1S1ZA

Photoactivated chromophore conformation in photoactive yellow protein (e46q mutant) from 10 to 500 nanoseconds
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAQGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photoreceptor
molecule keywords Photoactive Yellow Protein
publication title Chromophore conformation and the evolution of tertiary structural changes in photoactive yellow protein
pubmed doi rcsb
source organism Halorhodospira halophila
total genus 34
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2004-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1s1zA00
3RH8B 2BASA 3VOLA 1S67L 4BBVA 4I39A 4NXGA 4NXFA 4WF0A 5DJTA 4NXBA 4LRZE 4L9GA 5KIZA 4EXOA 3FC7A 1S1YA 3NHQA 5HSQA 4DJ2A 4GHIB 2PYRA 2OWJA 3MQQA 3LIDA 4H6JA 4LPZA 2WKQA 3E4QA 1Y28A 1TS0A 5HZHA 3GECA 3LICA 2YKHA 3LIEA 2JN7A 2ZOIA 2PDRA 3H7WA 2L4RA 2L0WA 4R70A 2A24A 4EERA 4R3AA 1BYWA 5F5YA 5AVFA 4HH2A 1OTDA 2Z6CA 2HV1A 4MN5A 1TS7A 1V9ZA 4R6LA 4L9FA 3F1NA 1S66L 5HDSA 2V1BA 4GCZA 2W0NA 3F1PA 3MFXA 3BY9A 2R78A 1F98A 3CLOA 3HJKA 4HJ6A 2QHKA 2W27A 4M4XA 4GHIA 4EEUA 4EETB 3CWFA 4DJ3A 4EW7A 2WKPA 3H9WA 1S1ZA 3PYPA 4H6JB 4JGOA 1X0OA 2OOLA 2VLGA 3OLOA 4I38A 2EA9A 3H7WB 2K7SA 4HP4A 5J7EA 5IS1A 2A24B 1T1AA 5DKLA 1OTAA 1UGUA 4JGPA 1LSXA 2ZBBA 2VEAA 4EESA 3A0RA 2V0UA 4LRYC 5I5LA 3F1NB 4WLAA 2OWHA 5J4EA 2L1MA 1UWPX 5G4ZA 3F1PB 3UB9A 4I5SA 3A0VA 1T18A 1XFQA 2PD8A 3C2WA 3E4OA 4EQ1A 1LSVA 4GS9A 4WUJA 2CMNA 5HDCA 5J3WA 4HIAA 1OJGA 3MJQA 2QJ7A 3VE4A 5HD5A 4KUKA 4I3AA 2JHEA 1T1CA 2PR5A 4HY8A 2VV7A 1ODVA 3IBRA 4HJ3A 3D72A 4K08A 2V1AA 5DJUA 1LSWA 5TBMB 1DP6A 4HNBA 1XJ6A 5HWTA 1OTEA 1TS8A 4MN6A 1TS6A 4GW9A 1V9YA 1D06A 1OTIA 4HOIA 1GSVA 3ULFA 2ZOHA 3PHYA 2Z6DA 2B02A 3A0SA 3MQOA 3MR0A 4XT2A 3LIFA 5HWVA 1OJ5A 3NJAA 4GS9B 4B9OA 2KDKA 1N9OA 4WL9A 1XJ3A 4L9EA 2PHYA 4LLOB 3T50A 1OT6A 3F1OA 1NWZA 3EEHA 2H28A 2I9VA 3IS2A 3KX0X 3LIAA 1GSWA 5G4YA 4KUOA 3E4PA 4F3LA 1T19A 5TBMA 3UB8A 1XJ4A 3BWLA 2D01A 4HHDA 2WKRA 5IU1A 4LRXC 3LIBA 5EFWA 3MXQA 5DKKA 3NOTC 5F68A 1F9IA 1GSXA 3G6OA 1P0ZA 3LI8A 3H82A 4YWZA 4BBUA 4WN5A 1EW0A 1OT9A 2D02A 4R38A 3UB6A 3ZQ5A 4XT2B 2KX6A 5HWWA 1T1BA 3UE6A 3SW1A 2V0WA 4HI4A 1N9NA 1KOUA 3C8CA 2QKPA 2INWA 3F1OB 2GJ3A 2PYPA 3VE3A 3IS2B 1VB6A 2YKFA 4I3IA 4F3LB 1DP9A 5F69A 4KQDA 2VV8A 4I3JA 1S4RA 3BY8A 2PD7A 3CAXA 1D7EA 3UMDA 1XFNA 4RQ9A 4NXEA 4JGRA 5HDDA 2P7JA 4HQAA 3GDIA 4E04A 3EWKA 1OTBA 1P97A 3HJIA 3K3CA 4JGQA 3B33A 2QWSA 3H82B 3ICYA 5HD3A 4BBTA 1DP8A 1WA9A 4HJ4A 2VV6A 2M1CA 4PKYA 1G28A 5AVEA 1LT0A 1N9LA 3NOPC 3LYXA 1XJ2A 3UMEA 1LL8A 1JNUA 3K3DA 5A8BA 3RTYA 2J80A 4HP9A 3UB7A 4EEPA 2PR6A 1UWNX 3P7NA 3NOUC 4HH3A 2V9AA 1MZUA 1S4SA 3FG8A 1DRMA 5F6AA 2QJ5A 3LI9A 3LUQA 4PKYG
chains in the Genus database with same CATH superfamily
2M7UA 1W63M 3BM6A 2HJ9C 1PZOA 3EQUA 4FUWA 3CPTA 3Q7VA 4E6XA 4MMNA 4OH0A 4NXFA 4OP5A 3ITBA 1JWPA 4NXBA 1K6SA 5KSHA 2GZAA 3LO7A 1SCWA 4YFMA 4XUZA 1J9MA 3B42A 4PM7A 4IUHA 3A3EA 4DJ2A 5E2EA 1TDLA 4Y7PA 5DVAA 4JF6A 4LPZA 1W5DA 4B88A 5HZHA 3GECA 2XR0A 1HTZA 2PAVP 1IOUA 2WYXA 2ZOIA 4HBTA 2Y2GA 1IELA 2P9VA 3M6HA 1ZC2A 2Q0OA 2RL3A 4LENA 5HAPA 2Z6CA 1TS7A 2V8FA 4D60A 4CQHA 4R6LA 2HDQA 3HLEA 2HPBA 2B5RA 4GCZA 4MBHA 2Y2JA 2O9BA 1VETB 2R78A 1F98A 4DE0A 1YPRA 2R9XA 4M4XA 4GHIA 4UA6A 5CHMA 4EETB 3CWFA 3W4PA 2WAFA 4EW7A 4KQOA 4OP8A 4ZJ2A 2FFFB 1PZPA 4LV0A 4FTXA 1VHMA 2Y2NA 4ARZB 3A3JA 3OLOA 1P9WA 4R0QA 2HP5A 4I38A 3G2ZA 5GHZA 1L3LA 2V2FF 3HVFA 1K54A 2EA9A 3BFGA 3H7WB 4OPRA 2XRNA 3CITA 3R7WB 1T1AA 5DKLA 1OTAA 2I72A 4PM8A 3IWQA 4C3QA 3MQ0A 4GN2A 2V0UA 2IWCA 3OBFA 2PU4A 5FDHA 3ZHHA 1LHYA 2WGVA 4WLAA 2L1MA 2EX8A 3HLCA 4JXGA 5FAOA 5CGWA 2VX8A 4Y0OA 4DF6A 1L0FA 3SS3A 2H10A 1T18A 1XFQA 4ZJ3A 3C2WA 1LSVA 5MC7A 2EFXA 3FV7A 4OLDA 3VE4A 3TJZC 4S2LA 4RVAA 5A90A 1MWSA 1F2KA 1T1CA 4IEDA 3OOVA 1Z09A 1XKZA 4JF5A 4X56A 1ODVA 4CPKA 3BYDA 2ACGA 3IWIA 4K08A 2X71A 5FQJA 1LSWA 1MWTA 1OMEA 1AWIA 2Y55A 4OPQA 1OPXA 5TBMB 3BFEA 4LGWA 2EXBA 4OLGA 1CI8A 3MKFA 4N92A 1MKMA 5HWTA 1OTEA 3VFHA 1TS8A 4MN6A 1TS6A 1V9YA 3DTEA 5EVEA 4EWFA 3VP2A 1G5UA 3ZFZA 4WELA 4JXVA 2OAP1 2ZOHA 2ZMVA 4QU3A 3T12B 2ZQ8A 1PWCA 3PHYA 3TSGA 2XH9A 4KZ6A 3MR0A 5M18A 5EOOA 3UB5P 5G18A 1OJ5A 2A3UA 4B9OA 2R9WA 3PXPA 4NETA 2PHYA 5L09A 5L2FA 4WZ5C 4DXCA 3UN7A 3E2KA 2X01A 3F1OA 1SKOB 2P04A 2ZQAA 1G6AA 1KE4A 3MBZA 3IS2A 3DBAA 4KUOA 3HL9A 1BLSA 1XJ4A 3IF5A 3WS0A 2Q9NA 2ZJ9A 1NY0A 3TE8A 3JVVA 3BFFA 5EFWA 3MXQA 1H5XA 5EVIB 2HF6A 2PBYA 5DKKA 4U3TA 5DTTA 5F68A 3S1YA 1F9IA 2ZMFA 3WRTA 5FQMA 2XDMA 1YLJA 3G6OA 4OPZA 3ZG0A 5AQAA 4E3MA 4Y3IA 3H82A 2Y2QA 4Y0TA 1E3UD 1EW0A 1OT9A 2GX5A 3UB6A 3ZQ5A 1TD5A 4XT2B 1ES4A 2KX6A 3FKVA 3HREA 3VP1A 3HBRA 1T1BA 3KYZA 3SW1A 1IEMA 3ZVTA 3CUEA 1N9NA 5EPHA 2JBFA 1FR1A 5GLAA 1IKIA 2INWA 5EV0A 2WGWB 1LL9A 3KSHA 1SZVA 2PYPA 3VE3A 4UA9A 1BUEA 1PI4A 5EM0A 1VB6A 3C4OA 5TGFA 3DAVA 4CLCD 4ZBEA 4WMCD 2OLUA 3CAXA 5FSRA 2FFYA 4O0PA 1XP4A 1MY8A 3NY4A 3S7NA 2IWBA 2HDUA 2Y8HA 4BWIA 4NG2A 1Q2QA 1NRFA 1YM1A 3HLWA 1P97A 1FR6A 2QWSA 3LY3A 3VP0A 3IXDA 3LY4A 4LV1A 1K4EA 2G7UA 2RCXA 2VA0A 4S2IA 5EVIC 4PKYA 4WZ4A 1FQGA 