4ZDXA

Structure of oxa-51 beta-lactamase
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
241
structure length
240
Chain Sequence
SDEKAEKIKNLFNEVHTTGVLVIQQGQTQQSYGNDLARASTEYVPASTFMLNALIGLEHHKATTTEVFKWDGQKRLFPEWEKDMTLGDAMKASAIPVYQDLARRIGLELMSKEVKRVGYGNADIGTQVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSPKVQDEVQSMLFIEEKNGNKIYAKSGWGWDVDPQVGWLTGWVVQPQGNIVAFSLNLEMKKGIPSSVRKEITYKSLEQLGIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Structural Basis for Enhancement of Carbapenemase Activity in the OXA-51 Family of Class D beta-Lactamases.
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Hydrolase
total genus 76
structure length 240
sequence length 241
ec nomenclature
pdb deposition date 2015-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4zdxA00
4E3KA 2DCFA 1E25A 1K6SA 3HLEA 3C5AA 5A91A 1L0EA 4YFMA 2HP6A 5J8XA 2R9WA 4A5RA 2Y4AA 5GL9A 1K57A 3IF6B 3Q7VB 2RCXA 3HL9A 4Y0OA 3MXSA 1W7FA 4OH0A 5GHXA 4M3KA 3IH8A 1FQGA 4PM7A 2WAFA 3MKFA 3ZCZA 4E3OA 3V39A 3HREA 3A3FA 3HLBA 5EVIA 4NK3A 3UPNA 4X68A 1E4DA 4R4SA 1K55A 4KZ6A 4R3JA 2Y2NA 3N7WA 4N92A 1BLCA 2WGVA 4OVDA 4ZJ2A 3UE0A 3OPRA 4S2JA 4PM9A 1U60A 3IWQA 4X55A 4IVIA 2V2FF 3TG9A 3V3SA 3VMAA 4KZ9A 1S6RA 1K54C 3BFEA 3BM6A 4UA6A 4DE3A 2I72A 2J9PA 3ZG0A 3UO9A 3V3RA 1RP5A 1ZG6A 1ES4A 5KZHA 3PBSA 3M6HA 5FAQA 1BLSA 4LV3A 4FSFA 4KZBA 3DWZA 4MBFA 5TR7A 4S2IA 1NY0A 1ONHA 1YLTA 2FFFB 1XPBA 1IYPA 4KZ4A 4Y0TA 1YLPA 2XD5A 1K56A 3HLCA 2VGJA 3IXGA 2CC1A 4RX3A 5AQ7A 4K91A 3VSKA 3LY4A 4S2PA 1WYCA 2ZLYA 1LHYA 1Y54A 3WS5A 1XXMA 3NBLA 1EI5A 1Q2PA 5FATA 1CEFA 1NJ4A 4N9KA 3OZHA 4MBKA 1XGJA 4KENB 1NYMA 2Y59A 1I2SA 3P98A 4MNRA 4E3LA 1GHIA 1FCOA 5DVAA 2XDMA 4R4RA 1ERMA 4GZBA 3NIAA 3IXHA 5CHJA 4LCMA 2EXBA 1YLYA 4C3QA 3B3XA 2PBYA 3A3JA 1HVBA 4PPRA 3N6IA 2A3UA 4FCFA 3MZFA 4EBPA 3W4PA 3VFHA 1XA7A 5HAIA 1FCNA 3UY6A 1XA1A 4BJPA 1RGZA 3PBOA 2ZM8A 3RXWA 1ONGA 3BYDA 4DE1A 1NZUA 3VOZA 5A90A 5GHYA 2EFUA 1NXYA 4DDYA 2Q9MA 2Y2JA 4XUXA 3UDIA 2R9XA 1YLWA 1ES3A 5FSRA 4ZBEA 5IHVA 5CEBA 2ZC4B 4QHCA 2WGWA 4S2NA 1KE4A 2OLVA 2HP5A 5TFQA 3MBZA 3ZVTA 1ESIA 4B88A 5DF9A 1MPLA 4DE2A 1KGEA 2Y2LA 3S1YA 5CGWA 4EWFA 3TOIA 2HDUA 4P0MA 4PM5A 1KGGA 3PAGA 3W4QA 1TVFA 1K57C 4DE0A 4F94A 1BSGA 1XX2A 3WRZA 3RJUA 2Y91A 4KZ7A 4XUZA 2HDQA 2Y2QA 1C3BA 5E2FA 1TDGA 4ZDXA 1IKGA 4KG2A 4LV0A 3O86A 1EWZA 5TGFA 5EVIC 5DTTA 3LCEA 3SOIA 1K55C 4RVAA 4E3MA 4LENA 3HUOA 3ZNYA 3GRJA 2J7VA 4HESA 4ID4A 4JKTA 4X53A 2WYXA 5JYOA 2XEPA 3OPPA 3BFCA 1CK3A 1G6AA 1KVLA 4P87A 2Y2GA 4GOGA 1BLHA 2H0YA 4S2KA 2IWBA 2V1ZA 5EECA 3BFGA 4MBHA 1G68A 3MZEA 4OQ0A 1ES2A 4FH2A 3D4FA 3C7UA 4GDNA 3PBQA 4XXRA 2OLUA 3PTEA 1MXOA 3BLMA 3WS2A 2WAEA 3HLFA 1CI8A 4HBTA 1XP4A 2C6WB 2J9OA 3Q82A 1MBLA 5DTSA 4ZJ1A 1JWZA 3V50A 2G2WA 4ZAMA 3Q1FA 5CRFA 5AQAA 4OOYA 4S2MA 3SS3A 4E3JA 1FR6A 4N9LA 4IBXA 1J9MA 1XGIA 3E2LA 4GN2A 4BL3A 3TSGA 1XKZA 3GVBA 4GNUA 3ZVWA 3W4OA 2P9VB 2J8YA 1JTGA 4EBNA 5HW3A 4EUZA 5AQ9A 3GV9A 3M6BA 3BRMA 2WKEA 4K0WA 3RXXA 1H8ZA 1YMXA 5EUAA 4D2OA 4MLLA 1GA9A 2WUQA 1BULA 1YLJA 1I5QA 4RYEA 1BUEA 4QY6A 5M19A 4HEFA 2Y2KA 5EPHA 3NDGA 3NI9A 5M1AA 2ZC3B 1L0GA 1JWVA 4S2OA 5G18A 4R23A 3UNWA 3N4IA 4QB8A 3G4PA 3IXBA 2XF3A 3IQAA 1NRFA 4S2LA 3IWOA 2EXAA 5EE8A 5EOEA 1LL9A 1DY6A 4U0TA 4WZ4A 2OV5A 2XGNA 1ERQA 1FR1A 2FFYA 4WZ5C 3GQZA 5HAPA 3M2JA 2XH9A 5FQ9A 3ZDJA 3ITAA 5F82A 4CPKA 2WZZA 4E3IA 4LV1A 4QU3A 1PWGA 4DF6A 2XK1A 5A93A 3IF6A 3Q7VA 3OCLA 2Q9NA 1N9BA 3HLGA 3HUMA 4KQQA 4S2NC 3LY3A 3ZGAB 4OOLA 3A3IA 5F83A 5GLDA 2PU2A 4C75A 1JVJA 3IH9A 1W5DA 4JXVA 1YLZA 3OPLA 5CERA 1RCJA 2Y2MA 2E8IA 2GDNA 2Y2HA 4OLGA 5KSCA 4CJNA 1K54A 3ITBA 1BT5A 1MWUA 5F1FA 1WYBA 4FD8A 3GSGA 5DTKA 4E6WA 3ZG5A 1GA0A 1N4OA 1AXBA 4R3BA 2P9VA 5GLBA 4RX2A 4WM9A 5FDHA 3ZFZA 4U3TA 3PBNA 3M2KA 5KSHA 3A3DA 4PMAA 3S4XA 3GTCA 3ZG7B 5KMWA 1LI9A 4UHUA 4BENA 4OPYA 3AGEA 2ZC6B 4UA9A 5M18A 2EX6A 1BTLA 4QJGA 1PI4A 1FSWA 2X01A 1Z6FA 5L2FA 3MZDA 5CECA 4BLMA 4OPQA 4DXCA 3O88A 2WADA 1YM1A 1IYSA 2QZ6A 3SH8A 1GCEA 4GKUA 4KG5A 4DDSA 3SH9A 4Q8IA 5HARA 3QNBA 3G34A 1FCMA 2A49A 2XFSA 1MKIA 1VQQA 5EVIB 3OPHA 4OKPA 1IELA 5CEDA 2ZM2A 3N8SA 2XR0A 1FOFA 1GHMA 2X02A 3FKWA 1RGYA 3CZDA 3QNCA 3Q7ZA 3ZNTA 5GHZA 4PM6A 4U0XA 2H10A 3ZG9B 3PAEA 4K0XA 4OP8A 3W8KA 2V20A 3SS5A 1PW8A 1Q2QA 3IF5A 2ZJ9A 3HLWA 4R1GA 1L2SA 4E6XA 5FQMA 4HBUA 3BLSA 4ZTKA 1CEGA 1ZC2A 5CHUA 1PZOA 2X71A 3FWLA 5F1GA 1PYYA 2EFXA 4IEDA 3JYIA 5HAQA 5I94A 4UA7A 5FQKA 1FSYA 3G31A 1MWTA 1JWPA 2EX8A 2DRWA 2HDSA 4OLDA 4IVKA 4WEKA 5FI6A 3IXDA 3O87A 4OQIA 4R0QA 4LV2A 3VOYA 3AGFA 1CI9A 2DNSA 1TDLA 3IHAA 3BEBA 3G30A 3WS1A 5AQBA 1LI0A 3GMWA 3BFFA 1O7EA 5CTMA 3DW0A 4BD1A 4JLFA 4OONA 2Z2LB 1ZG4A 4UAAA 1WE4A 4GD8A 4FH4A 1YQSA 2G2UA 1PZPA 4KQOA 4C6YA 5BOHA 5FQQA 2XFTA 1IEMA 5EOOA 3UDFA 4YINA 3OC2A 4KG6A 2BG1A 3NDEA 1SDEA 1EROA 2ZMAA 3HVFA 4QD4A 3FKVA 1H5XA 2JE5A 3BECA 2B5RA 3G2YA 4QY5A 4WYYA 3UPOA 4O7DA 3MFDA 4X56A 1SKFA 1K4FA 4DRTA 3EQUA 3IHBA 1ALQA 1E3UD 3IF6C 2ZQDA 5FAOA 3G2ZA 1DJAA 3G32A 2H0TA 2QPNA 4KZAA 2WKHA 1BLPA 1QMFA 5E2GA 1M40A 3PBTA 5D3OA 2HPBA 3WS0A 3HUNA 2HP9A 5DF8A 1HZOA 2Y2IA 4P85A 1L0FA 1W8YA 2XD1A 1HD8A 3VP4A 1YMSA 3ZG8B 2QMIA 4KZ8A 2JBFA 3UN7A 2Y55A 5FQJA 5U47A 4OQHA 2C5WB 2H5SA 1KGFA 1O07A 1K6RA 5FI7A 2ZD8A 3SS4A 2P74A 3AGDA 4N1XA 4GB7A 1NZOA 3IWIA 3IT9A 4PM8A 2WGWB 1LL5A 4WEJA 3I7JA 4N1HA 4OQGA 4OP5A 3SH7A 4E3NA 2UWXA 4Y0UA 4B4XA 3BFDA 1QMEA 2WZXA 3DTMA 1I2WA 5FQIA 3VP3A 4WMCD 3MXRA 4WELA 3NCKA 3CMZA 4IBRA 3WWXA 3UDXA 4OPZA 1K4EA 3C4OA 1H8YA 1SCWA 5FA7A 3S22A 5JYPA 4OPRA 2Z2MB 3MKEA 1MY8A 1KVMA 1BZAA 3UPPA 3CJMA 3GR2A 3C4PA 1ZKJA 3Q07A 5EVLA 1HTZA 1E3UA 3N8LA 3WRTA 4B4ZA 1K25A 4BD0A 4JF5A 3HLDA 2ZQCA 1GHPA 4GD6A 2OSUA 2HDRA 4KZ5A 2JC7A 4X6TA 3E2KA 1PWDA 1S0WA 2ZQ8A 4MEZA 5FAPA 1ES5A 3LEZA 4L0LA 4LCLA 3DWKA 3VP0A 3ZHHA 2ZQ7A 3V5MA 2ZM0A 4JXGA 3LO7A 5HFOA 3NY4A 4P6BA 4EBLA 1M6KA 5A92A 1W8QA 3ISGA 4BL2A 5DF7A 3UE1A 4DKIA 4DXBA 1YT4A 1LLBA 3HBRA 2RL3A 3VP1A 1IYQA 3N8RA 4EQIA 4WZ5A 4JBFA 3C7VA 1PI5A 3EQVA 4Y7PA 5EVID 4JF6A 1KE0A 2JCHA 1W79A 5CXWA 2ZC7A 2ZQ9A 1PIOA 1SDNA 2IWCA 2Y2OA 2IWDA 4GDBA 3UE3A 3WS4A 2BLSA 3NC8A 2WGIA 2WK0A 3VP2A 3G35A 1TEMA 5E2HA 4X69A 5GLCA 1KDSA 3FYZA 5CTNA 3PBRA 5CHMA 5GLAA 1NYYA 2WKIA 2PU4A 4WMCA 4JPMA 2XQZA 4RA7A 5CGSA 3CG5A 5E43A 1JTDA 1KE3A 4BQMA 2ZQAA 1MWSA 1OMEA 2XLNA 5HX9A 1PWCA 1SHVA 3O3VA 1DJCA 2ZC5B 1DJBA 2EX9A 4KQRA 3FV7A 4NETA 4WBGA 3Q81A 4Z9QA 5FASA 4JF4A 1ESUA 1MWRA 4EV4A 3P09A 3VFFA 5HL1A 1KDWA 4ZJ3A 4KZ3A 5E2EA 2EX2A 2Y2PA 3A3EA 4JXWA 4JXSA 1IYOA 2VGKA 5CGXA 1K56D 1K38A 1PW1A 1L0DA 3VSLA 3OCNA 4OOMA 5FI2A 3FZCA 1IKIA 3QHYA 4H8RA 1VM1A
chains in the Genus database with same CATH superfamily
