2VX8A

Vamp7 longin domain hrb peptide complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
136
structure length
136
Chain Sequence
TPEVKPLKSLLGDSAPTLHLNKGMAILFAVVARGTTILAKHAWCGGNFLEVTEQILAKIPSENNKLTYSHGNYLFHYICQDRIVYLCITDDDFERSRAFSFLNEVKKRFQTTYGSRAQTALPYAMNSEFSSVLAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis,exocytosis
molecule keywords NUCLEOPORIN-LIKE PROTEIN RIP, VESICLE-ASSOCIATED MEMBRANE PR
publication title Molecular Basis for the Sorting of the Snare Vamp7 Into Endocytic Clathrin-Coated Vesicles by the Arfgap Hrb.
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 136
sequence length 136
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13774 Longin Regulated-SNARE-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.50 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2vx8A01
2DMWA 1IOUA 1H8MA 2VX8A 4AFIA 3BW6A 3EGXC 2NUTC 3EGDC 2NUPC 1IFQA 4B93A 3KYQA
chains in the Genus database with same CATH superfamily
2L4RA 5KSCA 4M3KA 2WZZA 2D01A 1JVJA 2V2FF 1STZA 4X55A 1FCMA 1ZHHB 4GS9B 2JKRI 4PM8A 3SH9A 2XK1A 2W3GA 3ZCZA 1PYYA 2XFTA 3W8KA 2O9CA 4WMCA 4E3JA 3JYIA 2IWBA 5F6AA 1PZPA 1XJ2A 4QJGA 1DJBA 4I3IA 4ZJ3A 1E3UA 3C8CA 4S2PA 3OBFA 5FQKA 5L8MA 4HH2A 5HD3A 2WKHA 3IT9A 4M4XA 5CTMA 4OPYA 2PU2A 4FH2A 1PW8A 4BD1A 1S6RA 1FOFA 3NJAA 4GJ4A 4LV0A 3M2JA 3TOIA 5MC7A 2HV1A 1U60A 3G32A 1OTAA 4ZRRA 4OLDA 3PYPA 4OPQA 4D2OA 2FH5A 3HL9A 3IF6C 4E3LA 3T1SA 1N9NA 2OAQ1 4GDBA 1UGUA 5FQIA 5FDHA 2KX6A 3NOTC 2EXAA 2MJ6A 1T18A 4MN6A 1YKDA 3IWIA 3FV7A 2JBFA 4B4ZA 2ZD8A 1RP5A 5HDCA 4EXOA 1DJCA 3CI6A 4R0QA 4U0XA 3PBTA 1WYBA 1ONGA 1NY0A 2PBYA 1XP4A 3ZG5A 1K55C 3LYXA 3ZYTA 5E2FA 2DNSA 2Y2MA 4QU3A 2FFYA 4JGRA 1XA1A 4XUZA 4C6YA 1FR6A 3EGXC 2G2UA 5F83A 3O88A 3VP1A 2XSSA 2EX8A 3GDIA 3T4LA 4MNRA 1ERMA 4JXGA 1YLWA 3WS4A 1FCNA 3OLOA 5FDSA 4HJ6A 1SDNA 2XLNA 3VP4A 1TS6A 1G68A 3W4QA 1WE4A 2PDRA 1LI0A 2EXBA 5EVIB 3BFCA 5HWTA 3B33A 4GOGA 5HD5A 4PM9A 2INWA 1CEGA 2PYPA 3UPNA 3ZVWA 4KZ9A 1MC0A 3LR0A 4S2JA 1YSQA 1XJ6A 2XA7M 1G28A 3UN7A 5EV0A 3IWOA 2K2NA 1XJ4A 2EX6A 4KG6A 4DJ2A 2OAP1 3FPWA 3VP0A 3MZFA 2A2LA 4EBPA 3T1XA 2B18A 3KSHA 4C75A 5BOHA 1YT4A 5HARA 3HUNA 3QP1A 2YKFA 4R1GA 2ZL1B 4F94A 1LI9A 2V8CA 1N9BA 5CERA 5AJGA 2Q0OA 2WKQA 3CJMA 3MKEA 3T1RA 4UA6A 3R7WB 1W7FA 2H0TA 3IHBA 1Y54A 4X1MA 2Q9NA 2EX9A 3MXRA 4FH4A 1MY8A 3IF6A 1SZVA 2Q9MA 2V1BA 1GHPA 4R3JA 3FWLA 1DP9A 4QHCA 3GMWA 3DTMA 1JWVA 4QB8A 2ZMAA 3K3CA 4L9FA 1PNEA 1H5XA 2ZL1A 2M1CA 4EW7A 3TRCA 2KDKA 1VEUB 3QHYA 4WM9A 3LCEA 1K55A 1RGZA 2E8IA 4O8GA 3VE4A 4ETZA 2DRWA 2HDRA 3D9YA 3F1PA 4ESPA 4N9KA 1K4EA 3BRMA 4EERA 3OOVA 2P04A 4LENA 4CPKA 3HLGA 4MMNA 2PHYA 5CXWA 4ZJ1A 5KSHA 3MZEA 1SDEA 3LEQA 3P98A 2HJ9C 1ES3A 4P6ZS 1PI5A 1MWUA 4JXSA 5TR7A 3NIAA 3LR4A 4HP9A 3QNCA 1KE0A 4KUOA 4WLAA 2Z6CA 5DKLA 3L7HA 1DJAA 4WN5A 3LI9A 2H5SA 4PPRA 3OC2A 3ZNTA 1KGGA 2QZ6A 5EE8A 5L09A 3G35A 3RFBA 1FILA 1W8QA 5CTNA 4Q0HA 4P87A 5CHMA 4EBLA 4Y13A 5E2EA 2A24B 1NZOA 1HLUP 4FD8A 5EOEA 1RCJA 2PU4A 3R4KA 1OT6A 2W3EA 2K7SA 4IBXA 3O5YA 3QP4A 2OV5A 4S2LA 2EWWA 1KGEA 3SOIA 1TS7A 4LV3A 4WF0A 2B5RA 4E3KA 2EX2A 3B47A 3MZDA 5DFYA 4FTXA 4E6XA 4PHTA 3SS4A 4HNBA 2JHEA 1P0ZA 4GHIA 2X02A 1LL5A 4JLFA 3HBRA 1L0EA 4OPZA 3HJKA 4O0PA 3GSGA 3LR3A 1NRFA 4Y15A 3E0YA 1YLYA 3T4TA 2Y79A 5LBRA 3VP2A 5DTTA 4BBTA 2H10A 5FAQA 3HLBA 2JKTI 3CG5A 1Z6FA 3UMDA 2Y2IA 2OSUA 3A0RA 4Q0IA 3D4FA 3IWQA 4PAUA 1KVLA 3ZVTA 3VOLA 2Y2PA 2DMWA 4OOLA 3FPVA 4L9GA 5I94A 2Y2KA 1IEMA 3V3RA 2HDQA 4X53A 2HGVA 1VHMA 2XQZA 2VGLM 3PBRA 3MXQA 4ETXA 4LV1A 3MMHA 2WGWB 1JWZA 1YSPA 4K0XA 1XXMA 3C5AA 4FUWA 5IT5A 1L2SA 1XX2A 4MBFA 2VGKA 3T1QB 3ITAA 4FSFA 4YOFA 3QNBA 3Q81A 3RXXA 4Z1WA 3HUOA 5M1AA 1W63M 4BLMA 2VA0A 5L10A 4K08A 4C3QA 3N4IA 1TS0A 2ZM2A 3Q7VB 1GA0A 2V1ZA 4QY5A 4OQHA 2H28A 4HQAA 3BFDA 1T1BA 3AGDA 4KQQA 4JGOA 3HLCA 4OQIA 1ZC2A 1LT0A 2EA9A 3A3FA 2WKIA 2VJWA 5EVID 3IHAA 3TG9A 3LO7A 4I3JA 3MQOA 3F1OA 3ZGAB 5HL6A 1QMFA 5J3WA 1MKMA 3PAEA 4DXCA 2OLVA 2WYXA 3IX4A 2W3DA 4PKYG 1H0MA 3FG8A 2WGIA 1L3LA 3MFXA 4IHQA 3ZG0A 3ZDJA 3T4KA 4PM7A 5AQ9A 3UPPA 3LIFA 2GJ3A 4R6LA 4E6WA 4R38A 2XF3A 1OJ5A 4U3TA 4F3LA 3LIBA 3LY4A 1Q2PA 2JC7A 5CGWA 4MCWA 2V0UA 2QMIA 2OWHA 3UE6A 2WK0A 2HPBA 3G34A 4ZJ2A 3P01A 4X68A 4HBUA 1YAXA 4LV2A 3IXDA 4Q8IA 4OH0A 3IH9A 1V9ZA 5TBMB 3HLFA 5EUAA 1IOUA 5KMWA 4ARZB 4PKYA 1CF0A 5HAIA 1NZUA 1M40A 4AFIA 3IBJA 1OTIA 4EESA 3VSKA 4ZDXA 2BASA 1K0KA 3IXBA 1NYMA 5HZHA 3NI9A 1FIKA 2QJ7A 4OLGA 5L2FA 2OOLA 1XGIA 1WA9A 5FEFA 1CI8A 