4L9GA

Structure of ppsr n-q-pas1 from rb. sphaeroides
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
250
structure length
250
Chain Sequence
PSLAPDLVRDLIATAADISLLVSQEGVVREVMANPHHPSFGQLSEWEGRPLEEVLTAESVAKFRLRSEGLEPGRGSVAVELNHIDPRSFEFPIRYILHRLPADRSILMLGRDLRPIAEVQQQLVAAQLAMERDYETQREMETRYRVVLDVSRDPMVLVSMSTGRIVDLNSAAGLLLGGVRQDLLGAAIAQEFEGRRRGEFMETMTNLAATESAAPVEVLARRSQKRLLVVPRVFRAAGERLLLCQIDPAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, PpsR
publication title Multi-PAS domain-mediated protein oligomerization of PpsR from Rhodobacter sphaeroides.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Transcription
total genus 83
structure length 250
sequence length 250
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13188 PAS_8 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4l9gA02
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4l9gA01
3UB8A 4E04A 1D7EA 4I3JA 3LIDA 3H9WA 3UE6A 2L4RA 4HI4A 1N9OA 3ZQ5A 4JGRA 1UGUA 3CAXA 5HWTA 1OT9A 2PYPA 5F6AA 3KX0X 4H6JA 3UMEA 1XJ6A 4I3AA 4RQ9A 3H7WB 1Y28A 4LLOB 1JNUA 2Z6CA 3LI8A 1TS7A 4XT2A 4EEUA 5DJTA 2J80A 3LIAA 3EEHA 1OJ5A 2V1BA 4HP9A 3GDIA 1S4RA 3IS2A 5AVFA 5AVEA 2BASA 1TS8A 5J4EA 1G28A 4DJ3A 1F9IA 3A0SA 4HH3A 2QJ5A 4HJ4A 1V9ZA 4R3AA 2PR5A 4HHDA 4HP4A 3LIBA 3LYXA 3ULFA 3K3DA 1S67L 4L9FA 5HDSA 3PYPA 4GS9A 3A0RA 3MJQA 2INWA 1MZUA 1T1BA 1LSXA 1TS6A 4EXOA 2V0WA 1P97A 3NHQA 3F1NA 4F3LA 1ODVA 4H6JB 3ICYA 4WF0A 2H28A 4GHIA 5HWWA 4JGPA 4DJ2A 2CMNA 1N9LA 4XT2B 4EW7A 3BY8A 3G6OA 4HOIA 4BBVA 3HJIA 2PYRA 4WUJA 2V0UA 3IS2B 3T50A 2I9VA 2OWJA 3E4QA 3NOPC 3BY9A 2ZOHA 1OTIA 1OTDA 1N9NA 2VLGA 4LPZA 1S1YA 2L0WA 3H82A 1DP8A 4GCZA 4HH2A 4GS9B 1XJ3A 4L9GA 4HIAA 3PHYA 4R6LA 1OTEA 4EQ1A 5IU1A 2P7JA 3F1NB 5I5LA 4F3LB 1LL8A 3VE4A 4MN6A 1OJGA 2OWHA 4GHIB 2R78A 2Z6DA 2D02A 3RTYA 3E4PA 3NOTC 3CLOA 5KIZA 2KDKA 2VV7A 1LSVA 2GJ3A 4HJ3A 4I38A 4LRYC 3FG8A 4GW9A 2V1AA 3LIFA 3F1OA 2PD8A 1T1CA 3MQOA 5F5YA 1UWNX 5G4YA 4EEPA 3H82B 5TBMA 2WKRA 2QWSA 4HQAA 1XJ2A 4L9EA 2OOLA 3EWKA 4JGOA 5J3WA 2D01A 2L1MA 1NWZA 4I5SA 2JHEA 2PHYA 5DKKA 3UB6A 1BYWA 1OT6A 1XFQA 3NOUC 3NJAA 5HSQA 3F1PA 2M1CA 5DJUA 1XJ4A 4R38A 3OLOA 2ZBBA 2VEAA 1X0OA 3C2WA 4LRXC 3D72A 3LIEA 3A0VA 2HV1A 3LICA 1DRMA 2W0NA 1LT0A 5EFWA 2KX6A 4EESA 3HJKA 1GSVA 1D06A 1GSXA 4I3IA 5F69A 2A24A 3F1OB 2PDRA 3VOLA 1WA9A 1P0ZA 4BBTA 3VE3A 2JN7A 1LSWA 3GECA 5TBMB 5HD3A 3BWLA 5J7EA 4EERA 4YWZA 1DP6A 5HD5A 3MQQA 4WLAA 4WN5A 4PKYA 4WL9A 1UWPX 3F1PB 3P7NA 4HNBA 2QKPA 1EW0A 4MN5A 4B9OA 3MFXA 2ZOIA 4M4XA 3UB7A 4BBUA 4I39A 5HZHA 1DP9A 1KOUA 1OTBA 2B02A 2QJ7A 4HJ6A 4HY8A 1OTAA 4NXEA 3FC7A 2A24B 2YKHA 3LI9A 4NXBA 2QHKA 4KUKA 1F98A 5HDCA 2V9AA 4LRZE 1VB6A 5DKLA 4KQDA 1S1ZA 5A8BA 1T18A 4PKYG 5G4ZA 4KUOA 3CWFA 1T19A 2VV6A 3RH8B 1V9YA 3H7WA 1T1AA 4JGQA 2YKFA 2VV8A 5F68A 5IS1A 3K3CA 3E4OA 2EA9A 3C8CA 2PD7A 2K7SA 3MR0A 1GSWA 1XFNA 1S66L 3UMDA 1TS0A 1S4SA 4NXGA 4NXFA 4R70A 2PR6A 3LUQA 4K08A 3B33A 5HDDA 3IBRA 2WKQA 2W27A 3UB9A 5HWVA 3MXQA 3SW1A 2WKPA 4EETB
chains in the Genus database with same CATH superfamily
4U3TA 1IYOA 3C38A 1E3UD 1GHIA 4E04A 5EVEA 2XGNA 1YMSA 4JKTA 5M1AA 4KENB 2L4RA 4OLGA 3QP5A 3ZQ5A 3KYQA 1UGUA 5HWTA 2ZQ9A 2PYPA 3KX0X 3DTEA 5C5KA 3C4OA 1W79A 1JVJA 4ZJ3A 3UY6A 4RQ9A 2RL3A 3H7WB 5AQ9A 5CGXA 2MJ6A 4LLOB 1YT4A 1N9BA 3UDXA 3LI8A 5CRFA 5HAPA 1TS7A 2Y2IA 2FH5A 3SOIA 4IBRA 1DJBA 3ZCZA 5GHYA 5FEFA 3LIAA 3N8SA 4IVIA 3QP6A 4ZTKA 4MEZA 3EEHA 2W1RA 3GDIA 1S4RA 5AVFA 4CLCD 1BLCA 2ZM8A 2B5RA 1ESIA 4JF5A 2BASA 1BSGA 4S2KA 5L10A 2XQZA 1YLYA 3E98A 1G28A 4HH3A 3VP4A 4WMCD 4HJ4A 1V9ZA 2WK0A 4PM9A 4E3OA 4B93A 2OSUA 4HP4A 3LYXA 5FSRA 2QYBA 4ESPA 3HLGA 2ZQ7A 5FQQA 4GS9A 1ZC2A 4MBFA 3JPUA 5FQIA 3A0RA 2Y55A 4DDSA 1T1BA 1LSXA 3C5AA 4EXOA 1P97A 1CK3A 2VX8A 5FDHA 5FDSA 1ODVA 2FFYA 3CITA 4N1XA 1ALQA 1MWSA 4DKIA 3RJUA 4O8GA 4GHIA 3CMZA 4XUXA 4JBFA 4E6WA 4CLCE 4K0WA 4XT2B 3BY8A 3G6OA 3HLCA 3MFDA 2W1TB 4LFUA 5FATA 4EBLA 3NOPC 1U60A 5L2FA 4ME4A 5HX9A 2ZC7A 2ZM2A 2ZM0A 3A3JA 4OOMA 4S2JA 1FQGA 2QMIA 3CJMA 1AXBA 5CHMA 4HH2A 4XXRA 4JLFA 2LB9A 2J3WA 3A3DA 4FCFA 4G3VA 3IHAA 3IXGA 3BECA 2P7JA 1MXOA 2RCXA 1PWDA 4PPRA 4ARZA 5DF8A 4MN6A 3I7JA 2DNSA 4OONA 3CPTA 3BEBA 4KZ6A 4BL3A 2XLNA 4WZ4A 3G2YA 1I5QA 3ZVTA 2EXBA 4PMAA 3FKWA 3NOTC 1VEUA 3EQVA 5KIZA 2KDKA 3B47A 2J9PA 4I38A 2ZC4B 4O01A 3FPVA 5E2GA 4LRYC 2XH9A 1K38A 2PD8A 5FAOA 1IKGA 1OPXA 1ZG6A 4GNUA 3MQOA 4IUHA 3M6BA 3SH9A 2XEPA 3LEZA 2OOLA 4JGOA 3ZDJA 5HAQA 1PI5A 1P9WA 2DMWA 2I72A 3NOUC 3TG9A 3NJAA 3BJNA 5HSQA 1FCNA 3ZYTA 4C75A 5DJUA 1Q2PA 1XJ4A 4R38A 5L07A 2JKFA 4Y17A 1PZOA 2R9WA 2VEAA 3DTIA 3OCNA 4MN7A 4EV4A 3IF6A 4OOYA 1P9RA 1Z6FA 3O88A 2WYXA 5DF7A 3UPNA 3CUEC 1D1JA 1SDEA 3BYDA 2KX6A 2X02A 5FL3A 2BG1A 2EWWA 4JF4A 1NLYA 1GSVA 1D06A 1GSXA 4PM5A 4KZ9A 5HFOA 3IBJA 3G34A 1KE0A 3W4QA 4KZ8A 4GOGA 1P0ZA 4GJ4A 5EM0A 1XGJA 4GLQA 2XRNA 1S6RA 5TBMB 1HTZA 2QPNA 4IHQA 5J7EA 3A3IA 1ZG4A 4EERA 1DP6A 2K2NA 2DRWA 1ESUA 3O87A 3FYZA 1GCEA 3T12B 1UWPX 2AVXA 2QKPA 5EPHA 5CHJA 4DXCA 1ZTUA 3MFXA 4RX3A 2WAEA 2HPBA 1NLZA 1TDGA 2IA2A 1K55A 5KSHA 3C7UA 2Y2GA 5HZHA 1DP9A 4FSFA 2B02A 2QJ7A 3OZHA 4E3JA 1IFQA 