4L9GA

Structure of ppsr n-q-pas1 from rb. sphaeroides
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
250
structure length
250
Chain Sequence
PSLAPDLVRDLIATAADISLLVSQEGVVREVMANPHHPSFGQLSEWEGRPLEEVLTAESVAKFRLRSEGLEPGRGSVAVELNHIDPRSFEFPIRYILHRLPADRSILMLGRDLRPIAEVQQQLVAAQLAMERDYETQREMETRYRVVLDVSRDPMVLVSMSTGRIVDLNSAAGLLLGGVRQDLLGAAIAQEFEGRRRGEFMETMTNLAATESAAPVEVLARRSQKRLLVVPRVFRAAGERLLLCQIDPAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Transcriptional regulator, PpsR
publication title Multi-PAS domain-mediated protein oligomerization of PpsR from Rhodobacter sphaeroides.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
total genus 83
structure length 250
sequence length 250
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13188 PAS_8 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4l9gA02
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4l9gA01
2J80A 3D72A 3K3CA 4EEPA 5J7EA 4HNBA 4NXBA 3A0RA 1DP6A 1LSXA 5F5YA 5TBMB 4EEUA 4JGRA 1BYWA 1V9ZA 1OJGA 3FC7A 1JNUA 4B9OA 1UGUA 4LRXC 3G6OA 3PYPA 2PR6A 4EW7A 3K3DA 4HJ4A 4HP4A 1LSWA 5G4YA 4HOIA 5J4EA 2VEAA 3KX0X 5IU1A 1OT6A 3LUQA 2D01A 1T1AA 3PHYA 3A0SA 5HZHA 4MN6A 3FG8A 1S66L 4HH2A 3BY9A 4KUKA 1OTBA 3H82B 1DP9A 3F1OB 2ZBBA 5DKKA 1ODVA 2V0WA 4LRZE 3UB9A 2W0NA 4HHDA 5KIZA 5HWVA 5A8BA 3E4OA 3UB6A 2L1MA 1GSWA 2Z6CA 3LIEA 1OT9A 2YKHA 1KOUA 3C2WA 2KDKA 5HD5A 3LIFA 3ZQ5A 4L9FA 4DJ2A 4WN5A 5G4ZA 4HIAA 3ULFA 1XJ4A 4BBUA 3E4QA 2Z6DA 4GHIB 1OTAA 1EW0A 3A0VA 2VV6A 3RTYA 4RQ9A 4LRYC 1V9YA 4YWZA 2P7JA 1P97A 4HQAA 4LLOB 3LI8A 3VE3A 3UMEA 3VOLA 4R38A 2R78A 1Y28A 2BASA 2PR5A 3LI9A 3GDIA 4R3AA 2A24A 3BY8A 1TS0A 1T1BA 2CMNA 2QKPA 3MJQA 4GHIA 3IS2A 2WKRA 3P7NA 4BBVA 1P0ZA 2VV8A 1F98A 1OTIA 3HJKA 2V0UA 3NOPC 2HV1A 5F69A 3LIDA 5DKLA 4I3IA 2L4RA 5HDSA 1N9NA 1DP8A 3LICA 3LIBA 5HDDA 2PD7A 3ICYA 2PYPA 4KQDA 3IBRA 2JHEA 1UWPX 4GCZA 4JGOA 2ZOIA 2M1CA 1TS8A 5J3WA 3H7WB 4XT2B 5IS1A 3F1PA 3HJIA 3MFXA 4GS9A 3UB7A 3MQQA 4I3JA 2YKFA 4EESA 3NHQA 1LSVA 4H6JA 1XFNA 2B02A 2A24B 1GSVA 1XFQA 1MZUA 3C8CA 1S1YA 1UWNX 1X0OA 3OLOA 3MXQA 4PKYG 3UB8A 4HJ3A 4EQ1A 3IS2B 2L0WA 3F1NA 2PYRA 3H7WA 3MR0A 4GW9A 5HD3A 4WL9A 4XT2A 1T1CA 1XJ3A 3CLOA 4HP9A 4MN5A 3GECA 4NXEA 5I5LA 3VE4A 4L9GA 4I38A 2GJ3A 2JN7A 3EWKA 4L9EA 2K7SA 1VB6A 1TS7A 3NOUC 4PKYA 1XJ2A 2ZOHA 2PDRA 4HY8A 3MQOA 4HH3A 5F68A 3UMDA 3F1PB 3UE6A 2V1AA 1S4RA 4E04A 4K08A 4GS9B 3EEHA 4M4XA 4KUOA 3LYXA 1T18A 3NJAA 4H6JB 3SW1A 3RH8B 2QJ7A 2QJ5A 3H9WA 4NXFA 2PHYA 5DJTA 4EETB 1S1ZA 2H28A 1DRMA 4JGPA 4WF0A 4F3LB 4WLAA 4BBTA 1LT0A 2INWA 2V9AA 4HI4A 4R6LA 2QHKA 1F9IA 4I3AA 3F1NB 3BWLA 2V1BA 1G28A 2KX6A 3NOTC 4I5SA 4DJ3A 4NXGA 5HWWA 2VLGA 3B33A 1LL8A 1TS6A 4JGQA 2QWSA 5AVEA 4I39A 4R70A 5HWTA 4F3LA 1OTEA 2W27A 5TBMA 3CWFA 2EA9A 3CAXA 3T50A 1N9OA 1T19A 1D06A 3E4PA 4EERA 1N9LA 2OOLA 2D02A 1NWZA 1OJ5A 2OWJA 1S4SA 5HDCA 5F6AA 1XJ6A 1OTDA 4LPZA 4EXOA 2VV7A 4WUJA 4HJ6A 1WA9A 2I9VA 3H82A 3F1OA 3LIAA 5DJUA 2OWHA 1GSXA 5EFWA 1S67L 2PD8A 2WKQA 5AVFA 1D7EA 2WKPA 5HSQA
chains in the Genus database with same CATH superfamily
2J80A 3UN7A 2ZC3B 3K3CA 3Q07A 3HLGA 3SS3A 2HDSA 4PM5A 1G5UA 4ZJ2A 3JPUA 3UDIA 3ZVWA 1DJCA 4KG6A 4Y0UA 1W7FA 4Y3IA 1V9ZA 1OJGA 4B9OA 1VEUB 1UGUA 4LRXC 3PYPA 3CITA 1TD5A 4HP4A 5U47A 2BG1A 2EXBA 2VGKA 2GX5A 2HF6A 2HGVA 5G4YA 4RYEA 1I5QA 2VEAA 3IX3A 5AQAA 5IT5A 5IU1A 1OT6A 2HJEA 1KVLA 1IYQA 3EGDC 2A2LA 2XGNA 1S66L 4KUKA 3IX4A 2Y2NA 1DP9A 4A5RA 3SZTA 4X25A 4HHDA 3E4OA 3UB6A 3P09A 3W2ZA 2E8JA 3QP6A 3VP0A 1YM1A 5EPHA 1A0KA 3IBJA 4G3VA 5FQMA 2KDKA 5HD5A 3I7JA 5DTTA 3IHBA 2IWDA 4DJ2A 1M40A 4WN5A 3SS5A 3ULFA 1K25A 2HDRA 1PRQA 4Z1WA 4WM9A 