2QWSA 4CQHA 3D72A 4R3BA 3IS2B 5EVIC 3WS0A 4YWZA 1BLCA 2GNXA 2Y91A 5AQ7A 2EWVA 4RA7A 4WYYA 1ALQA 1P9RA 2PAVP 4I38A 5CEBA 5TBMA 2C5WB 3BFFA 5F69A 4ARZA 4DKIA 4I3AA 4GS9A 4BD0A 1TDGA 5CX7A 2J7VA 1OT9A 2P7JA 3W2ZA 5KIZA 2ZC6B 3FYZA 5FA7A 1ES2A 3HLEA 1TF1A 3K3DA 4G3KA 2NUTC 3EQUA 4GB7A 3UE0A 4L0LA 1HD8A 2V0WA 2PRFA 2NUPC 3BW6A 5E43A 3NC8A 5EVEA 3S7OA 3OCLA 4DJ3A 4CJNA 2WUQA 3SS5A 3Q7ZA 4BENA 3CMZA 1I2WA 2AVXA 1CK3A 1YLTA 4EUZA 4EQ1A 3V3SA 3BEBA 3LICA 4YFMA 2J3TD 1XJ3A 2UV0E 4NKPA 3DW0A 4K91A 3C4PA 3VV4A 1OTDA 1YQSA 4IEDA 4DE1A 5FAPA 4OONA 3GR2A 4LRZE 3SW1A 3UY6A 3S7PA 3BQAA 1IKIA 3B42A 1I5QA 3G6OA 4RYEA 1O7EA 3LFVA 1LLBA 1PW1A 3HREA 5EM1A 2QHKA 3UO9A 3E98A 1IKGA 1M6KA 3H7WB 2XEPA 2WZXA 1K38A 3LI8A 1P9WA 1NYYA 2XROA 2L1MA 3M6BA 1GSWA 4HJ4A 4ID4A 3V39A 4MBHA 3N8SA 3GTCA 4G3VA 1D06A 3KX0X 4Y17A 5FQJA 2WKRA 4KZBA 2WAFA 1LSVA 3OPPA 5D3OA 5HPFA 3H7WA 1SCWA 4P6ZM 1YMXA 5FI7A 2O9AA 3UB7A 1VM1A 5AQAA 2J3TC 3I7JA 2B95A 5EVIA 4CLCE 4PM5A 2GDNA 4LFUA 1HZOA 4GNUA 3WS2A 1JNUA 1LL9A 4N92A 2ZQ9A 5A92A 4S2MA 2PBDP 3IH8A 2ZJ9A 3PR6A 4G3WA 4QPRA 5HAQA 5TJJA 4XXRA 1AWIA 2DCFA 2JKFA 3VE3A 2LB5A 4WEKA 2CMNA 4DDSA 3BLSA 1GSXA 2VV8A 3AGEA 4UAAA 4JF4A 3M6HA 4Y0UA 5FQMA 3ZG9B 5CEDA 1AXBA 3KSIA 2PR5A 4BMWA 3LEZA 1SHVA 5DF8A 4MN5A 3R7WA 3LY3A 5HSQA 4ZTKA 4HOIA 1OTEA 1S1YA 2ZQ8A 3O86A 4BWIA 5FEGA 2HP9A 3NOPC 2UWXA 3CWFA 2M7UA 3VP3A 5IS1A 4IBRA 4JKTA 5HAPA 1HVBA 5EPHA 3PXPA 4KZ5A 2CC1A 2HF6A 5TFQA 1K25A 1GA9A 3VOZA 5HW3A 1ACFA 3CPTB 4BL2A 5K5BA 1VEUA 3GECA 2W3FA 2VK3A 4X69A 5E2GA 2W1TB 3E2LA 1NLZA 2WGVA 3K2NA 1TDLA 1MWTA 4EETB 2Z2MB 3QP5A 3VFHA 3QP6A 4GW9A 2B02A 1JTDA 4X6TA 2HDSA 3BLMA 1BTLA 1CEFA 3JVUA 3HLDA 4DMZA 4KENB 1SKFA 4OP8A 5AQBA 1F98A 2VGJA 2W0NA 3CZDA 2Y2LA 3EEHA 2W1TA 3C38A 5F82A 3CAXA 1IYPA 2G2WA 4UA9A 2J9PA 3WS5A 1L0GA 5AVEA 2BG1A 4RX2A 4Y0OA 5HWWA 4L9EA 3T4JA 1HTZA 4KZ7A 1K56D 3DWZA 4GDNA 3UB9A 3GRJA 1F5MA 2A24A 3E4PA 4EBNA 4R4RA 1GHMA 3TJZC 3Q1FA 3QP2A 3G31A 4UA7A 2IWCA 2KLIA 3LIDA 5IU1A 1E25A 1LHYA 1PFLA 2P08A 4S2KA 4HH3A 3KSFA 1BLSA 3KO6A 3WWXA 3FKVA 3IXHA 3T4OA 5FI2A 3N7WA 1W5DA 3E4OA 4KQOA 3GV9A 4XT2B 4LPZA 4B88A 2O9BA 4X56A 3N6IA 3NHQA 5HDSA 4S2OA 1Z09A 1ES4A 4ME4A 3NBLA 3C7VA 1PWCA 5U47A 1TD5A 3A3JA 1KE4A 3DTIA 5GLBA 2XGNA 4IVIA 1S4RA 5GLDA 1NLYA 3A0VA 2VV6A 4ZBEA 3U2AA 3BQ8A 2QYBA 2O99A 3EGDC 1IYQA 1YLJA 1S66L 4BL3A 2PR6A 1TEMA 1ONHA 4Y5FA 4WELA 3NDEA 1KE3A 2Y2OA 2WGWA 3MKFA 1OJGA 4BJPA 4KG5A 1E4DA 3W4PA 3NY4A 4Z9QA 4EUVA 1LSWA 4WZ5C 2Y2NA 4IJGA 3BECA 1V9YA 3A3DA 3DWKA 3MXSA 1DRMA 3JVVA 4GCZA 2ZMFA 3OCNA 1FSYA 3Q7VA 2GX5A 2OWJA 2VV7A 1PWDA 3ZHHA 1LSXA 3NDGA 2L0WA 2WKPA 1BYWA 3IBRA 4PM6A 2EFXA 3Q07A 4OP5A 3MBZA 4N1XA 4HIAA 1S4SA 3V5MA 3AGFA 4KZ6A 1NWZA 3KSGA 3V67A 1LL8A 2ZQDA 3UNWA 2H0YA 1N9LA 4DXBA 1MKIA 2RL3A 4JF6A 1F2KA 3QP8A 1W63Q 1GHIA 3NOUC 1S0WA 1XFNA 5GLAA 1VETB 2VZWA 5A8BA 1K54C 3UE3A 1DY6A 3OPRA 3BY9A 4RQ9A 4OVDA 2PYRA 3RTYA 5M18A 1XPBA 2WADA 2J80A 2XD1A 5FASA 1UWNX 1K4FA 3TE8A 4EQIA 4B4XA 1L0DA 2ZC3B 5EOOA 1XGJA 2Y59A 4R70A 4S2NC 1EROA 2EFUA 2P74A 4P85A 3BM6A 3OPHA 1W79A 3OZHA 2XD5A 3T4QA 1VETA 4R3AA 3GQZA 3S7QA 2V20A 1ESUA 3N8RA 4KZ4A 3LGOA 1DP6A 5EECA 1ZG6A 5IHVA 4KZAA 4H6JB 4YNRA 5HFOA 1EWZA 4RX3A 3HUMA 2V1AA 1KOUA 3BY8A 5CECA 5JYPA 3S22A 4N9LA 5FAOA 5GHYA 3LUQA 3CITA 5F1GA 3A0SA 1K56A 3IS2A 3P09A 5AVFA 5CGSA 5C5KA 4U0TA 3L9KA 4DE3A 4NETA 4ZAMA 3A3EA 4Y3IA 5L07A 5GHXA 3EEAA 2V8FA 4WUJA 5CRFA 2JKRM 3VOYA 5HPIA 2WAEA 3N8LA 3M2KA 3UPOA 5CHJA 3F1NB 5DFXA 1XA7A 1NJ4A 4QWOA 3IX3A 2HDUA 4H6JA 1T19A 3H9WA 3ICYA 5EM0A 2FZ0A 4JGPA 4GD6A 4WZ5A 4NG2A 5JYOA 2R9WA 4UQIS 3ITBA 2VEAA 3RH8B 4GD8A 1OMEA 2ZQ7A 3KYEA 4UHUA 3G30A 3FZCA 3D3OA 1Y4OA 2RCXA 2J9OA 3PBOA 5J8XA 2W1RA 1FR1A 2ZOIA 3F1NA 4KZ8A 1KVMA 2ZBBA 1CQAA 3DTKA 4RVAA 5EFWA 3UB5P 4CLCD 5FL3A 5DJUA 5A90A 4DN0A 2J3WA 4R4SA 2XRNA 1D1JA 4KUKA 4JGQA 3BWLA 2C6WB 2ZC5B 4DE2A 4I39A 3UDFA 3G2YA 5GLCA 3PBQA 1GCEA 4EWFA 1BZAA 3O87A 1KGFA 4HI4A 1K54A 2W3HA 3MS6A 4LCLA 4LLOB 3VMAA 3UMEA 1RGYA 2LB9A 4HESA 1H8MA 3S4XA 4PMAA 3H82B 1ZTUA 1X0OA 3IXGA 3P7NA 4GZBA 1S1ZA 1SKOB 4E3IA 1ESIA 4S2NA 4Y7PA 3MFDA 2WKEA 1MZUA 2HP6A 5CGXA 1KDSA 1YLPA 4Y0TA 3BYDA 1OTBA 2FFFB 3IF6B 4O7DA 2J8YA 4EEUA 2X71A 4NXFA 4MEZA 1DP8A 1VB6A 1ZKJA 5A91A 4IVKA 4JPMA 3S1YA 3G4PA 4MN7A 4OOYA 4FOFA 4FCFA 1T1CA 4S2IA 3HLWA 4I5SA 2PT7A 4MLLA 4XUXA 4DE0A 3H82A 3ISGA 2ZMVA 3NULA 2Y55A 4HBTA 1TS8A 1CI9A 1SKOA 3DTEA 5FQQA 4CLCC 3FC7A 2D02A 2PD8A 2QKPA 3CUEC 3G2ZA 2BLSA 3MR0A 3IX8A 