1H8ZA 2Z2MB 3MZEA 4R4SA 2VGLS 4Y2FA 3T1QB 3FC7A 2A24B 4OQIA 4AFIA 5CERA 4Y5FA 3W4PA 2OLUA 1FR6A 4HBUA 5GLCA 4ZRRA 1BUEA 4LRZE 3EGDC 3SS5A 4EU0A 4PAUA 3OPRA 4N1HA 2J3TC 1SKOB 2DCFA 3KYZA 3MKFA 5HAIA 3CWFA 1FCOA 2VV6A 2P9VA 3NULA 3PBOA 4JGQA 2PRFA 4U0XA 2XFSA 3IX8A 3HLWA 1FSWA 3V5MA 4R3BA 3BLSA 5EVIC 3HLDA 3L9KA 2J7VA 3E4OA 3C8CA 1G6AA 5EVIB 2K7SA 4C6YA 5EE8A 3RXWA 1TS0A 1S4SA 5IHVA 1BLSA 5EM1A 4NXGA 4NXFA 4JXWA 4RX2A 3LUQA 1OMEA 3OBFA 1XKZA 3B42A 2JE5A 1E4DA 3ZVWA 5EOEA 2Y79A 2W27A 3T4OA 5HWVA 3S7OA 2EX6A 4EETB 2ZLYA 3WS2A 4I3JA 4IVKA 4Y13A 4UA6A 3T4SA 1WYBA 2XSSA 1N9OA 4KG5A 4JGRA 5DTTA 3CAXA 1OT9A 1SDNA 3Q81A 2EX9A 3PTEA 1E25A 2EXAA 3UDFA 5CX7A 1W8QA 2XD5A 5A93A 4D60A 2JKTM 5DJTA 4MDZA 4B4XA 2IWCA 4HP9A 3VOZA 4OOLA 1LL5A 1E3UA 3ZG9B 1MWRA 3OOVA 2M7VA 4DJ3A 1PNEA 1F9IA 3A0SA 4YNRA 1KVMA 4HHDA 4FUWA 3K3DA 3LR4A 4LV1A 4S2LA 5KSCA 2GNXA 2WGWB 1O7EA 3EQUA 3HLEA 1TVFA 2INWA 1ONHA 5F1FA 1MZUA 4D2OA 1XP4A 2V0WA 3VP2A 1IYPA 4QB8A 3F1NA 4FH2A 4F3LA 4H6JB 2HP9A 4WF0A 3TE8A 4CLCA 2CC1A 5HWWA 1MC0A 2E8JA 4DE3A 4DJ2A 2CMNA 1N9LA 3CPTB 3HLBA 2E8IA 5F82A 3MF0A 1H0MA 4BMWA 3HJIA 2VZWA 3IS2B 1CQAA 3GMWA 3E4QA 3VP0A 3HUNA 1VEUB 3T4JA 5FASA 3QP2A 4S2MA 3Q07A 3BY9A 3W8KA 4NETA 5AJGA 1SCWA 4UEYA 5E2EA 3G30A 3H82A 1DP8A 2Y2OA 4OPRA 4DE1A 3SS4A 4KG6A 3S7QA 1XJ3A 3Q7VB 1YQSA 1ES2A 3PHYA 1K56D 1QMEA 3G2ZA 2Y2JA 4X6TA 3BW6A 1CEGA 3OPHA 4EQIA 1NRJA 1ERQA 4BD1A 4P6BA 3S7NA 2VKSA 2OWHA 3IF6C 1IYQA 1LL9A 5G18A 2O99A 3S1YA 1SHVA 3S22A 1NYYA 2XR0A 1YSQA 3MBZA 2ZMVA 2KLIA 4BWIA 1CJFA 4WZ5A 5FQKA 5DTSA 5HARA 4GZBA 3RFBA 5TJJA 4N9KA 3LIFA 5HL6A 2W3DA 3F1OA 5EUAA 1STZA 2X01A 3VOYA 1BTLA 4QD4A 3T1XA 2GZAA 2ZL1B 3KSIA 4G3KA 1NZOA 1ONGA 3EWKA 5J3WA 2D01A 2L1MA 5BOHA 1NWZA 1XA1A 1TD5A 3M2JA 2EX2A 1A0KA 1OT6A 1XFQA 3O3VA 3F1PA 4BL2A 2Y2LA 1K6RA 3OLOA 3TSGA 1CEFA 3JYIA 2VGLM 3C2WA 4Z9QA 2J3TD 3Q7ZA 3BFGA 3D72A 3A0VA 1K4EA 1DRMA 2VA0A 3GV9A 4OPZA 3UE1A 5EFWA 2HDSA 3GR2A 4KQQA 3TOIA 3P09A 2V20A 3JVVA 3U2AA 5F83A 3C4PA 3BM6A 5EVID 3ZGAB 2LB5A 3VOLA 5A91A 1WA9A 2B95A 4BBTA 3VE3A 2JN7A 2Y2HA 4NK3A 5HD3A 4S2OA 4DF6A 4YWZA 3AGEA 4HESA 4WLAA 2IWBA 3MS6A 1W63M 4HNBA 5DVAA 2Y59A 1EW0A 3PBRA 2WUQA 3PBQA 4S2NC 3NIAA 4LV3A 2ZOIA 4M4XA 4UAAA 4O7DA 1JWPA 2H0YA 4IUKA 4OH0A 1ERMA 5CTNA 3V3SA 2BTFP 2C5WB 4MBKA 4UQIS 5FQ9A 4HJ6A 2M7UA 4RVAA 4YFMA 4OPQA 1OTAA 1H8YA 3QP4A 1G68A 5GL9A 2H10A 4E3MA 4R4RA 2KOIA 4E3LA 4GN2A 5DF9A 3IWOA 3LR0A 4K0XA 3E0YA 1PRQA 3PBTA 1NRFA 1F98A 5HDCA 2V9AA 5CHUA 3UDIA 1SZVA 1JTDA 3KSFA 1T18A 3KO6A 4DMZA 5HPFA 1RCJA 2WZZA 3NECA 4KUOA 1G5UA 3RH8B 1V9YA 3K2NA 4Q0JA 3H7WA 1T1AA 4FD8A 4EBNA 3BFEA 3Q1FA 4UHUA 2XD1A 4JXGA 2Y4AA 4P0MA 1Y54A 4LENA 3E2KA 2ZMAA 1FR1A 5FAPA 1C3BA 3MR0A 2G7UA 4S2PA 5MC7A 2Q9MA 3GRJA 2B18A 3R4KA 5HPIA 4DRTA 1VM1A 3AGDA 4N92A 5FEGA 3N6IA 5HDDA 1MKIA 2Z2LB 1XPBA 4PM6A 2BLSA 2C6WB 5DFYA 3WS0A 3NDEA 1S0WA 1VETB 5CTMA 1G6OA 2W3EA 3H9WA 3UE6A 2O9BA 4HI4A 1ZHHB 3QNBA 2WKEA 3MXRA 5F6AA 4I3AA 1MKMA 1Y28A 1MBLA 2UWXA 4YOFA 3EGXC 3Q82A 2HJEA 2A49A 3HLFA 4XT2A 4WBGA 3WS4A 2J80A 3AGFA 3HREA 3FZCA 3BQAA 1OJ5A 5JYOA 5AVEA 1K57C 2W1TA 1GHMA 1I2SA 3UPOA 5GLDA 3ZG0A 2WKIA 2OLVA 4EWFA 4EUVA 1L0FA 1TS8A 5J4EA 2HDQA 1NYMA 3IXHA 2QJ5A 3GSGA 1JWZA 4NEED 5A90A 5AQ7A 3LIBA 4CQHA 1PFLA 3NCKA 1LI0A 4L9FA 3QNCA 1TF1A 5HDSA 3PYPA 1F2KA 4OP5A 4P6ZS 2J8YA 1VQQA 3KSGA 4XUZA 1TS6A 4ZDXA 1PW8A 2O0YA 4O0PA 3NC8A 1KDWA 2HZ5A 4X68A 3V67A 3VSKA 4R3JA 3ICYA 5FA7A 5GLAA 4CPKA 5GHXA 3ITAA 4IBXA 2H28A 1HLUP 3N8LA 1M40A 4MNRA 1ACFA 3VP1A 4NKPA 3V39A 4JGPA 2V1ZA 3LCEA 2QZ6A 4ZBEA 3P01A 4QJGA 4HOIA 3VP3A 4BBVA 3W4OA 1HD8A 2PYRA 3T50A 5J8XA 2I9VA 3S7PA 2OWJA 3ZG7B 4WZ5C 4KZ7A 4LV0A 4E3NA 3IX3A 3N4IA 1KE4A 3UE3A 4MLLA 2JKGA 3BFCA 1OTDA 4OVDA 3BQ8A 3ZHHA 4X69A 1ES4A 1HVBA 2VLGA 2UV0E 2Q9NA 2GX5A 5GLBA 3LR3A 2EX8A 4GS9B 4IEDA 4L9GA 4R6LA 1OTEA 3LFVA 3MZFA 3FPWA 5IU1A 2O9AA 4JXSA 2Y2MA 3CI6A 1LL8A 3VE4A 1DJAA 4GHIB 1K54A 1QMFA 3NI9A 2A2LA 3GTCA 3PBNA 3KSHA 2D02A 3HUMA 3PAEA 2ZJ9A 3ZG5A 4Q8IA 3CLOA 3IWIA 3CUEA 2VV7A 2GJ3A 4HJ3A 4X55A 4X56A 2PBYA 5HL1A 4GW9A 2V1AA 5CEDA 1T1CA 2VK3A 5F5YA 4YINA 5CEBA 4Y3IA 3A3FA 3D3OA 5G4YA 5EECA 1CI9A 4EEPA 5CGWA 5TBMA 1YKDA 2JC7A 4HQAA 1XJ2A 1YAXA 5DTKA 1TEMA 1IELA 4L9EA 2Y2PA 2OV5A 4GDBA 1WE4A 4I5SA 2PHYA 1MWTA 3G4PA 1W7FA 3L7HA 4GKUA 3O5YA 5LBRA 2W3GA 2M1CA 2JCHA 4ARZB 3P98A 4UQIM 3B3XA 3O86A 2X71A 4ZAMA 3CZDA 4WMCA 4X1MA 1X0OA 4KQRA 1ZKJA 3T4LA 1CF0A 1ES3A 2O9CA 3G31A 1L2SA 3OPLA 4LRXC 3LIEA 1FIKA 3UPPA 5E2HA 2ACGA 1LT0A 3DTKA 1DY6A 5FI7A 4BD0A 2XF3A 1J3WA 3HJKA 5FI6A 1CI8A 3NY4A 1KGFA 2OAP1 1N4OA 4OQHA 5F69A 2A24A 5KZHA 1BT5A 2Y91A 1XA7A 2ZMFA 2XA7S 3ZNTA 4Q0IA 3T4QA 1HZOA 3GQZA 4QY5A 1NY0A 3PR6A 1LSWA 2Y2NA 3GECA 3R7WA 3C30A 3MSHA 3ZNYA 3BWLA 3LY4A 2K31A 1SKOA 4M3KA 3MQQA 4WN5A 4ID4A 4PKYA 5AQAA 4WEKA 5TGFA 4JXVA 3P7NA 1H3QA 3E2LA 4RYEA 2V2FF 4GDNA 4B9OA 4KZ4A 4FTXA 1K6SA 3IF6B 1PZPA 5HW3A 1L0GA 3UB7A 4BBUA 4I39A 5U47A 3ZFZA 2VGJA 3BLMA 5EVIA 2PAVP 2GDNA 4OLDA 5EVLA 2H0TA 3S4XA 1J9MA 1F5MA 4HY8A 1W63Q 4GB7A 3VFFA 1ES5A 2YKHA 4OQGA 5AQBA 2PT7A 4E3KA 4UA9A 2HDUA 2QHKA 4P87A 1W5DA 2FFFB 3CG5A 