZPA 1P0ZA 1FCMA 4NXFA 2V1AA 1FILA 1BTLA 1FR6A 3W8KA 2W1RA 2JC7A 3MQQA 1V9YA 4ETZA 5DTKA 1W79A 5FAOA 3CLOA 3GV9A 1PW8A 1NZOA 4ZJ3A 2YKFA 2R9XA 2V8CA 4EERA 5CHUA 4S2OA 3LEZA 3EGDC 4CQHA 5EV0A 3IBRA 1IYSA 3ZGAB 2PHYA 4DE3A 2E8JA 3CITA 2WAEA 3UDXA 1G5UA 3LIAA 3WS0A 4B4XA 2OOLA 4HEFA 1WYBA 5FQ9A 4EUZA 2OAQ1 3C8CA 5HWVA 5EM1A 5FI7A 2HDSA 3BW6A 5CXWA 3OZHA 2ZC3B 1LL5A 4MCWA 4N92A 2W27A 4JXWA 4EEPA 3BQ8A 2J8YA 1XGIA 4KZAA 4RX3A 4WMCA 5TFQA 1I2SA 1TS8A 1W5DA 1MPLA 1TVFA 5FDSA 5I94A 4E3JA 1K57C 1YT4A 2M7VA 2GJ3A 3HLCA 3F1NA 3VP2A 5GL9A 4EQIA 4O01A 3UE3A 2EX2A 3GDIA 4IEDA 3KYZA 2H0YA 3RJUA 4E6WA 3I7JA 4F3LB 3IX3A 4LV1A 3QNCA 4K0WA 1PFLA 3JVVA 3W4OA 4II7A 4HH3A 1K55A 5CGXA 4QY5A 5HDSA 3MZEA 4JXVA 3Q7VA 4KZ3A 2UWXA 4PPRA 5CECA 1JVJA 1STZA 4LCMA 1K56D 1MWTA 2ZQ7A 4QWOA 2ZM2A 3T4TA 1MBLA 5I5LA 1K38A 4OONA 3TE8A 4OLDA 3ZVWA 4S2PA 2QPNA 5TJJA 4PM9A 3OCNA 3IHBA 5KMWA 1NRJA 2B18A 5L09A 3IH8A 3BFGA 2Y2HA 1K25A 5A90A 2B02A 3QNBA 3EEHA 1RGYA 1VB6A 3LICA 5HWWA 4BL3A 5FAQA 1G28A 4KZ5A 4ME4A 4PHTA 4KZ9A 4Z1WA 3A3DA 3IH9A 4HOIA 1PW1A 4HP4A 2Y2GA 4EQ1A 2HDRA 3A3EA 5DTSA 3LGOA 4CLCD 2VGLS 3G31A 1S4SA 1U60A 2B5RA 2XRNA 3UN7A 1ZG4A 3T4QA 4OOYA 1CEFA 2H0TA 2VA0A 4Y7PA 4R4SA 4UHUA 3UE0A 4YFMA 2KDKA 1K6SA 5AVEA 1JWZA 4JGQA 1XPBA 4OVDA 4R23A 4DE2A 1K4FA 2KOIA 3T50A 1GA0A 2ZQCA 5KIZA 4IBRA 2ZQAA 1SHVA 2DMWA 5M18A 5GHYA 2EWWA 1YMXA 3MJQA 3VMAA 3M6BA 2XK1A 1F98A 3FWLA 1TEMA 2V9AA 2Y2LA 1LLBA 4ETXA 2ZJ9A 2I72A 3PBSA 5DKKA 3RTYA 1K56A 3A0VA 2KLIA 4N1HA 2ZL1A 1O7EA 4ZTKA 3IBJA 3H82A 3RFBA 3K3CA 4YOFA 3NOTC 2W1TA 2V20A 3BY9A 3N7WA 2M7UA 4FUWA 4IHQA 2PR5A 5FQKA 5DF7A 5FQJA 5U47A 3NULA 3HUOA 1YKDA 3SS5A 3HBRA 3MKEA 2CMNA 1XJ3A 1N9OA 1ERQA 4CLCB 2P04A 3MS6A 4JF6A 4JLFA 3HREA 1RCJA 4L9FA 4EESA 1NJ4A 3DTEA 3MZFA 2ZC7A 1N9NA 4CLCA 3MQOA 3MF0A 5FEFA 4KG2A 4O0PA 1TS6A 2OLUA 4BBTA 1QMFA 3UB8A 4H8RA 4ARZB 1IELA 3A0RA 1Z6FA 4QJGA 2XLNA 4B88A 3VP1A 3MXRA 4OLGA 5TGFA 3MQ0A 1ES4A 3CWFA 1NLYA 2PYPA 4IUHA 3IS2A 1UGUA 5G18A 4BBUA 1LL9A 3HLWA 5E2FA 1SDEA 4EEUA 3LI8A 2PR6A 1FR1A 4U0XA 1GSXA 1XP4A 3IWQA 4WEKA 3AGEA 2X71A 2HDQA 1DJAA 4KZ7A 3H7WA 1PNEA 1E25A 3LR3A 2J3TC 3UB7A 4Z9QA 1N4OA 2Z2MB 1T18A 4UEYA 4JKTA 2DNSA 3CI6A 1XA1A 4OP5A 4PM7A 2V0UA 2XQZA 4X56A 2XROA 2QMIA 2WKHA 3D9YA 1LHYA 5EVID 5DFXA 3G34A 3BM6A 3GVBA 5GLCA 3LYXA 2Y55A 3PXPA 2OV5A 3KO6A 2Y2QA 3LIBA 4Q0JA 2PD7A 1Z09A 3T1XA 4BL2A 2XA7M 2GNXA 3F1OA 3KYQA 4N9KA 4C3QA 1K54C 4GN2A 1E3UD 1ZG6A 4Y13A 5KSHA 1MWSA 3VOLA 2NUPC 4R6LA 3W2ZA 1K0KA 3OPLA 2WAFA 2XFSA 1W63Q 3FYZA 3IX4A 3SH7A 2NUTC 1SCWA 4WZ5A 2V1ZA 4Y15A 5L07A 4WUJA 4QB8A 4GJ4A 5GLBA 5HWTA 3Q81A 4NXGA 1CI8A 2J9OA 2EFUA 1Y28A 4P6ZS 1MC0A 3VSLA 1H8MA 5HPIA 2C5WB 2EXAA 3M2JA 4BWIA 1XGJA 1L0DA 2JCHA 3IF6B 4HY8A 2PAVP 2IA2A 4EW7A 3VOYA 3MSHA 4KUOA 4N9LA 4MLLA 3BJNA 2L4RA 3LIEA 4WF0A 3P01A 5EVIB 1HLUP 1BZAA 2QKPA 4PM8A 2QYBA 3IF6A 5J7EA 5FASA 4RX2A 3JYIA 3ITAA 1BLPA 1ESIA 4LV0A 5LBRA 3HUNA 2WYXA 3TJZC 3SH8A 5A92A 5EVIA 1IEMA 4RVAA 4S2LA 4IJGA 5HD3A 4DN0A 1MKIA 3MR0A 3LCEA 3ZQ5A 5FQQA 4BBVA 3BFEA 3HUMA 3UMDA 5HZHA 1NYYA 4YNRA 1GHIA 3KSGA 2W3FA 1PI4A 4DMZA 3S7PA 2L1MA 2PU2A 1GHPA 2JKTI 1E3UA 1A0KA 4M3KA 1W63M 2PDRA 2WZZA 4KZ6A 5EOOA 5FEGA 5IS1A 4X68A 4RA7A 1SDNA 4HBTA 5FAPA 3T4KA 5FA7A 1H0MA 1YAXA 1YPRA 3V3RA 3NJAA 4S2IA 1YLPA 3FZCA 2QWSA 3UB9A 5FQMA 1S6RA 1L3LA 1BYWA 2PD8A 4GKUA 3N6IA 2VLGA 3T4OA 4KZ4A 1PWDA 1L2SA 4HI4A 3W4PA 1JWVA 3PAGA 4HJ6A 4X69A 2Q9MA 2FH5A 4C6YA 1KVLA 3QP2A 4MN5A 3C2WA 4HNBA 2KX6A 4GD8A 5HSQA 2ZMAA 1H3QA 5J4EA 3NDGA 1OTAA 1NYMA 2OAP1 4JXSA 4R0QA 5HAQA 5AVFA 3LO7A 5D3OA 4IVKA 4P6BA 1YLYA 2O9CA 2O9AA 4GOGA 4U3TA 1P9RA 1I5QA 4C75A 5MC7A 1SKOB 5CHJA 1J3WA 3W4QA 2FFFB 2IWCA 3F1NB 4GLQA 3BECA 1FSYA 1G6OA 3IXBA 3PBQA 3RXXA 4MMNA 2H10A 4Y0TA 4Y5FA 4BD0A 1ODVA 3G35A 3V5MA 5K5BA 2HZ5A 3QP1A 1ESUA 4D2OA 1SKOA 3ULFA 1ZKJA 1HTZA 3M6HA 5CEDA 1CF0A 2K7SA 3GECA 1XFQA 5G4YA 2R78A 2GZAA 2VKSA 4X55A 1UWPX 1XJ6A 5IT5A 2Y2IA 3PYPA 3Q7VB 1KE0A 5EECA 4OPRA 4OQGA 3IWOA 2VGJA 5EUAA 2Y2OA 3S7NA 5J8XA 2EA9A 5FI2A 5CGWA 5HX9A 4CJNA 4X25A 2V1BA 4K0XA 2O99A 3UDIA 4O7DA 5DF8A 2JKTM 4Q0IA 3ZG9B 4HP9A 2J7VA 2GDNA 2ZLYA 3N8SA 1MWRA 2A24A 1TS7A 1XXMA 3HJKA 1CEGA 4E3LA 4ZJ1A 2BLSA 4HBUA 3LFVA 1RGZA 3IX8A 4NG2A 1NXYA 2VV8A 5DFYA 2G7UA 1P9WA 1G6AA 4JF5A 3E4OA 3S7OA 1XKZA 3BFDA 4PAUA 1CI9A 1KE3A 2XD1A 1OTEA 2A2LA 1T19A 4KZ8A 5F69A 1TS0A 1X0OA 3UE1A 4QY6A 4Y17A 1MWUA 3E98A 5CHMA 3VOZA 3P98A 4UA6A 1PRQA 4UA9A 3CUEC 5F1GA 5JYPA 1VHMA 1DY6A 1OJGA 3KSIA 4DRTA 4S2MA 4DDYA 1FQGA 3BFCA 3VP4A 3S22A 3SZTA 2K31A 3C5AA 5F68A 2C6WB 3QP6A 3IXGA 1VEUA 2WUQA 3ZG8B 4BJPA 4O8GA 2EX9A 3WWXA 1D1JA 2Y2MA 4Q8IA 1XA7A 4GS9A 4S2KA 4WBGA 3EGXC 4HJ4A 1S1YA 4P87A 4LPZA 3N8RA 3C30A 1J9MA 3GQZA 4S2NC 4LV2A 2ZL1B 2HPBA 2PRFA 3H82B 1EROA 4H6JB 3G4PA 3NCKA 2W1TB 3ZNYA 1BLCA 3MFDA 3IF5A 4BENA 3VFFA 3AGDA 3A3IA 4FH4A 3G30A 1S4RA 4R70A 4H6JA 3WRZA 4EXOA 3OBFA 4MEZA 2ZBBA 4OPYA 4XT2A 2VK3A 3UB5P 4WEJA 2J3TD 2WKRA 3C4OA 2H28A 4R3AA 1IFQA 2IWBA 3VFHA 1GSVA 5L2FA 3IQAA 4HJ3A 1M40A 1HZOA 4EBLA 3BRMA 4Y0OA 1AXBA 1QMEA 4E3KA 3BQAA 3B42A 1BULA 3NOPC 1OMEA 2Y4AA 1LI0A 3EQVA 4HH2A 2I9VA 3RH8B 4B9OA 2V0WA 4HQAA 4CLCC 3CPTA 3DTMA 1LL8A 3IS2B 3CMZA 2JBFA 4LRZE 1IYQA 4LV3A 4PMAA 3PHYA 3HVFA 4KQOA 1PZOA 1BT5A 2P9VA 1W8QA 5E2HA 5HDCA 3VSKA 3OLOA 5DJUA 1KGFA 4R3BA 1C3BA 4I3AA 4FCFA 3H7WB 5EPHA 2X02A 2XSSA 1Y4OA 4E3NA 1BUEA 5E2EA 5L10A 3NIAA 3O3VA 5C5KA 4UA7A 1S67L 1BSGA 3VP3A 4YINA 5BOHA 4KQDA 2RL3A 3QP5A 2Z2LB 1XFNA 2EWVA 4HESA 2IWDA 3ZYTA 1L0GA 1XJ4A 1F2KA 2XD5A 4NETA 3WRTA 5EVEA 1S1ZA 2WGWA 1ACFA 3PAEA 1PYYA 3Q82A 2WKQA 3OC2A 1DJBA 2BG1A 2HP9A 5AQ9A 2WADA 3F1PB 3SOIA 3S1YA 