5HX9A 3MQQA 2XFSA 4LGWA 5DTKA 4DF6A 4B9OA 3F1PB 5HL1A 1JWPA 3CLOA 2A49A 1IYSA 1YMSA 4B93A 2YKHA 2M7VA 1W8YA 3CHWP 2ZM8A 3PHYA 1PIOA 1PZOA 3ZNYA 1BLHA 5J7EA 2VX8A 5A93A 4K0WA 4LRYC 5G18A 1IYOA 5DTSA 3C4OA 3V50A 3GVBA 3E4QA 2Y2GA 3WRZA 1K57C 1FSWA 3ZFZA 2HP5A 2P9VB 1Y28A 3WS1A 2A3UA 3BJNA 2XA7S 4HEFA 1K6SA 1PWGA 4GKUA 2ZOHA 4MBKA 1G6OA 5CHUA 2VKSA 1UWPX 4NXGA 4QY6A 1T1AA 3HJIA 4JXVA 3TW8A 2IA2A 2ZLYA 1MWRA 3VSLA 4Q0JA 4R23A 4LRXC 5FATA 2ZC4B 1L0FA 3PTEA 3T4SA 4DDYA 3B3XA 3EOIA 3UE1A 3LIEA 1NXYA 3ZQ5A 2O0YA 1A0KA 1H3QA 4WBGA 4GLQA 4KG2A 3SZTA 3SH7A 5HWVA 3CPTA 4P6BA 2P9VA 4EEPA 4KZ3A 1VQQA 1YPRA 2I72A 4WL9A 3PBSA 2XDMA 4WMCD 1F9IA 2VLGA 2QJ5A 4NK3A 4JXWA 2Y4AA 3IQAA 3OPLA 3S7NA 3W4OA 1NRJA 1E3UD 1S67L 3PAGA 4JBFA 1MXOA 1N9OA 1D7EA 4CLCB 5DF9A 4GHIB 1BSGA 4NEED 1BT5A 2Y8HA 1N4OA 4N1HA 5DF7A 5G4ZA 2R9XA 2XH9A 1YM1A 4OQ0A 3BFEA 1O07A 4IUKA 3LR5A 5DJTA 5FQ9A 5FI6A 3ZG8B 2JCHA 2PD7A 4IUHA 1H8YA 2QPNA 3IF5A 4EV4A 2ZM0A 5F5YA 5GL9A 3NECA 5F1FA 4Y2FA 3SH8A 2ZC7A 4HHDA 4E3MA 3MF0A 3DBAA 3HCYA 3NCKA 4CLCA 4OPRA 3E2KA 3CUEA 4HY8A 1WYCA 1TVFA 1GSVA 4E04A 3MSHA 5J4EA 1C3BA 2G7UA 3MQ0A 1PRQA 2W27A 4HP4A 3KYZA 4NXEA 1BULA 1K6RA 1G5UA 1XFQA 5TGFA 1CJFA 5E2HA 1Q2QA 5DKKA 4E3NA 2Y2HA 4DRTA 1ZG4A 3KYQA 5FSRA 2KOIA 4GN2A 4OQGA 3Q82A 1PI4A 2JN7A 1K57A 2GZAA 1MWSA 2JKGA 1OPXA 4WZ4A 3UDXA 2BTFP 3RXWA 3DAVA 2Y2JA 2ZQCA 3EWKA 3VFFA 3T12B 5F68A 1YLZA 2ACGA 1EI5A 4KQDA 3MJQA 4E3OA 3C2WA 1J3WA 2HJEA 1H8ZA 3JPUA 1MBLA 4X25A 1I2SA 4XT2A 1J9MA 3F1OB 1FQGA 4BQMA 3TSGA 3HVFA 2JKTM 5GHZA 1EW0A 5HDDA 1ODVA 2XR0A 3ZG7B 4MDZA 4HJ3A 2E8JA 3UB6A 2X01A 3RJUA 5I5LA 1FCOA 3EQVA 1KDWA 4II7A 4WEJA 1IELA 2OLUA 2Z2LB 3U4LP 4F3LB 3PBNA 4H8RA 4UEYA 1MPLA 3FKWA 2HZ5A 3C7UA 1ERQA 4P0MA 3SS3A 3A3IA 4OOMA 1XKZA 5KZHA 5M19A 3O3VA 5G4YA 4X1LA 2ZQAA 4EU0A 5EVLA 2IWDA 1BUEA 3UDIA 1JTGA 3C30A 2R78A 2Y2QA 1ES5A 4JF5A 4NXBA 1G6AA 4QD4A 1BLPA 2I9VA 1P97A 3UB8A 4A5RA 4D60A 4KQRA 4OKPA 2K31A 4BBVA 4BBUA 1QMEA 2VGLS 2JE5A 4UQIM 2V9AA 4YINA 2Z6DA 3ULFA 1IFQA 3LIAA 3WRTA 5DVAA 4O01A 3BFGA 4LCMA 3T50A
chains in the Genus database with same CATH topology
2DMWA 2L4RA 4OOLA 3FPVA 4L9GA 4I39A 2D01A 1STZA 5K5BA 2HGVA 1VHMA 1ZHHB 3PBQA 4GS9B 2JKRI 3GECA 2W3FA 2VGLM 3PBRA 2W3GA 3MXQA 4ETXA 2W1TB 4HI4A 2W3HA 1NLZA 3MMHA 4LLOB 1YSPA 3UMEA 2O9CA 2LB9A 3K2NA 5F6AA 1H8MA 1XJ2A 5IT5A 3H82B 4EETB 1ZTUA 1X0OA 4I3IA 3P7NA 4FSFA 3C8CA 1S1ZA 3OBFA 4YOFA 5L8MA 4HH2A 5HD3A 4M4XA 4GW9A 4Z1WA 2B02A 1W63M 1MZUA 3NJAA 2VA0A 4GJ4A 4K08A 1OTBA 3JVUA 1TS0A 4DMZA 5MC7A 2HV1A 1OTAA 4EEUA 1F98A 2W0NA 4ZRRA 4NXFA 2H28A 1DP8A 3PYPA 1VB6A 4HQAA 2FH5A 1T1BA 3EEHA 2W1TA 3C38A 4JGOA 1N9NA 3CAXA 4MN7A 2OAQ1 4FOFA 1T1CA 1UGUA 2KX6A 4I5SA 3NOTC 1LT0A 2EA9A 1T18A 2MJ6A 5AVEA 2PT7A 4MN6A 1YKDA 3H82A 2ZMVA 2VJWA 5HWWA 4L9EA 1TS8A 5HDCA 3T4JA 4I3JA 4EXOA 3MQOA 3F1OA 4CLCC 3CI6A 3FC7A 5HL6A 5J3WA 2D02A 1MKMA 2PD8A 3UB9A 2QKPA 3CUEC 3PBTA 1F5MA 2W3DA 3MR0A 4PKYG 2A24A 3E4PA 3FG8A 3MFXA 3MQQA 3LYXA 4IHQA 4B9OA 3F1PB 3T4KA 3ZYTA 3LIFA 3TJZC 2GJ3A 3CLOA 4R6LA 4R38A 1OJ5A 4B93A 4JGRA 2YKHA 4F3LA 3LIBA 2M7VA 4MCWA 2KLIA 2V0UA 2OWHA 3PHYA 3UE6A 3EGXC 3LIDA 5J7EA 5IU1A 2VX8A 2P08A 4LRYC 4HH3A 3KSFA 2XSSA 3P01A 1YAXA 3KO6A 3GDIA 3T4LA 3E4QA 3T4OA 1V9ZA 5TBMB 1IOUA 4ARZB 3E4OA 4PKYA 3OLOA 1Y28A 4HJ6A 4AFIA 3BJNA 3IBJA 1TS6A 1OTIA 4KQOA 4EESA 2XA7S 2BASA 5HZHA 4XT2B 2ZOHA 4LPZA 2PDRA 1G6OA 2QJ7A 2VKSA 2OOLA 1UWPX 4NXGA 1T1AA 2O9BA 3HJIA 3NHQA 5HWTA 5HDSA 1WA9A 3B33A 3TW8A 5HD5A 2IA2A 4ME4A 2INWA 2QWSA 4CQHA 3D72A 2PYPA 3IS2B 4Q0JA 4YWZA 4LRXC 2GNXA 1MC0A 2EWVA 1TD5A 3LR0A 3T4SA 1YSQA 1XJ6A 3EOIA 3LIEA 4I38A 1P9RA 2XA7M 1G28A 3ZQ5A 2O0YA 5TBMA 1S4RA 1NLYA 3A0VA 1H3QA 2VV6A 3U2AA 4GLQA 3BQ8A 5F69A 2K2NA 1XJ4A 4ARZA 5HWVA 4DJ2A 2QYBA 2OAP1 4EEPA 2O99A 3FPWA 3EGDC 4I3AA 4GS9A 4WL9A 3PBSA 1S66L 5CX7A 1F9IA 2PR6A 2A2LA 2VLGA 2B18A 2QJ5A 3KSHA 4Y5FA 4WELA 1OT9A 2P7JA 3S7NA 3W2ZA 5KIZA 1NRJA 1OJGA 1TF1A 1S67L 3K3DA 4G3KA 2YKFA 4BJPA 2NUTC 1N9OA 1D7EA 4CLCB 5DF9A 3EQUA 4GHIB 4NEED 4L0LA 2V0WA 2Y8HA 2NUPC 5AJGA 3BW6A 2WKQA 4EUVA 5G4ZA 1LSWA 3R7WB 3S7OA 3OCLA 4IUKA 4DJ3A 4IJGA 3LR5A 5DJTA 1V9YA 1DRMA 3JVVA 4GCZA 2ZMFA 3OCNA 2GX5A 2OWJA 2PD7A 2VV7A 2V1BA 4IUHA 1DP9A 4EQ1A 1LSXA 2L0WA 3LICA 5F5YA 2J3TD 1BYWA 1XJ3A 2WKPA 3IBRA 4Y2FA 3K3CA 4L9FA 4NKPA 4HHDA 3MF0A 3DBAA 3HCYA 4HIAA 3VV4A 1OTDA 1S4SA 4CLCA 4LRZE 2M1CA 4EW7A 3SW1A 3CUEA 1NWZA 4HY8A 3KSGA 3V67A 3S7PA 3BQAA 3TRCA 2KDKA 1LL8A 1GSVA 4E04A 3B42A 1N9LA 