3HCYA 1PIOA 2V8CA 1EWZA 5DKLA 1JWVA 1DJCA 1S1ZA 3HUOA 4JF6A 2Y2QA 3QHYA 5E43A 5G4ZA 1T19A 3EEAA 1LHYA 3C7VA 2YKFA 2VV8A 4OQ0A 5F68A 3T1RA 3K3CA 2G2WA 3U4LP 3IT9A 1K55C 1JTGA 3DWZA 2PU4A 1MPLA 3SH8A 4C3QA 1GSWA 2EFXA 1XFNA 1S66L 2J9OA 3LR5A 3ISGA 2NUTC 5L09A 4PM7A 3WRZA 4P6ZM 1L0DA 1TDLA 2R9XA 3PBSA 1I2WA 1FSYA 3TJZC 4BJPA 2OAQ1 4KG2A 5M18A 4K08A 4QPRA 3IBRA 3SH7A 5TFQA 1YLJA 3V3RA 4ZJ1A 3HL9A 4R0QA 3SW1A 1NZUA 3UB8A 2WGWA 4MCWA 1D7EA 1XX2A 3LIDA 5IT5A 2Y2KA 4PHTA 2HJ9C 3QP8A 4X25A 3V50A 4DE0A 4Y0UA 4LGWA 4H6JA 2P9VB 3UMEA 1XJ6A 3UB5P 1JNUA 1BLPA 2Z6CA 4N9LA 2ZQDA 4KZ3A 4OKPA 3JVUA 2Y8HA 1Z09A 4EEUA 4OPYA 4KQOA 1YLPA 2HP6A 2V1BA 3IX4A 3IS2A 1PYYA 1YSPA 3DTMA 5E2FA 3HBRA 4WYYA 1XGIA 5EOOA 4BQMA 4A5RA 5JYPA 1K25A 4KZAA 4R3AA 2PR5A 3ULFA 1YPRA 1S67L 1GHPA 5F1GA 1KDSA 1RGYA 3M6HA 4QWOA 2ZQ8A 3Q7VA 3M2KA 3MJQA 4LV2A 3DW0A 2WADA 1PW1A 3WS1A 3VMAA 3UNWA 3NHQA 3OPPA 3FKVA 3HVFA 1MY8A 5CGSA 1K54C 2ZC3B 3VSLA 2WAFA 3LO7A 4EW7A 3MZDA 4Y0OA 1EI5A 1LI9A 4LCLA 3FWLA 4WELA 2P74A 4DN0A 4WUJA 2V0UA 3IWQA 4RA7A 4FOFA 2EWVA 3D9YA 2WGVA 3FV7A 2ZOHA 4H8RA 1OTIA 1N9NA 1YMXA 4HEFA 4GD8A 3LEQA 4LPZA 5I94A 1S1YA 2L0WA 4BLMA 2ZL1A 4JPMA 4Y0TA 4QU3A 4GCZA 3T4KA 5DFXA 4HIAA 1GA0A 2V8FA 3MKEA 2P08A 3IF5A 1YLTA 4EQ1A 1MWUA 4KZBA 1SKFA 2Q0OA 1L3LA 2JBFA 3F1NB 4HBTA 5FQMA 5I5LA 4F3LB 4ZJ2A 4CLCC 1OJGA 4UA7A 1H5XA 4CLCB 2R78A 3D4FA 3IH8A 3W2ZA 1M6KA 3BFFA 1YLWA 2Z6DA 1IYSA 4BENA 2XA7M 2G2UA 3RTYA 3E4PA 3UE0A 2IWDA 1IOUA 3OCLA 3IQAA 3MMHA 1LSVA 4P85A 4NG2A 3DWKA 3VV4A 3FG8A 4WEJA 2HDRA 1UWNX 4B88A 3H82B 5FI2A 2FZ0A 2WKRA 2QWSA 2HF6A 2HP5A 5CXWA 2ZD8A 3LGOA 3R7WB 3ITBA 5L8MA 1BZAA 2JHEA 2ZQCA 2JKRM 5DKKA 4DXBA 3UB6A 4EUZA 1BYWA 4E3IA 1PWGA 2A3UA 2VJWA 3SZTA 4F94A 3IXBA 4GD6A 2PBDP 2JKRI 2VGKA 2XROA 2ZC5B 2ZBBA 5GHZA 4FH4A 5FAQA 4S2NA 1KVLA 1KE3A 3PXPA 2HV1A 3LICA 3NDGA 2WGIA 2W0NA 5CECA 1KGGA 4EESA 3SS3A 2XDMA 4I3IA 2W3FA 5KMWA 4Y15A 3NBLA 3F1OB 2PDRA 1IKIA 4Y7PA 3WS5A 3RXXA 4DDYA 1RP5A 3WWXA 3T4TA 1FILA 1PWCA 4MMNA 2WZXA 4Z1WA 3UN7A 5HD5A 3TW8A 1H8MA 1W8YA 4WL9A 1RGZA 3F1PB 1K4FA 4K91A 3DAVA 4ETXA 4DE2A 4MN5A 2NUPC 1YM1A 1BULA 4R1GA 3N7WA 2WKHA 1AWIA 2EFUA 2H5SA 4X1LA 5D3OA 1KOUA 4IJGA 1OTBA 4KZ5A 2W3HA 4B4ZA 3IXDA 3A3EA 1K56A 2ZC6B 2HGVA 4S2IA 3WRTA 1O07A 2JKTI 4LCMA 4QY6A 1PI4A 1XXMA 4EBPA 1VHMA 4NXEA 2ZQAA 4MBHA 2PU2A 3LI9A 4L0LA 4NXBA 4OP8A 4PM8A 1GA9A 4KUKA 1EROA 3TRCA 4U0TA 1FCMA 1VETA 5FQJA 2P04A 4X53A 5M19A 1VB6A 3UO9A 4KQDA 3G35A 5A8BA 4E6XA 1FOFA 4PKYG 3ZG8B 3IHBA 1K0KA 4WM9A 3CHWP 3PAGA 1NXYA 3N8RA 1Y4OA 1Q2QA 4ETZA 3LY3A 5IS1A 1NJ4A 4G3WA 1WYCA 3T1SA 1YLZA 3KYEA 3DBAA 3G32A 3BRMA 2EA9A 4Q0HA 1KGEA 1IEMA 3OC2A 2PD7A 5TR7A 2XK1A 3MQ0A 4QHCA 3IH9A 3EOIA 3UMDA 3GVBA 4CJNA 1LLBA 1K57A 4R23A 4R70A 2PR6A 3MXSA 5EV0A 3QP1A 3B33A 4II7A 5K5BA 2WKQA 2XFTA 3BFDA 3VFHA 1BLHA 1L0EA 5A92A 3UB9A 3MXQA 2WKPA
chains in the Genus database with same CATH topology
3C38A 3UB8A 4MCWA 4E04A 1D7EA 1G6OA 4I3JA 2W3EA 3LIDA 3H9WA 5IT5A 3UE6A 4PHTA 2O9BA 3T4SA 2XSSA 2HJ9C 2L4RA 4HI4A 1N9OA 3ZQ5A 1ZHHB 4JGRA 3KYQA 1UGUA 3CAXA 5HWTA 1OT9A 2PYPA 5F6AA 3KX0X 5C5KA 4H6JA 3UMEA 1XJ6A 4I3AA 4RQ9A 3H7WB 1MKMA 1Y28A 2MJ6A 4LLOB 1JNUA 5CX7A 4YOFA 2Z6CA 3EGXC 2HJEA 3LI8A 1TS7A 2FH5A 3JVUA 2Y8HA 4XT2A 4EEUA 2JKTM 5DJTA 2J80A 4MDZA 3LIAA 3BQAA 3EEHA 4KQOA 1OJ5A 2V1BA 2W1RA 4HP9A 3GDIA 1S4RA 3IS2A 5AVFA 2W1TA 5AVEA 4CLCD 4OOLA 1YSPA 2BASA 4EUVA 1TS8A 5J4EA 3OOVA 3E98A 2M7VA 1G28A 4DJ3A 1F9IA 3A0SA 4HH3A 4YNRA 2QJ5A 4HJ4A 1V9ZA 4R3AA 4B93A 2PR5A 4NEED 4HHDA 4HP4A 3LIBA 3LYXA 3ULFA 3K3DA 4CQHA 3LR4A 1S67L 4L9FA 2QYBA 1TF1A 5HDSA 2GNXA 3PYPA 4P6ZS 4GS9A 3EQUA 3A0RA 3MJQA 2INWA 1MZUA 1T1BA 3KSGA 1LSXA 1TS6A 4EXOA 2V0WA 1P97A 2O0YA 2VX8A 3NHQA 4O0PA 3F1NA 4F3LA 3V67A 1ODVA 3CITA 4H6JB 3ICYA 4WF0A 3TE8A 2H28A 4CLCA 4O8GA 4GHIA 5HWWA 1MC0A 4NKPA 4JGPA 4DJ2A 2CMNA 1N9LA 4CLCE 4XT2B 4EW7A 3BY8A 3G6OA 3P01A 3MF0A 4HOIA 4WELA 4DN0A 4BMWA 4BBVA 3HJIA 2PYRA 2VZWA 4WUJA 2V0UA 3IS2B 3T50A 2W1TB 2I9VA 3S7PA 2OWJA 3E4QA 4FOFA 2EWVA 3T4JA 3NOPC 3BY9A 3UE3A 4ME4A 2ZOHA 5AJGA 1OTIA 1OTDA 1N9NA 3BQ8A 4OOMA 4UEYA 2VLGA 4LPZA 1S1YA 2L0WA 3H82A 2GX5A 3LR3A 1DP8A 4GCZA 4HH2A 3T4KA 5DFXA 4GS9B 1XJ3A 3S7QA 4L9GA 4HIAA 3PHYA 4R6LA 1OTEA 2LB9A 2J3WA 3LFVA 2P08A 3BW6A 4G3VA 4EQ1A 3FPWA 5IU1A 1NRJA 2P7JA 2O9AA 3F1NB 5I5LA 4F3LB 4CLCC 4ARZA 3CI6A 1LL8A 3VE4A 4MN6A 1OJGA 3S7NA 2VKSA 2OWHA 4CLCB 4GHIB 2R78A 2A2LA 3PBNA 3KSHA 3W2ZA 2Z6DA 2D02A 2O99A 2XA7M 3RTYA 3E4PA 3NOTC 1YSQA 3CLOA 1IOUA 2ZMVA 3EQVA 3CUEA 2KLIA 3MMHA 3OCLA 5KIZA 4BWIA 2KDKA 2VV7A 1LSVA 2GJ3A 3B47A 4HJ3A 4I38A 4O01A 3FPVA 3VV4A 4LRYC 3FG8A 3RFBA 5TJJA 4GW9A 2V1AA 3LIFA 5HL6A 4WEJA 2W3DA 3F1OA 2PD8A 1STZA 1T1CA 1OPXA 3MQOA 5F5YA 4IUHA 1UWNX 4Y3IA 3D3OA 5G4YA 2GZAA 4EEPA 3H82B 3KSIA 2FZ0A 5TBMA 1YKDA 2WKRA 2QWSA 2HF6A 4G3KA 4HQAA 1XJ2A 1YAXA 4L9EA 2OOLA 3EWKA 4JGOA 5J3WA 2D01A 2L1MA 3R7WB 1NWZA 1TD5A 5L8MA 4I5SA 2JHEA 2PHYA 5DKKA 2JKRM 3UB6A 1BYWA 1OT6A 1XFQA 2VJWA 1P9WA 2DMWA 3O5YA 5LBRA 3NOUC 2W3GA 3NJAA 3BJNA 5HSQA 3F1PA 3ZYTA 2JKRI 2M1CA 5DJUA 4ARZB 2XROA 4UQIM 1XJ4A 4R38A 3OLOA 2ZBBA 2VEAA 