1TS8A 4CLCA 1K6SA 3C5AA 3D72A 2V8CA 3NECA 2Y4AA 3SZTA 5HD3A 2ZMVA 5FL3A 4M3KA 3QP2A 4E3OA 4X68A 1K55A 3MQOA 5FEFA 3PYPA 4PM9A 3TG9A 2VEAA 4IVIA 2V2FF 1XJ4A 3VMAA 1S6RA 2VA0A 3BFEA 3BM6A 4FUWA 3GECA 1OJGA 3UO9A 2PBDP 1ZG6A 3DWZA 2QJ5A 5TR7A 2K31A 2PD7A 1F2KA 1DP6A 1YLPA 5K5BA 5AQ7A 3LR5A 3WS5A 3NBLA 1EI5A 2V8FA 5FATA 1NJ4A 2O99A 4Y17A 2Y59A 4MNRA 1GHIA 1FCOA 4R4RA 1XFNA 3IXHA 2EXBA 3B3XA 3N6IA 4EBPA 4EEPA 3W4PA 1XA7A 5HD5A 5HAIA 4BJPA 3PBOA 2XSSA 1ONGA 1NXYA 2R9XA 4ZBEA 3CAXA 1DP9A 5CEBA 2ZC4B 4S2NA 4B88A 1MPLA 2Y2LA 3W4QA 1K57C 4Y3IA 1XX2A 3KSGA 4KG2A 4YNRA 1EWZA 1F5MA 5TGFA 2ZMFA 4E3MA 3HUOA 3ZNYA 4JKTA 2J7VA 2PR6A 1CK3A 1DP8A 2Y2GA 5HSQA 1G68A 3MZEA 5EFWA 3LR0A 2OLUA 3PTEA 1S4SA 3WS2A 4HBTA 5DJTA 2C6WB 4ZJ1A 3NOTC 3V50A 4ZAMA 3Q1FA 5CRFA 5AQAA 4JGOA 3IS2A 4BL3A 3TSGA 2J8YA 4EBNA 5L07A 3BRMA 1VB6A 3E4OA 2WUQA 1BULA 1I5QA 1HLUP 5M19A 2Y2KA 1YSPA 3UNWA 4S2OA 4EEUA 3N4IA 5EOEA 3U4LP 1F9IA 2B95A 4WZ5C 1NLYA 3M2JA 2XH9A 3UB6A 3ITAA 3VOLA 2XK1A 3UMDA 3MJQA 5HPFA 2Q9NA 1N9BA 3UB8A 4ARZA 3ZGAB 3A3IA 5GLDA 4L9FA 5KIZA 1JVJA 1W5DA 4JXVA 1YLZA 1OT6A 2Y2MA 2E8IA 1K54A 1BT5A 4FD8A 4NXFA 4E6WA 3ZG5A 1GA0A 3CLOA 2P9VA 4O01A 5GLBA 4RX2A 3ZYTA 3ZFZA 3PBNA 3DAVA 2O9BA 5KMWA 4UHUA 4NXGA 4OPYA 3T1XA 2EA9A 3D9YA 1X0OA 5CECA 4OPQA 1YM1A 3IBJA 2Y79A 4KG5A 3G34A 2A49A 2XFSA 3N8SA 2XR0A 2CMNA 3QNCA 4PM6A 4U0XA 3W2ZA 1Q2QA 2VZWA 4IJGA 1D1JA 4LFUA 1CEGA 5F1GA 1PYYA 2EFXA 4IEDA 3JYIA 3PXPA 5A8BA 4HY8A 5AJGA 5IT5A 5AQBA 1NRJA 4BD1A 4OONA 4GD8A 4FH4A 3KO6A 5BOHA 2O9AA 4YINA 2ZMAA 3FKVA 2JE5A 3G2YA 2GNXA 4HP9A 4DRTA 3EQUA 3IHBA 1E3UD 3CUEC 3IF6C 3RTYA 3B42A 4BWIA 2W3FA 5E2GA 2PD8A 1CF0A 3BJNA 3HUNA 4HQAA 1L0FA 1W8YA 2A24B 5EM1A 4MN5A 1HD8A 1MC0A 3ZG8B 2QMIA 5FQJA 1P0ZA 4JGQA 5FI7A 2ZD8A 5IU1A 1N9LA 3IT9A 2WGWB 1LL5A 3B33A 3I7JA 4OP5A 2VKSA 2W1TA 4EESA 2QWSA 2WZXA 3DTMA 1I2WA 5FQIA 3UB5P 5HWWA 1K0KA 3NCKA 3WWXA 3QP6A 3UDXA 1OT9A 1H8YA 1SCWA 2QJ7A 5FA7A 4O0PA 1MY8A 1BZAA 2J3TD 3CJMA 2J80A 3C4PA 3Q07A 5EVLA 1E3UA 3HLDA 1VEUA 4MEZA 4E04A 4L0LA 3VP0A 4ME4A 3T4KA 4EBLA 4I39A 5FDSA 5A92A 3N8RA 5DFYA 3C7VA 1KE0A 2ZC7A 2BASA 3LIDA 3KSIA 5E2HA 5CTNA 3FYZA 3PBRA 3L7HA 4RA7A 2XQZA 4L9EA 4BQMA 4WLAA 2PT7A 1MWSA 2ZQAA 2XLNA 1PWCA 1AWIA 4L9GA 4P6ZM 4KQRA 3FV7A 3Q81A 4JF4A 3P09A 3H7WB 4H6JA 4KZ3A 3EGDC 4HNBA 5C5KA 2VGKA 1XFQA 3VSLA 4KQDA 5FI2A 4P0MA 1IKIA 4IVKA 3GV9A 1UWNX 4WN5A 4E3KA 2DCFA 1E25A 3HLEA 1L0EA 3T1SA 2R9WA 4PKYG 5IS1A 5GL9A 2W1RA 2XRNA 3IF6B 4X1LA 2RCXA 3HL9A 3MXSA 3V67A 4OH0A 5GHXA 4PM7A 3IH8A 3MKFA 2KX6A 3A3FA 2VJWA 3HLBA 1W63M 2B18A 3UPNA 4QPRA 1KOUA 5F6AA 2Y2NA 3CPTB 3UE0A 4S2JA 4X55A 1U60A 1G5UA 3V3SA 3H82A 2INWA 3ZG0A 4CQHA 1P9RA 2V0WA 1ES4A 3PBSA 3M6HA 3HCYA 4LV3A 2W27A 4HP4A 4Z1WA 1YLTA 1XPBA 4KZ4A 4Y0TA 3T4TA 2CC1A 2VV8A 2EWVA 4N9KA 3OZHA 1OTDA 1XGJA 2LB9A 4KENB 1I2SA 1CQAA 3P7NA 4E3LA 5DFXA 4HHDA 3NIAA 3NOPC 4LCMA 1XJ6A 3A3JA 3DTEA 4FCFA 1XA1A 1RGZA 3BYDA 1D7EA 1NZUA 4Y2FA 3C2WA 3VOZA 2EFUA 4DDYA 3UDIA 1YLWA 2D02A 5HL6A 1N9OA 2HP5A 4CLCC 5DF9A 2PHYA 2L1MA 5CGWA 4EU0A 2HDUA 1KGGA 1YKDA 1IOUA 4R3AA 4HI4A 4KUKA 4F94A 2B02A 4XUZA 2HDQA 5E2FA 1C3BA 1TDGA 3O86A 5DTTA 3SOIA 1K55C 2OWJA 4X53A 2WYXA 5JYOA 2XEPA 1G6AA 4HH2A 3LIAA 4P87A 2XROA 2H0YA 2V1ZA 4MBHA 3NULA 3C7UA 4XXRA 4P6ZS 2PAVP 2WAEA 1XP4A 4NXBA 3Q82A 1JWZA 4CLCE 1TF1A 4S2MA 1D06A 3KSFA 4G3WA 1N9NA 2QYBA 3CHWP 4YOFA 4FTXA 2YKHA 5L09A 5TBMA 3M6BA 3OBFA 2WKEA 4K0WA 2MJ6A 5EM0A 3RXXA 1H8ZA 3MR0A 1GA9A 3R7WB 1YLJA 2K7SA 1OJ5A 4QY6A 4HEFA 3NDGA 1JWVA 3GDIA 4R23A 2XF3A 1LL9A 5HWVA 4WZ4A 3DBAA 4NKPA 1FR1A 5FQ9A 2HJEA 5F82A 2WZZA 4DF6A 3O5YA 3Q7VA 2V1BA 3F1OA 4ESPA 3HUMA 4S2NC 1S1YA 3H9WA 4C75A 4F3LB 1RCJA 1MWUA 5DTKA 1N4OA 2Z6DA 4LLOB 5FDHA 4U3TA 3P01A 5CX7A 3S4XA 3GTCA 4BENA 4CLCB 3MF0A 4JGRA 1S66L 1FSWA 1Z6FA 5L2FA 1YPRA 3O88A 1IYSA 2KDKA 3SH8A 3SH9A 3QNBA 1SKOA 2ZM2A 4OLDA 3FKWA 1FOFA 1GHMA 2X02A 3QP5A 3CZDA 4GS9A 3ZNTA 3KYZA 2H10A 2V20A 2ZJ9A 4R1GA 1L2SA 4E6XA 4HJ3A 4HBUA 2JN7A 3BLSA 4ZTKA 1TS7A 2KLIA 5HAQA 5I94A 1FSYA 2HDSA 5FI6A 1VHMA 4OQIA 4R0QA 3VOYA 3IHAA 3G30A 3LUQA 1T1CA 3C8CA 1S1ZA 3GMWA 3BFFA 1WA9A 1O7EA 3DTIA 1PNEA 4NXEA 4UAAA 2HGVA 2G2UA 4C6YA 1IEMA 4KG6A 3NDEA 3HVFA 4G3VA 5HZHA 1H5XA 3MFDA 4X56A 4NEED 3D3OA 2ZQDA 5FAOA 3G2ZA 1DJAA 4LRZE 4KZAA 3T50A 3LI9A 4MMNA 1QMFA 3K2NA 3BQAA 2Y2IA 2XD1A 3VP4A 1YMSA 3BY8A 5L8MA 2JBFA 3UN7A 1KGFA 3FC7A 3SS4A 2P74A 3IWIA 2LB5A 4WEJA 4OQGA 2Y8HA 4D60A 5F5YA 1Y28A 3E0YA 1K4EA 4Y13A 5J4EA 1GSWA 3S22A 4OPRA 2Z2MB 3MKEA 1ZTUA 3UPPA 3BWLA 1K25A 1T18A 4JF5A 4GD6A 2OSUA 1LSWA 2HDRA 4KZ5A 1EW0A 1OTEA 1PWDA 2ZQ8A 4I5SA 5FAPA 1ES5A 2W3GA 3ZHHA 2ZQ7A 2ZM0A 3L9KA 4P6BA 3LR4A 2PYPA 1W8QA 4DXBA 5F1FA 1YT4A 1LLBA 3HBRA 2RL3A 4WZ5A 2WKPA 1PI5A 4QWOA 2M1CA 5EVID 3C38A 2UV0E 2NUTC 1PIOA 2Y2OA 2IWCA 3LIEA 2IWDA 2BLSA 3NC8A 3MSHA 3G35A 3VP2A 4X69A 5GLAA 2QKPA 5CHMA 2JKFA 4UQIM 3CG5A 4MN6A 4EQ1A 1LT0A 1OMEA 4LRYC 3SW1A 1SHVA 3O3VA 1XJ3A 1VETA 4HIAA 4WBGA 1DJBA 4Z9QA 3T1RA 5HL1A 3A3EA 3UB9A 2I9VA 1K56D 1K38A 3QHYA 5F69A 4R70A 2HJ9C 1PFLA 2K2NA 4YFMA 1LL8A 5HDDA 4Y0OA 1S4RA 4I3IA 2WKQA 4II7A 1FQGA 3KYQA 3ZCZA 3V39A 5EVIA 3LGOA 4R4SA 3MQ0A 4R3JA 4OVDA 1BLCA 2WGVA 4B93A 2ZOHA 3LYXA 2P7JA 4XT2A 3JPUA 4KZ9A 2I72A 4IUKA 1RP5A 3K3DA 5HDSA 5FAQA 4KZBA 4HOIA 3T12B 3QP1A 4S2IA 1NY0A 1ONHA 3H7WA 2FFFB 4ZRRA 1IYPA 3C30A 2PRFA 2XD5A 3HLCA 1K56A 3IXGA 2VGJA 4RX3A 3VSKA 5HDCA 1WYCA 2ZLYA 1LHYA 1Y54A 1NWZA 3BQ8A 1Q2PA 3KX0X 1TD5A 2V0UA 2Q0OA 4R38A 1NYMA 3OOVA 3P98A 4RQ9A 2XDMA 1ERMA 4I3JA 5CHJA 5G4ZA 1YLYA 4GJ4A 4AFIA 1HVBA 4PPRA 4EERA 2A3UA 3MZFA 2VGLM 3B47A 3VFHA 1FCNA 3ULFA 2ZM8A 3RXWA 1OTBA 1V9YA 2Q9MA 2Y2JA 4XUXA 2J3TC 1ES3A 4I3AA 1T19A 4QHCA 1KE4A 2GZAA 5F68A 5TFQA 1F98A 5L10A 1ESIA 2PYRA 4DE2A 3S1YA 1BSGA 4MN7A 3RJUA 2Y2QA 4ZDXA 4LV0A 2JKRM 4RVAA 3A0VA 3DTKA 3GRJA 4HESA 4ID4A 3OPPA 3BFCA 2V1AA 2JKTI 4GOGA 4UQIS 5HWTA 1BLHA 4S2KA 2IWBA 5EECA 3BFGA 2EWWA 4FH2A 3D4FA 3PBQA 1MXOA 2L0WA 2W1TB 1CI8A 1P9WA 3VE4A 2J9OA 1MBLA 5DTSA 3FPVA 4OOYA 4E3JA 3UB7A 4N9LA 1XGIA 3E2LA 4GN2A 3GVBA 4GNUA 3ZVWA 1JTGA 5HW3A 3F1PA 3T4SA 5AQ9A 1ODVA 1VEUB 3FG8A 1H3QA 5EUAA 4D2OA 4MLLA 5FEGA 4RYEA 1BUEA 3IX8A 3T4LA 3F1NA 3NI9A 5M1AA 2ZC3B 1L0GA 5HPIA 3G4PA 3IQAA 1NRFA 4S2LA 3IWOA 3TJZC 3NOUC 2EXAA 1DY6A 2XGNA 5HAPA 1Z09A 1YSQA 3ZDJA 4LV1A 4QU3A 1PWGA 4EW7A 1LSXA 3HLGA 4KQQA 4Y15A 5F83A 2PU2A 2W3EA 2HV1A 1G28A 2Y2HA 2GDNA 4I38A 3EWKA 5EV0A 1WYBA 3GSGA 4EETB 3U2AA 1PRQA 5TJJA 4R3BA 3K3CA 4H6JB 4WM9A 5KSHA 3M2KA 3A3DA 4GLQA 3LEQA 1MKMA 5M18A 4FOFA 4BBUA 2ZC6B 4UA9A 2EX6A 1BTLA 2X01A 2VGLS 3VE3A 3HJKA 4BLMA 2QZ6A 4GKUA 4DDSA 5HARA 1MKIA 1VQQA 3EEAA 3OPHA 5CEDA 2W3DA 5GHZA 1NLZA 3ZG9B 4K0XA 3W8KA 1PW8A 3HJIA 3HLWA 3H82B 4EXOA 1ZC2A 5CHUA 2X71A 3FWLA 4UA7A 5FQKA 3G31A 1MWTA 3IXDA 3O87A 3AGFA 1CI9A 2DNSA 3WS1A 4B9OA 5MC7A 1LI0A 5AVFA 3DW0A 1ZG4A 1YQSA 3E4QA 1PZPA 4KQOA 5EOOA 4GHIB 2PDRA 1YAXA 3OC2A 1EROA 4QD4A 2B5RA 1TS0A 3UPOA 2ZL1B 4O7DA 1SKFA 1K4FA 4DJ3A 3G32A 2H0TA 2P08A 2WKHA 3IX3A 1BLPA 1M40A 1P97A 2HPBA 4P85A 2Y55A 5U47A 2C5WB 1O07A 1H8MA 1J3WA 2D01A 3IX4A 4GB7A 1NZOA 4PM8A 2QHKA 3NJAA 4N1HA 2H28A 4E3NA 