3G6OA 3LFVA 5J4EA 4O8GA 3VE4A 4ETZA 2G7UA 2QHKA 1W63Q 3MQ0A 3NOUC 3E98A 1XFNA 2W27A 3F1PA 2VZWA 4HP4A 3KYZA 5A8BA 3H7WB 4NXEA 3UE3A 1XFQA 4EERA 3LI8A 1P9WA 3OOVA 3BY9A 5DKKA 2XROA 4RQ9A 2P04A 2PYRA 2L1MA 3RTYA 1GSWA 4MMNA 4HJ4A 2PHYA 2J80A 5KSHA 1UWNX 3TE8A 2HJ9C 3KYQA 2KOIA 4G3VA 1D06A 3KX0X 4P6ZS 4R70A 2JN7A 2GZAA 1OPXA 3LR4A 4HP9A 2WKRA 4KUOA 4WLAA 1LSVA 2Z6CA 3EWKA 5DKLA 5F68A 4WN5A 3LI9A 3T4QA 4KQDA 4R3AA 3S7QA 5HPFA 3MJQA 3H7WA 3C2WA 3OC2A 2HJEA 4P6ZM 1DP6A 2O9AA 3UB7A 4XT2A 3F1OB 2J3TC 4H6JB 4YNRA 3RFBA 2V1AA 1KOUA 3BY8A 2JKTM 4CLCE 1EW0A 5HDDA 4Q0HA 3LUQA 3CITA 1ODVA 2A24B 3A0SA 3IS2A 5AVFA 4MDZA 1JNUA 5C5KA 4HJ3A 3R4KA 3UB6A 1OT6A 2W3EA 2K7SA 3PR6A 4G3WA 4QPRA 5I5LA 5TJJA 3EQVA 3O5YA 3VE3A 4II7A 4WEJA 4Y3IA 4F3LB 2LB5A 3PBNA 3EEAA 4WEKA 2CMNA 4WUJA 2JKRM 2EWWA 1GSXA 5HPIA 2VV8A 4UEYA 1TS7A 4WF0A 3F1NB 5DFXA 3B47A 4OOMA 4H6JA 5DFYA 1T19A 3H9WA 3ICYA 5G4YA 4PHTA 4EU0A 2FZ0A 4HNBA 4JGPA 3KSIA 2JHEA 2PR5A 1P0ZA 4GHIA 4BMWA 4UQIS 2VEAA 3RH8B 3HJKA 3C30A 4MN5A 2R78A 3R7WA 4O0PA 5HSQA 4NXBA 3LR3A 3E0YA 3D3OA 4HOIA 2I9VA 1OTEA 1S1YA 3T4TA 1P97A 2Y79A 4BWIA 5LBRA 3UB8A 3NOPC 3CWFA 3PBOA 2M7UA 4BBTA 5IS1A 2K31A 2W1RA 2JKTI 2ZOIA 3F1NA 4BBVA 4BBUA 2ZBBA 2VGLS 3UMDA 5EFWA 4UQIM 2V9AA 2Z6DA 4CLCD 5FL3A 3PXPA 3ULFA 5DJUA 2HF6A 1IFQA 2J3WA 3LIAA 4DN0A 3A0RA 4Q0IA 2XRNA 4KUKA 4O01A 4JGQA 4PAUA 3T50A 3BWLA 3VOLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DMW A;  1IOU A;  1H8M A;  2VX8 A;  4AFI A;  3BW6 A;  3EGX C;  2NUT C;  3EGD C;  2NUP C;  1IFQ A;  4B93 A;  3KYQ A; 
#chains in the Genus database with same CATH topology
 2L4R A;  5KSC A;  4M3K A;  2WZZ A;  2D01 A;  1JVJ A;  2V2F F;  1STZ A;  4X55 A;  1FCM A;  1ZHH B;  4GS9 B;  2JKR I;  4PM8 A;  3SH9 A;  2XK1 A;  2W3G A;  3ZCZ A;  1PYY A;  2XFT A;  3W8K A;  2O9C A;  4WMC A;  4E3J A;  3JYI A;  2IWB A;  5F6A A;  1PZP A;  1XJ2 A;  4QJG A;  1DJB A;  4I3I A;  4ZJ3 A;  1E3U A;  3C8C A;  4S2P A;  3OBF A;  5FQK A;  5L8M A;  4HH2 A;  5HD3 A;  2WKH A;  3IT9 A;  4M4X A;  5CTM A;  4OPY A;  2PU2 A;  4FH2 A;  1PW8 A;  4BD1 A;  1S6R A;  1FOF A;  3NJA A;  4GJ4 A;  4LV0 A;  3M2J A;  3TOI A;  5MC7 A;  2HV1 A;  1U60 A;  3G32 A;  1OTA A;  4ZRR A;  4OLD A;  3PYP A;  4OPQ A;  4D2O A;  2FH5 A;  3HL9 A;  3IF6 C;  4E3L A;  3T1S A;  1N9N A;  2OAQ 1;  4GDB A;  1UGU A;  5FQI A;  5FDH A;  2KX6 A;  3NOT C;  2EXA A;  2MJ6 A;  1T18 A;  4MN6 A;  1YKD A;  3IWI A;  3FV7 A;  2JBF A;  4B4Z A;  2ZD8 A;  1RP5 A;  5HDC A;  4EXO A;  1DJC A;  3CI6 A;  4R0Q A;  4U0X A;  3PBT A;  1WYB A;  1ONG A;  1NY0 A;  2PBY A;  1XP4 A;  3ZG5 A;  1K55 C;  3LYX A;  3ZYT A;  5E2F A;  2DNS A;  2Y2M A;  4QU3 A;  2FFY A;  4JGR A;  1XA1 A;  4XUZ A;  4C6Y A;  1FR6 A;  3EGX C;  2G2U A;  5F83 A;  3O88 A;  3VP1 A;  2XSS A;  2EX8 A;  3GDI A;  3T4L A;  4MNR A;  1ERM A;  4JXG A;  1YLW A;  3WS4 A;  1FCN A;  3OLO A;  5FDS A;  4HJ6 A;  1SDN A;  2XLN A;  3VP4 A;  1TS6 A;  1G68 A;  3W4Q A;  1WE4 A;  2PDR A;  1LI0 A;  2EXB A;  5EVI B;  3BFC A;  5HWT A;  3B33 A;  4GOG A;  5HD5 A;  4PM9 A;  2INW A;  1CEG A;  2PYP A;  3UPN A;  3ZVW A;  4KZ9 A;  1MC0 A;  3LR0 A;  4S2J A;  1YSQ A;  1XJ6 A;  2XA7 M;  1G28 A;  3UN7 A;  5EV0 A;  3IWO A;  2K2N A;  1XJ4 A;  2EX6 A;  4KG6 A;  4DJ2 A;  2OAP 1;  3FPW A;  3VP0 A;  3MZF A;  2A2L A;  4EBP A;  3T1X A;  2B18 A;  3KSH A;  4C75 A;  5BOH A;  1YT4 A;  5HAR A;  3HUN A;  3QP1 A;  2YKF A;  4R1G A;  2ZL1 B;  4F94 A;  1LI9 A;  2V8C A;  1N9B A;  5CER A;  5AJG A;  2Q0O A;  2WKQ A;  3CJM A;  3MKE A;  3T1R A;  4UA6 A;  3R7W B;  1W7F A;  2H0T A;  3IHB A;  1Y54 A;  4X1M A;  2Q9N A;  2EX9 A;  3MXR A;  4FH4 A;  1MY8 A;  3IF6 A;  1SZV A;  2Q9M A;  2V1B A;  1GHP A;  4R3J A;  3FWL A;  1DP9 A;  4QHC A;  3GMW A;  3DTM A;  1JWV A;  4QB8 A;  2ZMA A;  3K3C A;  4L9F A;  1PNE A;  1H5X A;  2ZL1 A;  2M1C A;  4EW7 A;  3TRC A;  2KDK A;  1VEU B;  3QHY A;  4WM9 A;  3LCE A;  1K55 A;  1RGZ A;  2E8I A;  4O8G A;  3VE4 A;  4ETZ A;  2DRW A;  2HDR A;  3D9Y A;  3F1P A;  4ESP A;  4N9K A;  1K4E A;  3BRM A;  4EER A;  3OOV A;  2P04 A;  4LEN A;  4CPK A;  3HLG A;  4MMN A;  2PHY A;  5CXW A;  4ZJ1 A;  5KSH A;  3MZE A;  1SDE A;  3LEQ A;  3P98 A;  2HJ9 C;  1ES3 A;  4P6Z S;  1PI5 A;  1MWU A;  4JXS A;  5TR7 A;  3NIA A;  3LR4 A;  4HP9 A;  3QNC A;  1KE0 A;  4KUO A;  4WLA A;  2Z6C A;  5DKL A;  3L7H A;  1DJA A;  4WN5 A;  3LI9 A;  2H5S A;  4PPR A;  3OC2 A;  3ZNT A;  1KGG A;  2QZ6 A;  5EE8 A;  5L09 A;  3G35 A;  3RFB A;  1FIL