4ZDXA

Structure of oxa-51 beta-lactamase
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
241
structure length
240
Chain Sequence
SDEKAEKIKNLFNEVHTTGVLVIQQGQTQQSYGNDLARASTEYVPASTFMLNALIGLEHHKATTTEVFKWDGQKRLFPEWEKDMTLGDAMKASAIPVYQDLARRIGLELMSKEVKRVGYGNADIGTQVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSPKVQDEVQSMLFIEEKNGNKIYAKSGWGWDVDPQVGWLTGWVVQPQGNIVAFSLNLEMKKGIPSSVRKEITYKSLEQLGIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase
publication title Structural Basis for Enhancement of Carbapenemase Activity in the OXA-51 Family of Class D beta-Lactamases.
pubmed doi rcsb
source organism Acinetobacter baumannii
total genus 76
structure length 240
sequence length 241
ec nomenclature
pdb deposition date 2015-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4zdxA00
4HBUA 2ZC4B 1PYYA 4OP8A 1YLZA 2EXAA 1E3UA 4R0QA 1PW8A 4R23A 1K54C 4LENA 4IVIA 3BECA 4QY5A 1HVBA 3Q1FA 4E3IA 3G4PA 3PBRA 3ZVTA 2HP6A 2X02A 1PWCA 1ONGA 3WS0A 5A92A 5KSCA 4PM8A 3VOYA 5HL1A 1MWSA 4KZ5A 5DF8A 3ZGAB 1DJCA 5AQBA 5CEBA 4OLGA 2HDRA 3VFHA 3WRZA 5EVIA 2ZQ7A 3UNWA 4EBPA 4KG5A 2A3UA 5EOOA 5F83A 3PTEA 4IEDA 4WEJA 3CG5A 4S2JA 4OKPA 1FSWA 5GHXA 2ZM2A 4K0XA 1YLWA 1DJAA 1ES4A 4OP5A 4P6BA 4BD0A 4MLLA 4WM9A 2JE5A 1K6SA 4LV2A 4ZDXA 4XUZA 2Y2MA 4JXWA 4CJNA 5CHJA 5F82A 3HUOA 3OPLA 2Q9NA 3N8RA 5CRFA 3ZFZA 4OQHA 4R3BA 3CMZA 4LV0A 1NJ4A 2ZC5B 5KSHA 3MZEA 4N9LA 3N8SA 4GDBA 4GDNA 3E2KA 1WYCA 4ZJ3A 1Y54A 3ZNYA 1BTLA 1K57A 1MKIA 5HFOA 4C3QA 1OMEA 4X53A 4IBXA 3W4OA 2Y2GA 4E6XA 3M2KA 1JWPA 3UE3A 4X6TA 3VMAA 3UO9A 3D4FA 1LHYA 1K4FA 2V1ZA 2WADA 3WS2A 3IXBA 3VP4A 1MY8A 3NY4A 4MNRA 3C4PA 3M2JA 3Q81A 3ZDJA 4QJGA 1NRFA 4WBGA 4JKTA 3SOIA 1W8QA 1RCJA 1ZKJA 3FZCA 4P0MA 5GLDA 1S0WA 5DTKA 3VFFA 1QMFA 1H5XA 1YMSA 3VSKA 2XD1A 3HUNA 3V3SA 2Y55A 3JYIA 4BENA 5CTNA 3UPNA 2X01A 4JXGA 4UA6A 1ESUA 2EX8A 1K54A 4R4RA 4E3MA 3HLBA 5D3OA 1VQQA 5CHUA 2RL3A 4N9KA 5FQMA 2IWCA 4BL3A 4R1GA 3A3FA 2PU4A 4S2OA 4OOLA 1PZPA 4B4XA 4E3KA 5EE8A 3UDIA 1NY0A 3MXRA 3NCKA 4P85A 2ZQAA 3WWXA 4PM5A 4LCLA 5FAPA 5TFQA 4MBKA 5CGWA 3WS1A 2B5RA 3FWLA 3B3XA 5GLCA 2R9XA 3GR2A 3IXDA 4GZBA 4IBRA 5AQ7A 2JBFA 3IH9A 1KDSA 5U47A 4EQIA 3OPPA 1O7EA 2P74A 3W4PA 3AGEA 1L0EA 3E2LA 1BLPA 2ZLYA 5EECA 3WS4A 4D2OA 3EQUA 1ES3A 3SH8A 2Z2MB 3N7WA 3S1YA 2QPNA 1J9MA 3LCEA 5FQKA 1CEGA 1HTZA 1WYBA 3AGDA 4FD8A 2WK0A 2ZC3B 3C7UA 3MZDA 4OH0A 3IXHA 3P98A 4WELA 3RXWA 3Q7VB 4GKUA 2CC1A 1GHMA 4K91A 5CXWA 5FQ9A 2HP9A 3HVFA 4RA7A 5FA7A 1PW1A 4U0TA 2PBYA 3HLFA 5FI6A 5HAPA 4BQMA 2Y59A 4N92A 3S22A 4WMCD 3NDGA 2OLUA 4M3KA 2E8IA 1U60A 4HEFA 3FKWA 1ZC2A 3UPOA 4KQQA 4KZ6A 3HL9A 4Q8IA 1MWTA 5A90A 1BSGA 2XR0A 1LI9A 1PI5A 1SHVA 2C6WB 2WZXA 1W7FA 2DNSA 2H0YA 3LEZA 1KE3A 3C5AA 1BULA 1TDGA 2H0TA 4JPMA 3IXGA 4QHCA 4U3TA 2ZC7A 1FCMA 3IF6B 1W5DA 1KE0A 1BT5A 3IF5A 2G2UA 3LY3A 3HREA 4HBTA 3ZG0A 4C6YA 5BOHA 1IELA 4LV1A 4N1XA 3MZFA 5KMWA 3RJUA 1K55C 2V2FF 3OCLA 3V50A 2IWBA 1DJBA 3MKEA 5E2HA 1NYYA 5TGFA 3HUMA 4KZBA 3A3JA 2XH9A 3BM6A 3OPHA 4KQRA 2ZD8A 3G35A 4Y0TA 3TSGA 2Y2OA 1K38A 2EXBA 3BFEA 3Q07A 2QZ6A 3VOZA 1NZOA 5KZHA 1S6RA 4GB7A 1FQGA 4C75A 1AXBA 5HAIA 4DXCA 4WZ4A 5DF9A 1DY6A 2H5SA 3DW0A 1YLJA 5EPHA 3BRMA 3NBLA 4KZ4A 1BLCA 3GV9A 4L0LA 1KVMA 3GTCA 2BG1A 3I7JA 3RXXA 1K6RA 4OOMA 3NC8A 4S2PA 3BFGA 3O3VA 1SDEA 4ZBEA 4WEKA 2X71A 4LV3A 3A3DA 4FSFA 1ZG6A 2HP5A 3OPRA 3A3EA 3IWIA 3SH9A 2ZJ9A 3MFDA 4S2LA 2WAEA 2P9VB 2DCFA 2WGWA 4S2MA 4S2KA 3HBRA 4ID4A 4UHUA 5FI2A 1ALQA 1W8YA 3PAGA 4JF4A 1JWZA 5JYPA 1K56D 5FAOA 3BLSA 1CK3A 2J7VA 1Q2QA 4GD8A 4OOYA 1JWVA 2R9WA 3PBNA 5I94A 3ZCZA 4ZJ2A 3MKFA 1MXOA 5G18A 3G30A 1XX2A 1GA9A 4U0XA 1FR6A 1IKIA 1M6KA 5HX9A 3G31A 1WE4A 5E2GA 4Z9QA 3V3RA 1VM1A 3DWZA 1L0FA 5CTMA 1YM1A 1H8ZA 1N9BA 5FATA 2RCXA 3SH7A 1YQSA 1XGJA 3VP3A 1HZOA 5E43A 5DVAA 1SDNA 3BFCA 1SCWA 1K55A 3HLCA 1G68A 1N4OA 3PBSA 1K4EA 4PPRA 3UY6A 3G2YA 4A5RA 3WRTA 4KZ3A 5J8XA 3ITBA 4ZJ1A 5FI7A 3TOIA 2VGJA 3FV7A 1IYOA 4B4ZA 1Q2PA 1O07A 3QNBA 1L0GA 2ZQ9A 1ES5A 5FQQA 4DRTA 3VP0A 3CJMA 1W79A 3HLWA 1ZG4A 3NIAA 3VP2A 3WS5A 3ZG7B 2OV5A 1JVJA 3HLEA 1PI4A 4FH2A 2Q9MA 3UDXA 4EWFA 2PU2A 4X55A 1PZOA 2C5WB 5IHVA 4PMAA 1E25A 3HLGA 2OLVA 2WKIA 4RX2A 2WZZA 1IYPA 2Y4AA 2XFTA 4KENB 3IWQA 4MBFA 2UWXA 2HDQA 2QMIA 1XKZA 2ZMAA 4MBHA 4OPRA 4Y0OA 4DE1A 3FYZA 4E3LA 4DDYA 3GMWA 1G6AA 4KZ8A 3HLDA 4BL2A 2Y2KA 1IEMA 3EQVA 4GD6A 5FDHA 1LL5A 1E3UD 4E6WA 4EBNA 1I2WA 5EVIB 3C4OA 1RGZA 5FSRA 1KE4A 4BD1A 2EX6A 2XD5A 1RGYA 4DKIA 5GLBA 3IH8A 3LY4A 3DWKA 2EX2A 4JF5A 4KZAA 4XXRA 2DRWA 5A91A 5HARA 5HW3A 2HPBA 3GSGA 3GVBA 5GLAA 2HDUA 3QNCA 5EVID 1PIOA 1NZUA 3GQZA 4YFMA 1LL9A 1YT4A 4RX3A 3VSLA 4DE3A 3ZVWA 1YLTA 2Y2PA 4DE2A 2J9PA 3AGFA 1JTDA 3ZG8B 1C3BA 2HDSA 3C7VA 2J9OA 4DXBA 1EWZA 2WKEA 4B88A 2I72A 2WKHA 3IWOA 3W4QA 1ONHA 5DTSA 1FSYA 2ZQDA 4S2NC 3N8LA 1L2SA 5HAQA 3FKVA 1EI5A 4PM7A 1RP5A 4OQIA 3N6IA 5EOEA 2WAFA 2Y91A 4WYYA 2GDNA 2IWDA 2XK1A 4R3JA 2BLSA 4N1HA 3UN7A 3BFFA 4X56A 4WMCA 1NYMA 3IHAA 3N4IA 3IT9A 3UDFA 2Z2LB 2JC7A 4KG2A 3S4XA 3ZG9B 4H8RA 5F1GA 2Y2QA 3Q7VA 5M1AA 4HESA 1KGFA 4RVAA 1H8YA 2ZQCA 1FOFA 1YLPA 1KGGA 1CEFA 5AQAA 1MBLA 4DF6A 2WGIA 5A93A 1GA0A 2WGVA 4OVDA 1LLBA 5FQIA 3Q7ZA 4ZAMA 3O86A 4R4SA 3BLMA 4E3OA 5CEDA 1YLYA 3M6BA 3PBOA 3UE1A 4LCMA 1NXYA 1KVLA 3IF6A 3V39A 1BZAA 1EROA 3SS3A 1XA7A 3O88A 4P87A 4OPZA 3UE0A 4PM6A 5E2FA 4DDSA 2VGKA 4JBFA 1ES2A 3OCNA 4E3JA 2ZM8A 3BFDA 1XXMA 5TR7A 1ESIA 2XLNA 1I5QA 1CI9A 4JXSA 4OLDA 3ITAA 5M19A 5FASA 3V5MA 2Y2NA 4WZ5A 1IKGA 3G2ZA 1E4DA 5M18A 5GHYA 1BLSA 2OSUA 3PAEA 1MPLA 5FQJA 4FCFA 3ISGA 3IHBA 5DTTA 4KQOA 4KZ7A 1BLHA 3TG9A 5EUAA 4OQGA 4YINA 5F1FA 2XDMA 2Y2JA 2WUQA 2J8YA 4S2NA 4CPKA 3Q82A 4QB8A 1YMXA 2ZM0A 5E2EA 4NK3A 4OPYA 5EVLA 1BUEA 5GL9A 3PBTA 4BLMA 3QHYA 4JXVA 4BJPA 4XUXA 2XFSA 4UA9A 5CECA 1K56A 2EX9A 3BEBA 1MWUA 4E3NA 3W8KA 3M6HA 5EVIC 4DE0A 2FFFB 3OZHA 3PBQA 3P09A 1MWRA 1XA1A 2P9VA 1GHIA 2WYXA 2Y2LA 4X68A 3ZNTA 1KGEA 1TVFA 4QU3A 3ZHHA 1IYQA 4FH4A 4GNUA 3LO7A 2V20A 2Y2IA 4OPQA 4S2IA 4X69A 2XEPA 1I2SA 1ERMA 1PWGA 2FFYA 4UA7A 2EFXA 3IQAA 5CGSA 5DF7A 4ZTKA 2JCHA 2ZC6B 3IF6C 4K0WA 1LI0A 2XGNA 4KZ9A 3ZG5A 4QY6A 3MBZA 1Z6FA 5FAQA 4JF6A 1IYSA 1QMEA 3VP1A 5L2FA 1TEMA 2A49A 3G32A 2H10A 4QD4A 3DTMA 4EUZA 4KG6A 4JLFA 3NI9A 1FCNA 1K57C 3O87A 4F94A 5GHZA 5CERA 3GRJA 3A3IA 4OQ0A 4NETA 1FR1A 2EFUA 1ERQA 1FCOA 3NDEA 4EBLA 2ZQ8A 4WZ5C 4Y0UA 3BYDA 2Y2HA 4IVKA 4O7DA 1KDWA 1M40A 1HD8A 1XPBA 4GN2A 4RYEA 5AQ9A 1PWDA 1GHPA 3SS4A 5CHMA 1JTGA 1XGIA 3MXSA 3OC2A 3SS5A 5JYOA 1CI8A 1K25A 3CZDA 5CGXA 4UAAA 1L0DA 4Y7PA 2G2WA 2XF3A 4GOGA 1XP4A 3UPPA 1TDLA 2WGWB 4OONA 4EV4A 4MEZA 4PM9A 2XQZA 1GCEA 3G34A 1SKFA
chains in the Genus database with same CATH superfamily