1PI5A 4KZ3A 4N9LA 3KSIA 5FATA 4OQGA 3IXDA 1RP5A 4YWZA 2P7JA 1GHIA 5CGXA 4DRTA 4LLOB 4UQIM 2P9VA 1W8QA 4GJ4A 4O0PA 1FOFA 3PBSA 3V5MA 4S2PA 1ES2A 3N8LA 4MN7A 1MWRA 3GDIA 3BM6A 1PNEA 1ERQA 1E25A 5K5BA 2O9AA 1PFLA 1TS0A 3ZYTA 1D1JA 4WMCD 3WWXA 2ZQAA 2CMNA 1FILA 3CPTA 3PBQA 5FQIA 4R0QA 4BBVA 2EX6A 1NZOA 2V0UA 1K55A 3SS4A 5F69A 5HFOA 4CQHA 5HDSA 3LICA 3HLEA 5GLDA 3G2YA 3N6IA 3ICYA 1KE0A 3IBRA 2I72A 1UWPX 5CGWA 1HD8A 4GCZA 3MS6A 5EM0A 2ZOIA 3DBAA 1KVMA 4XT2B 3F1PA 2XSSA 4WYYA 1HTZA 4GLQA 2ZM0A 5CEDA 1IFQA 4EESA 2P9VB 3ZVTA 5CEBA 4E6XA 1XFNA 3UPPA 3KSGA 4QHCA 4NETA 1GSVA 1IYSA 5TFQA 1H8MA 4X53A 4KZ8A 1S1YA 2O99A 5HAIA 1UWNX 5DVAA 1K38A 1NRJA 3UPNA 2HP9A 4GD6A 1KGGA 4PKYG 3CPTB 2OLVA 1AXBA 4HJ3A 2Q9NA 2Q9MA 2PYRA 4YINA 3H7WA 2WGVA 1PYYA 2WYXA 2DNSA 1XJ3A 3C38A 3WS5A 1AWIA 2JKRM 2Y2PA 1GHMA 3OPLA 5FAPA 4Y17A 3VE4A 2XD1A 2DRWA 1YLWA 4DE3A 3TOIA 4Y2FA 2K7SA 2ZQDA 3BEBA 4EBPA 4K91A 5FA7A 3ITBA 4HY8A 2IWBA 1XXMA 4HH3A 3G34A 5F68A 3UMDA 5A93A 3F1PB 4K0WA 1L0GA 4K08A 3ZG7B 1XGIA 4DMZA 2X02A 3ZG0A 3S7NA 3A3FA 4G3KA 3NJAA 3SW1A 1TVFA 3P98A 4GKUA 2QJ7A 3KSHA 4JPMA 2O9BA 1GA0A 2H5SA 5EOEA 5E43A 1DRMA 4OVDA 2ZL1A 5GL9A 5DTKA 4BBTA 3PBNA 4OQHA 3NI9A 3VFFA 2INWA 2QZ6A 3O87A 4R6LA 2XLNA 2PRFA 4S2KA 2QHKA 3IQAA 4PHTA 3U2AA 1EROA 3T4TA 4CLCC 4I3AA 1PWGA 3TW8A 1NXYA 4GDBA 3UPOA 2QPNA 1G28A 4DDYA 3MXSA 3VOZA 2LB5A 3T1SA 1SKOA 3NOTC 4I5SA 2JCHA 1K54C 3M6BA 3BFGA 2R9WA 5HWWA 1YAXA 3ZHHA 4OOYA 3M6HA 3B33A 1IEMA 3IF5A 4P6ZM 2VGJA 1TS6A 1CQAA 2QWSA 4X6TA 3UE1A 5AVEA 4BENA 4FCFA 4X56A 4S2OA 4R1GA 3Q7VA 4LFUA 2XK1A 3D4FA 3MF0A 4BD0A 4UQIS 5AQBA 1GCEA 3M2KA 4QU3A 3T4QA 3UY6A 4JLFA 2EA9A 4U0XA 3CAXA 4MBKA 5F82A 1T19A 3CZDA 1ESIA 4NEED 2NUPC 1BTLA 2OOLA 4EUZA 2HDQA 5TGFA 5HPIA 4S2JA 3LEZA 2ZL1B 2JKTI 4C3QA 5F6AA 4ETXA 1CF0A 3MBZA 3PTEA 4HJ6A 2C5WB 5C5KA 1WA9A 3H82A 1J3WA 5F1FA 4R4RA 3F1OA 3HVFA 3S7OA 1ZKJA 2OWHA 3A3JA 1S0WA 2ZM8A 1I2WA 1SKOB 1K56A 1JWVA 2PT7A 3HUNA 4E6WA 3QP1A 1W63Q 4X55A 3Q7ZA 1XA1A 3L9KA 4EV4A 3QP5A 3A3EA 3FKVA 1FCNA 3D72A 5CXWA 4C6YA 5J7EA 4HNBA 4KQQA 5EVIA 4UA7A 2J7VA 2W3EA 3NDEA 2JKGA 2Y2JA 3OOVA 3L7HA 3V67A 2HPBA 1ERMA 3FC7A 2WGWA 2HP5A 3G6OA 4EBLA 3V50A 4XUZA 2PR6A 3T4SA 3VMAA 3IWOA 5FEGA 3BW6A 4OQ0A 2Y59A 4E3LA 1YSPA 1LSWA 1STZA 2UWXA 4E3KA 3IXBA 5J4EA 3BFCA 3R7WA 1KE3A 3D9YA 2JKFA 4Y5FA 2Y2MA 5HZHA 2XFTA 4ME4A 4D2OA 5JYPA 3BY9A 4LCMA 3NCKA 4E3OA 4KQRA 1L3LA 3H82B 3F1OB 2EFXA 2MJ6A 1PZPA 4QB8A 2Y8HA 5DKKA 4MDZA 1ODVA 4GDNA 4DKIA 5HWVA 1KGFA 4KQOA 4JKTA 1NLZA 5FEFA 3FPWA 2WK0A 2WUQA 2VGLM 1OT9A 2YKHA 1VEUA 1L0EA 1KOUA 5FI2A 4YFMA 3LR3A 1FQGA 2XA7M 5FSRA 5GLAA 2JC7A 3ZQ5A 5G4ZA 3N7WA 1XJ4A 3ZCZA 3D3OA 3C7VA 1JWZA 2Z6DA 1O7EA 3GMWA 1ALQA 4PM6A 2EX8A 1F5MA 2VV6A 3A0VA 3CG5A 1KDSA 3QNCA 2WKEA 4LRYC 2WGWB 1V9YA 5D3OA 2Y2KA 2OLUA 5FAOA 1L2SA 1ACFA 4YOFA 3LI8A 3VE3A 4OLGA 3O5YA 3UMEA 4KENB 4EWFA 3R7WB 2R9XA 2JE5A 4R38A 2R78A 3QP8A 2PR5A 2J3TD 3LI9A 3BFFA 4U0TA 5GHYA 3LR4A 4IEDA 3BY8A 4BLMA 3PBTA 4OLDA 3S1YA 5CTMA 1K56D 3HLBA 2IWCA 3AGDA 4ESPA 4PM9A 4MBFA 5KSHA 3GSGA 5CECA 1BLPA 1YMSA 4P0MA 1MXOA 3P7NA 2V8CA 4P6ZS 5EVID 4OPZA 1OTIA 4PM7A 4FUWA 3QP4A 1FCOA 3WS4A 2HV1A 4OKPA 4R4SA 3RFBA 5DKLA 2XF3A 3BYDA 3LY3A 3G32A 3LIBA 3MZFA 2XROA 3AGFA 2PD7A 5HPFA 3NECA 2PYPA 2ZQ8A 3CJMA 4PM8A 4UAAA 4KZBA 1TS8A 4S2NA 2VA0A 3HJIA 2C6WB 3UO9A 3MQQA 4KZ6A 4I3JA 5L09A 3RJUA 1RGYA 3C7UA 4Q0JA 1LSVA 1VQQA 3A3DA 3IHAA 1MPLA 4HESA 5J8XA 5LBRA 2B02A 3IWIA 4MNRA 1S6RA 3HCYA 1MZUA 2J3WA 1YQSA 2OSUA 3IF6A 3FPVA 2XQZA 3PXPA 2Y2GA 2H0YA 3OLOA 3MXQA 3S7PA 3IX8A 1K0KA 1ZC2A 3UB8A 2PBYA 3N8SA 1N4OA 2L0WA 1P9WA 2VX8A 3G2ZA 2EFUA 4Y15A 1SCWA 3MR0A 