2VEAA 4DF6A 3KX0X 4EWFA 3Q1FA 3O5YA 3GRJA 3PBOA 4U0TA 4GB7A 2VV7A 3F1OB 3VE3A 1XJ2A 5DF9A 1BLSA 3U2AA 4KZBA 4DKIA 3F1PA 1XX2A 2HJ9C 1IOUA 1OTBA 2A49A 3E0YA 3SW1A 1FCOA 4P6ZM 4BLMA 2J3WA 1NLZA 1YM1A 2Y2KA 2VJWA 4B4ZA 1Q2PA 5HL1A 1YMSA 1D7EA 2P08A 2WGVA 3QP4A 5F5YA 4L9GA 4X53A 4R1GA 3T1RA 3TG9A 1IYOA 1H8ZA 2V2FF 2WGIA 2Z6DA 4E3MA 1NWZA 3KSFA 1K54A 1WA9A 3B33A 2VGKA 1OPXA 3GTCA 1K6RA 3L9KA 3MZDA 3OPPA 4UQIM 4ID4A 2XH9A 5AQAA 5IHVA 4EBPA 3MXQA 4IBXA 3KSHA 3LI9A 1GSWA 2XDMA 4K08A 2JKRI 3NOUC 3Q07A 3SH9A 2HGVA 3L7HA 2PYRA 4FH2A 4DDSA 4E3OA 4NXEA 2L0WA 3S4XA 2HDUA 5GLDA 4OOLA 5CEBA 3CHWP 2EX8A 3V39A 4JF4A 4JGRA 1W7FA 4FOFA 5HAPA 2J80A 2GX5A 2XA7S 5HDDA 2ACGA 2Y2PA 3P09A 3D72A 4GDNA 1ES5A 3HCYA 3E2KA 2K2NA 4QU3A 2M1CA 5M1AA 4PM6A 3BWLA 3E4QA 3IXDA 1T1AA 4HHDA 4JBFA 2ZOHA 3TW8A 4DXBA 2Y91A 5DKLA 5FL3A 4PKYG 4P0MA 1NY0A 3UPOA 1YQSA 4NKPA 1ZHHB 3PBNA 1N9BA 5EVLA 5FQIA 3V3SA 2P7JA 1LSXA 1HD8A 5GLAA 3UDFA 1KGGA 1LSVA 1JTDA 2Q9NA 4XXRA 3Q7ZA 5TR7A 1LSWA 4EBNA 1ERMA 4ESPA 1IKIA 3D3OA 2VV6A 4JGPA 4R4RA 3T4SA 4G3WA 4LFUA 3BEBA 2QZ6A 1L0FA 3UPPA 4A5RA 3GSGA 2HP6A 3LIFA 1JTGA 1V9ZA 5HL6A 1PI5A 3R4KA 4MN7A 5CTNA 3NBLA 5DJTA 1PIOA 4EETB
chains in the Genus database with same CATH topology
4H8RA 1TDLA 1IELA 1I2WA 2E8IA 3UE1A 4QY6A 3VP0A 1YLZA 1MWUA 3VOZA 5CHMA 4Y0UA 3C7VA 1Z6FA 1ONHA 3HLBA 3P98A 4N1XA 4UA6A 3G2ZA 2XLNA 3A3JA 4UA9A 4B88A 5F1GA 3O86A 4FSFA 4QJGA 5JYPA 3VP1A 1DY6A 3MXRA 4OLGA 5TGFA 4DRTA 1ES4A 4S2MA 4DDYA 1FQGA 3BFCA 1DJCA 4ZBEA 3S22A 2R9WA 3SS4A 3VP4A 4XUZA 1GCEA 4GDBA 3BLSA 4OKPA 5KSCA 5G18A 3GR2A 4QHCA 4X6TA 2JE5A 3C5AA 3O88A 2H5SA 1LL9A 3HLWA 5E2FA 2C6WB 3IXGA 1SDEA 2WUQA 3ZG8B 4BJPA 5GHZA 4BD1A 1MY8A 5EE8A 2EX9A 3WWXA 4CPKA 4MBFA 5DTTA 1FR1A 3IF6C 2ZC5B 4U0XA 1BLHA 4OOMA 4XUXA 1M6KA 5AQ7A 1XP4A 1WYCA 2Y2MA 3IWQA 1ES2A 4WEKA 3TSGA 1XA7A 3AGEA 4EV4A 4Q8IA 2X71A 2ZM0A 4OQ0A 4S2KA 4WBGA 2HDQA 1DJAA 1O07A 2FFYA 4KZ7A 4P87A 3E2LA 2XFTA 3N8RA 1E25A 4OP8A 1J9MA 3GQZA 1FSWA 4LV2A 2ZC4B 4S2NC 4PM5A 3DWZA 1KDSA 2HPBA 3IXHA 5EVIC 1K57A 4Z9QA 1N4OA 2Z2MB 1EROA 3CJMA 4JKTA 2A3UA 3G4PA 3NCKA 5M19A 1KDWA 3G2YA 3ZNYA 2DNSA 3C7UA 1XA1A 1BLCA 3MFDA 3IF5A 3NI9A 4MBHA 4BENA 2PU4A 3VFFA 3AGDA 3A3IA 1KGEA 3O87A 4FH4A 3G30A 3EQUA 2WKIA 5CRFA 4KG6A 3N4IA 3WS1A 4L0LA 3ZG0A 1CK3A 4OP5A 2OLVA 4PM7A 2ZC6B 4R3JA 2XQZA 4WMCD 1MXOA 3ZFZA 1FOFA 1NRFA 4X56A 1S0WA 3WRZA 3HLEA 4MEZA 2OSUA 5CGSA 4P85A 5FATA 4OQHA 2CC1A 4OPYA 2QMIA 1K55C 2Y2JA 3BYDA 1FCNA 3IHAA 2DRWA 2WKHA 4WEJA 5F83A 4BQMA 3C4OA 1LHYA 1YLWA 1ZC2A 5EVID 2IWBA 3VFHA 4LENA 3G34A 3BM6A 4WZ4A 4OQIA 1GHMA 1PZPA 3GVBA 5GLCA 5L2FA 1FCMA 3IQAA 2Y55A 2OV5A 1BTLA 1FR6A 1M40A 2Y2QA 1HZOA 4EBLA 3W8KA 2XEPA 4RYEA 2JC7A 3BRMA 4WELA 1AXBA 4Y0OA 5DTKA 1W79A 4N9KA 4BL2A 1QMEA 5FAOA 4E3KA 3V50A 4C3QA 1G68A 3GV9A 4K91A 3NC8A 1K54C 1PW8A 1NZOA 4GN2A 1E3UD 1ZG6A 3ZCZA 1BULA 1L0EA 5KSHA 1OMEA 1MWSA 4ZJ3A 4FD8A 2Y4AA 3G32A 2ZM8A 1LI0A 3OPLA 3EQVA 2R9XA 1Y54A 3HLGA 3A3FA 2WAFA 2XFSA 1NZUA 3PBRA 3FYZA 4S2OA 5CHUA 3OCLA 3LEZA 3WS2A 3SH7A 2G2UA 3DTMA 1SCWA 4WZ5A 3CMZA 1YLTA 1IYSA 2V1ZA 3M2KA 3ZGAB 2JBFA 4DE3A 1IYQA 4QB8A 2WAEA 4LV3A 5GLBA 3UDXA 4PMAA 3WS0A 3GMWA 3HVFA 2J9PA 3Q81A 2XF3A 4KQOA 1CI8A 1PZOA 2J9OA 4B4XA 2EFUA 1BT5A 2P9VA 1W8QA 5E2HA 3VSKA 4HEFA 3VSLA 1WYBA 5FQ9A 4EUZA 4LCLA 5DVAA 1KGFA 2C5WB 4R3BA 2EXAA 3C4PA 1H8YA 3M2JA 1C3BA 4FCFA 1XGJA 5FI7A 1L0DA 2HDSA 2JCHA 3IF6B 3LY4A 5EPHA 2X02A 5FDHA 5CXWA 3OZHA 1H5XA 2ZC3B 3VOYA 4N9LA 4MLLA 4DXCA 4E3NA 1BUEA 5E2EA 1LL5A 4N92A 3NIAA 3O3VA 4UA7A 1BSGA 3VP3A 4JXWA 2DCFA 1ALQA 4ZAMA 5CERA 4YINA 5BOHA 5EVIB 2J8YA 1XGIA 4KZAA 1BZAA 4OH0A 2RL3A 4PM8A 4RX3A 3IF6A 2Z2LB 1Q2QA 1K4EA 4WMCA 4HESA 3D4FA 5TFQA 2IWDA 5FASA 1L0GA 3FKVA 1I2SA 3ZVTA 1TDGA 4F94A 1W5DA 1MPLA 4DE0A 1TVFA 4RX2A 2XD5A 4KENB 4NETA 3WRTA 3JYIA 1JWPA 3ITAA 5I94A 1BLPA 1ESIA 4E3JA 1K57C 1YT4A 2WGWA 4LV0A 4S2NA 3HUNA 2WYXA 3QHYA 3SH8A 5A92A 5EVIA 1E4DA 3IT9A 3PAEA 1IEMA 1EI5A 1PYYA 3Q82A 4GNUA 4RVAA 4S2LA 3HLCA 1MKIA 3VP2A 2PBYA 2ZQ8A 3OC2A 5GL9A 4EQIA 3UE3A 3OPRA 1DJBA 2BG1A 2EX2A 3LCEA 5FQQA 2HP9A 5AQ9A 2WADA 1ONGA 3BFEA 3HUMA 4IEDA 3SOIA 1LI9A 1NYYA 5FSRA 2H0YA 1GHIA 3RJUA 3S1YA 1PI4A 4E6WA 3I7JA 1W8YA 4DF6A 4EWFA 3MKFA 3Q1FA 4ZJ2A 4LV1A 3QNCA 3GRJA 2PU2A 4K0WA 3PBOA 1GHPA 4U0TA 4GB7A 1E3UA 5DF9A 1BLSA 4M3KA 1PWGA 4KZBA 4DKIA 3ITBA 3W4OA 1XX2A 1K55A 5CGXA 2WZZA 1KE4A 3HLFA 4KZ6A 4QY5A 5EOOA 2A49A 3ZNTA 1FCOA 3WS5A 3FV7A 3ZG5A 4X68A 3MZEA 4JXVA 3Q7VA 4KZ3A 4RA7A 5E43A 4BLMA 2XGNA 1SDNA 4JPMA 1YM1A 3CG5A 4HBTA 2Y2KA 5FAPA 1VQQA 4B4ZA 1GA9A 1Q2PA 2UWXA 4PPRA 5FA7A 5HL1A 5CECA 1JVJA 1YMSA 2WGVA 5AQBA 3V3RA 2EFXA 2Y59A 4LCMA 1K56D 3PBTA 4S2IA 1YLPA 1MWTA 1VM1A 2ZQ7A 3FZCA 4X53A 4R1GA 2ZM2A 3TG9A 1MBLA 5FQMA 5HW3A 1IYOA 1K38A 1S6RA 4OONA 1H8ZA 2EXBA 2V2FF 4GKUA 2WGIA 3N6IA 3MXSA 4OLDA 3ZVWA 4S2PA 4E3MA 2QPNA 5CTMA 1K54A 3UPNA 2P9VB 4KZ4A 2VGKA 1PWDA 1L2SA 4PM9A 3OCNA 3W4PA 1JWVA 3GTCA 3IHBA 1K6RA 3PAGA 5KMWA 3MZDA 4X69A 2Q9MA 3IH8A 3BFGA 2Y2HA 1RP5A 3OPPA 3AGFA 1K25A 4C6YA 3B3XA 4ID4A 5A90A 1KVLA 2XH9A 2ZQ9A 1SKFA 4OPQA 5AQAA 4UAAA 5HARA 5IHVA 4EBPA 3QNBA 4IBXA 2XDMA 1RGYA 5HAIA 4BL3A 5FAQA 2X01A 3Q07A 4KZ5A 4GD8A 4GZBA 3SH9A 4KZ9A 2HP5A 4FH2A 4DDSA 2ZMAA 4E3OA 5F82A 3A3DA 3IH9A 3NDEA 3CZDA 3NDGA 4IVIA 3SS3A 5F1FA 4QD4A 1PW1A 3S4XA 2Y2GA 1NYMA 2HDRA 4JXSA 4R0QA 2ZQDA 5HAQA 2HDUA 1WE4A 5GLDA 3LO7A 4OOLA 2RCXA 5CEBA 3A3EA 4IVKA 4P6BA 5D3OA 5DTSA 2EX8A 3V39A 4JF4A 1YLYA 2WKEA 3G31A 5E2GA 4NK3A 4GOGA 4U3TA 2B5RA 1U60A 1W7FA 5HAPA 1I5QA 2WGWB 3UN7A 1ZG4A 4OOYA 4C75A 1CEFA 2H0TA 5CHJA 4WYYA 3W4QA 1HVBA 2FFFB 2IWCA 4Y7PA 4R4SA 2Y2PA 4UHUA 3TOIA 3FKWA 