2VX8A

Vamp7 longin domain hrb peptide complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
136
structure length
136
Chain Sequence
b'TPEVKPLKSLLGDSAPTLHLNKGMAILFAVVARGTTILAKHAWCGGNFLEVTEQILAKIPSENNKLTYSHGNYLFHYICQDRIVYLCITDDDFERSRAFSFLNEVKKRFQTTYGSRAQTALPYAMNSEFSSVLAAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEOPORIN-LIKE PROTEIN RIP, VESICLE-ASSOCIATED MEMBRANE PR
molecule tags Endocytosis,exocytosis
source organism Homo sapiens
publication title Molecular Basis for the Sorting of the Snare Vamp7 Into Endocytic Clathrin-Coated Vesicles by the Arfgap Hrb.
pubmed doi rcsb
total genus 28
structure length 136
sequence length 136
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13774 Longin Regulated-SNARE-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.50 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2vx8A01
3EGDC 2VX8A 1IFQA 3BW6A 2NUPC 4B93A 2DMWA 3KYQA 4AFIA 3EGXC 1H8MA 2NUTC 1IOUA
chains in the Genus database with same CATH superfamily
3BY8A 4MBFA 2J9OA 1P97A 4FUWA 4BQMA 3N6IA 2O0YA 3V39A 2WKEA 2L4RA 3UB5P 2XA7M 4OQGA 4DKIA 1YQSA 3DW0A 2JKTI 1S0WA 3LI9A 4KZAA 3IH9A 4P6ZM 2HZ5A 3BECA 2Z2LB 1ESUA 3CZDA 1SCWA 1G68A 3V67A 1CK3A 3IWOA 3IF6C 3IXHA 3FPVA 3PBQA 4DJ2A 5HL1A 1MXOA 5GHXA 1VETA 4Z1WA 4BBTA 3MKFA 2HDRA 5FI2A 2WGVA 3KSIA 4DE0A 4HH2A 5CGWA 2VGLM 2PRFA 3DAVA 3VSKA 3RJUA 4WELA 1E3UD 4B4XA 1N9LA 3BJNA 4NXBA 4WYYA 3N7WA 3IX4A 5GHZA 3UDXA 5A91A 4N1HA 5EVLA 4JBFA 4IVIA 2Y2MA 1BLPA 3W4QA 3G35A 1H8YA 1BUEA 2J3WA 4GNUA 4EU0A 1ZKJA 1OTEA 3SS3A 4H8RA 2VJWA 4JXWA 3H7WB 3WS1A 3R4KA 5AJGA 3NOPC 4M3KA 3O87A 2WKRA 1K4EA 3ZG7B 1MZUA 5J7EA 5F1GA 3LIDA 3KSFA 4RX3A 2M7UA 2ZQDA 3UDIA 3R7WA 3CMZA 1XKZA 2ZQAA 2W3DA 3O3VA 5CECA 2VV7A 2O9AA 2GZAA 4OOYA 2QPNA 2W3GA 3G32A 1K56D 3MXQA 4UEYA 4QY5A 1YKDA 5KSHA 5HWWA 4ZJ3A 4GDNA 4HP4A 4GZBA 5A90A 3ZQ5A 5HWTA 1NY0A 4X6TA 2PU2A 2D01A 4FSFA 1IYQA 1DJCA 5TJJA 2IWCA 2VV8A 1K55A 3HUNA 3SS5A 4Y17A 1PI5A 3IHBA 3MKEA 3UE3A 1ONGA 3P98A 5DKKA 2Y2QA 5L09A 1BLCA 1XA7A 4QJGA 3QP1A 1KGFA 3CI6A 4KQRA 2INWA 4HOIA 3HBRA 3FYZA 4ZDXA 3ZCZA 4KQQA 1IYSA 4LFUA 2HDUA 2R9WA 3FKWA 4HH3A 4KG6A 5GLCA 1PW8A 2UWXA 2W1TB 3MZEA 1OTBA 2W0NA 5D3OA 1K57C 1J3WA 1TVFA 1BTLA 3BLSA 4S2KA 1E3UA 4MEZA 4FD8A 4CLCE 1WA9A 1UGUA 2Y59A 4JF5A 5FEGA 2Z6DA 2A24A 3WS4A 3GR2A 4FTXA 3Q1FA 5EE8A 1K55C 1LL8A 2ZOHA 1BYWA 1E4DA 5FAQA 1KVLA 1KE3A 3HUMA 3UB6A 1MKIA 5G4ZA 3ISGA 4OQHA 2XEPA 2HPBA 4NEED 3EEAA 4EQ1A 4JLFA 4RX2A 5FEFA 2GX5A 4OKPA 3BQAA 1YLYA 2KOIA 2ZMFA 5CGSA 1NLZA 4U0XA 3UDFA 4PKYA 2J3TD 3T4LA 4EWFA 2XA7S 3QP2A 1D7EA 5FQQA 2WKPA 4GB7A 1XFQA 3F1OB 1VETB 4ZTKA 2WYXA 3FC7A 2W3FA 3MZFA 3GV9A 3ZVTA 4JGQA 4Y13A 2VA0A 5G4YA 1DJBA 1YMSA 5HX9A 2Y2NA 3PBRA 3N8RA 3TE8A 3FG8A 4M4XA 3GECA 3GMWA 1DJAA 1ERQA 2UV0E 5KSCA 4CLCA 3C4PA 3JYIA 2IWBA 2VGKA 3VP4A 4IVKA 1D06A 3H7WA 5EOOA 3E4OA 3DBAA 5EVID 3OOVA 3G2ZA 5FSRA 3OPRA 1W7FA 1OPXA 3VE3A 3U4LP 4OH0A 1GA9A 2ZM8A 4HIAA 3R7WB 2OV5A 4LRZE 3FV7A 1YPRA 1F98A 1PWCA 2Y2GA 4Y15A 1L0GA 2ZC4B 1VEUA 1V9YA 3MQOA 4UA6A 3NHQA 2PR5A 2XH9A 1SKOB 1LI9A 3P7NA 3D3OA 3CHWP 2EA9A 1IEMA 4F94A 4BL2A 2K31A 4P0MA 4BBVA 1FSWA 4GHIA 4Q0JA 2PD8A 4OPRA 4G3WA 3GTCA 2RCXA 1T18A 3S22A 3MSHA 2V1AA 3T12B 2E8IA 3HLCA 1YSPA 2VX8A 5AQAA 1SHVA 3HLEA 2ZQ8A 5DJTA 3T4OA 2WKQA 1TS6A 3BRMA 3HCYA 4WF0A 3F1PA 2BG1A 2JE5A 2H0YA 4N9KA 3F1PB 4OQ0A 5HDCA 3WRTA 3CITA 3PBTA 5CEDA 3BWLA 3UE6A 2ZBBA 4XXRA 4Q0IA 4N1XA 4EBLA 1PZPA 1TS7A 4P85A 4HBUA 1MKMA 4K0XA 2EX2A 4LLOB 5GLDA 4P6BA 2A24B 1XA1A 4BBUA 2OAQ1 2O9BA 1Z6FA 4LRXC 3MF0A 3UB8A 5L8MA 3PYPA 3IX8A 3S4XA 4KZ4A 2DNSA 3EWKA 2B18A 2WKHA 3KO6A 5EVIA 1KGGA 4E3OA 1CJFA 4R70A 4O8GA 2HJ9C 4K91A 1FR1A 4X53A 2J7VA 3I7JA 3UPOA 2HV1A 3IT9A 4MN7A 1NYYA 1XXMA 5FAOA 3LO7A 3QNBA 5HAQA 3RTYA 1IFQA 2WKIA 1N4OA 3BFFA 3HLBA 2V9AA 4R4SA 5HDSA 2HP5A 1XPBA 3IF6A 5TFQA 2KDKA 2ZM2A 4KZ6A 3A3IA 1A0KA 5DFYA 2WK0A 2W3HA 4HJ4A 2EX9A 3NC8A 5I5LA 1QMFA 2C6WB 3D4FA 4X68A 5A8BA 3U2AA 1S1ZA 1ZTUA 1CF0A 2DCFA 3UN7A 3O5YA 3KX0X 5CEBA 1HLUP 3PBOA 2Z2MB 2Y91A 2V0UA 3S1YA 3VFHA 1MC0A 4R3JA 4U0TA 4R3BA 1DRMA 1Y28A 3BW6A 1F2KA 3GSGA 1NRFA 4DXBA 2VLGA 1IKGA 4LV1A 3MXSA 3NDEA 4L0LA 1M40A 1F5MA 2JKFA 5EFWA 4KQOA 3E4PA 1E25A 4RVAA 2FFYA 4L9GA 5A92A 4PKYG 1CEFA 2V1ZA 5FAPA 1HD8A 3BFDA 4OQIA 4KZ9A 4S2NA 3UY6A 3MQQA 3B33A 3IXDA 2KLIA 4Y7PA 5HWVA 5KMWA 3NJAA 5HD3A 2PAVP 1W79A 1SKOA 3CUEC 5HARA 3GRJA 4S2OA 4UQIS 2AVXA 3UMDA 4EUZA 5G18A 3C4OA 4QU3A 2H5SA 1UWNX 2J8YA 2ZQCA 4GHIB 