A;  1W8Q A;  5CTN A;  4Q0H A;  4P87 A;  5CHM A;  4EBL A;  4Y13 A;  5E2E A;  2A24 B;  1NZO A;  1HLU P;  4FD8 A;  5EOE A;  1RCJ A;  2PU4 A;  3R4K A;  1OT6 A;  2W3E A;  2K7S A;  4IBX A;  3O5Y A;  3QP4 A;  2OV5 A;  4S2L A;  2EWW A;  1KGE A;  3SOI A;  1TS7 A;  4LV3 A;  4WF0 A;  2B5R A;  4E3K A;  2EX2 A;  3B47 A;  3MZD A;  5DFY A;  4FTX A;  4E6X A;  4PHT A;  3SS4 A;  4HNB A;  2JHE A;  1P0Z A;  4GHI A;  2X02 A;  1LL5 A;  4JLF A;  3HBR A;  1L0E A;  4OPZ A;  3HJK A;  4O0P A;  3GSG A;  3LR3 A;  1NRF A;  4Y15 A;  3E0Y A;  1YLY A;  3T4T A;  2Y79 A;  5LBR A;  3VP2 A;  5DTT A;  4BBT A;  2H10 A;  5FAQ A;  3HLB A;  2JKT I;  3CG5 A;  1Z6F A;  3UMD A;  2Y2I A;  2OSU A;  3A0R A;  4Q0I A;  3D4F A;  3IWQ A;  4PAU A;  1KVL A;  3ZVT A;  3VOL A;  2Y2P A;  2DMW A;  4OOL A;  3FPV A;  4L9G A;  5I94 A;  2Y2K A;  1IEM A;  3V3R A;  2HDQ A;  4X53 A;  2HGV A;  1VHM A;  2XQZ A;  2VGL M;  3PBR A;  3MXQ A;  4ETX A;  4LV1 A;  3MMH A;  2WGW B;  1JWZ A;  1YSP A;  4K0X A;  1XXM A;  3C5A A;  4FUW A;  5IT5 A;  1L2S A;  1XX2 A;  4MBF A;  2VGK A;  3T1Q B;  3ITA A;  4FSF A;  4YOF A;  3QNB A;  3Q81 A;  3RXX A;  4Z1W A;  3HUO A;  5M1A A;  1W63 M;  4BLM A;  2VA0 A;  5L10 A;  4K08 A;  4C3Q A;  3N4I A;  1TS0 A;  2ZM2 A;  3Q7V B;  1GA0 A;  2V1Z A;  4QY5 A;  4OQH A;  2H28 A;  4HQA A;  3BFD A;  1T1B A;  3AGD A;  4KQQ A;  4JGO A;  3HLC A;  4OQI A;  1ZC2 A;  1LT0 A;  2EA9 A;  3A3F A;  2WKI A;  2VJW A;  5EVI D;  3IHA A;  3TG9 A;  3LO7 A;  4I3J A;  3MQO A;  3F1O A;  3ZGA B;  5HL6 A;  1QMF A;  5J3W A;  1MKM A;  3PAE A;  4DXC A;  2OLV A;  2WYX A;  3IX4 A;  2W3D A;  4PKY G;  1H0M A;  3FG8 A;  2WGI A;  1L3L A;  3MFX A;  4IHQ A;  3ZG0 A;  3ZDJ A;  3T4K A;  4PM7 A;  5AQ9 A;  3UPP A;  3LIF A;  2GJ3 A;  4R6L A;  4E6W A;  4R38 A;  2XF3 A;  1OJ5 A;  4U3T A;  4F3L A;  3LIB A;  3LY4 A;  1Q2P A;  2JC7 A;  5CGW A;  4MCW A;  2V0U A;  2QMI A;  2OWH A;  3UE6 A;  2WK0 A;  2HPB A;  3G34 A;  4ZJ2 A;  3P01 A;  4X68 A;  4HBU A;  1YAX A;  4LV2 A;  3IXD A;  4Q8I A;  4OH0 A;  3IH9 A;  1V9Z A;  5TBM B;  3HLF A;  5EUA A;  1IOU A;  5KMW A;  4ARZ B;  4PKY A;  1CF0 A;  5HAI A;  1NZU A;  1M40 A;  4AFI A;  3IBJ A;  1OTI A;  4EES A;  3VSK A;  4ZDX A;  2BAS A;  1K0K A;  3IXB A;  1NYM A;  5HZH A;  3NI9 A;  1FIK A;  2QJ7 A;  4OLG A;  5L2F A;  2OOL A;  1XGI A;  1WA9 A;  5FEF A;  1CI8 A;  2QWS A;  4CQH A;  3D72 A;  4R3B A;  3IS2 B;  5EVI C;  3WS0 A;  4YWZ A;  1BLC A;  2GNX A;  2Y91 A;  5AQ7 A;  2EWV A;  4RA7 A;  4WYY A;  1ALQ A;  1P9R A;  2PAV P;  4I38 A;  5CEB A;  5TBM A;  2C5W B;  3BFF A;  5F69 A;  4ARZ A;  4DKI A;  4I3A A;  4GS9 A;  4BD0 A;  1TDG A;  5CX7 A;  2J7V A;  1OT9 A;  2P7J A;  3W2Z A;  5KIZ A;  2ZC6 B;  3FYZ A;  5FA7 A;  1ES2 A;  3HLE A;  1TF1 A;  3K3D A;  4G3K A;  2NUT C;  3EQU A;  4GB7 A;  3UE0 A;  4L0L A;  1HD8 A;  2V0W A;  2PRF A;  2NUP C;  3BW6 A;  5E43 A;  3NC8 A;  5EVE A;  3S7O A;  3OCL A;  4DJ3 A;  4CJN A;  2WUQ A;  3SS5 A;  3Q7Z A;  4BEN A;  3CMZ A;  1I2W A;  2AVX A;  1CK3 A;  1YLT A;  4EUZ A;  4EQ1 A;  3V3S A;  3BEB A;  3LIC A;  4YFM A;  2J3T D;  1XJ3 A;  2UV0 E;  4NKP A;  3DW0 A;  4K91 A;  3C4P A;  3VV4 A;  1OTD A;  1YQS A;  4IED A;  4DE1 A;  5FAP A;  4OON A;  3GR2 A;  4LRZ E;  3SW1 A;  3UY6 A;  3S7P A;  3BQA A;  1IKI A;  3B42 A;  1I5Q A;  3G6O A;  4RYE A;  1O7E A;  3LFV A;  1LLB A;  1PW1 A;  3HRE A;  5EM1 A;  2QHK A;  3UO9 A;  3E98 A;  1IKG A;  1M6K A;  3H7W B;  2XEP A;  2WZX A;  1K38 A;  3LI8 A;  1P9W A;  1NYY A;  2XRO A;  2L1M A;  3M6B A;  1GSW A;  4HJ4 A;  4ID4 A;  3V39 A;  4MBH A;  3N8S A;  3GTC A;  4G3V A;  1D06 A;  3KX0 X;  4Y17 A;  5FQJ A;  2WKR A;  4KZB A;  2WAF A;  1LSV A;  3OPP A;  5D3O A;  5HPF A;  3H7W A;  1SCW A;  4P6Z M;  1YMX A;  5FI7 A;  2O9A A;  3UB7 A;  1VM1 A;  5AQA A;  2J3T C;  3I7J A;  2B95 A;  5EVI A;  4CLC E;  4PM5 A;  2GDN A;  4LFU A;  1HZO A;  4GNU A;  3WS2 A;  1JNU A;  1LL9 A;  4N92 A;  2ZQ9 A;  5A92 A;  4S2M A;  2PBD P;  3IH8 A;  2ZJ9 A;  3PR6 A;  4G3W A;  4QPR A;  5HAQ A;  5TJJ A;  4XXR A;  1AWI A;  2DCF A;  2JKF A;  3VE3 A;  2LB5 A;  4WEK A;  2CMN A;  4DDS A;  3BLS A;  1GSX A;  2VV8 A;  3AGE A;  4UAA A;  4JF4 A;  3M6H A;  4Y0U A;  5FQM A;  3ZG9 B;  5CED A;  1AXB A;  3KSI A;  2PR5 A;  4BMW A;  3LEZ A;  1SHV A;  5DF8 A;  4MN5 A;  3R7W A;  3LY3 A;  5HSQ A;  4ZTK A;  4HOI A;  1OTE A;  1S1Y A;  2ZQ8 A;  3O86 A;  4BWI A;  5FEG A;  2HP9 A;  3NOP C;  2UWX A;  3CWF A;  2M7U A;  3VP3 A;  5IS1 A;  4IBR A;  4JKT A;  5HAP