2EXAA 4PM5A 3ZYTA 3MXRA 1ONHA 3KSFA 3BW6A 4DN0A 3RTYA 3UE0A 5F82A 3NC8A 3QNCA 1UWNX 3PBRA 3P7NA 2MJ6A 3PBTA 1ZKJA 1SDNA 2J7VA 1S4SA 2Y59A 2V1ZA 3T4KA 4O7DA 3FG8A 1ESUA 3QHYA 5AQBA 1PW1A 1A0KA 3P98A 3SS4A 3OCLA 5CGXA 3BECA 2QJ5A 2VK3A 3LI9A 5DF7A 3AGDA 4E3NA 3CZDA 4O01A 3FZCA 2ZC7A 1PYYA 1JWZA 1IFQA 2UV0E 2XLNA 1S67L 1VETA 3ZVWA 4I39A 2XD1A 4KENB 1LI9A 3I7JA 2J8YA 4DXBA 4GOGA 4LRZE 5AJGA 2FH5A 2DMWA 5FATA 3FC7A 4EXOA 1KDSA 1SHVA 3IX3A 3NHQA 5HSQA 2G2UA 2J3TC 2OWJA 4HEFA 3BLMA 3LIDA 4ARZA 1PFLA 3E4QA 4DE1A 2LB5A 3LICA 1VM1A 4X6TA 4GD8A 3BQAA 3N6IA 3FPVA 4PM9A 4BQMA 3H7WA 4E3OA 1TVFA 3VSKA 1WYBA 3UDXA 2H5SA 4S2JA 3R7WA 3UDFA 1I2WA 5EVLA 5F5YA 5FAQA 3KO6A 3QP1A 5DTKA 4JLFA 3W4OA 3CMZA 2M7VA 4L9FA 1W8YA 1FIKA 4S2MA 1EWZA 1S66L 5HDSA 2V1BA 4OVDA 4WZ5A 2Z2LB 4IVIA 2JKGA 5A93A 1ZG4A 4IHQA 3O3VA 4KZ5A 4L0LA 4X55A 3HJKA 3JPUA 4HJ6A 2QHKA 3Q81A 1W79A 1CEFA 1BSGA 4MEZA 3WS1A 3M6BA 5A92A 3H9WA 4JXSA 4BLMA 1XXMA 1S1ZA 4H6JB 1X0OA 3AGFA 4FSFA 2OOLA 4KZ8A 2HP6A 3WRZA 4U0TA 1NLZA 4P85A 5LBRA 4EBLA 1P9RA 4B4XA 5IS1A 3ZDJA 1NZUA 4N9LA 3D9YA 2A24B 3DWKA 1Z6FA 2JCHA 4OONA 1UGUA 1LSXA 4K91A 2ZBBA 3WS4A 3HLFA 1MXOA 2VEAA 1VQQA 5DF9A 5GLCA 3G30A 5I5LA 2ZM8A 4R23A 2OAQ1 1YAXA 4P87A 2OWHA 2GDNA 3UO9A 4WBGA 4BJPA 3O5YA 1UWPX 2QZ6A 3F1PB 1KGGA 1ERQA 1K6RA 2VGLS 3A0VA 4WM9A 4LFUA 2K2NA 4EQ1A 3VOYA 5KMWA 4Q8IA 5AQ7A 3O86A 2CMNA 2W3DA 1CJFA 3MJQA 1ZG6A 3S7PA 4KUKA 2PU2A 1SKOA 1BLHA 4K0WA 3SZTA 4E3LA 3ZNTA 1Y4OA 3W2ZA 3BJNA 4MLLA 2V1AA 3G2YA 4Q0IA 4QY6A 2JE5A 4YOFA 4BD0A 3N8RA 5CTMA 5FI7A 1QMFA 1HLUP 3T1SA 1O7EA 1OTIA 5I94A 3PAEA 3SH8A 3UE3A 4YINA 4ZDXA 2Z6DA 4JPMA 5CHJA 5A91A 3BLSA 4XT2A 3S7QA 2JKRI 3LIFA 2E8IA 4G3VA 4OQGA 1PWGA 3CG5A 2WKHA 3P09A 2VKSA 1PNEA 1FSWA 1N9OA 4PM6A 4DE2A 3LEZA 4Y0UA 1GCEA 3MKEA 2WGWA 1NWZA 1NRJA 3EEHA 1TF1A 1K55C 4MN7A 5FI6A 4BD1A 5HX9A 4JBFA 3CHWP 2W3EA 5G4YA 3E4PA 1T19A 4E3KA 3MZDA 3UB8A 4IBRA 2CC1A 1ZTUA 1H0MA 1MBLA 4MBFA 1I2SA 3EOIA 3LIBA 4Q0JA 1KDWA 3HLGA 3C7VA 2B18A 4EUVA 4QJGA 4AFIA 3LR4A 3PTEA 4RX2A 3LFVA 1P0ZA 1ESIA 1G6OA 3LI8A 4N1HA 4PHTA 4YWZA 4BBUA 4F94A 5IT5A 4KZ7A 4X68A 4KZ4A 1ACFA 2V0WA 1LLBA 4E3IA 3M2JA 4Y13A 2EX6A 3SH9A 5K5BA 5EE8A 5FL3A 3N8LA 2XF3A 5FASA 1NLYA 1H3QA 3HCYA 4DRTA 3GSGA 1L0GA 2AVXA 5CGSA 1DP9A 4KQDA 1W8QA 4GD6A 5DFXA 4Y15A 3TOIA 1S4RA 3UPOA 3BRMA 2UWXA 3BY8A 2PD7A 3UMDA 1XFNA 1DJAA 2JC7A 3E0YA 3FKWA 1NXYA 1OTBA 4C75A 3B33A 5EM1A 2HZ5A 2XGNA 5HD3A 3ZCZA 1DP8A 3E98A 3MFDA 5FQIA 4EBPA 1CQAA 4HJ4A 3KSIA 1YLTA 5L8MA 3UPNA 2M1CA 5KSCA 4OQHA 5L07A 5HL1A 3D4FA 1I5QA 5GHYA 4HBUA 1KGEA 1LT0A 3GR2A 3LYXA 2QMIA 4HESA 1JNUA 5A8BA 4HP9A 3PBOA 1W7FA 2PR6A 4ZTKA 3OCNA 1K56A 3NOUC 5HPIA 1TDGA 1MZUA 2XA7S 2DRWA 3FWLA 3UY6A 5EUAA 1WE4A 1H8MA 4S2PA 1EI5A 1HVBA 3C7UA 3OC2A 4P6BA 1IYQA 4GKUA 4KG5A 4PKYG 5FEFA 4P0MA 3RH8B 3GTCA 1N9BA 2BASA 3V3SA 3VOLA 1U60A 3KSGA 3GMWA 3EGDC 3UNWA 4NXGA 4PAUA 2BTFP 3S22A 4X25A 4WF0A 5DJTA 3RXXA 1MC0A 3MXSA 4L9GA 5KIZA 4PMAA 1TEMA 4GHIB 3OPRA 3MQQA 1F5MA 1KVLA 4H6JA 1XA1A 4R4RA 2Y2HA 3P01A 2WKQA 1Y28A 3LEQA 1TS0A 1IYOA 2W3HA 1L2SA 4ETZA 1DY6A 4A5RA 4QD4A 2NUPC 4Y5FA 2L4RA 4R4SA 4NK3A 2A24A 1CF0A 3M2KA 1K0KA 2J9OA 4Y17A 3VMAA 2JKTI 2P08A 4HH2A 5KZHA 1OTDA 2HV1A 3E2LA 4QPRA 3T4LA 5TFQA 2Y2IA 4ZRRA 3V50A 2W0NA 3F1PA 3VP4A 4K0XA 4NKPA 1K55A 4LCLA 3CLOA 3NI9A 4MBKA 2K31A 3S7OA 2PBDP 2WADA 1ALQA 1IYSA 4DJ3A 5GLBA 4ESPA 1GA0A 3EEAA 3QP4A 4EBNA 4GNUA 3PAGA 2VGLM 3R4KA 2HJEA 3W8KA 1XGIA 2O9AA 3HUMA 2VLGA 4WEJA 4KQRA 4BL3A 1O07A 3SOIA 2VZWA 2K7SA 1MPLA 4HP4A 3VSLA 3O88A 3NULA 5CHUA 4N1XA 2Y91A 4ME4A 1YMSA 1PRQA 1K25A 2G2WA 4UEYA 5FQ9A 3V3RA 1WYCA 3F1NB 5J4EA 2HDSA 3QP2A 3Q7ZA 5E43A 3UB9A 4RA7A 3T1RA 4I5SA 1JTDA 4KZBA 3CI6A 4QY5A 2EX2A 3KYQA 4WUJA 2W1TB 3OZHA 5GLDA 5HDCA 2O9CA 4HIAA 2QJ7A 4I3AA 3LR5A 2PR5A 4HY8A 2VV7A 4CJNA 5F1FA 2ZQ9A 4B4ZA 3IBRA 4OPYA 4HJ3A 3D72A 5EVID 5DJUA 5F1GA 3N4IA 3NDGA 4G3KA 4H8RA 5CXWA 1MWRA 1DP6A 4WEKA 3QP5A 4B93A 4OKPA 3MZEA 5FI2A 4GZBA 3LGOA 4GW9A 1D06A 5HAQA 3K2NA 4PPRA 4HOIA 4ZJ1A 2OLVA 2JKFA 1GSVA 3ULFA 4DDYA 4RX3A 3RFBA 5E2GA 1GHIA 3GV9A 2B02A 3OPHA 2WKEA 1ES5A 3NJAA 3QP6A 4QWOA 4GS9B 3NBLA 2W1RA 2BG1A 2KOIA 2KDKA 5U47A 2W3GA 3T50A 2H0YA 1YLWA 1OT6A 3T4JA 1FSYA 1K57C 1BULA 4X69A 2H28A 2V8CA 3WS5A 2VGJA 3LR3A 5FEGA 5TBMA 4KG6A 3L9KA 2X02A 3BWLA 3V67A 3LR0A 4HHDA 4EUZA 3IHBA 2WKRA 2J3TD 4LRXC 5AQ9A 4Z1WA 5CERA 3NOTC 4UA7A 4S2KA 3T1XA 4X53A 1GSXA 1LI0A 3RJUA 4E3JA 3IT9A 2ZC3B 1W63Q 4R38A 3UE1A 1ES3A 3OPPA 1BLCA 1Q2PA 4CLCE 2VGKA 4ID4A 2XFTA 3MMHA 4LV3A 4FH2A 4HI4A 3C5AA 3Q07A 1YMXA 1VEUB 2QKPA 4KQQA 1KE0A 4UHUA 4KZ9A 3DTKA 2YKFA 5HW3A 4F3LB 1NYYA 5F69A 5DFYA 4I3JA 1YKDA 2EWVA 2ZD8A 5EVIA 2ZM0A 1Y54A 5BOHA 3CUEC 3DTIA 3PBSA 1XGJA 2XFSA 4NXEA 5HDDA 4IBXA 4HQAA 3GDIA 3ZG9B 2NUTC 3G34A 2KLIA 2XA7M 5FA7A 5J8XA 3HJIA 3K3CA 3Q82A 3C4PA 4JGQA 3BEBA 3IF6B 4BBTA 2ZC4B 2Y2LA 1CEGA 5GHXA 1WA9A 1KVMA 2VV6A 4ZAMA 1ONGA 4KG2A 2ZMAA 1G28A 5AVEA 4R3BA 1N9LA 4Y2FA 3NOPC 1RCJA 1XJ2A 3GRJA 1K56D 3JYIA 3UMEA 1LL8A 2ZL1B 2Y4AA 4BENA 3EGXC 4EV4A 1K4FA 3HLDA 1S6RA 3PBNA 3UB7A 1MWUA 2IWDA 4NEED 