5AVFA 1RP5A 3CJMA 3H82A 3RH8B 3UB9A 3KYZA 1MPLA 4YWZA 1ES2A 3HJKA 1K57A 4BL3A 5HPIA 1LSXA 4ID4A 3MZDA 1YM1A 2Q9NA 4R0QA 4A5RA 3K3CA 5KIZA 2A3UA 2JN7A 3B42A 4CQHA 2V2FF 4X56A 4KZ5A 1G6AA 2VZWA 3E0YA 4WLAA 4IHQA 4E3JA 1ES3A 3OPHA 4HQAA 5CRFA 4S2NC 3TG9A 3EGDC 2FFFB 1K56A 3B47A 3NULA 1X0OA 3UMEA 3PXPA 4FOFA 4GOGA 2CC1A 2VEAA 1Z09A 3KSGA 4GS9B 2X71A 2M1CA 2G2UA 4KZ7A 1PWDA 2D02A 3VFFA 2ZQ7A 3MBZA 1F9IA 2W27A 4I5SA 2PYRA 3PBSA 5DJUA 2X01A 3FWLA 4LPZA 2W1RA 5FQMA 1HZOA 1TF1A 1WYCA 2Y2KA 2WGWB 1Q2PA 2FZ0A 3A3JA 3BQ8A 3DTKA 2WGWA 5AQBA 2JKRI 5DF8A 1BT5A 3Q82A 4I3IA 5JYPA 2ZOIA 3ZVWA 4EETB 2P08A 3LUQA 1LSWA 4S2LA 4QY6A 4ARZA 5AQ9A 4GCZA 4DXCA 5FI7A 3ZFZA 2EWVA 5AVEA 1ES4A 4Y3IA 3EOIA 3IBRA 3UE1A 2I9VA 3WWXA 4MBHA 4X69A 1N9NA 4GLQA 5DTSA 2K2NA 1DY6A 1U60A 1W8QA 1EROA 5HZHA 1PI4A 3CPTB 2XDMA 5F68A 5U47A 4B93A 4B4ZA 4XUXA 2WZXA 5A93A 3ZNTA 3OBFA 1DP8A 2G2WA 1OJ5A 1S1YA 5M18A 2OWJA 1PZOA 5E2EA 4R6LA 4MLLA 3SZTA 4HJ3A 4MNRA 4CJNA 4WZ5A 3BY9A 3LYXA 3IQAA 5E2GA 1TD5A 4C6YA 1PIOA 1BZAA 3VOZA 4ETXA 2HDSA 4JPMA 3OLOA 3V50A 1SDNA 2HF6A 2Y2OA 4WEJA 1GSXA 4G3VA 4EQIA 5TGFA 2ZMVA 2L1MA 1ALQA 1MWUA 3Q7VA 3C8CA 1Q2QA 4KZ8A 2JKRM 3IF5A 2P74A 3N8SA 1K4FA 5AQ7A 4HP9A 4LCMA 3WRZA 3Q7VB 3A0VA 5FQIA 2J80A 2H10A 5J3WA 1OT9A 5E2HA 3C7UA 4EEUA 4LRYC 3D9YA 4JGOA 2HP9A 3F1NA 3QP4A 1I5QA 2V20A 1XX2A 1CQAA 1HTZA 1MWSA 5TBMB 2Q9MA 4X1MA 1OMEA 4WZ5C 4B88A 1XJ6A 4KG5A 3MXRA 1P0ZA 1PFLA 3ZG8B 1KDSA 4KUOA 4Q8IA 2PHYA 1IYPA 4OPZA 5CTNA 3T1QB 2QYBA 3QNCA 4IBRA 2XD5A 3UE0A 5EVIC 5GHYA 3QP8A 4WMCA 1OTDA 3ZG9B 4H6JB 2QZ6A 3HLWA 5CHUA 5F83A 3LIBA 2H28A 3IBJA 3W4PA 5CX7A 5J8XA 2PBYA 1EI5A 2W3EA 2W1TA 4KG2A 3UPNA 4LV2A 1EW0A 3SS4A 3AGFA 4RA7A 5CXWA 5EUAA 2GJ3A 1K0KA 2Y2PA 3UPPA 3G34A 3WS0A 1H5XA 1IYOA 4EBPA 3DTIA 3A0SA 1W63Q 4QD4A 5DF7A 3M2JA 4WL9A 4ZJ2A 5EVIB 5HAIA 2RL3A 1XJ2A 4ARZB 5F1FA 4WM9A 4R23A 1NWZA 4EESA 2Y2HA 2Y8HA 2VGJA 3O86A 3IHAA 1K54A 4XUZA 3HL9A 1QMEA 4O7DA 5DKLA 3C7VA 5IHVA 3T1RA 3LGOA 4I3JA 3SW1A 3M2KA 4OONA 3LR0A 4PM8A 3TW8A 5F6AA 3RXXA 1CEGA 1TDGA 3IF6B 1L0DA 2ZLYA 3EEHA 4IUHA 5CHMA 2XGNA 1PWGA 1CI8A 1GA0A 1KDWA 1LLBA 3T1XA 1BLHA 1Y4OA 1NJ4A 4WEKA 4KZBA 2XD1A 5E2FA 2J9PA 1T1AA 1K6SA 4N92A 3CLOA 1OT6A 1KGEA 3H9WA 2ZM0A 3G6OA 3HVFA 1S67L 5IU1A 3RFBA 2A2LA 1YAXA 3NDGA 1DP6A 2R9XA 4OOLA 4X1LA 1I2WA 4GKUA 2XRNA 1BSGA 1GHIA 3IWQA 2ZL1A 4RYEA 5EOEA 3T50A 1G5UA 2GDNA 3HJIA 5KZHA 1NXYA 4K0WA 4K08A 1T1BA 1W63M 4G3KA 3N8LA 3L9KA 1OTAA 1KOUA 1FCMA 1H8MA 5FQKA 1WYBA 3VP3A 4QWOA 3ITAA 3EQVA 2VKSA 2OLUA 1XGJA 5LBRA 3RXWA 2Q0OA 1FCNA 3ULFA 1JTGA 1Y54A 2YKFA 3W4OA 1AWIA 2V8CA 1YLWA 2WUQA 4F3LB 4I38A 1LL9A 3KYEA 2XFSA 1MWRA 5HW3A 2WADA 1GHMA 5FA7A 3P09A 4IUKA 4NXGA 2O99A 4LV0A 1D1JA 2XSSA 3NBLA 1GCEA 2PT7A 4DDYA 5L07A 1L3LA 2WAFA 4OVDA 2ZQ9A 1V9ZA 2LB9A 2WAEA 1SZVA 4Q0HA 4HY8A 1T19A 4XT2B 3AGEA 3T4QA 5IT5A 2HDQA 2QHKA 3PHYA 3GVBA 3Q07A 1JVJA 5EM1A 1S4SA 4WZ4A 2L0WA 4KUKA 4FH2A 4O0PA 1NRJA 3ZNYA 2WGIA 1YLZA 4JXSA 4R3AA 1TEMA 2OOLA 2EWWA 1EWZA 3KSHA 1ZG4A 3JPUA 5HSQA 2VK3A 3DWKA 1WE4A 3OPPA 4E04A 1ZC2A 2BLSA 3GDIA 1FOFA 3SOIA 3T4TA 3P01A 1VQQA 4OLDA 1GSVA 1GHPA 4ZBEA 4LCLA 4C3QA 1G6OA 1K25A 3PTEA 1ODVA 2IWDA 1RGYA 2QWSA 3OCNA 1MY8A 1KE0A 5CHJA 2DMWA 4CLCD 3PBNA 5CGXA 3LY4A 5FI6A 3NCKA 3O88A 3BLMA 3HLGA 4KQDA 4JXGA 4YOFA 4FCFA 2X02A 5K5BA 5M1AA 3SH9A 3BEBA 4NKPA 1MWTA 3LY3A 4S2PA 1JWPA 4II7A 4CPKA 3G31A 3IWIA 3E98A 3K2NA 3HUOA 2M7VA 3MFXA 3ZG0A 3MMHA 3VV4A 2YKHA 3G2YA 3HLDA 5JYOA 5L2FA 1LSVA 1LT0A 2J3TC 2ZMAA 2ZC3B 4HI4A 4E3MA 3NOUC 2P9VB 1VHMA 3SH8A 5F82A 4GJ4A 1FILA 4OP8A 3TSGA 4HJ6A 3QP5A 1S4RA 1ZG6A 1VB6A 1L0FA 2JCHA 3VP1A 2WZZA 5EM0A 2A49A 4QPRA 4E3IA 4BENA 2NUTC 1JTDA 1K6RA 2EFXA 3ZHHA 4GDBA 1HVBA 1M6KA 5HL6A 4I3AA 1FSYA 1T1CA 4EXOA 2C5WB 3OC2A 2PBDP 1VEUB 1ERMA 1YT4A 4Y0TA 1GSWA 3Q81A 1KE4A 1NYMA 1PRQA 5FDHA 1SDEA 2KX6A 5EVEA 3VMAA 1ZHHB 3CAXA 1LHYA 1TS8A 2OWHA 2B95A 4YFMA 4DRTA 2ZC7A 3M6HA 4BLMA 4BD1A 2Z6CA 3IX3A 2PD7A 4HBTA 4WN5A 2HJEA 3V5MA 1STZA 3NI9A 1UWPX 2ZC5B 2XK1A 2JHEA 5HD5A 2BTFP 4Y2FA 2QMIA 2VV6A 5L10A 4Y0UA 3UNWA 3OPLA 4LENA 2Y2LA 1G28A 1PW1A 3JVVA 4QB8A 5DTKA 4IEDA 3EGXC 4P87A 1O07A 3HLFA 4JGRA 5EPHA 3N4IA 1XGIA 3NIAA 4H6JA 4PHTA 3VP0A 3IS2A 3LICA 3VOLA 5GLAA 3NECA 4ESPA 4GS9A 4PM5A 5CERA 1JWZA 2DRWA 3TOIA 4DE3A 2NUPC 3D72A 4YNRA 4GD8A 5FASA 1TDLA 2JC7A 4JXVA 1L0EA 3MFDA 5GLBA 3C5AA 3W8KA 2Y2JA 4S2JA 4AFIA 2EX6A 3S7NA 4OLGA 5MC7A 2XQZA 3ZDJA 3DTMA 4I39A 3C38A 3MR0A 5DTTA 4DE2A 4NG2A 4PPRA 4JF6A 4KENB 2EX8A 