1S1ZA

Photoactivated chromophore conformation in photoactive yellow protein (e46q mutant) from 10 to 500 nanoseconds
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAQGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive Yellow Protein
publication title Chromophore conformation and the evolution of tertiary structural changes in photoactive yellow protein
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Photoreceptor
total genus 34
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2004-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1s1zA00
1N9OA 1TS7A 4L9GA 1DP6A 5AVEA 3FG8A 4HJ4A 3PHYA 2OOLA 3LUQA 3UB7A 3UMEA 4DJ3A 1V9YA 4MN6A 4KQDA 1DP8A 2PR6A 2GJ3A 1XJ6A 3T50A 1XJ3A 3SW1A 4I3JA 1TS8A 1OTAA 1DRMA 3H82A 1S67L 4KUKA 4GCZA 2PHYA 5HDSA 1V9ZA 3K3DA 1VB6A 2V1BA 2QWSA 3LIEA 3H9WA 1S1ZA 2PDRA 3LICA 3LI9A 2VV7A 1XJ4A 3VOLA 1JNUA 3H82B 2VLGA 4HP9A 3IS2A 5HWVA 4JGQA 3F1NB 4HH2A 4PKYG 4H6JB 3PYPA 3VE3A 4EEPA 5AVFA 4HJ3A 3E4OA 1X0OA 2OWHA 3NOTC 3LI8A 2V1AA 3ICYA 2WKRA 3UB8A 1ODVA 2YKHA 1GSXA 1MZUA 4HJ6A 4HP4A 2BASA 1KOUA 3OLOA 3FC7A 2INWA 1OJGA 1N9LA 2L1MA 3LIFA 4WN5A 3MR0A 5DJUA 4GS9A 2WKPA 2JN7A 1T1AA 3F1OB 4WL9A 2H28A 4HNBA 4B9OA 4BBUA 1T19A 1XFQA 1UGUA 5HD3A 4XT2A 5DKLA 4R6LA 1NWZA 3A0VA 2Z6CA 1OT9A 4M4XA 2KDKA 3H7WB 4BBVA 1LSXA 5IS1A 4E04A 4HH3A 5F69A 5J7EA 3NOPC 4GHIB 5A8BA 2R78A 5HWTA 4YWZA 2WKQA 2KX6A 4XT2B 5F6AA 2QJ5A 5HDCA 1T1BA 2HV1A 4R70A 2VV6A 4K08A 3RTYA 3BY8A 4LRYC 1EW0A 5J4EA 4L9EA 4MN5A 1LL8A 3P7NA 4LRXC 2QJ7A 1DP9A 1N9NA 3UB9A 1OT6A 2W0NA 1S4SA 4WLAA 2PD8A 1D7EA 3NHQA 5HZHA 2A24A 2CMNA 5KIZA 3BWLA 3NOUC 1XJ2A 4DJ2A 3G6OA 1T18A 1T1CA 1OTBA 4HOIA 2M1CA 1GSWA 4NXBA 5HSQA 2D02A 3IS2B 1P97A 4EETB 4NXFA 1G28A 3MJQA 2ZOIA 5DJTA 5TBMA 4WF0A 1D06A 3CAXA 4R3AA 4JGRA 3RH8B 4KUOA 3F1PA 4PKYA 2PD7A 3GECA 5F5YA 5F68A 2Z6DA 3K3CA 1LT0A 5HD5A 5G4ZA 5G4YA 5EFWA 3IBRA 2I9VA 1LSWA 1UWPX 2PYRA 3NJAA 4GS9B 2V0UA 3MQOA 3F1PB 4HHDA 3KX0X 2W27A 4I3AA 4I39A 3BY9A 4HQAA 4I5SA 2P7JA 4I3IA 3MXQA 4LPZA 4WUJA 4F3LA 2QKPA 1LSVA 3CWFA 3D72A 4EEUA 2EA9A 3ZQ5A 2ZBBA 3C2WA 5DKKA 3MFXA 2PR5A 4JGOA 1TS0A 5I5LA 1S1YA 1Y28A 4RQ9A 4EERA 2V0WA 2OWJA 3UE6A 1WA9A 5J3WA 3EWKA 3MQQA 1TS6A 5HWWA 3F1NA 4EQ1A 4F3LB 4H6JA 3LIBA 1OJ5A 2YKFA 3CLOA 1OTIA 4GW9A 1UWNX 2JHEA 3HJKA 3UMDA 4EESA 1OTDA 3A0RA 3C8CA 4HI4A 4EXOA 3GDIA 1S4RA 4R38A 4BBTA 3B33A 2L0WA 4JGPA 2ZOHA 4LLOB 3E4PA 4EW7A 1XFNA 3LIAA 2VV8A 1OTEA 2VEAA 4LRZE 1S66L 1BYWA 1F98A 5IU1A 3F1OA 2A24B 2QHKA 2L4RA 3LYXA 4HY8A 2B02A 4HIAA 3LIDA 2K7SA 3UB6A 1F9IA 4I38A 2V9AA 3VE4A 3H7WA 2J80A 4L9FA 3ULFA 2D01A 5TBMB 5HDDA 4NXGA 3EEHA 3A0SA 1P0ZA 3HJIA 4GHIA 2PYPA 1GSVA 4NXEA 3E4QA
chains in the Genus database with same CATH superfamily
1N9OA 4KZBA 3V67A 1STZA 4EV4A 4HJ4A 1YLJA 1J9MA 3A3DA 3LUQA 4IHQA 1AXBA 4E3OA 4MN6A 3TW8A 2Y91A 2GJ3A 1XJ6A 4QD4A 2CC1A 1TS8A 1OTAA 3HVFA 4Y13A 5EOEA 1DRMA 3ITBA 4KUKA 2FH5A 1V9ZA 1YLWA 1LI9A 4OQHA 2V1BA 2QWSA 3IXGA 3Q07A 5CTMA 3FKWA 1PFLA 1I2SA 4RX3A 2PDRA 4CLCE 3MZEA 1XJ4A 2HDQA 3G35A 1VEUA 4OONA 2Q9NA 2XEPA 3HUNA 1K6SA 2H10A 3QP2A 3CITA 5EVEA 4QU3A 4OPRA 3T4QA 4HP9A 3O86A 4HH2A 4OLGA 3OZHA 2XA7S 2JKRM 1CEFA 2ZL1B 3NOTC 2V1AA 3ICYA 3EGDC 1C3BA 3CPTA 2X02A 1E3UD 3W4PA 4OP8A 3W2ZA 1GSXA 1L0FA 1ERMA 1K57C 4HJ6A 3IXBA 4HP4A 4HBUA 4X68A 4E3MA 1XA1A 5E43A 3FPWA 1N9BA 2L1MA 3MZFA 1K4FA 1CJFA 3KYEA 1EWZA 5DJUA 5FQJA 4A5RA 4PM9A 4WEJA 1ONHA 3HBRA 3HLGA 4WL9A 2H28A 2A49A 1CI8A 4WZ5C 3T4SA 4BBUA 1YMXA 1L2SA 5KZHA 2VGKA 2WGWA 4DDSA 4PPRA 5HAQA 1K57A 1FQGA 3P09A 2ZQDA 3S22A 1PYYA 3PBOA 1MY8A 4U0TA 5DF8A 2ZC5B 4FOFA 1W63Q 4BBVA 4RYEA 2Y2HA 4E04A 4DXCA 1K25A 2O9AA 2W1RA 1ACFA 5M19A 3Q7VB 1TDLA 2P9VB 1JWVA 1CEGA 2KX6A 1G6AA 4X55A 4WZ5A 2QJ5A 4DE0A 1DJAA 4WM9A 1KE0A 2XD5A 1T1BA 1N4OA 3NDGA 1WE4A 4R70A 3PTEA 5CEDA 4GLQA 1IKIA 2VV6A 3RFBA 1W7FA 2R9WA 3S7PA 4LRYC 3ZVWA 2BG1A 1KE3A 2W3DA 3TE8A 2ZMAA 2ACGA 5F83A 5FQIA 1N9NA 1JTDA 3D3OA 4UEYA 3UB9A 2Y2NA 3KSIA 1S4SA 3SS5A 3SS4A 1WYCA 3Q7ZA 1OMEA 3AGDA 2Q0OA 3IQAA 3OPRA 3OPHA 4IEDA 3VP0A 4N9LA 4BJPA 2A24A 3CUEC 1YKDA 3PAGA 5KIZA 5AQ7A 1PIOA 1GA9A 4EBLA 4BQMA 2HZ5A 1VEUB 1LI0A 4WYYA 4FD8A 4NXBA 5HSQA 3HLEA 1YAXA 1SZVA 4BL2A 5HL1A 4ZAMA 3T4KA 1G28A 4UHUA 2ZOIA 4CPKA 4KZ9A 5TBMA 5CERA 4MN7A 3CAXA 4R3AA 4P87A 3CPTB 3CUEA 3GECA 1FOFA 3JYIA 4OKPA 5F68A 1ZC2A 2ZC4B 4IBXA 4ZBEA 2IWCA 3DTKA 1E4DA 3T4TA 5EM1A 2JKTM 2ZJ9A 2ZQ9A 3DWKA 1LSWA 2XFSA 4IJGA 2PYRA 3CI6A 3G30A 4O0PA 2ZQAA 4X56A 4S2JA 2Y2GA 4HHDA 2BLSA 3KX0X 4I3AA 4N92A 3BY9A 2WGWB 4PM6A 1NRFA 3MXQA 4DRTA 4LV3A 1ESUA 2GNXA 2KOIA 2QKPA 4R4SA 2EA9A 2ZBBA 5DKKA 3S7NA 2DRWA 5GLDA 2PR5A 1YM1A 5I5LA 1S1YA 1Y28A 3WWXA 1BSGA 2OWJA 1CF0A 3UE6A 1WA9A 3MQQA 3OPPA 1M6KA 3MFDA 3BM6A 4H6JA 3LIBA 5HW3A 5FA7A 3ISGA 2J3TC 4DMZA 4EESA 1OTDA 2XFTA 5D3OA 4KENB 3UE0A 4HI4A 4EXOA 3GDIA 4OOYA 4BBTA 3ZDJA 4JGPA 5KSCA 3TJZC 3BECA 4Y0TA 3IH8A 1XFNA 3GMWA 3LIAA 2VV8A 2Y2PA 2EX9A 2Y2JA 1PRQA 3CMZA 1OTEA 4PM5A 5EVID 4JBFA 5HFOA 5L09A 2FFFB 3RJUA 2OLUA 2A24B 3TSGA 2L4RA 1YQSA 4IVIA 2R9XA 3LY4A 4MBHA 2B02A 5CHUA 2ZC6B 