2VGLM 3OCNA 4MN7A 1P9RA 1X0OA 3C2WA 2J3TD 3T4LA 2O9CA 3PXPA 4LRXC 3D72A 3LIEA 3A0VA 2HV1A 3CUEC 3LICA 1DRMA 2W0NA 1LT0A 2VA0A 5EFWA 2KX6A 4EESA 5FL3A 2EWWA 3HJKA 1NLYA 1GSVA 1D06A 1GSXA 2W3FA 4I3IA 2OAP1 3JVVA 3U2AA 5F69A 2A24A 3F1OB 2PDRA 2ZMFA 3IBJA 2XA7S 2LB5A 4Q0IA 3T4QA 3VOLA 1WA9A 1P0ZA 4GJ4A 4BBTA 3VE3A 2JN7A 3PR6A 4GLQA 1LSWA 2XRNA 3GECA 3R7WA 5TBMB 3T4TA 3C30A 4IHQA 5HD3A 4MMNA 3BWLA 5J7EA 4EERA 4Z1WA 2K31A 4YWZA 1DP6A 2K2NA 5HD5A 3MQQA 4WLAA 3TW8A 1H8MA 4WN5A 4PKYA 4WL9A 1W63M 1UWPX 3F1PB 4WEKA 3P7NA 1H3QA 4HNBA 2QKPA 4ETXA 1EW0A 3PBRA 4MN5A 4B9OA 1ZTUA 3MFXA 3PBQA 2NUPC 2ZOIA 4M4XA 1NLZA 3UB7A 4BBUA 4I39A 4IUKA 2IA2A 5KSHA 5HZHA 1DP9A 1KOUA 4FSFA 1OTBA 4IJGA 2B02A 2W3HA 2QJ7A 4UQIS 4HJ6A 2M7UA 1F5MA 1IFQA 2HGVA 4HY8A 1OTAA 1W63Q 2JKTI 2VGLS 4Y2FA 1VHMA 4NXEA 2KOIA 3FC7A 2A24B 2YKHA 5DF9A 3LI9A 3LR0A 4L0LA 4NXBA 3E0YA 4AFIA 2PT7A 4Y5FA 2QHKA 4KUKA 3PBTA 3TRCA 1F98A 4ZRRA 5HDCA 2V9AA 4LRZE 3EGDC 3HCYA 2P04A 1VB6A 5DKLA 4EU0A 4KQDA 1S1ZA 4PAUA 3KSFA 2J3TC 5A8BA 1T18A 3KO6A 4DMZA 5HPFA 4PKYG 3KYZA 5G4ZA 4KUOA 3CWFA 1T19A 2VV6A 3EEAA 3RH8B 1V9YA 3K2NA 4Q0JA 3H7WA 1T1AA 3PBOA 4JGQA 2YKFA 2VV8A 5F68A 4ETZA 5IS1A 4G3WA 3K3CA 3DBAA 3E4OA 2EA9A 3C8CA 4Q0HA 3OC2A 2PD7A 3MQ0A 2K7SA 3MR0A 3EOIA 1GSWA 2G7UA 1XFNA 1S66L 5MC7A 3UMDA 3LR5A 2NUTC 1TS0A 1S4SA 2B18A 3R4KA 4P6ZM 5HPIA 4NXGA 3PBSA 4NXFA 4R70A 2PR6A 3LUQA 3TJZC 3OBFA 4BJPA 3B42A 2OAQ1 4K08A 3B33A 4II7A 4QPRA 5HDDA 5K5BA 3IBRA 2WKQA 2Y79A 2W27A 3T4OA 3UB9A 5DFYA 5HWVA 3MXQA 3S7OA 3SW1A 2WKPA 4EETB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UB8 A;  4E04 A;  1D7E A;  4I3J A;  3LID A;  3H9W A;  3UE6 A;  2L4R A;  4HI4 A;  1N9O A;  3ZQ5 A;  4JGR A;  1UGU A;  3CAX A;  5HWT A;  1OT9 A;  2PYP A;  5F6A A;  3KX0 X;  4H6J A;  3UME A;  1XJ6 A;  4I3A A;  4RQ9 A;  3H7W B;  1Y28 A;  4LLO B;  1JNU A;  2Z6C A;  3LI8 A;  1TS7 A;  4XT2 A;  4EEU A;  5DJT A;  2J80 A;  3LIA A;  3EEH A;  1OJ5 A;  2V1B A;  4HP9 A;  3GDI A;  1S4R A;  3IS2 A;  5AVF A;  5AVE A;  2BAS A;  1TS8 A;  5J4E A;  1G28 A;  4DJ3 A;  1F9I A;  3A0S A;  4HH3 A;  2QJ5 A;  4HJ4 A;  1V9Z A;  4R3A A;  2PR5 A;  4HHD A;  4HP4 A;  3LIB A;  3LYX A;  3ULF A;  3K3D A;  1S67 L;  4L9F A;  5HDS A;  3PYP A;  4GS9 A;  3A0R A;  3MJQ A;  2INW A;  1MZU A;  1T1B A;  1LSX A;  1TS6 A;  4EXO A;  2V0W A;  1P97 A;  3NHQ A;  3F1N A;  4F3L A;  1ODV A;  4H6J B;  3ICY A;  4WF0 A;  2H28 A;  4GHI A;  5HWW A;  4JGP A;  4DJ2 A;  2CMN A;  1N9L A;  4XT2 B;  4EW7 A;  3BY8 A;  3G6O A;  4HOI A;  4BBV A;  3HJI A;  2PYR A;  4WUJ A;  2V0U A;  3IS2 B;  3T50 A;  2I9V A;  2OWJ A;  3E4Q A;  3NOP C;  3BY9 A;  2ZOH A;  1OTI A;  1OTD A;  1N9N A;  2VLG A;  4LPZ A;  1S1Y A;  2L0W A;  3H82 A;  1DP8 A;  4GCZ A;  4HH2 A;  4GS9 B;  1XJ3 A;  4L9G A;  4HIA A;  3PHY A;  4R6L A;  1OTE A;  4EQ1 A;  5IU1 A;  2P7J A;  3F1N B;  5I5L A;  4F3L B;  1LL8 A;  3VE4 A;  4MN6 A;  1OJG A;  2OWH A;  4GHI B;  2R78 A;  2Z6D A;  2D02 A;  3RTY A;  3E4P A;  3NOT C;  3CLO A;  5KIZ A;  2KDK A;  2VV7 A;  1LSV A;  2GJ3 A;  4HJ3 A;  4I38 A;  4LRY C;  3FG8 A;  4GW9 A;  2V1A A;  3LIF A;  3F1O A;  2PD8 A;  1T1C A;  3MQO A;  5F5Y A;  1UWN X;  5G4Y A;  4EEP A;  3H82 B;  5TBM A;  2WKR A;  2QWS A;  4HQA A;  1XJ2 A;  4L9E A;  2OOL A;  3EWK A;  4JGO A;  5J3W A;  2D01 A;  2L1M A;  1NWZ A;  4I5S A;  2JHE A;  2PHY A;  5DKK A;  3UB6 A;  1BYW A;  1OT6 A;  1XFQ A;  3NOU C;  3NJA A;  5HSQ A;  3F1P A;  2M1C A;  5DJU A;  1XJ4 A;  4R38 A;  3OLO A;  2ZBB A;  2VEA A;  1X0O A;  3C2W A;  4LRX C;  3D72 A;  3LIE A;  3A0V A;  2HV1 A;  3LIC A;  1DRM A;  2W0N A;  1LT0 A;  5EFW A;  2KX6 A;  4EES A;  3HJK A;  1GSV A;  1D06 A;  1GSX A;  4I3I A;  5F69 A;  2A24 A;  3F1O B;  2PDR A;  3VOL A;  1WA9 A;  1P0Z A;  4BBT A;  3VE3 A;  2JN7 A;  1LSW A;  3GEC A;  5TBM B;  5HD3 A;  3BWL A;  5J7E A;  4EER A;  4YWZ A;  1DP6 A;  5HD5 A;  3MQQ A;  4WLA A;  4WN5 A;  4PKY A;  4WL9 A;  1UWP X;  3F1P B;  3P7N A;  4HNB A;  2QKP A;  1EW0 A;  4MN5 A;  4B9O A;  3MFX A;  2ZOI A;  4M4X A;  3UB7 A;  4BBU A;  4I39 A;  5HZH A;  1DP9 A;  1KOU A;  1OTB A;  2B02 A;  2QJ7 A;  4HJ6 A;  4HY8 A;  1OTA A;  4NXE A;  3FC7 A;  2A24 B;  2YKH A;  3LI9 A;  4NXB A;  2QHK A;  4KUK A;  1F98 A;  5HDC A;  2V9A A;  4LRZ E;  1VB6 A;  5DKL A;  4KQD A;  1S1Z A;  5A8B A;  1T18 A;  4PKY G;  5G4Z A;  4KUO A;  3CWF A;  1T19 A;  2VV6 A;  3RH8 B;  1V9Y A;  3H7W A;  1T1A A;  4JGQ A;  2YKF A;  2VV8 A;  5F68 A;  5IS1 A;  3K3C A;  3E4O A;  2EA9 A;  3C8C A;  2PD7 A;  2K7S A;  3MR0 A;  1GSW A;  1XFN A;  1S66 L;  3UMD A;  1TS0 A;  1S4S A;  4NXG A;  4NXF A;  4R70 A;  2PR6 A;  3LUQ A;  4K08 A;  3B33 A;  5HDD A;  3IBR A;  2WKQ A;  2W27 A;  3UB9 A;  5HWV A;  3MXQ A;  3SW1 A;  2WKP A;  4EET B; 
#chains in the Genus database with same CATH topology