3BECA 4YFMA 1FSYA 3N8LA 3IXBA 3P09A 3PBQA 1K6SA 3UE0A 1JWZA 4GDNA 3RXXA 1XPBA 1ES5A 3UY6A 2H10A 4E3IA 4Y0TA 5EOEA 4OVDA 4BD0A 5GHXA 3E2KA 1EWZA 4R23A 4DE2A 4QU3A 1K4FA 5M1AA 1GA0A 2ZQCA 4PM6A 3V5MA 3G35A 4KG5A 5JYOA 3IXDA 1ESUA 4JBFA 4IBRA 4D2OA 2ZQAA 4E6XA 1SHVA 1ZKJA 1HTZA 3M6HA 5CEDA 5M18A 5GHYA 3NY4A 4DXBA 3OPHA 1YMXA 4KQQA 2Y91A 2XR0A 3VMAA 3M6BA 4X55A 2XK1A 2WK0A 4P0MA 3ZDJA 3FWLA 2Y2IA 1TEMA 1NY0A 3Q7VB 1KE0A 2Y2LA 1KVMA 3UPOA 1LLBA 2G2WA 4MNRA 1YQSA 5EECA 4OPRA 1YLJA 1ES3A 2ZJ9A 4OQGA 3IWOA 2I72A 5HFOA 3PBSA 1K56A 2VGJA 3PBNA 5A91A 1N9BA 2WZXA 4N1HA 4GD6A 5EUAA 2Y2OA 1O7EA 5EVLA 4WM9A 4ZTKA 3ISGA 5FQIA 3HL9A 3V3SA 5J8XA 3IWIA 4KQRA 5FI2A 5CGWA 5HX9A 4CJNA 1HD8A 5GLAA 3UDFA 2V20A 3BLMA 3N7WA 4K0XA 2Y2NA 1KGGA 1JTDA 3MBZA 2Q9NA 3UDIA 3LY3A 4XXRA 3Q7ZA 1PWCA 4O7DA 5DF8A 5TR7A 4ZDXA 5FQKA 3UNWA 4EBNA 1IYPA 3ZG9B 4OPZA 5DF7A 1ERMA 5FQJA 5U47A 2J7VA 2GDNA 2ZLYA 3HUOA 3N8SA 3SS5A 1MWRA 3HBRA 1XXMA 3MKEA 1CEGA 4E3LA 1IKIA 4ZJ1A 2ZD8A 5KZHA 1ERQA 2BLSA 3ZHHA 5FI6A 3HLDA 4HBUA 4JF6A 3ZG7B 4JLFA 4R4RA 3HREA 4MBKA 3PTEA 1RCJA 3UO9A 3BEBA 2QZ6A 1L0FA 1RGZA 3UPPA 1NXYA 3DWKA 4A5RA 3GSGA 2HP6A 3RXWA 1NJ4A 1G6AA 4JF5A 1IKGA 1JTGA 3WS4A 3MZFA 4WZ5C 1XKZA 4DE1A 2ZC7A 3BFDA 2XD1A 1CI9A 1KE3A 1PI5A 5A93A 4KG2A 4S2JA 2OLUA 1QMFA 5CTNA 3DW0A 3NBLA 4KZ8A 2P74A 3BFFA 1PIOA 4JXGA 2EX6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H8R A;  1TDL A;  1IEL A;  1I2W A;  2E8I A;  3UE1 A;  4QY6 A;  3VP0 A;  1YLZ A;  1MWU A;  3VOZ A;  5CHM A;  4Y0U A;  3C7V A;  1Z6F A;  1ONH A;  3HLB A;  3P98 A;  4N1X A;  4UA6 A;  3G2Z A;  2XLN A;  3A3J A;  4UA9 A;  4B88 A;  5F1G A;  3O86 A;  4FSF A;  4QJG A;  5JYP A;  3VP1 A;  1DY6 A;  3MXR A;  4OLG A;  5TGF A;  4DRT A;  1ES4 A;  4S2M A;  4DDY A;  1FQG A;  3BFC A;  1DJC A;  4ZBE A;  3S22 A;  2R9W A;  3SS4 A;  3VP4 A;  4XUZ A;  1GCE A;  4GDB A;  3BLS A;  4OKP A;  5KSC A;  5G18 A;  3GR2 A;  4QHC A;  4X6T A;  2JE5 A;  3C5A A;  3O88 A;  2H5S A;  1LL9 A;  3HLW A;  5E2F A;  2C6W B;  3IXG A;  1SDE A;  2WUQ A;  3ZG8 B;  4BJP A;  5GHZ A;  4BD1 A;  1MY8 A;  5EE8 A;  2EX9 A;  3WWX A;  4CPK A;  4MBF A;  5DTT A;  1FR1 A;  3IF6 C;  2ZC5 B;  4U0X A;  1BLH A;  4OOM A;  4XUX A;  1M6K A;  5AQ7 A;  1XP4 A;  1WYC A;  2Y2M A;  3IWQ A;  1ES2 A;  4WEK A;  3TSG A;  1XA7 A;  3AGE A;  4EV4 A;  4Q8I A;  2X71 A;  2ZM0 A;  4OQ0 A;  4S2K A;  4WBG A;  2HDQ A;  1DJA A;  1O07 A;  2FFY A;  4KZ7 A;  4P87 A;  3E2L A;  2XFT A;  3N8R A;  1E25 A;  4OP8 A;  1J9M A;  3GQZ A;  1FSW A;  4LV2 A;  2ZC4 B;  4S2N C;  4PM5 A;  3DWZ A;  1KDS A;  2HPB A;  3IXH A;  5EVI C;  1K57 A;  4Z9Q A;  1N4O A;  2Z2M B;  1ERO A;  3CJM A;  4JKT A;  2A3U A;  3G4P A;  3NCK A;  5M19 A;  1KDW A;  3G2Y A;  3ZNY A;  2DNS A;  3C7U A;  1XA1 A;  1BLC A;  3MFD A;  3IF5 A;  3NI9 A;  4MBH A;  4BEN A;  2PU4 A;  3VFF A;  3AGD A;  3A3I A;  1KGE A;  3O87 A;  4FH4 A;  3G30 A;  3EQU A;  2WKI A;  5CRF A;  4KG6 A;  3N4I A;  3WS1 A;  4L0L A;  3ZG0 A;  1CK3 A;  4OP5 A;  2OLV A;  4PM7 A;  2ZC6 B;  4R3J A;  2XQZ A;  4WMC D;  1MXO A;  3ZFZ A;  1FOF A;  1NRF A;  4X56 A;  1S0W A;  3WRZ A;  3HLE A;  4MEZ A;  2OSU A;  5CGS A;  4P85 A;  5FAT A;  4OQH A;  2CC1 A;  4OPY A;  2QMI A;  1K55 C;  2Y2J A;  3BYD A;  1FCN A;  3IHA A;  2DRW A;  2WKH A;  4WEJ A;  5F83 A;  4BQM A;  3C4O A;  1LHY A;  1YLW A;  1ZC2 A;  5EVI D;  2IWB A;  3VFH A;  4LEN A;  3G34 A;  3BM6 A;  4WZ4 A;  4OQI A;  1GHM A;  1PZP A;  3GVB A;  5GLC A;  5L2F A;  1FCM A;  3IQA A;  2Y55 A;  2OV5 A;  1BTL A;  1FR6 A;  1M40 A;  2Y2Q A;  1HZO A;  4EBL A;  3W8K A;  2XEP A;  4RYE A;  2JC7 A;  3BRM A;  4WEL A;  1AXB A;  4Y0O A;  5DTK A;  1W79 A;  4N9K A;  4BL2 A;  1QME A;  5FAO A;  4E3K A;  3V50 A;  4C3Q A;  1G68 A;  3GV9 A;  4K91 A;  3NC8 A;  1K54 C;  1PW8 A;  1NZO A;  4GN2 A;  1E3U D;  1ZG6 A;  3ZCZ A;  1BUL A;  1L0E A;  5KSH A;  1OME A;  1MWS A;  4ZJ3 A;  4FD8 A;  2Y4A A;  3G32 A;  2ZM8 A;  1LI0 A;  3OPL A;  3EQV A;  2R9X A;  1Y54 A;  3HLG A;  3A3F A;  2WAF A;  2XFS A;  1NZU A;  3PBR A;  3FYZ A;  4S2O A;  5CHU A;  3OCL A;  3LEZ A;  3WS2 A;  3SH7 A;  2G2U A;  3DTM A;  1SCW A;  4WZ5 A;  3CMZ A;  1YLT A;  1IYS A;  2V1Z A;  3M2K A;  3ZGA B;  2JBF A;  4DE3 A;  1IYQ A;  4QB8 A;  2WAE A;  4LV3 A;  5GLB A;  3UDX A;  4PMA A;  3WS0 A;  3GMW A;  3HVF A;  2J9P A;  3Q81 A;  2XF3 A;  4KQO A;  1CI8 A;  1PZO A;  2J9O A;  4B4X A;  2EFU A;  1BT5 A;  2P9V A;  1W8Q A;  5E2H A;  3VSK A;  4HEF A;  3VSL A;  1WYB A;  5FQ9 A;  4EUZ A;  4LCL A;  5DVA A;  1KGF A;  2C5W B;  4R3B A;  2EXA A;  3C4P A;  1H8Y A;  3M2J A;  1C3B A;  4FCF A;  1XGJ A;  5FI7 A;  1L0D A;  2HDS A;  2JCH A;  3IF6 B;  3LY4 A;  5EPH A;  2X02 A;  5FDH A;  5CXW A;  3OZH A;  1H5X A;  2ZC3 B;  3VOY A;  4N9L A;  4MLL A;  4DXC A;  4E3N A;  1BUE A;  5E2E A;  1LL5 A;  4N92 A;  3NIA A;  3O3V A;  4UA7 A;  1BSG A;  3VP3 A;  4JXW A;  2DCF A;  1ALQ A;  4ZAM A;  5CER A;  4YIN A;  5BOH A;  5EVI B;  2J8Y A;  1XGI A;  4KZA A;  1BZA A;  4OH0 A;  2RL3 A;  4PM8 A;  4RX3 A;  3IF6 A;  2Z2L B;  1Q2Q A;  1K4E A;  4WMC A;  4HES A;  3D4F A;  5TFQ A;  2IWD A;  5FAS A;  1L0G A;  3FKV A;  1I2S A;  3ZVT A;  1TDG A;  4F94 A;  1W5D A;  1MPL A;  4DE0 A;  1TVF A;  4RX2 A;  2XD5 A;  4KEN B;  4NET A;  3WRT A;  3JYI A;  1JWP A;  3ITA A;  5I94 A;  1BLP A;  1ESI A;  4E3J A;  1K57 C;  1YT4 A;  2WGW A;  4LV0 A;  4S2N A;  3HUN A;  2WYX A;  3QHY A;  3SH8 A;  5A92 A;  5EVI A;  1E4D A;  3IT9 A;  3PAE A;  1IEM A;  1EI5 A;  1PYY A;  3Q82 A;  4GNU A;  4RVA A;  4S2L A;  3HLC A;  1MKI A;  3VP2 A;  2PBY A;  2ZQ8 A;  3OC2 A;  5GL9 A;  4EQI A;  3UE3 A;  3OPR A;  1DJB A;  2BG1 A;  2EX2 A;  