2UWXA 5DKKA 2M7VA 4Y0UA 4B4XA 1QMEA 3VP3A 4WELA 4OPZA 2WKRA 5LBRA 1DRMA 4JGPA 2W0NA 3CITA 1KVMA 1SZVA 4B4ZA 4BD0A 3WRTA 2ZQCA 2JC7A 3E2KA 1S0WA 4LCLA 1GSXA 2XA7S 3DWKA 5HFOA 3R4KA 1M6KA 5G4YA 3CWFA 4BL2A 3UE1A 4DKIA 4EQIA 2M7UA 4Y7PA 1OPXA 1LSVA 4JF6A 1SDNA 3UE3A 2WK0A 1TEMA 3ZQ5A 1T1AA 4JPMA 4Q0HA 5TBMB 1JTDA 5HX9A 2V9AA 3NHQA 2ZC5B 5FASA 4EV4A 1MWRA 3EOIA 1KDWA 4ZJ3A 2Y2PA 4JXSA 1IYOA 5CGXA 1BYWA 3OCNA 1UGUA 4H8RA 1VM1A 4Q0IA 3TRCA 1ZHHB 5A91A 2HP6A 5J8XA 4A5RA 2Z6CA 1K57A 3Q7VB 3UMEA 4EUVA 3F1OB 1W7FA 2HF6A 2WAFA 3HREA 3BW6A 4NK3A 4BBTA 1E4DA 4KZ6A 3QP8A 3N7WA 4N92A 4ZJ2A 3OPRA 3IWQA 4UEYA 5I5LA 1K54C 4UA6A 2O9CA 4DE3A 1UWPX 2J9PA 2GX5A 2BTFP 3V3RA 3RH8B 1STZA 5KZHA 1BLSA 1S67L 4FSFA 2E8JA 4MBFA 3BY9A 3S7OA 3E4PA 4K91A 1V9ZA 2A2LA 3LY4A 4S2PA 1XXMA 2ZOIA 1SKOB 1CEFA 1A0KA 4MBKA 4GS9B 3T1QB 4BMWA 5DVAA 4GZBA 2L4RA 5EVEA 4C3QA 2PBYA 3UY6A 4PAUA 4WUJA 2A24A 4DE1A 5A90A 5GHYA 2HZ5A 3TE8A 2OWHA 5FSRA 5IHVA 2WGWA 3IS2B 2IA2A 2OLVA 2NUPC 3MBZA 3ZVTA 4ETXA 1KGEA 4DN0A 4X25A 4WF0A 4EWFA 3TOIA 1FIKA 4PM5A 3PAGA 1TVFA 4DE0A 3WRZA 2Y91A 4KZ7A 1IKGA 1T1BA 5EVIC 3LCEA 4WL9A 2FZ0A 4LENA 3EGXC 3MMHA 1KVLA 1H0MA 4OQ0A 1ES2A 3UE6A 3CI6A 4GDNA 4X1MA 5AVEA 2AVXA 4R6LA 3BLMA 4ARZB 3LIBA 4LGWA 3HLFA 2VV7A 2G2WA 2JHEA 3SS3A 1FR6A 3G6OA 4IBXA 1J9MA 1XKZA 3JVUA 3W4OA 2P9VB 4EUZA 3E98A 4O8GA 1YMXA 4IHQA 3PR6A 5EPHA 5G18A 3JVVA 4QB8A 2R78A 3IXBA 4YWZA 5EE8A 4U0TA 2OV5A 2ACGA 2DMWA 1ERQA 1XJ2A 2FFYA 2JKGA 3GQZA 3S7QA 3VV4A 4IUHA 4CPKA 4E3IA 4HJ6A 3QP4A 5A93A 2VK3A 3CUEA 3IF6A 4MDZA 4LPZA 3OCLA 3LY3A 4OOLA 4PKYA 4PHTA 4MCWA 3IH9A 3TW8A 3OPLA 5CERA 5KSCA 3CPTA 4OLGA 4CJNA 2J3WA 3LFVA 3ITBA 1VETB 3T4OA 1W63Q 1AXBA 3KYEA 2P04A 3IBRA 4PMAA 2JKRI 3ZG7B 2ZBBA 3T4JA 1LI9A 3AGEA 4QJGA 1PI4A 4KUOA 3MZDA 4DXCA 2WADA 1OTAA 1GCEA 4Q8IA 3KSHA 1FCMA 4GCZA 5EVIB 4OKPA 1MZUA 1IELA 2O0YA 1RGYA 3Q7ZA 3EEHA 3PAEA 4OP8A 5J3WA 3SS5A 3IF5A 3S7NA 3OLOA 4XT2B 5FQMA 4Y5FA 1G6OA 1Y4OA 1PZOA 2YKFA 4ETZA 1JWPA 2EX8A 2DRWA 4WEKA 4LV2A 1TDLA 3BEBA 5CTMA 3RFBA 4JLFA 2Z2LB 1ACFA 1WE4A 4BBVA 4M4XA 4DMZA 5FQQA 2XFTA 3UDFA 2VX8A 2BG1A 1SDEA 3BECA 2KOIA 4QY5A 4WYYA 1CJFA 3MXQA 4Q0JA 1L3LA 4LRXC 1ALQA 2QPNA 3PBTA 2JKTM 5D3OA 3WS0A 2HP9A 5DF8A 2OAQ1 1HZOA 2W3HA 1GSVA 4KZ8A 4OQHA 2H5SA 1K6RA 1JNUA 3AGDA 4N1XA 3LR3A 2FH5A 2VV6A 3SH7A 3BFDA 4WMCD 3MXRA 3CMZA 4IBRA 2XA7M 4GHIA 3C4OA 2OOLA 5JYPA 3MQQA 4HJ4A 3GR2A 2ZL1A 1ZKJA 4HH3A 1HTZA 3N8LA 1GHPA 1OTIA 2VLGA 3A0RA 4X6TA 3LIFA 3MS6A 3LEZA 3MFXA 4CLCD 4G3KA 3R7WA 3V5MA 4JXGA 3LO7A 3NY4A 3ISGA 3A0SA 4NG2A 5DF7A 3VP1A 1IYQA 5DJUA 4DJ2A 4JBFA 2G7UA 3EQVA 3FPWA 2JCHA 1W79A 5CXWA 2ZQ9A 4GDBA 3WS4A 2WGIA 1IFQA 5GLCA 1KDSA 1NYYA 2WKIA 3LICA 2PU4A 3F1PB 4WMCA 5CGSA 3LI8A 2GJ3A 5E43A 1KE3A 3PHYA 5DKLA 4F3LA 4K08A 3S7PA 1DJCA 2EX9A 4NETA 3T4QA 1FILA 1ESUA 3F1NB 3VFFA 5E2EA 4GW9A 2EX2A 4JXWA 3ICYA 2PR5A 1PW1A 1L0DA 4OOMA 2OAP1 3FZCA 5J7EA 1TS6A
chains in the Genus database with same CATH topology
4E3KA 2DCFA 1E25A 1K6SA 3HLEA 3C5AA 5A91A 1L0EA 4YFMA 2HP6A 5J8XA 2R9WA 4A5RA 2Y4AA 5GL9A 1K57A 3IF6B 3Q7VB 2RCXA 3HL9A 4Y0OA 3MXSA 1W7FA 4OH0A 5GHXA 4M3KA 3IH8A 1FQGA 4PM7A 2WAFA 3MKFA 3ZCZA 4E3OA 3V39A 3HREA 3A3FA 3HLBA 5EVIA 4NK3A 3UPNA 4X68A 1E4DA 4R4SA 1K55A 4KZ6A 4R3JA 2Y2NA 3N7WA 4N92A 1BLCA 2WGVA 4OVDA 4ZJ2A 3UE0A 3OPRA 4S2JA 4PM9A 1U60A 3IWQA 4X55A 4IVIA 2V2FF 3TG9A 3V3SA 3VMAA 4KZ9A 1S6RA 1K54C 3BFEA 3BM6A 4UA6A 4DE3A 2I72A 2J9PA 3ZG0A 3UO9A 3V3RA 1RP5A 1ZG6A 1ES4A 5KZHA 3PBSA 3M6HA 5FAQA 1BLSA 4LV3A 4FSFA 4KZBA 3DWZA 4MBFA 5TR7A 4S2IA 1NY0A 1ONHA 1YLTA 2FFFB 1XPBA 1IYPA 4KZ4A 4Y0TA 1YLPA 2XD5A 1K56A 3HLCA 2VGJA 3IXGA 2CC1A 4RX3A 5AQ7A 4K91A 3VSKA 3LY4A 4S2PA 1WYCA 2ZLYA 1LHYA 1Y54A 3WS5A 1XXMA 3NBLA 1EI5A 1Q2PA 5FATA 1CEFA 1NJ4A 4N9KA 3OZHA 4MBKA 1XGJA 4KENB 1NYMA 2Y59A 1I2SA 3P98A 4MNRA 4E3LA 1GHIA 1FCOA 5DVAA 2XDMA 4R4RA 1ERMA 4GZBA 3NIAA 3IXHA 5CHJA 4LCMA 2EXBA 1YLYA 4C3QA 3B3XA 2PBYA 3A3JA 1HVBA 4PPRA 3N6IA 2A3UA 4FCFA 3MZFA 4EBPA 3W4PA 3VFHA 1XA7A 5HAIA 1FCNA 3UY6A 1XA1A 4BJPA 1RGZA 3PBOA 2ZM8A 3RXWA 1ONGA 3BYDA 4DE1A 1NZUA 3VOZA 5A90A 5GHYA 2EFUA 1NXYA 4DDYA 2Q9MA 2Y2JA 4XUXA 3UDIA 2R9XA 1YLWA 1ES3A 5FSRA 4ZBEA 5IHVA 5CEBA 2ZC4B 4QHCA 2WGWA 4S2NA 1KE4A 2OLVA 2HP5A 5TFQA 3MBZA 3ZVTA 1ESIA 4B88A 5DF9A 1MPLA 4DE2A 1KGEA 2Y2LA 3S1YA 5CGWA 4EWFA 3TOIA 2HDUA 4P0MA 4PM5A 1KGGA 3PAGA 3W4QA 1TVFA 1K57C 4DE0A 4F94A 1BSGA 1XX2A 3WRZA 3RJUA 2Y91A 4KZ7A 4XUZA 2HDQA 2Y2QA 1C3BA 5E2FA 1TDGA 4ZDXA 1IKGA 4KG2A 4LV0A 3O86A 1EWZA 5TGFA 5EVIC 5DTTA 3LCEA 3SOIA 1K55C 4RVAA 4E3MA 4LENA 3HUOA 3ZNYA 3GRJA 2J7VA 4HESA 4ID4A 4JKTA 4X53A 2WYXA 5JYOA 2XEPA 3OPPA 3BFCA 1CK3A 1G6AA 1KVLA 4P87A 2Y2GA 4GOGA 1BLHA 2H0YA 4S2KA 2IWBA 2V1ZA 5EECA 3BFGA 4MBHA 1G68A 3MZEA 4OQ0A 1ES2A 4FH2A 3D4FA 3C7UA 4GDNA 3PBQA 4XXRA 2OLUA 3PTEA 1MXOA 3BLMA 3WS2A 2WAEA 3HLFA 1CI8A 4HBTA 1XP4A 2C6WB 2J9OA 3Q82A 1MBLA 5DTSA 4ZJ1A 1JWZA 3V50A 2G2WA 4ZAMA 3Q1FA 5CRFA 5AQAA 4OOYA 4S2MA 3SS3A 4E3JA 1FR6A 4N9LA 4IBXA 1J9MA 1XGIA 3E2LA 4GN2A 4BL3A 3TSGA 1XKZA 3GVBA 4GNUA 3ZVWA 3W4OA 2P9VB 2J8YA 1JTGA 4EBNA 5HW3A 4EUZA 5AQ9A 3GV9A 3M6BA 3BRMA 2WKEA 4K0WA 3RXXA 1H8ZA 1YMXA 5EUAA 4D2OA 4MLLA 1GA9A 2WUQA 1BULA 1YLJA 1I5QA 4RYEA 1BUEA 4QY6A 5M19A 4HEFA 2Y2KA 5EPHA 3NDGA 3NI9A 5M1AA 2ZC3B 1L0GA 1JWVA 4S2OA 5G18A 4R23A 3UNWA 3N4IA 4QB8A 3G4PA 3IXBA 2XF3A 3IQAA 1NRFA 4S2LA 3IWOA 2EXAA 5EE8A 5EOEA 1LL9A 1DY6A 4U0TA 4WZ4A 2OV5A 2XGNA 1ERQA 1FR1A 2FFYA 4WZ5C 3GQZA 5HAPA 3M2JA 2XH9A 5FQ9A 3ZDJA 3ITAA 5F82A 4CPKA 2WZZA 4E3IA 4LV1A 4QU3A 1PWGA 4DF6A 2XK1A 5A93A 3IF6A 3Q7VA 3OCLA 2Q9NA 1N9BA 3HLGA 3HUMA 4KQQA 4S2NC 3LY3A 3ZGAB 4OOLA 3A3IA 5F83A 5GLDA 2PU2A 4C75A 1JVJA 3IH9A 1W5DA 4JXVA 1YLZA 3OPLA 5CERA 1RCJA 2Y2MA 2E8IA 2GDNA 2Y2HA 4OLGA 5KSCA 4CJNA 1K54A 3ITBA 1BT5A 1MWUA 5F1FA 1WYBA 4FD8A 3GSGA 5DTKA 4E6WA 3ZG5A 1GA0A 1N4OA 1AXBA 4R3BA 2P9VA 5GLBA 4RX2A 4WM9A 5FDHA 3ZFZA 4U3TA 3PBNA 3M2KA 5KSHA 3A3DA 4PMAA 3S4XA 3GTCA 3ZG7B 5KMWA 1LI9A 4UHUA 4BENA 4OPYA 3AGEA 2ZC6B 4UA9A 5M18A 2EX6A 1BTLA 4QJGA 1PI4A 1FSWA 2X01A 1Z6FA 5L2FA 3MZDA 5CECA 4BLMA 4OPQA 4DXCA 3O88A 2WADA 1YM1A 1IYSA 2QZ6A 3SH8A 1GCEA 4GKUA 4KG5A 4DDSA 3SH9A 4Q8IA 5HARA 3QNBA 3G34A 1FCMA 2A49A 2XFSA 1MKIA 1VQQA 5EVIB 3OPHA 4OKPA 1IELA 5CEDA 2ZM2A 3N8SA 2XR0A 1FOFA 1GHMA 2X02A 3FKWA 1RGYA 3CZDA 3QNCA 3Q7ZA 3ZNTA 5GHZA 4PM6A 4U0XA 2H10A 3ZG9B 3PAEA 4K0XA 4OP8A 3W8KA 2V20A 3SS5A 1PW8A 1Q2QA 3IF5A 2ZJ9A 3HLWA 4R1GA 1L2SA 4E6XA 5FQMA 4HBUA 3BLSA 4ZTKA 1CEGA 1ZC2A 5CHUA 1PZOA 2X71A 3FWLA 5F1GA 1PYYA 2EFXA 4IEDA 3JYIA 5HAQA 5I94A 4UA7A 5FQKA 1FSYA 3G31A 1MWTA 1JWPA 2EX8A 2DRWA 2HDSA 4OLDA 4IVKA 4WEKA 5FI6A 3IXDA 3O87A 4OQIA 4R0QA 4LV2A 3VOYA 3AGFA 1CI9A 2DNSA 1TDLA 3IHAA 3BEBA 3G30A 3WS1A 5AQBA 1LI0A 3GMWA 3BFFA 1O7EA 5CTMA 3DW0A 4BD1A 4JLFA 4OONA 2Z2LB 1ZG4A 4UAAA 1WE4A 4GD8A 4FH4A 1YQSA 2G2UA 1PZPA 4KQOA 4C6YA 5BOHA 5FQQA 2XFTA 1IEMA 