4WL9A 4XT2A 3NIAA 4K0XA 5HW3A 3G30A 4RX3A 3T12B 3T4OA 1FR1A 4I38A 2JN7A 5GLCA 4L9EA 4L0LA 4ARZA 1VB6A 3ZG5A 3NOUC 3MQOA 2XH9A 4XXRA 4WZ5A 1Q2QA 2M7UA 2IA2A 1YSQA 5GLBA 1H3QA 1K6RA 2GNXA 1XA7A 3GVBA 5CGSA 3IH9A 3LFVA 2OV5A 1W63M 2WKHA 2QJ5A 4FTXA 1YLJA 4NXFA 2ZMVA 4EETB 2J8YA 4WELA 4MCWA 4WF0A 4F3LB 4LV0A 2Y2HA 5MC7A 4ZJ1A 5FI6A 3IF6B 2RL3A 3NC8A 1LT0A 4KZ7A 5FDHA 5L10A 1JWPA 3VP1A 3MKEA 3OZHA 1F9IA 1NRFA 4ZTKA 5KMWA 4OH0A 3CUEA 3BWLA 4H8RA 3SH9A 3MKFA 4RX2A 1MBLA 1CJFA 5BOHA 2KX6A 3B3XA 2VKSA 2Z2MB 4CJNA 3ITAA 4RA7A 4IUHA 3EQUA 2VLGA 5E2GA 4ARZB 4GOGA 1ES3A 4JGQA 4R70A 4OPRA 3KSFA 3BLMA 2JKRI 1H8YA 2XRNA 2HZ5A 1OTEA 1K57A 4PPRA 4GD8A 5TBMA 2FFYA 3VSKA 3ZNYA 4E3MA 3P01A 3WS0A 4B93A 3BQ8A 2Y4AA 1PW8A 1K4FA 3IT9A 5AQ9A 1N9LA 1VETB 3VP4A 3CMZA 5DF7A 3OCNA 3IXHA 4IHQA 2OWJA 2NUTC 4OP8A 1YLZA 1GHPA 4AFIA 4BWIA 1XJ6A 4LPZA 2FFFB 1KE4A 4JF5A 3UB5P 3UNWA 3W8KA 2I9VA 3LIAA 1G68A 5E2HA 2FH5A 2ZM2A 3S4XA 2K2NA 3IXGA 2J9PA 1IKIA 1K55C 3QNBA 1S67L 2H10A 4QY5A 3R4KA 5HAQA 5AVFA 4E3IA 1D7EA 4UA6A 3SH7A 3WRZA 4IUKA 1CI8A 1I2SA 2PU4A 4EEPA 4BJPA 5CTNA 5L2FA 3KO6A 4NXBA 1LSXA 4DE0A 2QYBA 4CLCB 5TBMB 4EEUA 4JGRA 1BYWA 4Q0IA 3HLWA 1PWCA 1CEFA 1FSWA 3EGXC 3AGEA 5IHVA 1HLUP 2V20A 4MBHA 5FAQA 5FQKA 3KX0X 4QJGA 3LUQA 2D01A 3Q81A 2WZZA 3HUOA 3A0SA 3E2LA 4MN6A 3FG8A 5A92A 4ZRRA 1CEGA 1OTBA 4DE1A 5L8MA 4R3BA 2X01A 4PAUA 2V0WA 1Q2PA 3VSLA 2W0NA 1NYYA 5HL6A 2V2FF 2L1MA 3PBRA 1GSWA 2Z6CA 5M19A 4WEKA 4Z9QA 5G18A 3LIFA 2HP6A 2ZD8A 4L9FA 2PAVP 1FR6A 4HIAA 3VFHA 2DCFA 4BBUA 4GHIB 1OTAA 1EW0A 4F94A 3RTYA 4G3WA 5F1GA 4RQ9A 3WS1A 3DAVA 4HBTA 2AVXA 3EQVA 5DFYA 1QMFA 2X71A 3T4JA 4X69A 3DWKA 1IYOA 3G35A 1W5DA 5CERA 1Y28A 1YMXA 3T1XA 2BASA 3MXRA 3LY4A 4R3AA 2A24A 4YNRA 5A91A 1G6OA 5DF9A 2B95A 3OBFA 3PR6A 1Z09A 1BLCA 1SDNA 2Q0OA 1T1BA 4HBUA 3TE8A 5EV0A 1H8ZA 4ZBEA 4FH4A 3MJQA 3MQ0A 4O7DA 5TJJA 5KSCA 1TDGA 5FDSA 2VV8A 1N9BA 1F98A 4N9KA 5EE8A 5EM1A 3OPRA 4NG2A 4GB7A 3OPHA 1O07A 1H5XA 1HZOA 1LL9A 1NJ4A 2WAFA 1NYMA 3MZEA 4KQDA 2Y2IA 2JHEA 3W4OA 3MMHA 3DWZA 3BRMA 1SZVA 5J3WA 1Y54A 2VZWA 3K2NA 3UB7A 3U4LP 2EXAA 3UE0A 4LV1A 2Y55A 2ZC4B 1CI9A 3HBRA 4H6JA 1JTGA 2Y2LA 3TG9A 5HX9A 2A24B 1F2KA 2HDUA 3C8CA 3B42A 1XPBA 4RVAA 2W3GA 2ZQCA 4Y7PA 5EECA 4B4XA 3NY4A 3C4PA 2OAQ1 2PU2A 1NY0A 1X0OA 1ZHHB 2J3TC 4N1HA 3TSGA 4JXSA 5TR7A 1BT5A 4GW9A 5HD3A 3PAGA 1XX2A 3CLOA 4HP9A 2PBDP 4MN5A 1SHVA 2WZXA 3W4PA 3GECA 1E4DA 4NXEA 4ETZA 5EOOA 2XFSA 2B18A 1BSGA 3PAEA 3Q82A 5EVIC 1ES4A 4LENA 1W79A 1XJ2A 2ZOHA 2PDRA 3BLSA 2DMWA 1TDLA 3OPPA 3UE3A 4QWOA 3WS2A 3OC2A 4O01A 4DE2A 4M4XA 1FCMA 3E2KA 5CHJA 3LYXA 2G2WA 1T18A 2EX9A 4H6JB 1LI9A 2W1TB 4B88A 1DJBA 1BLSA 4B4ZA 4LGWA 2V8FA 3BFEA 1PW1A 1S1ZA 3EEAA 2P04A 1MWUA 3LEQA 4JGPA 4R3JA 4WLAA 3A3IA 1WYBA 2W3DA 3ZGAB 2EWWA 1SKFA 2RCXA 3HLFA 3KYZA 2OAP1 4OQIA 2V1BA 1PZOA 3RXXA 1K6SA 4LV2A 3LR5A 3KYQA 4NXGA 3EOIA 2VJWA 2W3FA 2ZJ9A 1K4EA 1WE4A 3O86A 4I39A 3ZG8B 3LR0A 3LCEA 3FKWA 1PIOA 4F3LA 3T1QB 4JXGA 1WYCA 2VK3A 4KG2A 5E2EA 2XDMA 3T50A 2BTFP 3FYZA 1BULA 2A49A 4X68A 2ZC6B 3DTIA 3HUMA 4N92A 5HAPA 4DXCA 1OTDA 1JTDA 4KZ9A 2VV7A 3T1RA 2XD5A 2O0YA 5CX7A 3W4QA 4QPRA 4WUJA 4S2LA 5HARA 3RXWA 3LGOA 4QY6A 2V1ZA 5DJUA 2ZLYA 4IVKA 2EX2A 4II7A 5EFWA 2CC1A 1NLYA 5A90A 3B47A 1FIKA 1BUEA 2WKPA 5HSQA 1VETA 3S7QA 5DTSA 5CHMA 3GR2A 2P08A 5FQ9A 3ZFZA 5EVLA 2HJ9C 3A0RA 1DP6A 1MC0A 5F5YA 1J9MA 4Q8IA 4S2NC 4WZ4A 2W1RA 1P9RA 1OPXA 1KDWA 4P85A 5GHXA 2VGLS 1ZG6A 1JNUA 1OMEA 5AJGA 4JXWA 4EW7A 3K3DA 4HJ4A 4IVIA 4UHUA 1EWZA 4JXVA 2XA7S 1MY8A 4OONA 3T4KA 4HOIA 1BZAA 4JBFA 3PHYA 1T1AA 5M1AA 3IF6C 1W8YA 4NKPA 4DN0A 2KLIA 4HH2A 2Y79A 3HREA 3V39A 3TRCA 1KGEA 1M6KA 