3LCE A;  5FQQ A;  2HP9 A;  5AQ9 A;  2WAD A;  1ONG A;  3BFE A;  3HUM A;  4IED A;  3SOI A;  1LI9 A;  1NYY A;  5FSR A;  2H0Y A;  1GHI A;  3RJU A;  3S1Y A;  1PI4 A;  4E6W A;  3I7J A;  1W8Y A;  4DF6 A;  4EWF A;  3MKF A;  3Q1F A;  4ZJ2 A;  4LV1 A;  3QNC A;  3GRJ A;  2PU2 A;  4K0W A;  3PBO A;  1GHP A;  4U0T A;  4GB7 A;  1E3U A;  5DF9 A;  1BLS A;  4M3K A;  1PWG A;  4KZB A;  4DKI A;  3ITB A;  3W4O A;  1XX2 A;  1K55 A;  5CGX A;  2WZZ A;  1KE4 A;  3HLF A;  4KZ6 A;  4QY5 A;  5EOO A;  2A49 A;  3ZNT A;  1FCO A;  3WS5 A;  3FV7 A;  3ZG5 A;  4X68 A;  3MZE A;  4JXV A;  3Q7V A;  4KZ3 A;  4RA7 A;  5E43 A;  4BLM A;  2XGN A;  1SDN A;  4JPM A;  1YM1 A;  3CG5 A;  4HBT A;  2Y2K A;  5FAP A;  1VQQ A;  4B4Z A;  1GA9 A;  1Q2P A;  2UWX A;  4PPR A;  5FA7 A;  5HL1 A;  5CEC A;  1JVJ A;  1YMS A;  2WGV A;  5AQB A;  3V3R A;  2EFX A;  2Y59 A;  4LCM A;  1K56 D;  3PBT A;  4S2I A;  1YLP A;  1MWT A;  1VM1 A;  2ZQ7 A;  3FZC A;  4X53 A;  4R1G A;  2ZM2 A;  3TG9 A;  1MBL A;  5FQM A;  5HW3 A;  1IYO A;  1K38 A;  1S6R A;  4OON A;  1H8Z A;  2EXB A;  2V2F F;  4GKU A;  2WGI A;  3N6I A;  3MXS A;  4OLD A;  3ZVW A;  4S2P A;  4E3M A;  2QPN A;  5CTM A;  1K54 A;  3UPN A;  2P9V B;  4KZ4 A;  2VGK A;  1PWD A;  1L2S A;  4PM9 A;  3OCN A;  3W4P A;  1JWV A;  3GTC A;  3IHB A;  1K6R A;  3PAG A;  5KMW A;  3MZD A;  4X69 A;  2Q9M A;  3IH8 A;  3BFG A;  2Y2H A;  1RP5 A;  3OPP A;  3AGF A;  1K25 A;  4C6Y A;  3B3X A;  4ID4 A;  5A90 A;  1KVL A;  2XH9 A;  2ZQ9 A;  1SKF A;  4OPQ A;  5AQA A;  4UAA A;  5HAR A;  5IHV A;  4EBP A;  3QNB A;  4IBX A;  2XDM A;  1RGY A;  5HAI A;  4BL3 A;  5FAQ A;  2X01 A;  3Q07 A;  4KZ5 A;  4GD8 A;  4GZB A;  3SH9 A;  4KZ9 A;  2HP5 A;  4FH2 A;  4DDS A;  2ZMA A;  4E3O A;  5F82 A;  3A3D A;  3IH9 A;  3NDE A;  3CZD A;  3NDG A;  4IVI A;  3SS3 A;  5F1F A;  4QD4 A;  1PW1 A;  3S4X A;  2Y2G A;  1NYM A;  2HDR A;  4JXS A;  4R0Q A;  2ZQD A;  5HAQ A;  2HDU A;  1WE4 A;  5GLD A;  3LO7 A;  4OOL A;  2RCX A;  5CEB A;  3A3E A;  4IVK A;  4P6B A;  5D3O A;  5DTS A;  2EX8 A;  3V39 A;  4JF4 A;  1YLY A;  2WKE A;  3G31 A;  5E2G A;  4NK3 A;  4GOG A;  4U3T A;  2B5R A;  1U60 A;  1W7F A;  5HAP A;  1I5Q A;  2WGW B;  3UN7 A;  1ZG4 A;  4OOY A;  4C75 A;  1CEF A;  2H0T A;  5CHJ A;  4WYY A;  3W4Q A;  1HVB A;  2FFF B;  2IWC A;  4Y7P A;  4R4S A;  2Y2P A;  4UHU A;  3TOI A;  3FKW A;  3BEC A;  4YFM A;  1FSY A;  3N8L A;  3IXB A;  3P09 A;  3PBQ A;  1K6S A;  3UE0 A;  1JWZ A;  4GDN A;  3RXX A;  1XPB A;  1ES5 A;  3UY6 A;  2H10 A;  4E3I A;  4Y0T A;  5EOE A;  4OVD A;  4BD0 A;  5GHX A;  3E2K A;  1EWZ A;  4R23 A;  4DE2 A;  4QU3 A;  1K4F A;  5M1A A;  1GA0 A;  2ZQC A;  4PM6 A;  3V5M A;  3G35 A;  4KG5 A;  5JYO A;  3IXD A;  1ESU A;  4JBF A;  4IBR A;  4D2O A;  2ZQA A;  4E6X A;  1SHV A;  1ZKJ A;  1HTZ A;  3M6H A;  5CED A;  5M18 A;  5GHY A;  3NY4 A;  4DXB A;  3OPH A;  1YMX A;  4KQQ A;  2Y91 A;  2XR0 A;  3VMA A;  3M6B A;  4X55 A;  2XK1 A;  2WK0 A;  4P0M A;  3ZDJ A;  3FWL A;  2Y2I A;  1TEM A;  1NY0 A;  3Q7V B;  1KE0 A;  2Y2L A;  1KVM A;  3UPO A;  1LLB A;  2G2W A;  4MNR A;  1YQS A;  5EEC A;  4OPR A;  1YLJ A;  1ES3 A;  2ZJ9 A;  4OQG A;  3IWO A;  2I72 A;  5HFO A;  3PBS A;  1K56 A;  2VGJ A;  3PBN A;  5A91 A;  1N9B A;  2WZX A;  4N1H A;  4GD6 A;  5EUA A;  2Y2O A;  1O7E A;  5EVL A;  4WM9 A;  4ZTK A;  3ISG A;  5FQI A;  3HL9 A;  3V3S A;  5J8X A;  3IWI A;  4KQR A;  5FI2 A;  5CGW A;  5HX9 A;  4CJN A;  1HD8 A;  5GLA A;  3UDF A;  2V20 A;  3BLM A;  3N7W A;  4K0X A;  2Y2N A;  1KGG A;  1JTD A;  3MBZ A;  2Q9N A;  3UDI A;  3LY3 A;  4XXR A;  3Q7Z A;  1PWC A;  4O7D A;  5DF8 A;  5TR7 A;  4ZDX A;  5FQK A;  3UNW A;  4EBN A;  1IYP A;  3ZG9 B;  4OPZ A;  5DF7 A;  1ERM A;  5FQJ A;  5U47 A;  2J7V A;  2GDN A;  2ZLY A;  3HUO A;  3N8S A;  3SS5 A;  1MWR A;  3HBR A;  1XXM A;  3MKE A;  1CEG A;  4E3L A;  1IKI A;  4ZJ1 A;  2ZD8 A;  5KZH A;  1ERQ A;  2BLS A;  3ZHH A;  5FI6 A;  3HLD A;  4HBU A;  4JF6 A;  3ZG7 B;  4JLF A;  4R4R A;  3HRE A;  4MBK A;  3PTE A;  1RCJ A;  3UO9 A;  3BEB A;  2QZ6 A;  1L0F A;  1RGZ A;  3UPP A;  1NXY A;  3DWK A;  4A5R A;  3GSG A;  2HP6 A;  3RXW A;  1NJ4 A;  1G6A A;  4JF5 A;  1IKG A;  1JTG A;  3WS4 A;  3MZF A;  4WZ5 C;  1XKZ A;  4DE1 A;  2ZC7 A;  3BFD A;  2XD1 A;  1CI9 A;  1KE3 A;  1PI5 A;  5A93 A;  4KG2 A;  4S2J A;  2OLU A;  1QMF A;  5CTN A;  3DW0 A;  3NBL A;  4KZ8 A;  2P74 A;  3BFF A;  1PIO A;  4JXG A;  2EX6 A; 
#chains in the Genus database with same CATH topology
 1TDL A;  1I2W A;  1OT6 A;  3VP0 A;  1YLZ A;  3U4L P;  4Y0U A;  3C7V A;  1ONH A;  3HLB A;  3A3J A;  3O86 A;  4FSF A;  2O0Y A;  3G6O A;  1D06 A;  2JKR M;  1OTD A;  3T1S A;  3SS4 A;  4GDB A;  4NXB A;  3NHQ A;  3BLS A;  4QHC A;  4X6T A;  1DRM A;  1SZV A;  2H5S A;  4AFI A;  5GHZ A;  1MY8 A;  4CPK A;  3KYE A;  2MJ6 A;  4MBF A;  1BLH A;  5AQ7 A;  1WYC A;  3K2N A;  2ZM0 A;  4OQ0 A;  3E2L A;  2XFT A;  1FSW A;  4PM5 A;  2Z6C A;  3IXH A;  1K57 A;  3ICY A;  3OOV A;  3CJM A;  5HD5 A;  5IU1 A;  5M19 A;  1KDW A;  3G2Y A;  3C7U A;  4G3V A;  2V8F A;  3EWK A;  4MBH A;  2AVX A;  1LT0 A;  1DP6 A;  1KGE A;  1OJ5 A;  3O87 A;  3EQU A;  5CRF A;  3DAV A;  4L0L A;  4ZRR A;  1CK3 A;  3ZG0 A;  2OLV A;  2HJE A;  2ZC6 B;  3ZFZ A;  1NRF A;  3TRC A;  3HLE A;  2A24 B;  5CGS A;  4P85 A;  4OQH A;  2CC1 A;  1K55 C;  5F83 A;  1YLW A;  3EOI A;  2INW A;  4WN5 A;  4WZ4 A;  3VE4 A;  5L8M A;  2VGL M;  4F3L A;  2XEP A;  4RYE A;  4WEL A;  4E04 A;  5TBM B;  4LLO B;  5J3W A;  3LR5 A;  3V50 A;  1G68 A;  4K91 A;  3NC8 A;  3ZCZ A;  1L0E A;  4FD8 A;  2W3H A;  3G32 A;  4WL9 A;  2ZM8 A;  3BY8 A;  3LEQ A;  1Y54 A;  3HLG A;  3A3F A;  3PBR A;  1NZU A;  2B95 A;  3OCL A;  