5EOOA 3UDFA 4YINA 3OC2A 4KG6A 2BG1A 3NDEA 1SDEA 1EROA 2ZMAA 3HVFA 4QD4A 3FKVA 1H5XA 2JE5A 3BECA 2B5RA 3G2YA 4QY5A 4WYYA 3UPOA 4O7DA 3MFDA 4X56A 1SKFA 1K4FA 4DRTA 3EQUA 3IHBA 1ALQA 1E3UD 3IF6C 2ZQDA 5FAOA 3G2ZA 1DJAA 3G32A 2H0TA 2QPNA 4KZAA 2WKHA 1BLPA 1QMFA 5E2GA 1M40A 3PBTA 5D3OA 2HPBA 3WS0A 3HUNA 2HP9A 5DF8A 1HZOA 2Y2IA 4P85A 1L0FA 1W8YA 2XD1A 1HD8A 3VP4A 1YMSA 3ZG8B 2QMIA 4KZ8A 2JBFA 3UN7A 2Y55A 5FQJA 5U47A 4OQHA 2C5WB 2H5SA 1KGFA 1O07A 1K6RA 5FI7A 2ZD8A 3SS4A 2P74A 3AGDA 4N1XA 4GB7A 1NZOA 3IWIA 3IT9A 4PM8A 2WGWB 1LL5A 4WEJA 3I7JA 4N1HA 4OQGA 4OP5A 3SH7A 4E3NA 2UWXA 4Y0UA 4B4XA 3BFDA 1QMEA 2WZXA 3DTMA 1I2WA 5FQIA 3VP3A 4WMCD 3MXRA 4WELA 3NCKA 3CMZA 4IBRA 3WWXA 3UDXA 4OPZA 1K4EA 3C4OA 1H8YA 1SCWA 5FA7A 3S22A 5JYPA 4OPRA 2Z2MB 3MKEA 1MY8A 1KVMA 1BZAA 3UPPA 3CJMA 3GR2A 3C4PA 1ZKJA 3Q07A 5EVLA 1HTZA 1E3UA 3N8LA 3WRTA 4B4ZA 1K25A 4BD0A 4JF5A 3HLDA 2ZQCA 1GHPA 4GD6A 2OSUA 2HDRA 4KZ5A 2JC7A 4X6TA 3E2KA 1PWDA 1S0WA 2ZQ8A 4MEZA 5FAPA 1ES5A 3LEZA 4L0LA 4LCLA 3DWKA 3VP0A 3ZHHA 2ZQ7A 3V5MA 2ZM0A 4JXGA 3LO7A 5HFOA 3NY4A 4P6BA 4EBLA 1M6KA 5A92A 1W8QA 3ISGA 4BL2A 5DF7A 3UE1A 4DKIA 4DXBA 1YT4A 1LLBA 3HBRA 2RL3A 3VP1A 1IYQA 3N8RA 4EQIA 4WZ5A 4JBFA 3C7VA 1PI5A 3EQVA 4Y7PA 5EVID 4JF6A 1KE0A 2JCHA 1W79A 5CXWA 2ZC7A 2ZQ9A 1PIOA 1SDNA 2IWCA 2Y2OA 2IWDA 4GDBA 3UE3A 3WS4A 2BLSA 3NC8A 2WGIA 2WK0A 3VP2A 3G35A 1TEMA 5E2HA 4X69A 5GLCA 1KDSA 3FYZA 5CTNA 3PBRA 5CHMA 5GLAA 1NYYA 2WKIA 2PU4A 4WMCA 4JPMA 2XQZA 4RA7A 5CGSA 3CG5A 5E43A 1JTDA 1KE3A 4BQMA 2ZQAA 1MWSA 1OMEA 2XLNA 5HX9A 1PWCA 1SHVA 3O3VA 1DJCA 2ZC5B 1DJBA 2EX9A 4KQRA 3FV7A 4NETA 4WBGA 3Q81A 4Z9QA 5FASA 4JF4A 1ESUA 1MWRA 4EV4A 3P09A 3VFFA 5HL1A 1KDWA 4ZJ3A 4KZ3A 5E2EA 2EX2A 2Y2PA 3A3EA 4JXWA 4JXSA 1IYOA 2VGKA 5CGXA 1K56D 1K38A 1PW1A 1L0DA 3VSLA 3OCNA 4OOMA 5FI2A 3FZCA 1IKIA 3QHYA 4H8RA 1VM1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E3K A;  2DCF A;  1E25 A;  1K6S A;  3HLE A;  3C5A A;  5A91 A;  1L0E A;  4YFM A;  2HP6 A;  5J8X A;  2R9W A;  4A5R A;  2Y4A A;  5GL9 A;  1K57 A;  3IF6 B;  3Q7V B;  2RCX A;  3HL9 A;  4Y0O A;  3MXS A;  1W7F A;  4OH0 A;  5GHX A;  4M3K A;  3IH8 A;  1FQG A;  4PM7 A;  2WAF A;  3MKF A;  3ZCZ A;  4E3O A;  3V39 A;  3HRE A;  3A3F A;  3HLB A;  5EVI A;  4NK3 A;  3UPN A;  4X68 A;  1E4D A;  4R4S A;  1K55 A;  4KZ6 A;  4R3J A;  2Y2N A;  3N7W A;  4N92 A;  1BLC A;  2WGV A;  4OVD A;  4ZJ2 A;  3UE0 A;  3OPR A;  4S2J A;  4PM9 A;  1U60 A;  3IWQ A;  4X55 A;  4IVI A;  2V2F F;  3TG9 A;  3V3S A;  3VMA A;  4KZ9 A;  1S6R A;  1K54 C;  3BFE A;  3BM6 A;  4UA6 A;  4DE3 A;  2I72 A;  2J9P A;  3ZG0 A;  3UO9 A;  3V3R A;  1RP5 A;  1ZG6 A;  1ES4 A;  5KZH A;  3PBS A;  3M6H A;  5FAQ A;  1BLS A;  4LV3 A;  4FSF A;  4KZB A;  3DWZ A;  4MBF A;  5TR7 A;  4S2I A;  1NY0 A;  1ONH A;  1YLT A;  2FFF B;  1XPB A;  1IYP A;  4KZ4 A;  4Y0T A;  1YLP A;  2XD5 A;  1K56 A;  3HLC A;  2VGJ A;  3IXG A;  2CC1 A;  4RX3 A;  5AQ7 A;  4K91 A;  3VSK A;  3LY4 A;  4S2P A;  1WYC A;  2ZLY A;  1LHY A;  1Y54 A;  3WS5 A;  1XXM A;  3NBL A;  1EI5 A;  1Q2P A;  5FAT A;  1CEF A;  1NJ4 A;  4N9K A;  3OZH A;  4MBK A;  1XGJ A;  4KEN B;  1NYM A;  2Y59 A;  1I2S A;  3P98 A;  4MNR A;  4E3L A;  1GHI A;  1FCO A;  5DVA A;  2XDM A;  4R4R A;  1ERM A;  4GZB A;  3NIA A;  3IXH A;  5CHJ A;  4LCM A;  2EXB A;  1YLY A;  4C3Q A;  3B3X A;  2PBY A;  3A3J A;  1HVB A;  4PPR A;  3N6I A;  2A3U A;  4FCF A;  3MZF A;  4EBP A;  3W4P A;  3VFH A;  1XA7 A;  5HAI A;  1FCN A;  3UY6 A;  1XA1 A;  4BJP A;  1RGZ A;  3PBO A;  2ZM8 A;  3RXW A;  1ONG A;  3BYD A;  4DE1 A;  1NZU A;  3VOZ A;  5A90 A;  5GHY A;  2EFU A;  1NXY A;  4DDY A;  2Q9M A;  2Y2J A;  4XUX A;  3UDI A;  2R9X A;  1YLW A;  1ES3 A;  5FSR A;  4ZBE A;  5IHV A;  5CEB A;  2ZC4 B;  4QHC A;  2WGW A;  4S2N A;  1KE4 A;  2OLV A;  2HP5 A;  5TFQ A;  3MBZ A;  3ZVT A;  1ESI A;  4B88 A;  5DF9 A;  1MPL A;  4DE2 A;  1KGE A;  2Y2L A;  3S1Y A;  5CGW A;  4EWF A;  3TOI A;  2HDU A;  4P0M A;  4PM5 A;  1KGG A;  3PAG A;  3W4Q A;  1TVF A;  1K57 C;  4DE0 A;  4F94 A;  1BSG A;  1XX2 A;  3WRZ A;  3RJU A;  2Y91 A;  4KZ7 A;  4XUZ A;  2HDQ A;  2Y2Q A;  1C3B A;  5E2F A;  1TDG A;  4ZDX A;  1IKG A;  4KG2 A;  4LV0 A;  3O86 A;  1EWZ A;  5TGF A;  5EVI C;  5DTT A;  3LCE A;  3SOI A;  1K55 C;  4RVA A;  4E3M A;  4LEN A;  3HUO A;  3ZNY A;  3GRJ A;  2J7V A;  4HES A;  4ID4 A;  4JKT A;  4X53 A;  2WYX A;  5JYO A;  2XEP A;  3OPP A;  3BFC A;  1CK3 A;  1G6A A;  1KVL A;  4P87 A;  2Y2G A;  4GOG A;  1BLH A;  2H0Y A;  4S2K A;  2IWB A;  2V1Z A;  5EEC A;  3BFG A;  4MBH A;  1G68 A;  3MZE A;  4OQ0 A;  1ES2 A;  4FH2 A;  3D4F A;  3C7U A;  4GDN A;  3PBQ A;  4XXR A;  2OLU A;  3PTE A;  1MXO A;  3BLM A;  3WS2 A;  2WAE A;  3HLF A;  1CI8 A;  4HBT A;  1XP4 A;  2C6W B;  2J9O A;  3Q82 A;  1MBL A;  5DTS A;  4ZJ1 A;  1JWZ A;  3V50 A;  2G2W A;  4ZAM A;  3Q1F A;  5CRF A;  5AQA A;  4OOY A;  4S2M A;  3SS3 A;  4E3J A;  1FR6 A;  4N9L A;  4IBX A;  1J9M A;  1XGI A;  3E2L A;  4GN2 A;  4BL3 A;  3TSG A;  1XKZ A;  3GVB A;  4GNU A;  3ZVW A;  3W4O A;  2P9V B;  2J8Y A;  1JTG A;  4EBN A;  5HW3 A;  4EUZ A;  5AQ9 A;  3GV9 A;  3M6B A;  3BRM A;  2WKE A;  4K0W A;  3RXX A;  1H8Z A;  1YMX A;  5EUA A;  4D2O A;  4MLL A;  1GA9 A;  2WUQ A;  1BUL A;  1YLJ A;  1I5Q A;  4RYE A;  1BUE A;  4QY6 A;  5M19 A;  4HEF A;  2Y2K A;  5EPH A;  3NDG A;  3NI9 A;  5M1A A;  2ZC3 B;  1L0G A;  1JWV A;  4S2O A;  5G18 A;  4R23 A;  3UNW A;  3N4I A;  4QB8 A;  3G4P A;  3IXB A;  2XF3 A;  3IQA A;  1NRF A;  4S2L A;  3IWO A;  2EXA A;  5EE8 A;  5EOE A;  1LL9 A;  1DY6 A;  4U0T A;  4WZ4 A;  2OV5 A;  2XGN A;  1ERQ A;  1FR1 A;  2FFY A;  4WZ5 C;  3GQZ A;  5HAP A;  3M2J A;  2XH9 A;  5FQ9 A;  3ZDJ A;  3ITA A;  5F82 A;  4CPK A;  2WZZ A;  4E3I A;  4LV1 A;  4QU3 A;  1PWG A;  4DF6 A;  2XK1 A;  5A93 A;  3IF6 A;  3Q7V A;  3OCL A;  2Q9N A;  1N9B A;  3HLG A;  3HUM A;  4KQQ A;  4S2N C;  3LY3 A;  3ZGA B;  4OOL A;  3A3I A;  5F83 A;  5GLD A;  2PU2 A;  4C75 A;  1JVJ A;  3IH9 A;  1W5D A;  4JXV A;  1YLZ A;  3OPL A;  5CER A;  1RCJ A;  2Y2M A;  2E8I A;  2GDN A;  2Y2H A;  4OLG A;  5KSC A;  4CJN A;  1K54 A;  3ITB A;  1BT5 A;  1MWU A;  5F1F A;  1WYB A;  4FD8 A;  3GSG A;  5DTK A;  4E6W A;  3ZG5 A;  1GA0 A;  1N4O A;  1AXB A;  4R3B A;  2P9V A;  5GLB A;  4RX2 A;  4WM9 A;  5FDH A;  3ZFZ A;  4U3T A;  3PBN A;  3M2K A;  5KSH A;  3A3D A;  4PMA A;  3S4X A;  3GTC A;  3ZG7 B;  5KMW A;  1LI9 A;  4UHU A;  4BEN A;  4OPY A;  3AGE A;  2ZC6 B;  4UA9 A;  5M18 A;  2EX6 A;  1BTL A;  4QJG A;  1PI4 A;  1FSW A;  2X01 A;  1Z6F A;  5L2F A;  3MZD A;  5CEC A;  4BLM A;  4OPQ A;  4DXC A;  3O88 A;  2WAD A;  1YM1 A;  1IYS A;  2QZ6 A;  3SH8 A;  1GCE A;  4GKU A;  4KG5 A;  4DDS A;  3SH9 A;  4Q8I A;  5HAR A;  3QNB A;  3G34 A;  1FCM A;  2A49 A;  2XFS A;  1MKI A;  1VQQ A;  5EVI B;  3OPH A;  4OKP A;  1IEL A;  5CED A;  2ZM2 A;  3N8S A;  2XR0 A;  1FOF A;  1GHM A;  2X02 A;  3FKW A;  