1U60A 4OP5A 3G31A 2ZBBA 3FV7A 4LRZE 3UB9A 4CLCA 3WRTA 5KIZA 1C3BA 1ZG4A 5A8BA 1JVJA 3LIEA 3MZDA 1ES5A 5EVEA 1K54A 3C2WA 4KZ5A 2ZMAA 1ONGA 2ZC5B 4UEYA 1E3UA 3N8RA 4D60A 3BECA 3E4QA 2Y91A 4WZ5C 4IBXA 5JYOA 1IKGA 3PBOA 1RGZA 1IYPA 4EU0A 1TEMA 5FI7A 1IOUA 3S22A 4UA9A 1P97A 2M7VA 5FQJA 4BMWA 4HQAA 1SDEA 3Q1FA 3DTMA 3VOLA 3N4IA 5FQQA 4DXBA 2B5RA 2ZMFA 1MWTA 5AQ7A 1GA9A 2BLSA 1YKDA 4X1MA 3GRJA 4Y13A 1LLBA 3IWQA 4EUVA 2EWVA 2QKPA 3CUEC 4C75A 4EBNA 4GHIA 3IS2A 2WKRA 1P0ZA 4E3JA 3ZDJA 4R23A 3HJKA 1CK3A 2KOIA 3NOPC 3HL9A 4KG5A 1YT4A 3LIDA 4NK3A 1YPRA 4I3IA 1L0FA 2L4RA 1DY6A 1HVBA 4OPYA 4P87A 1N9NA 1DP8A 3HLDA 2ZQ9A 5HDDA 4DF6A 3CI6A 1TF1A 4JF4A 2H0TA 1MKIA 3VP2A 1L0DA 3O3VA 3KYEA 2XR0A 3C4OA 4JF6A 3V3RA 1K57C 4IJGA 4JGOA 4ZJ3A 3FZCA 3V3SA 2M1CA 3H7WB 3T4LA 3QP2A 1LL5A 5IS1A 3JVUA 5KZHA 3MFXA 4GS9A 3C30A 4ZDXA 1XKZA 4BL2A 2YKFA 3NHQA 1DJAA 3ZNTA 2GZAA 4KZAA 5CHUA 4ID4A 4GNUA 4U3TA 4BL3A 1XFQA 1LI0A 1EI5A 4CLCD 2G2UA 3FWLA 1QMEA 4O8GA 3BJNA 1PWDA 4EQIA 3DW0A 5GHZA 3MSHA 3IH8A 4MLLA 2WADA 2ACGA 4EQ1A 3IS2B 4Y0OA 1NZUA 4GN2A 3F1NA 1E3UD 3BQAA 2W3HA 3DTKA 3OCLA 5HL1A 1T1CA 3LO7A 4OPQA 3SH8A 3ZG9B 1XP4A 1H0MA 4CPKA 3VOYA 5I5LA 4L9GA 2GJ3A 3EWKA 4KZ4A 1TS7A 5I94A 4PKYA 1VM1A 4IBRA 3DTEA 4P6BA 3UE6A 2V1AA 1S4RA 4E04A 3NBLA 4GS9B 3EEHA 4KUOA 2UV0E 2JKTM 4FH2A 5FASA 4OOLA 2WKIA 3CHWP 3RH8B 5L07A 2Y2QA 4S2MA 3H9WA 4QD4A 2PHYA 5DJTA 1FSYA 3M2JA 4FOFA 2H28A 4WBGA 3Q7VB 4HEFA 1G6AA 4LV3A 5DFXA 5DF8A 1MWSA 1PI4A 4X1LA 3BFDA 4DDSA 2WAEA 1BLHA 4PMAA 2P74A 4XUXA 2V9AA 4HI4A 4MEZA 4N1XA 2Y2OA 3F1NB 3NDGA 3UDFA 5E2FA 4DJ3A 2XEPA 2ZQ7A 1Z6FA 4GZBA 1XGJA 3E0YA 2W1TA 4OOMA 1LL8A 1Y4OA 5EUAA 1YLYA 3VP3A 1LHYA 2JBFA 4LCLA 4WEJA 5HWTA 5F83A 1MKMA 1ZTUA 2W27A 3UDXA 2A3UA 1YLPA 4BD1A 2LB9A 3CWFA 3SOIA 2K31A 3GV9A 1VHMA 3JVVA 1N9OA 5CRFA 1D06A 2Z2LB 3E4PA 4S2IA 3TJZC 4EERA 3QHYA 4Q0HA 3GQZA 5M18A 2D02A 3JYIA 2FZ0A 1NWZA 2G7UA 2O9CA 1YLTA 5EVIB 3C5AA 1OJ5A 1S4SA 3HLCA 5HDCA 3ISGA 1ESUA 4MMNA 4ZAMA 3GTCA 4EXOA 4FSFA 2J9OA 4FD8A 4CLCE 3O88A 4M3KA 3MFDA 1ONHA 1RCJA 4Y0TA 3E98A 1GSXA 2GDNA 4E3NA 1IELA 2WGIA 4BQMA 2QMIA 2PD8A 3NULA 5FL3A 4WMCA 3VV4A 2WKQA 2ZC7A 2E8IA 3G4PA
chains in the Genus database with same CATH topology
2J80A 3D72A 3K3CA 2P08A 4EEPA 5J7EA 4HNBA 4BJPA 2HJ9C 3KO6A 4NXBA 3A0RA 2W3EA 1DP6A 1MC0A 1LSXA 5F5YA 2QYBA 4CLCB 5TBMB 4EEUA 4JGRA 2W1RA 1P9RA 1BYWA 1OPXA 3OOVA 4Y3IA 4Q0IA 1V9ZA 3V67A 1OJGA 2VGLS 3FC7A 1JNUA 5AJGA 1UGUA 4B9OA 4LRXC 3G6OA 3PYPA 3CITA 1TD5A 2PR6A 3K3DA 4EW7A 4HJ4A 3T4SA 4HP4A 2XA7S 3EGXC 3BW6A 1YSPA 1LSWA 2GX5A 2HF6A 2HGVA 1STZA 5G4YA 3T4KA 4HOIA 5J4EA 2VEAA 3R7WA 3KX0X 5IT5A 5IU1A 1OT6A 3LUQA 2D01A 1T1AA 2HJEA 3PHYA 3EGDC 3A0SA 2A2LA 4Y5FA 5HZHA 4MN6A 4NKPA 3FG8A 4DN0A 1S66L 4ME4A 2KLIA 4HH2A 3BY9A 2Y79A 4KUKA 4ZRRA 3TRCA 1OTBA 3H82B 5L8MA 1DP9A 3F1OB 2MJ6A 2ZBBA 2Y8HA 5DKKA 4MDZA 1ODVA 4PAUA 2V0WA 4LRZE 3UB9A 4CLCA 2W0NA 4HHDA 5KIZA 5HWVA 5HL6A 3E4OA 3UB6A 5A8BA 2L1MA 4KQOA 1NLZA 3W2ZA 3PBRA 1GSWA 3FPWA 2Z6CA 3LIEA 2VGLM 1OT9A 2YKHA 4WEKA 3IBJA 4G3VA 1KOUA 3C2WA 3LR3A 2KDKA 5HD5A 2XA7M 3LIFA 4UEYA 3ZQ5A 4L9FA 4DJ2A 4WN5A 5G4ZA 4HIAA 3ULFA 1XJ4A 4BBUA 3E4QA 3D3OA 4Z1WA 2Z6DA 4GHIB 3PBOA 1OTAA 1EW0A 3KSIA 1F5MA 2VV6A 3A0VA 3RTYA 4EU0A 4G3WA 1IOUA 4RQ9A 4LRYC 1V9YA 4YWZA 2P7JA 1P97A 3EQVA 5DFYA 2M7VA 4BMWA 4HQAA 4LLOB 3T4JA 4UQIM 4YOFA 3LI8A 3VE3A 3O5YA 3UMEA 3VOLA 3R7WB 4GJ4A 4O0PA 4R38A 2R78A 3PBSA 1Y28A 2BASA 2J3TD 2PR5A 2ZMFA 3GDIA 3LI9A 4MN7A 4R3AA 2A24A 3LR4A 4YNRA 3BY8A 5K5BA 1G6OA 5DF9A 2O9AA 3PBTA 3OBFA 3PR6A 1YKDA 1TS0A 3ZYTA 1T1BA 3TE8A 4EUVA 5KSHA 2CMNA 2EWVA 2QKPA 3MJQA 3CUEC 3PBQA 3MQ0A 4GHIA 