A;  1HVB A;  5EPH A;  3PXP A;  4KZ5 A;  2CC1 A;  2HF6 A;  5TFQ A;  1K25 A;  1GA9 A;  3VOZ A;  5HW3 A;  1ACF A;  3CPT B;  4BL2 A;  5K5B A;  1VEU A;  3GEC A;  2W3F A;  2VK3 A;  4X69 A;  5E2G A;  2W1T B;  3E2L A;  1NLZ A;  2WGV A;  3K2N A;  1TDL A;  1MWT A;  4EET B;  2Z2M B;  3QP5 A;  3VFH A;  3QP6 A;  4GW9 A;  2B02 A;  1JTD A;  4X6T A;  2HDS A;  3BLM A;  1BTL A;  1CEF A;  3JVU A;  3HLD A;  4DMZ A;  4KEN B;  1SKF A;  4OP8 A;  5AQB A;  1F98 A;  2VGJ A;  2W0N A;  3CZD A;  2Y2L A;  3EEH A;  2W1T A;  3C38 A;  5F82 A;  3CAX A;  1IYP A;  2G2W A;  4UA9 A;  2J9P A;  3WS5 A;  1L0G A;  5AVE A;  2BG1 A;  4RX2 A;  4Y0O A;  5HWW A;  4L9E A;  3T4J A;  1HTZ A;  4KZ7 A;  1K56 D;  3DWZ A;  4GDN A;  3UB9 A;  3GRJ A;  1F5M A;  2A24 A;  3E4P A;  4EBN A;  4R4R A;  1GHM A;  3TJZ C;  3Q1F A;  3QP2 A;  3G31 A;  4UA7 A;  2IWC A;  2KLI A;  3LID A;  5IU1 A;  1E25 A;  1LHY A;  1PFL A;  2P08 A;  4S2K A;  4HH3 A;  3KSF A;  1BLS A;  3KO6 A;  3WWX A;  3FKV A;  3IXH A;  3T4O A;  5FI2 A;  3N7W A;  1W5D A;  3E4O A;  4KQO A;  3GV9 A;  4XT2 B;  4LPZ A;  4B88 A;  2O9B A;  4X56 A;  3N6I A;  3NHQ A;  5HDS A;  4S2O A;  1Z09 A;  1ES4 A;  4ME4 A;  3NBL A;  3C7V A;  1PWC A;  5U47 A;  1TD5 A;  3A3J A;  1KE4 A;  3DTI A;  5GLB A;  2XGN A;  4IVI A;  1S4R A;  5GLD A;  1NLY A;  3A0V A;  2VV6 A;  4ZBE A;  3U2A A;  3BQ8 A;  2QYB A;  2O99 A;  3EGD C;  1IYQ A;  1YLJ A;  1S66 L;  4BL3 A;  2PR6 A;  1TEM A;  1ONH A;  4Y5F A;  4WEL A;  3NDE A;  1KE3 A;  2Y2O A;  2WGW A;  3MKF A;  1OJG A;  4BJP A;  4KG5 A;  1E4D A;  3W4P A;  3NY4 A;  4Z9Q A;  4EUV A;  1LSW A;  4WZ5 C;  2Y2N A;  4IJG A;  3BEC A;  1V9Y A;  3A3D A;  3DWK A;  3MXS A;  1DRM A;  3JVV A;  4GCZ A;  2ZMF A;  3OCN A;  1FSY A;  3Q7V A;  2GX5 A;  2OWJ A;  2VV7 A;  1PWD A;  3ZHH A;  1LSX A;  3NDG A;  2L0W A;  2WKP A;  1BYW A;  3IBR A;  4PM6 A;  2EFX A;  3Q07 A;  4OP5 A;  3MBZ A;  4N1X A;  4HIA A;  1S4S A;  3V5M A;  3AGF A;  4KZ6 A;  1NWZ A;  3KSG A;  3V67 A;  1LL8 A;  2ZQD A;  3UNW A;  2H0Y A;  1N9L A;  4DXB A;  1MKI A;  2RL3 A;  4JF6 A;  1F2K A;  3QP8 A;  1W63 Q;  1GHI A;  3NOU C;  1S0W A;  1XFN A;  5GLA A;  1VET B;  2VZW A;  5A8B A;  1K54 C;  3UE3 A;  1DY6 A;  3OPR A;  3BY9 A;  4RQ9 A;  4OVD A;  2PYR A;  3RTY A;  5M18 A;  1XPB A;  2WAD A;  2J80 A;  2XD1 A;  5FAS A;  1UWN X;  1K4F A;  3TE8 A;  4EQI A;  4B4X A;  1L0D A;  2ZC3 B;  5EOO A;  1XGJ A;  2Y59 A;  4R70 A;  4S2N C;  1ERO A;  2EFU A;  2P74 A;  4P85 A;  3BM6 A;  3OPH A;  1W79 A;  3OZH A;  2XD5 A;  3T4Q A;  1VET A;  4R3A A;  3GQZ A;  3S7Q A;  2V20 A;  1ESU A;  3N8R A;  4KZ4 A;  3LGO A;  1DP6 A;  5EEC A;  1ZG6 A;  5IHV A;  4KZA A;  4H6J B;  4YNR A;  5HFO A;  1EWZ A;  4RX3 A;  3HUM A;  2V1A A;  1KOU A;  3BY8 A;  5CEC A;  5JYP A;  3S22 A;  4N9L A;  5FAO A;  5GHY A;  3LUQ A;  3CIT A;  5F1G A;  3A0S A;  1K56 A;  3IS2 A;  3P09 A;  5AVF A;  5CGS A;  5C5K A;  4U0T A;  3L9K A;  4DE3 A;  4NET A;  4ZAM A;  3A3E A;  4Y3I A;  5L07 A;  5GHX A;  3EEA A;  2V8F A;  4WUJ A;  5CRF A;  2JKR M;  3VOY A;  5HPI A;  2WAE A;  3N8L A;  3M2K A;  3UPO A;  5CHJ A;  3F1N B;  5DFX A;  1XA7 A;  1NJ4 A;  4QWO A;  3IX3 A;  2HDU A;  4H6J A;  1T19 A;  3H9W A;  3ICY A;  5EM0 A;  2FZ0 A;  4JGP A;  4GD6 A;  4WZ5 A;  4NG2 A;  5JYO A;  2R9W A;  4UQI S;  3ITB A;  2VEA A;  3RH8 B;  4GD8 A;  1OME A;  2ZQ7 A;  3KYE A;  4UHU A;  3G30 A;  3FZC A;  3D3O A;  1Y4O A;  2RCX A;  2J9O A;  3PBO A;  5J8X A;  2W1R A;  1FR1 A;  2ZOI A;  3F1N A;  4KZ8 A;  1KVM A;  2ZBB A;  1CQA A;  3DTK A;  4RVA A;  5EFW A;  3UB5 P;  4CLC D;  5FL3 A;  5DJU A;  5A90 A;  4DN0 A;  2J3W A;  4R4S A;  2XRN A;  1D1J A;  4KUK A;  4JGQ A;  3BWL A;  2C6W B;  2ZC5 B;  4DE2 A;  4I39 A;  3UDF A;  3G2Y A;  5GLC A;  3PBQ A;  1GCE A;  4EWF A;  1BZA A;  3O87 A;  1KGF A;  4HI4 A;  1K54 A;  2W3H A;  3MS6 A;  4LCL A;  4LLO B;  3VMA A;  3UME A;  1RGY A;  2LB9 A;  4HES A;  1H8M A;  3S4X A;  4PMA A;  3H82 B;  1ZTU A;  1X0O A;  3IXG A;  3P7N A;  4GZB A;  1S1Z A;  1SKO B;  4E3I A;  1ESI A;  4S2N A;  4Y7P A;  3MFD A;  2WKE A;  1MZU A;  2HP6 A;  5CGX A;  1KDS A;  1YLP A;  4Y0T A;  3BYD A;  1OTB A;  2FFF B;  3IF6 B;  4O7D A;  2J8Y A;  4EEU A;  2X71 A;  4NXF A;  4MEZ A;  1DP8 A;  1VB6 A;  1ZKJ A;  5A91 A;  4IVK A;  4JPM A;  3S1Y A;  3G4P A;  4MN7 A;  4OOY A;  4FOF A;  4FCF A;  1T1C A;  4S2I A;  3HLW A;  4I5S A;  2PT7 A;  4MLL A;  4XUX A;  4DE0 A;  3H82 A;  3ISG A;  2ZMV A;  3NUL A;  2Y55 A;  4HBT A;  1TS8 A;  1CI9 A;  1SKO A;  