2EFUA 2V9AA 2BLSA 1DRMA 3BQ8A 2QPNA 1FCNA 1RP5A 4KZAA 2XROA 4S2NC 4C6YA 2HDRA 3ZNYA 5E2HA 4GLQA 5DTSA 3LUQA 3QNBA 2FZ0A 2P74A 4CLCB 1ES2A 3GVBA 4MCWA 4U0XA 4DKIA 3IX4A 2ZLYA 4M3KA 1S0WA 4BBVA 3MZFA 1SDEA 2OV5A 4FD8A 2O0YA 2HGVA 1XPBA 2ZQCA 1S1YA 3NECA 2PYRA 4UQIM 1M6KA 3VOZA 2EWWA 3PR6A 3IF6C 4BL2A 1L0EA 4D2OA 3NCKA 1ZHHB 1STZA 5D3OA 3NDEA 2OSUA 2YKHA 1BT5A 3IBJA 3LIEA 2QYBA 2JN7A 2PDRA 3HUNA 3MSHA 4FOFA 3VV4A 2ZC5B 4OOYA 2L0WA 4R70A 4EERA 1JVJA 4R3AA 5E2FA 1BYWA 5AVFA 3ZG5A 5HARA 1RGZA 1KGFA 3ISGA 4LV2A 4MN5A 1V9ZA 2Q9MA 3F1NA 4GB7A 3ZG8B 4IVKA 3CPTB 2Y2MA 2H0TA 3Q7VB 4OQIA 3MFXA 1K57A 3BY9A 4DE3A 2XD5A 5HFOA 1YLYA 3IXGA 1HD8A 1FCOA 2C5WB 3MF0A 4JKTA 2W27A 4CLCC 4EEUA 2XEPA 2W1TA 2WKIA 2WKPA 3C30A 3LCEA 2EX9A 3C38A 3PBQA 3IXBA 3PYPA 1H8YA 4BMWA 1PWDA 3N8SA 4JGOA 5FAPA 1QMEA 3UPPA 5EECA 1PIOA 3ITAA 4II7A 5J7EA 2Y2OA 2P9VB 3DW0A 3NIAA 4JGPA 1C3BA 1FOFA 1EROA 4EESA 5JYOA 2WGIA 3A0RA 4LRYC 1G68A 2XK1A 3T4QA 2A49A 2W3FA 4KZ3A 1AXBA 5G4ZA 4GDBA 4EQIA 1RGYA 1H8ZA 2JKRM 5HAIA 5CRFA 3HUOA 1NJ4A 1MKIA 2Y2KA 2PD8A 3E4OA 1ERMA 3FYZA 3OPLA 4DDSA 4GS9A 2PT7A 4Q0HA 2Y79A 4OOMA 3T4SA 4P6ZM 1XX2A 5J3WA 1OJGA 1YSQA 1LL5A 1BZAA 5HD5A 4Z9QA 1IKGA 2JHEA 3EQVA 3A3FA 3UDIA 4R3JA 3T1QB 4YNRA 2A2LA 5HL6A 4XUXA 2Y2PA 3IWOA 3ZGAB 2ZM2A 3G31A 3BFCA 1NYMA 3B3XA 4HNBA 1E25A 1XJ6A 3Q1FA 3O87A 4UAAA 3HLBA 3ZG7B 4RYEA 1XA7A 3AGEA 1YSPA 5FQQA 1CK3A 3VP3A 3U2AA 2DCFA 4UQIS 5JYPA 1BTLA 3A0SA 3MQOA 4FCFA 4MDZA 5L10A 5HWVA 1YT4A 2WZZA 2WZXA 2GNXA 2ZC6B 3QP8A 1YLPA 2PRFA 5TR7A 1VEUA 4E6WA 4WL9A 1XJ3A 4L9EA 4LLOB 3IH8A 4S2NA 1BLPA 3U4LP 1YLZA 1L0DA 2I9VA 5CEDA 4QHCA 3JVUA 3SS5A 2C6WB 3KX0X 5HPFA 2DNSA 3LIAA 1SKFA 1CI9A 1GSWA 4F3LA 4FH4A 2D01A 2E8JA 2HP9A 5IU1A 4IUKA 3G4PA 2VJWA 1HZOA 4ETXA 3MS6A 2WUQA 1KE3A 2XQZA 3TRCA 1NZOA 3IH9A 1GHPA 4N9KA 3SH7A 3L7HA 5DF8A 1K54C 3V39A 3IF6A 4EU0A 4JF4A 4S2OA 5M19A 4WN5A 1K38A 1YQSA 2D02A 3GQZA 5HWWA 3UE6A 4X1MA 5C5KA 3KYEA 2J3WA 5TJJA 1E3UA 1JWVA 3IHAA 1J3WA 3IXHA 3S4XA 3T4TA 1E4DA 1KOUA 1DJCA 3C8CA 2ZL1A 5GL9A 4R1GA 3F1OB 2GJ3A 3V5MA 1M40A 3CJMA 1FILA 3IS2B 2J9PA 4DMZA 4XXRA 4I3IA 2WAEA 3IQAA 3RXWA 4QB8A 2VV8A 2ZQ7A 4O8GA 1D7EA 3D3OA 5CEBA 3VFFA 3N7WA 5FQKA 4RQ9A 3FPWA 4JGRA 2Z2MB 5CX7A 1JTGA 2P7JA 4CLCA 3G32A 2LB9A 4MNRA 4E04A 3EWKA 1IYPA 4G3WA 2XSSA 3TG9A 4WMCA 3IX8A 4GJ4A 4P6ZS 3DWZA 4WYYA 3H82B 3ICYA 3G35A 5CECA 1FCMA 4IJGA 4OOLA 3A3DA 3WWXA 1PI5A 1PW8A 3DTMA 5IHVA 2ZQDA 3K3DA 3B47A 2V20A 3W4QA 5CTNA 1GHMA 2B95A 2J80A 3TW8A 5FDSA 4EEPA 4X1LA 5EOEA 1DJBA 4HH3A 2O99A 4GDNA 3WS2A 3A3IA 1GA9A 3T4OA 1N4OA 5M1AA 2JKTM 4JXWA 5F6AA 2WK0A 2IA2A 4LCMA 5F83A 4OQ0A 3BFDA 1D1JA
chains in the Genus database with same CATH topology
4O01A 2M7UA 3RH8B 1W63M 2HJ9C 2BASA 4MCWA 1IFQA 3EQUA 3VOLA 3KSGA 1S67L 3EGDC 4BBVA 4I39A 4MMNA 4NXGA 4PAUA 4NXFA 4WF0A 5DJTA 1MC0A 4NXBA 5KSHA 2GZAA 4LRZE 4L9GA 5AJGA 2FH5A 2O0YA 5KIZA 2DMWA 4EXOA 3FC7A 2HGVA 3B42A 1S1YA 3NHQA 4IUHA 5HSQA 4DJ2A 4GHIB 2PYRA 2J3TC 2OWJA 4UQIM 3MQQA 1F5MA 2EWWA 3LIDA 3PR6A 4H6JA 4ARZA 3P01A 4LPZA 2WKQA 3E4QA 1Y28A 1TS0A 1ZHHB 1STZA 5HZHA 3GECA 2LB5A 2W3HA 3LICA 2YKHA 3IBJA 1IOUA 3LIEA 2QYBA 3BQAA 4ETZA 2JN7A 2ZOIA 2PDRA 3FPVA 3H7WA 4FOFA 2NUPC 4Y5FA 3VV4A 2L4RA 2L0WA 4R70A 2A24A 3R7WA 4EERA 4R3AA 1BYWA 5F5YA 5AVFA 2JKTI 3KO6A 2P08A 4HH2A 1OTDA 2Z6CA 2HV1A 4MN5A 1TS7A 4QPRA 1V9ZA 4R6LA 2M7VA 4CQHA 4L9FA 3F1NA 1S66L 3T4LA 5HDSA 2V1BA 4GCZA 4ZRRA 2W0NA 3F1PA 3MFXA 2O9BA 4NKPA 3BY9A 2R78A 1F98A 3CLOA 4IHQA 2K31A 4L0LA 3HJKA 3S7OA 4HJ6A 2QHKA 3MF0A 2W27A 4M4XA 4GHIA 4CLCC 4EEUA 4EETB 2W1TA 3CWFA 4DJ3A 4EW7A 4KQOA 3EEAA 2WKPA 3H9WA 3C30A 2VGLM 1S1ZA 3R4KA 2HJEA 1VHMA 3C38A 3PBQA 3PYPA 4BMWA 4H6JB 2O9AA 4ARZB 4JGOA 1X0OA 4FSFA 2OOLA 2VLGA 3OLOA 1P9WA 4WEJA 1NLZA 4I38A 5LBRA 4II7A 2EA9A 2VZWA 3H7WB 2K7SA 1P9RA 4HP4A 5J7EA 5IS1A 2XRNA 3CITA 2A24B 3R7WB 1T1AA 5DKLA 1OTAA 1UGUA 4ME4A 4JGPA 1LSXA 2ZBBA 2VEAA 3MQ0A 4EESA 5DF9A 3A0RA 2V0UA 4LRYC 4UEYA 5I5LA 2OAQ1 3OBFA 1YAXA 3F1NB 4WLAA 2OWHA 5J4EA 3T4QA 2L1MA 2W3FA 4BJPA 3O5YA 1UWPX 5G4ZA 3F1PB 3UB9A 2VX8A 4I5SA 2VGLS 2JKRM 3A0VA 3CI6A 1T18A 1XFQA 2K2NA 2PD8A 3C2WA 3E4OA 4EQ1A 3KYQA 1LSVA 4GS9A 4WUJA 5MC7A 2PT7A 2W1TB 4Q0HA 2CMNA 5HDCA 2Y79A 2O9CA 2W3DA 4OOMA 3T4SA 4P6ZM 4HIAA 1OJGA 5J3WA 1YSQA 3MJQA 2QJ7A 3S7PA 3VE4A 5HD5A 3TJZC 4KUKA 4I3AA 2JHEA 3LR5A 3EQVA 1T1CA 2PR5A 3OOVA 4HY8A 2VV7A 1ODVA 3IBRA 4YNRA 3BJNA 3W2ZA 4HJ3A 3D72A 4K08A 2V1AA 2A2LA 5DJUA 4Q0IA 1LSWA 5HL6A 4G3KA 1OPXA 5TBMB 1DP6A 4WEKA 4YOFA 4B93A 4HNBA 1XJ6A 1MKMA 5HWTA 1OTEA 1TS8A 4MN6A 1TS6A 4GW9A 1V9YA 1D06A 1OTIA 3K2NA 1YSPA 4HOIA 4WELA 1GSVA 3U2AA 3ULFA 4UQIS 2OAP1 3UE3A 2ZOHA 2ZMVA 3RFBA 3PHYA 2Z6DA 2B02A 3A0SA 3MQOA 3MR0A 4XT2A 3S7QA 2JKRI 4MDZA 3LIFA 4G3VA 5HWVA 1OJ5A 3NJAA 2GNXA 4GS9B 4B9OA 2W1RA 3PXPA 2VKSA 2KOIA 2KDKA 1N9OA 4WL9A 1XJ3A 4L9EA 2PHYA 4LLOB 2W3GA 3T50A 1OT6A 3T4JA 3F1OA 1NWZA 1NRJA 3EEHA 1TF1A 2P04A 2H28A 4MN7A 2I9VA 3IS2A 3JVUA 3KX0X 3LR3A 5HPFA 2W3EA 3LIAA 3DBAA 1GSWA 5G4YA 4KUOA 3E4PA 4F3LA 1T19A 5TBMA 3UB8A 1XJ4A 3BWLA 2D01A 3V67A 3LR0A 3TE8A 4HHDA 3JVVA 