3IS2A 5TJJA 2WKRA 3P7NA 4BBVA 1P0ZA 2VV8A 4P6ZS 1OTIA 1F98A 3HJKA 2V0UA 3NOPC 2KOIA 2HV1A 5F69A 3LIDA 3RFBA 5DKLA 4CQHA 4I3IA 2L4RA 5HDSA 1N9NA 1DP8A 3LICA 3LIBA 5HDDA 3CI6A 1TF1A 2XROA 2PD7A 5HPFA 3ICYA 2PYPA 4KQDA 3IBRA 2JHEA 1UWPX 3MMHA 4IJGA 4GCZA 4JGOA 2ZOIA 2M1CA 1TS8A 5J3WA 3H7WB 3T4LA 2VA0A 3DBAA 2VZWA 4XT2B 5IS1A 3K2NA 3F1PA 3HJIA 3JVUA 3MFXA 2XSSA 3C30A 4GS9A 3UB7A 4GLQA 3MQQA 1IFQA 4I3JA 2YKFA 4EESA 3NHQA 2GZAA 4Q0JA 1LSVA 4H6JA 5LBRA 1XFNA 2B02A 2A24B 3KSGA 1GSVA 1XFQA 3HCYA 1H8MA 1MZUA 2J3WA 3B42A 3C8CA 2W3GA 1S1YA 4CLCD 2OAQ1 2O99A 1UWNX 3FPVA 4O8GA 3BJNA 1X0OA 3PXPA 1ZHHB 2J3TC 1NRJA 3OLOA 3MXQA 3S7PA 4PKYG 3UB8A 4HJ3A 4EQ1A 3IS2B 2L0WA 1P9WA 2VX8A 3F1NA 2PYRA 3H7WA 3BQAA 2W3HA 3MR0A 3OCLA 4GW9A 4WL9A 5HD3A 4XT2A 1T1CA 1XJ3A 3C38A 3CLOA 4HP9A 2JKRM 4MN5A 3GECA 4NXEA 5I5LA 3VE4A 4ETZA 3T4OA 4L9GA 2B18A 4I38A 2GJ3A 2JN7A 3EWKA 4L9EA 4Y2FA 2K7SA 4L0LA 4ARZA 1VB6A 1TS7A 3NOUC 4PKYA 1XJ2A 2ZOHA 2PDRA 2DMWA 4HY8A 3MQOA 3UE3A 4HH3A 5F68A 3OC2A 4O01A 3UMDA 3F1PB 2M7UA 3UE6A 2IA2A 2V1AA 1S4RA 4E04A 1YSQA 4K08A 1H3QA 4GS9B 3EEHA 4M4XA 4KUOA 2GNXA 4DMZA 2JKTM 3S7NA 4OOLA 3LYXA 4G3KA 1T18A 3NJAA 3LFVA 4H6JB 3SW1A 1W63M 3RH8B 2W1TB 2QJ7A 2QJ5A 3KSHA 3H9WA 4NXFA 2PHYA 2ZMVA 2O9BA 5DJTA 4EETB 4FOFA 1S1ZA 2H28A 4WELA 3EEAA 4MCWA 2P04A 1DRMA 4JGPA 4WF0A 5DFXA 4F3LB 5MC7A 4WLAA 2W3DA 4BBTA 3PBNA 1LT0A 2EWWA 2INWA 2V9AA 4HI4A 4R6LA 2QHKA 4PHTA 1F9IA 3U2AA 3T4TA 4CLCC 4I3AA 3F1NB 3TW8A 3KYZA 2OAP1 3CUEA 3BWLA 2V1BA 1G28A 2LB5A 2KX6A 3NOTC 2VKSA 4I5SA 3LR5A 4DJ3A 3KYQA 4NXGA 3EOIA 5HWWA 4IUHA 2VJWA 1YAXA 3EQUA 2VLGA 2W3FA 3E0YA 2W1TA 3B33A 4ARZB 4OOMA 1LL8A 4P6ZM 1TS6A 4JGQA 2QWSA 5AVEA 4I39A 4R70A 4WEJA 5HWTA 3KSFA 3LR0A 1MKMA 2JKRI 2XRNA 4F3LA 1ZTUA 3MF0A 1OTEA 4UQIS 2W27A 5TBMA 3T4QA 2LB9A 2EA9A 3CWFA 2K31A 3P01A 3CAXA 1VHMA 3JVVA 4B93A 3BQ8A 3T50A 1N9OA 1T19A 1D06A 3E4PA 4NEED 3TJZC 2NUPC 4EERA 1N9LA 4Q0HA 2OOLA 2D02A 2FZ0A 1NWZA 2G7UA 2O9CA 5HPIA 1OJ5A 3OCNA 4IHQA 2OWJA 1S4SA 2NUTC 5HDCA 2JKTI 5F6AA 4AFIA 4MMNA 4BWIA 1XJ6A 1OTDA 4LPZA 4EXOA 2VV7A 4FSFA 4CLCE 2O0YA 5CX7A 4ETXA 4QPRA 4WUJA 4HJ6A 5C5KA 3E98A 1WA9A 2I9VA 3H82A 3F1OA 3LIAA 5DJUA 3S7OA 2OWHA 1GSXA 2FH5A 4II7A 5EFWA 2K2NA 1NLYA 2PT7A 3B47A 1S67L 2PD8A 1W63Q 5FL3A 3VV4A 2WKQA 3R4KA 5AVFA 1D7EA 2WKPA 4IUKA 5HSQA 3S7QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J80 A;  3D72 A;  3K3C A;  4EEP A;  5J7E A;  4HNB A;  4NXB A;  3A0R A;  1DP6 A;  1LSX A;  5F5Y A;  5TBM B;  4EEU A;  4JGR A;  1BYW A;  1V9Z A;  1OJG A;  3FC7 A;  1JNU A;  4B9O A;  1UGU A;  4LRX C;  3G6O A;  3PYP A;  2PR6 A;  4EW7 A;  3K3D A;  4HJ4 A;  4HP4 A;  1LSW A;  5G4Y A;  4HOI A;  5J4E A;  2VEA A;  3KX0 X;  5IU1 A;  1OT6 A;  3LUQ A;  2D01 A;  1T1A A;  3PHY A;  3A0S A;  5HZH A;  4MN6 A;  3FG8 A;  1S66 L;  4HH2 A;  3BY9 A;  4KUK A;  1OTB A;  3H82 B;  1DP9 A;  3F1O B;  2ZBB A;  5DKK A;  1ODV A;  2V0W A;  4LRZ E;  3UB9 A;  2W0N A;  4HHD A;  5KIZ A;  5HWV A;  5A8B A;  3E4O A;  3UB6 A;  2L1M A;  1GSW A;  2Z6C A;  3LIE A;  1OT9 A;  2YKH A;  1KOU A;  3C2W A;  2KDK A;  5HD5 A;  3LIF A;  3ZQ5 A;  4L9F A;  4DJ2 A;  4WN5 A;  5G4Z A;  4HIA A;  3ULF A;  1XJ4 A;  4BBU A;  3E4Q A;  2Z6D A;  4GHI B;  1OTA A;  1EW0 A;  3A0V A;  2VV6 A;  3RTY A;  4RQ9 A;  4LRY C;  1V9Y A;  4YWZ A;  2P7J A;  1P97 A;  4HQA A;  4LLO B;  3LI8 A;  3VE3 A;  3UME A;  3VOL A;  4R38 A;  2R78 A;  1Y28 A;  2BAS A;  2PR5 A;  3LI9 A;  3GDI A;  4R3A A;  2A24 A;  3BY8 A;  1TS0 A;  1T1B A;  2CMN A;  2QKP A;  3MJQ A;  4GHI A;  3IS2 A;  2WKR A;  3P7N A;  4BBV A;  1P0Z A;  2VV8 A;  1F98 A;  1OTI A;  3HJK A;  2V0U A;  3NOP