2ZC4B 4EQ1A 1DP9A 1Z09A 2EXAA 1PW8A 4NXEA 4LENA 4IVIA 4QY5A 4O01A 4E3IA 3Q1FA 4L9GA 3G4PA 1ONGA 5KSCA 4PKYA 2O9AA 1DJCA 5CEBA 4OLGA 3WRZA 5A8BA 2J3WA 3PTEA 1VETA 4K0XA 1YLWA 4KQDA 3T4KA 2JE5A 1K6SA 3HUOA 2Q9NA 3EEHA 4OQHA 4EEUA 4DJ3A 3MZEA 3F1PA 4GDBA 4GDNA 4F3LA 4LFUA 4ZJ3A 5HFOA 1OMEA 1LSVA 4IBXA 3W4OA 2Y2GA 5FEGA 4PHTA 3VMAA 2M7VA 3UO9A 2WADA 2GX5A 2JKTI 3NY4A 1NRFA 1UWNX 4X25A 1RCJA 5DTKA 5IU1A 2J3TD 3JYIA 4R70A 1D1JA 4JXGA 5HWTA 1VEUB 5HDDA 2RL3A 4BL3A 5TJJA 4R1GA 3A3FA 4B4XA 1XJ3A 5EE8A 2A2LA 2INWA 3WWXA 4P6ZS 2JKGA 4MBKA 5CGWA 1NLYA 5GLCA 3GR2A 2EWVA 3D9YA 3T4JA 4GZBA 5AQ7A 4CQHA 5U47A 1O7EA 4D2OA 3E2LA 2VKSA 1BLPA 5EECA 3R7WA 1SZVA 1ES3A 2VV7A 2VLGA 4WL9A 1WYBA 4I3AA 2W3GA 3VOLA 3C7UA 4OH0A 4WELA 5AJGA 1P9RA 2VGLS 1Y28A 5HD3A 1F98A 4BQMA 4N92A 2KDKA 4HJ3A 1U60A 2O9BA 3UPOA 5L8MA 1OTEA 2XR0A 3LICA 1PI5A 1SHVA 2C6WB 1YSQA 1TDGA 4CLCE 3IF6B 1BT5A 3LY3A 3ZG0A 4C6YA 4M4XA 4GHIB 4ESPA 1KOUA 3C2WA 3MKEA 5TGFA 3T4SA 3BM6A 3OPHA 1H0MA 2LB9A 2EXBA 3VOZA 1NZOA 1S6RA 4GB7A 1AXBA 3DW0A 1YLJA 3BRMA 1BLCA 1OT6A 2PD8A 2XROA 2BG1A 3I7JA 4OOMA 3HCYA 3DTKA 3OPRA 3KYZA 5I5LA 3MFDA 2WGWA 1CK3A 2PT7A 4I3JA 1SKOB 4OOYA 5HD5A 1GSVA 5K5BA 4L9FA 4GS9B 5G18A 3G30A 1GA9A 5F6AA 5HX9A 2RCXA 1YQSA 5DVAA 1N9LA 3B42A 1G68A 1S66L 5HDSA 3CUEA 4PAUA 2VGJA 3FV7A 3QNBA 2ZMVA 2ZQ9A 4DRTA 1PFLA 1S1ZA 3NIAA 3HLEA 4FH2A 2PYRA 4EWFA 2PU2A 4X55A 2WKIA 4RX2A 1TS0A 2WZZA 2Y4AA 2XFTA 4FOFA 1Y4OA 2ZMFA 3E0YA 2QMIA 3UB6A 4OPRA 1G6AA 3C30A 4BL2A 2Y2KA 3EQVA 4GD6A 5FDHA 2A24A 4E6WA 1I2WA 2OAP1 3LIAA 3NULA 1RGZA 4DKIA 4H6JA 3DWKA 2EX2A 5HARA 5GLAA 2PHYA 1YT4A 4LRYC 4DE3A 1YLTA 2Y2PA 4F3LB 3TE8A 1PNEA 2Z6CA 3KSFA 2WKEA 3T50A 2I72A 2WKHA 2ZQDA 3N8LA 1L2SA 2Y8HA 2R78A 2WAFA 2Y91A 4WYYA 4LGWA 2IWDA 2XK1A 4N1HA 4X56A 3IT9A 2Z2LB 2JC7A 4GJ4A 4ARZA 3RH8B 4RQ9A 1H8YA 4CLCA 1STZA 1CEFA 3KX0X 4DF6A 2WGVA 5IS1A 3FG8A 4ZAMA 4R4SA 5KIZA 1YLYA 1CJFA 2Z6DA 3UE1A 4LCMA 4WUJA 4GCZA 3O88A 4DDSA 3R7WB 4JBFA 3LR3A 3G6OA 2ZM8A 1ESIA 4NG2A 1A0KA 3CHWP 2XLNA 1S4SA 2YKHA 2XRNA 2Y2NA 3QP1A 1E4DA 3CITA 2OSUA 5GHYA 2M7UA 1MPLA 4MCWA 5FQJA 2K7SA 3JVUA 3E4PA 4KZ7A 1BLHA 2XDMA 3LUQA 1J3WA 4CPKA 4I5SA 2FZ0A 5E2EA 1TS6A 5FL3A 4BLMA 3QHYA 3F1OA 3BEBA 1MWUA 4E3NA 3E4OA 3M6HA 4DE0A 3P09A 3ZNTA 3NECA 4QU3A 3ZHHA 4FH4A 2O99A 4S2IA 1WA9A 2WKRA 2XEPA 3ZQ5A 2FFYA 4UA7A 3IQAA 2M1CA 3MMHA 4K0WA 3ZG5A 3MBZA 1TEMA 4QD4A 4DMZA 4EUZA 1N9NA 2V0WA 1D06A 3O87A 5CERA 3BQ8A 1T18A 3NDEA 4EBLA 3BYDA 5HWVA 3QP5A 4IVKA 1KDWA 3CPTA 3OC2A 3MXSA 3H82A 5JYOA 5CGXA 1L0DA 2XF3A 1XP4A 2WGWB 4OONA 1F5MA 3OLOA 1YLZA 1E3UA 4R0QA 1X0OA 4AFIA 1HVBA 1P9WA 2W27A 2X02A 3S7NA 4I38A 5A92A 4QPRA 2HDRA 5EVEA 3VFHA 1ZHHB 3W2ZA 2ZQ7A 3UNWA 2A3UA 3E98A 4IEDA 2QJ7A 2V1AA 4MLLA 1S1YA 2Y2MA 4CJNA 5CHJA 4UEYA 2B95A 5HPIA 2KLIA 4R3BA 1NJ4A 5KSHA 3LIBA 1T1CA 4HHDA 4X53A 3M2KA 4P6ZM 1JWPA 3QP8A 3S7OA 4X6TA 2ZL1A 3D4FA 2A24B 2VX8A 1K4FA 5FDSA 4UQIS 1MY8A 4QJGA 3Q81A 4WBGA 3SOIA 3FC7A 1ZKJA 3FZCA 4H6JB 3VFFA 3CI6A 3VSKA 2XD1A 2Y55A 2V9AA 2X01A 1K54A 4R4RA 1ZTUA 1VQQA 2VGLM 4N9KA 5FQMA 2IWCA 3P7NA 4OOLA 4E3KA 4HP9A 3FPVA 3MXRA 3UB9A 4P85A 4BBUA 2K2NA 3LFVA 2R9XA 4HP4A 5TBMA 3W4PA 3WS4A 3SH8A 3KYQA 3S1YA 1J9MA 2QPNA 2VZWA 3JPUA 3S7PA 4ARZB 4BBTA 1GHMA 5DFYA 4CLCB 5CXWA 2HP9A 1OJ5A 1PW1A 2Y59A 3GECA 3JVVA 5G4YA 1ODVA 3FKWA 3KSIA 3BW6A 3HL9A 5G4ZA 1LI9A 2WZXA 1KE3A 3C5AA 2H0TA 4U3TA 4JPMA 4QHCA 2ZC7A 2D02A 3IF5A 4HI4A 4G3KA 2G2UA 1IELA 4N1XA 2EA9A 2V2FF 3V50A 2IWBA 1DJBA 3A3JA 2Q0OA 3LI8A 3G35A 4Y0TA 3NOTC 1K38A 3Q07A 4HOIA 1OTAA 4JGRA 5KZHA 4DXCA 1FQGA 5HAIA 4WZ4A 1DY6A 5EPHA 4KZ4A 1LSXA 1KVMA 1TD5A 4WN5A 5EV0A 1EW0A 3BQAA 3NC8A 4S2PA 2P7JA 3F1OB 3UB7A 4S2LA 5DFXA 4ID4A 3C8CA 4HH3A 2HJ9C 1K56D 5FAOA 2J7VA 2EWWA 5I94A 3ZCZA 3PHYA 4MDZA 3MKFA 1XX2A 3DAVA 4U0XA 3G31A 5F68A 5E2GA 4Z9QA 1VM1A 3DWZA 1YM1A 4Z1WA 1FIKA 1XGJA 3VP3A 1HZOA 5E43A 1SCWA 3UB5P 1K55A 2NUTC 3HLCA 3PBSA 4PPRA 3G2YA 4G3VA 4X1LA 3ITBA 3H82B 5FI7A 4ZJ1A 4MN7A 1IYOA 1O07A 2PD7A 3LIEA 3VP0A 3CJMA 4NXFA 3TJZC 3WS5A 4NEED 3LR5A 5IHVA 4PMAA 1P0ZA 3HLGA 3EGXC 1IYPA 2UWXA 2HDQA 2ZMAA 1XKZA 3NOPC 4E3LA 3U2AA 2QWSA 1IEMA 5AVFA 5FEFA 5FSRA 2EX6A 2VA0A 3IH8A 2W1TA 3LY4A 4O0PA 4XXRA 2DRWA 5A91A 3PYPA 3MR0A 2HDUA 1TF1A 3QNCA 2O0YA 4YOFA 4YFMA 1T19A 4IHQA 4RX3A 3ZVWA 3V67A 2J9PA 3D3OA 3AGFA 3ZG8B 1C3BA 2GNXA 3C7VA 1XJ6A 3IWOA 3OBFA 3W4QA 1ONHA 5DTSA 2ZL1B 4IUKA 4JGOA 3FKVA 1RP5A 3N6IA 5EOEA 4R3JA 3UN7A 2PR6A 4WMCA 1NYMA 3N4IA 4NXGA 4FTXA 4H8RA 5HL6A 5F1GA 2Y2QA 1KGFA 2ZQCA 3LIDA 1YLPA 1KGGA 1K0KA 1DP8A 1MBLA 5A93A 1GA0A 2JN7A 2JKRM 2KX6A 4NKPA 1NXYA 5TBMB 1BZAA 1EROA 3UE0A 1OPXA 2UV0E 3OCNA 4EETB 3GDIA 3BFDA 2PR5A 3T1XA 4JXSA 3ITAA 5M19A 4B93A 4WZ5A 2D01A 2BTFP 2XA7M 4PKYG 5DKLA 4EEPA 4KQOA 5EUAA 3QP6A 4OQGA 4YINA 3LI9A 3RFBA 2Y2JA 4S2NA 2ZOIA 1XFQA 1GSWA 3PBTA 4JXVA 4Y17A 2EX9A 5F5YA 2FFFB 1MWRA 1XA1A 2P9VA 2WYXA 4EU0A 5HSQA 4GNUA 3LIFA 2OAQ1 3H7WA 1ERMA 4ZTKA 2JCHA 2ZC6B 3IF6C 1LI0A 2XGNA 4QY6A 1VETB 5FAQA 3VP1A 5L2FA 3SZTA 3SW1A 3DTMA 1FCNA 5GHZA 3GRJA 4ZRRA 1ERQA 2JHEA 1F2KA 1XPBA 3DBAA 3F1PB 1JTGA 3SS5A 1CI8A 3CZDA 4GOGA 4LPZA 5HDCA 3TW8A 2ACGA 3EEAA 4MEZA 2V1BA 3KO6A 3G34A 3LEQA 1SKFA 1PYYA 4OP8A 1K54C 2FH5A 3BECA 1H3QA 2AVXA 3PBRA 3WS0A 4PM8A 5HL1A 4HH2A 1MWSA 4KZ5A 5DF8A 3F1NA 5EVIA 3A0SA 3UB8A 5F83A 4UQIM 4WEJA 3PXPA 4S2JA 4OKPA 2ZM2A 3NOUC 1DJAA 1ES4A 4BD0A 4P6BA 2HJEA 4WM9A 4LV2A 3CLOA 4ZDXA 4JXWA 2BASA 3ICYA 3OPLA 5CRFA 3ZFZA 1AWIA 4XT2A 3CMZA 2ZC5B 4N9LA 5L09A 1V9YA 3N8SA 2KOIA 1Y54A 3ZNYA 1K57A 4C3QA 3RTYA 1P97A 3K3DA 3EWKA 5AVEA 1JNUA 1ACFA 3WS2A 3VP4A 4Q0JA 3ZDJA 2HV1A 2B18A 3T4TA 4P0MA 2W1TB 4IJGA 2PDRA 3V3SA 3HUNA 4BENA 5CTNA 2I9VA 4UA6A 2E8JA 1ESUA 5DKKA 3MJQA 4E3MA 5D3OA 5CHUA 1OJGA 3DTEA 1PZPA 4HJ6A 4G3WA 1NY0A 3LYXA 2L0WA 2PYPA 3MS6A 1V9ZA 2ZQAA 5FAPA 3WS1A 2B5RA 3FWLA 3B3XA 5C5KA 4IBRA 2JBFA 2P74A 4R6LA 3AGEA 1L0EA 3E4QA 4Y3IA 2QHKA 3EQUA 2Z2MB 3N7WA 4YNRA 3LCEA 5FQKA 3MQQA 1HTZA 1DRMA 4FD8A 3UMDA 2ZC3B 4IUHA 3CWFA 3IXHA 3P98A 3RXWA 4L9EA 4GKUA 3LR0A 5FQ9A 4RA7A 1G6OA 4GLQA 2PBYA 4LRXC 5FI6A 5HAPA 3S22A 3NDGA 1L3LA 4M3KA 1DP6A 2E8IA 3MQ0A 1ZC2A 4KQQA 4JGQA 4Q8IA 1MWTA 1BSGA 4CLCD 4E3JA 2H0YA 1W7FA 2DNSA 4JGPA 1BULA 3NHQA 1FCMA 4HBTA 1W5DA 3HREA 3P01A 5DJUA 4LV1A 1YSPA 3MZFA 5KMWA 3RJUA 1K55C 3OCLA 5E2HA 1NYYA 1N9OA 4KZBA 1UGUA 4KQRA 2ZD8A 3TSGA 2Y2OA 2QZ6A 1OTDA 2V8CA 3NBLA 3GV9A 4L0LA 3T1SA 1NRJA 1PRQA 1XFNA 4B9OA 2W0NA 1UWPX 3MF0A 3A0VA 3BFGA 3O3VA 4ZBEA 4HQAA 4WEKA 4LV3A 2HP5A 3IWIA 3SH9A 3T4LA 2ZJ9A 2V8FA 2WAEA 2P9VB 2DCFA 2LB5A 4S2KA 3IX3A 1W8YA 3PAGA 2XSSA 4JF4A 1JWZA 2P08A 4ZJ2A 1FR6A 1M6KA 1WE4A 1L0FA 3BY9A 5FATA 3T4QA 2JKFA 5DJTA 3SH7A 1N4OA 1K4EA 1GSXA 2ZOHA 1TS8A 1S67L 2Y79A 5J8XA 2L4RA 3TOIA 4B4ZA 1Q2PA 1ES5A 5FQQA 4E04A 2ZBBA 2O9CA 1W79A 4X1MA 1ZG4A 2OV5A 2Q9MA 3UDXA 1E25A 2VK3A 2OLVA 4MBFA 4MBHA 4DE1A 5HZHA 3FYZA 3VE3A 1E3UD 3F1NB 5EVIB 2V0UA 1SKOA 1KE4A 2XD5A 4GS9A 4JF5A 2W3EA 3EOIA 3T4OA 1LL9A 4DE2A 4HJ4A 1W63Q 4ME4A 1JTDA 2B02A 2J9OA 4DXBA 4B88A 3CUEC 4S2NC 2WKQA 1NWZA 3IHAA 3UDFA 1NLZA 3T12B 4DN0A 3Q7VA 5M1AA 4HESA 2VV6A 1S4RA 5AQAA 2WGIA 5FQIA 