4UA7A 3C2WA 5M19A 1IKIA 3PAEA 3TRCA 3T4KA 3UB7A 5CTMA 4Y0OA 1K38A 3ZGAB 1N9OA 3LR3A 2PDRA 1NLYA 3BM6A 1FIKA 1XP4A 3MS6A 4ME4A 5C5KA 4CLCB 3MQ0A 2Y55A 1DP9A 3E2LA 1FQGA 4DN0A 4DE1A 4UAAA 1JNUA 1IOUA 3BFEA 1O7EA 4UHUA 1P9WA 3W2ZA 2G7UA 1ONHA 4U3TA 4DDSA 2HP6A 4R1GA 1P9RA 1PYYA 4E6WA 3ICYA 4WBGA 4D2OA 3TJZC 3EQUA 4UQIM 1BLSA 5GL9A 1SKFA 2P9VA 3LIEA 4EBNA 1J9MA 1YMXA 2QKPA 1TS0A 4IJGA 1VM1A 4D60A 3LIAA 4WMCD 4OP5A 3BFCA 4WUJA 3JVUA 3LIFA 4CLCC 5DVAA 3FKVA 4BWIA 4E6XA 2H0TA 3VOYA 4PAUA 2OSUA 4ZRRA 2B02A 4EERA 4MN6A 2Y79A 1W5DA 1ACFA 5F5YA 5HDDA 4RQ9A 1I2SA 1H3QA 1OJGA 2QJ7A 2FH5A 1H8ZA 4S2IA 4NXFA 4LV3A 4FH4A 1C3BA 4HNBA 2P7JA 4N9LA 2JKGA 4X25A 5E43A 3K3DA 1OTIA 3B3XA 3PR6A 5FQJA 3WS5A 4HESA 4EV4A 4E3LA 5TBMA 1FR6A 2GNXA 2B5RA 4HEFA 1RCJA 2VGLS 2PR6A 4E3NA 1L2SA 3S7PA 3VP2A 5FATA 1JWVA 2PU4A 4IBXA 4NK3A 3BFGA 1S66L 5F69A 5EECA 3GQZA 3DTEA 3CUEA 3G4PA 2XF3A 1K54C 3V3RA 5HPFA 4XT2A 2XLNA 4LGWA 1RGZA 3HREA 3IS2B 2QJ5A 3Q7ZA 2OLVA 3CWFA 2EXAA 3SH7A 3LI8A 1CI9A 4EEPA 4P6ZS 4MN5A 1H0MA 1NZUA 3ITBA 2ZD8A 4MCWA 1ESIA 4PM7A 3LEZA 3LEQA 4OPYA 4YINA 3OCLA 1YLPA 2Y2IA 1XJ3A 2E8JA 1S6RA 1KVMA 3DWZA 2CMNA 5I94A 1IELA 3FPWA 3LR4A 3OZHA 4NXEA 4JGPA 3F1OA 3E2KA 2V1BA 3G30A 4B9OA 2XFTA 4JKTA 3T4SA 2BASA 2V8FA 4E3KA 3M6BA 1XFNA 2O9CA 2XR0A 4NETA 4ZAMA 3CPTA 2HGVA 2PYPA 4R38A 2ZC6B 3KYQA 3S7OA 4Z9QA 2IA2A 4GW9A 1MBLA 3WS2A 5FL3A 4O01A 3FZCA 1AXBA 4HHDA 3C30A 2MJ6A 2ZJ9A 1PNEA 4DJ3A 3AGDA 5DFXA 5DF9A 3A3DA 4GN2A 3L7HA 5EV0A 2R78A 4QHCA 2K7SA 4R4RA 3QHYA 4MDZA 4EW7A 3T1SA 2JKTM 4DMZA 2V0WA 3NY4A 1FCOA 5FQ9A 4JF4A 2Y4AA 4ETZA 2ACGA 5IS1A 3IXBA 1NZOA 1ES5A 1W8YA 4MMNA 4BJPA 5HFOA 2ZL1B 3PAGA 4BD0A 3CG5A 4KZ3A 3IXGA 2OAP1 1LI0A 1YSQA 5FDSA 3UO9A 4X55A 4DF6A 1LL5A 5HAPA 4Y5FA 4L9FA 2LB5A 3F1NB 3A3EA 3V3SA 4EUVA 3H82B 4PM6A 3T4JA 3QP6A 4OPQA 3BYDA 1XJ4A 3A0RA 2P04A 3MJQA 4PM9A 2EXBA 3IH8A 4OOMA 4L9EA 4F3LA 5J4EA 2I72A 4MBKA 1YLJA 4GD6A 3LFVA 5BOHA 3LCEA 4ZJ1A 5TR7A 1YLTA 3E4QA 2EFUA 4C75A 4UA9A 1BULA 3ZYTA 3NOTC 3A3FA 2JBFA 1N9BA 4BMWA 4PMAA 3ZG5A 3VSLA 3S7QA 3LR5A 2XROA 4S2MA 3VE4A
chains in the Genus database with same CATH topology
4Q0IA 1OTDA 3BY8A 4JGRA 1TS7A 4H6JB 1P97A 1MKMA 3LIBA 2O0YA 4LLOB 2H28A 3IBJA 2L4RA 5CX7A 2A24B 2W3EA 4H6JA 4PHTA 2XA7M 4BBUA 2OAQ1 3IS2A 2W1TA 2O9BA 3LICA 3VOLA 1EW0A 4LRXC 3MF0A 3UB8A 4GS9A 5L8MA 2JKTI 3PYPA 3LI9A 4P6ZM 2NUPC 3D72A 2GJ3A 4YNRA 3EWKA 2B18A 3KO6A 3A0SA 1W63Q 4R70A 4O8GA 3V67A 4WL9A 2HJ9C 4AFIA 3S7NA 1XJ2A 4ARZB 5MC7A 2HV1A 1NWZA 3FPVA 3PBQA 4MN7A 4DJ2A 4I39A 4EESA 2Y8HA 3C38A 3MR0A 4Z1WA 4BBTA 1IFQA 3RTYA 5DKLA 3KSIA 2V9AA 4HH2A 3C2WA 2VGLM 5HDSA 4I3JA 3SW1A 3LR0A 4WELA 2KDKA 3TRCA 3TW8A 5F6AA 3T4KA 1N9LA 3BJNA 3UB7A 5DFYA 4NXBA 2W3HA 4HJ4A 3EEHA 1N9OA 4IUHA 3LR3A 2PDRA 1NLYA 5I5LA 4ME4A 5C5KA 4CLCB 3MQ0A 2J3WA 4EU0A 1DP9A 1OTEA 3U2AA 1S1ZA 5A8BA 1ZTUA 4WEKA 4DN0A 1JNUA 1IOUA 2VJWA 1T1AA 1P9WA 3H7WB 3O5YA 3KX0X 3W2ZA 2G7UA 1P9RA 3PBOA 3CLOA 3ICYA 2V0UA 3R4KA 5AJGA 1OT6A 3NOPC 3EQUA 3TJZC 3H9WA 3G6OA 4UQIM 1MC0A 1S67L 2WKRA 1DRMA 1MZUA 5IU1A 1Y28A 5J7EA 3RFBA 2A2LA 3BW6A 3LIEA 1YAXA 3LIDA 3KSFA 1DP6A 2QKPA 1TS0A 2M7UA 3R7WA 2VLGA 2W3DA 4IJGA 4OOLA 2VV7A 2O9AA 4L0LA 2XRNA 3LIAA 1F5MA 2GZAA 5EFWA 4KQOA 3E4PA 2W3GA 4L9GA 4PKYG 3MXQA 4UEYA 4WUJA 3JVUA 3LIFA 3T50A 1YKDA 5KSHA 4CLCC 5HWWA 3MQQA 3B33A 4HP4A 4BWIA 2KLIA 3HJIA 5HWVA 4PAUA 4ZRRA 2B02A 4EERA 4MN6A 3NJAA 5HD3A 3ZQ5A 2Y79A 4K08A 5HWTA 1T1BA 1W63M 4G3KA 1OTAA 1KOUA 3CUEC 1H8MA 2D01A 5F5YA 4UQIS 5HDDA 4RQ9A 3UMDA 4FSFA 5TJJA 1H3QA 1OJGA 2QJ7A 2VV8A 2VKSA 3EQVA 2FH5A 5LBRA 1UWNX 4NXFA 4GHIB 5AVFA 3ULFA 4HNBA 2P7JA 2YKFA 3H82A 3RH8B 3UB9A 3KYZA 3UE3A 4YWZA 3HJKA 3K3DA 5DKKA 1OTIA 4F3LB 3PR6A 5HPIA 4I38A 1LSXA 3CI6A 5TBMA 4IUKA 2GNXA 4NXGA 2INWA 2O99A 4HOIA 3K3CA 5KIZA 2JN7A 2VGLS 3B42A 4CQHA 2PR6A 2XSSA 3S7PA 2PT7A 2VZWA 1V9ZA 2LB9A 4HH3A 3E0YA 4WLAA 4Q0HA 4IHQA 4HQAA 1S66L 4HY8A 1T19A 5F69A 3EGDC 2W1TB 3B47A 4XT2B 5IT5A 1X0OA 3T4QA 3UMEA 3PXPA 4FOFA 1OTBA 2QHKA 3CUEA 2W0NA 3PHYA 2VEAA 3KSGA 4GS9B 1S4SA 5HPFA 2M1CA 2L0WA 4XT2A 4KUKA 4CLCE 1WA9A 2D02A 1NRJA 4O0PA 1UGUA 2Z6DA 2A24A 3IS2B 4R3AA 1F9IA 2W27A 4I5SA 2PYRA 3PBSA 1LL8A 5DJUA 2QJ5A 2ZOHA 1BYWA 4LPZA 2W1RA 2OOLA 3CWFA 2EWWA 3KSHA 3UB6A 5G4ZA 1TF1A 3LI8A 4EEPA 4P6ZS 4MN5A 5HSQA 4NEED 3EEAA 4E04A 4EQ1A 2FZ0A 3GDIA 3BQ8A 2GX5A 4MCWA 3T4TA 3P01A 3BQAA 1GSVA 2JKRI 2KOIA 4I3IA 2ZMFA 2ZOIA 4EETB 1NLZA 1G6OA 2P08A 4PKYA 3LUQA 1LSWA 2J3TD 3OCLA 3T4LA 4ARZA 1ODVA 