 4U3T A;  1IYO A;  3C38 A;  1E3U D;  1GHI A;  4E04 A;  5EVE A;  2XGN A;  1YMS A;  4JKT A;  5M1A A;  4KEN B;  2L4R A;  4OLG A;  3QP5 A;  3ZQ5 A;  3KYQ A;  1UGU A;  5HWT A;  2ZQ9 A;  2PYP A;  3KX0 X;  3DTE A;  5C5K A;  3C4O A;  1W79 A;  1JVJ A;  4ZJ3 A;  3UY6 A;  4RQ9 A;  2RL3 A;  3H7W B;  5AQ9 A;  5CGX A;  2MJ6 A;  4LLO B;  1YT4 A;  1N9B A;  3UDX A;  3LI8 A;  5CRF A;  5HAP A;  1TS7 A;  2Y2I A;  2FH5 A;  3SOI A;  4IBR A;  1DJB A;  3ZCZ A;  5GHY A;  5FEF A;  3LIA A;  3N8S A;  4IVI A;  3QP6 A;  4ZTK A;  4MEZ A;  3EEH A;  2W1R A;  3GDI A;  1S4R A;  5AVF A;  4CLC D;  1BLC A;  2ZM8 A;  2B5R A;  1ESI A;  4JF5 A;  2BAS A;  1BSG A;  4S2K A;  5L10 A;  2XQZ A;  1YLY A;  3E98 A;  1G28 A;  4HH3 A;  3VP4 A;  4WMC D;  4HJ4 A;  1V9Z A;  2WK0 A;  4PM9 A;  4E3O A;  4B93 A;  2OSU A;  4HP4 A;  3LYX A;  5FSR A;  2QYB A;  4ESP A;  3HLG A;  2ZQ7 A;  5FQQ A;  4GS9 A;  1ZC2 A;  4MBF A;  3JPU A;  5FQI A;  3A0R A;  2Y55 A;  4DDS A;  1T1B A;  1LSX A;  3C5A A;  4EXO A;  1P97 A;  1CK3 A;  2VX8 A;  5FDH A;  5FDS A;  1ODV A;  2FFY A;  3CIT A;  4N1X A;  1ALQ A;  1MWS A;  4DKI A;  3RJU A;  4O8G A;  4GHI A;  3CMZ A;  4XUX A;  4JBF A;  4E6W A;  4CLC E;  4K0W A;  4XT2 B;  3BY8 A;  3G6O A;  3HLC A;  3MFD A;  2W1T B;  4LFU A;  5FAT A;  4EBL A;  3NOP C;  1U60 A;  5L2F A;  4ME4 A;  5HX9 A;  2ZC7 A;  2ZM2 A;  2ZM0 A;  3A3J A;  4OOM A;  4S2J A;  1FQG A;  2QMI A;  3CJM A;  1AXB A;  5CHM A;  4HH2 A;  4XXR A;  4JLF A;  2LB9 A;  2J3W A;  3A3D A;  4FCF A;  4G3V A;  3IHA A;  3IXG A;  3BEC A;  2P7J A;  1MXO A;  2RCX A;  1PWD A;  4PPR A;  4ARZ A;  5DF8 A;  4MN6 A;  3I7J A;  2DNS A;  4OON A;  3CPT A;  3BEB A;  4KZ6 A;  4BL3 A;  2XLN A;  4WZ4 A;  3G2Y A;  1I5Q A;  3ZVT A;  2EXB A;  4PMA A;  3FKW A;  3NOT C;  1VEU A;  3EQV A;  5KIZ A;  2KDK A;  3B47 A;  2J9P A;  4I38 A;  2ZC4 B;  4O01 A;  3FPV A;  5E2G A;  4LRY C;  2XH9 A;  1K38 A;  2PD8 A;  5FAO A;  1IKG A;  1OPX A;  1ZG6 A;  4GNU A;  3MQO A;  4IUH A;  3M6B A;  3SH9 A;  2XEP A;  3LEZ A;  2OOL A;  4JGO A;  3ZDJ A;  5HAQ A;  1PI5 A;  1P9W A;  2DMW A;  2I72 A;  3NOU C;  3TG9 A;  3NJA A;  3BJN A;  5HSQ A;  1FCN A;  3ZYT A;  4C75 A;  5DJU A;  1Q2P A;  1XJ4 A;  4R38 A;  5L07 A;  2JKF A;  4Y17 A;  1PZO A;  2R9W A;  2VEA A;  3DTI A;  3OCN A;  4MN7 A;  4EV4 A;  3IF6 A;  4OOY A;  1P9R A;  1Z6F A;  3O88 A;  2WYX A;  5DF7 A;  3UPN A;  3CUE C;  1D1J A;  1SDE A;  3BYD A;  2KX6 A;  2X02 A;  5FL3 A;  2BG1 A;  2EWW A;  4JF4 A;  1NLY A;  1GSV A;  1D06 A;  1GSX A;  4PM5 A;  4KZ9 A;  5HFO A;  3IBJ A;  3G34 A;  1KE0 A;  3W4Q A;  4KZ8 A;  4GOG A;  1P0Z A;  4GJ4 A;  5EM0 A;  1XGJ A;  4GLQ A;  2XRN A;  1S6R A;  5TBM B;  1HTZ A;  2QPN A;  4IHQ A;  5J7E A;  3A3I A;  1ZG4 A;  4EER A;  1DP6 A;  2K2N A;  2DRW A;  1ESU A;  3O87 A;  3FYZ A;  1GCE A;  3T12 B;  1UWP X;  2AVX A;  2QKP A;  5EPH A;  5CHJ A;  4DXC A;  1ZTU A;  3MFX A;  4RX3 A;  2WAE A;  2HPB A;  1NLZ A;  1TDG A;  2IA2 A;  1K55 A;  5KSH A;  3C7U A;  2Y2G A;  5HZH A;  1DP9 A;  4FSF A;  2B02 A;  2QJ7 A;  3OZH A;  4E3J A;  1IFQ A;  1H8Z A;  2Z2M B;  3MZE A;  4R4S A;  2VGL S;  4Y2F A;  3T1Q B;  3FC7 A;  2A24 B;  4OQI A;  4AFI A;  5CER A;  4Y5F A;  3W4P A;  2OLU A;  1FR6 A;  4HBU A;  5GLC A;  4ZRR A;  1BUE A;  4LRZ E;  3EGD C;  3SS5 A;  4EU0 A;  4PAU A;  3OPR A;  4N1H A;  2J3T C;  1SKO B;  2DCF A;  3KYZ A;  3MKF A;  5HAI A;  3CWF A;  1FCO A;  2VV6 A;  2P9V A;  3NUL A;  3PBO A;  4JGQ A;  2PRF A;  4U0X A;  2XFS A;  3IX8 A;  3HLW A;  1FSW A;  3V5M A;  4R3B A;  3BLS A;  5EVI C;  3HLD A;  3L9K A;  2J7V A;  3E4O A;  3C8C A;  1G6A A;  5EVI B;  2K7S A;  4C6Y A;  5EE8 A;  3RXW A;  1TS0 A;  1S4S A;  5IHV A;  1BLS A;  5EM1 A;  4NXG A;  4NXF A;  4JXW A;  4RX2 A;  3LUQ A;  1OME A;  3OBF A;  1XKZ A;  3B42 A;  2JE5 A;  1E4D A;  3ZVW A;  5EOE A;  2Y79 A;  2W27 A;  3T4O A;  5HWV A;  3S7O A;  2EX6 A;  4EET B;  2ZLY A;  3WS2 A;  4I3J A;  4IVK A;  4Y13 A;  4UA6 A;  3T4S A;  1WYB A;  2XSS A;  1N9O A;  4KG5 A;  4JGR A;  5DTT A;  3CAX A;  1OT9 A;  1SDN A;  3Q81 A;  2EX9 A;  3PTE A;  1E25 A;  2EXA A;  3UDF A;  5CX7 A;  1W8Q A;  2XD5 A;  5A93 A;  4D60 A;  2JKT M;  5DJT A;  4MDZ A;  4B4X A;  2IWC A;  4HP9 A;  3VOZ A;  4OOL A;  1LL5 A;  1E3U A;  3ZG9 B;  1MWR A;  3OOV A;  2M7V A;  4DJ3 A;  1PNE A;  1F9I A;  3A0S A;  4YNR A;  1KVM A;  4HHD A;  4FUW A;  3K3D A;  3LR4 A;  4LV1 A;  4S2L A;  5KSC A;  2GNX A;  2WGW B;  1O7E A;  3EQU A;  3HLE A;  1TVF A;  2INW A;  1ONH A;  5F1F A;  1MZU A;  4D2O A;  1XP4 A;  2V0W A;  3VP2 A;  1IYP A;  4QB8 A;  3F1N A;  4FH2 A;  4F3L A;  4H6J B;  2HP9 A;  4WF0 A;  3TE8 A;  4CLC A;  2CC1 A;  5HWW A;  1MC0 A;  2E8J A;  4DE3 A;  4DJ2 A;  2CMN A;  1N9L A;  3CPT B;  3HLB A;  2E8I A;  5F82 A;  3MF0 A;  1H0M A;  4BMW A;  3HJI A;  2VZW A;  3IS2 B;  1CQA A;  3GMW A;  3E4Q A;  3VP0 A;  3HUN A;  1VEU B;  3T4J A;  5FAS A;  3QP2 A;  4S2M A;  3Q07 A;  3BY9 A;  3W8K A;  4NET A;  5AJG A;  1SCW A;  4UEY A;  5E2E A;  3G30 A;  3H82 A;  1DP8 A;  2Y2O A;  4OPR A;  4DE1 A;  3SS4 A;  4KG6 A;  3S7Q A;  1XJ3 A;  3Q7V B;  1YQS A;  1ES2 A;  3PHY A;  1K56 D;  1QME A;  3G2Z A;  2Y2J A;  4X6T A;  3BW6 A;  1CEG A;  3OPH A;  4EQI A;  1NRJ A;  1ERQ A;  4BD1 A;  4P6B A;  3S7N A;  2VKS A;  2OWH A;  3IF6 C;  1IYQ A;  1LL9 A;  5G18 A;  2O99 A;  3S1Y A;  1SHV A;  3S22 A;  1NYY A;  2XR0 A;  1YSQ A;  3MBZ A;  2ZMV A;  2KLI A;  4BWI A;  1CJF A;  4WZ5 A;  5FQK A;  5DTS A;  