1RGY A;  3CZD A;  3QNC A;  3Q7Z A;  3ZNT A;  5GHZ A;  4PM6 A;  4U0X A;  2H10 A;  3ZG9 B;  3PAE A;  4K0X A;  4OP8 A;  3W8K A;  2V20 A;  3SS5 A;  1PW8 A;  1Q2Q A;  3IF5 A;  2ZJ9 A;  3HLW A;  4R1G A;  1L2S A;  4E6X A;  5FQM A;  4HBU A;  3BLS A;  4ZTK A;  1CEG A;  1ZC2 A;  5CHU A;  1PZO A;  2X71 A;  3FWL A;  5F1G A;  1PYY A;  2EFX A;  4IED A;  3JYI A;  5HAQ A;  5I94 A;  4UA7 A;  5FQK A;  1FSY A;  3G31 A;  1MWT A;  1JWP A;  2EX8 A;  2DRW A;  2HDS A;  4OLD A;  4IVK A;  4WEK A;  5FI6 A;  3IXD A;  3O87 A;  4OQI A;  4R0Q A;  4LV2 A;  3VOY A;  3AGF A;  1CI9 A;  2DNS A;  1TDL A;  3IHA A;  3BEB A;  3G30 A;  3WS1 A;  5AQB A;  1LI0 A;  3GMW A;  3BFF A;  1O7E A;  5CTM A;  3DW0 A;  4BD1 A;  4JLF A;  4OON A;  2Z2L B;  1ZG4 A;  4UAA A;  1WE4 A;  4GD8 A;  4FH4 A;  1YQS A;  2G2U A;  1PZP A;  4KQO A;  4C6Y A;  5BOH A;  5FQQ A;  2XFT A;  1IEM A;  5EOO A;  3UDF A;  4YIN A;  3OC2 A;  4KG6 A;  2BG1 A;  3NDE A;  1SDE A;  1ERO A;  2ZMA A;  3HVF A;  4QD4 A;  3FKV A;  1H5X A;  2JE5 A;  3BEC A;  2B5R A;  3G2Y A;  4QY5 A;  4WYY A;  3UPO A;  4O7D A;  3MFD A;  4X56 A;  1SKF A;  1K4F A;  4DRT A;  3EQU A;  3IHB A;  1ALQ A;  1E3U D;  3IF6 C;  2ZQD A;  5FAO A;  3G2Z A;  1DJA A;  3G32 A;  2H0T A;  2QPN A;  4KZA A;  2WKH A;  1BLP A;  1QMF A;  5E2G A;  1M40 A;  3PBT A;  5D3O A;  2HPB A;  3WS0 A;  3HUN A;  2HP9 A;  5DF8 A;  1HZO A;  2Y2I A;  4P85 A;  1L0F A;  1W8Y A;  2XD1 A;  1HD8 A;  3VP4 A;  1YMS A;  3ZG8 B;  2QMI A;  4KZ8 A;  2JBF A;  3UN7 A;  2Y55 A;  5FQJ A;  5U47 A;  4OQH A;  2C5W B;  2H5S A;  1KGF A;  1O07 A;  1K6R A;  5FI7 A;  2ZD8 A;  3SS4 A;  2P74 A;  3AGD A;  4N1X A;  4GB7 A;  1NZO A;  3IWI A;  3IT9 A;  4PM8 A;  2WGW B;  1LL5 A;  4WEJ A;  3I7J A;  4N1H A;  4OQG A;  4OP5 A;  3SH7 A;  4E3N A;  2UWX A;  4Y0U A;  4B4X A;  3BFD A;  1QME A;  2WZX A;  3DTM A;  1I2W A;  5FQI A;  3VP3 A;  4WMC D;  3MXR A;  4WEL A;  3NCK A;  3CMZ A;  4IBR A;  3WWX A;  3UDX A;  4OPZ A;  1K4E A;  3C4O A;  1H8Y A;  1SCW A;  5FA7 A;  3S22 A;  5JYP A;  4OPR A;  2Z2M B;  3MKE A;  1MY8 A;  1KVM A;  1BZA A;  3UPP A;  3CJM A;  3GR2 A;  3C4P A;  1ZKJ A;  3Q07 A;  5EVL A;  1HTZ A;  1E3U A;  3N8L A;  3WRT A;  4B4Z A;  1K25 A;  4BD0 A;  4JF5 A;  3HLD A;  2ZQC A;  1GHP A;  4GD6 A;  2OSU A;  2HDR A;  4KZ5 A;  2JC7 A;  4X6T A;  3E2K A;  1PWD A;  1S0W A;  2ZQ8 A;  4MEZ A;  5FAP A;  1ES5 A;  3LEZ A;  4L0L A;  4LCL A;  3DWK A;  3VP0 A;  3ZHH A;  2ZQ7 A;  3V5M A;  2ZM0 A;  4JXG A;  3LO7 A;  5HFO A;  3NY4 A;  4P6B A;  4EBL A;  1M6K A;  5A92 A;  1W8Q A;  3ISG A;  4BL2 A;  5DF7 A;  3UE1 A;  4DKI A;  4DXB A;  1YT4 A;  1LLB A;  3HBR A;  2RL3 A;  3VP1 A;  1IYQ A;  3N8R A;  4EQI A;  4WZ5 A;  4JBF A;  3C7V A;  1PI5 A;  3EQV A;  4Y7P A;  5EVI D;  4JF6 A;  1KE0 A;  2JCH A;  1W79 A;  5CXW A;  2ZC7 A;  2ZQ9 A;  1PIO A;  1SDN A;  2IWC A;  2Y2O A;  2IWD A;  4GDB A;  3UE3 A;  3WS4 A;  2BLS A;  3NC8 A;  2WGI A;  2WK0 A;  3VP2 A;  3G35 A;  1TEM A;  5E2H A;  4X69 A;  5GLC A;  1KDS A;  3FYZ A;  5CTN A;  3PBR A;  5CHM A;  5GLA A;  1NYY A;  2WKI A;  2PU4 A;  4WMC A;  4JPM A;  2XQZ A;  4RA7 A;  5CGS A;  3CG5 A;  5E43 A;  1JTD A;  1KE3 A;  4BQM A;  2ZQA A;  1MWS A;  1OME A;  2XLN A;  5HX9 A;  1PWC A;  1SHV A;  3O3V A;  1DJC A;  2ZC5 B;  1DJB A;  2EX9 A;  4KQR A;  3FV7 A;  4NET A;  4WBG A;  3Q81 A;  4Z9Q A;  5FAS A;  4JF4 A;  1ESU A;  1MWR A;  4EV4 A;  3P09 A;  3VFF A;  5HL1 A;  1KDW A;  4ZJ3 A;  4KZ3 A;  5E2E A;  2EX2 A;  2Y2P A;  3A3E A;  4JXW A;  4JXS A;  1IYO A;  2VGK A;  5CGX A;  1K56 D;  1K38 A;  1PW1 A;  1L0D A;  3VSL A;  3OCN A;  4OOM A;  5FI2 A;  3FZC A;  1IKI A;  3QHY A;  4H8R A;  1VM1 A; 
#chains in the Genus database with same CATH topology
 1TS8 A;  4CLC A;  1K6S A;  3C5A A;  3D72 A;  2V8C A;  3NEC A;  2Y4A A;  3SZT A;  5HD3 A;  2ZMV A;  5FL3 A;  4M3K A;  3QP2 A;  4E3O A;  4X68 A;  1K55 A;  3MQO A;  5FEF A;  3PYP A;  4PM9 A;  3TG9 A;  2VEA A;  4IVI A;  2V2F F;  1XJ4 A;  3VMA A;  1S6R A;  2VA0 A;  3BFE A;  3BM6 A;  4FUW A;  3GEC A;  1OJG A;  3UO9 A;  2PBD P;  1ZG6 A;  3DWZ A;  2QJ5 A;  5TR7 A;  2K31 A;  2PD7 A;  1F2K A;  1DP6 A;  1YLP A;  5K5B A;  5AQ7 A;  3LR5 A;  3WS5 A;  3NBL A;  1EI5 A;  2V8F A;  5FAT A;  1NJ4 A;  2O99 A;  4Y17 A;  2Y59 A;  4MNR A;  1GHI A;  1FCO A;  4R4R A;  1XFN A;  3IXH A;  2EXB A;  3B3X A;  3N6I A;  4EBP A;  4EEP A;  3W4P A;  1XA7 A;  5HD5 A;  5HAI A;  4BJP A;  3PBO A;  2XSS A;  1ONG A;  1NXY A;  2R9X A;  4ZBE A;  3CAX A;  1DP9 A;  5CEB A;  2ZC4 B;  4S2N A;  4B88 A;  1MPL A;  2Y2L A;  3W4Q A;  1K57 C;  4Y3I A;  1XX2 A;  3KSG A;  4KG2 A;  4YNR A;  1EWZ A;  1F5M A;  5TGF A;  2ZMF A;  4E3M A;  3HUO A;  3ZNY A;  4JKT A;  2J7V A;  2PR6 A;  1CK3 A;  1DP8 A;  2Y2G A;  5HSQ A;  1G68 A;  3MZE A;  5EFW A;  3LR0 A;  2OLU A;  3PTE A;  1S4S A;  3WS2 A;  4HBT A;  5DJT A;  2C6W B;  4ZJ1 A;  3NOT C;  3V50 A;  4ZAM A;  3Q1F A;  5CRF A;  5AQA A;  4JGO A;  3IS2 A;  4BL3 A;  3TSG A;  2J8Y A;  4EBN A;  5L07 A;  3BRM A;  1VB6 A;  3E4O A;  2WUQ A;  1BUL A;  1I5Q A;  1HLU P;  5M19 A;  2Y2K A;  1YSP A;  3UNW A;  4S2O A;  4EEU A;  3N4I A;  5EOE A;  3U4L P;  1F9I A;  2B95 A;  4WZ5 C;  1NLY A;  3M2J A;  2XH9 A;  3UB6 A;  3ITA A;  3VOL A;  2XK1 A;  3UMD A;  3MJQ A;  5HPF A;  2Q9N A;  1N9B A;  3UB8 A;  4ARZ A;  3ZGA B;  3A3I A;  5GLD A;  4L9F A;  5KIZ A;  1JVJ A;  1W5D A;  4JXV A;  1YLZ A;  1OT6 A;  2Y2M A;  2E8I A;  1K54 A;  1BT5 A;  4FD8 A;  4NXF A;  4E6W A;  3ZG5 A;  1GA0 A;  3CLO A;  2P9V A;  4O01 A;  5GLB A;  4RX2 A;  3ZYT A;  3ZFZ A;  3PBN A;  3DAV A;  2O9B A;  5KMW A;  4UHU A;  4NXG A;  4OPY A;  3T1X A;  2EA9 A;  3D9Y A;  1X0O A;  5CEC A;  4OPQ A;  1YM1 A;  3IBJ A;  2Y79 A;  4KG5 A;  3G34 A;  2A49 A;  2XFS A;  3N8S A;  2XR0 A;  2CMN A;  3QNC A;  4PM6 A;  4U0X A;  3W2Z A;  1Q2Q A;  2VZW A;  4IJG A;  1D1J A;  4LFU A;  1CEG A;  5F1G A;  1PYY A;  2EFX A;  4IED A;  3JYI A;  3PXP A;  5A8B A;  4HY8 A;  5AJG A;  5IT5 A;  5AQB A;  1NRJ A;  4BD1 A;  4OON A;  4GD8 A;  4FH4 A;  3KO6 A;  5BOH A;  2O9A A;  4YIN A;  2ZMA A;  3FKV A;  2JE5 A;  3G2Y A;  2GNX A;  4HP9 A;  4DRT A;  3EQU A;  3IHB A;  1E3U D;  3CUE C;  3IF6 C;  3RTY A;  3B42 A;  4BWI A;  2W3F A;  5E2G A;  2PD8 A;  1CF0 A;  3BJN A;  3HUN A;  4HQA A;  1L0F A;  1W8Y A;  2A24 B;  5EM1 A;  4MN5 A;  1HD8 A;  1MC0 A;  3ZG8 B;  2QMI A;  5FQJ A;  1P0Z A;  4JGQ A;  5FI7 A;  2ZD8 A;  5IU1 A;  1N9L A;  3IT9 A;  2WGW B;  1LL5 A;  3B33 A;  3I7J A;  4OP5 A;  2VKS A;  2W1T A;  4EES A;  2QWS A;  2WZX A;  3DTM A;  1I2W A;  5FQI A;  3UB5 P;  5HWW A;  1K0K A;  3NCK A;  3WWX A;  3QP6 A;  3UDX A;  1OT9 A;  1H8Y A;  1SCW A;  2QJ7 A;  5FA7 A;  4O0P A;  1MY8 A;  1BZA A;  2J3T D;  3CJM A;  2J80 A;  3C4P A;  3Q07 A;  5EVL A;  1E3U A;  3HLD A;  1VEU A;  4MEZ A;  4E04 A;  4L0L A;  3VP0 A;  4ME4 A;  3T4K A;  4EBL A;  4I39 A;  5FDS A;  5A92 A;  3N8R A;  5DFY A;  