4GCZA 2XA7S 1XJ3A 2EWVA 5AVEA 1D7EA 2WKPA 2QWSA 1XFQA 3OCNA 3F1OB 2CMNA 4Y3IA 3EOIA 2DMWA 4CLCD 3FPWA 3LR4A 4NXEA 3FC7A 3PBNA 2W3FA 3IBRA 2I9VA 4JGPA 3F1OA 2V1BA 4B9OA 4JGQA 3T4SA 2BASA 1N9NA 4GLQA 2VA0A 4KQDA 5G4YA 1XFNA 2O9CA 4YOFA 3PBRA 5K5BA 4NKPA 2K2NA 3TE8A 3FG8A 2HGVA 4M4XA 3GECA 4II7A 2PYPA 4R38A 3E98A 3KYQA 3K2NA 3S7OA 4CLCA 2IA2A 2M7VA 5HZHA 4GW9A 3MFXA 5F68A 4B93A 3MMHA 3VV4A 2YKHA 3OBFA 4O01A 5FL3A 1DP8A 4HHDA 3C30A 1OJ5A 1D06A 2MJ6A 1S1YA 3H7WA 4DJ3A 3E4OA 5DFXA 3DBAA 2OWJA 5DF9A 4R6LA 3OOVA 4HJ3A 1LSVA 2R78A 1LT0A 2J3TC 2K7SA 3BY9A 3LYXA 4HI4A 3NOUC 4MDZA 1OPXA 1VHMA 4EW7A 3VE3A 1TD5A 2JKTM 4GJ4A 4DMZA 2V0WA 4ETXA 4HJ6A 4HIAA 4ETZA 1S4RA 3R7WB 1VB6A 4LRZE 1F98A 5IS1A 3OLOA 2HF6A 4QPRA 4WEJA 1GSXA 2NUTC 4G3VA 4MMNA 4BJPA 1V9YA 3MQOA 2ZMVA 2L1MA 5HL6A 3NHQA 2PR5A 4I3AA 2OAP1 1YSQA 3C8CA 3P7NA 1T1CA 4EXOA 3OC2A 3D3OA 2JKRM 2EA9A 4HP9A 1GSWA 2K31A 3A0VA 4BBVA 2J80A 4GHIA 4Y5FA 4Q0JA 4L9FA 2PD8A 5J3WA 2LB5A 4G3WA 3F1NB 2KX6A 1OT9A 1T18A 4EUVA 1ZHHB 3CAXA 3H82B 4EEUA 4LRYC 3T4JA 2V1AA 1XJ4A 3A0RA 2P04A 3MJQA 4JGOA 1TS8A 2OWHA 3F1NA 4OOMA 4L9EA 1YSPA 2VX8A 4F3LA 5J4EA 3LFVA 5DJTA 3T4OA 2WKQA 1TS6A 3HCYA 4WF0A 5TBMB 3F1PA 2Z6CA 2PD7A 3E4QA 4WN5A 1XJ6A 2HJEA 1STZA 1P0ZA 1UWPX 5HD5A 2JHEA 3F1PB 4KUOA 3ZYTA 3NOTC 4Y2FA 5HDCA 2VV6A 2PHYA 3CITA 3PBTA 2QYBA 1G28A 4BMWA 3BWLA 3S7QA 2ZBBA 3JVVA 3LR5A 3UE6A 2XROA 3VE4A 3EGXC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EGD C;  2VX8 A;  1IFQ A;  3BW6 A;  2NUP C;  4B93 A;  2DMW A;  3KYQ A;  4AFI A;  3EGX C;  1H8M A;  2NUT C;  1IOU A; 
#chains in the Genus database with same CATH topology
 3BY8 A;  4MBF A;  2J9O A;  1P97 A;  4FUW A;  4BQM A;  3N6I A;  2O0Y A;  3V39 A;  2WKE A;  2L4R A;  3UB5 P;  2XA7 M;  4OQG A;  4DKI A;  1YQS A;  3DW0 A;  2JKT I;  1S0W A;  3LI9 A;  4KZA A;  3IH9 A;  4P6Z M;  2HZ5 A;  3BEC A;  2Z2L B;  1ESU A;  3CZD A;  1SCW A;  1G68 A;  3V67 A;  1CK3 A;  3IWO A;  3IF6 C;  3IXH A;  3FPV A;  3PBQ A;  4DJ2 A;  5HL1 A;  1MXO A;  5GHX A;  1VET A;  4Z1W A;  4BBT A;  3MKF A;  2HDR A;  5FI2 A;  2WGV A;  3KSI A;  4DE0 A;  4HH2 A;  5CGW A;  2VGL M;  2PRF A;  3DAV A;  3VSK A;  3RJU A;  4WEL A;  1E3U D;  4B4X A;  1N9L A;  3BJN A;  4NXB A;  4WYY A;  3N7W A;  3IX4 A;  5GHZ A;  3UDX A;  5A91 A;  4N1H A;  5EVL A;  4JBF A;  4IVI A;  2Y2M A;  1BLP A;  3W4Q A;  3G35 A;  1H8Y A;  1BUE A;  2J3W A;  4GNU A;  4EU0 A;  1ZKJ A;  1OTE A;  3SS3 A;  4H8R A;  2VJW A;  4JXW A;  3H7W B;  3WS1 A;  3R4K A;  5AJG A;  3NOP C;  4M3K A;  3O87 A;  2WKR A;  1K4E A;  3ZG7 B;  1MZU A;  5J7E A;  5F1G A;  3LID A;  3KSF A;  4RX3 A;  2M7U A;  2ZQD A;  3UDI A;  3R7W A;  3CMZ A;  1XKZ A;  2ZQA A;  2W3D A;  3O3V A;  5CEC A;  2VV7 A;  2O9A A;  2GZA A;  4OOY A;  2QPN A;  2W3G A;  3G32 A;  1K56 D;  3MXQ A;  4UEY A;  4QY5 A;  1YKD A;  5KSH A;  5HWW A;  4ZJ3 A;  4GDN A;  4HP4 A;  4GZB A;  5A90 A;  3ZQ5 A;  5HWT A;  1NY0 A;  4X6T A;  2PU2 A;  2D01 A;  4FSF A;  1IYQ A;  1DJC A;  5TJJ A;  2IWC A;  2VV8 A;  1K55 A;  3HUN A;  3SS5 A;  4Y17 A;  1PI5 A;  3IHB A;  3MKE A;  3UE3 A;  1ONG A;  3P98 A;  5DKK A;  2Y2Q A;  5L09 A;  1BLC A;  1XA7 A;  4QJG A;  3QP1 A;  1KGF A;  3CI6 A;  4KQR A;  2INW A;  4HOI A;  3HBR A;  3FYZ A;  4ZDX A;  3ZCZ A;  4KQQ A;  1IYS A;  4LFU A;  2HDU A;  2R9W A;  3FKW A;  4HH3 A;  4KG6 A;  5GLC A;  1PW8 A;  2UWX A;  2W1T B;  3MZE A;  1OTB A;  2W0N A;  5D3O A;  1K57 C;  1J3W A;  1TVF A;  1BTL A;  3BLS A;  4S2K A;  1E3U A;  4MEZ A;  4FD8 A;  4CLC E;  1WA9 A;  1UGU A;  2Y59 A;  4JF5 A;  5FEG A;  2Z6D A;  2A24 A;  3WS4 A;  3GR2 A;  4FTX A;  3Q1F A;  5EE8 A;  1K55 C;  1LL8 A;  2ZOH A;  1BYW A;  1E4D A;  5FAQ A;  1KVL A;  1KE3 A;  3HUM A;  3UB6 A;  1MKI A;  5G4Z A;  3ISG A;  4OQH A;  2XEP A;  2HPB A;  4NEE D;  3EEA A;  4EQ1 A;  4JLF A;  4RX2 A;  5FEF A;  2GX5 A;  4OKP A;  3BQA A;  1YLY A;  2KOI A;  2ZMF A;  5CGS A;  1NLZ A;  4U0X A;  3UDF A;  4PKY A;  2J3T D;  3T4L A;  4EWF A;  2XA7 S;  3QP2 A;  1D7E A;  5FQQ A;  2WKP A;  4GB7 A;  1XFQ A;  3F1O B;  1VET B;  4ZTK A;  2WYX A;  3FC7 A;  2W3F A;  3MZF A;  3GV9 A;  3ZVT A;  4JGQ A;  4Y13 A;  2VA0 A;  5G4Y A;  1DJB A;  1YMS A;  5HX9 A;  2Y2N A;  3PBR A;  3N8R A;  3TE8 A;  3FG8 A;  4M4X A;  3GEC A;  3GMW A;  1DJA A;  1ERQ A;  2UV0 E;  5KSC A;  4CLC A;  3C4P A;  3JYI A;  2IWB A;  2VGK A;  3VP4 A;  4IVK A;  1D06 A;  3H7W A;  5EOO A;  3E4O A;  3DBA A;  5EVI D;  3OOV A;  3G2Z A;  5FSR A;  3OPR A;  1W7F A;  1OPX A;  