5TBM A;  3WS2 A;  2G2U A;  4LRY C;  1YLT A;  3M2K A;  1DP8 A;  1VEU B;  2HF6 A;  1MZU A;  3GMW A;  2J9P A;  1T1C A;  2XF3 A;  1MKM A;  3DTK A;  4I5S A;  1OTI A;  4LCL A;  5DVA A;  4Y2F A;  4GS9 B;  3C4P A;  1H8Y A;  3CUE A;  1F9I A;  4I3I A;  4HIA A;  3LY4 A;  2QHK A;  5FDH A;  2Y79 A;  4DXC A;  1H5X A;  1T1B A;  4WLA A;  2FZ0 A;  4EUV A;  2DCF A;  1ALQ A;  4ZAM A;  5CER A;  2D01 A;  5CX7 A;  4OH0 A;  1Q2Q A;  1K4E A;  3D4F A;  3FKV A;  4M4X A;  3ZVT A;  1TDG A;  4F94 A;  4DE0 A;  1YSP A;  4KEN B;  4I38 A;  1JWP A;  4S2N A;  2O9B A;  3QHY A;  4XT2 B;  1E4D A;  3IT9 A;  1EI5 A;  4GNU A;  2PBY A;  2ZQ8 A;  3E4P A;  3OPR A;  1ONG A;  1LI9 A;  1VET B;  5FSR A;  3UE6 A;  3VV4 A;  1W8Y A;  3MKF A;  4ZJ2 A;  5EFW A;  2W3D A;  1PWG A;  3FPW A;  4R38 A;  3ITB A;  1VET A;  4IUK A;  3UB6 A;  3HLF A;  1KE4 A;  3ZNT A;  4MDZ A;  3WS5 A;  3FV7 A;  3ZG5 A;  5E43 A;  2XGN A;  4JPM A;  1CJF A;  3CG5 A;  1VQQ A;  4LRX C;  2HV1 A;  2W3E A;  1GA9 A;  2BAS A;  2Q0O A;  5AQB A;  2OWJ A;  3FG8 A;  2EFX A;  2Y59 A;  5AJG A;  3PBT A;  3CPT B;  3HJI A;  1VM1 A;  3MMH A;  2OWH A;  2JKG A;  3LR4 A;  4MN6 A;  5HW3 A;  1N9L A;  3LID A;  2EXB A;  3MXS A;  3QP8 A;  3JVU A;  5CTM A;  3UPN A;  2JN7 A;  2P9V B;  4YWZ A;  2QJ5 A;  2BTF P;  5A8B A;  1RP5 A;  5EM0 A;  3AGF A;  3LR0 A;  3B3X A;  3R7W B;  2Y8H A;  2ZQ9 A;  1SKF A;  4OPQ A;  4UAA A;  5HAR A;  4FTX A;  4X1L A;  5HAI A;  2LB9 A;  4G3K A;  3PR6 A;  2X01 A;  4GZB A;  2HP5 A;  5F82 A;  3FC7 A;  3SS3 A;  3NDE A;  3CZD A;  4IVI A;  5F1F A;  4QD4 A;  3R7W A;  2ZQD A;  1TF1 A;  1WE4 A;  4X1M A;  2RCX A;  4RQ9 A;  2WKE A;  5E2G A;  4NK3 A;  2PBD P;  4Y3I A;  2WGW B;  4PKY A;  4ARZ A;  4DJ2 A;  4WYY A;  2ZOI A;  2PT7 A;  1HVB A;  4I3J A;  3TOI A;  3T12 B;  1S66 L;  3FKW A;  3N8L A;  1JNU A;  3T4J A;  3UY6 A;  4E3I A;  5EOE A;  5GHX A;  1EWZ A;  3EEA A;  1YSQ A;  5JYO A;  2W0N A;  4KG5 A;  2D02 A;  1ZTU A;  3CAX A;  4E6X A;  4B93 A;  2UV0 E;  2WKP A;  3NY4 A;  3OPH A;  4KQQ A;  2XR0 A;  1EW0 A;  2WK0 A;  3ZDJ A;  1KVM A;  2JKF A;  4LGW A;  1UWN X;  2G2W A;  4MNR A;  2JHE A;  1YLJ A;  1ES3 A;  5HFO A;  4I39 A;  5A91 A;  2WZX A;  4GD6 A;  4WM9 A;  3ISG A;  3HL9 A;  4QPR A;  3IWI A;  4KQR A;  3BLM A;  2Y2N A;  3MBZ A;  1DP9 A;  3LY3 A;  3LUQ A;  1PWC A;  4ZDX A;  3B47 A;  4EU0 A;  3UNW A;  1IYP A;  4OPZ A;  2YKH A;  2W3G A;  2ZD8 A;  5KZH A;  4DJ3 A;  3ZHH A;  1FIK A;  5FI6 A;  3HLD A;  3ZG7 B;  4MBK A;  3UO9 A;  3PTE A;  4GW9 A;  4GCZ A;  3DWK A;  3V67 A;  3RXW A;  1IKG A;  3WS4 A;  1CQA A;  4NEE D;  4WZ5 C;  4DE1 A;  5A93 A;  3DBA A;  4S2J A;  3T4L A;  3DW0 A;  2P74 A;  3BFF A;  4JXG A;  2EX6 A;  3UME A;  3H9W A;  2ZMV A;  2E8I A;  2ZMF A;  4N1X A;  3C38 A;  3G2Z A;  3DTI A;  1OT9 A;  3FPV A;  4L9E A;  1P97 A;  4ZBE A;  3NEC A;  1DJC A;  2R9W A;  4XUZ A;  1GCE A;  4OKP A;  5KSC A;  1F5M A;  3GR2 A;  2JE5 A;  3O88 A;  4BD1 A;  3A0S A;  5EE8 A;  5DTT A;  3IF6 C;  2ZC5 B;  4CLC E;  4OOM A;  4XUX A;  1M6K A;  4D60 A;  5HPF A;  2VX8 A;  4BMW A;  1ES2 A;  3TSG A;  4EV4 A;  4JGO A;  1O07 A;  2FFY A;  4OP8 A;  2ZC4 B;  3DWZ A;  1KDS A;  5EVI C;  5F6A A;  3T1Q B;  2A3U A;  4UQI S;  2QJ7 A;  4KUK A;  3NI9 A;  3S7Q A;  3MFX A;  2PU4 A;  1KOU A;  2WKI A;  3K3D A;  4KG6 A;  3N4I A;  3WS1 A;  4GHI B;  5G4Z A;  4R3J A;  4WMC D;  1MXO A;  1FOF A;  1S0W A;  4Q0H A;  2OSU A;  5FAT A;  2LB5 A;  3JPU A;  1TD5 A;  3P7N A;  2Y2J A;  3BYD A;  1FCN A;  3IHA A;  2DRW A;  4BQM A;  1ZC2 A;  4GHI A;  2VZW A;  4LEN A;  1AWI A;  4OQI A;  1GHM A;  1PZP A;  1P0Z A;  1FCM A;  4NXF A;  2V1A A;  1FIL A;  1BTL A;  1FR6 A;  3W8K A;  2W1R A;  2JC7 A;  3MQQ A;  1V9Y A;  4ETZ A;  5DTK A;  1W79 A;  5FAO A;  3CLO A;  3GV9 A;  1PW8 A;  1NZO A;  4ZJ3 A;  2YKF A;  2R9X A;  2V8C A;  4EER A;  5CHU A;  4S2O A;  3LEZ A;  3EGD C;  4CQH A;  5EV0 A;  3IBR A;  1IYS A;  3ZGA B;  2PHY A;  4DE3 A;  2E8J A;  3CIT A;  2WAE A;  3UDX A;  1G5U A;  3LIA A;  3WS0 A;  4B4X A;  2OOL A;  4HEF A;  1WYB A;  5FQ9 A;  4EUZ A;  2OAQ 1;  3C8C A;  5HWV A;  5EM1 A;  5FI7 A;  2HDS A;  3BW6 A;  5CXW A;  3OZH A;  2ZC3 B;  1LL5 A;  4MCW A;  4N92 A;  2W27 A;  4JXW A;  4EEP A;  3BQ8 A;  2J8Y A;  1XGI A;  4KZA A;  4RX3 A;  4WMC A;  5TFQ A;  1I2S A;  1TS8 A;  1W5D A;  1MPL A;  1TVF A;  5FDS A;  5I94 A;  4E3J A;  1K57 C;  1YT4 A;  2M7V A;  2GJ3 A;  3HLC A;  3F1N A;  3VP2 A;  5GL9 A;  4EQI A;  4O01 A;  3UE3 A;  2EX2 A;  3GDI A;  4IED A;  3KYZ A;  2H0Y A;  3RJU A;  4E6W A;  3I7J A;  4F3L B;  3IX3 A;  4LV1 A;  3QNC A;  4K0W A;  1PFL A;  3JVV A;  3W4O A;  4II7 A;  4HH3 A;  1K55 A;  5CGX A;  4QY5 A;  5HDS A;  3MZE A;  4JXV A;  3Q7V A;  4KZ3 A;  2UWX A;  4PPR A;  5CEC A;  1JVJ A;  1STZ A;  4LCM A;  1K56 D;  1MWT A;  2ZQ7 A;  4QWO A;  2ZM2 A;  3T4T A;  1MBL A;  5I5L A;  1K38 A;  4OON A;  3TE8 A;  4OLD A;  3ZVW A;  4S2P A;  2QPN A;  5TJJ A;  4PM9 A;  3OCN A;  3IHB A;  5KMW A;  1NRJ A;  2B18 A;  5L09 A;  3IH8 A;  3BFG A;  2Y2H A;  1K25 A;  5A90 A;  2B02 A;  3QNB A;  3EEH A;  1RGY A;  1VB6 A;  3LIC A;  5HWW A;  4BL3 A;  5FAQ A;  1G28 A;  4KZ5 A;  4ME4 A;  4PHT A;  4KZ9 A;  4Z1W A;  3A3D A;  3IH9 A;  4HOI A;  1PW1 A;  4HP4 A;  2Y2G A;  4EQ1 A;  2HDR A;  3A3E A;  5DTS A;  3LGO A;  4CLC D;  2VGL S;  3G31 A;  1S4S A;  1U60 A;  2B5R A;  2XRN A;  3UN7 A;  1ZG4 A;  3T4Q A;  4OOY A;  1CEF A;  2H0T A;  2VA0 A;  4Y7P A;  4R4S A;  4UHU A;  3UE0 A;  4YFM A;  2KDK A;  1K6S A;  5AVE A;  1JWZ A;  4JGQ A;  1XPB A;  4OVD A;  4R23 A;  4DE2 A;  1K4F A;  2KOI A;  3T50 A;  1GA0 A;  2ZQC A;  5KIZ A;  4IBR A;  2ZQA A;  1SHV A;  2DMW A;  5M18 A;  5GHY A;  