5HAR A;  4GZB A;  3RFB A;  5TJJ A;  4N9K A;  3LIF A;  5HL6 A;  2W3D A;  3F1O A;  5EUA A;  1STZ A;  2X01 A;  3VOY A;  1BTL A;  4QD4 A;  3T1X A;  2GZA A;  2ZL1 B;  3KSI A;  4G3K A;  1NZO A;  1ONG A;  3EWK A;  5J3W A;  2D01 A;  2L1M A;  5BOH A;  1NWZ A;  1XA1 A;  1TD5 A;  3M2J A;  2EX2 A;  1A0K A;  1OT6 A;  1XFQ A;  3O3V A;  3F1P A;  4BL2 A;  2Y2L A;  1K6R A;  3OLO A;  3TSG A;  1CEF A;  3JYI A;  2VGL M;  3C2W A;  4Z9Q A;  2J3T D;  3Q7Z A;  3BFG A;  3D72 A;  3A0V A;  1K4E A;  1DRM A;  2VA0 A;  3GV9 A;  4OPZ A;  3UE1 A;  5EFW A;  2HDS A;  3GR2 A;  4KQQ A;  3TOI A;  3P09 A;  2V20 A;  3JVV A;  3U2A A;  5F83 A;  3C4P A;  3BM6 A;  5EVI D;  3ZGA B;  2LB5 A;  3VOL A;  5A91 A;  1WA9 A;  2B95 A;  4BBT A;  3VE3 A;  2JN7 A;  2Y2H A;  4NK3 A;  5HD3 A;  4S2O A;  4DF6 A;  4YWZ A;  3AGE A;  4HES A;  4WLA A;  2IWB A;  3MS6 A;  1W63 M;  4HNB A;  5DVA A;  2Y59 A;  1EW0 A;  3PBR A;  2WUQ A;  3PBQ A;  4S2N C;  3NIA A;  4LV3 A;  2ZOI A;  4M4X A;  4UAA A;  4O7D A;  1JWP A;  2H0Y A;  4IUK A;  4OH0 A;  1ERM A;  5CTN A;  3V3S A;  2BTF P;  2C5W B;  4MBK A;  4UQI S;  5FQ9 A;  4HJ6 A;  2M7U A;  4RVA A;  4YFM A;  4OPQ A;  1OTA A;  1H8Y A;  3QP4 A;  1G68 A;  5GL9 A;  2H10 A;  4E3M A;  4R4R A;  2KOI A;  4E3L A;  4GN2 A;  5DF9 A;  3IWO A;  3LR0 A;  4K0X A;  3E0Y A;  1PRQ A;  3PBT A;  1NRF A;  1F98 A;  5HDC A;  2V9A A;  5CHU A;  3UDI A;  1SZV A;  1JTD A;  3KSF A;  1T18 A;  3KO6 A;  4DMZ A;  5HPF A;  1RCJ A;  2WZZ A;  3NEC A;  4KUO A;  1G5U A;  3RH8 B;  1V9Y A;  3K2N A;  4Q0J A;  3H7W A;  1T1A A;  4FD8 A;  4EBN A;  3BFE A;  3Q1F A;  4UHU A;  2XD1 A;  4JXG A;  2Y4A A;  4P0M A;  1Y54 A;  4LEN A;  3E2K A;  2ZMA A;  1FR1 A;  5FAP A;  1C3B A;  3MR0 A;  2G7U A;  4S2P A;  5MC7 A;  2Q9M A;  3GRJ A;  2B18 A;  3R4K A;  5HPI A;  4DRT A;  1VM1 A;  3AGD A;  4N92 A;  5FEG A;  3N6I A;  5HDD A;  1MKI A;  2Z2L B;  1XPB A;  4PM6 A;  2BLS A;  2C6W B;  5DFY A;  3WS0 A;  3NDE A;  1S0W A;  1VET B;  5CTM A;  1G6O A;  2W3E A;  3H9W A;  3UE6 A;  2O9B A;  4HI4 A;  1ZHH B;  3QNB A;  2WKE A;  3MXR A;  5F6A A;  4I3A A;  1MKM A;  1Y28 A;  1MBL A;  2UWX A;  4YOF A;  3EGX C;  3Q82 A;  2HJE A;  2A49 A;  3HLF A;  4XT2 A;  4WBG A;  3WS4 A;  2J80 A;  3AGF A;  3HRE A;  3FZC A;  3BQA A;  1OJ5 A;  5JYO A;  5AVE A;  1K57 C;  2W1T A;  1GHM A;  1I2S A;  3UPO A;  5GLD A;  3ZG0 A;  2WKI A;  2OLV A;  4EWF A;  4EUV A;  1L0F A;  1TS8 A;  5J4E A;  2HDQ A;  1NYM A;  3IXH A;  2QJ5 A;  3GSG A;  1JWZ A;  4NEE D;  5A90 A;  5AQ7 A;  3LIB A;  4CQH A;  1PFL A;  3NCK A;  1LI0 A;  4L9F A;  3QNC A;  1TF1 A;  5HDS A;  3PYP A;  1F2K A;  4OP5 A;  4P6Z S;  2J8Y A;  1VQQ A;  3KSG A;  4XUZ A;  1TS6 A;  4ZDX A;  1PW8 A;  2O0Y A;  4O0P A;  3NC8 A;  1KDW A;  2HZ5 A;  4X68 A;  3V67 A;  3VSK A;  4R3J A;  3ICY A;  5FA7 A;  5GLA A;  4CPK A;  5GHX A;  3ITA A;  4IBX A;  2H28 A;  1HLU P;  3N8L A;  1M40 A;  4MNR A;  1ACF A;  3VP1 A;  4NKP A;  3V39 A;  4JGP A;  2V1Z A;  3LCE A;  2QZ6 A;  4ZBE A;  3P01 A;  4QJG A;  4HOI A;  3VP3 A;  4BBV A;  3W4O A;  1HD8 A;  2PYR A;  3T50 A;  5J8X A;  2I9V A;  3S7P A;  2OWJ A;  3ZG7 B;  4WZ5 C;  4KZ7 A;  4LV0 A;  4E3N A;  3IX3 A;  3N4I A;  1KE4 A;  3UE3 A;  4MLL A;  2JKG A;  3BFC A;  1OTD A;  4OVD A;  3BQ8 A;  3ZHH A;  4X69 A;  1ES4 A;  1HVB A;  2VLG A;  2UV0 E;  2Q9N A;  2GX5 A;  5GLB A;  3LR3 A;  2EX8 A;  4GS9 B;  4IED A;  4L9G A;  4R6L A;  1OTE A;  3LFV A;  3MZF A;  3FPW A;  5IU1 A;  2O9A A;  4JXS A;  2Y2M A;  3CI6 A;  1LL8 A;  3VE4 A;  1DJA A;  4GHI B;  1K54 A;  1QMF A;  3NI9 A;  2A2L A;  3GTC A;  3PBN A;  3KSH A;  2D02 A;  3HUM A;  3PAE A;  2ZJ9 A;  3ZG5 A;  4Q8I A;  3CLO A;  3IWI A;  3CUE A;  2VV7 A;  2GJ3 A;  4HJ3 A;  4X55 A;  4X56 A;  2PBY A;  5HL1 A;  4GW9 A;  2V1A A;  5CED A;  1T1C A;  2VK3 A;  5F5Y A;  4YIN A;  5CEB A;  4Y3I A;  3A3F A;  3D3O A;  5G4Y A;  5EEC A;  1CI9 A;  4EEP A;  5CGW A;  5TBM A;  1YKD A;  2JC7 A;  4HQA A;  1XJ2 A;  1YAX A;  5DTK A;  1TEM A;  1IEL A;  4L9E A;  2Y2P A;  2OV5 A;  4GDB A;  1WE4 A;  4I5S A;  2PHY A;  1MWT A;  3G4P A;  1W7F A;  3L7H A;  4GKU A;  3O5Y A;  5LBR A;  2W3G A;  2M1C A;  2JCH A;  4ARZ B;  3P98 A;  4UQI M;  3B3X A;  3O86 A;  2X71 A;  4ZAM A;  3CZD A;  4WMC A;  4X1M A;  1X0O A;  4KQR A;  1ZKJ A;  3T4L A;  1CF0 A;  1ES3 A;  2O9C A;  3G31 A;  1L2S A;  3OPL A;  4LRX C;  3LIE A;  1FIK A;  3UPP A;  5E2H A;  2ACG A;  1LT0 A;  3DTK A;  1DY6 A;  5FI7 A;  4BD0 A;  2XF3 A;  1J3W A;  3HJK A;  5FI6 A;  1CI8 A;  3NY4 A;  1KGF A;  2OAP 1;  1N4O A;  4OQH A;  5F69 A;  2A24 A;  5KZH A;  1BT5 A;  2Y91 A;  1XA7 A;  2ZMF A;  2XA7 S;  3ZNT A;  4Q0I A;  3T4Q A;  1HZO A;  3GQZ A;  4QY5 A;  1NY0 A;  3PR6 A;  1LSW A;  2Y2N A;  3GEC A;  3R7W A;  3C30 A;  3MSH A;  3ZNY A;  3BWL A;  3LY4 A;  2K31 A;  1SKO A;  4M3K A;  3MQQ A;  4WN5 A;  4ID4 A;  4PKY A;  5AQA A;  4WEK A;  5TGF A;  4JXV A;  3P7N A;  1H3Q A;  3E2L A;  4RYE A;  2V2F F;  4GDN A;  4B9O A;  4KZ4 A;  4FTX A;  1K6S A;  3IF6 B;  1PZP A;  5HW3 A;  1L0G A;  3UB7 A;  4BBU A;  4I39 A;  5U47 A;  3ZFZ A;  2VGJ A;  3BLM A;  5EVI A;  2PAV P;  2GDN A;  4OLD A;  5EVL A;  2H0T