5EVLA 3DTEA 3UB6A 2Y79A 5JYOA 3BQAA 3QP6A 3S7QA 3U2AA 1Q2QA 1ES4A 3H7WA 2J80A 2H5SA 4L9FA 1K6RA 3ULFA 2ZQ7A 2D01A 5TBMB 4NXGA 5FATA 2C5WB 5LBRA 2WKEA 4Q0HA 1H0MA 4BD0A 2JBFA 3IF5A 4Y7PA 4MNRA 2Y55A 4QY5A 5F1GA 5E2EA 1TS7A 2A2LA 4L9GA 1IYOA 3IX8A 3HLCA 3FG8A 3PHYA 1L0GA 1KGGA 2OOLA 1ES2A 3CJMA 2A3UA 1VETA 1FCOA 3Q81A 4DJ3A 1IYSA 2LB9A 5AQ9A 1DP8A 3UDFA 2XROA 5HAPA 1NJ4A 3UB5P 1YLTA 2G2UA 1Y54A 1YPRA 4P6BA 4UQIM 1VB6A 1YSPA 2PRFA 3LIEA 1ZG4A 2XRNA 1KDSA 2HJEA 3VP2A 1K54C 4NK3A 4PAUA 3VOZA 2OLVA 3VOLA 4WBGA 3WS1A 1PI4A 2X71A 1JNUA 3H82B 1PW1A 1NLYA 3IS2A 1MC0A 5HWVA 2HP9A 1FSYA 1MKIA 5DFXA 5M18A 4H6JB 3UDIA 3G4PA 4KQQA 1K55C 1LHYA 4MLLA 3EOIA 4EWFA 4Y0UA 5FI2A 1MZUA 4QJGA 5EUAA 5DTKA 4ZJ2A 1K54A 2HP5A 1OJGA 4B93A 2EWVA 2PT7A 3ZG0A 3C30A 3LIFA 5GLAA 5DTTA 4WN5A 3MR0A 3BRMA 5FDHA 3L7HA 3VSKA 1K56A 1MWTA 1T1AA 4RA7A 4OPQA 1J3WA 1K55A 4MBFA 4GN2A 4B9OA 1T19A 4JXGA 3EQUA 2P9VA 2WAFA 1W63M 5CHJA 1L0EA 1CQAA 4QB8A 1L3LA 3T4LA 4R6LA 1NWZA 3ZG9B 2LB5A 2Z6CA 5DVAA 2VGLS 1OT9A 4DE2A 4UA6A 3EEAA 3H7WB 3D4FA 1HLUP 4U0XA 4HH3A 3LGOA 2M7UA 1BLHA 3V39A 1SKOA 2R78A 5HWTA 2WKQA 4PM8A 4XT2B 5F6AA 3LO7A 2X01A 3ZCZA 3R7WA 3VV4A 3IF6B 3HUOA 2B18A 4B88A 2NUPC 1HVBA 4WELA 3MKFA 1VETB 3KSFA 3RTYA 4EBNA 2P04A 3K2NA 3ZNTA 5A93A 1F5MA 4AFIA 2ZM8A 4CLCC 2FFYA 3MMHA 2UV0E 2HDSA 3T4JA 2PD8A 1GHMA 1D7EA 3NHQA 1S6RA 5EE8A 1JWZA 3GR2A 2Q9MA 3D9YA 1XJ2A 4OH0A 4DJ2A 2O9CA 5DFYA 3MQ0A 2WZZA 3OBFA 3MZDA 3T1XA 3VFHA 1T18A 1EI5A 1T1CA 4KG5A 4MMNA 4DXBA 1OTBA 4HOIA 5E2GA 2D02A 5IT5A 4EQIA 2Y59A 4CLCA 3IS2B 3NIAA 1P97A 4B4ZA 1NZOA 3M2JA 2V8CA 4EU0A 4NXFA 4ZDXA 4Q0JA 3TOIA 4D2OA 1BT5A 5F82A 1LLBA 4IBRA 1RGYA 4KUOA 5MC7A 2XSSA 2E8JA 4ZTKA 3K3CA 3O87A 1Z09A 3LR5A 1YSQA 4LCMA 3PBTA 3OCLA 2HDUA 1MWUA 1IKGA 1MXOA 2OV5A 1W5DA 3F1PB 4QPRA 4F94A 2HGVA 2WZXA 4KZ6A 2V1ZA 4I5SA 1PWDA 2WAEA 2P7JA 4S2KA 5FAQA 4I3IA 4GD8A 4WUJA 3JVUA 3QP8A 1LSVA 3FV7A 3GRJA 3KSGA 3D72A 3ZGAB 3ZQ5A 2VK3A 3C2WA 2NUTC 3V50A 5FI7A 3LFVA 2AVXA 4P85A 1NY0A 1SKOB 2V0WA 3LEZA 3TRCA 1NRJA 2JKRI 4GDNA 1TS6A 4LFUA 4KQOA 3R7WB 5HWWA 2WUQA 4F3LB 3QNCA 4S2OA 4BLMA 2YKFA 3G2YA 2Y4AA 1GHPA 1UWNX 1G6OA 3IH9A 3AGEA 3QP1A 2XA7M 3CZDA 3P98A 3GQZA 1XGJA 4QHCA 3VP1A 4YOFA 1S4RA 3R4KA 4N9KA 3B33A 1FR6A 4O7DA 5U47A 5GLCA 4G3KA 3E4PA 1DY6A 2Y2QA 2B95A 4LV0A 4BENA 4Y0OA 4Y15A 3MSHA 1BYWA 2EXBA 1F98A 2GDNA 2HJ9C 5IU1A 1KGFA 2EX2A 3F1OA 4OQ0A 2FZ0A 4RX2A 3T1SA 3RXWA 2WGIA 3LYXA 5FL3A 1I2WA 2OSUA 4HY8A 4OPYA 3NCKA 4PHTA 4HIAA 2UWXA 1JVJA 4CLCB 1F9IA 4EBPA 2XD1A 4I38A 1H8ZA 4NEED 1YLYA 5A90A 3VFFA 1DJCA 4JXWA 4E3JA 5HDDA 4EUZA 5L2FA 3OC2A 3HJIA 3KO6A 4GNUA 4E3IA 3BFGA 5FASA 4DF6A 5FSRA 3E4QA 1ZG6A 4L0LA 2MJ6A 3MS6A 2Y2LA 1NZUA 3SH9A 3UMEA 2ZM2A 3C38A 1V9YA 4O8GA 5FAPA 3HUMA 1U60A 3S1YA 3BYDA 2JC7A 1H8MA 2QYBA 4JF6A 3T50A 4Y17A 3MKEA 4LCLA 1XJ3A 3SW1A 4I3JA 3HLFA 3TG9A 3H82A 1S67L 2ZLYA 5HAIA 3W8KA 4GCZA 2PHYA 4UAAA 3SOIA 4HBTA 3K3DA 5GHZA 2JE5A 4OOLA 3BJNA 3IT9A 1QMFA 4Y5FA 3H9WA 1S1ZA 5J8XA 3EQVA 3LI9A 2VV7A 2W3HA 3L9KA 1VHMA 3O5YA 4P6ZS 5FQQA 1EROA 5CHMA 1W8QA 4JGQA 1MBLA 4LENA 4GB7A 4Y2FA 4DKIA 3PYPA 3VE3A 4EEPA 3E4OA 3W4QA 1YLPA 1X0OA 3T4OA 3NBLA 4KZ5A 2HPBA 3ZNYA 3IXHA 2JKTI 2DMWA 2BASA 2HDRA 1KOUA 3NDEA 4KG6A 4OLDA 3IF6C 2XDMA 5FEGA 3FC7A 3MF0A 3LEQA 1N9LA 1FR1A 1ONGA 3KSHA 5FQKA 2P08A 1W79A 2Z2LB 3VP3A 4ARZA 1FIKA 3FPVA 3V3SA 3G32A 4GS9A 3T1QB 4JLFA 2JN7A 1S0WA 3F1OB 1E25A 4HNBA 5CGWA 4YINA 3BLSA 3PBQA 1UGUA 2K31A 5HD3A 4XT2A 5F1FA 1O7EA 3IF6A 4JF4A 1BZAA 3V3RA 4S2NC 2W1TA 4M4XA 2KDKA 1LSXA 5IS1A 3N4IA 3DW0A 1BLSA 4S2LA 5F69A 4CQHA 1RCJA 4R1GA 1K0KA 1ZHHB 3NOPC 5FI6A 4ME4A 3IWQA 4YWZA 5FQMA 3FKVA 3MXRA 1NYYA 4R0QA 5HDCA 2ZMFA 4OQIA 3W4OA 2J3TD 3PR6A 5GHYA 4XUXA 3ZVTA 4N1XA 1ZKJA 3BY8A 2WYXA 1K38A 1EW0A 5J4EA 3GVBA 2VKSA 4MN5A 3WS5A 4FTXA 1LL8A 4LRXC 2M7VA 3IX4A 1GA0A 3C5AA 4Z9QA 2DNSA 5CECA 2W0NA 4QWOA 4WLAA 1MWSA 3E0YA 1JWPA 1Y4OA 4Z1WA 1VQQA 2J8YA 1SCWA 1RP5A 3BWLA 3NOUC 4IUHA 1HD8A 5FEFA 5TR7A 3WS0A 4PMAA 3SZTA 4JF5A 2M1CA 2C6WB 3UE3A 4KZ4A 4EETB 3QP5A 4UA9A 1AWIA 4B4XA 4BWIA 1HZOA 4K0WA 4WF0A 2Y2OA 4JGRA 3RH8B 1IEMA 3B42A 3F1PA 3OPLA 2VX8A 4KZ7A 4PKYA 4OP5A 3S4XA 1LL5A 5F5YA 4C75A 1XKZA 2Y2KA 2Z6DA 1BULA 5EECA 5HD5A 1O07A 5TJJA 5EFWA 2ZMVA 3QHYA 3IBRA 3G34A 1ZTUA 1XP4A 4ARZB 3NJAA 1XXMA 4GS9B 4KG2A 2V0UA 3M2KA 3IHAA 4IUKA 3KYQA 1YT4A 2W27A 3NI9A 3S7OA 4I39A 4HQAA 3O88A 3QNBA 4LPZA 1E3UA 2WGVA 4C6YA 4F3LA 2Y2IA 5E2FA 1MWRA 1PWCA 1YLZA 4EEUA 4G3WA 2W1TB 4DE3A 3A3FA 3LR0A 1BTLA 4H8RA 2P74A 3MFXA 4OQGA 3E2LA 4JGOA 1TS0A 3FZCA 5FQ9A 1KVLA 3HLBA 3IHBA 4EERA 1TF1A 4E3LA 1SKFA 2V20A 4WEKA 5J3WA 1K56D 1P9WA 2ZM0A 3F1NA 1NLZA 4JPMA 2Z2MB 4DE1A 1OJ5A 1PZOA 1IYPA 4S2MA 1OTIA 4GW9A 2JHEA 4ESPA 4ETZA 4MBKA 1A0KA 5C5KA 3HJKA 1MPLA 3UMDA 2DCFA 3IX3A 4EUVA 4YFMA 3V5MA 3DAVA 5FAOA 4BD1A 5AQAA 3N8RA 2ZOHA 2K2NA 4LLOB 3BLMA 3ZFZA 4GOGA 4JKTA 2XF3A 5CRFA 2EWWA 4C3QA 2J3WA 2V8FA 5DF7A 2KLIA 3N7WA 4GD6A 1G68A 4LV2A 3PXPA 4LRZE 1S66L 3CHWP 3N8LA 2WADA 3UO9A 2PBYA 3SH7A 1TVFA 4K91A 5CEBA 3WRZA 5EM0A 2XK1A 4KZ3A 1KE4A 3LIDA 3HL9A 2EFXA 4RVAA 4GDBA 