3VE3 A;  3U4L P;  4OH0 A;  1GA9 A;  2ZM8 A;  4HIA A;  3R7W B;  2OV5 A;  4LRZ E;  3FV7 A;  1YPR A;  1F98 A;  1PWC A;  2Y2G A;  4Y15 A;  1L0G A;  2ZC4 B;  1VEU A;  1V9Y A;  3MQO A;  4UA6 A;  3NHQ A;  2PR5 A;  2XH9 A;  1SKO B;  1LI9 A;  3P7N A;  3D3O A;  3CHW P;  2EA9 A;  1IEM A;  4F94 A;  4BL2 A;  2K31 A;  4P0M A;  4BBV A;  1FSW A;  4GHI A;  4Q0J A;  2PD8 A;  4OPR A;  4G3W A;  3GTC A;  2RCX A;  1T18 A;  3S22 A;  3MSH A;  2V1A A;  3T12 B;  2E8I A;  3HLC A;  1YSP A;  2VX8 A;  5AQA A;  1SHV A;  3HLE A;  2ZQ8 A;  5DJT A;  3T4O A;  2WKQ A;  1TS6 A;  3BRM A;  3HCY A;  4WF0 A;  3F1P A;  2BG1 A;  2JE5 A;  2H0Y A;  4N9K A;  3F1P B;  4OQ0 A;  5HDC A;  3WRT A;  3CIT A;  3PBT A;  5CED A;  3BWL A;  3UE6 A;  2ZBB A;  4XXR A;  4Q0I A;  4N1X A;  4EBL A;  1PZP A;  1TS7 A;  4P85 A;  4HBU A;  1MKM A;  4K0X A;  2EX2 A;  4LLO B;  5GLD A;  4P6B A;  2A24 B;  1XA1 A;  4BBU A;  2OAQ 1;  2O9B A;  1Z6F A;  4LRX C;  3MF0 A;  3UB8 A;  5L8M A;  3PYP A;  3IX8 A;  3S4X A;  4KZ4 A;  2DNS A;  3EWK A;  2B18 A;  2WKH A;  3KO6 A;  5EVI A;  1KGG A;  4E3O A;  1CJF A;  4R70 A;  4O8G A;  2HJ9 C;  4K91 A;  1FR1 A;  4X53 A;  2J7V A;  3I7J A;  3UPO A;  2HV1 A;  3IT9 A;  4MN7 A;  1NYY A;  1XXM A;  5FAO A;  3LO7 A;  3QNB A;  5HAQ A;  3RTY A;  1IFQ A;  2WKI A;  1N4O A;  3BFF A;  3HLB A;  2V9A A;  4R4S A;  5HDS A;  2HP5 A;  1XPB A;  3IF6 A;  5TFQ A;  2KDK A;  2ZM2 A;  4KZ6 A;  3A3I A;  1A0K A;  5DFY A;  2WK0 A;  2W3H A;  4HJ4 A;  2EX9 A;  3NC8 A;  5I5L A;  1QMF A;  2C6W B;  3D4F A;  4X68 A;  5A8B A;  3U2A A;  1S1Z A;  1ZTU A;  1CF0 A;  2DCF A;  3UN7 A;  3O5Y A;  3KX0 X;  5CEB A;  1HLU P;  3PBO A;  2Z2M B;  2Y91 A;  2V0U A;  3S1Y A;  3VFH A;  1MC0 A;  4R3J A;  4U0T A;  4R3B A;  1DRM A;  1Y28 A;  3BW6 A;  1F2K A;  3GSG A;  1NRF A;  4DXB A;  2VLG A;  1IKG A;  4LV1 A;  3MXS A;  3NDE A;  4L0L A;  1M40 A;  1F5M A;  2JKF A;  5EFW A;  4KQO A;  3E4P A;  1E25 A;  4RVA A;  2FFY A;  4L9G A;  5A92 A;  4PKY G;  1CEF A;  2V1Z A;  5FAP A;  1HD8 A;  3BFD A;  4OQI A;  4KZ9 A;  4S2N A;  3UY6 A;  3MQQ A;  3B33 A;  3IXD A;  2KLI A;  4Y7P A;  5HWV A;  5KMW A;  3NJA A;  5HD3 A;  2PAV P;  1W79 A;  1SKO A;  3CUE C;  5HAR A;  3GRJ A;  4S2O A;  4UQI S;  2AVX A;  3UMD A;  4EUZ A;  5G18 A;  3C4O A;  4QU3 A;  2H5S A;  1UWN X;  2J8Y A;  2ZQC A;  4GHI B;  5AVF A;  1RP5 A;  3CJM A;  3H82 A;  3RH8 B;  3UB9 A;  3KYZ A;  1MPL A;  4YWZ A;  1ES2 A;  3HJK A;  1K57 A;  4BL3 A;  5HPI A;  1LSX A;  4ID4 A;  3MZD A;  1YM1 A;  2Q9N A;  4R0Q A;  4A5R A;  3K3C A;  5KIZ A;  2A3U A;  2JN7 A;  3B42 A;  4CQH A;  2V2F F;  4X56 A;  4KZ5 A;  1G6A A;  2VZW A;  3E0Y A;  4WLA A;  4IHQ A;  4E3J A;  1ES3 A;  3OPH A;  4HQA A;  5CRF A;  4S2N C;  3TG9 A;  3EGD C;  2FFF B;  1K56 A;  3B47 A;  3NUL A;  1X0O A;  3UME A;  3PXP A;  4FOF A;  4GOG A;  2CC1 A;  2VEA A;  1Z09 A;  3KSG A;  4GS9 B;  2X71 A;  2M1C A;  2G2U A;  4KZ7 A;  1PWD A;  2D02 A;  3VFF A;  2ZQ7 A;  3MBZ A;  1F9I A;  2W27 A;  4I5S A;  2PYR A;  3PBS A;  5DJU A;  2X01 A;  3FWL A;  4LPZ A;  2W1R A;  5FQM A;  1HZO A;  1TF1 A;  1WYC A;  2Y2K A;  2WGW B;  1Q2P A;  2FZ0 A;  3A3J A;  3BQ8 A;  3DTK A;  2WGW A;  5AQB A;  2JKR I;  5DF8 A;  1BT5 A;  3Q82 A;  4I3I A;  5JYP A;  2ZOI A;  3ZVW A;  4EET B;  2P08 A;  3LUQ A;  1LSW A;  4S2L A;  4QY6 A;  4ARZ A;  5AQ9 A;  4GCZ A;  4DXC A;  5FI7 A;  3ZFZ A;  2EWV A;  5AVE A;  1ES4 A;  4Y3I A;  3EOI A;  3IBR A;  3UE1 A;  2I9V A;  3WWX A;  4MBH A;  4X69 A;  1N9N A;  4GLQ A;  5DTS A;  2K2N A;  1DY6 A;  1U60 A;  1W8Q A;  1ERO A;  5HZH A;  1PI4 A;  3CPT B;  2XDM A;  5F68 A;  5U47 A;  4B93 A;  4B4Z A;  4XUX A;  2WZX A;  5A93 A;  3ZNT A;  3OBF A;  1DP8 A;  2G2W A;  1OJ5 A;  1S1Y A;  5M18 A;  2OWJ A;  1PZO A;  5E2E A;  4R6L A;  4MLL A;  3SZT A;  4HJ3 A;  4MNR A;  4CJN A;  4WZ5 A;  3BY9 A;  3LYX A;  3IQA A;  5E2G A;  1TD5 A;  4C6Y A;  1PIO A;  1BZA A;  3VOZ A;  4ETX A;  2HDS A;  4JPM A;  3OLO A;  3V50 A;  1SDN A;  2HF6 A;  2Y2O A;  4WEJ A;  1GSX A;  4G3V A;  4EQI A;  5TGF A;  2ZMV A;  2L1M A;  1ALQ A;  1MWU A;  3Q7V A;  3C8C A;  1Q2Q A;  4KZ8 A;  2JKR M;  3IF5 A;  2P74 A;  3N8S A;  1K4F A;  5AQ7 A;  4HP9 A;  4LCM A;  3WRZ A;  3Q7V B;  3A0V A;  5FQI A;  2J80 A;  2H10 A;  5J3W A;  1OT9 A;  5E2H A;  3C7U A;  4EEU A;  4LRY C;  3D9Y A;  4JGO A;  2HP9 A;  3F1N A;  3QP4 A;  1I5Q A;  2V20 A;  1XX2 A;  1CQA A;  1HTZ A;  1MWS A;  5TBM B;  2Q9M A;  4X1M A;  1OME A;  4WZ5 C;  4B88 A;  1XJ6 A;  4KG5 A;  3MXR A;  1P0Z