1ZTUA 2WKRA 5IU1A 3EOIA 4IUKA 2J3TD 4LRXC 3LIBA 5EFWA 3MXQA 2VJWA 4Q0JA 4Z1WA 4ETXA 2HF6A 5DKKA 3NOTC 5F68A 1F9IA 1GSXA 2ZMFA 3TRCA 2B18A 4EUVA 4AFIA 3G6OA 3LR4A 3LFVA 1P0ZA 4Y3IA 3LI8A 1G6OA 3H82A 4PHTA 4EU0A 4YWZA 4BBUA 5IT5A 4WN5A 1W63Q 1EW0A 1OT9A 2GX5A 2D02A 4R38A 3UB6A 3ZQ5A 1TD5A 4CLCE 4XT2B 2KX6A 5HWWA 1T1BA 3UE6A 3KYZA 3SW1A 2V0WA 3MMHA 5C5KA 3CUEA 4HI4A 2J3WA 5TJJA 1N9NA 3T4TA 1KOUA 3C8CA 2QKPA 5K5BA 2INWA 5FL3A 3KSHA 3F1OB 2GJ3A 2PYPA 3VE3A 1NLYA 1H3QA 3HCYA 3IS2B 4DMZA 1VB6A 2YKFA 4I3IA 4F3LB 1DP9A 5F69A 4KQDA 4CLCD 5DFYA 2VV8A 4I3JA 5DFXA 1YKDA 2EWVA 4O8GA 1S4RA 3BY8A 2PD7A 3CAXA 3CUEC 1D7EA 3D3OA 3PBSA 3UMDA 1XFNA 4O0PA 3S7NA 4RQ9A 3FPWA 4NXEA 4JGRA 2Y8HA 5CX7A 5HDDA 4BWIA 2P7JA 3E0YA 4CLCA 4HQAA 2LB9A 3GDIA 4E04A 2NUTC 3EWKA 2KLIA 2XA7M 2XSSA 4G3WA 1OTBA 1P97A 3HJIA 4GJ4A 3K3CA 4P6ZS 4JGQA 3B33A 2QWSA 3H82B 3ICYA 5HD3A 4BBTA 1DP8A 3E98A 1WA9A 2G7UA 4IJGA 2VA0A 4HJ4A 4OOLA 3KSIA 5L8MA 2VV6A 2M1CA 4PKYA 1G28A 5AVEA 1LT0A 1N9LA 4Y2FA 3NOPC 3LYXA 1XJ2A 3ZYTA 3UMEA 1LL8A 1JNUA 3K3DA 3B47A 3KSFA 3EGXC 3BW6A 5A8BA 4DN0A 3RTYA 2J80A 3PBNA 4HP9A 3TW8A 3PBOA 3UB7A 4EEPA 2PR6A 1UWNX 3OCNA 3PBRA 3P7NA 2MJ6A 3PBTA 3NOUC 4HH3A 4NEED 2O99A 5HPIA 2V9AA 1MZUA 1S4SA 3T4KA 3FG8A 1DRMA 2XA7S 3BQ8A 3T4OA 2XROA 1H8MA 2JKTM 3OCLA 3OC2A 5F6AA 4GLQA 2IA2A 2QJ5A 3LI9A 3LUQA 2FZ0A 4PKYG 4CLCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RH8 B;  2BAS A;  3VOL A;  1S67 L;  4BBV A;  4I39 A;  4NXG A;  4NXF A;  4WF0 A;  5DJT A;  4NXB A;  4LRZ E;  4L9G A;  5KIZ A;  4EXO A;  3FC7 A;  1S1Y A;  3NHQ A;  5HSQ A;  4DJ2 A;  4GHI B;  2PYR A;  2OWJ A;  3MQQ A;  3LID A;  4H6J A;  4LPZ A;  2WKQ A;  3E4Q A;  1Y28 A;  1TS0 A;  5HZH A;  3GEC A;  3LIC A;  2YKH A;  3LIE A;  2JN7 A;  2ZOI A;  2PDR A;  3H7W A;  2L4R A;  2L0W A;  4R70 A;  2A24 A;  4EER A;  4R3A A;  1BYW A;  5F5Y A;  5AVF A;  4HH2 A;  1OTD A;  2Z6C A;  2HV1 A;  4MN5 A;  1TS7 A;  1V9Z A;  4R6L A;  4L9F A;  3F1N A;  1S66 L;  5HDS A;  2V1B A;  4GCZ A;  2W0N A;  3F1P A;  3MFX A;  3BY9 A;  2R78 A;  1F98 A;  3CLO A;  3HJK A;  4HJ6 A;  2QHK A;  2W27 A;  4M4X A;  4GHI A;  4EEU A;  4EET B;  3CWF A;  4DJ3 A;  4EW7 A;  2WKP A;  3H9W A;  1S1Z A;  3PYP A;  4H6J B;  4JGO A;  1X0O A;  2OOL A;  2VLG A;  3OLO A;  4I38 A;  2EA9 A;  3H7W B;  2K7S A;  4HP4 A;  5J7E A;  5IS1 A;  2A24 B;  1T1A A;  5DKL A;  1OTA A;  1UGU A;  4JGP A;  1LSX A;  2ZBB A;  2VEA A;  4EES A;  3A0R A;  2V0U A;  4LRY C;  5I5L A;  3F1N B;  4WLA A;  2OWH A;  5J4E A;  2L1M A;  1UWP X;  5G4Z A;  3F1P B;  3UB9 A;  4I5S A;  3A0V A;  1T18 A;  1XFQ A;  2PD8 A;  3C2W A;  3E4O A;  4EQ1 A;  1LSV A;  4GS9 A;  4WUJ A;  2CMN A;  5HDC A;  5J3W A;  4HIA A;  1OJG A;  3MJQ A;  2QJ7 A;  3VE4 A;  5HD5 A;  4KUK A;  4I3A A;  2JHE A;  1T1C A;  2PR5 A;  4HY8 A;  2VV7 A;  1ODV A;  3IBR A;  4HJ3 A;  3D72 A;  4K08 A;  2V1A A;  5DJU A;  1LSW A;  5TBM B;  1DP6 A;  4HNB A;  1XJ6 A;  5HWT A;  1OTE A;  1TS8 A;  4MN6 A;  1TS6 A;  4GW9 A;  1V9Y A;  1D06 A;  1OTI A;  4HOI A;  1GSV A;  3ULF A;  2ZOH A;  3PHY A;  2Z6D A;  2B02 A;  3A0S A;  3MQO A;  3MR0 A;  4XT2 A;  3LIF A;  5HWV A;  1OJ5 A;  3NJA A;  4GS9 B;  4B9O A;  2KDK A;  1N9O A;  4WL9 A;  1XJ3 A;  4L9E A;  2PHY A;  4LLO B;  3T50 A;  1OT6 A;  3F1O A;  1NWZ A;  3EEH A;  2H28 A;  2I9V A;  3IS2 A;  3KX0 X;  3LIA A;  1GSW A;  5G4Y A;  4KUO A;  3E4P A;  4F3L A;  1T19 A;  5TBM A;  3UB8 A;  1XJ4 A;  3BWL A;  2D01 A;  4HHD A;  2WKR A;  5IU1 A;  4LRX C;  3LIB A;  5EFW A;  3MXQ A;  5DKK A;  3NOT C;  5F68 A;  1F9I A;  1GSX A;  3G6O A;  1P0Z A;  3LI8 A;  3H82 A;  4YWZ A;  4BBU A;  4WN5 A;  1EW0 A;  1OT9 A;  2D02 A;  4R38 A;  3UB6 A;  3ZQ5 A;  4XT2 B;  2KX6 A;  5HWW A;  1T1B A;  3UE6 A;  3SW1 A;  2V0W A;  4HI4 A;  1N9N A;  1KOU A;  3C8C A;  2QKP A;  2INW A;  3F1O B;  2GJ3 A;  2PYP A;  3VE3 A;  3IS2 B;  1VB6 A;  2YKF A;  4I3I A;  4F3L B;  1DP9 A;  5F69 A;  4KQD A;  2VV8 A;  4I3J A;  1S4R A;  3BY8 A;  2PD7 A;  3CAX A;  1D7E A;  3UMD A;  1XFN A;  4RQ9 A;  4NXE A;  4JGR A;  5HDD A;  2P7J A;  4HQA A;  3GDI A;  4E04 A;  3EWK A;  1OTB A;  1P97 A;  3HJI A;  3K3C A;  4JGQ A;  3B33 A;  2QWS A;  3H82 B;  3ICY A;  5HD3 A;  4BBT A;  1DP8 A;  1WA9 A;  4HJ4 A;  2VV6 A;  2M1C A;  4PKY A;  1G28 A;  5AVE A;  1LT0 A;  1N9L A;  3NOP C;  3LYX A;  1XJ2 A;  3UME A;  1LL8 A;  1JNU A;  3K3D A;  5A8B A;  3RTY A;  2J80 A;  4HP9 A;  3UB7 A;  4EEP A;  2PR6 A;  1UWN X;  3P7N A;  3NOU C;  4HH3 A;  2V9A A;  1MZU A;  1S4S A;  3FG8 A;  1DRM A;  5F6A A;  2QJ5 A;  3LI9 A;  3LUQ A;  4PKY G; 
#chains in the Genus database with same CATH topology