1D1JA 3BFFA 1JTGA 2V9AA 1H8YA 3VE4A 3BW6A 2ZC7A 5M1AA 1IELA 2VGLM 3P01A 2VZWA 3EEHA 1P0ZA 4GHIA 2PYPA 1LL9A 5HL6A 1GSVA 5L07A 5KMWA 4X25A 4E3NA 5GHXA 3UPPA 5BOHA 2VJWA 2Y2MA 1DP6A 5AVEA 3OCNA 1PZPA 4KZ8A 4LGWA 1W8YA 3T12B 5CGXA 3UY6A 3VP4A 3LR4A 3UB7A 4CLCD 4X69A 4KQDA 2PR6A 4HESA 3NULA 2EX8A 2JKFA 4NKPA 3WRTA 5EV0A 5K5BA 4ZRRA 2RCXA 1I5QA 4E6WA 4X6TA 4X53A 3PBSA 3IBJA 1ERQA 2EX6A 2OAP1 1NYMA 4E3KA 5HDSA 3B3XA 5CGSA 5L8MA 5HPIA 1SDNA 3IWOA 2W3GA 4D60A 1XA7A 3LICA 3I7JA 4U3TA 1K4EA 2VLGA 2XH9A 2OAQ1 2W3EA 3A3EA 3F1NB 4PKYG 3VMAA 2B5RA 3WS4A 4X1LA 1TDGA 5AVFA 5JYPA 4HJ3A 2OWHA 4P0MA 3LI8A 2WKRA 4UA7A 3UB8A 5L10A 1ODVA 1VM1A 2YKHA 2JKGA 3C4OA 1NXYA 4NG2A 2G2WA 4NETA 3OLOA 4KQRA 2INWA 4GZBA 2ZQ8A 1OPXA 3WS2A 3T1RA 2GZAA 1XPBA 1FCNA 4XUZA 1CI9A 2WKPA 1TEMA 2WK0A 5DF9A 4X1MA 2ZC3B 2QZ6A 4R3BA 4R23A 5EVIC 3N6IA 4ZJ3A 1XFQA 3JVVA 3SH8A 3IWIA 3A3JA 5DKLA 1KDWA 1PNEA 2IA2A 3AGFA 3A0VA 4FCFA 3M6BA 4OPZA 3HCYA 3UPOA 5HARA 3HREA 4HEFA 3UE1A 1TD5A 3NECA 5J7EA 2EFUA 1IFQA 4GHIB 3ZYTA 5A8BA 1H3QA 3FYZA 1PI5A 4ZJ1A 4FUWA 4II7A 1SHVA 1HTZA 5EVIA 1ESIA 3BFEA 3LCEA 3UNWA 2HV1A 2GX5A 5CX7A 3NY4A 4K0XA 3ZG7B 4DDYA 4BL3A 5HPFA 4K08A 1FILA 5E2HA 3ITAA 2EXAA 3U4LP 3M6HA 4ETXA 1PWGA 1F2KA 4L9EA 3KYZA 3N8SA 1XX2A 2O9BA 2J7VA 4OVDA 3PBRA 3DBAA 3P7NA 1Q2PA 1SDEA 2QJ7A 1DP9A 2XGNA 2PAVP 4ID4A 4FSFA 4UQIS 4PM7A 3E98A 2JCHA 2PBDP 2PU2A 1M40A 3VOYA 1OT6A 4Q8IA 5HZHA 2WKIA 1KVMA 1FSWA 4LV1A 4Q0IA 3UPNA 4WZ4A 2XQZA 1DJBA 2CMNA 3BEBA 4JXSA 5TGFA 3FWLA 3B47A 3G6OA 1ES3A 3LR3A 3EGXC 4DN0A 1GSWA 3LY3A 3DTIA 3UN7A 4GJ4A 3HLWA 3MJQA 2PU4A 3C7UA 5FDSA 5DJTA 3PBNA 1D06A 2ZD8A 3G31A 3C4PA 3BFDA 3CG5A 2IWDA 4OOMA 2PD7A 5GLBA 3VSLA 2Y8HA 1LT0A 4JXVA 5G4ZA 3IXDA 5G4YA 1IYQA 4BMWA 2I9VA 1G5UA 2HF6A 3G2ZA 1UWPX 1FCMA 4R4RA 1RGZA 2ZQCA 3MQOA 4S2PA 3ZHHA 5KSHA 2J9OA 3UDXA 1BLPA 3ZG8B 4G3VA 5I94A 4FH4A 1WYBA 4M3KA 1BLCA 2HP6A 3NC8A 1YMSA 3Q82A 5G18A 4MEZA 2XLNA 5CTNA 3CWFA 1BUEA 2BTFP 3QP4A 3BQ8A 3OOVA 4RQ9A 4N1HA 2VA0A 2O0YA 4MCWA 4S2NA 1ES5A 2H0YA 2VGJA 3O3VA 2W3FA 2O99A 4CJNA 1IOUA 1ALQA 4FH2A 5AJGA 3EWKA 3E2KA 5EVIB 2E8IA 2G7UA 4P6ZM 4EQ1A 4WMCA 3CLOA 4XXRA 5CXWA 2ZL1A 2QPNA 3DTMA 3Q1FA 3MXSA 3ZG5A 4O01A 3A0RA 3BFCA 3C8CA 2XR0A 2H0TA 4R38A 1PW8A 3SS3A 2L0WA 5EPHA 3DWZA 4EW7A 1P9RA 5IHVA 2RL3A 2V2FF 1Z6FA 1KGEA 1GCEA 5DTSA 2WKHA 2VEAA 3C7VA 3HLDA 3GTCA 4E6XA 1CK3A 2QHKA 2IWBA 1XGIA 4GKUA 3MBZA 5A91A 1QMEA 2K7SA 4Y3IA 4KZAA 3GV9A 3GSGA 5HX9A 1H5XA 1MKMA 2J9PA 4R3JA 4S2IA 5TFQA 5A92A 2I72A 5AQBA 4IVKA 4WMCD 3A0SA 2QMIA 1GHIA 3Q7VA 4QY6A 3PAEA 5EOOA 4YNRA 5GL9A 1L0DA 3RXXA 4NXEA 3JPUA 3A3IA 4MDZA
chains in the Genus database with same CATH topology
1N9OA 3V67A 4L0LA 2VJWA 1TS7A 2A2LA 1STZA 4L9GA 1DP6A 5AVEA 3OCNA 3FG8A 4HJ4A 3PHYA 2MJ6A 2OOLA 3LR4A 3LUQA 3UB7A 4CLCD 4IHQA 3UMEA 3C38A 4DJ3A 1V9YA 4O8GA 2LB9A 4MN6A 4KQDA 1DP8A 3TW8A 2PR6A 2XROA 2QYBA 1H8MA 2GJ3A 1XJ6A 3T50A 4NKPA 5K5BA 4ZRRA 1XJ3A 3SW1A 4I3JA 1TS8A 1OTAA 1DRMA 3H82A 3PBSA 3IBJA 1S67L 4KUKA 2OAP1 4GCZA 2PHYA 5HDSA 2FH5A 4UQIM 1V9ZA 3K3DA 1VB6A 1YSPA 2V1BA 4OOLA 2QWSA 5L8MA 5HPIA 3LIEA 3BJNA 4Y5FA 2XRNA 3H9WA 1S1ZA 2HJEA 2W3GA 2PDRA 4CLCE 3EQVA 3LICA 3LI9A 2VV7A 4PAUA 2W3HA 1XJ4A 1VHMA 3VOLA 3O5YA 4P6ZS 1JNUA 3CITA 3H82B 1NLYA 3T4QA 2VLGA 4HP9A 3IS2A 1MC0A 5HWVA 4JGQA 2OAQ1 2W3EA 3F1NB 4HH2A 4PKYG 5DFXA 4Y2FA 4H6JB 3PYPA 3VE3A 4EEPA 5AVFA 4HJ3A 3E4OA 2XA7S 1X0OA 2JKRM 2OWHA 3NOTC 3LI8A 2V1AA 3ICYA 3T4OA 2WKRA 3EOIA 3EGDC 3UB8A 1ODVA 2YKHA 1GSXA 3W2ZA 1MZUA 2JKTI 4HJ6A 4HP4A 2DMWA 2BASA 1KOUA 3OLOA 3FC7A 2INWA 3MF0A 1OJGA 3FPWA 1N9LA 2L1MA 4B93A 1OPXA 2EWVA 2PT7A 3C30A 3LIFA 3KSHA 2GZAA 4WN5A 2P08A 3MR0A 4ARZA 3FPVA 5DJUA 4GS9A 2WKPA 4WEJA 5DF9A 2JN7A 1T1AA 3F1OB 4WL9A 2H28A 4HNBA 4B9OA 3T4SA 4BBUA 1T19A 3PBQA 3EQUA 1XFQA 3JVVA 1UGUA 1W63M 2K31A 5HD3A 4XT2A 5DKLA 3PBOA 3T4LA 4R6LA 2IA2A 1NWZA 2LB5A 3A0VA 2Z6CA 2VGLS 4FOFA 1OT9A 2W1TA 1W63Q 3HCYA 4M4XA 2KDKA 3EEAA 3H7WB 4BBVA 1LSXA 5IS1A 4E04A 4HH3A 1TD5A 5F69A 4CQHA 2O9AA 2M7UA 2W1RA 5J7EA 1ZHHB 3NOPC 1IFQA 4GHIB 4ME4A 3ZYTA 5A8BA 1H3QA 2R78A 5HWTA 4YWZA 2WKQA 2KX6A 4XT2B 4II7A 5F6AA 2QJ5A 3R7WA 3VV4A 5HDCA 2ZMFA 1T1BA 2J3TD 2HV1A 3PR6A 2GX5A 4R70A 2B18A 5CX7A 2NUPC 4GLQA 4WELA 2VV6A 5HPFA 4K08A 3RFBA 3KSFA 3RTYA 3BY8A 3S7PA 2P04A 4LRYC 1EW0A 4ETXA 3K2NA 5J4EA 4L9EA 3KYZA 2W3DA 2VKSA 1F5MA 4AFIA 2O9BA 4MN5A 3TE8A 4CLCC 1LL8A 3PBRA 3DBAA 3P7NA 4LRXC 2QJ7A 1DP9A 2M7VA 1N9NA 3D3OA 4UEYA 3UB9A 3MMHA 4FSFA 4UQIS 3E98A 1OT6A 2W0NA 1S4SA 3KSIA 4WLAA 3T4JA 2PD8A 1D7EA 3E0YA 3NHQA 5HZHA 4Z1WA 4Q0IA 4BJPA 2A24A 3CUEC 2CMNA 1YKDA 5KIZA 3BWLA 3NOUC 1XJ2A 4IUHA 3B47A 4DJ2A 2O9CA 5DFYA 3G6OA 3MQ0A 3OBFA 1T18A 1T1CA 3LR3A 4MMNA 1OTBA 4HOIA 2M1CA 3EGXC 4DN0A 1GSWA 4NXBA 5HSQA 2D02A 5IT5A 4CLCA 3UE3A 1YAXA 3IS2B 1P97A 4EETB 4EU0A 4GJ4A 4NXFA 3T4KA 4Q0JA 1G28A 3MJQA 4BWIA 2ZOIA 5DJTA 3PBNA 5TBMA 4MN7A 4WF0A 1D06A 3CAXA 4R3AA 4JGRA 3RH8B 4KUOA 3B42A 5MC7A 3F1PA 2VX8A 4PKYA 4OOMA 2PD7A 2XSSA 3CUEA 3GECA 5F5YA 5F68A 2Y8HA 2Z6DA 3K3CA 3LR5A 1YSQA 1LT0A 5HD5A 3PBTA 5G4ZA 3T4TA 5TJJA 5G4YA 