A;  1PFL A;  3ZG8 B;  1KDS A;  4KUO A;  4Q8I A;  2PHY A;  1IYP A;  4OPZ A;  5CTN A;  3T1Q B;  2QYB A;  3QNC A;  4IBR A;  2XD5 A;  3UE0 A;  5EVI C;  5GHY A;  3QP8 A;  4WMC A;  1OTD A;  3ZG9 B;  4H6J B;  2QZ6 A;  3HLW A;  5CHU A;  5F83 A;  3LIB A;  2H28 A;  3IBJ A;  3W4P A;  5CX7 A;  5J8X A;  2PBY A;  1EI5 A;  2W3E A;  2W1T A;  4KG2 A;  3UPN A;  4LV2 A;  1EW0 A;  3SS4 A;  3AGF A;  4RA7 A;  5CXW A;  5EUA A;  2GJ3 A;  1K0K A;  2Y2P A;  3UPP A;  3G34 A;  3WS0 A;  1H5X A;  1IYO A;  4EBP A;  3DTI A;  3A0S A;  1W63 Q;  4QD4 A;  5DF7 A;  3M2J A;  4WL9 A;  4ZJ2 A;  5EVI B;  5HAI A;  2RL3 A;  1XJ2 A;  4ARZ B;  5F1F A;  4WM9 A;  4R23 A;  1NWZ A;  4EES A;  2Y2H A;  2Y8H A;  2VGJ A;  3O86 A;  3IHA A;  1K54 A;  4XUZ A;  3HL9 A;  1QME A;  4O7D A;  5DKL A;  3C7V A;  5IHV A;  3T1R A;  3LGO A;  4I3J A;  3SW1 A;  3M2K A;  4OON A;  3LR0 A;  4PM8 A;  3TW8 A;  5F6A A;  3RXX A;  1CEG A;  1TDG A;  3IF6 B;  1L0D A;  2ZLY A;  3EEH A;  4IUH A;  5CHM A;  2XGN A;  1PWG A;  1CI8 A;  1GA0 A;  1KDW A;  1LLB A;  3T1X A;  1BLH A;  1Y4O A;  1NJ4 A;  4WEK A;  4KZB A;  2XD1 A;  5E2F A;  2J9P A;  1T1A A;  1K6S A;  4N92 A;  3CLO A;  1OT6 A;  1KGE A;  3H9W A;  2ZM0 A;  3G6O A;  3HVF A;  1S67 L;  5IU1 A;  3RFB A;  2A2L A;  1YAX A;  3NDG A;  1DP6 A;  2R9X A;  4OOL A;  4X1L A;  1I2W A;  4GKU A;  2XRN A;  1BSG A;  1GHI A;  3IWQ A;  2ZL1 A;  4RYE A;  5EOE A;  3T50 A;  1G5U A;  2GDN A;  3HJI A;  5KZH A;  1NXY A;  4K0W A;  4K08 A;  1T1B A;  1W63 M;  4G3K A;  3N8L A;  3L9K A;  1OTA A;  1KOU A;  1FCM A;  1H8M A;  5FQK A;  1WYB A;  3VP3 A;  4QWO A;  3ITA A;  3EQV A;  2VKS A;  2OLU A;  1XGJ A;  5LBR A;  3RXW A;  2Q0O A;  1FCN A;  3ULF A;  1JTG A;  1Y54 A;  2YKF A;  3W4O A;  1AWI A;  2V8C A;  1YLW A;  2WUQ A;  4F3L B;  4I38 A;  1LL9 A;  3KYE A;  2XFS A;  1MWR A;  5HW3 A;  2WAD A;  1GHM A;  5FA7 A;  3P09 A;  4IUK A;  4NXG A;  2O99 A;  4LV0 A;  1D1J A;  2XSS A;  3NBL A;  1GCE A;  2PT7 A;  4DDY A;  5L07 A;  1L3L A;  2WAF A;  4OVD A;  2ZQ9 A;  1V9Z A;  2LB9 A;  2WAE A;  1SZV A;  4Q0H A;  4HY8 A;  1T19 A;  4XT2 B;  3AGE A;  3T4Q A;  5IT5 A;  2HDQ A;  2QHK A;  3PHY A;  3GVB A;  3Q07 A;  1JVJ A;  5EM1 A;  1S4S A;  4WZ4 A;  2L0W A;  4KUK A;  4FH2 A;  4O0P A;  1NRJ A;  3ZNY A;  2WGI A;  1YLZ A;  4JXS A;  4R3A A;  1TEM A;  2OOL A;  2EWW A;  1EWZ A;  3KSH A;  1ZG4 A;  3JPU A;  5HSQ A;  2VK3 A;  3DWK A;  1WE4 A;  3OPP A;  4E04 A;  1ZC2 A;  2BLS A;  3GDI A;  1FOF A;  3SOI A;  3T4T A;  3P01 A;  1VQQ A;  4OLD A;  1GSV A;  1GHP A;  4ZBE A;  4LCL A;  4C3Q A;  1G6O A;  1K25 A;  3PTE A;  1ODV A;  2IWD A;  1RGY A;  2QWS A;  3OCN A;  1MY8 A;  1KE0 A;  5CHJ A;  2DMW A;  4CLC D;  3PBN A;  5CGX A;  3LY4 A;  5FI6 A;  3NCK A;  3O88 A;  3BLM A;  3HLG A;  4KQD A;  4JXG A;  4YOF A;  4FCF A;  2X02 A;  5K5B A;  5M1A A;  3SH9 A;  3BEB A;  4NKP A;  1MWT A;  3LY3 A;  4S2P A;  1JWP A;  4II7 A;  4CPK A;  3G31 A;  3IWI A;  3E98 A;  3K2N A;  3HUO A;  2M7V A;  3MFX A;  3ZG0 A;  3MMH A;  3VV4 A;  2YKH A;  3G2Y A;  3HLD A;  5JYO A;  5L2F A;  1LSV A;  1LT0 A;  2J3T C;  2ZMA A;  2ZC3 B;  4HI4 A;  4E3M A;  3NOU C;  2P9V B;  1VHM A;  3SH8 A;  5F82 A;  4GJ4 A;  1FIL A;  4OP8 A;  3TSG A;  4HJ6 A;  3QP5 A;  1S4R A;  1ZG6 A;  1VB6 A;  1L0F A;  2JCH A;  3VP1 A;  2WZZ A;  5EM0 A;  2A49 A;  4QPR A;  4E3I A;  4BEN A;  2NUT C;  1JTD A;  1K6R A;  2EFX A;  3ZHH A;  4GDB A;  1HVB A;  1M6K A;  5HL6 A;  4I3A A;  1FSY A;  1T1C A;  4EXO A;  2C5W B;  3OC2 A;  2PBD P;  1VEU B;  1ERM A;  1YT4 A;  4Y0T A;  1GSW A;  3Q81 A;  1KE4 A;  1NYM A;  1PRQ A;  5FDH A;  1SDE A;  2KX6 A;  5EVE A;  3VMA A;  1ZHH B;  3CAX A;  1LHY A;  1TS8 A;  2OWH A;  2B95 A;  4YFM A;  4DRT A;  2ZC7 A;  3M6H A;  4BLM A;  4BD1 A;  2Z6C A;  3IX3 A;  2PD7 A;  4HBT A;  4WN5 A;  2HJE A;  3V5M A;  1STZ A;  3NI9 A;  1UWP X;  2ZC5 B;  2XK1 A;  2JHE A;  5HD5 A;  2BTF P;  4Y2F A;  2QMI A;  2VV6 A;  5L10 A;  4Y0U A;  3UNW A;  3OPL A;  4LEN A;  2Y2L A;  1G28 A;  1PW1 A;  3JVV A;  4QB8 A;  5DTK A;  4IED A;  3EGX C;  4P87 A;  1O07 A;  3HLF A;  4JGR A;  5EPH A;  3N4I A;  1XGI A;  3NIA A;  4H6J A;  4PHT A;  3VP0 A;  3IS2 A;  3LIC A;  3VOL A;  5GLA A;  3NEC A;  4ESP A;  4GS9 A;  4PM5 A;  5CER A;  1JWZ A;  2DRW A;  3TOI A;  4DE3 A;  2NUP C;  3D72 A;  4YNR A;  4GD8 A;  5FAS A;  1TDL A;  2JC7 A;  4JXV A;  1L0E A;  3MFD A;  5GLB A;  3C5A A;  3W8K A;  2Y2J A;  4S2J A;  4AFI A;  2EX6 A;  3S7N A;  4OLG A;  5MC7 A;  2XQZ A;  3ZDJ A;  3DTM A;  4I39 