C;  2HV1 A;  5F69 A;  3LID A;  5DKL A;  4I3I A;  2L4R A;  5HDS A;  1N9N A;  1DP8 A;  3LIC A;  3LIB A;  5HDD A;  2PD7 A;  3ICY A;  2PYP A;  4KQD A;  3IBR A;  2JHE A;  1UWP X;  4GCZ A;  4JGO A;  2ZOI A;  2M1C A;  1TS8 A;  5J3W A;  3H7W B;  4XT2 B;  5IS1 A;  3F1P A;  3HJI A;  3MFX A;  4GS9 A;  3UB7 A;  3MQQ A;  4I3J A;  2YKF A;  4EES A;  3NHQ A;  1LSV A;  4H6J A;  1XFN A;  2B02 A;  2A24 B;  1GSV A;  1XFQ A;  1MZU A;  3C8C A;  1S1Y A;  1UWN X;  1X0O A;  3OLO A;  3MXQ A;  4PKY G;  3UB8 A;  4HJ3 A;  4EQ1 A;  3IS2 B;  2L0W A;  3F1N A;  2PYR A;  3H7W A;  3MR0 A;  4GW9 A;  5HD3 A;  4WL9 A;  4XT2 A;  1T1C A;  1XJ3 A;  3CLO A;  4HP9 A;  4MN5 A;  3GEC A;  4NXE A;  5I5L A;  3VE4 A;  4L9G A;  4I38 A;  2GJ3 A;  2JN7 A;  3EWK A;  4L9E A;  2K7S A;  1VB6 A;  1TS7 A;  3NOU C;  4PKY A;  1XJ2 A;  2ZOH A;  2PDR A;  4HY8 A;  3MQO A;  4HH3 A;  5F68 A;  3UMD A;  3F1P B;  3UE6 A;  2V1A A;  1S4R A;  4E04 A;  4K08 A;  4GS9 B;  3EEH A;  4M4X A;  4KUO A;  3LYX A;  1T18 A;  3NJA A;  4H6J B;  3SW1 A;  3RH8 B;  2QJ7 A;  2QJ5 A;  3H9W A;  4NXF A;  2PHY A;  5DJT A;  4EET B;  1S1Z A;  2H28 A;  1DRM A;  4JGP A;  4WF0 A;  4F3L B;  4WLA A;  4BBT A;  1LT0 A;  2INW A;  2V9A A;  4HI4 A;  4R6L A;  2QHK A;  1F9I A;  4I3A A;  3F1N B;  3BWL A;  2V1B A;  1G28 A;  2KX6 A;  3NOT C;  4I5S A;  4DJ3 A;  4NXG A;  5HWW A;  2VLG A;  3B33 A;  1LL8 A;  1TS6 A;  4JGQ A;  2QWS A;  5AVE A;  4I39 A;  4R70 A;  5HWT A;  4F3L A;  1OTE A;  2W27 A;  5TBM A;  3CWF A;  2EA9 A;  3CAX A;  3T50 A;  1N9O A;  1T19 A;  1D06 A;  3E4P A;  4EER A;  1N9L A;  2OOL A;  2D02 A;  1NWZ A;  1OJ5 A;  2OWJ A;  1S4S A;  5HDC A;  5F6A A;  1XJ6 A;  1OTD A;  4LPZ A;  4EXO A;  2VV7 A;  4WUJ A;  4HJ6 A;  1WA9 A;  2I9V A;  3H82 A;  3F1O A;  3LIA A;  5DJU A;  2OWH A;  1GSX A;  5EFW A;  1S67 L;  2PD8 A;  2WKQ A;  5AVF A;  1D7E A;  2WKP A;  5HSQ A; 
#chains in the Genus database with same CATH topology
 2J80 A;  3UN7 A;  2ZC3 B;  3K3C A;  3Q07 A;  3HLG A;  3SS3 A;  2HDS A;  4PM5 A;  1G5U A;  4ZJ2 A;  3JPU A;  3UDI A;  3ZVW A;  1DJC A;  4KG6 A;  4Y0U A;  1W7F A;  4Y3I A;  1V9Z A;  1OJG A;  4B9O A;  1VEU B;  1UGU A;  4LRX C;  3PYP A;  3CIT A;  1TD5 A;  4HP4 A;  5U47 A;  2BG1 A;  2EXB A;  2VGK A;  2GX5 A;  2HF6 A;  2HGV A;  5G4Y A;  4RYE A;  1I5Q A;  2VEA A;  3IX3 A;  5AQA A;  5IT5 A;  5IU1 A;  1OT6 A;  2HJE A;  1KVL A;  1IYQ A;  3EGD C;  2A2L A;  2XGN A;  1S66 L;  4KUK A;  3IX4 A;  2Y2N A;  1DP9 A;  4A5R A;  3SZT A;  4X25 A;  4HHD A;  3E4O A;  3UB6 A;  3P09 A;  3W2Z A;  2E8J A;  3QP6 A;  3VP0 A;  1YM1 A;  5EPH A;  1A0K A;  3IBJ A;  4G3V A;  5FQM A;  2KDK A;  5HD5 A;  3I7J A;  5DTT A;  3IHB A;  2IWD A;  4DJ2 A;  1M40 A;  4WN5 A;  3SS5 A;  3ULF A;  1K25 A;  2HDR A;  1PRQ A;  4Z1W A;  4WM9 A;  1PI5 A;  4KZ3 A;  4N9L A;  3KSI A;  5FAT A;  4OQG A;  3IXD A;  1RP5 A;  4YWZ A;  2P7J A;  1GHI A;  5CGX A;  4DRT A;  4LLO B;  4UQI M;  2P9V A;  1W8Q A;  4GJ4 A;  4O0P A;  1FOF A;  3PBS A;  3V5M A;  4S2P A;  1ES2 A;  3N8L A;  4MN7 A;  1MWR A;  3GDI A;  3BM6 A;  1PNE A;  1ERQ A;  1E25 A;  5K5B A;  2O9A A;  1PFL A;  1TS0 A;  3ZYT A;  1D1J A;  4WMC D;  3WWX A;  2ZQA A;  2CMN A;  1FIL A;  3CPT A;  3PBQ A;  5FQI A;  4R0Q A;  4BBV A;  2EX6 A;  1NZO A;  2V0U A;  1K55 A;  3SS4 A;  5F69 A;  5HFO A;  4CQH A;  5HDS A;  3LIC A;  3HLE A;  5GLD A;  3G2Y A;  3N6I A;  3ICY A;  1KE0 A;  3IBR A;  2I72 A;  1UWP X;  5CGW A;  1HD8 A;  4GCZ A;  3MS6 A;  5EM0 A;  2ZOI A;  3DBA A;  1KVM A;  4XT2 B;  3F1P A;  2XSS A;  4WYY A;  1HTZ A;  4GLQ A;  2ZM0 A;  5CED A;  1IFQ A;  4EES A;  2P9V B;  3ZVT A;  5CEB A;  4E6X A;  1XFN A;  3UPP