3DTE A;  5FQQ A;  4CLC C;  3FC7 A;  2D02 A;  2PD8 A;  2QKP A;  3CUE C;  3G2Z A;  2BLS A;  3MR0 A;  3IX8 A;  5HX9 A;  3MQQ A;  2XFS A;  4LGW A;  5DTK A;  4DF6 A;  4B9O A;  3F1P B;  5HL1 A;  1JWP A;  3CLO A;  2A49 A;  1IYS A;  1YMS A;  4B93 A;  2YKH A;  2M7V A;  1W8Y A;  3CHW P;  2ZM8 A;  3PHY A;  1PIO A;  1PZO A;  3ZNY A;  1BLH A;  5J7E A;  2VX8 A;  5A93 A;  4K0W A;  4LRY C;  5G18 A;  1IYO A;  5DTS A;  3C4O A;  3V50 A;  3GVB A;  3E4Q A;  2Y2G A;  3WRZ A;  1K57 C;  1FSW A;  3ZFZ A;  2HP5 A;  2P9V B;  1Y28 A;  3WS1 A;  2A3U A;  3BJN A;  2XA7 S;  4HEF A;  1K6S A;  1PWG A;  4GKU A;  2ZOH A;  4MBK A;  1G6O A;  5CHU A;  2VKS A;  1UWP X;  4NXG A;  4QY6 A;  1T1A A;  3HJI A;  4JXV A;  3TW8 A;  2IA2 A;  2ZLY A;  1MWR A;  3VSL A;  4Q0J A;  4R23 A;  4LRX C;  5FAT A;  2ZC4 B;  1L0F A;  3PTE A;  3T4S A;  4DDY A;  3B3X A;  3EOI A;  3UE1 A;  3LIE A;  1NXY A;  3ZQ5 A;  2O0Y A;  1A0K A;  1H3Q A;  4WBG A;  4GLQ A;  4KG2 A;  3SZT A;  3SH7 A;  5HWV A;  3CPT A;  4P6B A;  2P9V A;  4EEP A;  4KZ3 A;  1VQQ A;  1YPR A;  2I72 A;  4WL9 A;  3PBS A;  2XDM A;  4WMC D;  1F9I A;  2VLG A;  2QJ5 A;  4NK3 A;  4JXW A;  2Y4A A;  3IQA A;  3OPL A;  3S7N A;  3W4O A;  1NRJ A;  1E3U D;  1S67 L;  3PAG A;  4JBF A;  1MXO A;  1N9O A;  1D7E A;  4CLC B;  5DF9 A;  4GHI B;  1BSG A;  4NEE D;  1BT5 A;  2Y8H A;  1N4O A;  4N1H A;  5DF7 A;  5G4Z A;  2R9X A;  2XH9 A;  1YM1 A;  4OQ0 A;  3BFE A;  1O07 A;  4IUK A;  3LR5 A;  5DJT A;  5FQ9 A;  5FI6 A;  3ZG8 B;  2JCH A;  2PD7 A;  4IUH A;  1H8Y A;  2QPN A;  3IF5 A;  4EV4 A;  2ZM0 A;  5F5Y A;  5GL9 A;  3NEC A;  5F1F A;  4Y2F A;  3SH8 A;  2ZC7 A;  4HHD A;  4E3M A;  3MF0 A;  3DBA A;  3HCY A;  3NCK A;  4CLC A;  4OPR A;  3E2K A;  3CUE A;  4HY8 A;  1WYC A;  1TVF A;  1GSV A;  4E04 A;  3MSH A;  5J4E A;  1C3B A;  2G7U A;  3MQ0 A;  1PRQ A;  2W27 A;  4HP4 A;  3KYZ A;  4NXE A;  1BUL A;  1K6R A;  1G5U A;  1XFQ A;  5TGF A;  1CJF A;  5E2H A;  1Q2Q A;  5DKK A;  4E3N A;  2Y2H A;  4DRT A;  1ZG4 A;  3KYQ A;  5FSR A;  2KOI A;  4GN2 A;  4OQG A;  3Q82 A;  1PI4 A;  2JN7 A;  1K57 A;  2GZA A;  1MWS A;  2JKG A;  1OPX A;  4WZ4 A;  3UDX A;  2BTF P;  3RXW A;  3DAV A;  2Y2J A;  2ZQC A;  3EWK A;  3VFF A;  3T12 B;  5F68 A;  1YLZ A;  2ACG A;  1EI5 A;  4KQD A;  3MJQ A;  4E3O A;  3C2W A;  1J3W A;  2HJE A;  1H8Z A;  3JPU A;  1MBL A;  4X25 A;  1I2S A;  4XT2 A;  1J9M A;  3F1O B;  1FQG A;  4BQM A;  3TSG A;  3HVF A;  2JKT M;  5GHZ A;  1EW0 A;  5HDD A;  1ODV A;  2XR0 A;  3ZG7 B;  4MDZ A;  4HJ3 A;  2E8J A;  3UB6 A;  2X01 A;  3RJU A;  5I5L A;  1FCO A;  3EQV A;  1KDW A;  4II7 A;  4WEJ A;  1IEL A;  2OLU A;  2Z2L B;  3U4L P;  4F3L B;  3PBN A;  4H8R A;  4UEY A;  1MPL A;  3FKW A;  2HZ5 A;  3C7U A;  1ERQ A;  4P0M A;  3SS3 A;  3A3I A;  4OOM A;  1XKZ A;  5KZH A;  5M19 A;  3O3V A;  5G4Y A;  4X1L A;  2ZQA A;  4EU0 A;  5EVL A;  2IWD A;  1BUE A;  3UDI A;  1JTG A;  3C30 A;  2R78 A;  2Y2Q A;  1ES5 A;  4JF5 A;  4NXB A;  1G6A A;  4QD4 A;  1BLP A;  2I9V A;  1P97 A;  3UB8 A;  4A5R A;  4D60 A;  4KQR A;  4OKP A;  2K31 A;  4BBV A;  4BBU A;  1QME A;  2VGL S;  2JE5 A;  4UQI M;  2V9A A;  4YIN A;  2Z6D A;  3ULF A;  1IFQ A;  3LIA A;  3WRT A;  5DVA A;  4O01 A;  3BFG A;  4LCM A;  3T50 A; 
#chains in the Genus database with same CATH homology
 2DMW A;  2L4R A;  4OOL A;  3FPV A;  4L9G A;  4I39 A;  2D01 A;  1STZ A;  5K5B A;  2HGV A;  1VHM A;  1ZHH B;  3PBQ A;  4GS9 B;  2JKR I;  3GEC A;  2W3F A;  2VGL M;  3PBR A;  2W3G A;  3MXQ A;  4ETX A;  2W1T B;  4HI4 A;  2W3H A;  1NLZ A;  3MMH A;  4LLO B;  1YSP A;  3UME A;  2O9C A;  2LB9 A;  3K2N A;  5F6A A;  1H8M A;  1XJ2 A;  5IT5 A;  3H82 B;  4EET B;  1ZTU A;  1X0O A;  4I3I A;  3P7N A;  4FSF A;  3C8C A;  1S1Z A;  3OBF A;  4YOF A;  5L8M A;  4HH2 A;  5HD3 A;  4M4X A;  4GW9 A;  4Z1W A;  2B02 A;  1W63 M;  1MZU A;  3NJA A;  2VA0 A;  4GJ4 A;  4K08 A;  1OTB A;  3JVU A;  1TS0 A;  4DMZ A;  5MC7 A;  2HV1 A;  1OTA A;  4EEU A;  1F98 A;  2W0N A;  4ZRR A;  4NXF A;  2H28 A;  1DP8 A;  3PYP A;  1VB6 A;  4HQA A;  2FH5 A;  1T1B A;  3EEH A;  2W1T A;  3C38 A;  4JGO A;  1N9N A;  3CAX A;  4MN7 A;  2OAQ 1;  4FOF A;  1T1C A;  1UGU A;  2KX6 A;  4I5S A;  3NOT C;  1LT0 A;  2EA9 A;  1T18 A;  2MJ6 A;  5AVE A;  2PT7 A;  4MN6 A;  1YKD A;  3H82 A;  2ZMV A;  2VJW A;  5HWW A;  4L9E A;  1TS8 A;  5HDC A;  3T4J A;  4I3J A;  4EXO A;  3MQO A;  3F1O A;  4CLC C;  3CI6 A;  3FC7 A;  5HL6 A;  5J3W A;  2D02 A;  1MKM A;  2PD8 A;  3UB9 A;  2QKP A;  3CUE C;  3PBT A;  1F5M