2EWW A;  1YMX A;  3MJQ A;  3VMA A;  3M6B A;  2XK1 A;  1F98 A;  3FWL A;  1TEM A;  2V9A A;  2Y2L A;  1LLB A;  4ETX A;  2ZJ9 A;  2I72 A;  3PBS A;  5DKK A;  3RTY A;  1K56 A;  3A0V A;  2KLI A;  4N1H A;  2ZL1 A;  1O7E A;  4ZTK A;  3IBJ A;  3H82 A;  3RFB A;  3K3C A;  4YOF A;  3NOT C;  2W1T A;  2V20 A;  3BY9 A;  3N7W A;  2M7U A;  4FUW A;  4IHQ A;  2PR5 A;  5FQK A;  5DF7 A;  5FQJ A;  5U47 A;  3NUL A;  3HUO A;  1YKD A;  3SS5 A;  3HBR A;  3MKE A;  2CMN A;  1XJ3 A;  1N9O A;  1ERQ A;  4CLC B;  2P04 A;  3MS6 A;  4JF6 A;  4JLF A;  3HRE A;  1RCJ A;  4L9F A;  4EES A;  1NJ4 A;  3DTE A;  3MZF A;  2ZC7 A;  1N9N A;  4CLC A;  3MQO A;  3MF0 A;  5FEF A;  4KG2 A;  4O0P A;  1TS6 A;  2OLU A;  4BBT A;  1QMF A;  3UB8 A;  4H8R A;  4ARZ B;  1IEL A;  3A0R A;  1Z6F A;  4QJG A;  2XLN A;  4B88 A;  3VP1 A;  3MXR A;  4OLG A;  5TGF A;  3MQ0 A;  1ES4 A;  3CWF A;  1NLY A;  2PYP A;  4IUH A;  3IS2 A;  1UGU A;  5G18 A;  4BBU A;  1LL9 A;  3HLW A;  5E2F A;  1SDE A;  4EEU A;  3LI8 A;  2PR6 A;  1FR1 A;  4U0X A;  1GSX A;  1XP4 A;  3IWQ A;  4WEK A;  3AGE A;  2X71 A;  2HDQ A;  1DJA A;  4KZ7 A;  3H7W A;  1PNE A;  1E25 A;  3LR3 A;  2J3T C;  3UB7 A;  4Z9Q A;  1N4O A;  2Z2M B;  1T18 A;  4UEY A;  4JKT A;  2DNS A;  3CI6 A;  1XA1 A;  4OP5 A;  4PM7 A;  2V0U A;  2XQZ A;  4X56 A;  2XRO A;  2QMI A;  2WKH A;  3D9Y A;  1LHY A;  5EVI D;  5DFX A;  3G34 A;  3BM6 A;  3GVB A;  5GLC A;  3LYX A;  2Y55 A;  3PXP A;  2OV5 A;  3KO6 A;  2Y2Q A;  3LIB A;  4Q0J A;  2PD7 A;  1Z09 A;  3T1X A;  4BL2 A;  2XA7 M;  2GNX A;  3F1O A;  3KYQ A;  4N9K A;  4C3Q A;  1K54 C;  4GN2 A;  1E3U D;  1ZG6 A;  4Y13 A;  5KSH A;  1MWS A;  3VOL A;  2NUP C;  4R6L A;  3W2Z A;  1K0K A;  3OPL A;  2WAF A;  2XFS A;  1W63 Q;  3FYZ A;  3IX4 A;  3SH7 A;  2NUT C;  1SCW A;  4WZ5 A;  2V1Z A;  4Y15 A;  5L07 A;  4WUJ A;  4QB8 A;  4GJ4 A;  5GLB A;  5HWT A;  3Q81 A;  4NXG A;  1CI8 A;  2J9O A;  2EFU A;  1Y28 A;  4P6Z S;  1MC0 A;  3VSL A;  1H8M A;  5HPI A;  2C5W B;  2EXA A;  3M2J A;  4BWI A;  1XGJ A;  1L0D A;  2JCH A;  3IF6 B;  4HY8 A;  2PAV P;  2IA2 A;  4EW7 A;  3VOY A;  3MSH A;  4KUO A;  4N9L A;  4MLL A;  3BJN A;  2L4R A;  3LIE A;  4WF0 A;  3P01 A;  5EVI B;  1HLU P;  1BZA A;  2QKP A;  4PM8 A;  2QYB A;  3IF6 A;  5J7E A;  5FAS A;  4RX2 A;  3JYI A;  3ITA A;  1BLP A;  1ESI A;  4LV0 A;  5LBR A;  3HUN A;  2WYX A;  3TJZ C;  3SH8 A;  5A92 A;  5EVI A;  1IEM A;  4RVA A;  4S2L A;  4IJG A;  5HD3 A;  4DN0 A;  1MKI A;  3MR0 A;  3LCE A;  3ZQ5 A;  5FQQ A;  4BBV A;  3BFE A;  3HUM A;  3UMD A;  5HZH A;  1NYY A;  4YNR A;  1GHI A;  3KSG A;  2W3F A;  1PI4 A;  4DMZ A;  3S7P A;  2L1M A;  2PU2 A;  1GHP A;  2JKT I;  1E3U A;  1A0K A;  4M3K A;  1W63 M;  2PDR A;  2WZZ A;  4KZ6 A;  5EOO A;  5FEG A;  5IS1 A;  4X68 A;  4RA7 A;  1SDN A;  4HBT A;  5FAP A;  3T4K A;  5FA7 A;  1H0M A;  1YAX A;  1YPR A;  3V3R A;  3NJA A;  4S2I A;  1YLP A;  3FZC A;  2QWS A;  3UB9 A;  5FQM A;  1S6R A;  1L3L A;  1BYW A;  2PD8 A;  4GKU A;  3N6I A;  2VLG A;  3T4O A;  4KZ4 A;  1PWD A;  1L2S A;  4HI4 A;  3W4P A;  1JWV A;  3PAG A;  4HJ6 A;  4X69 A;  2Q9M A;  2FH5 A;  4C6Y A;  1KVL A;  3QP2 A;  4MN5 A;  3C2W A;  4HNB A;  2KX6 A;  4GD8 A;  5HSQ A;  2ZMA A;  1H3Q A;  5J4E A;  3NDG A;  1OTA A;  1NYM A;  2OAP 1;  4JXS A;  4R0Q A;  5HAQ A;  5AVF A;  3LO7 A;  5D3O A;  4IVK A;  4P6B A;  1YLY A;  2O9C A;  2O9A A;  4GOG A;  4U3T A;  1P9R A;  1I5Q A;  4C75 A;  5MC7 A;  1SKO B;  5CHJ A;  1J3W A;  3W4Q A;  2FFF B;  2IWC A;  3F1N B;  4GLQ A;  3BEC A;  1FSY A;  1G6O A;  3IXB A;  3PBQ A;  3RXX A;  4MMN A;  2H10 A;  4Y0T A;  4Y5F A;  4BD0 A;  1ODV A;  3G35 A;  3V5M A;  5K5B A;  2HZ5 A;  3QP1 A;  1ESU A;  4D2O A;  1SKO A;  3ULF A;  1ZKJ A;  1HTZ A;  3M6H A;  5CED A;  1CF0 A;  2K7S A;  3GEC A;  1XFQ A;  5G4Y A;  2R78 A;  2GZA A;  2VKS A;  4X55 A;  1UWP X;  1XJ6 A;  5IT5 A;  2Y2I A;  3PYP A;  3Q7V B;  1KE0 A;  5EEC A;  4OPR A;  4OQG A;  3IWO A;  2VGJ A;  5EUA A;  2Y2O A;  3S7N A;  5J8X A;  2EA9 A;  5FI2 A;  5CGW A;  5HX9 A;  4CJN A;  4X25 A;  2V1B A;  4K0X A;  2O99 A;  3UDI A;  4O7D A;  5DF8 A;  2JKT M;  4Q0I A;  3ZG9 B;  4HP9 A;  2J7V A;  2GDN A;  2ZLY A;  3N8S A;  1MWR A;  2A24 A;  1TS7 A;  1XXM A;  3HJK A;  1CEG A;  4E3L A;  4ZJ1 A;  2BLS A;  4HBU A;  3LFV A;  1RGZ A;  3IX8 A;  4NG2 A;  1NXY A;  2VV8 A;  5DFY A;  2G7U A;  1P9W A;  1G6A A;  4JF5 A;  3E4O A;  3S7O A;  1XKZ A;  3BFD A;  4PAU A;  1CI9 A;  1KE3 A;  2XD1 A;  1OTE A;  2A2L A;  1T19 A;  4KZ8 A;  5F69 A;  1TS0 A;  1X0O A;  3UE1 A;  4QY6 A;  4Y17 A;  1MWU A;  3E98 A;  5CHM A;  3VOZ A;  3P98 A;  4UA6 A;  1PRQ A;  4UA9 A;  3CUE C;  5F1G A;  5JYP A;  1VHM A;  1DY6 A;  1OJG A;  3KSI A;  4DRT A;  4S2M A;  4DDY A;  1FQG A;  3BFC A;  3VP4 A;  3S22 A;  3SZT A;  2K31 A;  3C5A A;  5F68 A;  2C6W B;  3QP6 A;  3IXG A;  1VEU A;  2WUQ A;  3ZG8 B;  4BJP A;  4O8G A;  2EX9 A;  3WWX A;  1D1J A;  2Y2M A;  4Q8I A;  1XA7 A;  4GS9 A;  4S2K A;  4WBG A;  3EGX C;  4HJ4 A;  1S1Y A;  4P87 A;  4LPZ A;  3N8R A;  3C30 A;  1J9M A;  3GQZ A;  4S2N C;  4LV2 A;  2ZL1 B;  2HPB A;  2PRF A;  3H82 B;  1ERO A;  4H6J B;  3G4P A;  3NCK A;  2W1T B;  3ZNY A;  1BLC A;  3MFD A;  3IF5 A;  4BEN A;  3VFF A;  3AGD A;  3A3I A;  4FH4 A;  3G30 A;  1S4R A;  4R70 A;  4H6J A;  3WRZ A;  4EXO A;  3OBF A;  4MEZ A;  2ZBB A;  4OPY A;  4XT2 A;  2VK3 A;  3UB5 P;  4WEJ A;  2J3T D;  2WKR A;  3C4O A;  2H28 A;  4R3A A;  1IFQ A;  2IWB A;  3VFH A;  1GSV A;  5L2F A;  3IQA A;  4HJ3 A;  1M40 A;  1HZO A;  4EBL A;  3BRM A;  4Y0O A;  1AXB A;  1QME A;  4E3K A;  3BQA A;  3B42 A;  1BUL A;  3NOP C;  1OME A;  2Y4A A;  1LI0 A;  3EQV A;  4HH2 A;  2I9V A;  3RH8 B;  4B9O A;  