 2M7U A;  1W63 M;  3BM6 A;  2HJ9 C;  1PZO A;  3EQU A;  4FUW A;  3CPT A;  3Q7V A;  4E6X A;  4MMN A;  4OH0 A;  4NXF A;  4OP5 A;  3ITB A;  1JWP A;  4NXB A;  1K6S A;  5KSH A;  2GZA A;  3LO7 A;  1SCW A;  4YFM A;  4XUZ A;  1J9M A;  3B42 A;  4PM7 A;  4IUH A;  3A3E A;  4DJ2 A;  5E2E A;  1TDL A;  4Y7P A;  5DVA A;  4JF6 A;  4LPZ A;  1W5D A;  4B88 A;  5HZH A;  3GEC A;  2XR0 A;  1HTZ A;  2PAV P;  1IOU A;  2WYX A;  2ZOI A;  4HBT A;  2Y2G A;  1IEL A;  2P9V A;  3M6H A;  1ZC2 A;  2Q0O A;  2RL3 A;  4LEN A;  5HAP A;  2Z6C A;  1TS7 A;  2V8F A;  4D60 A;  4CQH A;  4R6L A;  2HDQ A;  3HLE A;  2HPB A;  2B5R A;  4GCZ A;  4MBH A;  2Y2J A;  2O9B A;  1VET B;  2R78 A;  1F98 A;  4DE0 A;  1YPR A;  2R9X A;  4M4X A;  4GHI A;  4UA6 A;  5CHM A;  4EET B;  3CWF A;  3W4P A;  2WAF A;  4EW7 A;  4KQO A;  4OP8 A;  4ZJ2 A;  2FFF B;  1PZP A;  4LV0 A;  4FTX A;  1VHM A;  2Y2N A;  4ARZ B;  3A3J A;  3OLO A;  1P9W A;  4R0Q A;  2HP5 A;  4I38 A;  3G2Z A;  5GHZ A;  1L3L A;  2V2F F;  3HVF A;  1K54 A;  2EA9 A;  3BFG A;  3H7W B;  4OPR A;  2XRN A;  3CIT A;  3R7W B;  1T1A A;  5DKL A;  1OTA A;  2I72 A;  4PM8 A;  3IWQ A;  4C3Q A;  3MQ0 A;  4GN2 A;  2V0U A;  2IWC A;  3OBF A;  2PU4 A;  5FDH A;  3ZHH A;  1LHY A;  2WGV A;  4WLA A;  2L1M A;  2EX8 A;  3HLC A;  4JXG A;  5FAO A;  5CGW A;  2VX8 A;  4Y0O A;  4DF6 A;  1L0F A;  3SS3 A;  2H10 A;  1T18 A;  1XFQ A;  4ZJ3 A;  3C2W A;  1LSV A;  5MC7 A;  2EFX A;  3FV7 A;  4OLD A;  3VE4 A;  3TJZ C;  4S2L A;  4RVA A;  5A90 A;  1MWS A;  1F2K A;  1T1C A;  4IED A;  3OOV A;  1Z09 A;  1XKZ A;  4JF5 A;  4X56 A;  1ODV A;  4CPK A;  3BYD A;  2ACG A;  3IWI A;  4K08 A;  2X71 A;  5FQJ A;  1LSW A;  1MWT A;  1OME A;  1AWI A;  2Y55 A;  4OPQ A;  1OPX A;  5TBM B;  3BFE A;  4LGW A;  2EXB A;  4OLG A;  1CI8 A;  3MKF A;  4N92 A;  1MKM A;  5HWT A;  1OTE A;  3VFH A;  1TS8 A;  4MN6 A;  1TS6 A;  1V9Y A;  3DTE A;  5EVE A;  4EWF A;  3VP2 A;  1G5U A;  3ZFZ A;  4WEL A;  4JXV A;  2OAP 1;  2ZOH A;  2ZMV A;  4QU3 A;  3T12 B;  2ZQ8 A;  1PWC A;  3PHY A;  3TSG A;  2XH9 A;  4KZ6 A;  3MR0 A;  5M18 A;  5EOO A;  3UB5 P;  5G18 A;  1OJ5 A;  2A3U A;  4B9O A;  2R9W A;  3PXP A;  4NET A;  2PHY A;  5L09 A;  5L2F A;  4WZ5 C;  4DXC A;  3UN7 A;  3E2K A;  2X01 A;  3F1O A;  1SKO B;  2P04 A;  2ZQA A;  1G6A A;  1KE4 A;  3MBZ A;  3IS2 A;  3DBA A;  4KUO A;  3HL9 A;  1BLS A;  1XJ4 A;  3IF5 A;  3WS0 A;  2Q9N A;  2ZJ9 A;  1NY0 A;  3TE8 A;  3JVV A;  3BFF A;  5EFW A;  3MXQ A;  1H5X A;  5EVI B;  2HF6 A;  2PBY A;  5DKK A;  4U3T A;  5DTT A;  5F68 A;  3S1Y A;  1F9I A;  2ZMF A;  3WRT A;  5FQM A;  2XDM A;  1YLJ A;  3G6O A;  4OPZ A;  3ZG0 A;  5AQA A;  4E3M A;  4Y3I A;  3H82 A;  2Y2Q A;  4Y0T A;  1E3U D;  1EW0 A;  1OT9 A;  2GX5 A;  3UB6 A;  3ZQ5 A;  1TD5 A;  4XT2 B;  1ES4 A;  2KX6 A;  3FKV A;  3HRE A;  3VP1 A;  3HBR A;  1T1B A;  3KYZ A;  3SW1 A;  1IEM A;  3ZVT A;  3CUE A;  1N9N A;  5EPH A;  2JBF A;  1FR1 A;  5GLA A;  1IKI A;  2INW A;  5EV0 A;  2WGW B;  1LL9 A;  3KSH A;  1SZV A;  2PYP A;  3VE3 A;  4UA9 A;  1BUE A;  1PI4 A;  5EM0 A;  1VB6 A;  3C4O A;  5TGF A;  3DAV A;  4CLC D;  4ZBE A;  4WMC D;  2OLU A;  3CAX A;  5FSR A;  2FFY A;  4O0P A;  1XP4 A;  1MY8 A;  3NY4 A;  3S7N A;  2IWB A;  2HDU A;  2Y8H A;  4BWI A;  4NG2 A;  1Q2Q A;  1NRF A;  1YM1 A;  3HLW A;  1P97 A;  1FR6 A;  2QWS A;  3LY3 A;  3VP0 A;  3IXD A;  3LY4 A;  4LV1 A;  1K4E A;  2G7U A;  2RCX A;  2VA0 A;  4S2I A;  5EVI C;  4PKY A;  4WZ4 A;  1FQG A;  2EXA A;  4PM5 A;  3ZYT A;  3MXR A;  1ONH A;  3KSF A;  3BW6 A;  4DN0 A;  3RTY A;  3UE0 A;  5F82 A;  3NC8 A;  3QNC A;  1UWN X;  3PBR A;  3P7N A;  2MJ6 A;  3PBT A;  1ZKJ A;  1SDN A;  2J7V A;  1S4S A;  2Y59 A;  2V1Z A;  3T4K A;  4O7D A;  3FG8 A;  1ESU A;  3QHY A;  5AQB A;  1PW1 A;  1A0K A;  3P98 A;  3SS4 A;  3OCL A;  5CGX A;  3BEC A;  2QJ5 A;  2VK3 A;  3LI9 A;  5DF7 A;  3AGD A;  4E3N A;  3CZD A;  4O01 A;  3FZC A;  2ZC7 A;  1PYY A;  1JWZ A;  1IFQ A;  2UV0 E;  2XLN A;  1S67 L;  1VET A;  3ZVW A;  4I39 A;  2XD1 A;  4KEN B;  1LI9 A;  3I7J A;  2J8Y A;  4DXB A;  4GOG A;  4LRZ E;  5AJG A;  2FH5 A;  2DMW A;  5FAT A;  3FC7 A;  4EXO A;  1KDS A;  1SHV A;  3IX3 A;  3NHQ A;  5HSQ A;  2G2U A;  2J3T C;  2OWJ A;  4HEF A;  3BLM A;  3LID A;  4ARZ A;  1PFL A;  3E4Q A;  4DE1 A;  2LB5 A;  3LIC A;  1VM1 A;  4X6T A;  4GD8 A;  3BQA A;  3N6I A;  3FPV A;  4PM9 A;  4BQM A;  3H7W A;  4E3O A;  1TVF A;  3VSK A;  1WYB A;  3UDX A;  2H5S A;  4S2J A;  3R7W A;  3UDF A;  1I2W A;  5EVL A;  5F5Y A;  5FAQ A;  3KO6 A;  3QP1 A;  5DTK A;  4JLF A;  3W4O A;  3CMZ A;  2M7V A;  4L9F A;  1W8Y A;  1FIK A;  4S2M A;  1EWZ A;  1S66 L;  5HDS A;  2V1B A;  4OVD A;  4WZ5 A;  2Z2L B;  4IVI A;  2JKG A;  5A93 A;  1ZG4 A;  4IHQ A;  3O3V A;  4KZ5 A;  4L0L A;  4X55 A;  3HJK A;  3JPU A;  4HJ6 A;  2QHK A;  3Q81 A;  1W79 A;  1CEF A;  1BSG A;  4MEZ A;  3WS1 A;  3M6B A;  5A92 A;  3H9W A;  4JXS A;  4BLM A;  1XXM A;  1S1Z A;  4H6J B;  1X0O A;  3AGF A;  4FSF A;  2OOL A;  4KZ8 A;  2HP6 A;  3WRZ A;  4U0T A;  1NLZ A;  4P85 A;  5LBR A;  4EBL A;  1P9R A;  4B4X A;  5IS1 A;  3ZDJ A;  1NZU A;  4N9L A;  3D9Y A;  2A24 B;  3DWK A;  1Z6F A;  2JCH A;  4OON A;  1UGU A;  1LSX A;  4K91 A;  2ZBB A;  3WS4 A;  3HLF A;  1MXO A;  2VEA A;  1VQQ A;  5DF9 A;  5GLC A;  3G30 A;  5I5L A;  2ZM8 A;  4R23 A;  2OAQ 1;  1YAX A;  4P87 A;  2OWH A;  2GDN A;  3UO9 A;  4WBG A;  4BJP A;  3O5Y A;  1UWP X;  2QZ6 A;  3F1P B;  1KGG A;  1ERQ A;  1K6R A;  2VGL S;  3A0V A;  4WM9 A;  4LFU A;  2K2N A;  4EQ1 A;  3VOY A;  5KMW A;  4Q8I A;  5AQ7 A;  3O86 A;  2CMN A;  2W3D