A;  3C38 A;  3MR0 A;  5DTT A;  4DE2 A;  4NG2 A;  4PPR A;  4JF6 A;  4KEN B;  2EX8 A;  4UA7 A;  3C2W A;  5M19 A;  1IKI A;  3PAE A;  3TRC A;  3T4K A;  3UB7 A;  5CTM A;  4Y0O A;  1K38 A;  3ZGA B;  1N9O A;  3LR3 A;  2PDR A;  1NLY A;  3BM6 A;  1FIK A;  1XP4 A;  3MS6 A;  4ME4 A;  5C5K A;  4CLC B;  3MQ0 A;  2Y55 A;  1DP9 A;  3E2L A;  1FQG A;  4DN0 A;  4DE1 A;  4UAA A;  1JNU A;  1IOU A;  3BFE A;  1O7E A;  4UHU A;  1P9W A;  3W2Z A;  2G7U A;  1ONH A;  4U3T A;  4DDS A;  2HP6 A;  4R1G A;  1P9R A;  1PYY A;  4E6W A;  3ICY A;  4WBG A;  4D2O A;  3TJZ C;  3EQU A;  4UQI M;  1BLS A;  5GL9 A;  1SKF A;  2P9V A;  3LIE A;  4EBN A;  1J9M A;  1YMX A;  2QKP A;  1TS0 A;  4IJG A;  1VM1 A;  4D60 A;  3LIA A;  4WMC D;  4OP5 A;  3BFC A;  4WUJ A;  3JVU A;  3LIF A;  4CLC C;  5DVA A;  3FKV A;  4BWI A;  4E6X A;  2H0T A;  3VOY A;  4PAU A;  2OSU A;  4ZRR A;  2B02 A;  4EER A;  4MN6 A;  2Y79 A;  1W5D A;  1ACF A;  5F5Y A;  5HDD A;  4RQ9 A;  1I2S A;  1H3Q A;  1OJG A;  2QJ7 A;  2FH5 A;  1H8Z A;  4S2I A;  4NXF A;  4LV3 A;  4FH4 A;  1C3B A;  4HNB A;  2P7J A;  4N9L A;  2JKG A;  4X25 A;  5E43 A;  3K3D A;  1OTI A;  3B3X A;  3PR6 A;  5FQJ A;  3WS5 A;  4HES A;  4EV4 A;  4E3L A;  5TBM A;  1FR6 A;  2GNX A;  2B5R A;  4HEF A;  1RCJ A;  2VGL S;  2PR6 A;  4E3N A;  1L2S A;  3S7P A;  3VP2 A;  5FAT A;  1JWV A;  2PU4 A;  4IBX A;  4NK3 A;  3BFG A;  1S66 L;  5F69 A;  5EEC A;  3GQZ A;  3DTE A;  3CUE A;  3G4P A;  2XF3 A;  1K54 C;  3V3R A;  5HPF A;  4XT2 A;  2XLN A;  4LGW A;  1RGZ A;  3HRE A;  3IS2 B;  2QJ5 A;  3Q7Z A;  2OLV A;  3CWF A;  2EXA A;  3SH7 A;  3LI8 A;  1CI9 A;  4EEP A;  4P6Z S;  4MN5 A;  1H0M A;  1NZU A;  3ITB A;  2ZD8 A;  4MCW A;  1ESI A;  4PM7 A;  3LEZ A;  3LEQ A;  4OPY A;  4YIN A;  3OCL A;  1YLP A;  2Y2I A;  1XJ3 A;  2E8J A;  1S6R A;  1KVM A;  3DWZ A;  2CMN A;  5I94 A;  1IEL A;  3FPW A;  3LR4 A;  3OZH A;  4NXE A;  4JGP A;  3F1O A;  3E2K A;  2V1B A;  3G30 A;  4B9O A;  2XFT A;  4JKT A;  3T4S A;  2BAS A;  2V8F A;  4E3K A;  3M6B A;  1XFN A;  2O9C A;  2XR0 A;  4NET A;  4ZAM A;  3CPT A;  2HGV A;  2PYP A;  4R38 A;  2ZC6 B;  3KYQ A;  3S7O A;  4Z9Q A;  2IA2 A;  4GW9 A;  1MBL A;  3WS2 A;  5FL3 A;  4O01 A;  3FZC A;  1AXB A;  4HHD A;  3C30 A;  2MJ6 A;  2ZJ9 A;  1PNE A;  4DJ3 A;  3AGD A;  5DFX A;  5DF9 A;  3A3D A;  4GN2 A;  3L7H A;  5EV0 A;  2R78 A;  4QHC A;  2K7S A;  4R4R A;  3QHY A;  4MDZ A;  4EW7 A;  3T1S A;  2JKT M;  4DMZ A;  2V0W A;  3NY4 A;  1FCO A;  5FQ9 A;  4JF4 A;  2Y4A A;  4ETZ A;  2ACG A;  5IS1 A;  3IXB A;  1NZO A;  1ES5 A;  1W8Y A;  4MMN A;  4BJP A;  5HFO A;  2ZL1 B;  3PAG A;  4BD0 A;  3CG5 A;  4KZ3 A;  3IXG A;  2OAP 1;  1LI0 A;  1YSQ A;  5FDS A;  3UO9 A;  4X55 A;  4DF6 A;  1LL5 A;  5HAP A;  4Y5F A;  4L9F A;  2LB5 A;  3F1N B;  3A3E A;  3V3S A;  4EUV A;  3H82 B;  4PM6 A;  3T4J A;  3QP6 A;  4OPQ A;  3BYD A;  1XJ4 A;  3A0R A;  2P04 A;  3MJQ A;  4PM9 A;  2EXB A;  3IH8 A;  4OOM A;  4L9E A;  4F3L A;  5J4E A;  2I72 A;  4MBK A;  1YLJ A;  4GD6 A;  3LFV A;  5BOH A;  3LCE A;  4ZJ1 A;  5TR7 A;  1YLT A;  3E4Q A;  2EFU A;  4C75 A;  4UA9 A;  1BUL A;  3ZYT A;  3NOT C;  3A3F A;  2JBF A;  1N9B A;  4BMW A;  4PMA A;  3ZG5 A;  3VSL A;  3S7Q A;  3LR5 A;  2XRO A;  4S2M A;  3VE4 A; 
#chains in the Genus database with same CATH homology
 4Q0I A;  1OTD A;  3BY8 A;  4JGR A;  1TS7 A;  4H6J B;  1P97 A;  1MKM A;  3LIB A;  2O0Y A;  4LLO B;  2H28 A;  3IBJ A;  2L4R A;  5CX7 A;  2A24 B;  2W3E A;  4H6J A;  4PHT A;  2XA7 M;  4BBU A;  2OAQ 1;  3IS2 A;  2W1T A;  2O9B A;  3LIC A;  3VOL A;  1EW0 A;  4LRX C;  3MF0 A;  3UB8 A;  4GS9 A;  5L8M A;  2JKT I;  3PYP A;  3LI9 A;  4P6Z M;  2NUP C;  3D72 A;  2GJ3 A;  4YNR A;  3EWK A;  2B18 A;  3KO6 A;  3A0S A;  1W63 Q;  4R70 A;  4O8G A;  3V67 A;  4WL9 A;  2HJ9 C;  4AFI A;  3S7N A;  1XJ2 A;  4ARZ B;  5MC7 A;  2HV1 A;  1NWZ A;  3FPV A;  3PBQ A;  4MN7 A;  4DJ2 A;  4I39 A;  4EES A;  2Y8H A;  3C38 A;  3MR0 A;  4Z1W A;  4BBT A;  1IFQ A;  3RTY A;  5DKL A;  3KSI A;  2V9A A;  4HH2 A;  3C2W A;  2VGL M;  5HDS A;  4I3J A;  3SW1 A;  3LR0 A;  4WEL A;  2KDK A;  3TRC A;  3TW8 A;  5F6A A;  3T4K A;  1N9L A;  3BJN A;  3UB7 A;  5DFY A;  4NXB A;  2W3H A;  4HJ4 A;  3EEH A;  1N9O A;  4IUH A;  3LR3 A;  2PDR A;  1NLY A;  5I5L A;  4ME4 A;  5C5K A;  4CLC B;  3MQ0 A;  2J3W A;  4EU0 A;  1DP9 A;  1OTE A;  3U2A A;  1S1Z A;  5A8B A;  1ZTU A;  4WEK A;  4DN0 A;  1JNU A;  1IOU A;  2VJW A;  1T1A A;  1P9W A;  3H7W B;  3O5Y A;  3KX0 X;  3W2Z A;  2G7U A;  1P9R A;  