5EFWA 2ZMVA 3OCLA 2JKTM 3IBRA 4BMWA 2I9VA 2HF6A 1ZTUA 1LSWA 1UWPX 4IJGA 4ARZB 2PYRA 3NJAA 4GS9B 2V0UA 3CI6A 3MQOA 5KSHA 4O0PA 3F1PB 4IUKA 4QPRA 3KYQA 4HHDA 2HGVA 3KX0X 2W27A 4I3AA 3S7OA 4I39A 3BY9A 4HQAA 4I5SA 4G3VA 2P7JA 4I3IA 3MXQA 4LPZA 4WUJA 3JVUA 4F3LA 2GNXA 2KOIA 2QKPA 1LSVA 3CWFA 3KSGA 3D72A 4EEUA 4G3WA 2EA9A 2W1TB 3LR0A 3ZQ5A 2ZBBA 3C2WA 5DKKA 3S7NA 3MFXA 3BQ8A 2PR5A 4JGOA 3OOVA 1TS0A 2NUTC 5I5LA 1S1YA 1Y28A 4RQ9A 2VA0A 4EERA 3LFVA 2O0YA 1TF1A 4MCWA 2V0WA 3TRCA 2OWJA 2W3FA 2O99A 3UE6A 1IOUA 1NRJA 2JKRI 4WEKA 1WA9A 5J3WA 5AJGA 1P9WA 3EWKA 3MQQA 1TS6A 4KQOA 3R7WB 2G7UA 5HWWA 4P6ZM 3F1NA 1NLZA 4EQ1A 4F3LB 4H6JA 3LIBA 1OJ5A 2YKFA 3CLOA 1OTIA 4GW9A 1UWNX 2JHEA 4ETZA 2J3TC 1G6OA 4DMZA 5C5KA 3HJKA 2XA7M 3UMDA 4EESA 1OTDA 4O01A 3A0RA 3C8CA 4HI4A 4YOFA 3GDIA 4EXOA 1S4RA 4EUVA 3R4KA 4R38A 4BBTA 3B33A 2L0WA 4JGPA 2ZOHA 2K2NA 3TJZC 4G3KA 4LLOB 3E4PA 4EW7A 1XFNA 1P9RA 3LIAA 2VV8A 2EWWA 2J3WA 1OTEA 2VEAA 2KLIA 3PXPA 4LRZE 1S66L 1BYWA 1F98A 5IU1A 2HJ9C 3F1OA 2A24B 2FZ0A 2QHKA 2L4RA 3LYXA 5FL3A 4HY8A 2B02A 4PHTA 4HIAA 3LIDA 2K7SA 4CLCB 4Y3IA 3UB6A 2Y79A 1F9IA 3BQAA 3S7QA 4I38A 3U2AA 2V9AA 4NEED 1MKMA 3VE4A 3H7WA 2J80A 3BW6A 4L9FA 3ULFA 2VGLM 2D01A 3P01A 5HDDA 5TBMB 4NXGA 2VZWA 3EEHA 3A0SA 1P0ZA 3HJIA 3OC2A 4GHIA 2PYPA 5LBRA 5HL6A 4YNRA 1GSVA 4Q0HA 3KO6A 4NXEA 3E4QA 4MDZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N9O A;  1TS7 A;  4L9G A;  1DP6 A;  5AVE A;  3FG8 A;  4HJ4 A;  3PHY A;  2OOL A;  3LUQ A;  3UB7 A;  3UME A;  4DJ3 A;  1V9Y A;  4MN6 A;  4KQD A;  1DP8 A;  2PR6 A;  2GJ3 A;  1XJ6 A;  3T50 A;  1XJ3 A;  3SW1 A;  4I3J A;  1TS8 A;  1OTA A;  1DRM A;  3H82 A;  1S67 L;  4KUK A;  4GCZ A;  2PHY A;  5HDS A;  1V9Z A;  3K3D A;  1VB6 A;  2V1B A;  2QWS A;  3LIE A;  3H9W A;  1S1Z A;  2PDR A;  3LIC A;  3LI9 A;  2VV7 A;  1XJ4 A;  3VOL A;  1JNU A;  3H82 B;  2VLG A;  4HP9 A;  3IS2 A;  5HWV A;  4JGQ A;  3F1N B;  4HH2 A;  4PKY G;  4H6J B;  3PYP A;  3VE3 A;  4EEP A;  5AVF A;  4HJ3 A;  3E4O A;  1X0O A;  2OWH A;  3NOT C;  3LI8 A;  2V1A A;  3ICY A;  2WKR A;  3UB8 A;  1ODV A;  2YKH A;  1GSX A;  1MZU A;  4HJ6 A;  4HP4 A;  2BAS A;  1KOU A;  3OLO A;  3FC7 A;  2INW A;  1OJG A;  1N9L A;  2L1M A;  3LIF A;  4WN5 A;  3MR0 A;  5DJU A;  4GS9 A;  2WKP A;  2JN7 A;  1T1A A;  3F1O B;  4WL9 A;  2H28 A;  4HNB A;  4B9O A;  4BBU A;  1T19 A;  1XFQ A;  1UGU A;  5HD3 A;  4XT2 A;  5DKL A;  4R6L A;  1NWZ A;  3A0V A;  2Z6C A;  1OT9 A;  4M4X A;  2KDK A;  3H7W B;  4BBV A;  1LSX A;  5IS1 A;  4E04 A;  4HH3 A;  5F69 A;  5J7E A;  3NOP C;  4GHI B;  5A8B A;  2R78 A;  5HWT A;  4YWZ A;  2WKQ A;  2KX6 A;  4XT2 B;  5F6A A;  2QJ5 A;  5HDC A;  1T1B A;  2HV1 A;  4R70 A;  2VV6 A;  4K08 A;  3RTY A;  3BY8 A;  4LRY C;  1EW0 A;  5J4E A;  4L9E A;  4MN5 A;  1LL8 A;  3P7N A;  4LRX C;  2QJ7 A;  1DP9 A;  1N9N A;  3UB9 A;  1OT6 A;  2W0N A;  1S4S A;  4WLA A;  2PD8 A;  1D7E A;  3NHQ A;  5HZH A;  2A24 A;  2CMN A;  5KIZ A;  3BWL A;  3NOU C;  1XJ2 A;  4DJ2 A;  3G6O A;  1T18 A;  1T1C A;  1OTB A;  4HOI A;  2M1C A;  1GSW A;  4NXB A;  5HSQ A;  2D02 A;  3IS2 B;  1P97 A;  4EET B;  4NXF A;  1G28 A;  3MJQ A;  2ZOI A;  5DJT A;  5TBM A;  4WF0 A;  1D06 A;  3CAX A;  4R3A A;  4JGR A;  3RH8 B;  4KUO A;  3F1P A;  4PKY A;  2PD7 A;  3GEC A;  5F5Y A;  5F68 A;  2Z6D A;  3K3C A;  1LT0 A;  5HD5 A;  5G4Z A;  5G4Y A;  5EFW A;  3IBR A;  2I9V A;  1LSW A;  1UWP X;  2PYR A;  3NJA A;  4GS9 B;  2V0U A;  3MQO A;  3F1P B;  4HHD A;  3KX0 X;  2W27 A;  4I3A A;  4I39 A;  3BY9 A;  4HQA A;  4I5S A;  2P7J A;  4I3I A;  3MXQ A;  4LPZ A;  4WUJ A;  4F3L A;  2QKP A;  1LSV A;  3CWF A;  3D72 A;  4EEU A;  2EA9 A;  3ZQ5 A;  2ZBB A;  3C2W A;  5DKK A;  3MFX A;  2PR5 A;  4JGO A;  1TS0 A;  5I5L A;  1S1Y A;  1Y28 A;  4RQ9 A;  4EER A;  2V0W A;  2OWJ A;  3UE6 A;  1WA9 A;  5J3W A;  3EWK A;  3MQQ A;  1TS6 A;  5HWW A;  3F1N A;  4EQ1 A;  4F3L B;  4H6J A;  3LIB A;  1OJ5 A;  2YKF A;  3CLO A;  1OTI A;  4GW9 A;  1UWN X;  2JHE A;  3HJK A;  3UMD A;  4EES A;  1OTD A;  3A0R A;  3C8C A;  4HI4 A;  4EXO A;  3GDI A;  1S4R A;  4R38 A;  4BBT A;  3B33 A;  2L0W A;  4JGP A;  2ZOH A;  4LLO B;  3E4P A;  4EW7 A;  1XFN A;  3LIA A;  2VV8 A;  1OTE A;  2VEA A;  4LRZ E;  1S66 L;  1BYW A;  1F98 A;  5IU1 A;  3F1O A;  2A24 B;  2QHK A;  2L4R A;  3LYX A;  4HY8 A;  2B02 A;  4HIA A;  3LID A;  2K7S A;  3UB6 A;  1F9I A;  4I38 A;  2V9A A;  3VE4 A;  3H7W A;  2J80 A;  4L9F A;  3ULF A;  2D01 A;  5TBM B;  5HDD A;  4NXG A;  3EEH A;  3A0S A;  1P0Z A;  3HJI A;  4GHI A;  2PYP A;  1GSV A;  4NXE A;  3E4Q A; 
#chains in the Genus database with same CATH topology