A;  1CJF A;  3MJQ A;  1ZG6 A;  3S7P A;  4KUK A;  2PU2 A;  1SKO A;  1BLH A;  4K0W A;  3SZT A;  4E3L A;  3ZNT A;  1Y4O A;  3W2Z A;  3BJN A;  4MLL A;  2V1A A;  3G2Y A;  4Q0I A;  4QY6 A;  2JE5 A;  4YOF A;  4BD0 A;  3N8R A;  5CTM A;  5FI7 A;  1QMF A;  1HLU P;  3T1S A;  1O7E A;  1OTI A;  5I94 A;  3PAE A;  3SH8 A;  3UE3 A;  4YIN A;  4ZDX A;  2Z6D A;  4JPM A;  5CHJ A;  5A91 A;  3BLS A;  4XT2 A;  3S7Q A;  2JKR I;  3LIF A;  2E8I A;  4G3V A;  4OQG A;  1PWG A;  3CG5 A;  2WKH A;  3P09 A;  2VKS A;  1PNE A;  1FSW A;  1N9O A;  4PM6 A;  4DE2 A;  3LEZ A;  4Y0U A;  1GCE A;  3MKE A;  2WGW A;  1NWZ A;  1NRJ A;  3EEH A;  1TF1 A;  1K55 C;  4MN7 A;  5FI6 A;  4BD1 A;  5HX9 A;  4JBF A;  3CHW P;  2W3E A;  5G4Y A;  3E4P A;  1T19 A;  4E3K A;  3MZD A;  3UB8 A;  4IBR A;  2CC1 A;  1ZTU A;  1H0M A;  1MBL A;  4MBF A;  1I2S A;  3EOI A;  3LIB A;  4Q0J A;  1KDW A;  3HLG A;  3C7V A;  2B18 A;  4EUV A;  4QJG A;  4AFI A;  3LR4 A;  3PTE A;  4RX2 A;  3LFV A;  1P0Z A;  1ESI A;  1G6O A;  3LI8 A;  4N1H A;  4PHT A;  4YWZ A;  4BBU A;  4F94 A;  5IT5 A;  4KZ7 A;  4X68 A;  4KZ4 A;  1ACF A;  2V0W A;  1LLB A;  4E3I A;  3M2J A;  4Y13 A;  2EX6 A;  3SH9 A;  5K5B A;  5EE8 A;  5FL3 A;  3N8L A;  2XF3 A;  5FAS A;  1NLY A;  1H3Q A;  3HCY A;  4DRT A;  3GSG A;  1L0G A;  2AVX A;  5CGS A;  1DP9 A;  4KQD A;  1W8Q A;  4GD6 A;  5DFX A;  4Y15 A;  3TOI A;  1S4R A;  3UPO A;  3BRM A;  2UWX A;  3BY8 A;  2PD7 A;  3UMD A;  1XFN A;  1DJA A;  2JC7 A;  3E0Y A;  3FKW A;  1NXY A;  1OTB A;  4C75 A;  3B33 A;  5EM1 A;  2HZ5 A;  2XGN A;  5HD3 A;  3ZCZ A;  1DP8 A;  3E98 A;  3MFD A;  5FQI A;  4EBP A;  1CQA A;  4HJ4 A;  3KSI A;  1YLT A;  5L8M A;  3UPN A;  2M1C A;  5KSC A;  4OQH A;  5L07 A;  5HL1 A;  3D4F A;  1I5Q A;  5GHY A;  4HBU A;  1KGE A;  1LT0 A;  3GR2 A;  3LYX A;  2QMI A;  4HES A;  1JNU A;  5A8B A;  4HP9 A;  3PBO A;  1W7F A;  2PR6 A;  4ZTK A;  3OCN A;  1K56 A;  3NOU C;  5HPI A;  1TDG A;  1MZU A;  2XA7 S;  2DRW A;  3FWL A;  3UY6 A;  5EUA A;  1WE4 A;  1H8M A;  4S2P A;  1EI5 A;  1HVB A;  3C7U A;  3OC2 A;  4P6B A;  1IYQ A;  4GKU A;  4KG5 A;  4PKY G;  5FEF A;  4P0M A;  3RH8 B;  3GTC A;  1N9B A;  2BAS A;  3V3S A;  3VOL A;  1U60 A;  3KSG A;  3GMW A;  3EGD C;  3UNW A;  4NXG A;  4PAU A;  2BTF P;  3S22 A;  4X25 A;  4WF0 A;  5DJT A;  3RXX A;  1MC0 A;  3MXS A;  4L9G A;  5KIZ A;  4PMA A;  1TEM A;  4GHI B;  3OPR A;  3MQQ A;  1F5M A;  1KVL A;  4H6J A;  1XA1 A;  4R4R A;  2Y2H A;  3P01 A;  2WKQ A;  1Y28 A;  3LEQ A;  1TS0 A;  1IYO A;  2W3H A;  1L2S A;  4ETZ A;  1DY6 A;  4A5R A;  4QD4 A;  2NUP C;  4Y5F A;  2L4R A;  4R4S A;  4NK3 A;  2A24 A;  1CF0 A;  3M2K A;  1K0K A;  2J9O A;  4Y17 A;  3VMA A;  2JKT I;  2P08 A;  4HH2 A;  5KZH A;  1OTD A;  2HV1 A;  3E2L A;  4QPR A;  3T4L A;  5TFQ A;  2Y2I A;  4ZRR A;  3V50 A;  2W0N A;  3F1P A;  3VP4 A;  4K0X A;  4NKP A;  1K55 A;  4LCL A;  3CLO A;  3NI9 A;  4MBK A;  2K31 A;  3S7O A;  2PBD P;  2WAD A;  1ALQ A;  1IYS A;  4DJ3 A;  5GLB A;  4ESP A;  1GA0 A;  3EEA A;  3QP4 A;  4EBN A;  4GNU A;  3PAG A;  2VGL M;  3R4K A;  2HJE A;  3W8K A;  1XGI A;  2O9A A;  3HUM A;  2VLG A;  4WEJ A;  4KQR A;  4BL3 A;  1O07 A;  3SOI A;  2VZW A;  2K7S A;  1MPL A;  4HP4 A;  3VSL A;  3O88 A;  3NUL A;  5CHU A;  4N1X A;  2Y91 A;  4ME4 A;  1YMS A;  1PRQ A;  1K25 A;  2G2W A;  4UEY A;  5FQ9 A;  3V3R A;  1WYC A;  3F1N B;  5J4E A;  2HDS A;  3QP2 A;  3Q7Z A;  5E43 A;  3UB9 A;  4RA7 A;  3T1R A;  4I5S A;  1JTD A;  4KZB A;  3CI6 A;  4QY5 A;  2EX2 A;  3KYQ A;  4WUJ A;  2W1T B;  3OZH A;  5GLD A;  5HDC A;  2O9C A;  4HIA A;  2QJ7 A;  4I3A A;  3LR5 A;  2PR5 A;  4HY8 A;  2VV7 A;  4CJN A;  5F1F A;  2ZQ9 A;  4B4Z A;  3IBR A;  4OPY A;  4HJ3 A;  3D72 A;  5EVI D;  5DJU A;  5F1G A;  3N4I A;  3NDG A;  4G3K A;  4H8R A;  5CXW A;  1MWR A;  1DP6 A;  4WEK A;  3QP5 A;  4B93 A;  4OKP A;  3MZE A;  5FI2 A;  4GZB A;  3LGO A;  4GW9 A;  1D06 A;  5HAQ A;  3K2N A;  4PPR A;  4HOI A;  4ZJ1 A;  2OLV A;  2JKF A;  1GSV A;  3ULF A;  4DDY A;  4RX3 A;  3RFB A;  5E2G A;  1GHI A;  3GV9 A;  2B02 A;  3OPH A;  2WKE A;  1ES5 A;  3NJA A;  3QP6 A;  4QWO A;  4GS9 B;  3NBL A;  2W1R A;  2BG1 A;  2KOI A;  2KDK A;  5U47 A;  2W3G A;  3T50 A;  2H0Y A;  1YLW A;  1OT6 A;  3T4J A;  1FSY A;  1K57 C;  1BUL A;  4X69 A;  2H28 A;  2V8C A;  3WS5 A;  2VGJ A;  3LR3 A;  5FEG A;  5TBM A;  4KG6 A;  3L9K A;  2X02 A;  3BWL A;  3V67 A;  3LR0 A;  4HHD A;  4EUZ A;  3IHB A;  2WKR A;  2J3T D;  4LRX C;  5AQ9 A;  4Z1W A;  5CER A;  3NOT C;  4UA7 A;  4S2K A;  3T1X A;  4X53 A;  1GSX A;  1LI0 A;  3RJU A;  4E3J A;  3IT9 A;  2ZC3 B;  1W63 Q;  4R38 A;  3UE1 A;  1ES3 A;  3OPP A;  1BLC A;  1Q2P A;  4CLC E;  2VGK A;  4ID4 A;  2XFT A;  3MMH A;  4LV3 A;  4FH2 A;  4HI4 A;  3C5A A;  3Q07 A;  1YMX A;  1VEU B;  2QKP A;  4KQQ A;  1KE0 A;  4UHU A;  4KZ9 A;  3DTK A;  2YKF A;  5HW3 A;  4F3L B;  1NYY A;  5F69 A;  5DFY A;  4I3J A;  1YKD A;  2EWV A;  2ZD8 A;  5EVI A;  2ZM0 A;  1Y54 A;  5BOH A;  3CUE C;  3DTI A;  3PBS A;  1XGJ A;  2XFS A;  4NXE A;  5HDD A;  4IBX A;  4HQA A;  3GDI A;  3ZG9 B;  2NUT C;  3G34 A;  2KLI A;  2XA7 M;  