4E3OA 2GJ3A 3H9WA 3M6BA 3PBOA 1KVLA 3V39A 2VJWA 5E2FA 1CQAA 4EW7A 1ES2A 5TR7A 3HJKA 1I5QA 1CI9A 5IT5A 3IBRA 1IKGA 2G7UA 2L1MA 3K2NA 5M18A 1BLSA 3PAEA 5DTTA 3KYEA 3CPTB 2J8YA 1OTBA 3Q82A 5F69A 1YMXA 4NK3A 4OPYA 3IBJA 1BUEA 5GL9A 3MXQA 3DTIA 4BJPA 4XUXA 4UA9A 1YKDA 5CECA 4R3AA 1OTIA 4CLCC 3T1QB 5EVIC 3FPWA 3PBQA 2Y2LA 1GHIA 4X68A 1KGEA 1TVFA 3A0RA 3ZYTA 3LO7A 4X69A 4OPQA 2JKRI 5MC7A 2EFXA 5DF7A 1H8MA 1Z6FA 4JF6A 2A49A 3G32A 2PBDP 4KG6A 3TRCA 1K57C 2VV8A 3A3IA 4NETA 1FR1A 2EFUA 1FCOA 1MKMA 2Y2HA 4EERA 4O7DA 1HD8A 2DMWA 3B33A 1YPRA 3SS4A 5CHMA 1XGIA 3MFXA 4Y7PA 2G2WA 1IOUA 1YAXA 4HY8A 4EV4A 3O5YA 2XQZA 1GCEA 4BMWA 4DDYA 4HBUA 2JKTM 4R23A 2OWJA 3ZVTA 2PRFA 2HP6A 1PWCA 1XJ4A 3C38A 2HGVA 3VOYA 5HPFA 3D72A 4EESA 3ZGAB 1HLUP 5AQBA 2HZ5A 3ULFA 3LGOA 4EBPA 4KG5A 5EOOA 2W1RA 3CG5A 5GHXA 1FSWA 1FILA 3EGDC 5L07A 4XUZA 4KUKA 1VHMA 5F82A 3N8RA 2OOLA 4LV0A 3KSGA 3E2KA 1WYCA 1BTLA 1MKIA 4E6XA 2OWHA 2K31A 3UE3A 4KUOA 4R38A 1LHYA 4QWOA 4ETXA 2V1ZA 4Q0HA 1IFQA 3IXBA 4MNRA 3C4PA 3M2JA 4JKTA 1W8QA 2W3DA 5GLDA 1S0WA 1QMFA 1H5XA 1YMSA 3UPNA 3HJIA 2EX8A 3IS2A 5EM0A 3PR6A 3HLBA 3L7HA 2PU4A 4S2OA 3UDIA 2J80A 1OT9A 4Y15A 3NCKA 4PM5A 2HF6A 4LCLA 5TFQA 3IXDA 1XJ2A 3IH9A 1KDSA 4EQIA 3OPPA 2ZLYA 4MN6A 3BJNA 1CEGA 3AGDA 2P04A 2WK0A 3MZDA 2MJ6A 1W63M 3Q7VB 2CC1A 4K91A 2IA2A 3HVFA 5FA7A 4U0TA 3HLFA 4II7A 4ETZA 4WMCD 2OLUA 3LR4A 4HEFA 5EM1A 3VV4A 4KZ6A 5A90A 4OP5A 3LEZA 3IXGA 3L9KA 2NUPC 1KE0A 5BOHA 4WF0A 3HUMA 4EXOA 1TS7A 2XH9A 3UMEA 3BFEA 4C75A 5DF9A 2H5SA 1F9IA 1CF0A 3GTCA 5HWWA 3RXXA 1K6RA 1SDEA 5J7EA 2X71A 3A3DA 4FSFA 1ZG6A 2J3TC 3B47A 3A3EA 3BWLA 2WKPA 4S2MA 3HBRA 4UHUA 5FI2A 1ALQA 3NJAA 5JYPA 3S7QA 3BLSA 3T1RA 1Q2QA 1G28A 4GD8A 4I39A 1JWVA 2R9WA 3PBNA 4Y2FA 4EUVA 1MXOA 5L10A 2CMNA 1IKIA 3V3RA 5CTMA 1H8ZA 1N9BA 4BWIA 1SDNA 3BFCA 3MQOA 3UY6A 4A5RA 3WRTA 4KZ3A 1L0GA 3HLWA 3VP2A 3ZG7B 3UE6A 1JVJA 1PI4A 4HIAA 1PZOA 2C5WB 3VE4A 4DJ2A 4KENB 3IWQA 4Y0OA 3GMWA 4KZ8A 3HLDA 1LL5A 4EBNA 2W3FA 5CX7A 3U4LP 3C4OA 3CAXA 2XA7S 4BD1A 1RGYA 4D60A 5GLBA 3KSHA 4KZAA 5HW3A 2HPBA 3GSGA 3GVBA 5EVID 1VEUA 1PIOA 1NZUA 3GQZA 4O8GA 4GW9A 3VSLA 4BBVA 3QP4A 4I3IA 2YKFA 2HDSA 2QKPA 1EWZA 1G5UA 1FSYA 4HNBA 5HAQA 3MSHA 1EI5A 4PM7A 4OQIA 2GDNA 2BLSA 2PAVP 3BFFA 5LBRA 1T1BA 3ZG9B 4KG2A 3S4XA 3IX8A 4RVAA 4NXBA 3IS2B 1FOFA 4K08A 3R4KA 4Q0IA 1LSWA 2QYBA 4OVDA 1LLBA 3Q7ZA 3O86A 3BLMA 5CEDA 3H7WB 4FUWA 3IF6A 3SS3A 1D7EA 1XA7A 4P87A 2W3HA 4OPZA 4PM6A 3K3CA 4GHIA 4Y13A 2VGKA 2GZAA 1LT0A 4LRZE 1XXMA 1LL8A 4MMNA 4Y5FA 4OLDA 2VEAA 5FASA 3V5MA 3IX4A 1VB6A 3G2ZA 4FCFA 3ISGA 3IHBA 3TG9A 5F1FA 2WUQA 5J4EA 4QB8A 3QP2A 3OOVA 2ZM0A 5EVLA 2XFSA 1K56A 3W8KA 3OZHA 3BY8A 4LLOB 1IYQA 2V20A 2Y2IA 5J3WA 1I2SA 1PWGA 1BYWA 5CGSA 1T1AA 2H28A 4KZ9A 1IYSA 1QMEA 4MN5A 4YWZA 2H10A 4JLFA 3NI9A 4F94A 4OQ0A 4XT2B 2ZQ8A 4WZ5C 4Y0UA 1M40A 4GN2A 5AQ9A 4RYEA 1MZUA 1PWDA 1GHPA 5EFWA 2QJ5A 1K25A 1MC0A 4UAAA 3UPPA 1TDLA 4WLAA 4PM9A
chains in the Genus database with same CATH topology
4HBUA 2ZC4B 1PYYA 4OP8A 1YLZA 2EXAA 1E3UA 4R0QA 1PW8A 4R23A 1K54C 4LENA 4IVIA 3BECA 4QY5A 1HVBA 3Q1FA 4E3IA 3G4PA 3PBRA 3ZVTA 2HP6A 2X02A 1PWCA 1ONGA 3WS0A 5A92A 5KSCA 4PM8A 3VOYA 5HL1A 1MWSA 4KZ5A 5DF8A 3ZGAB 1DJCA 5AQBA 5CEBA 4OLGA 2HDRA 3VFHA 3WRZA 5EVIA 2ZQ7A 3UNWA 4EBPA 4KG5A 2A3UA 5EOOA 5F83A 3PTEA 4IEDA 4WEJA 3CG5A 4S2JA 4OKPA 1FSWA 5GHXA 2ZM2A 4K0XA 1YLWA 1DJAA 1ES4A 4OP5A 4P6BA 4BD0A 4MLLA 4WM9A 2JE5A 1K6SA 4LV2A 4ZDXA 4XUZA 2Y2MA 4JXWA 4CJNA 5CHJA 5F82A 3HUOA 3OPLA 2Q9NA 3N8RA 5CRFA 3ZFZA 4OQHA 4R3BA 3CMZA 4LV0A 1NJ4A 2ZC5B 5KSHA 3MZEA 4N9LA 3N8SA 4GDBA 4GDNA 3E2KA 1WYCA 4ZJ3A 1Y54A 3ZNYA 1BTLA 1K57A 1MKIA 5HFOA 4C3QA 1OMEA 4X53A 4IBXA 3W4OA 2Y2GA 4E6XA 3M2KA 1JWPA 3UE3A 4X6TA 3VMAA 3UO9A 3D4FA 1LHYA 1K4FA 2V1ZA 2WADA 3WS2A 3IXBA 3VP4A 1MY8A 3NY4A 4MNRA 3C4PA 3M2JA 3Q81A 3ZDJA 4QJGA 1NRFA 4WBGA 4JKTA 3SOIA 1W8QA 1RCJA 1ZKJA 3FZCA 4P0MA 5GLDA 1S0WA 5DTKA 3VFFA 1QMFA 1H5XA 1YMSA 3VSKA 2XD1A 3HUNA 3V3SA 2Y55A 3JYIA 4BENA 5CTNA 3UPNA 2X01A 4JXGA 4UA6A 1ESUA 2EX8A 1K54A 4R4RA 4E3MA 3HLBA 5D3OA 1VQQA 5CHUA 2RL3A 4N9KA 5FQMA 2IWCA 4BL3A 4R1GA 3A3FA 2PU4A 4S2OA 4OOLA 1PZPA 4B4XA 4E3KA 5EE8A 3UDIA 1NY0A 3MXRA 3NCKA 4P85A 2ZQAA 3WWXA 4PM5A 4LCLA 5FAPA 5TFQA 4MBKA 5CGWA 3WS1A 2B5RA 3FWLA 3B3XA 5GLCA 2R9XA 3GR2A 3IXDA 4GZBA 4IBRA 5AQ7A 2JBFA 3IH9A 1KDSA 5U47A 4EQIA 3OPPA 1O7EA 2P74A 3W4PA 3AGEA 1L0EA 3E2LA 1BLPA 2ZLYA 5EECA 3WS4A 4D2OA 3EQUA 1ES3A 3SH8A 2Z2MB 3N7WA 3S1YA 2QPNA 1J9MA 3LCEA 5FQKA 1CEGA 1HTZA 1WYBA 3AGDA 4FD8A 2WK0A 2ZC3B 3C7UA 3MZDA 4OH0A 3IXHA 3P98A 4WELA 3RXWA 3Q7VB 4GKUA 2CC1A 1GHMA 4K91A 5CXWA 5FQ9A 2HP9A 3HVFA 4RA7A 5FA7A 1PW1A 4U0TA 2PBYA 3HLFA 5FI6A 5HAPA 4BQMA 2Y59A 4N92A 3S22A 4WMCD 3NDGA 2OLUA 4M3KA 2E8IA 1U60A 4HEFA 3FKWA 1ZC2A 3UPOA 4KQQA 4KZ6A 3HL9A 4Q8IA 1MWTA 5A90A 1BSGA 2XR0A 1LI9A 1PI5A 1SHVA 2C6WB 2WZXA 1W7FA 2DNSA 2H0YA 3LEZA 1KE3A 3C5AA 1BULA 1TDGA 2H0TA 4JPMA 3IXGA 4QHCA 4U3TA 2ZC7A 1FCMA 3IF6B 1W5DA 1KE0A 1BT5A 3IF5A 2G2UA 3LY3A 3HREA 4HBTA 3ZG0A 4C6YA 5BOHA 1IELA 4LV1A 4N1XA 3MZFA 5KMWA 3RJUA 1K55C 2V2FF 3OCLA 3V50A 2IWBA 1DJBA 3MKEA 5E2HA 1NYYA 5TGFA 3HUMA 4KZBA 3A3JA 2XH9A 3BM6A 3OPHA 4KQRA 2ZD8A 3G35A 4Y0TA 3TSGA 2Y2OA 1K38A 2EXBA 3BFEA 3Q07A 2QZ6A 3VOZA 1NZOA 5KZHA 1S6RA 4GB7A 1FQGA 4C75A 1AXBA 5HAIA 4DXCA 4WZ4A 5DF9A 1DY6A 2H5SA 3DW0A 1YLJA 5EPHA 3BRMA 3NBLA 4KZ4A 1BLCA 3GV9A 4L0LA 1KVMA 3GTCA 2BG1A 3I7JA 3RXXA 1K6RA 4OOMA 3NC8A 4S2PA 3BFGA 3O3VA 1SDEA 4ZBEA 4WEKA 2X71A 4LV3A 3A3DA 4FSFA 1ZG6A 2HP5A 3OPRA 3A3EA 3IWIA 3SH9A 2ZJ9A 3MFDA 4S2LA 2WAEA 2P9VB 2DCFA 2WGWA 4S2MA 4S2KA 3HBRA 4ID4A 4UHUA 5FI2A 1ALQA 1W8YA 3PAGA 4JF4A 1JWZA 5JYPA 1K56D 5FAOA 3BLSA 1CK3A 2J7VA 1Q2QA 4GD8A 4OOYA 1JWVA 2R9WA 3PBNA 5I94A 3ZCZA 4ZJ2A 3MKFA 1MXOA 5G18A 3G30A 1XX2A 1GA9A 4U0XA 1FR6A 1IKIA 1M6KA 5HX9A 3G31A 1WE4A 5E2GA 4Z9QA 3V3RA 1VM1A 3DWZA 1L0FA 5CTMA 1YM1A 1H8ZA 1N9BA 5FATA 2RCXA 3SH7A 1YQSA 1XGJA 3VP3A 1HZOA 5E43A 5DVAA 1SDNA 3BFCA 1SCWA 1K55A 3HLCA 1G68A 1N4OA 3PBSA 1K4EA 4PPRA 3UY6A 3G2YA 4A5RA 3WRTA 4KZ3A 5J8XA 3ITBA 4ZJ1A 5FI7A 3TOIA 2VGJA 3FV7A 1IYOA 4B4ZA 1Q2PA 1O07A 3QNBA 1L0GA 2ZQ9A 1ES5A 5FQQA 4DRTA 3VP0A 3CJMA 1W79A 3HLWA 1ZG4A 3NIAA 3VP2A 3WS5A 3ZG7B 2OV5A 1JVJA 3HLEA 1PI4A 4FH2A 2Q9MA 3UDXA 4EWFA 2PU2A 4X55A 1PZOA 2C5WB 5IHVA 4PMAA 1E25A 3HLGA 2OLVA 2WKIA 4RX2A 2WZZA 1IYPA 2Y4AA 2XFTA 4KENB 3IWQA 4MBFA 2UWXA 2HDQA 2QMIA 1XKZA 2ZMAA 4MBHA 4OPRA 4Y0OA 4DE1A 3FYZA 4E3LA 4DDYA 3GMWA 1G6AA 4KZ8A 3HLDA 4BL2A 2Y2KA 1IEMA 3EQVA 4GD6A 5FDHA 1LL5A 1E3UD 4E6WA 4EBNA 1I2WA 5EVIB 3C4OA 1RGZA 5FSRA 1KE4A 4BD1A 2EX6A 2XD5A 1RGYA 4DKIA 5GLBA 3IH8A 3LY4A 3DWKA 2EX2A 4JF5A 4KZAA 4XXRA 2DRWA 5A91A 5HARA 5HW3A 2HPBA 3GSGA 3GVBA 5GLAA 2HDUA 3QNCA 5EVID 1PIOA 1NZUA 3GQZA 4YFMA 1LL9A 1YT4A 4RX3A 3VSLA 4DE3A 3ZVWA 1YLTA 2Y2PA 4DE2A 2J9PA 3AGFA 1JTDA 3ZG8B 1C3BA 2HDSA 3C7VA 2J9OA 4DXBA 1EWZA 2WKEA 4B88A 2I72A 