2V0W A;  4HQA A;  4CLC C;  3CPT A;  3DTM A;  1LL8 A;  3IS2 B;  3CMZ A;  2JBF A;  4LRZ E;  1IYQ A;  4LV3 A;  4PMA A;  3PHY A;  3HVF A;  4KQO A;  1PZO A;  1BT5 A;  2P9V A;  1W8Q A;  5E2H A;  5HDC A;  3VSK A;  3OLO A;  5DJU A;  1KGF A;  4R3B A;  1C3B A;  4I3A A;  4FCF A;  3H7W B;  5EPH A;  2X02 A;  2XSS A;  1Y4O A;  4E3N A;  1BUE A;  5E2E A;  5L10 A;  3NIA A;  3O3V A;  5C5K A;  4UA7 A;  1S67 L;  1BSG A;  3VP3 A;  4YIN A;  5BOH A;  4KQD A;  2RL3 A;  3QP5 A;  2Z2L B;  1XFN A;  2EWV A;  4HES A;  2IWD A;  3ZYT A;  1L0G A;  1XJ4 A;  1F2K A;  2XD5 A;  4NET A;  3WRT A;  5EVE A;  1S1Z A;  2WGW A;  1ACF A;  3PAE A;  1PYY A;  3Q82 A;  2WKQ A;  3OC2 A;  1DJB A;  2BG1 A;  2HP9 A;  5AQ9 A;  2WAD A;  3F1P B;  3SOI A;  3S1Y A;  2VEA A;  4DF6 A;  3KX0 X;  4EWF A;  3Q1F A;  3O5Y A;  3GRJ A;  3PBO A;  4U0T A;  4GB7 A;  2VV7 A;  3F1O B;  3VE3 A;  1XJ2 A;  5DF9 A;  1BLS A;  3U2A A;  4KZB A;  4DKI A;  3F1P A;  1XX2 A;  2HJ9 C;  1IOU A;  1OTB A;  2A49 A;  3E0Y A;  3SW1 A;  1FCO A;  4P6Z M;  4BLM A;  2J3W A;  1NLZ A;  1YM1 A;  2Y2K A;  2VJW A;  4B4Z A;  1Q2P A;  5HL1 A;  1YMS A;  1D7E A;  2P08 A;  2WGV A;  3QP4 A;  5F5Y A;  4L9G A;  4X53 A;  4R1G A;  3T1R A;  3TG9 A;  1IYO A;  1H8Z A;  2V2F F;  2WGI A;  2Z6D A;  4E3M A;  1NWZ A;  3KSF A;  1K54 A;  1WA9 A;  3B33 A;  2VGK A;  1OPX A;  3GTC A;  1K6R A;  3L9K A;  3MZD A;  3OPP A;  4UQI M;  4ID4 A;  2XH9 A;  5AQA A;  5IHV A;  4EBP A;  3MXQ A;  4IBX A;  3KSH A;  3LI9 A;  1GSW A;  2XDM A;  4K08 A;  2JKR I;  3NOU C;  3Q07 A;  3SH9 A;  2HGV A;  3L7H A;  2PYR A;  4FH2 A;  4DDS A;  4E3O A;  4NXE A;  2L0W A;  3S4X A;  2HDU A;  5GLD A;  4OOL A;  5CEB A;  3CHW P;  2EX8 A;  3V39 A;  4JF4 A;  4JGR A;  1W7F A;  4FOF A;  5HAP A;  2J80 A;  2GX5 A;  2XA7 S;  5HDD A;  2ACG A;  2Y2P A;  3P09 A;  3D72 A;  4GDN A;  1ES5 A;  3HCY A;  3E2K A;  2K2N A;  4QU3 A;  2M1C A;  5M1A A;  4PM6 A;  3BWL A;  3E4Q A;  3IXD A;  1T1A A;  4HHD A;  4JBF A;  2ZOH A;  3TW8 A;  4DXB A;  2Y91 A;  5DKL A;  5FL3 A;  4PKY G;  4P0M A;  1NY0 A;  3UPO A;  1YQS A;  4NKP A;  1ZHH B;  3PBN A;  1N9B A;  5EVL A;  5FQI A;  3V3S A;  2P7J A;  1LSX A;  1HD8 A;  5GLA A;  3UDF A;  1KGG A;  1LSV A;  1JTD A;  2Q9N A;  4XXR A;  3Q7Z A;  5TR7 A;  1LSW A;  4EBN A;  1ERM A;  4ESP A;  1IKI A;  3D3O A;  2VV6 A;  4JGP A;  4R4R A;  3T4S A;  4G3W A;  4LFU A;  3BEB A;  2QZ6 A;  1L0F A;  3UPP A;  4A5R A;  3GSG A;  2HP6 A;  3LIF A;  1JTG A;  1V9Z A;  5HL6 A;  1PI5 A;  3R4K A;  4MN7 A;  5CTN A;  3NBL A;  5DJT A;  1PIO A;  4EET B; 
#chains in the Genus database with same CATH homology
 4H8R A;  1TDL A;  1IEL A;  1I2W A;  2E8I A;  3UE1 A;  4QY6 A;  3VP0 A;  1YLZ A;  1MWU A;  3VOZ A;  5CHM A;  4Y0U A;  3C7V A;  1Z6F A;  1ONH A;  3HLB A;  3P98 A;  4N1X A;  4UA6 A;  3G2Z A;  2XLN A;  3A3J A;  4UA9 A;  4B88 A;  5F1G A;  3O86 A;  4FSF A;  4QJG A;  5JYP A;  3VP1 A;  1DY6 A;  3MXR A;  4OLG A;  5TGF A;  4DRT A;  1ES4 A;  4S2M A;  4DDY A;  1FQG A;  3BFC A;  1DJC A;  4ZBE A;  3S22 A;  2R9W A;  3SS4 A;  3VP4 A;  4XUZ A;  1GCE A;  4GDB A;  3BLS A;  4OKP A;  5KSC A;  5G18 A;  3GR2 A;  4QHC A;  4X6T A;  2JE5 A;  3C5A A;  3O88 A;  2H5S A;  1LL9 A;  3HLW A;  5E2F A;  2C6W B;  3IXG A;  1SDE A;  2WUQ A;  3ZG8 B;  4BJP A;  5GHZ A;  4BD1 A;  1MY8 A;  5EE8 A;  2EX9 A;  3WWX A;  4CPK A;  4MBF A;  5DTT A;  1FR1 A;  3IF6 C;  2ZC5 B;  4U0X A;  1BLH A;  4OOM A;  4XUX A;  1M6K A;  5AQ7 A;  1XP4 A;  1WYC A;  2Y2M A;  3IWQ A;  1ES2 A;  4WEK A;  3TSG A;  1XA7 A;  3AGE A;  4EV4 A;  4Q8I A;  2X71 A;  2ZM0 A;  4OQ0 A;  4S2K A;  4WBG A;  2HDQ A;  1DJA A;  1O07 A;  2FFY A;  4KZ7 A;  4P87 A;  3E2L A;  2XFT A;  3N8R A;  1E25 A;  4OP8 A;  1J9M A;  3GQZ A;  1FSW A;  4LV2 A;  2ZC4 B;  4S2N C;  4PM5 A;  3DWZ A;  1KDS A;  2HPB A;  3IXH A;  5EVI C;  1K57 A;  4Z9Q A;  1N4O A;  2Z2M B;  1ERO A;  3CJM A;  4JKT A;  2A3U A;  3G4P A;  3NCK A;  5M19 A;  1KDW A;  3G2Y A;  3ZNY A;  2DNS A;  3C7U A;  1XA1 A;  1BLC A;  3MFD A;  3IF5 A;  3NI9 A;  4MBH A;  4BEN A;  2PU4 A;  3VFF A;  3AGD A;  3A3I A;  1KGE A;  3O87 A;  4FH4 A;  3G30 A;  3EQU A;  2WKI A;  5CRF A;  4KG6 A;  3N4I A;  3WS1 A;  4L0L A;  3ZG0 A;  1CK3 A;  4OP5 A;  2OLV A;  4PM7 A;  2ZC6 B;  4R3J A;  2XQZ A;  4WMC D;  1MXO A;  3ZFZ A;  1FOF A;  1NRF A;  4X56 A;  1S0W A;  3WRZ A;  3HLE A;  4MEZ A;  2OSU A;  5CGS A;  4P85 A;  5FAT A;  4OQH A;  2CC1 A;  4OPY A;  2QMI A;  1K55 C;  2Y2J A;  3BYD A;  1FCN A;  3IHA A;  2DRW A;  2WKH A;  4WEJ A;  5F83 A;  4BQM A;  3C4O A;  1LHY A;  1YLW A;  1ZC2 A;  5EVI D;  2IWB A;  3VFH A;  4LEN A;  3G34 A;  3BM6 A;  4WZ4 A;  4OQI A;  1GHM A;  1PZP A;  3GVB A;  5GLC A;  5L2F A;  1FCM A;  3IQA A;  2Y55 A;  2OV5 A;  1BTL A;  1FR6 A;  1M40 A;  2Y2Q A;  1HZO A;  4EBL A;  3W8K A;  2XEP A;  4RYE A;  2JC7 A;  3BRM A;  4WEL A;  1AXB A;  4Y0O A;  5DTK A;  1W79 A;  4N9K A;  4BL2 A;  1QME A;  5FAO A;  4E3K A;  3V50 A;  4C3Q A;  1G68 A;  3GV9 A;  4K91 A;  3NC8 A;  1K54 C;  1PW8 A;  1NZO A;  4GN2 A;  1E3U D;  1ZG6 A;  3ZCZ A;  1BUL A;  1L0E A;  5KSH A;  1OME A;  1MWS A;  4ZJ3 A;  4FD8 A;  2Y4A A;  3G32 A;  2ZM8 A;  1LI0 A;  3OPL A;  3EQV A;  2R9X A;  1Y54 A;  3HLG A;  3A3F A;  2WAF A;  2XFS A;  1NZU A;  3PBR A;  3FYZ A;  4S2O A;  5CHU A;  3OCL A;  3LEZ A;  3WS2 A;  3SH7 A;  2G2U A;  3DTM A;  1SCW A;  4WZ5 A;  3CMZ A;  1YLT A;  1IYS A;  2V1Z A;  3M2K A;  3ZGA B;  2JBF A;  4DE3 A;  1IYQ A;  4QB8 A;  2WAE A;  4LV3 A;  5GLB A;  3UDX A;  4PMA A;  3WS0 A;  3GMW A;  3HVF A;  2J9P A;  3Q81 A;  2XF3 A;  4KQO A;  1CI8 A;  1PZO A;  2J9O A;  4B4X A;  2EFU A;  1BT5 A;  2P9V A;  1W8Q A;  5E2H A;  3VSK