A;  3KSG A;  4QHC A;  4NET A;  1GSV A;  1IYS A;  5TFQ A;  1H8M A;  4X53 A;  4KZ8 A;  1S1Y A;  2O99 A;  5HAI A;  1UWN X;  5DVA A;  1K38 A;  1NRJ A;  3UPN A;  2HP9 A;  4GD6 A;  1KGG A;  4PKY G;  3CPT B;  2OLV A;  1AXB A;  4HJ3 A;  2Q9N A;  2Q9M A;  2PYR A;  4YIN A;  3H7W A;  2WGV A;  1PYY A;  2WYX A;  2DNS A;  1XJ3 A;  3C38 A;  3WS5 A;  1AWI A;  2JKR M;  2Y2P A;  1GHM A;  3OPL A;  5FAP A;  4Y17 A;  3VE4 A;  2XD1 A;  2DRW A;  1YLW A;  4DE3 A;  3TOI A;  4Y2F A;  2K7S A;  2ZQD A;  3BEB A;  4EBP A;  4K91 A;  5FA7 A;  3ITB A;  4HY8 A;  2IWB A;  1XXM A;  4HH3 A;  3G34 A;  5F68 A;  3UMD A;  5A93 A;  3F1P B;  4K0W A;  1L0G A;  4K08 A;  3ZG7 B;  1XGI A;  4DMZ A;  2X02 A;  3ZG0 A;  3S7N A;  3A3F A;  4G3K A;  3NJA A;  3SW1 A;  1TVF A;  3P98 A;  4GKU A;  2QJ7 A;  3KSH A;  4JPM A;  2O9B A;  1GA0 A;  2H5S A;  5EOE A;  5E43 A;  1DRM A;  4OVD A;  2ZL1 A;  5GL9 A;  5DTK A;  4BBT A;  3PBN A;  4OQH A;  3NI9 A;  3VFF A;  2INW A;  2QZ6 A;  3O87 A;  4R6L A;  2XLN A;  2PRF A;  4S2K A;  2QHK A;  3IQA A;  4PHT A;  3U2A A;  1ERO A;  3T4T A;  4CLC C;  4I3A A;  1PWG A;  3TW8 A;  1NXY A;  4GDB A;  3UPO A;  2QPN A;  1G28 A;  4DDY A;  3MXS A;  3VOZ A;  2LB5 A;  3T1S A;  1SKO A;  3NOT C;  4I5S A;  2JCH A;  1K54 C;  3M6B A;  3BFG A;  2R9W A;  5HWW A;  1YAX A;  3ZHH A;  4OOY A;  3M6H A;  3B33 A;  1IEM A;  3IF5 A;  4P6Z M;  2VGJ A;  1TS6 A;  1CQA A;  2QWS A;  4X6T A;  3UE1 A;  5AVE A;  4BEN A;  4FCF A;  4X56 A;  4S2O A;  4R1G A;  3Q7V A;  4LFU A;  2XK1 A;  3D4F A;  3MF0 A;  4BD0 A;  4UQI S;  5AQB A;  1GCE A;  3M2K A;  4QU3 A;  3T4Q A;  3UY6 A;  4JLF A;  2EA9 A;  4U0X A;  3CAX A;  4MBK A;  5F82 A;  1T19 A;  3CZD A;  1ESI A;  4NEE D;  2NUP C;  1BTL A;  2OOL A;  4EUZ A;  2HDQ A;  5TGF A;  5HPI A;  4S2J A;  3LEZ A;  2ZL1 B;  2JKT I;  4C3Q A;  5F6A A;  4ETX A;  1CF0 A;  3MBZ A;  3PTE A;  4HJ6 A;  2C5W B;  5C5K A;  1WA9 A;  3H82 A;  1J3W A;  5F1F A;  4R4R A;  3F1O A;  3HVF A;  3S7O A;  1ZKJ A;  2OWH A;  3A3J A;  1S0W A;  2ZM8 A;  1I2W A;  1SKO B;  1K56 A;  1JWV A;  2PT7 A;  3HUN A;  4E6W A;  3QP1 A;  1W63 Q;  4X55 A;  3Q7Z A;  1XA1 A;  3L9K A;  4EV4 A;  3QP5 A;  3A3E A;  3FKV A;  1FCN A;  3D72 A;  5CXW A;  4C6Y A;  5J7E A;  4HNB A;  4KQQ A;  5EVI A;  4UA7 A;  2J7V A;  2W3E A;  3NDE A;  2JKG A;  2Y2J A;  3OOV A;  3L7H A;  3V67 A;  2HPB A;  1ERM A;  3FC7 A;  2WGW A;  2HP5 A;  3G6O A;  4EBL A;  3V50 A;  4XUZ A;  2PR6 A;  3T4S A;  3VMA A;  3IWO A;  5FEG A;  3BW6 A;  4OQ0 A;  2Y59 A;  4E3L A;  1YSP A;  1LSW A;  1STZ A;  2UWX A;  4E3K A;  3IXB A;  5J4E A;  3BFC A;  3R7W A;  1KE3 A;  3D9Y A;  2JKF A;  4Y5F A;  2Y2M A;  5HZH A;  2XFT A;  4ME4 A;  4D2O A;  5JYP A;  3BY9 A;  4LCM A;  3NCK A;  4E3O A;  4KQR A;  1L3L A;  3H82 B;  3F1O B;  2EFX A;  2MJ6 A;  1PZP A;  4QB8 A;  2Y8H A;  5DKK A;  4MDZ A;  1ODV A;  4GDN A;  4DKI A;  5HWV A;  1KGF A;  4KQO A;  4JKT A;  1NLZ A;  5FEF A;  3FPW A;  2WK0 A;  2WUQ A;  2VGL M;  1OT9 A;  2YKH A;  1VEU A;  1L0E A;  1KOU A;  5FI2 A;  4YFM A;  3LR3 A;  1FQG A;  2XA7 M;  5FSR A;  5GLA A;  2JC7 A;  3ZQ5 A;  5G4Z A;  3N7W A;  1XJ4 A;  3ZCZ A;  3D3O A;  3C7V A;  1JWZ A;  2Z6D A;  1O7E A;  3GMW A;  1ALQ A;  4PM6 A;  2EX8 A;  1F5M A;  2VV6 A;  3A0V A;  3CG5 A;  1KDS A;  3QNC A;  2WKE A;  4LRY C;  2WGW B;  1V9Y A;  5D3O A;  2Y2K A;  2OLU A;  5FAO A;  1L2S A;  1ACF A;  4YOF A;  3LI8 A;  3VE3 A;  4OLG A;  3O5Y A;  3UME A;  4KEN B;  4EWF A;  3R7W B;  2R9X A;  2JE5 A;  4R38 A;  2R78 A;  3QP8 A;  2PR5 A;  2J3T D;  3LI9 A;  3BFF A;  4U0T A;  5GHY A;  3LR4 A;  4IED A;  3BY8 A;  4BLM A;  3PBT A;  4OLD A;  3S1Y A;  5CTM A;  1K56 D;  