2WKHA 3IWOA 3W4QA 1ONHA 5DTSA 1FSYA 2ZQDA 4S2NC 3N8LA 1L2SA 5HAQA 3FKVA 1EI5A 4PM7A 1RP5A 4OQIA 3N6IA 5EOEA 2WAFA 2Y91A 4WYYA 2GDNA 2IWDA 2XK1A 4R3JA 2BLSA 4N1HA 3UN7A 3BFFA 4X56A 4WMCA 1NYMA 3IHAA 3N4IA 3IT9A 3UDFA 2Z2LB 2JC7A 4KG2A 3S4XA 3ZG9B 4H8RA 5F1GA 2Y2QA 3Q7VA 5M1AA 4HESA 1KGFA 4RVAA 1H8YA 2ZQCA 1FOFA 1YLPA 1KGGA 1CEFA 5AQAA 1MBLA 4DF6A 2WGIA 5A93A 1GA0A 2WGVA 4OVDA 1LLBA 5FQIA 3Q7ZA 4ZAMA 3O86A 4R4SA 3BLMA 4E3OA 5CEDA 1YLYA 3M6BA 3PBOA 3UE1A 4LCMA 1NXYA 1KVLA 3IF6A 3V39A 1BZAA 1EROA 3SS3A 1XA7A 3O88A 4P87A 4OPZA 3UE0A 4PM6A 5E2FA 4DDSA 2VGKA 4JBFA 1ES2A 3OCNA 4E3JA 2ZM8A 3BFDA 1XXMA 5TR7A 1ESIA 2XLNA 1I5QA 1CI9A 4JXSA 4OLDA 3ITAA 5M19A 5FASA 3V5MA 2Y2NA 4WZ5A 1IKGA 3G2ZA 1E4DA 5M18A 5GHYA 1BLSA 2OSUA 3PAEA 1MPLA 5FQJA 4FCFA 3ISGA 3IHBA 5DTTA 4KQOA 4KZ7A 1BLHA 3TG9A 5EUAA 4OQGA 4YINA 5F1FA 2XDMA 2Y2JA 2WUQA 2J8YA 4S2NA 4CPKA 3Q82A 4QB8A 1YMXA 2ZM0A 5E2EA 4NK3A 4OPYA 5EVLA 1BUEA 5GL9A 3PBTA 4BLMA 3QHYA 4JXVA 4BJPA 4XUXA 2XFSA 4UA9A 5CECA 1K56A 2EX9A 3BEBA 1MWUA 4E3NA 3W8KA 3M6HA 5EVIC 4DE0A 2FFFB 3OZHA 3PBQA 3P09A 1MWRA 1XA1A 2P9VA 1GHIA 2WYXA 2Y2LA 4X68A 3ZNTA 1KGEA 1TVFA 4QU3A 3ZHHA 1IYQA 4FH4A 4GNUA 3LO7A 2V20A 2Y2IA 4OPQA 4S2IA 4X69A 2XEPA 1I2SA 1ERMA 1PWGA 2FFYA 4UA7A 2EFXA 3IQAA 5CGSA 5DF7A 4ZTKA 2JCHA 2ZC6B 3IF6C 4K0WA 1LI0A 2XGNA 4KZ9A 3ZG5A 4QY6A 3MBZA 1Z6FA 5FAQA 4JF6A 1IYSA 1QMEA 3VP1A 5L2FA 1TEMA 2A49A 3G32A 2H10A 4QD4A 3DTMA 4EUZA 4KG6A 4JLFA 3NI9A 1FCNA 1K57C 3O87A 4F94A 5GHZA 5CERA 3GRJA 3A3IA 4OQ0A 4NETA 1FR1A 2EFUA 1ERQA 1FCOA 3NDEA 4EBLA 2ZQ8A 4WZ5C 4Y0UA 3BYDA 2Y2HA 4IVKA 4O7DA 1KDWA 1M40A 1HD8A 1XPBA 4GN2A 4RYEA 5AQ9A 1PWDA 1GHPA 3SS4A 5CHMA 1JTGA 1XGIA 3MXSA 3OC2A 3SS5A 5JYOA 1CI8A 1K25A 3CZDA 5CGXA 4UAAA 1L0DA 4Y7PA 2G2WA 2XF3A 4GOGA 1XP4A 3UPPA 1TDLA 2WGWB 4OONA 4EV4A 4MEZA 4PM9A 2XQZA 1GCEA 3G34A 1SKFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HBU A;  2ZC4 B;  1PYY A;  4OP8 A;  1YLZ A;  2EXA A;  1E3U A;  4R0Q A;  1PW8 A;  4R23 A;  1K54 C;  4LEN A;  4IVI A;  3BEC A;  4QY5 A;  1HVB A;  3Q1F A;  4E3I A;  3G4P A;  3PBR A;  3ZVT A;  2HP6 A;  2X02 A;  1PWC A;  1ONG A;  3WS0 A;  5A92 A;  5KSC A;  4PM8 A;  3VOY A;  5HL1 A;  1MWS A;  4KZ5 A;  5DF8 A;  3ZGA B;  1DJC A;  5AQB A;  5CEB A;  4OLG A;  2HDR A;  3VFH A;  3WRZ A;  5EVI A;  2ZQ7 A;  3UNW A;  4EBP A;  4KG5 A;  2A3U A;  5EOO A;  5F83 A;  3PTE A;  4IED A;  4WEJ A;  3CG5 A;  4S2J A;  4OKP A;  1FSW A;  5GHX A;  2ZM2 A;  4K0X A;  1YLW A;  1DJA A;  1ES4 A;  4OP5 A;  4P6B A;  4BD0 A;  4MLL A;  4WM9 A;  2JE5 A;  1K6S A;  4LV2 A;  4ZDX A;  4XUZ A;  2Y2M A;  4JXW A;  4CJN A;  5CHJ A;  5F82 A;  3HUO A;  3OPL A;  2Q9N A;  3N8R A;  5CRF A;  3ZFZ A;  4OQH A;  4R3B A;  3CMZ A;  4LV0 A;  1NJ4 A;  2ZC5 B;  5KSH A;  3MZE A;  4N9L A;  3N8S A;  4GDB A;  4GDN A;  3E2K A;  1WYC A;  4ZJ3 A;  1Y54 A;  3ZNY A;  1BTL A;  1K57 A;  1MKI A;  5HFO A;  4C3Q A;  1OME A;  4X53 A;  4IBX A;  3W4O A;  2Y2G A;  4E6X A;  3M2K A;  1JWP A;  3UE3 A;  4X6T A;  3VMA A;  3UO9 A;  3D4F A;  1LHY A;  1K4F A;  2V1Z A;  2WAD A;  3WS2 A;  3IXB A;  3VP4 A;  1MY8 A;  3NY4 A;  4MNR A;  3C4P A;  3M2J A;  3Q81 A;  3ZDJ A;  4QJG A;  1NRF A;  4WBG A;  4JKT A;  3SOI A;  1W8Q A;  1RCJ A;  1ZKJ A;  3FZC A;  4P0M A;  5GLD A;  1S0W A;  5DTK A;  3VFF A;  1QMF A;  1H5X A;  1YMS A;  3VSK A;  2XD1 A;  3HUN A;  3V3S A;  2Y55 A;  3JYI A;  4BEN A;  5CTN A;  3UPN A;  2X01 A;  4JXG A;  4UA6 A;  1ESU A;  2EX8 A;  1K54 A;  4R4R A;  4E3M A;  3HLB A;  5D3O A;  1VQQ A;  5CHU A;  2RL3 A;  4N9K A;  5FQM A;  2IWC A;  4BL3 A;  4R1G A;  3A3F A;  2PU4 A;  4S2O A;  4OOL A;  1PZP A;  4B4X A;  4E3K A;  5EE8 A;  3UDI A;  1NY0 A;  3MXR A;  3NCK A;  4P85 A;  2ZQA A;  3WWX A;  4PM5 A;  4LCL A;  5FAP A;  5TFQ A;  4MBK A;  5CGW A;  3WS1 A;  2B5R A;  3FWL A;  3B3X A;  5GLC A;  2R9X A;  3GR2 A;  3IXD A;  4GZB A;  4IBR A;  5AQ7 A;  2JBF A;  3IH9 A;  1KDS A;  5U47 A;  4EQI A;  3OPP A;  1O7E A;  2P74 A;  3W4P A;  3AGE A;  1L0E A;  3E2L A;  1BLP A;  2ZLY A;  5EEC A;  3WS4 A;  4D2O A;  3EQU A;  1ES3 A;  3SH8 A;  2Z2M B;  3N7W A;  3S1Y A;  2QPN A;  1J9M A;  3LCE A;  5FQK A;  1CEG A;  1HTZ A;  1WYB A;  3AGD A;  4FD8 A;  2WK0 A;  2ZC3 B;  3C7U A;  3MZD A;  4OH0 A;  3IXH A;  3P98 A;  4WEL A;  3RXW A;  3Q7V B;  4GKU A;  2CC1 A;  1GHM A;  4K91 A;  5CXW A;  5FQ9 A;  2HP9 A;  3HVF A;  4RA7 A;  5FA7 A;  1PW1 A;  4U0T A;  2PBY A;  3HLF A;  5FI6 A;  5HAP A;  4BQM A;  2Y59 A;  4N92 A;  3S22 A;  4WMC D;  3NDG A;  2OLU A;  4M3K A;  2E8I A;  1U60 A;  4HEF A;  3FKW A;  1ZC2 A;  3UPO A;  4KQQ A;  4KZ6 A;  3HL9 A;  4Q8I A;  1MWT A;  5A90 A;  1BSG A;  2XR0 A;  1LI9 A;  1PI5 A;  1SHV A;  2C6W B;  2WZX A;  1W7F A;  2DNS A;  2H0Y A;  3LEZ A;  1KE3 A;  3C5A A;  1BUL A;  1TDG A;  2H0T A;  4JPM A;  3IXG A;  4QHC A;  4U3T A;  2ZC7 A;  1FCM A;  3IF6 B;  1W5D A;  1KE0 A;  1BT5 A;  3IF5 A;  2G2U A;  3LY3 A;  3HRE A;  4HBT A;  3ZG0 A;  4C6Y A;  5BOH A;  1IEL A;  4LV1 A;  4N1X A;  3MZF A;  5KMW A;  3RJU A;  1K55 C;  2V2F F;  3OCL A;  3V50 A;  2IWB A;  1DJB A;  3MKE A;  5E2H A;  1NYY A;  5TGF A;  3HUM A;  4KZB A;  3A3J A;  2XH9 A;  3BM6 A;  3OPH A;  4KQR A;  2ZD8 A;  3G35 A;  4Y0T A;  3TSG A;  2Y2O A;  1K38 A;  2EXB A;  3BFE A;  3Q07 A;  2QZ6 A;  3VOZ A;  1NZO A;  5KZH A;  1S6R A;  4GB7 A;  1FQG A;  4C75 A;  1AXB A;  5HAI A;  4DXC A;  4WZ4 A;  5DF9 A;  1DY6 A;  2H5S A;  3DW0 A;  1YLJ A;  5EPH A;  3BRM A;  3NBL A;  4KZ4 A;  1BLC A;  3GV9 A;  4L0L A;  1KVM A;  3GTC A;  2BG1 A;  3I7J A;  3RXX A;  1K6R A;  4OOM A;  3NC8 A;  4S2P A;  3BFG A;  3O3V A;  1SDE A;  4ZBE A;  4WEK A;  2X71 A;  4LV3 A;  3A3D A;  4FSF A;  1ZG6 A;  2HP5 A;  3OPR A;  3A3E A;  3IWI A;  3SH9 A;  2ZJ9 A;  3MFD A;  4S2L A;  2WAE A;  2P9V B;  2DCF A;  2WGW A;  4S2M A;  4S2K A;  3HBR A;  4ID4 A;  4UHU A;  5FI2 A;  1ALQ A;  1W8Y A;  3PAG A;  4JF4 A;  1JWZ A;  5JYP A;  1K56 D;  5FAO A;  3BLS A;  1CK3 A;  2J7V A;  1Q2Q A;  4GD8 A;  4OOY A;  1JWV A;  2R9W A;  3PBN A;  5I94 A;  3ZCZ A;  4ZJ2 A;  3MKF A;  1MXO A;  5G18 A;  3G30 A;  1XX2 A;  1GA9 A;  4U0X A;  1FR6 A;  1IKI A;  1M6K A;  5HX9 A;  3G31 A;  1WE4 A;  5E2G A;  4Z9Q A;  3V3R A;  1VM1 A;  3DWZ A;  1L0F A;  5CTM A;  1YM1 A;  1H8Z A;  1N9B A;  5FAT A;  2RCX A;  3SH7 A;  1YQS A;  1XGJ A;  3VP3 A;  1HZO A;  5E43 A;  5DVA A;  1SDN A;  3BFC A;  1SCW A;  1K55 A;  3HLC A;  1G68 A;  1N4O A;  3PBS A;  1K4E A;  4PPR A;  3UY6 A;  3G2Y A;  4A5R A;  3WRT A;  4KZ3 A;  5J8X A;  3ITB A;  4ZJ1 A;  5FI7 A;  3TOI A;  2VGJ A;  3FV7 A;  1IYO A;  4B4Z A;  1Q2P A;  1O07 A;  3QNB A;  1L0G A;  2ZQ9 A;  1ES5 A;  5FQQ A;  4DRT A;  3VP0 A;  3CJM A;  1W79 A;  3HLW A;  1ZG4 A;  3NIA A;  3VP2 A;  3WS5 A;  3ZG7 B;  2OV5 A;  1JVJ A;  3HLE A;  1PI4 A;  4FH2 A;  2Q9M A;  3UDX A;  4EWF A;  2PU2 A;  4X55 A;  1PZO A;  2C5W B;  5IHV A;  4PMA A;  1E25 A;  3HLG A;  