 1N9O A;  4KZB A;  3V67 A;  1STZ A;  4EV4 A;  4HJ4 A;  1YLJ A;  1J9M A;  3A3D A;  3LUQ A;  4IHQ A;  1AXB A;  4E3O A;  4MN6 A;  3TW8 A;  2Y91 A;  2GJ3 A;  1XJ6 A;  4QD4 A;  2CC1 A;  1TS8 A;  1OTA A;  3HVF A;  4Y13 A;  5EOE A;  1DRM A;  3ITB A;  4KUK A;  2FH5 A;  1V9Z A;  1YLW A;  1LI9 A;  4OQH A;  2V1B A;  2QWS A;  3IXG A;  3Q07 A;  5CTM A;  3FKW A;  1PFL A;  1I2S A;  4RX3 A;  2PDR A;  4CLC E;  3MZE A;  1XJ4 A;  2HDQ A;  3G35 A;  1VEU A;  4OON A;  2Q9N A;  2XEP A;  3HUN A;  1K6S A;  2H10 A;  3QP2 A;  3CIT A;  5EVE A;  4QU3 A;  4OPR A;  3T4Q A;  4HP9 A;  3O86 A;  4HH2 A;  4OLG A;  3OZH A;  2XA7 S;  2JKR M;  1CEF A;  2ZL1 B;  3NOT C;  2V1A A;  3ICY A;  3EGD C;  1C3B A;  3CPT A;  2X02 A;  1E3U D;  3W4P A;  4OP8 A;  3W2Z A;  1GSX A;  1L0F A;  1ERM A;  1K57 C;  4HJ6 A;  3IXB A;  4HP4 A;  4HBU A;  4X68 A;  4E3M A;  1XA1 A;  5E43 A;  3FPW A;  1N9B A;  2L1M A;  3MZF A;  1K4F A;  1CJF A;  3KYE A;  1EWZ A;  5DJU A;  5FQJ A;  4A5R A;  4PM9 A;  4WEJ A;  1ONH A;  3HBR A;  3HLG A;  4WL9 A;  2H28 A;  2A49 A;  1CI8 A;  4WZ5 C;  3T4S A;  4BBU A;  1YMX A;  1L2S A;  5KZH A;  2VGK A;  2WGW A;  4DDS A;  4PPR A;  5HAQ A;  1K57 A;  1FQG A;  3P09 A;  2ZQD A;  3S22 A;  1PYY A;  3PBO A;  1MY8 A;  4U0T A;  5DF8 A;  2ZC5 B;  4FOF A;  1W63 Q;  4BBV A;  4RYE A;  2Y2H A;  4E04 A;  4DXC A;  1K25 A;  2O9A A;  2W1R A;  1ACF A;  5M19 A;  3Q7V B;  1TDL A;  2P9V B;  1JWV A;  1CEG A;  2KX6 A;  1G6A A;  4X55 A;  4WZ5 A;  2QJ5 A;  4DE0 A;  1DJA A;  4WM9 A;  1KE0 A;  2XD5 A;  1T1B A;  1N4O A;  3NDG A;  1WE4 A;  4R70 A;  3PTE A;  5CED A;  4GLQ A;  1IKI A;  2VV6 A;  3RFB A;  1W7F A;  2R9W A;  3S7P A;  4LRY C;  3ZVW A;  2BG1 A;  1KE3 A;  2W3D A;  3TE8 A;  2ZMA A;  2ACG A;  5F83 A;  5FQI A;  1N9N A;  1JTD A;  3D3O A;  4UEY A;  3UB9 A;  2Y2N A;  3KSI A;  1S4S A;  3SS5 A;  3SS4 A;  1WYC A;  3Q7Z A;  1OME A;  3AGD A;  2Q0O A;  3IQA A;  3OPR A;  3OPH A;  4IED A;  3VP0 A;  4N9L A;  4BJP A;  2A24 A;  3CUE C;  1YKD A;  3PAG A;  5KIZ A;  5AQ7 A;  1PIO A;  1GA9 A;  4EBL A;  4BQM A;  2HZ5 A;  1VEU B;  1LI0 A;  4WYY A;  4FD8 A;  4NXB A;  5HSQ A;  3HLE A;  1YAX A;  1SZV A;  4BL2 A;  5HL1 A;  4ZAM A;  3T4K A;  1G28 A;  4UHU A;  2ZOI A;  4CPK A;  4KZ9 A;  5TBM A;  5CER A;  4MN7 A;  3CAX A;  4R3A A;  4P87 A;  3CPT B;  3CUE A;  3GEC A;  1FOF A;  3JYI A;  4OKP A;  5F68 A;  1ZC2 A;  2ZC4 B;  4IBX A;  4ZBE A;  2IWC A;  3DTK A;  1E4D A;  3T4T A;  5EM1 A;  2JKT M;  2ZJ9 A;  2ZQ9 A;  3DWK A;  1LSW A;  2XFS A;  4IJG A;  2PYR A;  3CI6 A;  3G30 A;  4O0P A;  2ZQA A;  4X56 A;  4S2J A;  2Y2G A;  4HHD A;  2BLS A;  3KX0 X;  4I3A A;  4N92 A;  3BY9 A;  2WGW B;  4PM6 A;  1NRF A;  3MXQ A;  4DRT A;  4LV3 A;  1ESU A;  2GNX A;  2KOI A;  2QKP A;  4R4S A;  2EA9 A;  2ZBB A;  5DKK A;  3S7N A;  2DRW A;  5GLD A;  2PR5 A;  1YM1 A;  5I5L A;  1S1Y A;  1Y28 A;  3WWX A;  1BSG A;  2OWJ A;  1CF0 A;  3UE6 A;  1WA9 A;  3MQQ A;  3OPP A;  1M6K A;  3MFD A;  3BM6 A;  4H6J A;  3LIB A;  5HW3 A;  5FA7 A;  3ISG A;  2J3T C;  4DMZ A;  4EES A;  1OTD A;  2XFT A;  5D3O A;  4KEN B;  3UE0 A;  4HI4 A;  4EXO A;  3GDI A;  4OOY A;  4BBT A;  3ZDJ A;  4JGP A;  5KSC A;  3TJZ C;  3BEC A;  4Y0T A;  3IH8 A;  1XFN A;  3GMW A;  3LIA A;  2VV8 A;  2Y2P A;  2EX9 A;  2Y2J A;  1PRQ A;  3CMZ A;  1OTE A;  4PM5 A;  5EVI D;  4JBF A;  5HFO A;  5L09 A;  2FFF B;  3RJU A;  2OLU A;  2A24 B;  3TSG A;  2L4R A;  1YQS A;  4IVI A;  2R9X A;  3LY4 A;  4MBH A;  2B02 A;  5CHU A;  2ZC6 B;  5EVL A;  3DTE A;  3UB6 A;  2Y79 A;  5JYO A;  3BQA A;  3QP6 A;  3S7Q A;  3U2A A;  1Q2Q A;  1ES4 A;  3H7W A;  2J80 A;  2H5S A;  4L9F A;  1K6R A;  3ULF A;  2ZQ7 A;  2D01 A;  5TBM B;  4NXG A;  5FAT A;  2C5W B;  5LBR A;  2WKE A;  4Q0H A;  1H0M A;  4BD0 A;  2JBF A;  3IF5 A;  4Y7P A;  4MNR A;  2Y55 A;  4QY5 A;  5F1G A;  5E2E A;  1TS7 A;  2A2L A;  4L9G A;  1IYO A;  3IX8 A;  3HLC A;  3FG8 A;  3PHY A;  1L0G A;  1KGG A;  2OOL A;  1ES2 A;  3CJM A;  2A3U A;  1VET A;  1FCO A;  3Q81 A;  4DJ3 A;  1IYS A;  2LB9 A;  5AQ9 A;  1DP8 A;  3UDF A;  2XRO A;  5HAP A;  1NJ4 A;  3UB5 P;  1YLT A;  2G2U A;  1Y54 A;  1YPR A;  4P6B A;  4UQI M;  1VB6 A;  1YSP A;  2PRF A;  3LIE A;  1ZG4 A;  2XRN A;  1KDS A;  2HJE A;  3VP2 A;  1K54 C;  4NK3 A;  4PAU A;  3VOZ A;  2OLV A;  3VOL A;  4WBG A;  3WS1 A;  1PI4 A;  2X71 A;  1JNU A;  3H82 B;  1PW1 A;  1NLY A;  3IS2 A;  1MC0 A;  5HWV A;  2HP9 A;  1FSY A;  1MKI A;  5DFX A;  5M18 A;  4H6J B;  3UDI A;  3G4P A;  4KQQ A;  1K55 C;  1LHY A;  4MLL A;  3EOI A;  4EWF A;  4Y0U A;  5FI2 A;  1MZU A;  4QJG A;  5EUA A;  5DTK A;  4ZJ2 A;  1K54 A;  2HP5 A;  1OJG A;  4B93 A;  2EWV A;  2PT7 A;  3ZG0 A;  3C30 A;  3LIF A;  5GLA A;  5DTT A;  4WN5 A;  3MR0 A;  3BRM A;  5FDH A;  3L7H A;  3VSK A;  1K56 A;  1MWT A;  1T1A A;  4RA7 A;  4OPQ A;  1J3W A;  1K55 A;  4MBF A;  4GN2 A;  4B9O A;  1T19 A;  4JXG A;  3EQU A;  2P9V A;  2WAF A;  1W63 M;  5CHJ A;  1L0E A;  1CQA A;  4QB8 A;  1L3L A;  3T4L A;  4R6L A;  1NWZ A;  3ZG9 B;  2LB5 A;  2Z6C A;  5DVA A;  2VGL S;  1OT9 A;  4DE2 A;  4UA6 A;  3EEA A;  3H7W B;  3D4F A;  1HLU P;  4U0X A;  4HH3 A;  3LGO A;  2M7U A;  1BLH A;  3V39 A;  1SKO A;  2R78 A;  5HWT A;  2WKQ A;  4PM8 A;  4XT2 B;  5F6A A;  3LO7 A;  2X01 A;  3ZCZ A;  3R7W A;  3VV4 A;  3IF6 B;  3HUO A;  2B18 A;  4B88 A;  2NUP C;  1HVB A;  4WEL A;  3MKF A;  1VET B;  3KSF A;  3RTY A;  4EBN A;  2P04 A;  3K2N A;  3ZNT A;  5A93 A;  1F5M A;  4AFI A;  2ZM8 A;  4CLC C;  2FFY A;  3MMH A;  2UV0 E;  2HDS A;  3T4J A;  2PD8 A;  1GHM A;  1D7E A;  3NHQ A;  1S6R A;  5EE8 