3PBO A;  3CLO A;  3ICY A;  2V0U A;  3R4K A;  5AJG A;  1OT6 A;  3NOP C;  3EQU A;  3TJZ C;  3H9W A;  3G6O A;  4UQI M;  1MC0 A;  1S67 L;  2WKR A;  1DRM A;  1MZU A;  5IU1 A;  1Y28 A;  5J7E A;  3RFB A;  2A2L A;  3BW6 A;  3LIE A;  1YAX A;  3LID A;  3KSF A;  1DP6 A;  2QKP A;  1TS0 A;  2M7U A;  3R7W A;  2VLG A;  2W3D A;  4IJG A;  4OOL A;  2VV7 A;  2O9A A;  4L0L A;  2XRN A;  3LIA A;  1F5M A;  2GZA A;  5EFW A;  4KQO A;  3E4P A;  2W3G A;  4L9G A;  4PKY G;  3MXQ A;  4UEY A;  4WUJ A;  3JVU A;  3LIF A;  3T50 A;  1YKD A;  5KSH A;  4CLC C;  5HWW A;  3MQQ A;  3B33 A;  4HP4 A;  4BWI A;  2KLI A;  3HJI A;  5HWV A;  4PAU A;  4ZRR A;  2B02 A;  4EER A;  4MN6 A;  3NJA A;  5HD3 A;  3ZQ5 A;  2Y79 A;  4K08 A;  5HWT A;  1T1B A;  1W63 M;  4G3K A;  1OTA A;  1KOU A;  3CUE C;  1H8M A;  2D01 A;  5F5Y A;  4UQI S;  5HDD A;  4RQ9 A;  3UMD A;  4FSF A;  5TJJ A;  1H3Q A;  1OJG A;  2QJ7 A;  2VV8 A;  2VKS A;  3EQV A;  2FH5 A;  5LBR A;  1UWN X;  4NXF A;  4GHI B;  5AVF A;  3ULF A;  4HNB A;  2P7J A;  2YKF A;  3H82 A;  3RH8 B;  3UB9 A;  3KYZ A;  3UE3 A;  4YWZ A;  3HJK A;  3K3D A;  5DKK A;  1OTI A;  4F3L B;  3PR6 A;  5HPI A;  4I38 A;  1LSX A;  3CI6 A;  5TBM A;  4IUK A;  2GNX A;  4NXG A;  2INW A;  2O99 A;  4HOI A;  3K3C A;  5KIZ A;  2JN7 A;  2VGL S;  3B42 A;  4CQH A;  2PR6 A;  2XSS A;  3S7P A;  2PT7 A;  2VZW A;  1V9Z A;  2LB9 A;  4HH3 A;  3E0Y A;  4WLA A;  4Q0H A;  4IHQ A;  4HQA A;  1S66 L;  4HY8 A;  1T19 A;  5F69 A;  3EGD C;  2W1T B;  3B47 A;  4XT2 B;  5IT5 A;  1X0O A;  3T4Q A;  3UME A;  3PXP A;  4FOF A;  1OTB A;  2QHK A;  3CUE A;  2W0N A;  3PHY A;  2VEA A;  3KSG A;  4GS9 B;  1S4S A;  5HPF A;  2M1C A;  2L0W A;  4XT2 A;  4KUK A;  4CLC E;  1WA9 A;  2D02 A;  1NRJ A;  4O0P A;  1UGU A;  2Z6D A;  2A24 A;  3IS2 B;  4R3A A;  1F9I A;  2W27 A;  4I5S A;  2PYR A;  3PBS A;  1LL8 A;  5DJU A;  2QJ5 A;  2ZOH A;  1BYW A;  4LPZ A;  2W1R A;  2OOL A;  3CWF A;  2EWW A;  3KSH A;  3UB6 A;  5G4Z A;  1TF1 A;  3LI8 A;  4EEP A;  4P6Z S;  4MN5 A;  5HSQ A;  4NEE D;  3EEA A;  4E04 A;  4EQ1 A;  2FZ0 A;  3GDI A;  3BQ8 A;  2GX5 A;  4MCW A;  3T4T A;  3P01 A;  3BQA A;  1GSV A;  2JKR I;  2KOI A;  4I3I A;  2ZMF A;  2ZOI A;  4EET B;  1NLZ A;  1G6O A;  2P08 A;  4PKY A;  3LUQ A;  1LSW A;  2J3T D;  3OCL A;  3T4L A;  4ARZ A;  1ODV A;  4GCZ A;  2XA7 S;  1XJ3 A;  2EWV A;  5AVE A;  1D7E A;  2WKP A;  2QWS A;  1XFQ A;  3OCN A;  3F1O B;  2CMN A;  4Y3I A;  3EOI A;  2DMW A;  4CLC D;  3FPW A;  3LR4 A;  4NXE A;  3FC7 A;  3PBN A;  2W3F A;  3IBR A;  2I9V A;  4JGP A;  3F1O A;  2V1B A;  4B9O A;  4JGQ A;  3T4S A;  2BAS A;  1N9N A;  4GLQ A;  2VA0 A;  4KQD A;  5G4Y A;  1XFN A;  2O9C A;  4YOF A;  3PBR A;  5K5B A;  4NKP A;  2K2N A;  3TE8 A;  3FG8 A;  2HGV A;  4M4X A;  3GEC A;  4II7 A;  2PYP A;  4R38 A;  3E98 A;  3KYQ A;  3K2N A;  3S7O A;  4CLC A;  2IA2 A;  2M7V A;  5HZH A;  4GW9 A;  3MFX A;  5F68 A;  4B93 A;  3MMH A;  3VV4 A;  2YKH A;  3OBF A;  4O01 A;  5FL3 A;  1DP8 A;  4HHD A;  3C30 A;  1OJ5 A;  1D06 A;  2MJ6 A;  1S1Y A;  3H7W A;  4DJ3 A;  3E4O A;  5DFX A;  3DBA A;  2OWJ A;  5DF9 A;  4R6L A;  3OOV A;  4HJ3 A;  1LSV A;  2R78 A;  1LT0 A;  2J3T C;  2K7S A;  3BY9 A;  3LYX A;  4HI4 A;  3NOU C;  4MDZ A;  1OPX A;  1VHM A;  4EW7 A;  3VE3 A;  1TD5 A;  2JKT M;  4GJ4 A;  4DMZ A;  2V0W A;  4ETX A;  4HJ6 A;  4HIA A;  4ETZ A;  1S4R A;  3R7W B;  1VB6 A;  4LRZ E;  1F98 A;  5IS1 A;  3OLO A;  2HF6 A;  4QPR A;  4WEJ A;  1GSX A;  2NUT C;  4G3V A;  4MMN A;  4BJP A;  1V9Y A;  3MQO A;  2ZMV A;  2L1M A;  5HL6 A;  3NHQ A;  2PR5 A;  4I3A A;  2OAP 1;  1YSQ A;  3C8C A;  3P7N A;  1T1C A;  4EXO A;  3OC2 A;  3D3O A;  2JKR M;  2EA9 A;  4HP9 A;  1GSW A;  2K31 A;  3A0V A;  4BBV A;  2J80 A;  4GHI A;  4Y5F A;  4Q0J A;  4L9F A;  2PD8 A;  5J3W A;  2LB5 A;  4G3W A;  3F1N B;  2KX6 A;  1OT9 A;  1T18 A;  4EUV A;  1ZHH B;  3CAX A;  3H82 B;  4EEU A;  4LRY C;  3T4J A;  2V1A A;  1XJ4 A;  3A0R A;  2P04 A;  3MJQ A;  4JGO A;  1TS8 A;  2OWH A;  3F1N A;  4OOM A;  4L9E A;  1YSP A;  2VX8 A;  4F3L A;  5J4E A;  3LFV A;  5DJT A;  3T4O A;  2WKQ A;  1TS6 A;  3HCY A;  4WF0 A;  5TBM B;  3F1P A;  2Z6C A;  2PD7 A;  3E4Q A;  4WN5 A;  1XJ6 A;  2HJE A;  1STZ A;  1P0Z A;  1UWP X;  5HD5 A;  2JHE A;  3F1P B;  4KUO A;  3ZYT A;  3NOT C;  4Y2F A;  5HDC A;  2VV6 A;  2PHY A;  3CIT A;  3PBT A;  2QYB A;  1G28 A;  4BMW A;  3BWL A;  3S7Q A;  2ZBB A;  3JVV A;  3LR5 A;  3UE6 A;  2XRO A;  3VE4 A;  3EGX C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...