A;  3S4X A;  1J9M A;  1F5M A;  4HY8 A;  1W63 Q;  4GB7 A;  3VFF A;  1ES5 A;  2YKH A;  4OQG A;  5AQB A;  2PT7 A;  4E3K A;  4UA9 A;  2HDU A;  2QHK A;  4P87 A;  1W5D A;  2FFF B;  3CG5 A;  3HCY A;  1PIO A;  2V8C A;  1EWZ A;  5DKL A;  1JWV A;  1DJC A;  1S1Z A;  3HUO A;  4JF6 A;  2Y2Q A;  3QHY A;  5E43 A;  5G4Z A;  1T19 A;  3EEA A;  1LHY A;  3C7V A;  2YKF A;  2VV8 A;  4OQ0 A;  5F68 A;  3T1R A;  3K3C A;  2G2W A;  3U4L P;  3IT9 A;  1K55 C;  1JTG A;  3DWZ A;  2PU4 A;  1MPL A;  3SH8 A;  4C3Q A;  1GSW A;  2EFX A;  1XFN A;  1S66 L;  2J9O A;  3LR5 A;  3ISG A;  2NUT C;  5L09 A;  4PM7 A;  3WRZ A;  4P6Z M;  1L0D A;  1TDL A;  2R9X A;  3PBS A;  1I2W A;  1FSY A;  3TJZ C;  4BJP A;  2OAQ 1;  4KG2 A;  5M18 A;  4K08 A;  4QPR A;  3IBR A;  3SH7 A;  5TFQ A;  1YLJ A;  3V3R A;  4ZJ1 A;  3HL9 A;  4R0Q A;  3SW1 A;  1NZU A;  3UB8 A;  2WGW A;  4MCW A;  1D7E A;  1XX2 A;  3LID A;  5IT5 A;  2Y2K A;  4PHT A;  2HJ9 C;  3QP8 A;  4X25 A;  3V50 A;  4DE0 A;  4Y0U A;  4LGW A;  4H6J A;  2P9V B;  3UME A;  1XJ6 A;  3UB5 P;  1JNU A;  1BLP A;  2Z6C A;  4N9L A;  2ZQD A;  4KZ3 A;  4OKP A;  3JVU A;  2Y8H A;  1Z09 A;  4EEU A;  4OPY A;  4KQO A;  1YLP A;  2HP6 A;  2V1B A;  3IX4 A;  3IS2 A;  1PYY A;  1YSP A;  3DTM A;  5E2F A;  3HBR A;  4WYY A;  1XGI A;  5EOO A;  4BQM A;  4A5R A;  5JYP A;  1K25 A;  4KZA A;  4R3A A;  2PR5 A;  3ULF A;  1YPR A;  1S67 L;  1GHP A;  5F1G A;  1KDS A;  1RGY A;  3M6H A;  4QWO A;  2ZQ8 A;  3Q7V A;  3M2K A;  3MJQ A;  4LV2 A;  3DW0 A;  2WAD A;  1PW1 A;  3WS1 A;  3VMA A;  3UNW A;  3NHQ A;  3OPP A;  3FKV A;  3HVF A;  1MY8 A;  5CGS A;  1K54 C;  2ZC3 B;  3VSL A;  2WAF A;  3LO7 A;  4EW7 A;  3MZD A;  4Y0O A;  1EI5 A;  1LI9 A;  4LCL A;  3FWL A;  4WEL A;  2P74 A;  4DN0 A;  4WUJ A;  2V0U A;  3IWQ A;  4RA7 A;  4FOF A;  2EWV A;  3D9Y A;  2WGV A;  3FV7 A;  2ZOH A;  4H8R A;  1OTI A;  1N9N A;  1YMX A;  4HEF A;  4GD8 A;  3LEQ A;  4LPZ A;  5I94 A;  1S1Y A;  2L0W A;  4BLM A;  2ZL1 A;  4JPM A;  4Y0T A;  4QU3 A;  4GCZ A;  3T4K A;  5DFX A;  4HIA A;  1GA0 A;  2V8F A;  3MKE A;  2P08 A;  3IF5 A;  1YLT A;  4EQ1 A;  1MWU A;  4KZB A;  1SKF A;  2Q0O A;  1L3L A;  2JBF A;  3F1N B;  4HBT A;  5FQM A;  5I5L A;  4F3L B;  4ZJ2 A;  4CLC C;  1OJG A;  4UA7 A;  1H5X A;  4CLC B;  2R78 A;  3D4F A;  3IH8 A;  3W2Z A;  1M6K A;  3BFF A;  1YLW A;  2Z6D A;  1IYS A;  4BEN A;  2XA7 M;  2G2U A;  3RTY A;  3E4P A;  3UE0 A;  2IWD A;  1IOU A;  3OCL A;  3IQA A;  3MMH A;  1LSV A;  4P85 A;  4NG2 A;  3DWK A;  3VV4 A;  3FG8 A;  4WEJ A;  2HDR A;  1UWN X;  4B88 A;  3H82 B;  5FI2 A;  2FZ0 A;  2WKR A;  2QWS A;  2HF6 A;  2HP5 A;  5CXW A;  2ZD8 A;  3LGO A;  3R7W B;  3ITB A;  5L8M A;  1BZA A;  2JHE A;  2ZQC A;  2JKR M;  5DKK A;  4DXB A;  3UB6 A;  4EUZ A;  1BYW A;  4E3I A;  1PWG A;  2A3U A;  2VJW A;  3SZT A;  4F94 A;  3IXB A;  4GD6 A;  2PBD P;  2JKR I;  2VGK A;  2XRO A;  2ZC5 B;  2ZBB A;  5GHZ A;  4FH4 A;  5FAQ A;  4S2N A;  1KVL A;  1KE3 A;  3PXP A;  2HV1 A;  3LIC A;  3NDG A;  2WGI A;  2W0N A;  5CEC A;  1KGG A;  4EES A;  3SS3 A;  2XDM A;  4I3I A;  2W3F A;  5KMW A;  4Y15 A;  3NBL A;  3F1O B;  2PDR A;  1IKI A;  4Y7P A;  3WS5 A;  3RXX A;  4DDY A;  1RP5 A;  3WWX A;  3T4T A;  1FIL A;  1PWC A;  4MMN A;  2WZX A;  4Z1W A;  3UN7 A;  5HD5 A;  3TW8 A;  1H8M A;  1W8Y A;  4WL9 A;  1RGZ A;  3F1P B;  1K4F A;  4K91 A;  3DAV A;  4ETX A;  4DE2 A;  4MN5 A;  2NUP C;  1YM1 A;  1BUL A;  4R1G A;  3N7W A;  2WKH A;  1AWI A;  2EFU A;  2H5S A;  4X1L A;  5D3O A;  1KOU A;  4IJG A;  1OTB A;  4KZ5 A;  2W3H A;  4B4Z A;  3IXD A;  3A3E A;  1K56 A;  2ZC6 B;  2HGV A;  4S2I A;  3WRT A;  1O07 A;  2JKT I;  4LCM A;  4QY6 A;  1PI4 A;  1XXM A;  4EBP A;  1VHM A;  4NXE A;  2ZQA A;  4MBH A;  2PU2 A;  3LI9 A;  4L0L A;  4NXB A;  4OP8 A;  4PM8 A;  1GA9 A;  4KUK A;  1ERO A;  3TRC A;  4U0T A;  1FCM A;  1VET A;  5FQJ A;  2P04 A;  4X53 A;  5M19 A;  1VB6 A;  3UO9 A;  4KQD A;  3G35 A;  5A8B A;  4E6X A;  1FOF A;  4PKY G;  3ZG8 B;  3IHB A;  1K0K A;  4WM9 A;  3CHW P;  3PAG A;  1NXY A;  3N8R A;  1Y4O A;  1Q2Q A;  4ETZ A;  3LY3 A;  5IS1 A;  1NJ4 A;  4G3W A;  1WYC A;  3T1S A;  1YLZ A;  3KYE A;  3DBA A;  3G32 A;  3BRM A;  2EA9 A;  4Q0H A;  1KGE A;  1IEM A;  3OC2 A;  2PD7 A;  5TR7 A;  2XK1 A;  3MQ0 A;  4QHC A;  3IH9 A;  3EOI A;  3UMD A;  3GVB A;  4CJN A;  1LLB A;  1K57 A;  4R23 A;  4R70 A;  2PR6 A;  3MXS A;  5EV0 A;  3QP1 A;  3B33 A;  4II7 A;  5K5B A;  2WKQ A;  2XFT A;  3BFD A;  3VFH A;  1BLH A;  1L0E A;  5A92 A;  3UB9 A;  3MXQ A;  2WKP A; 
#chains in the Genus database with same CATH homology