A;  4HEF A;  3VSL A;  1WYB A;  5FQ9 A;  4EUZ A;  4LCL A;  5DVA A;  1KGF A;  2C5W B;  4R3B A;  2EXA A;  3C4P A;  1H8Y A;  3M2J A;  1C3B A;  4FCF A;  1XGJ A;  5FI7 A;  1L0D A;  2HDS A;  2JCH A;  3IF6 B;  3LY4 A;  5EPH A;  2X02 A;  5FDH A;  5CXW A;  3OZH A;  1H5X A;  2ZC3 B;  3VOY A;  4N9L A;  4MLL A;  4DXC A;  4E3N A;  1BUE A;  5E2E A;  1LL5 A;  4N92 A;  3NIA A;  3O3V A;  4UA7 A;  1BSG A;  3VP3 A;  4JXW A;  2DCF A;  1ALQ A;  4ZAM A;  5CER A;  4YIN A;  5BOH A;  5EVI B;  2J8Y A;  1XGI A;  4KZA A;  1BZA A;  4OH0 A;  2RL3 A;  4PM8 A;  4RX3 A;  3IF6 A;  2Z2L B;  1Q2Q A;  1K4E A;  4WMC A;  4HES A;  3D4F A;  5TFQ A;  2IWD A;  5FAS A;  1L0G A;  3FKV A;  1I2S A;  3ZVT A;  1TDG A;  4F94 A;  1W5D A;  1MPL A;  4DE0 A;  1TVF A;  4RX2 A;  2XD5 A;  4KEN B;  4NET A;  3WRT A;  3JYI A;  1JWP A;  3ITA A;  5I94 A;  1BLP A;  1ESI A;  4E3J A;  1K57 C;  1YT4 A;  2WGW A;  4LV0 A;  4S2N A;  3HUN A;  2WYX A;  3QHY A;  3SH8 A;  5A92 A;  5EVI A;  1E4D A;  3IT9 A;  3PAE A;  1IEM A;  1EI5 A;  1PYY A;  3Q82 A;  4GNU A;  4RVA A;  4S2L A;  3HLC A;  1MKI A;  3VP2 A;  2PBY A;  2ZQ8 A;  3OC2 A;  5GL9 A;  4EQI A;  3UE3 A;  3OPR A;  1DJB A;  2BG1 A;  2EX2 A;  3LCE A;  5FQQ A;  2HP9 A;  5AQ9 A;  2WAD A;  1ONG A;  3BFE A;  3HUM A;  4IED A;  3SOI A;  1LI9 A;  1NYY A;  5FSR A;  2H0Y A;  1GHI A;  3RJU A;  3S1Y A;  1PI4 A;  4E6W A;  3I7J A;  1W8Y A;  4DF6 A;  4EWF A;  3MKF A;  3Q1F A;  4ZJ2 A;  4LV1 A;  3QNC A;  3GRJ A;  2PU2 A;  4K0W A;  3PBO A;  1GHP A;  4U0T A;  4GB7 A;  1E3U A;  5DF9 A;  1BLS A;  4M3K A;  1PWG A;  4KZB A;  4DKI A;  3ITB A;  3W4O A;  1XX2 A;  1K55 A;  5CGX A;  2WZZ A;  1KE4 A;  3HLF A;  4KZ6 A;  4QY5 A;  5EOO A;  2A49 A;  3ZNT A;  1FCO A;  3WS5 A;  3FV7 A;  3ZG5 A;  4X68 A;  3MZE A;  4JXV A;  3Q7V A;  4KZ3 A;  4RA7 A;  5E43 A;  4BLM A;  2XGN A;  1SDN A;  4JPM A;  1YM1 A;  3CG5 A;  4HBT A;  2Y2K A;  5FAP A;  1VQQ A;  4B4Z A;  1GA9 A;  1Q2P A;  2UWX A;  4PPR A;  5FA7 A;  5HL1 A;  5CEC A;  1JVJ A;  1YMS A;  2WGV A;  5AQB A;  3V3R A;  2EFX A;  2Y59 A;  4LCM A;  1K56 D;  3PBT A;  4S2I A;  1YLP A;  1MWT A;  1VM1 A;  2ZQ7 A;  3FZC A;  4X53 A;  4R1G A;  2ZM2 A;  3TG9 A;  1MBL A;  5FQM A;  5HW3 A;  1IYO A;  1K38 A;  1S6R A;  4OON A;  1H8Z A;  2EXB A;  2V2F F;  4GKU A;  2WGI A;  3N6I A;  3MXS A;  4OLD A;  3ZVW A;  4S2P A;  4E3M A;  2QPN A;  5CTM A;  1K54 A;  3UPN A;  2P9V B;  4KZ4 A;  2VGK A;  1PWD A;  1L2S A;  4PM9 A;  3OCN A;  3W4P A;  1JWV A;  3GTC A;  3IHB A;  1K6R A;  3PAG A;  5KMW A;  3MZD A;  4X69 A;  2Q9M A;  3IH8 A;  3BFG A;  2Y2H A;  1RP5 A;  3OPP A;  3AGF A;  1K25 A;  4C6Y A;  3B3X A;  4ID4 A;  5A90 A;  1KVL A;  2XH9 A;  2ZQ9 A;  1SKF A;  4OPQ A;  5AQA A;  4UAA A;  5HAR A;  5IHV A;  4EBP A;  3QNB A;  4IBX A;  2XDM A;  1RGY A;  5HAI A;  4BL3 A;  5FAQ A;  2X01 A;  3Q07 A;  4KZ5 A;  4GD8 A;  4GZB A;  3SH9 A;  4KZ9 A;  2HP5 A;  4FH2 A;  4DDS A;  2ZMA A;  4E3O A;  5F82 A;  3A3D A;  3IH9 A;  3NDE A;  3CZD A;  3NDG A;  4IVI A;  3SS3 A;  5F1F A;  4QD4 A;  1PW1 A;  3S4X A;  2Y2G A;  1NYM A;  2HDR A;  4JXS A;  4R0Q A;  2ZQD A;  5HAQ A;  2HDU A;  1WE4 A;  5GLD A;  3LO7 A;  4OOL A;  2RCX A;  5CEB A;  3A3E A;  4IVK A;  4P6B A;  5D3O A;  5DTS A;  2EX8 A;  3V39 A;  4JF4 A;  1YLY A;  2WKE A;  3G31 A;  5E2G A;  4NK3 A;  4GOG A;  4U3T A;  2B5R A;  1U60 A;  1W7F A;  5HAP A;  1I5Q A;  2WGW B;  3UN7 A;  1ZG4 A;  4OOY A;  4C75 A;  1CEF A;  2H0T A;  5CHJ A;  4WYY A;  3W4Q A;  1HVB A;  2FFF B;  2IWC A;  4Y7P A;  4R4S A;  2Y2P A;  4UHU A;  3TOI A;  3FKW A;  3BEC A;  4YFM A;  1FSY A;  3N8L A;  3IXB A;  3P09 A;  3PBQ A;  1K6S A;  3UE0 A;  1JWZ A;  4GDN A;  3RXX A;  1XPB A;  1ES5 A;  3UY6 A;  2H10 A;  4E3I A;  4Y0T A;  5EOE A;  4OVD A;  4BD0 A;  5GHX A;  3E2K A;  1EWZ A;  4R23 A;  4DE2 A;  4QU3 A;  1K4F A;  5M1A A;  1GA0 A;  2ZQC A;  4PM6 A;  3V5M A;  3G35 A;  4KG5 A;  5JYO A;  3IXD A;  1ESU A;  4JBF A;  4IBR A;  4D2O A;  2ZQA A;  4E6X A;  1SHV A;  1ZKJ A;  1HTZ A;  3M6H A;  5CED A;  5M18 A;  5GHY A;  3NY4 A;  4DXB A;  3OPH A;  1YMX A;  4KQQ A;  2Y91 A;  2XR0 A;  3VMA A;  3M6B A;  4X55 A;  2XK1 A;  2WK0 A;  4P0M A;  3ZDJ A;  3FWL A;  2Y2I A;  1TEM A;  1NY0 A;  3Q7V B;  1KE0 A;  2Y2L A;  1KVM A;  3UPO A;  1LLB A;  2G2W A;  4MNR A;  1YQS A;  5EEC A;  4OPR A;  1YLJ A;  1ES3 A;  2ZJ9 A;  4OQG A;  3IWO A;  2I72 A;  5HFO A;  3PBS A;  1K56 A;  2VGJ A;  3PBN A;  5A91 A;  1N9B A;  2WZX A;  4N1H A;  4GD6 A;  5EUA A;  2Y2O A;  1O7E A;  5EVL A;  4WM9 A;  4ZTK A;  3ISG A;  5FQI A;  3HL9 A;  3V3S A;  5J8X A;  3IWI A;  4KQR A;  5FI2 A;  5CGW A;  5HX9 A;  4CJN A;  1HD8 A;  5GLA A;  3UDF A;  2V20 A;  3BLM A;  3N7W A;  4K0X A;  2Y2N A;  1KGG A;  1JTD A;  3MBZ A;  2Q9N A;  3UDI A;  3LY3 A;  4XXR A;  3Q7Z A;  1PWC A;  4O7D A;  5DF8 A;  5TR7 A;  4ZDX A;  5FQK A;  3UNW A;  4EBN A;  1IYP A;  3ZG9 B;  4OPZ A;  5DF7 A;  1ERM A;  5FQJ A;  5U47 A;  2J7V A;  2GDN A;  2ZLY A;  3HUO A;  3N8S A;  3SS5 A;  1MWR A;  3HBR A;  1XXM A;  3MKE A;  1CEG A;  4E3L A;  1IKI A;  4ZJ1 A;  2ZD8 A;  5KZH A;  1ERQ A;  2BLS A;  3ZHH A;  5FI6 A;  3HLD A;  4HBU A;  4JF6 A;  3ZG7 B;  4JLF A;  4R4R A;  3HRE A;  4MBK A;  3PTE A;  1RCJ A;  3UO9 A;  3BEB A;  2QZ6 A;  1L0F A;  1RGZ A;  3UPP A;  1NXY A;  3DWK A;  4A5R A;  3GSG A;  2HP6 A;  3RXW A;  1NJ4 A;  1G6A A;  4JF5 A;  1IKG A;  1JTG A;  3WS4 A;  3MZF A;  4WZ5 C;  1XKZ A;  4DE1 A;  2ZC7 A;  3BFD A;  2XD1 A;  1CI9 A;  1KE3 A;  1PI5 A;  5A93 A;  4KG2 A;  4S2J A;  2OLU A;  1QMF A;  5CTN A;  3DW0 A;  3NBL A;  4KZ8 A;  2P74 A;  3BFF A;  1PIO A;  4JXG A;  2EX6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...