3C7V A;  1KE0 A;  2ZC7 A;  2BAS A;  3LID A;  3KSI A;  5E2H A;  5CTN A;  3FYZ A;  3PBR A;  3L7H A;  4RA7 A;  2XQZ A;  4L9E A;  4BQM A;  4WLA A;  2PT7 A;  1MWS A;  2ZQA A;  2XLN A;  1PWC A;  1AWI A;  4L9G A;  4P6Z M;  4KQR A;  3FV7 A;  3Q81 A;  4JF4 A;  3P09 A;  3H7W B;  4H6J A;  4KZ3 A;  3EGD C;  4HNB A;  5C5K A;  2VGK A;  1XFQ A;  3VSL A;  4KQD A;  5FI2 A;  4P0M A;  1IKI A;  4IVK A;  3GV9 A;  1UWN X;  4WN5 A;  4E3K A;  2DCF A;  1E25 A;  3HLE A;  1L0E A;  3T1S A;  2R9W A;  4PKY G;  5IS1 A;  5GL9 A;  2W1R A;  2XRN A;  3IF6 B;  4X1L A;  2RCX A;  3HL9 A;  3MXS A;  3V67 A;  4OH0 A;  5GHX A;  4PM7 A;  3IH8 A;  3MKF A;  2KX6 A;  3A3F A;  2VJW A;  3HLB A;  1W63 M;  2B18 A;  3UPN A;  4QPR A;  1KOU A;  5F6A A;  2Y2N A;  3CPT B;  3UE0 A;  4S2J A;  4X55 A;  1U60 A;  1G5U A;  3V3S A;  3H82 A;  2INW A;  3ZG0 A;  4CQH A;  1P9R A;  2V0W A;  1ES4 A;  3PBS A;  3M6H A;  3HCY A;  4LV3 A;  2W27 A;  4HP4 A;  4Z1W A;  1YLT A;  1XPB A;  4KZ4 A;  4Y0T A;  3T4T A;  2CC1 A;  2VV8 A;  2EWV A;  4N9K A;  3OZH A;  1OTD A;  1XGJ A;  2LB9 A;  4KEN B;  1I2S A;  1CQA A;  3P7N A;  4E3L A;  5DFX A;  4HHD A;  3NIA A;  3NOP C;  4LCM A;  1XJ6 A;  3A3J A;  3DTE A;  4FCF A;  1XA1 A;  1RGZ A;  3BYD A;  1D7E A;  1NZU A;  4Y2F A;  3C2W A;  3VOZ A;  2EFU A;  4DDY A;  3UDI A;  1YLW A;  2D02 A;  5HL6 A;  1N9O A;  2HP5 A;  4CLC C;  5DF9 A;  2PHY A;  2L1M A;  5CGW A;  4EU0 A;  2HDU A;  1KGG A;  1YKD A;  1IOU A;  4R3A A;  4HI4 A;  4KUK A;  4F94 A;  2B02 A;  4XUZ A;  2HDQ A;  5E2F A;  1C3B A;  1TDG A;  3O86 A;  5DTT A;  3SOI A;  1K55 C;  2OWJ A;  4X53 A;  2WYX A;  5JYO A;  2XEP A;  1G6A A;  4HH2 A;  3LIA A;  4P87 A;  2XRO A;  2H0Y A;  2V1Z A;  4MBH A;  3NUL A;  3C7U A;  4XXR A;  4P6Z S;  2PAV P;  2WAE A;  1XP4 A;  4NXB A;  3Q82 A;  1JWZ A;  4CLC E;  1TF1 A;  4S2M A;  1D06 A;  3KSF A;  4G3W A;  1N9N A;  2QYB A;  3CHW P;  4YOF A;  4FTX A;  2YKH A;  5L09 A;  5TBM A;  3M6B A;  3OBF A;  2WKE A;  4K0W A;  2MJ6 A;  5EM0 A;  3RXX A;  1H8Z A;  3MR0 A;  1GA9 A;  3R7W B;  1YLJ A;  2K7S A;  1OJ5 A;  4QY6 A;  4HEF A;  3NDG A;  1JWV A;  3GDI A;  4R23 A;  2XF3 A;  1LL9 A;  5HWV A;  4WZ4 A;  3DBA A;  4NKP A;  1FR1 A;  5FQ9 A;  2HJE A;  5F82 A;  2WZZ A;  4DF6 A;  3O5Y A;  3Q7V A;  2V1B A;  3F1O A;  4ESP A;  3HUM A;  4S2N C;  1S1Y A;  3H9W A;  4C75 A;  4F3L B;  1RCJ A;  1MWU A;  5DTK A;  1N4O A;  2Z6D A;  4LLO B;  5FDH A;  4U3T A;  3P01 A;  5CX7 A;  3S4X A;  3GTC A;  4BEN A;  4CLC B;  3MF0 A;  4JGR A;  1S66 L;  1FSW A;  1Z6F A;  5L2F A;  1YPR A;  3O88 A;  1IYS A;  2KDK A;  3SH8 A;  3SH9 A;  3QNB A;  1SKO A;  2ZM2 A;  4OLD A;  3FKW A;  1FOF A;  1GHM A;  2X02 A;  3QP5 A;  3CZD A;  4GS9 A;  3ZNT A;  3KYZ A;  2H10 A;  2V20 A;  2ZJ9 A;  4R1G A;  1L2S A;  4E6X A;  4HJ3 A;  4HBU A;  2JN7 A;  3BLS A;  4ZTK A;  1TS7 A;  2KLI A;  5HAQ A;  5I94 A;  1FSY A;  2HDS A;  5FI6 A;  1VHM A;  4OQI A;  4R0Q A;  3VOY A;  3IHA A;  3G30 A;  3LUQ A;  1T1C A;  3C8C A;  1S1Z A;  3GMW A;  3BFF A;  1WA9 A;  1O7E A;  3DTI A;  1PNE A;  4NXE A;  4UAA A;  2HGV A;  2G2U A;  4C6Y A;  1IEM A;  4KG6 A;  3NDE A;  3HVF A;  4G3V A;  5HZH A;  1H5X A;  3MFD A;  4X56 A;  4NEE D;  3D3O A;  2ZQD A;  5FAO A;  3G2Z A;  1DJA A;  4LRZ E;  4KZA A;  3T50 A;  3LI9 A;  4MMN A;  1QMF A;  3K2N A;  3BQA A;  2Y2I A;  2XD1 A;  3VP4 A;  1YMS A;  3BY8 A;  5L8M A;  2JBF A;  3UN7 A;  1KGF A;  3FC7 A;  3SS4 A;  2P74 A;  3IWI A;  2LB5 A;  4WEJ A;  4OQG A;  2Y8H A;  4D60 A;  5F5Y A;  1Y28 A;  3E0Y A;  1K4E A;  4Y13 A;  5J4E A;  1GSW A;  3S22 A;  4OPR A;  2Z2M B;  3MKE A;  1ZTU A;  3UPP A;  3BWL A;  1K25 A;  1T18 A;  4JF5 A;  4GD6 A;  2OSU A;  1LSW A;  2HDR A;  4KZ5 A;  1EW0 A;  1OTE A;  1PWD A;  2ZQ8 A;  4I5S A;  5FAP A;  1ES5 A;  2W3G A;  3ZHH A;  2ZQ7 A;  2ZM0 A;  3L9K A;  4P6B A;  3LR4 A;  2PYP A;  1W8Q A;  4DXB A;  5F1F A;  1YT4 A;  1LLB A;  3HBR A;  2RL3 A;  4WZ5 A;  2WKP A;  1PI5 A;  4QWO A;  2M1C A;  5EVI D;  3C38 A;  2UV0 E;  2NUT C;  1PIO A;  2Y2O A;  2IWC A;  3LIE A;  2IWD A;  2BLS A;  3NC8 A;  3MSH A;  3G35 A;  3VP2 A;  4X69 A;  5GLA A;  2QKP A;  5CHM A;  2JKF A;  4UQI M;  3CG5 A;  4MN6 A;  4EQ1 A;  1LT0 A;  1OME A;  4LRY C;  3SW1 A;  1SHV A;  3O3V A;  1XJ3 A;  1VET A;  4HIA A;  4WBG A;  1DJB A;  4Z9Q A;  3T1R A;  5HL1 A;  3A3E A;  3UB9 A;  2I9V A;  1K56 D;  1K38 A;  3QHY A;  5F69 A;  4R70 A;  2HJ9 C;  1PFL A;  2K2N A;  4YFM A;  1LL8 A;  5HDD A;  4Y0O A;  1S4R A;  4I3I A;  2WKQ A;  4II7 A;  1FQG A;  3KYQ A;  3ZCZ A;  3V39 A;  5EVI A;  3LGO A;  4R4S A;  3MQ0 A;  4R3J A;  4OVD A;  1BLC A;  2WGV A;  4B93 A;  2ZOH A;  3LYX A;  2P7J A;  4XT2 A;  3JPU A;  4KZ9 A;  2I72 A;  4IUK A;  1RP5 A;  3K3D A;  5HDS A;  5FAQ A;  4KZB A;  4HOI A;  3T12 B;  3QP1 A;  4S2I A;  1NY0 A;  1ONH A;  3H7W A;  2FFF B;  4ZRR A;  1IYP A;  3C30 A;  2PRF A;  2XD5 A;  3HLC A;  1K56 A;  3IXG A;  2VGJ A;  4RX3 A;  3VSK A;  5HDC A;  1WYC A;  2ZLY A;  1LHY A;  1Y54 A;  1NWZ A;  3BQ8 A;  1Q2P A;  3KX0 X;  1TD5 A;  2V0U A;  2Q0O A;  4R38 A;  1NYM A;  3OOV A;  3P98 A;  4RQ9 A;  2XDM A;  1ERM A;  4I3J A;  5CHJ A;  5G4Z A;  1YLY A;  4GJ4 A;  4AFI A;  1HVB A;  4PPR A;  4EER A;  2A3U A;  3MZF A;  2VGL M;  3B47 A;  3VFH A;  1FCN A;  3ULF A;  2ZM8 A;  3RXW A;  1OTB A;  1V9Y A;  2Q9M A;  2Y2J A;  4XUX A;  2J3T C;  1ES3 A;  4I3A A;  1T19 A;  4QHC A;  1KE4 A;  2GZA A;  5F68 A;  5TFQ A;  1F98 A;  5L10 A;  1ESI A;  2PYR A;  4DE2 A;  3S1Y A;  1BSG A;  4MN7 A;  3RJU A;  2Y2Q A;  4ZDX A;  4LV0 A;  2JKR M;  4RVA A;  3A0V A;  3DTK A;  3GRJ A;  4HES A;  4ID4 A;  3OPP A;  3BFC A;  2V1A A;  2JKT I;  4GOG A;  4UQI S;  5HWT A;  1BLH A;  4S2K A;  2IWB A;  5EEC A;  3BFG A;  2EWW A;  4FH2 A;  3D4F A;  3PBQ A;  1MXO A;  2L0W A;  2W1T B;  1CI8 A;  1P9W A;  3VE4 A;  2J9O A;  1MBL A;  5DTS A;  3FPV A;  4OOY A;  4E3J A;  3UB7 A;  4N9L A;  1XGI A;  3E2L A;  4GN2 A;  3GVB A;  4GNU A;  3ZVW A;  1JTG A;  5HW3 A;  3F1P A;  3T4S A;  5AQ9 A;  1ODV A;  1VEU B;  3FG8 A;  1H3Q A;  5EUA A;  4D2O A;  4MLL A;  5FEG A;  4RYE A;  1BUE A;  3IX8 A;  3T4L A;  3F1N A;  3NI9 A;  5M1A A;  2ZC3 B;  1L0G A;  5HPI A;  3G4P A;  3IQA A;  1NRF A;  4S2L A;  3IWO A;  3TJZ C;  3NOU C;  2EXA A;  1DY6 A;  2XGN A;  5HAP A;  1Z09 A;  1YSQ A;  3ZDJ A;  4LV1 A;  4QU3 A;  1PWG A;  4EW7 A;  1LSX A;  3HLG A;  4KQQ A;  4Y15 A;  5F83 A;  2PU2 A;  2W3E A;  2HV1 A;  1G28 A;  2Y2H A;  2GDN A;  4I38 A;  3EWK A;  5EV0 A;  1WYB A;  3GSG A;  4EET B;  3U2A A;  1PRQ A;  5TJJ A;  4R3B A;  3K3C A;  4H6J B;  4WM9 A;  5KSH A;  3M2K A;  3A3D A;  4GLQ A;  3LEQ A;  1MKM A;  5M18 A;  4FOF A;  4BBU A;  2ZC6 B;  4UA9 A;  2EX6 A;  1BTL A;  2X01 A;  2VGL S;  3VE3 A;  3HJK A;  4BLM A;  2QZ6 A;  4GKU A;  4DDS A;  5HAR A;  1MKI A;  1VQQ A;  3EEA A;  3OPH A;  5CED A;  2W3D A;  5GHZ A;  1NLZ A;  3ZG9 B;  4K0X A;  3W8K A;  1PW8 A;  3HJI A;  3HLW A;  3H82 