2OLV A;  2WKI A;  4RX2 A;  2WZZ A;  1IYP A;  2Y4A A;  2XFT A;  4KEN B;  3IWQ A;  4MBF A;  2UWX A;  2HDQ A;  2QMI A;  1XKZ A;  2ZMA A;  4MBH A;  4OPR A;  4Y0O A;  4DE1 A;  3FYZ A;  4E3L A;  4DDY A;  3GMW A;  1G6A A;  4KZ8 A;  3HLD A;  4BL2 A;  2Y2K A;  1IEM A;  3EQV A;  4GD6 A;  5FDH A;  1LL5 A;  1E3U D;  4E6W A;  4EBN A;  1I2W A;  5EVI B;  3C4O A;  1RGZ A;  5FSR A;  1KE4 A;  4BD1 A;  2EX6 A;  2XD5 A;  1RGY A;  4DKI A;  5GLB A;  3IH8 A;  3LY4 A;  3DWK A;  2EX2 A;  4JF5 A;  4KZA A;  4XXR A;  2DRW A;  5A91 A;  5HAR A;  5HW3 A;  2HPB A;  3GSG A;  3GVB A;  5GLA A;  2HDU A;  3QNC A;  5EVI D;  1PIO A;  1NZU A;  3GQZ A;  4YFM A;  1LL9 A;  1YT4 A;  4RX3 A;  3VSL A;  4DE3 A;  3ZVW A;  1YLT A;  2Y2P A;  4DE2 A;  2J9P A;  3AGF A;  1JTD A;  3ZG8 B;  1C3B A;  2HDS A;  3C7V A;  2J9O A;  4DXB A;  1EWZ A;  2WKE A;  4B88 A;  2I72 A;  2WKH A;  3IWO A;  3W4Q A;  1ONH A;  5DTS A;  1FSY A;  2ZQD A;  4S2N C;  3N8L A;  1L2S A;  5HAQ A;  3FKV A;  1EI5 A;  4PM7 A;  1RP5 A;  4OQI A;  3N6I A;  5EOE A;  2WAF A;  2Y91 A;  4WYY A;  2GDN A;  2IWD A;  2XK1 A;  4R3J A;  2BLS A;  4N1H A;  3UN7 A;  3BFF A;  4X56 A;  4WMC A;  1NYM A;  3IHA A;  3N4I A;  3IT9 A;  3UDF A;  2Z2L B;  2JC7 A;  4KG2 A;  3S4X A;  3ZG9 B;  4H8R A;  5F1G A;  2Y2Q A;  3Q7V A;  5M1A A;  4HES A;  1KGF A;  4RVA A;  1H8Y A;  2ZQC A;  1FOF A;  1YLP A;  1KGG A;  1CEF A;  5AQA A;  1MBL A;  4DF6 A;  2WGI A;  5A93 A;  1GA0 A;  2WGV A;  4OVD A;  1LLB A;  5FQI A;  3Q7Z A;  4ZAM A;  3O86 A;  4R4S A;  3BLM A;  4E3O A;  5CED A;  1YLY A;  3M6B A;  3PBO A;  3UE1 A;  4LCM A;  1NXY A;  1KVL A;  3IF6 A;  3V39 A;  1BZA A;  1ERO A;  3SS3 A;  1XA7 A;  3O88 A;  4P87 A;  4OPZ A;  3UE0 A;  4PM6 A;  5E2F A;  4DDS A;  2VGK A;  4JBF A;  1ES2 A;  3OCN A;  4E3J A;  2ZM8 A;  3BFD A;  1XXM A;  5TR7 A;  1ESI A;  2XLN A;  1I5Q A;  1CI9 A;  4JXS A;  4OLD A;  3ITA A;  5M19 A;  5FAS A;  3V5M A;  2Y2N A;  4WZ5 A;  1IKG A;  3G2Z A;  1E4D A;  5M18 A;  5GHY A;  1BLS A;  2OSU A;  3PAE A;  1MPL A;  5FQJ A;  4FCF A;  3ISG A;  3IHB A;  5DTT A;  4KQO A;  4KZ7 A;  1BLH A;  3TG9 A;  5EUA A;  4OQG A;  4YIN A;  5F1F A;  2XDM A;  2Y2J A;  2WUQ A;  2J8Y A;  4S2N A;  4CPK A;  3Q82 A;  4QB8 A;  1YMX A;  2ZM0 A;  5E2E A;  4NK3 A;  4OPY A;  5EVL A;  1BUE A;  5GL9 A;  3PBT A;  4BLM A;  3QHY A;  4JXV A;  4BJP A;  4XUX A;  2XFS A;  4UA9 A;  5CEC A;  1K56 A;  2EX9 A;  3BEB A;  1MWU A;  4E3N A;  3W8K A;  3M6H A;  5EVI C;  4DE0 A;  2FFF B;  3OZH A;  3PBQ A;  3P09 A;  1MWR A;  1XA1 A;  2P9V A;  1GHI A;  2WYX A;  2Y2L A;  4X68 A;  3ZNT A;  1KGE A;  1TVF A;  4QU3 A;  3ZHH A;  1IYQ A;  4FH4 A;  4GNU A;  3LO7 A;  2V20 A;  2Y2I A;  4OPQ A;  4S2I A;  4X69 A;  2XEP A;  1I2S A;  1ERM A;  1PWG A;  2FFY A;  4UA7 A;  2EFX A;  3IQA A;  5CGS A;  5DF7 A;  4ZTK A;  2JCH A;  2ZC6 B;  3IF6 C;  4K0W A;  1LI0 A;  2XGN A;  4KZ9 A;  3ZG5 A;  4QY6 A;  3MBZ A;  1Z6F A;  5FAQ A;  4JF6 A;  1IYS A;  1QME A;  3VP1 A;  5L2F A;  1TEM A;  2A49 A;  3G32 A;  2H10 A;  4QD4 A;  3DTM A;  4EUZ A;  4KG6 A;  4JLF A;  3NI9 A;  1FCN A;  1K57 C;  3O87 A;  4F94 A;  5GHZ A;  5CER A;  3GRJ A;  3A3I A;  4OQ0 A;  4NET A;  1FR1 A;  2EFU A;  1ERQ A;  1FCO A;  3NDE A;  4EBL A;  2ZQ8 A;  4WZ5 C;  4Y0U A;  3BYD A;  2Y2H A;  4IVK A;  4O7D A;  1KDW A;  1M40 A;  1HD8 A;  1XPB A;  4GN2 A;  4RYE A;  5AQ9 A;  1PWD A;  1GHP A;  3SS4 A;  5CHM A;  1JTG A;  1XGI A;  3MXS A;  3OC2 A;  3SS5 A;  5JYO A;  1CI8 A;  1K25 A;  3CZD A;  5CGX A;  4UAA A;  1L0D A;  4Y7P A;  2G2W A;  2XF3 A;  4GOG A;  1XP4 A;  3UPP A;  1TDL A;  2WGW B;  4OON A;  4EV4 A;  4MEZ A;  4PM9 A;  2XQZ A;  1GCE A;  3G34 A;  1SKF A; 
#chains in the Genus database with same CATH topology
 2ZC4 B;  4EQ1 A;  1DP9 A;  1Z09 A;  2EXA A;  1PW8 A;  4NXE A;  4LEN A;  4IVI A;  4QY5 A;  4O01 A;  4E3I A;  3Q1F A;  4L9G A;  3G4P A;  1ONG A;  5KSC A;  4PKY A;  2O9A A;  1DJC A;  5CEB A;  4OLG A;  3WRZ A;  5A8B A;  2J3W A;  3PTE A;  1VET A;  4K0X A;  1YLW A;  4KQD A;  3T4K A;  2JE5 A;  1K6S A;  3HUO A;  2Q9N A;  3EEH A;  4OQH A;  4EEU A;  4DJ3 A;  3MZE A;  3F1P A;  4GDB A;  4GDN A;  4F3L A;  4LFU A;  4ZJ3 A;  5HFO A;  1OME A;  1LSV A;  4IBX A;  3W4O A;  2Y2G A;  5FEG A;  4PHT A;  3VMA A;  2M7V A;  3UO9 A;  2WAD A;  2GX5 A;  2JKT I;  3NY4 A;  1NRF A;  1UWN X;  4X25 A;  1RCJ A;  5DTK A;  5IU1 A;  2J3T D;  3JYI A;  4R70 A;  1D1J A;  4JXG A;  5HWT A;  1VEU B;  5HDD A;  2RL3 A;  4BL3 A;  5TJJ A;  4R1G A;  3A3F A;  4B4X A;  1XJ3 A;  5EE8 A;  2A2L A;  2INW A;  3WWX A;  4P6Z S;  2JKG A;  4MBK A;  5CGW A;  1NLY A;  5GLC A;  3GR2 A;  2EWV A;  3D9Y A;  3T4J A;  4GZB A;  5AQ7 A;  4CQH A;  5U47 A;  1O7E A;  4D2O A;  3E2L A;  2VKS A;  1BLP A;  5EEC A;  3R7W A;  1SZV A;  1ES3 A;  2VV7 A;  2VLG A;  4WL9 A;  1WYB A;  4I3A A;  2W3G A;  3VOL A;  3C7U A;  4OH0 A;  4WEL A;  5AJG A;  1P9R A;  2VGL S;  1Y28 A;  5HD3 A;  1F98 A;  4BQM A;  4N92 A;  2KDK A;  4HJ3 A;  1U60 A;  2O9B A;  3UPO A;  5L8M A;  1OTE A;  2XR0 A;  3LIC A;  1PI5 A;  1SHV A;  2C6W B;  1YSQ A;  1TDG A;  4CLC E;  3IF6 B;  1BT5 A;  3LY3 A;  3ZG0 A;  4C6Y A;  4M4X A;  4GHI B;  4ESP A;  1KOU A;  3C2W A;  3MKE A;  5TGF A;  3T4S A;  3BM6 A;  3OPH A;  1H0M A;  2LB9 A;  2EXB A;  3VOZ A;  1NZO A;  1S6R A;  4GB7 A;  1AXB A;  3DW0 A;  1YLJ A;  3BRM A;  1BLC A;  1OT6 A;  2PD8 A;  2XRO A;  2BG1 A;  3I7J A;  4OOM A;  3HCY A;  3DTK A;  3OPR A;  3KYZ A;  5I5L A;  3MFD A;  2WGW A;  1CK3 A;  2PT7 A;  4I3J A;  1SKO B;  4OOY A;  5HD5 A;  1GSV A;  5K5B A;  4L9F A;  4GS9 B;  5G18 A;  3G30 A;  1GA9 A;  5F6A A;  5HX9 A;  2RCX A;  1YQS A;  5DVA A;  1N9L A;  3B42 A;  1G68 A;  1S66 L;  5HDS A;  3CUE A;  4PAU A;  2VGJ A;  3FV7 A;  3QNB A;  2ZMV A;  2ZQ9 A;  4DRT A;  1PFL A;  1S1Z A;  3NIA A;  3HLE A;  4FH2 A;  2PYR A;  4EWF A;  2PU2 A;  4X55 A;  2WKI A;  4RX2 A;  1TS0 A;  2WZZ A;  2Y4A A;  2XFT A;  4FOF A;  1Y4O A;  2ZMF A;  3E0Y A;  2QMI A;  3UB6 A;  4OPR A;  1G6A A;  3C30 A;  4BL2 A;  2Y2K A;  3EQV A;  4GD6 A;  5FDH A;  2A24 A;  4E6W A;  1I2W A;  2OAP 1;  3LIA A;  3NUL A;  1RGZ A;  4DKI A;  4H6J A;  3DWK A;  2EX2 A;  5HAR A;  5GLA A;  2PHY A;  1YT4 A;  4LRY C;  4DE3 A;  1YLT A;  2Y2P A;  4F3L B;  3TE8 A;  1PNE A;  2Z6C A;  3KSF A;  2WKE A;  3T50 A;  2I72 A;  2WKH A;  2ZQD A;  3N8L A;  1L2S A;  2Y8H A;  2R78 A;  2WAF A;  2Y91 A;  4WYY A;  4LGW A;  2IWD A;  2XK1 A;  4N1H A;  4X56 A;  3IT9 A;  2Z2L B;  2JC7 A;  4GJ4 A;  4ARZ A;  3RH8 B;  4RQ9 A;  1H8Y A;  4CLC A;  1STZ A;  1CEF A;  3KX0 X;  4DF6 A;  2WGV A;  5IS1 A;  3FG8 A;  4ZAM A;  4R4S A;  5KIZ A;  1YLY A;  1CJF A;  2Z6D A;  3UE1 A;  4LCM A;  4WUJ A;  4GCZ A;  3O88 A;  4DDS A;  3R7W B;  4JBF A;  3LR3 A;  3G6O A;  2ZM8 A;  1ESI A;  4NG2 A;  1A0K A;  3CHW P;  2XLN A;  1S4S A;  2YKH A;  2XRN A;  2Y2N A;  3QP1 A;  1E4D A;  3CIT A;  2OSU A;  5GHY A;  2M7U A;  1MPL A;  4MCW