5FA7 A;  5J8X A;  3HJI A;  3K3C A;  3Q82 A;  3C4P A;  4JGQ A;  3BEB A;  3IF6 B;  4BBT A;  2ZC4 B;  2Y2L A;  1CEG A;  5GHX A;  1WA9 A;  1KVM A;  2VV6 A;  4ZAM A;  1ONG A;  4KG2 A;  2ZMA A;  1G28 A;  5AVE A;  4R3B A;  1N9L A;  4Y2F A;  3NOP C;  1RCJ A;  1XJ2 A;  3GRJ A;  1K56 D;  3JYI A;  3UME A;  1LL8 A;  2ZL1 B;  2Y4A A;  4BEN A;  3EGX C;  4EV4 A;  1K4F A;  3HLD A;  1S6R A;  3PBN A;  3UB7 A;  1MWU A;  2IWD A;  4NEE D;  2EFU A;  2V9A A;  2BLS A;  1DRM A;  3BQ8 A;  2QPN A;  1FCN A;  1RP5 A;  4KZA A;  2XRO A;  4S2N C;  4C6Y A;  2HDR A;  3ZNY A;  5E2H A;  4GLQ A;  5DTS A;  3LUQ A;  3QNB A;  2FZ0 A;  2P74 A;  4CLC B;  1ES2 A;  3GVB A;  4MCW A;  4U0X A;  4DKI A;  3IX4 A;  2ZLY A;  4M3K A;  1S0W A;  4BBV A;  3MZF A;  1SDE A;  2OV5 A;  4FD8 A;  2O0Y A;  2HGV A;  1XPB A;  2ZQC A;  1S1Y A;  3NEC A;  2PYR A;  4UQI M;  1M6K A;  3VOZ A;  2EWW A;  3PR6 A;  3IF6 C;  4BL2 A;  1L0E A;  4D2O A;  3NCK A;  1ZHH B;  1STZ A;  5D3O A;  3NDE A;  2OSU A;  2YKH A;  1BT5 A;  3IBJ A;  3LIE A;  2QYB A;  2JN7 A;  2PDR A;  3HUN A;  3MSH A;  4FOF A;  3VV4 A;  2ZC5 B;  4OOY A;  2L0W A;  4R70 A;  4EER A;  1JVJ A;  4R3A A;  5E2F A;  1BYW A;  5AVF A;  3ZG5 A;  5HAR A;  1RGZ A;  1KGF A;  3ISG A;  4LV2 A;  4MN5 A;  1V9Z A;  2Q9M A;  3F1N A;  4GB7 A;  3ZG8 B;  4IVK A;  3CPT B;  2Y2M A;  2H0T A;  3Q7V B;  4OQI A;  3MFX A;  1K57 A;  3BY9 A;  4DE3 A;  2XD5 A;  5HFO A;  1YLY A;  3IXG A;  1HD8 A;  1FCO A;  2C5W B;  3MF0 A;  4JKT A;  2W27 A;  4CLC C;  4EEU A;  2XEP A;  2W1T A;  2WKI A;  2WKP A;  3C30 A;  3LCE A;  2EX9 A;  3C38 A;  3PBQ A;  3IXB A;  3PYP A;  1H8Y A;  4BMW A;  1PWD A;  3N8S A;  4JGO A;  5FAP A;  1QME A;  3UPP A;  5EEC A;  1PIO A;  3ITA A;  4II7 A;  5J7E A;  2Y2O A;  2P9V B;  3DW0 A;  3NIA A;  4JGP A;  1C3B A;  1FOF A;  1ERO A;  4EES A;  5JYO A;  2WGI A;  3A0R A;  4LRY C;  1G68 A;  2XK1 A;  3T4Q A;  2A49 A;  2W3F A;  4KZ3 A;  1AXB A;  5G4Z A;  4GDB A;  4EQI A;  1RGY A;  1H8Z A;  2JKR M;  5HAI A;  5CRF A;  3HUO A;  1NJ4 A;  1MKI A;  2Y2K A;  2PD8 A;  3E4O A;  1ERM A;  3FYZ A;  3OPL A;  4DDS A;  4GS9 A;  2PT7 A;  4Q0H A;  2Y79 A;  4OOM A;  3T4S A;  4P6Z M;  1XX2 A;  5J3W A;  1OJG A;  1YSQ A;  1LL5 A;  1BZA A;  5HD5 A;  4Z9Q A;  1IKG A;  2JHE A;  3EQV A;  3A3F A;  3UDI A;  4R3J A;  3T1Q B;  4YNR A;  2A2L A;  5HL6 A;  4XUX A;  2Y2P A;  3IWO A;  3ZGA B;  2ZM2 A;  3G31 A;  3BFC A;  1NYM A;  3B3X A;  4HNB A;  1E25 A;  1XJ6 A;  3Q1F A;  3O87 A;  4UAA A;  3HLB A;  3ZG7 B;  4RYE A;  1XA7 A;  3AGE A;  1YSP A;  5FQQ A;  1CK3 A;  3VP3 A;  3U2A A;  2DCF A;  4UQI S;  5JYP A;  1BTL A;  3A0S A;  3MQO A;  4FCF A;  4MDZ A;  5L10 A;  5HWV A;  1YT4 A;  2WZZ A;  2WZX A;  2GNX A;  2ZC6 B;  3QP8 A;  1YLP A;  2PRF A;  5TR7 A;  1VEU A;  4E6W A;  4WL9 A;  1XJ3 A;  4L9E A;  4LLO B;  3IH8 A;  4S2N A;  1BLP A;  3U4L P;  1YLZ A;  1L0D A;  2I9V A;  5CED A;  4QHC A;  3JVU A;  3SS5 A;  2C6W B;  3KX0 X;  5HPF A;  2DNS A;  3LIA A;  1SKF A;  1CI9 A;  1GSW A;  4F3L A;  4FH4 A;  2D01 A;  2E8J A;  2HP9 A;  5IU1 A;  4IUK A;  3G4P A;  2VJW A;  1HZO A;  4ETX A;  3MS6 A;  2WUQ A;  1KE3 A;  2XQZ A;  3TRC A;  1NZO A;  3IH9 A;  1GHP A;  4N9K A;  3SH7 A;  3L7H A;  5DF8 A;  1K54 C;  3V39 A;  3IF6 A;  4EU0 A;  4JF4 A;  4S2O A;  5M19 A;  4WN5 A;  1K38 A;  1YQS A;  2D02 A;  3GQZ A;  5HWW A;  3UE6 A;  4X1M A;  5C5K A;  3KYE A;  2J3W A;  5TJJ A;  1E3U A;  1JWV A;  3IHA A;  1J3W A;  3IXH A;  3S4X A;  3T4T A;  1E4D A;  1KOU A;  1DJC A;  3C8C A;  2ZL1 A;  5GL9 A;  4R1G A;  3F1O B;  2GJ3 A;  3V5M A;  1M40 A;  3CJM A;  1FIL A;  3IS2 B;  2J9P A;  4DMZ A;  4XXR A;  4I3I A;  2WAE A;  3IQA A;  3RXW A;  4QB8 A;  2VV8 A;  2ZQ7 A;  4O8G A;  1D7E A;  3D3O A;  5CEB A;  3VFF A;  3N7W A;  5FQK A;  4RQ9 A;  3FPW A;  4JGR A;  2Z2M B;  5CX7 A;  1JTG A;  2P7J A;  4CLC A;  3G32 A;  2LB9 A;  4MNR A;  4E04 A;  3EWK A;  1IYP A;  4G3W A;  2XSS A;  3TG9 A;  4WMC A;  3IX8 A;  4GJ4 A;  4P6Z S;  3DWZ A;  4WYY A;  3H82 B;  3ICY A;  3G35 A;  5CEC A;  1FCM A;  4IJG A;  4OOL A;  3A3D A;  3WWX A;  1PI5 A;  1PW8 A;  3DTM A;  5IHV A;  2ZQD A;  3K3D A;  3B47 A;  2V20 A;  3W4Q A;  5CTN A;  1GHM A;  2B95 A;  2J80 A;  3TW8 A;  5FDS A;  4EEP A;  4X1L A;  5EOE A;  1DJB A;  4HH3 A;  2O99 A;  4GDN A;  3WS2 A;  3A3I A;  1GA9 A;  3T4O A;  1N4O A;  5M1A A;  2JKT M;  4JXW A;  5F6A A;  2WK0 A;  2IA2 A;  4LCM A;  5F83 A;  4OQ0 A;  3BFD A;  1D1J A; 
#chains in the Genus database with same CATH homology