B;  4EXO A;  1ZC2 A;  5CHU A;  2X71 A;  3FWL A;  4UA7 A;  5FQK A;  3G31 A;  1MWT A;  3IXD A;  3O87 A;  3AGF A;  1CI9 A;  2DNS A;  3WS1 A;  4B9O A;  5MC7 A;  1LI0 A;  5AVF A;  3DW0 A;  1ZG4 A;  1YQS A;  3E4Q A;  1PZP A;  4KQO A;  5EOO A;  4GHI B;  2PDR A;  1YAX A;  3OC2 A;  1ERO A;  4QD4 A;  2B5R A;  1TS0 A;  3UPO A;  2ZL1 B;  4O7D A;  1SKF A;  1K4F A;  4DJ3 A;  3G32 A;  2H0T A;  2P08 A;  2WKH A;  3IX3 A;  1BLP A;  1M40 A;  1P97 A;  2HPB A;  4P85 A;  2Y55 A;  5U47 A;  2C5W B;  1O07 A;  1H8M A;  1J3W A;  2D01 A;  3IX4 A;  4GB7 A;  1NZO A;  4PM8 A;  2QHK A;  3NJA A;  4N1H A;  2H28 A;  4E3N A;  2UWX A;  5DKK A;  2M7V A;  4Y0U A;  4B4X A;  1QME A;  3VP3 A;  4WEL A;  4OPZ A;  2WKR A;  5LBR A;  1DRM A;  4JGP A;  2W0N A;  3CIT A;  1KVM A;  1SZV A;  4B4Z A;  4BD0 A;  3WRT A;  2ZQC A;  2JC7 A;  3E2K A;  1S0W A;  4LCL A;  1GSX A;  2XA7 S;  3DWK A;  5HFO A;  3R4K A;  1M6K A;  5G4Y A;  3CWF A;  4BL2 A;  3UE1 A;  4DKI A;  4EQI A;  2M7U A;  4Y7P A;  1OPX A;  1LSV A;  4JF6 A;  1SDN A;  3UE3 A;  2WK0 A;  1TEM A;  3ZQ5 A;  1T1A A;  4JPM A;  4Q0H A;  5TBM B;  1JTD A;  5HX9 A;  2V9A A;  3NHQ A;  2ZC5 B;  5FAS A;  4EV4 A;  1MWR A;  3EOI A;  1KDW A;  4ZJ3 A;  2Y2P A;  4JXS A;  1IYO A;  5CGX A;  1BYW A;  3OCN A;  1UGU A;  4H8R A;  1VM1 A;  4Q0I A;  3TRC A;  1ZHH B;  5A91 A;  2HP6 A;  5J8X A;  4A5R A;  2Z6C A;  1K57 A;  3Q7V B;  3UME A;  4EUV A;  3F1O B;  1W7F A;  2HF6 A;  2WAF A;  3HRE A;  3BW6 A;  4NK3 A;  4BBT A;  1E4D A;  4KZ6 A;  3QP8 A;  3N7W A;  4N92 A;  4ZJ2 A;  3OPR A;  3IWQ A;  4UEY A;  5I5L A;  1K54 C;  4UA6 A;  2O9C A;  4DE3 A;  1UWP X;  2J9P A;  2GX5 A;  2BTF P;  3V3R A;  3RH8 B;  1STZ A;  5KZH A;  1BLS A;  1S67 L;  4FSF A;  2E8J A;  4MBF A;  3BY9 A;  3S7O A;  3E4P A;  4K91 A;  1V9Z A;  2A2L A;  3LY4 A;  4S2P A;  1XXM A;  2ZOI A;  1SKO B;  1CEF A;  1A0K A;  4MBK A;  4GS9 B;  3T1Q B;  4BMW A;  5DVA A;  4GZB A;  2L4R A;  5EVE A;  4C3Q A;  2PBY A;  3UY6 A;  4PAU A;  4WUJ A;  2A24 A;  4DE1 A;  5A90 A;  5GHY A;  2HZ5 A;  3TE8 A;  2OWH A;  5FSR A;  5IHV A;  2WGW A;  3IS2 B;  2IA2 A;  2OLV A;  2NUP C;  3MBZ A;  3ZVT A;  4ETX A;  1KGE A;  4DN0 A;  4X25 A;  4WF0 A;  4EWF A;  3TOI A;  1FIK A;  4PM5 A;  3PAG A;  1TVF A;  4DE0 A;  3WRZ A;  2Y91 A;  4KZ7 A;  1IKG A;  1T1B A;  5EVI C;  3LCE A;  4WL9 A;  2FZ0 A;  4LEN A;  3EGX C;  3MMH A;  1KVL A;  1H0M A;  4OQ0 A;  1ES2 A;  3UE6 A;  3CI6 A;  4GDN A;  4X1M A;  5AVE A;  2AVX A;  4R6L A;  3BLM A;  4ARZ B;  3LIB A;  4LGW A;  3HLF A;  2VV7 A;  2G2W A;  2JHE A;  3SS3 A;  1FR6 A;  3G6O A;  4IBX A;  1J9M A;  1XKZ A;  3JVU A;  3W4O A;  2P9V B;  4EUZ A;  3E98 A;  4O8G A;  1YMX A;  4IHQ A;  3PR6 A;  5EPH A;  5G18 A;  3JVV A;  4QB8 A;  2R78 A;  3IXB A;  4YWZ A;  5EE8 A;  4U0T A;  2OV5 A;  2ACG A;  2DMW A;  1ERQ A;  1XJ2 A;  2FFY A;  2JKG A;  3GQZ A;  3S7Q A;  3VV4 A;  4IUH A;  4CPK A;  4E3I A;  4HJ6 A;  3QP4 A;  5A93 A;  2VK3 A;  3CUE A;  3IF6 A;  4MDZ A;  4LPZ A;  3OCL A;  3LY3 A;  4OOL A;  4PKY A;  4PHT A;  4MCW A;  3IH9 A;  3TW8 A;  3OPL A;  5CER A;  5KSC A;  3CPT A;  4OLG A;  4CJN A;  2J3W A;  3LFV A;  3ITB A;  1VET B;  3T4O A;  1W63 Q;  1AXB A;  3KYE A;  2P04 A;  3IBR A;  4PMA A;  2JKR I;  3ZG7 B;  2ZBB A;  3T4J A;  1LI9 A;  3AGE A;  4QJG A;  1PI4 A;  4KUO A;  3MZD A;  4DXC A;  2WAD A;  1OTA A;  1GCE A;  4Q8I A;  3KSH A;  1FCM A;  4GCZ A;  5EVI B;  4OKP A;  1MZU A;  1IEL A;  2O0Y A;  1RGY A;  3Q7Z A;  3EEH A;  3PAE A;  4OP8 A;  5J3W A;  3SS5 A;  3IF5 A;  3S7N A;  3OLO A;  4XT2 B;  5FQM A;  4Y5F A;  1G6O A;  1Y4O A;  1PZO A;  2YKF A;  4ETZ A;  1JWP A;  2EX8 A;  2DRW A;  4WEK A;  4LV2 A;  1TDL A;  3BEB A;  5CTM A;  3RFB A;  4JLF A;  2Z2L B;  1ACF A;  1WE4 A;  4BBV A;  4M4X A;  4DMZ A;  5FQQ A;  2XFT A;  3UDF A;  2VX8 A;  2BG1 A;  1SDE A;  3BEC A;  2KOI A;  4QY5 A;  4WYY A;  1CJF A;  3MXQ A;  4Q0J A;  1L3L A;  4LRX C;  1ALQ A;  2QPN A;  3PBT A;  2JKT M;  5D3O A;  3WS0 A;  2HP9 A;  5DF8 A;  2OAQ 1;  1HZO A;  2W3H A;  1GSV A;  4KZ8 A;  4OQH A;  2H5S A;  1K6R A;  1JNU A;  3AGD A;  4N1X A;  3LR3 A;  2FH5 A;  2VV6 A;  3SH7 A;  3BFD A;  4WMC D;  3MXR A;  3CMZ A;  4IBR A;  2XA7 M;  4GHI A;  3C4O A;  2OOL A;  5JYP A;  3MQQ A;  4HJ4 A;  3GR2 A;  2ZL1 A;  1ZKJ A;  4HH3 A;  1HTZ A;  3N8L A;  1GHP A;  1OTI A;  2VLG A;  3A0R A;  4X6T A;  3LIF A;  3MS6 A;  3LEZ A;  3MFX A;  4CLC D;  4G3K A;  3R7W A;  3V5M A;  4JXG A;  3LO7 A;  3NY4 A;  3ISG A;  3A0S A;  4NG2 A;  5DF7 A;  3VP1 A;  1IYQ A;  5DJU A;  4DJ2 A;  4JBF A;  2G7U A;  3EQV A;  3FPW A;  2JCH A;  1W79 A;  5CXW A;  2ZQ9 A;  4GDB A;  3WS4 A;  2WGI A;  1IFQ A;  5GLC A;  1KDS A;  1NYY A;  2WKI A;  3LIC A;  2PU4 A;  3F1P B;  4WMC A;  5CGS A;  3LI8 A;  2GJ3 A;  5E43 A;  1KE3 A;  3PHY A;  5DKL A;  4F3L A;  4K08 A;  3S7P A;  1DJC A;  2EX9 A;  4NET A;  3T4Q A;  1FIL A;  1ESU A;  3F1N B;  3VFF A;  5E2E A;  4GW9 A;  2EX2 A;  4JXW A;  3ICY A;  2PR5 A;  1PW1 A;  1L0D A;  4OOM A;  2OAP 1;  3FZC A;  5J7E A;  1TS6 A; 
#chains in the Genus database with same CATH homology
 4E3K A;  2DCF A;  1E25 A;  1K6S A;  3HLE A;  3C5A A;  5A91 A;  1L0E A;  4YFM A;  2HP6 A;  5J8X A;  2R9W A;  4A5R A;  2Y4A A;  5GL9 A;  1K57 A;  3IF6 B;  3Q7V B;  2RCX A;  3HL9 A;  4Y0O A;  3MXS A;  1W7F A;  4OH0 A;  5GHX A;  4M3K A;  3IH8 A;  1FQG A;  4PM7 A;  2WAF A;  3MKF A;  3ZCZ A;  4E3O A;  3V39 A;  3HRE A;  3A3F A;  3HLB A;  5EVI A;  4NK3 A;  3UPN A;  4X68 A;  1E4D A;  4R4S A;  1K55 A;  4KZ6 A;  4R3J A;  2Y2N A;  3N7W A;  4N92 A;  1BLC A;  2WGV A;  4OVD A;  4ZJ2 A;  3UE0 A;  3OPR A;  4S2J A;  4PM9 A;  1U60 A;  3IWQ A;  4X55 A;  4IVI A;  2V2F F;  3TG9 A;  3V3S A;  3VMA A;  4KZ9 A;  1S6R A;  1K54 C;  3BFE A;  3BM6 A;  4UA6 A;  4DE3 A;  2I72 A;  2J9P A;  3ZG0 A;  3UO9 A;  3V3R A;  1RP5 A;  1ZG6 A;  1ES4 A;  5KZH A;  3PBS A;  3M6H A;  5FAQ A;  1BLS A;  4LV3 A;  4FSF A;  4KZB A;  3DWZ A;  4MBF A;  5TR7 A;  4S2I A;  1NY0 A;  1ONH A;  1YLT A;  2FFF B;  1XPB A;  1IYP A;  4KZ4 A;  4Y0T A;  1YLP A;  2XD5 A;  1K56 A;  3HLC A;  2VGJ A;  3IXG A;  2CC1 A;  4RX3 A;  5AQ7 A;  4K91 A;  3VSK A;  3LY4 A;  4S2P A;  1WYC A;  2ZLY A;  1LHY A;  1Y54 A;  3WS5 A;  1XXM A;  3NBL A;  1EI5 A;  1Q2P A;  5FAT A;  1CEF A;  1NJ4 A;  4N9K A;  3OZH A;  4MBK A;  1XGJ A;  4KEN B;  1NYM A;  2Y59 A;  1I2S A;  3P98 A;  4MNR A;  4E3L A;  1GHI A;  1FCO A;  5DVA A;  2XDM A;  4R4R A;  1ERM A;  4GZB A;  3NIA A;  3IXH A;  5CHJ A;  4LCM A;  2EXB A;  1YLY A;  4C3Q A;  3B3X A;  2PBY A;  3A3J A;  1HVB A;  4PPR A;  3N6I A;  2A3U A;  4FCF A;  3MZF A;  4EBP A;  3W4P A;  3VFH A;  1XA7 A;  5HAI A;  1FCN A;  3UY6 A;  1XA1 A;  4BJP A;  1RGZ A;  3PBO A;  2ZM8 A;  3RXW A;  1ONG A;  3BYD A;  4DE1 A;  1NZU A;  3VOZ A;  5A90 A;  5GHY A;  2EFU A;  1NXY A;  4DDY A;  2Q9M A;  2Y2J A;  4XUX A;  3UDI A;  2R9X A;  1YLW A;  1ES3 A;  5FSR A;  4ZBE