A;  5FQJ A;  2K7S A;  3JVU A;  3E4P A;  4KZ7 A;  1BLH A;  2XDM A;  3LUQ A;  1J3W A;  4CPK A;  4I5S A;  2FZ0 A;  5E2E A;  1TS6 A;  5FL3 A;  4BLM A;  3QHY A;  3F1O A;  3BEB A;  1MWU A;  4E3N A;  3E4O A;  3M6H A;  4DE0 A;  3P09 A;  3ZNT A;  3NEC A;  4QU3 A;  3ZHH A;  4FH4 A;  2O99 A;  4S2I A;  1WA9 A;  2WKR A;  2XEP A;  3ZQ5 A;  2FFY A;  4UA7 A;  3IQA A;  2M1C A;  3MMH A;  4K0W A;  3ZG5 A;  3MBZ A;  1TEM A;  4QD4 A;  4DMZ A;  4EUZ A;  1N9N A;  2V0W A;  1D06 A;  3O87 A;  5CER A;  3BQ8 A;  1T18 A;  3NDE A;  4EBL A;  3BYD A;  5HWV A;  3QP5 A;  4IVK A;  1KDW A;  3CPT A;  3OC2 A;  3MXS A;  3H82 A;  5JYO A;  5CGX A;  1L0D A;  2XF3 A;  1XP4 A;  2WGW B;  4OON A;  1F5M A;  3OLO A;  1YLZ A;  1E3U A;  4R0Q A;  1X0O A;  4AFI A;  1HVB A;  1P9W A;  2W27 A;  2X02 A;  3S7N A;  4I38 A;  5A92 A;  4QPR A;  2HDR A;  5EVE A;  3VFH A;  1ZHH B;  3W2Z A;  2ZQ7 A;  3UNW A;  2A3U A;  3E98 A;  4IED A;  2QJ7 A;  2V1A A;  4MLL A;  1S1Y A;  2Y2M A;  4CJN A;  5CHJ A;  4UEY A;  2B95 A;  5HPI A;  2KLI A;  4R3B A;  1NJ4 A;  5KSH A;  3LIB A;  1T1C A;  4HHD A;  4X53 A;  3M2K A;  4P6Z M;  1JWP A;  3QP8 A;  3S7O A;  4X6T A;  2ZL1 A;  3D4F A;  2A24 B;  2VX8 A;  1K4F A;  5FDS A;  4UQI S;  1MY8 A;  4QJG A;  3Q81 A;  4WBG A;  3SOI A;  3FC7 A;  1ZKJ A;  3FZC A;  4H6J B;  3VFF A;  3CI6 A;  3VSK A;  2XD1 A;  2Y55 A;  2V9A A;  2X01 A;  1K54 A;  4R4R A;  1ZTU A;  1VQQ A;  2VGL M;  4N9K A;  5FQM A;  2IWC A;  3P7N A;  4OOL A;  4E3K A;  4HP9 A;  3FPV A;  3MXR A;  3UB9 A;  4P85 A;  4BBU A;  2K2N A;  3LFV A;  2R9X A;  4HP4 A;  5TBM A;  3W4P A;  3WS4 A;  3SH8 A;  3KYQ A;  3S1Y A;  1J9M A;  2QPN A;  2VZW A;  3JPU A;  3S7P A;  4ARZ B;  4BBT A;  1GHM A;  5DFY A;  4CLC B;  5CXW A;  2HP9 A;  1OJ5 A;  1PW1 A;  2Y59 A;  3GEC A;  3JVV A;  5G4Y A;  1ODV A;  3FKW A;  3KSI A;  3BW6 A;  3HL9 A;  5G4Z A;  1LI9 A;  2WZX A;  1KE3 A;  3C5A A;  2H0T A;  4U3T A;  4JPM A;  4QHC A;  2ZC7 A;  2D02 A;  3IF5 A;  4HI4 A;  4G3K A;  2G2U A;  1IEL A;  4N1X A;  2EA9 A;  2V2F F;  3V50 A;  2IWB A;  1DJB A;  3A3J A;  2Q0O A;  3LI8 A;  3G35 A;  4Y0T A;  3NOT C;  1K38 A;  3Q07 A;  4HOI A;  1OTA A;  4JGR A;  5KZH A;  4DXC A;  1FQG A;  5HAI A;  4WZ4 A;  1DY6 A;  5EPH A;  4KZ4 A;  1LSX A;  1KVM A;  1TD5 A;  4WN5 A;  5EV0 A;  1EW0 A;  3BQA A;  3NC8 A;  4S2P A;  2P7J A;  3F1O B;  3UB7 A;  4S2L A;  5DFX A;  4ID4 A;  3C8C A;  4HH3 A;  2HJ9 C;  1K56 D;  5FAO A;  2J7V A;  2EWW A;  5I94 A;  3ZCZ A;  3PHY A;  4MDZ A;  3MKF A;  1XX2 A;  3DAV A;  4U0X A;  3G31 A;  5F68 A;  5E2G A;  4Z9Q A;  1VM1 A;  3DWZ A;  1YM1 A;  4Z1W A;  1FIK A;  1XGJ A;  3VP3 A;  1HZO A;  5E43 A;  1SCW A;  3UB5 P;  1K55 A;  2NUT C;  3HLC A;  3PBS A;  4PPR A;  3G2Y A;  4G3V A;  4X1L A;  3ITB A;  3H82 B;  5FI7 A;  4ZJ1 A;  4MN7 A;  1IYO A;  1O07 A;  2PD7 A;  3LIE A;  3VP0 A;  3CJM A;  4NXF A;  3TJZ C;  3WS5 A;  4NEE D;  3LR5 A;  5IHV A;  4PMA A;  1P0Z A;  3HLG A;  3EGX C;  1IYP A;  2UWX A;  2HDQ A;  2ZMA A;  1XKZ A;  3NOP C;  4E3L A;  3U2A A;  2QWS A;  1IEM A;  5AVF A;  5FEF A;  5FSR A;  2EX6 A;  2VA0 A;  3IH8 A;  2W1T A;  3LY4 A;  4O0P A;  4XXR A;  2DRW A;  5A91 A;  3PYP A;  3MR0 A;  2HDU A;  1TF1 A;  3QNC A;  2O0Y A;  4YOF A;  4YFM A;  1T19 A;  4IHQ A;  4RX3 A;  3ZVW A;  3V67 A;  2J9P A;  3D3O A;  3AGF A;  3ZG8 B;  1C3B A;  2GNX A;  3C7V A;  1XJ6 A;  3IWO A;  3OBF A;  3W4Q A;  1ONH A;  5DTS A;  2ZL1 B;  4IUK A;  4JGO A;  3FKV A;  1RP5 A;  3N6I A;  5EOE A;  4R3J A;  3UN7 A;  2PR6 A;  4WMC A;  1NYM A;  3N4I A;  4NXG A;  4FTX A;  4H8R A;  5HL6 A;  5F1G A;  2Y2Q A;  1KGF A;  2ZQC A;  3LID A;  1YLP A;  1KGG A;  1K0K A;  1DP8 A;  1MBL A;  5A93 A;  1GA0 A;  2JN7 A;  2JKR M;  2KX6 A;  4NKP A;  1NXY A;  5TBM B;  1BZA A;  1ERO A;  3UE0 A;  1OPX A;  2UV0 E;  3OCN A;  4EET B;  3GDI A;  3BFD A;  2PR5 A;  3T1X A;  4JXS A;  3ITA A;  5M19 A;  4B93 A;  4WZ5 A;  2D01 A;  2BTF P;  2XA7 M;  4PKY G;  5DKL A;  4EEP A;  4KQO A;  5EUA A;  3QP6 A;  4OQG A;  4YIN A;  3LI9 A;  3RFB A;  2Y2J A;  4S2N A;  2ZOI A;  1XFQ A;  1GSW A;  3PBT A;  4JXV A;  4Y17 A;  2EX9 A;  5F5Y A;  2FFF B;  1MWR A;  1XA1 A;  2P9V A;  2WYX A;  4EU0 A;  5HSQ A;  4GNU A;  3LIF A;  2OAQ 1;  3H7W A;  1ERM A;  4ZTK A;  2JCH A;  2ZC6 B;  3IF6 C;  1LI0 A;  2XGN A;  4QY6 A;  1VET B;  5FAQ A;  3VP1 A;  5L2F A;  3SZT A;  3SW1 A;  3DTM A;  1FCN A;  5GHZ A;  3GRJ A;  4ZRR A;  1ERQ A;  2JHE A;  1F2K A;  1XPB A;  3DBA A;  3F1P B;  1JTG A;  3SS5 A;  1CI8 A;  3CZD A;  4GOG A;  4LPZ A;  5HDC A;  3TW8 A;  2ACG A;  3EEA A;  4MEZ A;  2V1B A;  3KO6 A;  3G34 A;  3LEQ A;  1SKF A;  1PYY A;  4OP8 A;  1K54 C;  2FH5 A;  3BEC A;  1H3Q A;  2AVX A;  3PBR A;  3WS0 A;  4PM8 A;  5HL1 A;  4HH2 A;  1MWS A;  4KZ5 A;  5DF8 A;  3F1N A;  5EVI A;  3A0S A;  3UB8 A;  5F83 A;  4UQI M;  4WEJ A;  3PXP A;  4S2J A;  4OKP A;  2ZM2 A;  3NOU C;  1DJA A;  1ES4 A;  4BD0 A;  4P6B A;  2HJE A;  4WM9 A;  4LV2 A;  3CLO A;  4ZDX A;  4JXW A;  2BAS A;  3ICY A;  3OPL A;  5CRF A;  3ZFZ A;  1AWI A;  4XT2 A;  3CMZ A;  2ZC5 B;  4N9L A;  5L09 A;  1V9Y A;  3N8S A;  2KOI A;  1Y54 A;  3ZNY A;  1K57 A;  4C3Q A;  3RTY A;  1P97 A;  3K3D A;  3EWK A;  5AVE A;  1JNU A;  1ACF A;  3WS2 A;  3VP4 A;  4Q0J A;  3ZDJ A;  2HV1 A;  2B18 A;  3T4T A;  4P0M A;  2W1T B;  4IJG A;  2PDR A;  3V3S A;  3HUN A;  4BEN A;  5CTN A;  2I9V A;  4UA6 A;  2E8J A;  1ESU A;  5DKK A;  3MJQ A;  4E3M A;  5D3O A;  5CHU A;  1OJG A;  3DTE A;  1PZP A;  4HJ6 A;  4G3W A;  1NY0 A;  3LYX A;  2L0W A;  2PYP A;  3MS6 A;  1V9Z A;  2ZQA A;  5FAP A;  3WS1 A;  2B5R A;  3FWL A;  3B3X A;  5C5K A;  4IBR A;  2JBF A;  2P74 A;  4R6L A;  3AGE A;  1L0E A;  3E4Q A;  4Y3I A;  2QHK A;  3EQU A;  2Z2M B;  3N7W A;  4YNR A;  3LCE A;  5FQK A;  3MQQ A;  1HTZ A;  1DRM A;  4FD8 A;  3UMD A;  2ZC3 B;  4IUH A;  3CWF A;  3IXH A;  3P98 A;  3RXW A;  4L9E A;  4GKU A;  3LR0 A;  5FQ9 A;  4RA7 A;  1G6O A;  4GLQ A;  2PBY A;  4LRX C;  5FI6 A;  5HAP A;  3S22 A;  3NDG A;  1L3L A;  4M3K A;  1DP6 A;  2E8I A;  3MQ0 A;  1ZC2 A;  4KQQ A;  4JGQ A;  4Q8I A;  1MWT A;  1BSG A;  4CLC D;  4E3J A;  2H0Y A;  1W7F A;  2DNS A;  4JGP A;  1BUL A;  3NHQ A;  1FCM A;  4HBT A;  1W5D A;  3HRE A;  3P01 A;  5DJU A;  4LV1 A;  1YSP A;  3MZF A;  5KMW A;  3RJU A;  1K55 C;  3OCL A;  5E2H A;  1NYY A;  1N9O A;  4KZB A;  1UGU A;  4KQR A;  2ZD8 A;  3TSG A;  2Y2O A;  2QZ6 A;  1OTD A;  2V8C A;  3NBL A;  3GV9 A;  4L0L A;  3T1S A;  1NRJ A;  1PRQ A;  1XFN A;  4B9O A;  2W0N A;  1UWP X;  3MF0 A;  3A0V A;  3BFG A;  3O3V A;  4ZBE A;  4HQA A;  4WEK A;  4LV3 A;  2HP5 A;  3IWI A;  3SH9 A;  3T4L A;  2ZJ9 A;  2V8F A;  2WAE A;  2P9V B;  2DCF A;  2LB5 A;  4S2K A;  3IX3 A;  1W8Y A;  3PAG A;  2XSS A;  4JF4 A;  1JWZ A;  2P08 A;  4ZJ2 A;  1FR6 A;  1M6K A;  1WE4 A;  1L0F A;  3BY9 A;  5FAT A;  3T4Q A;  2JKF A;  5DJT A;  3SH7 A;  1N4O A;  1K4E A;  1GSX A;  2ZOH A;  1TS8 A;  1S67 L;  