 3C38 A;  3UB8 A;  4MCW A;  4E04 A;  1D7E A;  1G6O A;  4I3J A;  2W3E A;  3LID A;  3H9W A;  5IT5 A;  3UE6 A;  4PHT A;  2O9B A;  3T4S A;  2XSS A;  2HJ9 C;  2L4R A;  4HI4 A;  1N9O A;  3ZQ5 A;  1ZHH B;  4JGR A;  3KYQ A;  1UGU A;  3CAX A;  5HWT A;  1OT9 A;  2PYP A;  5F6A A;  3KX0 X;  5C5K A;  4H6J A;  3UME A;  1XJ6 A;  4I3A A;  4RQ9 A;  3H7W B;  1MKM A;  1Y28 A;  2MJ6 A;  4LLO B;  1JNU A;  5CX7 A;  4YOF A;  2Z6C A;  3EGX C;  2HJE A;  3LI8 A;  1TS7 A;  2FH5 A;  3JVU A;  2Y8H A;  4XT2 A;  4EEU A;  2JKT M;  5DJT A;  2J80 A;  4MDZ A;  3LIA A;  3BQA A;  3EEH A;  4KQO A;  1OJ5 A;  2V1B A;  2W1R A;  4HP9 A;  3GDI A;  1S4R A;  3IS2 A;  5AVF A;  2W1T A;  5AVE A;  4CLC D;  4OOL A;  1YSP A;  2BAS A;  4EUV A;  1TS8 A;  5J4E A;  3OOV A;  3E98 A;  2M7V A;  1G28 A;  4DJ3 A;  1F9I A;  3A0S A;  4HH3 A;  4YNR A;  2QJ5 A;  4HJ4 A;  1V9Z A;  4R3A A;  4B93 A;  2PR5 A;  4NEE D;  4HHD A;  4HP4 A;  3LIB A;  3LYX A;  3ULF A;  3K3D A;  4CQH A;  3LR4 A;  1S67 L;  4L9F A;  2QYB A;  1TF1 A;  5HDS A;  2GNX A;  3PYP A;  4P6Z S;  4GS9 A;  3EQU A;  3A0R A;  3MJQ A;  2INW A;  1MZU A;  1T1B A;  3KSG A;  1LSX A;  1TS6 A;  4EXO A;  2V0W A;  1P97 A;  2O0Y A;  2VX8 A;  3NHQ A;  4O0P A;  3F1N A;  4F3L A;  3V67 A;  1ODV A;  3CIT A;  4H6J B;  3ICY A;  4WF0 A;  3TE8 A;  2H28 A;  4CLC A;  4O8G A;  4GHI A;  5HWW A;  1MC0 A;  4NKP A;  4JGP A;  4DJ2 A;  2CMN A;  1N9L A;  4CLC E;  4XT2 B;  4EW7 A;  3BY8 A;  3G6O A;  3P01 A;  3MF0 A;  4HOI A;  4WEL A;  4DN0 A;  4BMW A;  4BBV A;  3HJI A;  2PYR A;  2VZW A;  4WUJ A;  2V0U A;  3IS2 B;  3T50 A;  2W1T B;  2I9V A;  3S7P A;  2OWJ A;  3E4Q A;  4FOF A;  2EWV A;  3T4J A;  3NOP C;  3BY9 A;  3UE3 A;  4ME4 A;  2ZOH A;  5AJG A;  1OTI A;  1OTD A;  1N9N A;  3BQ8 A;  4OOM A;  4UEY A;  2VLG A;  4LPZ A;  1S1Y A;  2L0W A;  3H82 A;  2GX5 A;  3LR3 A;  1DP8 A;  4GCZ A;  4HH2 A;  3T4K A;  5DFX A;  4GS9 B;  1XJ3 A;  3S7Q A;  4L9G A;  4HIA A;  3PHY A;  4R6L A;  1OTE A;  2LB9 A;  2J3W A;  3LFV A;  2P08 A;  3BW6 A;  4G3V A;  4EQ1 A;  3FPW A;  5IU1 A;  1NRJ A;  2P7J A;  2O9A A;  3F1N B;  5I5L A;  4F3L B;  4CLC C;  4ARZ A;  3CI6 A;  1LL8 A;  3VE4 A;  4MN6 A;  1OJG A;  3S7N A;  2VKS A;  2OWH A;  4CLC B;  4GHI B;  2R78 A;  2A2L A;  3PBN A;  3KSH A;  3W2Z A;  2Z6D A;  2D02 A;  2O99 A;  2XA7 M;  3RTY A;  3E4P A;  3NOT C;  1YSQ A;  3CLO A;  1IOU A;  2ZMV A;  3EQV A;  3CUE A;  2KLI A;  3MMH A;  3OCL A;  5KIZ A;  4BWI A;  2KDK A;  2VV7 A;  1LSV A;  2GJ3 A;  3B47 A;  4HJ3 A;  4I38 A;  4O01 A;  3FPV A;  3VV4 A;  4LRY C;  3FG8 A;  3RFB A;  5TJJ A;  4GW9 A;  2V1A A;  3LIF A;  5HL6 A;  4WEJ A;  2W3D A;  3F1O A;  2PD8 A;  1STZ A;  1T1C A;  1OPX A;  3MQO A;  5F5Y A;  4IUH A;  1UWN X;  4Y3I A;  3D3O A;  5G4Y A;  2GZA A;  4EEP A;  3H82 B;  3KSI A;  2FZ0 A;  5TBM A;  1YKD A;  2WKR A;  2QWS A;  2HF6 A;  4G3K A;  4HQA A;  1XJ2 A;  1YAX A;  4L9E A;  2OOL A;  3EWK A;  4JGO A;  5J3W A;  2D01 A;  2L1M A;  3R7W B;  1NWZ A;  1TD5 A;  5L8M A;  4I5S A;  2JHE A;  2PHY A;  5DKK A;  2JKR M;  3UB6 A;  1BYW A;  1OT6 A;  1XFQ A;  2VJW A;  1P9W A;  2DMW A;  3O5Y A;  5LBR A;  3NOU C;  2W3G A;  3NJA A;  3BJN A;  5HSQ A;  3F1P A;  3ZYT A;  2JKR I;  2M1C A;  5DJU A;  4ARZ B;  2XRO A;  4UQI M;  1XJ4 A;  4R38 A;  3OLO A;  2ZBB A;  2VEA A;  2VGL M;  3OCN A;  4MN7 A;  1P9R A;  1X0O A;  3C2W A;  2J3T D;  3T4L A;  2O9C A;  3PXP A;  4LRX C;  3D72 A;  3LIE A;  3A0V A;  2HV1 A;  3CUE C;  3LIC A;  1DRM A;  2W0N A;  1LT0 A;  2VA0 A;  5EFW A;  2KX6 A;  4EES A;  5FL3 A;  2EWW A;  3HJK A;  1NLY A;  1GSV A;  1D06 A;  1GSX A;  2W3F A;  4I3I A;  2OAP 1;  3JVV A;  3U2A A;  5F69 A;  2A24 A;  3F1O B;  2PDR A;  2ZMF A;  3IBJ A;  2XA7 S;  2LB5 A;  4Q0I A;  3T4Q A;  3VOL A;  1WA9 A;  1P0Z A;  4GJ4 A;  4BBT A;  3VE3 A;  2JN7 A;  3PR6 A;  4GLQ A;  1LSW A;  2XRN A;  3GEC A;  3R7W A;  5TBM B;  3T4T A;  3C30 A;  4IHQ A;  5HD3 A;  4MMN A;  3BWL A;  5J7E A;  4EER A;  4Z1W A;  2K31 A;  4YWZ A;  1DP6 A;  2K2N A;  5HD5 A;  3MQQ A;  4WLA A;  3TW8 A;  1H8M A;  4WN5 A;  4PKY A;  4WL9 A;  1W63 M;  1UWP X;  3F1P B;  4WEK A;  3P7N A;  1H3Q A;  4HNB A;  2QKP A;  4ETX A;  1EW0 A;  3PBR A;  4MN5 A;  4B9O A;  1ZTU A;  3MFX A;  3PBQ A;  2NUP C;  2ZOI A;  4M4X A;  1NLZ A;  3UB7 A;  4BBU A;  4I39 A;  4IUK A;  2IA2 A;  5KSH A;  5HZH A;  1DP9 A;  1KOU A;  4FSF A;  1OTB A;  4IJG A;  2B02 A;  2W3H A;  2QJ7 A;  4UQI S;  4HJ6 A;  2M7U A;  1F5M A;  1IFQ A;  2HGV A;  4HY8 A;  1OTA A;  1W63 Q;  2JKT I;  2VGL S;  4Y2F A;  1VHM A;  4NXE A;  2KOI A;  3FC7 A;  2A24 B;  2YKH A;  5DF9 A;  3LI9 A;  3LR0 A;  4L0L A;  4NXB A;  3E0Y A;  4AFI A;  2PT7 A;  4Y5F A;  2QHK A;  4KUK A;  3PBT A;  3TRC A;  1F98 A;  4ZRR A;  5HDC A;  2V9A A;  4LRZ E;  3EGD C;  3HCY A;  2P04 A;  1VB6 A;  5DKL A;  4EU0 A;  4KQD A;  1S1Z A;  4PAU A;  3KSF A;  2J3T C;  5A8B A;  1T18 A;  3KO6 A;  4DMZ A;  5HPF A;  4PKY G;  3KYZ A;  5G4Z A;  4KUO A;  3CWF A;  1T19 A;  2VV6 A;  3EEA A;  3RH8 B;  1V9Y A;  3K2N A;  4Q0J A;  3H7W A;  1T1A A;  3PBO A;  4JGQ A;  2YKF A;  2VV8 A;  5F68 A;  4ETZ A;  5IS1 A;  4G3W A;  3K3C A;  3DBA A;  3E4O A;  2EA9 A;  3C8C A;  4Q0H A;  3OC2 A;  2PD7 A;  3MQ0 A;  2K7S A;  3MR0 A;  3EOI A;  1GSW A;  2G7U A;  1XFN A;  1S66 L;  5MC7 A;  3UMD A;  3LR5 A;  2NUT C;  1TS0 A;  1S4S A;  2B18 A;  3R4K A;  4P6Z M;  5HPI A;  4NXG A;  3PBS A;  4NXF A;  4R70 A;  2PR6 A;  3LUQ A;  3TJZ C;  3OBF A;  4BJP A;  3B42 A;  2OAQ 1;  4K08 A;  3B33 A;  4II7 A;  4QPR A;  5HDD A;  5K5B A;  3IBR A;  2WKQ A;  2Y79 A;  2W27 A;  3T4O A;  3UB9 A;  5DFY A;  5HWV A;  3MXQ A;  3S7O A;  3SW1 A;  2WKP A;  4EET B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...