 4O01 A;  2M7U A;  3RH8 B;  1W63 M;  2HJ9 C;  2BAS A;  4MCW A;  1IFQ A;  3EQU A;  3VOL A;  3KSG A;  1S67 L;  3EGD C;  4BBV A;  4I39 A;  4MMN A;  4NXG A;  4PAU A;  4NXF A;  4WF0 A;  5DJT A;  1MC0 A;  4NXB A;  5KSH A;  2GZA A;  4LRZ E;  4L9G A;  5AJG A;  2FH5 A;  2O0Y A;  5KIZ A;  2DMW A;  4EXO A;  3FC7 A;  2HGV A;  3B42 A;  1S1Y A;  3NHQ A;  4IUH A;  5HSQ A;  4DJ2 A;  4GHI B;  2PYR A;  2J3T C;  2OWJ A;  4UQI M;  3MQQ A;  1F5M A;  2EWW A;  3LID A;  3PR6 A;  4H6J A;  4ARZ A;  3P01 A;  4LPZ A;  2WKQ A;  3E4Q A;  1Y28 A;  1TS0 A;  1ZHH B;  1STZ A;  5HZH A;  3GEC A;  2LB5 A;  2W3H A;  3LIC A;  2YKH A;  3IBJ A;  1IOU A;  3LIE A;  2QYB A;  3BQA A;  4ETZ A;  2JN7 A;  2ZOI A;  2PDR A;  3FPV A;  3H7W A;  4FOF A;  2NUP C;  4Y5F A;  3VV4 A;  2L4R A;  2L0W A;  4R70 A;  2A24 A;  3R7W A;  4EER A;  4R3A A;  1BYW A;  5F5Y A;  5AVF A;  2JKT I;  3KO6 A;  2P08 A;  4HH2 A;  1OTD A;  2Z6C A;  2HV1 A;  4MN5 A;  1TS7 A;  4QPR A;  1V9Z A;  4R6L A;  2M7V A;  4CQH A;  4L9F A;  3F1N A;  1S66 L;  3T4L A;  5HDS A;  2V1B A;  4GCZ A;  4ZRR A;  2W0N A;  3F1P A;  3MFX A;  2O9B A;  4NKP A;  3BY9 A;  2R78 A;  1F98 A;  3CLO A;  4IHQ A;  2K31 A;  4L0L A;  3HJK A;  3S7O A;  4HJ6 A;  2QHK A;  3MF0 A;  2W27 A;  4M4X A;  4GHI A;  4CLC C;  4EEU A;  4EET B;  2W1T A;  3CWF A;  4DJ3 A;  4EW7 A;  4KQO A;  3EEA A;  2WKP A;  3H9W A;  3C30 A;  2VGL M;  1S1Z A;  3R4K A;  2HJE A;  1VHM A;  3C38 A;  3PBQ A;  3PYP A;  4BMW A;  4H6J B;  2O9A A;  4ARZ B;  4JGO A;  1X0O A;  4FSF A;  2OOL A;  2VLG A;  3OLO A;  1P9W A;  4WEJ A;  1NLZ A;  4I38 A;  5LBR A;  4II7 A;  2EA9 A;  2VZW A;  3H7W B;  2K7S A;  1P9R A;  4HP4 A;  5J7E A;  5IS1 A;  2XRN A;  3CIT A;  2A24 B;  3R7W B;  1T1A A;  5DKL A;  1OTA A;  1UGU A;  4ME4 A;  4JGP A;  1LSX A;  2ZBB A;  2VEA A;  3MQ0 A;  4EES A;  5DF9 A;  3A0R A;  2V0U A;  4LRY C;  4UEY A;  5I5L A;  2OAQ 1;  3OBF A;  1YAX A;  3F1N B;  4WLA A;  2OWH A;  5J4E A;  3T4Q A;  2L1M A;  2W3F A;  4BJP A;  3O5Y A;  1UWP X;  5G4Z A;  3F1P B;  3UB9 A;  2VX8 A;  4I5S A;  2VGL S;  2JKR M;  3A0V A;  3CI6 A;  1T18 A;  1XFQ A;  2K2N A;  2PD8 A;  3C2W A;  3E4O A;  4EQ1 A;  3KYQ A;  1LSV A;  4GS9 A;  4WUJ A;  5MC7 A;  2PT7 A;  2W1T B;  4Q0H A;  2CMN A;  5HDC A;  2Y79 A;  2O9C A;  2W3D A;  4OOM A;  3T4S A;  4P6Z M;  4HIA A;  1OJG A;  5J3W A;  1YSQ A;  3MJQ A;  2QJ7 A;  3S7P A;  3VE4 A;  5HD5 A;  3TJZ C;  4KUK A;  4I3A A;  2JHE A;  3LR5 A;  3EQV A;  1T1C A;  2PR5 A;  3OOV A;  4HY8 A;  2VV7 A;  1ODV A;  3IBR A;  4YNR A;  3BJN A;  3W2Z A;  4HJ3 A;  3D72 A;  4K08 A;  2V1A A;  2A2L A;  5DJU A;  4Q0I A;  1LSW A;  5HL6 A;  4G3K A;  1OPX A;  5TBM B;  1DP6 A;  4WEK A;  4YOF A;  4B93 A;  4HNB A;  1XJ6 A;  1MKM A;  5HWT A;  1OTE A;  1TS8 A;  4MN6 A;  1TS6 A;  4GW9 A;  1V9Y A;  1D06 A;  1OTI A;  3K2N A;  1YSP A;  4HOI A;  4WEL A;  1GSV A;  3U2A A;  3ULF A;  4UQI S;  2OAP 1;  3UE3 A;  2ZOH A;  2ZMV A;  3RFB A;  3PHY A;  2Z6D A;  2B02 A;  3A0S A;  3MQO A;  3MR0 A;  4XT2 A;  3S7Q A;  2JKR I;  4MDZ A;  3LIF A;  4G3V A;  5HWV A;  1OJ5 A;  3NJA A;  2GNX A;  4GS9 B;  4B9O A;  2W1R A;  3PXP A;  2VKS A;  2KOI A;  2KDK A;  1N9O A;  4WL9 A;  1XJ3 A;  4L9E A;  2PHY A;  4LLO B;  2W3G A;  3T50 A;  1OT6 A;  3T4J A;  3F1O A;  1NWZ A;  1NRJ A;  3EEH A;  1TF1 A;  2P04 A;  2H28 A;  4MN7 A;  2I9V A;  3IS2 A;  3JVU A;  3KX0 X;  3LR3 A;  5HPF A;  2W3E A;  3LIA A;  3DBA A;  1GSW A;  5G4Y A;  4KUO A;  3E4P A;  4F3L A;  1T19 A;  5TBM A;  3UB8 A;  1XJ4 A;  3BWL A;  2D01 A;  3V67 A;  3LR0 A;  3TE8 A;  4HHD A;  3JVV A;  1ZTU A;  2WKR A;  5IU1 A;  3EOI A;  4IUK A;  2J3T D;  4LRX C;  3LIB A;  5EFW A;  3MXQ A;  2VJW A;  4Q0J A;  4Z1W A;  4ETX A;  2HF6 A;  5DKK A;  3NOT C;  5F68 A;  1F9I A;  1GSX A;  2ZMF A;  3TRC A;  2B18 A;  4EUV A;  4AFI A;  3G6O A;  3LR4 A;  3LFV A;  1P0Z A;  4Y3I A;  3LI8 A;  1G6O A;  3H82 A;  4PHT A;  4EU0 A;  4YWZ A;  4BBU A;  5IT5 A;  4WN5 A;  1W63 Q;  1EW0 A;  1OT9 A;  2GX5 A;  2D02 A;  4R38 A;  3UB6 A;  3ZQ5 A;  1TD5 A;  4CLC E;  4XT2 B;  2KX6 A;  5HWW A;  1T1B A;  3UE6 A;  3KYZ A;  3SW1 A;  2V0W A;  3MMH A;  5C5K A;  3CUE A;  4HI4 A;  2J3W A;  5TJJ A;  1N9N A;  3T4T A;  1KOU A;  3C8C A;  2QKP A;  5K5B A;  2INW A;  5FL3 A;  3KSH A;  3F1O B;  2GJ3 A;  2PYP A;  3VE3 A;  1NLY A;  1H3Q A;  3HCY A;  3IS2 B;  4DMZ A;  1VB6 A;  2YKF A;  4I3I A;  4F3L B;  1DP9 A;  5F69 A;  4KQD A;  4CLC D;  5DFY A;  2VV8 A;  4I3J A;  5DFX A;  1YKD A;  2EWV A;  4O8G A;  1S4R A;  3BY8 A;  2PD7 A;  3CAX A;  3CUE C;  1D7E A;  3D3O A;  3PBS A;  3UMD A;  1XFN A;  4O0P A;  3S7N A;  4RQ9 A;  3FPW A;  4NXE A;  4JGR A;  2Y8H A;  5CX7 A;  5HDD A;  4BWI A;  2P7J A;  3E0Y A;  4CLC A;  4HQA A;  2LB9 A;  3GDI A;  4E04 A;  2NUT C;  3EWK A;  2KLI A;  2XA7 M;  2XSS A;  4G3W A;  1OTB A;  1P97 A;  3HJI A;  4GJ4 A;  3K3C A;  4P6Z S;  4JGQ A;  3B33 A;  2QWS A;  3H82 B;  3ICY A;  5HD3 A;  4BBT A;  1DP8 A;  3E98 A;  1WA9 A;  2G7U A;  4IJG A;  2VA0 A;  4HJ4 A;  4OOL A;  3KSI A;  5L8M A;  2VV6 A;  2M1C A;  4PKY A;  1G28 A;  5AVE A;  1LT0 A;  1N9L A;  4Y2F A;  3NOP C;  3LYX A;  1XJ2 A;  3ZYT A;  3UME A;  1LL8 A;  1JNU A;  3K3D A;  3B47 A;  3KSF A;  3EGX C;  3BW6 A;  5A8B A;  4DN0 A;  3RTY A;  2J80 A;  3PBN A;  4HP9 A;  3TW8 A;  3PBO A;  3UB7 A;  4EEP A;  2PR6 A;  1UWN X;  3OCN A;  3PBR A;  3P7N A;  2MJ6 A;  3PBT A;  3NOU C;  4HH3 A;  4NEE D;  2O99 A;  5HPI A;  2V9A A;  1MZU A;  1S4S A;  3T4K A;  3FG8 A;  1DRM A;  2XA7 S;  3BQ8 A;  3T4O A;  2XRO A;  1H8M A;  2JKT M;  3OCL A;  3OC2 A;  5F6A A;  4GLQ A;  2IA2 A;  2QJ5 A;  3LI9 A;  3LUQ A;  2FZ0 A;  4PKY G;  4CLC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...