A;  1JWZ A;  3GR2 A;  2Q9M A;  3D9Y A;  1XJ2 A;  4OH0 A;  4DJ2 A;  2O9C A;  5DFY A;  3MQ0 A;  2WZZ A;  3OBF A;  3MZD A;  3T1X A;  3VFH A;  1T18 A;  1EI5 A;  1T1C A;  4KG5 A;  4MMN A;  4DXB A;  1OTB A;  4HOI A;  5E2G A;  2D02 A;  5IT5 A;  4EQI A;  2Y59 A;  4CLC A;  3IS2 B;  3NIA A;  1P97 A;  4B4Z A;  1NZO A;  3M2J A;  2V8C A;  4EU0 A;  4NXF A;  4ZDX A;  4Q0J A;  3TOI A;  4D2O A;  1BT5 A;  5F82 A;  1LLB A;  4IBR A;  1RGY A;  4KUO A;  5MC7 A;  2XSS A;  2E8J A;  4ZTK A;  3K3C A;  3O87 A;  1Z09 A;  3LR5 A;  1YSQ A;  4LCM A;  3PBT A;  3OCL A;  2HDU A;  1MWU A;  1IKG A;  1MXO A;  2OV5 A;  1W5D A;  3F1P B;  4QPR A;  4F94 A;  2HGV A;  2WZX A;  4KZ6 A;  2V1Z A;  4I5S A;  1PWD A;  2WAE A;  2P7J A;  4S2K A;  5FAQ A;  4I3I A;  4GD8 A;  4WUJ A;  3JVU A;  3QP8 A;  1LSV A;  3FV7 A;  3GRJ A;  3KSG A;  3D72 A;  3ZGA B;  3ZQ5 A;  2VK3 A;  3C2W A;  2NUT C;  3V50 A;  5FI7 A;  3LFV A;  2AVX A;  4P85 A;  1NY0 A;  1SKO B;  2V0W A;  3LEZ A;  3TRC A;  1NRJ A;  2JKR I;  4GDN A;  1TS6 A;  4LFU A;  4KQO A;  3R7W B;  5HWW A;  2WUQ A;  4F3L B;  3QNC A;  4S2O A;  4BLM A;  2YKF A;  3G2Y A;  2Y4A A;  1GHP A;  1UWN X;  1G6O A;  3IH9 A;  3AGE A;  3QP1 A;  2XA7 M;  3CZD A;  3P98 A;  3GQZ A;  1XGJ A;  4QHC A;  3VP1 A;  4YOF A;  1S4R A;  3R4K A;  4N9K A;  3B33 A;  1FR6 A;  4O7D A;  5U47 A;  5GLC A;  4G3K A;  3E4P A;  1DY6 A;  2Y2Q A;  2B95 A;  4LV0 A;  4BEN A;  4Y0O A;  4Y15 A;  3MSH A;  1BYW A;  2EXB A;  1F98 A;  2GDN A;  2HJ9 C;  5IU1 A;  1KGF A;  2EX2 A;  3F1O A;  4OQ0 A;  2FZ0 A;  4RX2 A;  3T1S A;  3RXW A;  2WGI A;  3LYX A;  5FL3 A;  1I2W A;  2OSU A;  4HY8 A;  4OPY A;  3NCK A;  4PHT A;  4HIA A;  2UWX A;  1JVJ A;  4CLC B;  1F9I A;  4EBP A;  2XD1 A;  4I38 A;  1H8Z A;  4NEE D;  1YLY A;  5A90 A;  3VFF A;  1DJC A;  4JXW A;  4E3J A;  5HDD A;  4EUZ A;  5L2F A;  3OC2 A;  3HJI A;  3KO6 A;  4GNU A;  4E3I A;  3BFG A;  5FAS A;  4DF6 A;  5FSR A;  3E4Q A;  1ZG6 A;  4L0L A;  2MJ6 A;  3MS6 A;  2Y2L A;  1NZU A;  3SH9 A;  3UME A;  2ZM2 A;  3C38 A;  1V9Y A;  4O8G A;  5FAP A;  3HUM A;  1U60 A;  3S1Y A;  3BYD A;  2JC7 A;  1H8M A;  2QYB A;  4JF6 A;  3T50 A;  4Y17 A;  3MKE A;  4LCL A;  1XJ3 A;  3SW1 A;  4I3J A;  3HLF A;  3TG9 A;  3H82 A;  1S67 L;  2ZLY A;  5HAI A;  3W8K A;  4GCZ A;  2PHY A;  4UAA A;  3SOI A;  4HBT A;  3K3D A;  5GHZ A;  2JE5 A;  4OOL A;  3BJN A;  3IT9 A;  1QMF A;  4Y5F A;  3H9W A;  1S1Z A;  5J8X A;  3EQV A;  3LI9 A;  2VV7 A;  2W3H A;  3L9K A;  1VHM A;  3O5Y A;  4P6Z S;  5FQQ A;  1ERO A;  5CHM A;  1W8Q A;  4JGQ A;  1MBL A;  4LEN A;  4GB7 A;  4Y2F A;  4DKI A;  3PYP A;  3VE3 A;  4EEP A;  3E4O A;  3W4Q A;  1YLP A;  1X0O A;  3T4O A;  3NBL A;  4KZ5 A;  2HPB A;  3ZNY A;  3IXH A;  2JKT I;  2DMW A;  2BAS A;  2HDR A;  1KOU A;  3NDE A;  4KG6 A;  4OLD A;  3IF6 C;  2XDM A;  5FEG A;  3FC7 A;  3MF0 A;  3LEQ A;  1N9L A;  1FR1 A;  1ONG A;  3KSH A;  5FQK A;  2P08 A;  1W79 A;  2Z2L B;  3VP3 A;  4ARZ A;  1FIK A;  3FPV A;  3V3S A;  3G32 A;  4GS9 A;  3T1Q B;  4JLF A;  2JN7 A;  1S0W A;  3F1O B;  1E25 A;  4HNB A;  5CGW A;  4YIN A;  3BLS A;  3PBQ A;  1UGU A;  2K31 A;  5HD3 A;  4XT2 A;  5F1F A;  1O7E A;  3IF6 A;  4JF4 A;  1BZA A;  3V3R A;  4S2N C;  2W1T A;  4M4X A;  2KDK A;  1LSX A;  5IS1 A;  3N4I A;  3DW0 A;  1BLS A;  4S2L A;  5F69 A;  4CQH A;  1RCJ A;  4R1G A;  1K0K A;  1ZHH B;  3NOP C;  5FI6 A;  4ME4 A;  3IWQ A;  4YWZ A;  5FQM A;  3FKV A;  3MXR A;  1NYY A;  4R0Q A;  5HDC A;  2ZMF A;  4OQI A;  3W4O A;  2J3T D;  3PR6 A;  5GHY A;  4XUX A;  3ZVT A;  4N1X A;  1ZKJ A;  3BY8 A;  2WYX A;  1K38 A;  1EW0 A;  5J4E A;  3GVB A;  2VKS A;  4MN5 A;  3WS5 A;  4FTX A;  1LL8 A;  4LRX C;  2M7V A;  3IX4 A;  1GA0 A;  3C5A A;  4Z9Q A;  2DNS A;  5CEC A;  2W0N A;  4QWO A;  4WLA A;  1MWS A;  3E0Y A;  1JWP A;  1Y4O A;  4Z1W A;  1VQQ A;  2J8Y A;  1SCW A;  1RP5 A;  3BWL A;  3NOU C;  4IUH A;  1HD8 A;  5FEF A;  5TR7 A;  3WS0 A;  4PMA A;  3SZT A;  4JF5 A;  2M1C A;  2C6W B;  3UE3 A;  4KZ4 A;  4EET B;  3QP5 A;  4UA9 A;  1AWI A;  4B4X A;  4BWI A;  1HZO A;  4K0W A;  4WF0 A;  2Y2O A;  4JGR A;  3RH8 B;  1IEM A;  3B42 A;  3F1P A;  3OPL A;  2VX8 A;  4KZ7 A;  4PKY A;  4OP5 A;  3S4X A;  1LL5 A;  5F5Y A;  4C75 A;  1XKZ A;  2Y2K A;  2Z6D A;  1BUL A;  5EEC A;  5HD5 A;  1O07 A;  5TJJ A;  5EFW A;  2ZMV A;  3QHY A;  3IBR A;  3G34 A;  1ZTU A;  1XP4 A;  4ARZ B;  3NJA A;  1XXM A;  4GS9 B;  4KG2 A;  2V0U A;  3M2K A;  3IHA A;  4IUK A;  3KYQ A;  1YT4 A;  2W27 A;  3NI9 A;  3S7O A;  4I39 A;  4HQA A;  3O88 A;  3QNB A;  4LPZ A;  1E3U A;  2WGV A;  4C6Y A;  4F3L A;  2Y2I A;  5E2F A;  1MWR A;  1PWC A;  1YLZ A;  4EEU A;  4G3W A;  2W1T B;  4DE3 A;  3A3F A;  3LR0 A;  1BTL A;  4H8R A;  2P74 A;  3MFX A;  4OQG A;  3E2L A;  4JGO A;  1TS0 A;  3FZC A;  5FQ9 A;  1KVL A;  3HLB A;  3IHB A;  4EER A;  1TF1 A;  4E3L A;  1SKF A;  2V20 A;  4WEK A;  5J3W A;  1K56 D;  1P9W A;  2ZM0 A;  3F1N A;  1NLZ A;  4JPM A;  2Z2M B;  4DE1 A;  1OJ5 A;  1PZO A;  1IYP A;  4S2M A;  1OTI A;  4GW9 A;  2JHE A;  4ESP A;  4ETZ A;  4MBK A;  1A0K A;  5C5K A;  3HJK A;  1MPL A;  3UMD A;  2DCF