A;  5IHV A;  5CEB A;  2ZC4 B;  4QHC A;  2WGW A;  4S2N A;  1KE4 A;  2OLV A;  2HP5 A;  5TFQ A;  3MBZ A;  3ZVT A;  1ESI A;  4B88 A;  5DF9 A;  1MPL A;  4DE2 A;  1KGE A;  2Y2L A;  3S1Y A;  5CGW A;  4EWF A;  3TOI A;  2HDU A;  4P0M A;  4PM5 A;  1KGG A;  3PAG A;  3W4Q A;  1TVF A;  1K57 C;  4DE0 A;  4F94 A;  1BSG A;  1XX2 A;  3WRZ A;  3RJU A;  2Y91 A;  4KZ7 A;  4XUZ A;  2HDQ A;  2Y2Q A;  1C3B A;  5E2F A;  1TDG A;  4ZDX A;  1IKG A;  4KG2 A;  4LV0 A;  3O86 A;  1EWZ A;  5TGF A;  5EVI C;  5DTT A;  3LCE A;  3SOI A;  1K55 C;  4RVA A;  4E3M A;  4LEN A;  3HUO A;  3ZNY A;  3GRJ A;  2J7V A;  4HES A;  4ID4 A;  4JKT A;  4X53 A;  2WYX A;  5JYO A;  2XEP A;  3OPP A;  3BFC A;  1CK3 A;  1G6A A;  1KVL A;  4P87 A;  2Y2G A;  4GOG A;  1BLH A;  2H0Y A;  4S2K A;  2IWB A;  2V1Z A;  5EEC A;  3BFG A;  4MBH A;  1G68 A;  3MZE A;  4OQ0 A;  1ES2 A;  4FH2 A;  3D4F A;  3C7U A;  4GDN A;  3PBQ A;  4XXR A;  2OLU A;  3PTE A;  1MXO A;  3BLM A;  3WS2 A;  2WAE A;  3HLF A;  1CI8 A;  4HBT A;  1XP4 A;  2C6W B;  2J9O A;  3Q82 A;  1MBL A;  5DTS A;  4ZJ1 A;  1JWZ A;  3V50 A;  2G2W A;  4ZAM A;  3Q1F A;  5CRF A;  5AQA A;  4OOY A;  4S2M A;  3SS3 A;  4E3J A;  1FR6 A;  4N9L A;  4IBX A;  1J9M A;  1XGI A;  3E2L A;  4GN2 A;  4BL3 A;  3TSG A;  1XKZ A;  3GVB A;  4GNU A;  3ZVW A;  3W4O A;  2P9V B;  2J8Y A;  1JTG A;  4EBN A;  5HW3 A;  4EUZ A;  5AQ9 A;  3GV9 A;  3M6B A;  3BRM A;  2WKE A;  4K0W A;  3RXX A;  1H8Z A;  1YMX A;  5EUA A;  4D2O A;  4MLL A;  1GA9 A;  2WUQ A;  1BUL A;  1YLJ A;  1I5Q A;  4RYE A;  1BUE A;  4QY6 A;  5M19 A;  4HEF A;  2Y2K A;  5EPH A;  3NDG A;  3NI9 A;  5M1A A;  2ZC3 B;  1L0G A;  1JWV A;  4S2O A;  5G18 A;  4R23 A;  3UNW A;  3N4I A;  4QB8 A;  3G4P A;  3IXB A;  2XF3 A;  3IQA A;  1NRF A;  4S2L A;  3IWO A;  2EXA A;  5EE8 A;  5EOE A;  1LL9 A;  1DY6 A;  4U0T A;  4WZ4 A;  2OV5 A;  2XGN A;  1ERQ A;  1FR1 A;  2FFY A;  4WZ5 C;  3GQZ A;  5HAP A;  3M2J A;  2XH9 A;  5FQ9 A;  3ZDJ A;  3ITA A;  5F82 A;  4CPK A;  2WZZ A;  4E3I A;  4LV1 A;  4QU3 A;  1PWG A;  4DF6 A;  2XK1 A;  5A93 A;  3IF6 A;  3Q7V A;  3OCL A;  2Q9N A;  1N9B A;  3HLG A;  3HUM A;  4KQQ A;  4S2N C;  3LY3 A;  3ZGA B;  4OOL A;  3A3I A;  5F83 A;  5GLD A;  2PU2 A;  4C75 A;  1JVJ A;  3IH9 A;  1W5D A;  4JXV A;  1YLZ A;  3OPL A;  5CER A;  1RCJ A;  2Y2M A;  2E8I A;  2GDN A;  2Y2H A;  4OLG A;  5KSC A;  4CJN A;  1K54 A;  3ITB A;  1BT5 A;  1MWU A;  5F1F A;  1WYB A;  4FD8 A;  3GSG A;  5DTK A;  4E6W A;  3ZG5 A;  1GA0 A;  1N4O A;  1AXB A;  4R3B A;  2P9V A;  5GLB A;  4RX2 A;  4WM9 A;  5FDH A;  3ZFZ A;  4U3T A;  3PBN A;  3M2K A;  5KSH A;  3A3D A;  4PMA A;  3S4X A;  3GTC A;  3ZG7 B;  5KMW A;  1LI9 A;  4UHU A;  4BEN A;  4OPY A;  3AGE A;  2ZC6 B;  4UA9 A;  5M18 A;  2EX6 A;  1BTL A;  4QJG A;  1PI4 A;  1FSW A;  2X01 A;  1Z6F A;  5L2F A;  3MZD A;  5CEC A;  4BLM A;  4OPQ A;  4DXC A;  3O88 A;  2WAD A;  1YM1 A;  1IYS A;  2QZ6 A;  3SH8 A;  1GCE A;  4GKU A;  4KG5 A;  4DDS A;  3SH9 A;  4Q8I A;  5HAR A;  3QNB A;  3G34 A;  1FCM A;  2A49 A;  2XFS A;  1MKI A;  1VQQ A;  5EVI B;  3OPH A;  4OKP A;  1IEL A;  5CED A;  2ZM2 A;  3N8S A;  2XR0 A;  1FOF A;  1GHM A;  2X02 A;  3FKW A;  1RGY A;  3CZD A;  3QNC A;  3Q7Z A;  3ZNT A;  5GHZ A;  4PM6 A;  4U0X A;  2H10 A;  3ZG9 B;  3PAE A;  4K0X A;  4OP8 A;  3W8K A;  2V20 A;  3SS5 A;  1PW8 A;  1Q2Q A;  3IF5 A;  2ZJ9 A;  3HLW A;  4R1G A;  1L2S A;  4E6X A;  5FQM A;  4HBU A;  3BLS A;  4ZTK A;  1CEG A;  1ZC2 A;  5CHU A;  1PZO A;  2X71 A;  3FWL A;  5F1G A;  1PYY A;  2EFX A;  4IED A;  3JYI A;  5HAQ A;  5I94 A;  4UA7 A;  5FQK A;  1FSY A;  3G31 A;  1MWT A;  1JWP A;  2EX8 A;  2DRW A;  2HDS A;  4OLD A;  4IVK A;  4WEK A;  5FI6 A;  3IXD A;  3O87 A;  4OQI A;  4R0Q A;  4LV2 A;  3VOY A;  3AGF A;  1CI9 A;  2DNS A;  1TDL A;  3IHA A;  3BEB A;  3G30 A;  3WS1 A;  5AQB A;  1LI0 A;  3GMW A;  3BFF A;  1O7E A;  5CTM A;  3DW0 A;  4BD1 A;  4JLF A;  4OON A;  2Z2L B;  1ZG4 A;  4UAA A;  1WE4 A;  4GD8 A;  4FH4 A;  1YQS A;  2G2U A;  1PZP A;  4KQO A;  4C6Y A;  5BOH A;  5FQQ A;  2XFT A;  1IEM A;  5EOO A;  3UDF A;  4YIN A;  3OC2 A;  4KG6 A;  2BG1 A;  3NDE A;  1SDE A;  1ERO A;  2ZMA A;  3HVF A;  4QD4 A;  3FKV A;  1H5X A;  2JE5 A;  3BEC A;  2B5R A;  3G2Y A;  4QY5 A;  4WYY A;  3UPO A;  4O7D A;  3MFD A;  4X56 A;  1SKF A;  1K4F A;  4DRT A;  3EQU A;  3IHB A;  1ALQ A;  1E3U D;  3IF6 C;  2ZQD A;  5FAO A;  3G2Z A;  1DJA A;  3G32 A;  2H0T A;  2QPN A;  4KZA A;  2WKH A;  1BLP A;  1QMF A;  5E2G A;  1M40 A;  3PBT A;  5D3O A;  2HPB A;  3WS0 A;  3HUN A;  2HP9 A;  5DF8 A;  1HZO A;  2Y2I A;  4P85 A;  1L0F A;  1W8Y A;  2XD1 A;  1HD8 A;  3VP4 A;  1YMS A;  3ZG8 B;  2QMI A;  4KZ8 A;  2JBF A;  3UN7 A;  2Y55 A;  5FQJ A;  5U47 A;  4OQH A;  2C5W B;  2H5S A;  1KGF A;  1O07 A;  1K6R A;  5FI7 A;  2ZD8 A;  3SS4 A;  2P74 A;  3AGD A;  4N1X A;  4GB7 A;  1NZO A;  3IWI A;  3IT9 A;  4PM8 A;  2WGW B;  1LL5 A;  4WEJ A;  3I7J A;  4N1H A;  4OQG A;  4OP5 A;  3SH7 A;  4E3N A;  2UWX A;  4Y0U A;  4B4X A;  3BFD A;  1QME A;  2WZX A;  3DTM A;  1I2W A;  5FQI A;  3VP3 A;  4WMC D;  3MXR A;  4WEL A;  3NCK A;  3CMZ A;  4IBR A;  3WWX A;  3UDX A;  4OPZ A;  1K4E A;  3C4O A;  1H8Y A;  1SCW A;  5FA7 A;  3S22 A;  5JYP A;  4OPR A;  2Z2M B;  3MKE A;  1MY8 A;  1KVM A;  1BZA A;  3UPP A;  3CJM A;  3GR2 A;  3C4P A;  1ZKJ A;  3Q07 A;  5EVL A;  1HTZ A;  1E3U A;  3N8L A;  3WRT A;  4B4Z A;  1K25 A;  4BD0 A;  4JF5 A;  3HLD A;  2ZQC A;  1GHP A;  4GD6 A;  2OSU A;  2HDR A;  4KZ5 A;  2JC7 A;  4X6T A;  3E2K A;  1PWD A;  1S0W A;  2ZQ8 A;  4MEZ A;  5FAP A;  1ES5 A;  3LEZ A;  4L0L A;  4LCL A;  3DWK A;  3VP0 A;  3ZHH A;  2ZQ7 A;  3V5M A;  2ZM0 A;  4JXG A;  3LO7 A;  5HFO A;  3NY4 A;  4P6B A;  4EBL A;  1M6K A;  5A92 A;  1W8Q A;  3ISG A;  4BL2 A;  5DF7 A;  3UE1 A;  4DKI A;  4DXB A;  1YT4 A;  1LLB A;  3HBR A;  2RL3 A;  3VP1 A;  1IYQ A;  3N8R A;  4EQI A;  4WZ5 A;  4JBF A;  3C7V A;  1PI5 A;  3EQV A;  4Y7P A;  5EVI D;  4JF6 A;  1KE0 A;  2JCH A;  1W79 A;  5CXW A;  2ZC7 A;  2ZQ9 A;  1PIO A;  1SDN A;  2IWC A;  2Y2O A;  2IWD A;  4GDB A;  3UE3 A;  3WS4 A;  2BLS A;  3NC8 A;  2WGI A;  2WK0 A;  3VP2 A;  3G35 A;  1TEM A;  5E2H A;  4X69 A;  5GLC A;  1KDS A;  3FYZ A;  5CTN A;  3PBR A;  5CHM A;  5GLA A;  1NYY A;  2WKI A;  2PU4 A;  4WMC A;  4JPM A;  2XQZ A;  4RA7 A;  5CGS A;  3CG5 A;  5E43 A;  1JTD A;  1KE3 A;  4BQM A;  2ZQA A;  1MWS A;  1OME A;  2XLN A;  5HX9 A;  1PWC A;  1SHV A;  3O3V A;  1DJC A;  2ZC5 B;  1DJB A;  2EX9 A;  4KQR A;  3FV7 A;  4NET A;  4WBG A;  3Q81 A;  4Z9Q A;  5FAS A;  4JF4 A;  1ESU A;  1MWR A;  4EV4 A;  3P09 A;  3VFF A;  5HL1 A;  1KDW A;  4ZJ3 A;  4KZ3 A;  5E2E A;  2EX2 A;  2Y2P A;  3A3E A;  4JXW A;  4JXS A;  1IYO A;  2VGK A;  5CGX A;  1K56 D;  1K38 A;  1PW1 A;  1L0D A;  3VSL A;  3OCN A;  4OOM A;  5FI2 A;  3FZC A;  1IKI A;  3QHY A;  4H8R A;  1VM1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...