2Y79 A;  5J8X A;  2L4R A;  3TOI A;  4B4Z A;  1Q2P A;  1ES5 A;  5FQQ A;  4E04 A;  2ZBB A;  2O9C A;  1W79 A;  4X1M A;  1ZG4 A;  2OV5 A;  2Q9M A;  3UDX A;  1E25 A;  2VK3 A;  2OLV A;  4MBF A;  4MBH A;  4DE1 A;  5HZH A;  3FYZ A;  3VE3 A;  1E3U D;  3F1N B;  5EVI B;  2V0U A;  1SKO A;  1KE4 A;  2XD5 A;  4GS9 A;  4JF5 A;  2W3E A;  3EOI A;  3T4O A;  1LL9 A;  4DE2 A;  4HJ4 A;  1W63 Q;  4ME4 A;  1JTD A;  2B02 A;  2J9O A;  4DXB A;  4B88 A;  3CUE C;  4S2N C;  2WKQ A;  1NWZ A;  3IHA A;  3UDF A;  1NLZ A;  3T12 B;  4DN0 A;  3Q7V A;  5M1A A;  4HES A;  2VV6 A;  1S4R A;  5AQA A;  2WGI A;  5FQI A;  4E3O A;  2GJ3 A;  3H9W A;  3M6B A;  3PBO A;  1KVL A;  3V39 A;  2VJW A;  5E2F A;  1CQA A;  4EW7 A;  1ES2 A;  5TR7 A;  3HJK A;  1I5Q A;  1CI9 A;  5IT5 A;  3IBR A;  1IKG A;  2G7U A;  2L1M A;  3K2N A;  5M18 A;  1BLS A;  3PAE A;  5DTT A;  3KYE A;  3CPT B;  2J8Y A;  1OTB A;  3Q82 A;  5F69 A;  1YMX A;  4NK3 A;  4OPY A;  3IBJ A;  1BUE A;  5GL9 A;  3MXQ A;  3DTI A;  4BJP A;  4XUX A;  4UA9 A;  1YKD A;  5CEC A;  4R3A A;  1OTI A;  4CLC C;  3T1Q B;  5EVI C;  3FPW A;  3PBQ A;  2Y2L A;  1GHI A;  4X68 A;  1KGE A;  1TVF A;  3A0R A;  3ZYT A;  3LO7 A;  4X69 A;  4OPQ A;  2JKR I;  5MC7 A;  2EFX A;  5DF7 A;  1H8M A;  1Z6F A;  4JF6 A;  2A49 A;  3G32 A;  2PBD P;  4KG6 A;  3TRC A;  1K57 C;  2VV8 A;  3A3I A;  4NET A;  1FR1 A;  2EFU A;  1FCO A;  1MKM A;  2Y2H A;  4EER A;  4O7D A;  1HD8 A;  2DMW A;  3B33 A;  1YPR A;  3SS4 A;  5CHM A;  1XGI A;  3MFX A;  4Y7P A;  2G2W A;  1IOU A;  1YAX A;  4HY8 A;  4EV4 A;  3O5Y A;  2XQZ A;  1GCE A;  4BMW A;  4DDY A;  4HBU A;  2JKT M;  4R23 A;  2OWJ A;  3ZVT A;  2PRF A;  2HP6 A;  1PWC A;  1XJ4 A;  3C38 A;  2HGV A;  3VOY A;  5HPF A;  3D72 A;  4EES A;  3ZGA B;  1HLU P;  5AQB A;  2HZ5 A;  3ULF A;  3LGO A;  4EBP A;  4KG5 A;  5EOO A;  2W1R A;  3CG5 A;  5GHX A;  1FSW A;  1FIL A;  3EGD C;  5L07 A;  4XUZ A;  4KUK A;  1VHM A;  5F82 A;  3N8R A;  2OOL A;  4LV0 A;  3KSG A;  3E2K A;  1WYC A;  1BTL A;  1MKI A;  4E6X A;  2OWH A;  2K31 A;  3UE3 A;  4KUO A;  4R38 A;  1LHY A;  4QWO A;  4ETX A;  2V1Z A;  4Q0H A;  1IFQ A;  3IXB A;  4MNR A;  3C4P A;  3M2J A;  4JKT A;  1W8Q A;  2W3D A;  5GLD A;  1S0W A;  1QMF A;  1H5X A;  1YMS A;  3UPN A;  3HJI A;  2EX8 A;  3IS2 A;  5EM0 A;  3PR6 A;  3HLB A;  3L7H A;  2PU4 A;  4S2O A;  3UDI A;  2J80 A;  1OT9 A;  4Y15 A;  3NCK A;  4PM5 A;  2HF6 A;  4LCL A;  5TFQ A;  3IXD A;  1XJ2 A;  3IH9 A;  1KDS A;  4EQI A;  3OPP A;  2ZLY A;  4MN6 A;  3BJN A;  1CEG A;  3AGD A;  2P04 A;  2WK0 A;  3MZD A;  2MJ6 A;  1W63 M;  3Q7V B;  2CC1 A;  4K91 A;  2IA2 A;  3HVF A;  5FA7 A;  4U0T A;  3HLF A;  4II7 A;  4ETZ A;  4WMC D;  2OLU A;  3LR4 A;  4HEF A;  5EM1 A;  3VV4 A;  4KZ6 A;  5A90 A;  4OP5 A;  3LEZ A;  3IXG A;  3L9K A;  2NUP C;  1KE0 A;  5BOH A;  4WF0 A;  3HUM A;  4EXO A;  1TS7 A;  2XH9 A;  3UME A;  3BFE A;  4C75 A;  5DF9 A;  2H5S A;  1F9I A;  1CF0 A;  3GTC A;  5HWW A;  3RXX A;  1K6R A;  1SDE A;  5J7E A;  2X71 A;  3A3D A;  4FSF A;  1ZG6 A;  2J3T C;  3B47 A;  3A3E A;  3BWL A;  2WKP A;  4S2M A;  3HBR A;  4UHU A;  5FI2 A;  1ALQ A;  3NJA A;  5JYP A;  3S7Q A;  3BLS A;  3T1R A;  1Q2Q A;  1G28 A;  4GD8 A;  4I39 A;  1JWV A;  2R9W A;  3PBN A;  4Y2F A;  4EUV A;  1MXO A;  5L10 A;  2CMN A;  1IKI A;  3V3R A;  5CTM A;  1H8Z A;  1N9B A;  4BWI A;  1SDN A;  3BFC A;  3MQO A;  3UY6 A;  4A5R A;  3WRT A;  4KZ3 A;  1L0G A;  3HLW A;  3VP2 A;  3ZG7 B;  3UE6 A;  1JVJ A;  1PI4 A;  4HIA A;  1PZO A;  2C5W B;  3VE4 A;  4DJ2 A;  4KEN B;  3IWQ A;  4Y0O A;  3GMW A;  4KZ8 A;  3HLD A;  1LL5 A;  4EBN A;  2W3F A;  5CX7 A;  3U4L P;  3C4O A;  3CAX A;  2XA7 S;  4BD1 A;  1RGY A;  4D60 A;  5GLB A;  3KSH A;  4KZA A;  5HW3 A;  2HPB A;  3GSG A;  3GVB A;  5EVI D;  1VEU A;  1PIO A;  1NZU A;  3GQZ A;  4O8G A;  4GW9 A;  3VSL A;  4BBV A;  3QP4 A;  4I3I A;  2YKF A;  2HDS A;  2QKP A;  1EWZ A;  1G5U A;  1FSY A;  4HNB A;  5HAQ A;  3MSH A;  1EI5 A;  4PM7 A;  4OQI A;  2GDN A;  2BLS A;  2PAV P;  3BFF A;  5LBR A;  1T1B A;  3ZG9 B;  4KG2 A;  3S4X A;  3IX8 A;  4RVA A;  4NXB A;  3IS2 B;  1FOF A;  4K08 A;  3R4K A;  4Q0I A;  1LSW A;  2QYB A;  4OVD A;  1LLB A;  3Q7Z A;  3O86 A;  3BLM A;  5CED A;  3H7W B;  4FUW A;  3IF6 A;  3SS3 A;  1D7E A;  1XA7 A;  4P87 A;  2W3H A;  4OPZ A;  4PM6 A;  3K3C A;  4GHI A;  4Y13 A;  2VGK A;  2GZA A;  1LT0 A;  4LRZ E;  1XXM A;  1LL8 A;  4MMN A;  4Y5F A;  4OLD A;  2VEA A;  5FAS A;  3V5M A;  3IX4 A;  1VB6 A;  3G2Z A;  4FCF A;  3ISG A;  3IHB A;  3TG9 A;  5F1F A;  2WUQ A;  5J4E A;  4QB8 A;  3QP2 A;  3OOV A;  2ZM0 A;  5EVL A;  2XFS A;  1K56 A;  3W8K A;  3OZH A;  3BY8 A;  4LLO B;  1IYQ A;  2V20 A;  2Y2I A;  5J3W A;  1I2S A;  1PWG A;  1BYW A;  5CGS A;  1T1A A;  2H28 A;  4KZ9 A;  1IYS A;  1QME A;  4MN5 A;  4YWZ A;  2H10 A;  4JLF A;  3NI9 A;  4F94 A;  4OQ0 A;  4XT2 B;  2ZQ8 A;  4WZ5 C;  4Y0U A;  1M40 A;  4GN2 A;  5AQ9 A;  4RYE A;  1MZU A;  1PWD A;  1GHP A;  5EFW A;  2QJ5 A;  1K25 A;  1MC0 A;  4UAA A;  3UPP A;  1TDL A;  4WLA A;  4PM9 A; 
#chains in the Genus database with same CATH homology
 4HBU A;  2ZC4 B;  1PYY A;  4OP8 A;  1YLZ A;  2EXA A;  1E3U A;  4R0Q A;  1PW8 A;  4R23 A;  1K54 C;  4LEN A;  4IVI A;  3BEC A;  4QY5 A;  1HVB A;  3Q1F A;  4E3I A;  3G4P A;  3PBR A;  3ZVT A;  2HP6 A;  2X02 A;  1PWC A;  1ONG A;  3WS0 A;  5A92 A;  5KSC A;  4PM8 A;  3VOY A;  5HL1 A;  1MWS A;  4KZ5 A;  5DF8 A;  3ZGA B;  1DJC A;  5AQB A;  5CEB A;  4OLG A;  2HDR A;  3VFH A;  3WRZ A;  5EVI A;  2ZQ7 A;  3UNW A;  4EBP A;  4KG5 A;  2A3U A;  5EOO A;  5F83 A;  3PTE A;  4IED A;  4WEJ A;  3CG5 A;  4S2J A;  4OKP A;  1FSW A;  5GHX A;  2ZM2 A;  4K0X A;  1YLW A;  1DJA A;  1ES4 A;  4OP5 A;  4P6B A;  4BD0 A;  4MLL A;  4WM9 A;  2JE5 A;  1K6S A;  4LV2 A;  4ZDX A;  4XUZ A;  2Y2M A;  4JXW A;  4CJN A;  5CHJ A;  5F82 A;  3HUO A;  3OPL A;  2Q9N A;  3N8R A;  5CRF A;  3ZFZ A;  4OQH A;  4R3B A;  3CMZ A;  4LV0 A;  1NJ4 A;  2ZC5 B;  5KSH A;  3MZE A;  4N9L A;  3N8S A;  4GDB A;  4GDN A;  3E2K A;  1WYC A;  4ZJ3 A;  1Y54 A;  3ZNY A;  1BTL A;  1K57 A;  1MKI A;  5HFO A;  4C3Q A;  1OME A;  4X53 A;  4IBX A;  3W4O A;  2Y2G A;  4E6X A;  3M2K A;  1JWP A;  3UE3 A;  4X6T A;  3VMA A;  3UO9 A;  3D4F A;  1LHY A;  1K4F A;  2V1Z A;  2WAD A;  3WS2 A;  3IXB A;  3VP4 A;  1MY8 A;  3NY4 A;  4MNR A;  3C4P A;  3M2J A;  3Q81 A;  3ZDJ A;  4QJG A;  1NRF A;  4WBG A;  4JKT A;  3SOI A;  1W8Q A;  1RCJ A;  1ZKJ A;  3FZC A;  4P0M A;  5GLD A;  1S0W A;  5DTK A;  3VFF A;  1QMF A;  1H5X A;  1YMS A;  3VSK A;  2XD1 A;  3HUN A;  3V3S A;  2Y55 A;  3JYI A;  4BEN A;  5CTN A;  3UPN A;  2X01 A;  4JXG A;  4UA6 A;  1ESU A;  2EX8 A;  1K54 A;  4R4R A;  4E3M A;  3HLB A;  5D3O A;  1VQQ A;  5CHU A;  2RL3 A;  4N9K A;  5FQM A;  2IWC A;  4BL3 A;  4R1G A;  3A3F A;  2PU4 A;  4S2O A;  4OOL A;  1PZP A;  4B4X A;  4E3K A;  5EE8 A;  3UDI A;  1NY0 A;  3MXR A;  3NCK A;  4P85 A;  