A;  3IX3 A;  4EUV A;  4YFM A;  3V5M A;  3DAV A;  5FAO A;  4BD1 A;  5AQA A;  3N8R A;  2ZOH A;  2K2N A;  4LLO B;  3BLM A;  3ZFZ A;  4GOG A;  4JKT A;  2XF3 A;  5CRF A;  2EWW A;  4C3Q A;  2J3W A;  2V8F A;  5DF7 A;  2KLI A;  3N7W A;  4GD6 A;  1G68 A;  4LV2 A;  3PXP A;  4LRZ E;  1S66 L;  3CHW P;  3N8L A;  2WAD A;  3UO9 A;  2PBY A;  3SH7 A;  1TVF A;  4K91 A;  5CEB A;  3WRZ A;  5EM0 A;  2XK1 A;  4KZ3 A;  1KE4 A;  3LID A;  3HL9 A;  2EFX A;  4RVA A;  4GDB A;  1D1J A;  3BFF A;  1JTG A;  2V9A A;  1H8Y A;  3VE4 A;  3BW6 A;  2ZC7 A;  5M1A A;  1IEL A;  2VGL M;  3P01 A;  2VZW A;  3EEH A;  1P0Z A;  4GHI A;  2PYP A;  1LL9 A;  5HL6 A;  1GSV A;  5L07 A;  5KMW A;  4X25 A;  4E3N A;  5GHX A;  3UPP A;  5BOH A;  2VJW A;  2Y2M A;  1DP6 A;  5AVE A;  3OCN A;  1PZP A;  4KZ8 A;  4LGW A;  1W8Y A;  3T12 B;  5CGX A;  3UY6 A;  3VP4 A;  3LR4 A;  3UB7 A;  4CLC D;  4X69 A;  4KQD A;  2PR6 A;  4HES A;  3NUL A;  2EX8 A;  2JKF A;  4NKP A;  3WRT A;  5EV0 A;  5K5B A;  4ZRR A;  2RCX A;  1I5Q A;  4E6W A;  4X6T A;  4X53 A;  3PBS A;  3IBJ A;  1ERQ A;  2EX6 A;  2OAP 1;  1NYM A;  4E3K A;  5HDS A;  3B3X A;  5CGS A;  5L8M A;  5HPI A;  1SDN A;  3IWO A;  2W3G A;  4D60 A;  1XA7 A;  3LIC A;  3I7J A;  4U3T A;  1K4E A;  2VLG A;  2XH9 A;  2OAQ 1;  2W3E A;  3A3E A;  3F1N B;  4PKY G;  3VMA A;  2B5R A;  3WS4 A;  4X1L A;  1TDG A;  5AVF A;  5JYP A;  4HJ3 A;  2OWH A;  4P0M A;  3LI8 A;  2WKR A;  4UA7 A;  3UB8 A;  5L10 A;  1ODV A;  1VM1 A;  2YKH A;  2JKG A;  3C4O A;  1NXY A;  4NG2 A;  2G2W A;  4NET A;  3OLO A;  4KQR A;  2INW A;  4GZB A;  2ZQ8 A;  1OPX A;  3WS2 A;  3T1R A;  2GZA A;  1XPB A;  1FCN A;  4XUZ A;  1CI9 A;  2WKP A;  1TEM A;  2WK0 A;  5DF9 A;  4X1M A;  2ZC3 B;  2QZ6 A;  4R3B A;  4R23 A;  5EVI C;  3N6I A;  4ZJ3 A;  1XFQ A;  3JVV A;  3SH8 A;  3IWI A;  3A3J A;  5DKL A;  1KDW A;  1PNE A;  2IA2 A;  3AGF A;  3A0V A;  4FCF A;  3M6B A;  4OPZ A;  3HCY A;  3UPO A;  5HAR A;  3HRE A;  4HEF A;  3UE1 A;  1TD5 A;  3NEC A;  5J7E A;  2EFU A;  1IFQ A;  4GHI B;  3ZYT A;  5A8B A;  1H3Q A;  3FYZ A;  1PI5 A;  4ZJ1 A;  4FUW A;  4II7 A;  1SHV A;  1HTZ A;  5EVI A;  1ESI A;  3BFE A;  3LCE A;  3UNW A;  2HV1 A;  2GX5 A;  5CX7 A;  3NY4 A;  4K0X A;  3ZG7 B;  4DDY A;  4BL3 A;  5HPF A;  4K08 A;  1FIL A;  5E2H A;  3ITA A;  2EXA A;  3U4L P;  3M6H A;  4ETX A;  1PWG A;  1F2K A;  4L9E A;  3KYZ A;  3N8S A;  1XX2 A;  2O9B A;  2J7V A;  4OVD A;  3PBR A;  3DBA A;  3P7N A;  1Q2P A;  1SDE A;  2QJ7 A;  1DP9 A;  2XGN A;  2PAV P;  4ID4 A;  4FSF A;  4UQI S;  4PM7 A;  3E98 A;  2JCH A;  2PBD P;  2PU2 A;  1M40 A;  3VOY A;  1OT6 A;  4Q8I A;  5HZH A;  2WKI A;  1KVM A;  1FSW A;  4LV1 A;  4Q0I A;  3UPN A;  4WZ4 A;  2XQZ A;  1DJB A;  2CMN A;  3BEB A;  4JXS A;  5TGF A;  3FWL A;  3B47 A;  3G6O A;  1ES3 A;  3LR3 A;  3EGX C;  4DN0 A;  1GSW A;  3LY3 A;  3DTI A;  3UN7 A;  4GJ4 A;  3HLW A;  3MJQ A;  2PU4 A;  3C7U A;  5FDS A;  5DJT A;  3PBN A;  1D06 A;  2ZD8 A;  3G31 A;  3C4P A;  3BFD A;  3CG5 A;  2IWD A;  4OOM A;  2PD7 A;  5GLB A;  3VSL A;  2Y8H A;  1LT0 A;  4JXV A;  5G4Z A;  3IXD A;  5G4Y A;  1IYQ A;  4BMW A;  2I9V A;  1G5U A;  2HF6 A;  3G2Z A;  1UWP X;  1FCM A;  4R4R A;  1RGZ A;  2ZQC A;  3MQO A;  4S2P A;  3ZHH A;  5KSH A;  2J9O A;  3UDX A;  1BLP A;  3ZG8 B;  4G3V A;  5I94 A;  4FH4 A;  1WYB A;  4M3K A;  1BLC A;  2HP6 A;  3NC8 A;  1YMS A;  3Q82 A;  5G18 A;  4MEZ A;  2XLN A;  5CTN A;  3CWF A;  1BUE A;  2BTF P;  3QP4 A;  3BQ8 A;  3OOV A;  4RQ9 A;  4N1H A;  2VA0 A;  2O0Y A;  4MCW A;  4S2N A;  1ES5 A;  2H0Y A;  2VGJ A;  3O3V A;  2W3F A;  2O99 A;  4CJN A;  1IOU A;  1ALQ A;  4FH2 A;  5AJG A;  3EWK A;  3E2K A;  5EVI B;  2E8I A;  2G7U A;  4P6Z M;  4EQ1 A;  4WMC A;  3CLO A;  4XXR A;  5CXW A;  2ZL1 A;  2QPN A;  3DTM A;  3Q1F A;  3MXS A;  3ZG5 A;  4O01 A;  3A0R A;  3BFC A;  3C8C A;  2XR0 A;  2H0T A;  4R38 A;  1PW8 A;  3SS3 A;  2L0W A;  5EPH A;  3DWZ A;  4EW7 A;  1P9R A;  5IHV A;  2RL3 A;  2V2F F;  1Z6F A;  1KGE A;  1GCE A;  5DTS A;  2WKH A;  2VEA A;  3C7V A;  3HLD A;  3GTC A;  4E6X A;  1CK3 A;  2QHK A;  2IWB A;  1XGI A;  4GKU A;  3MBZ A;  5A91 A;  1QME A;  2K7S A;  4Y3I A;  4KZA A;  3GV9 A;  3GSG A;  5HX9 A;  1H5X A;  1MKM A;  2J9P A;  4R3J A;  4S2I A;  5TFQ A;  5A92 A;  2I72 A;  5AQB A;  4IVK A;  4WMC D;  3A0S A;  2QMI A;  1GHI A;  3Q7V A;  4QY6 A;  3PAE A;  5EOO A;  4YNR A;  5GL9 A;  1L0D A;  3RXX A;  4NXE A;  3JPU A;  3A3I A;  4MDZ A; 
#chains in the Genus database with same CATH homology