A;  2W3D A;  3MR0 A;  4PKY G;  2A24 A;  3E4P A;  3FG8 A;  3MFX A;  3MQQ A;  3LYX A;  4IHQ A;  4B9O A;  3F1P B;  3T4K A;  3ZYT A;  3LIF A;  3TJZ C;  2GJ3 A;  3CLO A;  4R6L A;  4R38 A;  1OJ5 A;  4B93 A;  4JGR A;  2YKH A;  4F3L A;  3LIB A;  2M7V A;  4MCW A;  2KLI A;  2V0U A;  2OWH A;  3PHY A;  3UE6 A;  3EGX C;  3LID A;  5J7E A;  5IU1 A;  2VX8 A;  2P08 A;  4LRY C;  4HH3 A;  3KSF A;  2XSS A;  3P01 A;  1YAX A;  3KO6 A;  3GDI A;  3T4L A;  3E4Q A;  3T4O A;  1V9Z A;  5TBM B;  1IOU A;  4ARZ B;  3E4O A;  4PKY A;  3OLO A;  1Y28 A;  4HJ6 A;  4AFI A;  3BJN A;  3IBJ A;  1TS6 A;  1OTI A;  4KQO A;  4EES A;  2XA7 S;  2BAS A;  5HZH A;  4XT2 B;  2ZOH A;  4LPZ A;  2PDR A;  1G6O A;  2QJ7 A;  2VKS A;  2OOL A;  1UWP X;  4NXG A;  1T1A A;  2O9B A;  3HJI A;  3NHQ A;  5HWT A;  5HDS A;  1WA9 A;  3B33 A;  3TW8 A;  5HD5 A;  2IA2 A;  4ME4 A;  2INW A;  2QWS A;  4CQH A;  3D72 A;  2PYP A;  3IS2 B;  4Q0J A;  4YWZ A;  4LRX C;  2GNX A;  1MC0 A;  2EWV A;  1TD5 A;  3LR0 A;  3T4S A;  1YSQ A;  1XJ6 A;  3EOI A;  3LIE A;  4I38 A;  1P9R A;  2XA7 M;  1G28 A;  3ZQ5 A;  2O0Y A;  5TBM A;  1S4R A;  1NLY A;  3A0V A;  1H3Q A;  2VV6 A;  3U2A A;  4GLQ A;  3BQ8 A;  5F69 A;  2K2N A;  1XJ4 A;  4ARZ A;  5HWV A;  4DJ2 A;  2QYB A;  2OAP 1;  4EEP A;  2O99 A;  3FPW A;  3EGD C;  4I3A A;  4GS9 A;  4WL9 A;  3PBS A;  1S66 L;  5CX7 A;  1F9I A;  2PR6 A;  2A2L A;  2VLG A;  2B18 A;  2QJ5 A;  3KSH A;  4Y5F A;  4WEL A;  1OT9 A;  2P7J A;  3S7N A;  3W2Z A;  5KIZ A;  1NRJ A;  1OJG A;  1TF1 A;  1S67 L;  3K3D A;  4G3K A;  2YKF A;  4BJP A;  2NUT C;  1N9O A;  1D7E A;  4CLC B;  5DF9 A;  3EQU A;  4GHI B;  4NEE D;  4L0L A;  2V0W A;  2Y8H A;  2NUP C;  5AJG A;  3BW6 A;  2WKQ A;  4EUV A;  5G4Z A;  1LSW A;  3R7W B;  3S7O A;  3OCL A;  4IUK A;  4DJ3 A;  4IJG A;  3LR5 A;  5DJT A;  1V9Y A;  1DRM A;  3JVV A;  4GCZ A;  2ZMF A;  3OCN A;  2GX5 A;  2OWJ A;  2PD7 A;  2VV7 A;  2V1B A;  4IUH A;  1DP9 A;  4EQ1 A;  1LSX A;  2L0W A;  3LIC A;  5F5Y A;  2J3T D;  1BYW A;  1XJ3 A;  2WKP A;  3IBR A;  4Y2F A;  3K3C A;  4L9F A;  4NKP A;  4HHD A;  3MF0 A;  3DBA A;  3HCY A;  4HIA A;  3VV4 A;  1OTD A;  1S4S A;  4CLC A;  4LRZ E;  2M1C A;  4EW7 A;  3SW1 A;  3CUE A;  1NWZ A;  4HY8 A;  3KSG A;  3V67 A;  3S7P A;  3BQA A;  3TRC A;  2KDK A;  1LL8 A;  1GSV A;  4E04 A;  3B42 A;  1N9L A;  3G6O A;  3LFV A;  5J4E A;  4O8G A;  3VE4 A;  4ETZ A;  2G7U A;  2QHK A;  1W63 Q;  3MQ0 A;  3NOU C;  3E98 A;  1XFN A;  2W27 A;  3F1P A;  2VZW A;  4HP4 A;  3KYZ A;  5A8B A;  3H7W B;  4NXE A;  3UE3 A;  1XFQ A;  4EER A;  3LI8 A;  1P9W A;  3OOV A;  3BY9 A;  5DKK A;  2XRO A;  4RQ9 A;  2P04 A;  2PYR A;  2L1M A;  3RTY A;  1GSW A;  4MMN A;  4HJ4 A;  2PHY A;  2J80 A;  5KSH A;  1UWN X;  3TE8 A;  2HJ9 C;  3KYQ A;  2KOI A;  4G3V A;  1D06 A;  3KX0 X;  4P6Z S;  4R70 A;  2JN7 A;  2GZA A;  1OPX A;  3LR4 A;  4HP9 A;  2WKR A;  4KUO A;  4WLA A;  1LSV A;  2Z6C A;  3EWK A;  5DKL A;  5F68 A;  4WN5 A;  3LI9 A;  3T4Q A;  4KQD A;  4R3A A;  3S7Q A;  5HPF A;  3MJQ A;  3H7W A;  3C2W A;  3OC2 A;  2HJE A;  4P6Z M;  1DP6 A;  2O9A A;  3UB7 A;  4XT2 A;  3F1O B;  2J3T C;  4H6J B;  4YNR A;  3RFB A;  2V1A A;  1KOU A;  3BY8 A;  2JKT M;  4CLC E;  1EW0 A;  5HDD A;  4Q0H A;  3LUQ A;  3CIT A;  1ODV A;  2A24 B;  3A0S A;  3IS2 A;  5AVF A;  4MDZ A;  1JNU A;  5C5K A;  4HJ3 A;  3R4K A;  3UB6 A;  1OT6 A;  2W3E A;  2K7S A;  3PR6 A;  4G3W A;  4QPR A;  5I5L A;  5TJJ A;  3EQV A;  3O5Y A;  3VE3 A;  4II7 A;  4WEJ A;  4Y3I A;  4F3L B;  2LB5 A;  3PBN A;  3EEA A;  4WEK A;  2CMN A;  4WUJ A;  2JKR M;  2EWW A;  1GSX A;  5HPI A;  2VV8 A;  4UEY A;  1TS7 A;  4WF0 A;  3F1N B;  5DFX A;  3B47 A;  4OOM A;  4H6J A;  5DFY A;  1T19 A;  3H9W A;  3ICY A;  5G4Y A;  4PHT A;  4EU0 A;  2FZ0 A;  4HNB A;  4JGP A;  3KSI A;  2JHE A;  2PR5 A;  1P0Z A;  4GHI A;  4BMW A;  4UQI S;  2VEA A;  3RH8 B;  3HJK A;  3C30 A;  4MN5 A;  2R78 A;  3R7W A;  4O0P A;  5HSQ A;  4NXB A;  3LR3 A;  3E0Y A;  3D3O A;  4HOI A;  2I9V A;  1OTE A;  1S1Y A;  3T4T A;  1P97 A;  2Y79 A;  4BWI A;  5LBR A;  3UB8 A;  3NOP C;  3CWF A;  3PBO A;  2M7U A;  4BBT A;  5IS1 A;  2K31 A;  2W1R A;  2JKT I;  2ZOI A;  3F1N A;  4BBV A;  4BBU A;  2ZBB A;  2VGL S;  3UMD A;  5EFW A;  4UQI M;  2V9A A;  2Z6D A;  4CLC D;  5FL3 A;  3PXP A;  3ULF A;  5DJU A;  2HF6 A;  1IFQ A;  2J3W A;  3LIA A;  4DN0 A;  3A0R A;  4Q0I A;  2XRN A;  4KUK A;  4O01 A;  4JGQ A;  4PAU A;  3T50 A;  3BWL A;  3VOL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...