2ZQA A;  3WWX A;  4PM5 A;  4LCL A;  5FAP A;  5TFQ A;  4MBK A;  5CGW A;  3WS1 A;  2B5R A;  3FWL A;  3B3X A;  5GLC A;  2R9X A;  3GR2 A;  3IXD A;  4GZB A;  4IBR A;  5AQ7 A;  2JBF A;  3IH9 A;  1KDS A;  5U47 A;  4EQI A;  3OPP A;  1O7E A;  2P74 A;  3W4P A;  3AGE A;  1L0E A;  3E2L A;  1BLP A;  2ZLY A;  5EEC A;  3WS4 A;  4D2O A;  3EQU A;  1ES3 A;  3SH8 A;  2Z2M B;  3N7W A;  3S1Y A;  2QPN A;  1J9M A;  3LCE A;  5FQK A;  1CEG A;  1HTZ A;  1WYB A;  3AGD A;  4FD8 A;  2WK0 A;  2ZC3 B;  3C7U A;  3MZD A;  4OH0 A;  3IXH A;  3P98 A;  4WEL A;  3RXW A;  3Q7V B;  4GKU A;  2CC1 A;  1GHM A;  4K91 A;  5CXW A;  5FQ9 A;  2HP9 A;  3HVF A;  4RA7 A;  5FA7 A;  1PW1 A;  4U0T A;  2PBY A;  3HLF A;  5FI6 A;  5HAP A;  4BQM A;  2Y59 A;  4N92 A;  3S22 A;  4WMC D;  3NDG A;  2OLU A;  4M3K A;  2E8I A;  1U60 A;  4HEF A;  3FKW A;  1ZC2 A;  3UPO A;  4KQQ A;  4KZ6 A;  3HL9 A;  4Q8I A;  1MWT A;  5A90 A;  1BSG A;  2XR0 A;  1LI9 A;  1PI5 A;  1SHV A;  2C6W B;  2WZX A;  1W7F A;  2DNS A;  2H0Y A;  3LEZ A;  1KE3 A;  3C5A A;  1BUL A;  1TDG A;  2H0T A;  4JPM A;  3IXG A;  4QHC A;  4U3T A;  2ZC7 A;  1FCM A;  3IF6 B;  1W5D A;  1KE0 A;  1BT5 A;  3IF5 A;  2G2U A;  3LY3 A;  3HRE A;  4HBT A;  3ZG0 A;  4C6Y A;  5BOH A;  1IEL A;  4LV1 A;  4N1X A;  3MZF A;  5KMW A;  3RJU A;  1K55 C;  2V2F F;  3OCL A;  3V50 A;  2IWB A;  1DJB A;  3MKE A;  5E2H A;  1NYY A;  5TGF A;  3HUM A;  4KZB A;  3A3J A;  2XH9 A;  3BM6 A;  3OPH A;  4KQR A;  2ZD8 A;  3G35 A;  4Y0T A;  3TSG A;  2Y2O A;  1K38 A;  2EXB A;  3BFE A;  3Q07 A;  2QZ6 A;  3VOZ A;  1NZO A;  5KZH A;  1S6R A;  4GB7 A;  1FQG A;  4C75 A;  1AXB A;  5HAI A;  4DXC A;  4WZ4 A;  5DF9 A;  1DY6 A;  2H5S A;  3DW0 A;  1YLJ A;  5EPH A;  3BRM A;  3NBL A;  4KZ4 A;  1BLC A;  3GV9 A;  4L0L A;  1KVM A;  3GTC A;  2BG1 A;  3I7J A;  3RXX A;  1K6R A;  4OOM A;  3NC8 A;  4S2P A;  3BFG A;  3O3V A;  1SDE A;  4ZBE A;  4WEK A;  2X71 A;  4LV3 A;  3A3D A;  4FSF A;  1ZG6 A;  2HP5 A;  3OPR A;  3A3E A;  3IWI A;  3SH9 A;  2ZJ9 A;  3MFD A;  4S2L A;  2WAE A;  2P9V B;  2DCF A;  2WGW A;  4S2M A;  4S2K A;  3HBR A;  4ID4 A;  4UHU A;  5FI2 A;  1ALQ A;  1W8Y A;  3PAG A;  4JF4 A;  1JWZ A;  5JYP A;  1K56 D;  5FAO A;  3BLS A;  1CK3 A;  2J7V A;  1Q2Q A;  4GD8 A;  4OOY A;  1JWV A;  2R9W A;  3PBN A;  5I94 A;  3ZCZ A;  4ZJ2 A;  3MKF A;  1MXO A;  5G18 A;  3G30 A;  1XX2 A;  1GA9 A;  4U0X A;  1FR6 A;  1IKI A;  1M6K A;  5HX9 A;  3G31 A;  1WE4 A;  5E2G A;  4Z9Q A;  3V3R A;  1VM1 A;  3DWZ A;  1L0F A;  5CTM A;  1YM1 A;  1H8Z A;  1N9B A;  5FAT A;  2RCX A;  3SH7 A;  1YQS A;  1XGJ A;  3VP3 A;  1HZO A;  5E43 A;  5DVA A;  1SDN A;  3BFC A;  1SCW A;  1K55 A;  3HLC A;  1G68 A;  1N4O A;  3PBS A;  1K4E A;  4PPR A;  3UY6 A;  3G2Y A;  4A5R A;  3WRT A;  4KZ3 A;  5J8X A;  3ITB A;  4ZJ1 A;  5FI7 A;  3TOI A;  2VGJ A;  3FV7 A;  1IYO A;  4B4Z A;  1Q2P A;  1O07 A;  3QNB A;  1L0G A;  2ZQ9 A;  1ES5 A;  5FQQ A;  4DRT A;  3VP0 A;  3CJM A;  1W79 A;  3HLW A;  1ZG4 A;  3NIA A;  3VP2 A;  3WS5 A;  3ZG7 B;  2OV5 A;  1JVJ A;  3HLE A;  1PI4 A;  4FH2 A;  2Q9M A;  3UDX A;  4EWF A;  2PU2 A;  4X55 A;  1PZO A;  2C5W B;  5IHV A;  4PMA A;  1E25 A;  3HLG A;  2OLV A;  2WKI A;  4RX2 A;  2WZZ A;  1IYP A;  2Y4A A;  2XFT A;  4KEN B;  3IWQ A;  4MBF A;  2UWX A;  2HDQ A;  2QMI A;  1XKZ A;  2ZMA A;  4MBH A;  4OPR A;  4Y0O A;  4DE1 A;  3FYZ A;  4E3L A;  4DDY A;  3GMW A;  1G6A A;  4KZ8 A;  3HLD A;  4BL2 A;  2Y2K A;  1IEM A;  3EQV A;  4GD6 A;  5FDH A;  1LL5 A;  1E3U D;  4E6W A;  4EBN A;  1I2W A;  5EVI B;  3C4O A;  1RGZ A;  5FSR A;  1KE4 A;  4BD1 A;  2EX6 A;  2XD5 A;  1RGY A;  4DKI A;  5GLB A;  3IH8 A;  3LY4 A;  3DWK A;  2EX2 A;  4JF5 A;  4KZA A;  4XXR A;  2DRW A;  5A91 A;  5HAR A;  5HW3 A;  2HPB A;  3GSG A;  3GVB A;  5GLA A;  2HDU A;  3QNC A;  5EVI D;  1PIO A;  1NZU A;  3GQZ A;  4YFM A;  1LL9 A;  1YT4 A;  4RX3 A;  3VSL A;  4DE3 A;  3ZVW A;  1YLT A;  2Y2P A;  4DE2 A;  2J9P A;  3AGF A;  1JTD A;  3ZG8 B;  1C3B A;  2HDS A;  3C7V A;  2J9O A;  4DXB A;  1EWZ A;  2WKE A;  4B88 A;  2I72 A;  2WKH A;  3IWO A;  3W4Q A;  1ONH A;  5DTS A;  1FSY A;  2ZQD A;  4S2N C;  3N8L A;  1L2S A;  5HAQ A;  3FKV A;  1EI5 A;  4PM7 A;  1RP5 A;  4OQI A;  3N6I A;  5EOE A;  2WAF A;  2Y91 A;  4WYY A;  2GDN A;  2IWD A;  2XK1 A;  4R3J A;  2BLS A;  4N1H A;  3UN7 A;  3BFF A;  4X56 A;  4WMC A;  1NYM A;  3IHA A;  3N4I A;  3IT9 A;  3UDF A;  2Z2L B;  2JC7 A;  4KG2 A;  3S4X A;  3ZG9 B;  4H8R A;  5F1G A;  2Y2Q A;  3Q7V A;  5M1A A;  4HES A;  1KGF A;  4RVA A;  1H8Y A;  2ZQC A;  1FOF A;  1YLP A;  1KGG A;  1CEF A;  5AQA A;  1MBL A;  4DF6 A;  2WGI A;  5A93 A;  1GA0 A;  2WGV A;  4OVD A;  1LLB A;  5FQI A;  3Q7Z A;  4ZAM A;  3O86 A;  4R4S A;  3BLM A;  4E3O A;  5CED A;  1YLY A;  3M6B A;  3PBO A;  3UE1 A;  4LCM A;  1NXY A;  1KVL A;  3IF6 A;  3V39 A;  1BZA A;  1ERO A;  3SS3 A;  1XA7 A;  3O88 A;  4P87 A;  4OPZ A;  3UE0 A;  4PM6 A;  5E2F A;  4DDS A;  2VGK A;  4JBF A;  1ES2 A;  3OCN A;  4E3J A;  2ZM8 A;  3BFD A;  1XXM A;  5TR7 A;  1ESI A;  2XLN A;  1I5Q A;  1CI9 A;  4JXS A;  4OLD A;  3ITA A;  5M19 A;  5FAS A;  3V5M A;  2Y2N A;  4WZ5 A;  1IKG A;  3G2Z A;  1E4D A;  5M18 A;  5GHY A;  1BLS A;  2OSU A;  3PAE A;  1MPL A;  5FQJ A;  4FCF A;  3ISG A;  3IHB A;  5DTT A;  4KQO A;  4KZ7 A;  1BLH A;  3TG9 A;  5EUA A;  4OQG A;  4YIN A;  5F1F A;  2XDM A;  2Y2J A;  2WUQ A;  2J8Y A;  4S2N A;  4CPK A;  3Q82 A;  4QB8 A;  1YMX A;  2ZM0 A;  5E2E A;  4NK3 A;  4OPY A;  5EVL A;  1BUE A;  5GL9 A;  3PBT A;  4BLM A;  3QHY A;  4JXV A;  4BJP A;  4XUX A;  2XFS A;  4UA9 A;  5CEC A;  1K56 A;  2EX9 A;  3BEB A;  1MWU A;  4E3N A;  3W8K A;  3M6H A;  5EVI C;  4DE0 A;  2FFF B;  3OZH A;  3PBQ A;  3P09 A;  1MWR A;  1XA1 A;  2P9V A;  1GHI A;  2WYX A;  2Y2L A;  4X68 A;  3ZNT A;  1KGE A;  1TVF A;  4QU3 A;  3ZHH A;  1IYQ A;  4FH4 A;  4GNU A;  3LO7 A;  2V20 A;  2Y2I A;  4OPQ A;  4S2I A;  4X69 A;  2XEP A;  1I2S A;  1ERM A;  1PWG A;  2FFY A;  4UA7 A;  2EFX A;  3IQA A;  5CGS A;  5DF7 A;  4ZTK A;  2JCH A;  2ZC6 B;  3IF6 C;  4K0W A;  1LI0 A;  2XGN A;  4KZ9 A;  3ZG5 A;  4QY6 A;  3MBZ A;  1Z6F A;  5FAQ A;  4JF6 A;  1IYS A;  1QME A;  3VP1 A;  5L2F A;  1TEM A;  2A49 A;  3G32 A;  2H10 A;  4QD4 A;  3DTM A;  4EUZ A;  4KG6 A;  4JLF A;  3NI9 A;  1FCN A;  1K57 C;  3O87 A;  4F94 A;  5GHZ A;  5CER A;  3GRJ A;  3A3I A;  4OQ0 A;  4NET A;  1FR1 A;  2EFU A;  1ERQ A;  1FCO A;  3NDE A;  4EBL A;  2ZQ8 A;  4WZ5 C;  4Y0U A;  3BYD A;  2Y2H A;  4IVK A;  4O7D A;  1KDW A;  1M40 A;  1HD8 A;  1XPB A;  4GN2 A;  4RYE A;  5AQ9 A;  1PWD A;  1GHP A;  3SS4 A;  5CHM A;  1JTG A;  1XGI A;  3MXS A;  3OC2 A;  3SS5 A;  5JYO A;  1CI8 A;  1K25 A;  3CZD A;  5CGX A;  4UAA A;  1L0D A;  4Y7P A;  2G2W A;  2XF3 A;  4GOG A;  1XP4 A;  3UPP A;  1TDL A;  2WGW B;  4OON A;  4EV4 A;  4MEZ A;  4PM9 A;  2XQZ A;  1GCE A;  3G34 A;  1SKF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...