 1N9O A;  3V67 A;  4L0L A;  2VJW A;  1TS7 A;  2A2L A;  1STZ A;  4L9G A;  1DP6 A;  5AVE A;  3OCN A;  3FG8 A;  4HJ4 A;  3PHY A;  2MJ6 A;  2OOL A;  3LR4 A;  3LUQ A;  3UB7 A;  4CLC D;  4IHQ A;  3UME A;  3C38 A;  4DJ3 A;  1V9Y A;  4O8G A;  2LB9 A;  4MN6 A;  4KQD A;  1DP8 A;  3TW8 A;  2PR6 A;  2XRO A;  2QYB A;  1H8M A;  2GJ3 A;  1XJ6 A;  3T50 A;  4NKP A;  5K5B A;  4ZRR A;  1XJ3 A;  3SW1 A;  4I3J A;  1TS8 A;  1OTA A;  1DRM A;  3H82 A;  3PBS A;  3IBJ A;  1S67 L;  4KUK A;  2OAP 1;  4GCZ A;  2PHY A;  5HDS A;  2FH5 A;  4UQI M;  1V9Z A;  3K3D A;  1VB6 A;  1YSP A;  2V1B A;  4OOL A;  2QWS A;  5L8M A;  5HPI A;  3LIE A;  3BJN A;  4Y5F A;  2XRN A;  3H9W A;  1S1Z A;  2HJE A;  2W3G A;  2PDR A;  4CLC E;  3EQV A;  3LIC A;  3LI9 A;  2VV7 A;  4PAU A;  2W3H A;  1XJ4 A;  1VHM A;  3VOL A;  3O5Y A;  4P6Z S;  1JNU A;  3CIT A;  3H82 B;  1NLY A;  3T4Q A;  2VLG A;  4HP9 A;  3IS2 A;  1MC0 A;  5HWV A;  4JGQ A;  2OAQ 1;  2W3E A;  3F1N B;  4HH2 A;  4PKY G;  5DFX A;  4Y2F A;  4H6J B;  3PYP A;  3VE3 A;  4EEP A;  5AVF A;  4HJ3 A;  3E4O A;  2XA7 S;  1X0O A;  2JKR M;  2OWH A;  3NOT C;  3LI8 A;  2V1A A;  3ICY A;  3T4O A;  2WKR A;  3EOI A;  3EGD C;  3UB8 A;  1ODV A;  2YKH A;  1GSX A;  3W2Z A;  1MZU A;  2JKT I;  4HJ6 A;  4HP4 A;  2DMW A;  2BAS A;  1KOU A;  3OLO A;  3FC7 A;  2INW A;  3MF0 A;  1OJG A;  3FPW A;  1N9L A;  2L1M A;  4B93 A;  1OPX A;  2EWV A;  2PT7 A;  3C30 A;  3LIF A;  3KSH A;  2GZA A;  4WN5 A;  2P08 A;  3MR0 A;  4ARZ A;  3FPV A;  5DJU A;  4GS9 A;  2WKP A;  4WEJ A;  5DF9 A;  2JN7 A;  1T1A A;  3F1O B;  4WL9 A;  2H28 A;  4HNB A;  4B9O A;  3T4S A;  4BBU A;  1T19 A;  3PBQ A;  3EQU A;  1XFQ A;  3JVV A;  1UGU A;  1W63 M;  2K31 A;  5HD3 A;  4XT2 A;  5DKL A;  3PBO A;  3T4L A;  4R6L A;  2IA2 A;  1NWZ A;  2LB5 A;  3A0V A;  2Z6C A;  2VGL S;  4FOF A;  1OT9 A;  2W1T A;  1W63 Q;  3HCY A;  4M4X A;  2KDK A;  3EEA A;  3H7W B;  4BBV A;  1LSX A;  5IS1 A;  4E04 A;  4HH3 A;  1TD5 A;  5F69 A;  4CQH A;  2O9A A;  2M7U A;  2W1R A;  5J7E A;  1ZHH B;  3NOP C;  1IFQ A;  4GHI B;  4ME4 A;  3ZYT A;  5A8B A;  1H3Q A;  2R78 A;  5HWT A;  4YWZ A;  2WKQ A;  2KX6 A;  4XT2 B;  4II7 A;  5F6A A;  2QJ5 A;  3R7W A;  3VV4 A;  5HDC A;  2ZMF A;  1T1B A;  2J3T D;  2HV1 A;  3PR6 A;  2GX5 A;  4R70 A;  2B18 A;  5CX7 A;  2NUP C;  4GLQ A;  4WEL A;  2VV6 A;  5HPF A;  4K08 A;  3RFB A;  3KSF A;  3RTY A;  3BY8 A;  3S7P A;  2P04 A;  4LRY C;  1EW0 A;  4ETX A;  3K2N A;  5J4E A;  4L9E A;  3KYZ A;  2W3D A;  2VKS A;  1F5M A;  4AFI A;  2O9B A;  4MN5 A;  3TE8 A;  4CLC C;  1LL8 A;  3PBR A;  3DBA A;  3P7N A;  4LRX C;  2QJ7 A;  1DP9 A;  2M7V A;  1N9N A;  3D3O A;  4UEY A;  3UB9 A;  3MMH A;  4FSF A;  4UQI S;  3E98 A;  1OT6 A;  2W0N A;  1S4S A;  3KSI A;  4WLA A;  3T4J A;  2PD8 A;  1D7E A;  3E0Y A;  3NHQ A;  5HZH A;  4Z1W A;  4Q0I A;  4BJP A;  2A24 A;  3CUE C;  2CMN A;  1YKD A;  5KIZ A;  3BWL A;  3NOU C;  1XJ2 A;  4IUH A;  3B47 A;  4DJ2 A;  2O9C A;  5DFY A;  3G6O A;  3MQ0 A;  3OBF A;  1T18 A;  1T1C A;  3LR3 A;  4MMN A;  1OTB A;  4HOI A;  2M1C A;  3EGX C;  4DN0 A;  1GSW A;  4NXB A;  5HSQ A;  2D02 A;  5IT5 A;  4CLC A;  3UE3 A;  1YAX A;  3IS2 B;  1P97 A;  4EET B;  4EU0 A;  4GJ4 A;  4NXF A;  3T4K A;  4Q0J A;  1G28 A;  3MJQ A;  4BWI A;  2ZOI A;  5DJT A;  3PBN A;  5TBM A;  4MN7 A;  4WF0 A;  1D06 A;  3CAX A;  4R3A A;  4JGR A;  3RH8 B;  4KUO A;  3B42 A;  5MC7 A;  3F1P A;  2VX8 A;  4PKY A;  4OOM A;  2PD7 A;  2XSS A;  3CUE A;  3GEC A;  5F5Y A;  5F68 A;  2Y8H A;  2Z6D A;  3K3C A;  3LR5 A;  1YSQ A;  1LT0 A;  5HD5 A;  3PBT A;  5G4Z A;  3T4T A;  5TJJ A;  5G4Y A;  5EFW A;  2ZMV A;  3OCL A;  2JKT M;  3IBR A;  4BMW A;  2I9V A;  2HF6 A;  1ZTU A;  1LSW A;  1UWP X;  4IJG A;  4ARZ B;  2PYR A;  3NJA A;  4GS9 B;  2V0U A;  3CI6 A;  3MQO A;  5KSH A;  4O0P A;  3F1P B;  4IUK A;  4QPR A;  3KYQ A;  4HHD A;  2HGV A;  3KX0 X;  2W27 A;  4I3A A;  3S7O A;  4I39 A;  3BY9 A;  4HQA A;  4I5S A;  4G3V A;  2P7J A;  4I3I A;  3MXQ A;  4LPZ A;  4WUJ A;  3JVU A;  4F3L A;  2GNX A;  2KOI A;  2QKP A;  1LSV A;  3CWF A;  3KSG A;  3D72 A;  4EEU A;  4G3W A;  2EA9 A;  2W1T B;  3LR0 A;  3ZQ5 A;  2ZBB A;  3C2W A;  5DKK A;  3S7N A;  3MFX A;  3BQ8 A;  2PR5 A;  4JGO A;  3OOV A;  1TS0 A;  2NUT C;  5I5L A;  1S1Y A;  1Y28 A;  4RQ9 A;  2VA0 A;  4EER A;  3LFV A;  2O0Y A;  1TF1 A;  4MCW A;  2V0W A;  3TRC A;  2OWJ A;  2W3F A;  2O99 A;  3UE6 A;  1IOU A;  1NRJ A;  2JKR I;  4WEK A;  1WA9 A;  5J3W A;  5AJG A;  1P9W A;  3EWK A;  3MQQ A;  1TS6 A;  4KQO A;  3R7W B;  2G7U A;  5HWW A;  4P6Z M;  3F1N A;  1NLZ A;  4EQ1 A;  4F3L B;  4H6J A;  3LIB A;  1OJ5 A;  2YKF A;  3CLO A;  1OTI A;  4GW9 A;  1UWN X;  2JHE A;  4ETZ A;  2J3T C;  1G6O A;  4DMZ A;  5C5K A;  3HJK A;  2XA7 M;  3UMD A;  4EES A;  1OTD A;  4O01 A;  3A0R A;  3C8C A;  4HI4 A;  4YOF A;  3GDI A;  4EXO A;  1S4R A;  4EUV A;  3R4K A;  4R38 A;  4BBT A;  3B33 A;  2L0W A;  4JGP A;  2ZOH A;  2K2N A;  3TJZ C;  4G3K A;  4LLO B;  3E4P A;  4EW7 A;  1XFN A;  1P9R A;  3LIA A;  2VV8 A;  2EWW A;  2J3W A;  1OTE A;  2VEA A;  2KLI A;  3PXP A;  4LRZ E;  1S66 L;  1BYW A;  1F98 A;  5IU1 A;  2HJ9 C;  3F1O A;  2A24 B;  2FZ0 A;  2QHK A;  2L4R A;  3LYX A;  5FL3 A;  4HY8 A;  2B02 A;  4PHT A;  4HIA A;  3LID A;  2K7S A;  4CLC B;  4Y3I A;  3UB6 A;  2Y79 A;  1F9I A;  3BQA A;  3S7Q A;  4I38 A;  3U2A A;  2V9A A;  4NEE D;  1MKM A;  3VE4 A;  3H7W A;  2J80 A;  3BW6 A;  4L9F A;  3ULF A;  2VGL M;  2D01 A;  3P01 A;  5HDD A;  5TBM B;  4NXG A;  2VZW A;  3EEH A;  3A0S A;  1P0Z A;  3HJI A;  3OC2 A;  4GHI A;  2PYP A;  5LBR A;  5HL6 A;  4YNR A;  1GSV A;  4Q0H A;  3KO6 A;  4NXE A;  3E4Q A;  4MDZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...