3HLB A;  2IWC A;  3AGD A;  4ESP A;  4PM9 A;  4MBF A;  5KSH A;  3GSG A;  5CEC A;  1BLP A;  1YMS A;  4P0M A;  1MXO A;  3P7N A;  2V8C A;  4P6Z S;  5EVI D;  4OPZ A;  1OTI A;  4PM7 A;  4FUW A;  3QP4 A;  1FCO A;  3WS4 A;  2HV1 A;  4OKP A;  4R4S A;  3RFB A;  5DKL A;  2XF3 A;  3BYD A;  3LY3 A;  3G32 A;  3LIB A;  3MZF A;  2XRO A;  3AGF A;  2PD7 A;  5HPF A;  3NEC A;  2PYP A;  2ZQ8 A;  3CJM A;  4PM8 A;  4UAA A;  4KZB A;  1TS8 A;  4S2N A;  2VA0 A;  3HJI A;  2C6W B;  3UO9 A;  3MQQ A;  4KZ6 A;  4I3J A;  5L09 A;  3RJU A;  1RGY A;  3C7U A;  4Q0J A;  1LSV A;  1VQQ A;  3A3D A;  3IHA A;  1MPL A;  4HES A;  5J8X A;  5LBR A;  2B02 A;  3IWI A;  4MNR A;  1S6R A;  3HCY A;  1MZU A;  2J3W A;  1YQS A;  2OSU A;  3IF6 A;  3FPV A;  2XQZ A;  3PXP A;  2Y2G A;  2H0Y A;  3OLO A;  3MXQ A;  3S7P A;  3IX8 A;  1K0K A;  1ZC2 A;  3UB8 A;  2PBY A;  3N8S A;  1N4O A;  2L0W A;  1P9W A;  2VX8 A;  3G2Z A;  2EFU A;  4Y15 A;  1SCW A;  3MR0 A;  4WL9 A;  4XT2 A;  3NIA A;  4K0X A;  5HW3 A;  3G30 A;  4RX3 A;  3T12 B;  3T4O A;  1FR1 A;  4I38 A;  2JN7 A;  5GLC A;  4L9E A;  4L0L A;  4ARZ A;  1VB6 A;  3ZG5 A;  3NOU C;  3MQO A;  2XH9 A;  4XXR A;  4WZ5 A;  1Q2Q A;  2M7U A;  2IA2 A;  1YSQ A;  5GLB A;  1H3Q A;  1K6R A;  2GNX A;  1XA7 A;  3GVB A;  5CGS A;  3IH9 A;  3LFV A;  2OV5 A;  1W63 M;  2WKH A;  2QJ5 A;  4FTX A;  1YLJ A;  4NXF A;  2ZMV A;  4EET B;  2J8Y A;  4WEL A;  4MCW A;  4WF0 A;  4F3L B;  4LV0 A;  2Y2H A;  5MC7 A;  4ZJ1 A;  5FI6 A;  3IF6 B;  2RL3 A;  3NC8 A;  1LT0 A;  4KZ7 A;  5FDH A;  5L10 A;  1JWP A;  3VP1 A;  3MKE A;  3OZH A;  1F9I A;  1NRF A;  4ZTK A;  5KMW A;  4OH0 A;  3CUE A;  3BWL A;  4H8R A;  3SH9 A;  3MKF A;  4RX2 A;  1MBL A;  1CJF A;  5BOH A;  2KX6 A;  3B3X A;  2VKS A;  2Z2M B;  4CJN A;  3ITA A;  4RA7 A;  4IUH A;  3EQU A;  2VLG A;  5E2G A;  4ARZ B;  4GOG A;  1ES3 A;  4JGQ A;  4R70 A;  4OPR A;  3KSF A;  3BLM A;  2JKR I;  1H8Y A;  2XRN A;  2HZ5 A;  1OTE A;  1K57 A;  4PPR A;  4GD8 A;  5TBM A;  2FFY A;  3VSK A;  3ZNY A;  4E3M A;  3P01 A;  3WS0 A;  4B93 A;  3BQ8 A;  2Y4A A;  1PW8 A;  1K4F A;  3IT9 A;  5AQ9 A;  1N9L A;  1VET B;  3VP4 A;  3CMZ A;  5DF7 A;  3OCN A;  3IXH A;  4IHQ A;  2OWJ A;  2NUT C;  4OP8 A;  1YLZ A;  1GHP A;  4AFI A;  4BWI A;  1XJ6 A;  4LPZ A;  2FFF B;  1KE4 A;  4JF5 A;  3UB5 P;  3UNW A;  3W8K A;  2I9V A;  3LIA A;  1G68 A;  5E2H A;  2FH5 A;  2ZM2 A;  3S4X A;  2K2N A;  3IXG A;  2J9P A;  1IKI A;  1K55 C;  3QNB A;  1S67 L;  2H10 A;  4QY5 A;  3R4K A;  5HAQ A;  5AVF A;  4E3I A;  1D7E A;  4UA6 A;  3SH7 A;  3WRZ A;  4IUK A;  1CI8 A;  1I2S A;  2PU4 A;  4EEP A;  4BJP A;  5CTN A;  5L2F A;  3KO6 A;  4NXB A;  1LSX A;  4DE0 A;  2QYB A;  4CLC B;  5TBM B;  4EEU A;  4JGR A;  1BYW A;  4Q0I A;  3HLW A;  1PWC A;  1CEF A;  1FSW A;  3EGX C;  3AGE A;  5IHV A;  1HLU P;  2V20 A;  4MBH A;  5FAQ A;  5FQK A;  3KX0 X;  4QJG A;  3LUQ A;  2D01 A;  3Q81 A;  2WZZ A;  3HUO A;  3A0S A;  3E2L A;  4MN6 A;  3FG8 A;  5A92 A;  4ZRR A;  1CEG A;  1OTB A;  4DE1 A;  5L8M A;  4R3B A;  2X01 A;  4PAU A;  2V0W A;  1Q2P A;  3VSL A;  2W0N A;  1NYY A;  5HL6 A;  2V2F F;  2L1M A;  3PBR A;  1GSW A;  2Z6C A;  5M19 A;  4WEK A;  4Z9Q A;  5G18 A;  3LIF A;  2HP6 A;  2ZD8 A;  4L9F A;  2PAV P;  1FR6 A;  4HIA A;  3VFH A;  2DCF A;  4BBU A;  4GHI B;  1OTA A;  1EW0 A;  4F94 A;  3RTY A;  4G3W A;  5F1G A;  4RQ9 A;  3WS1 A;  3DAV A;  4HBT A;  2AVX A;  3EQV A;  5DFY A;  1QMF A;  2X71 A;  3T4J A;  4X69 A;  3DWK A;  1IYO A;  3G35 A;  1W5D A;  5CER A;  1Y28 A;  1YMX A;  3T1X A;  2BAS A;  3MXR A;  3LY4 A;  4R3A A;  2A24 A;  4YNR A;  5A91 A;  1G6O A;  5DF9 A;  2B95 A;  3OBF A;  3PR6 A;  1Z09 A;  1BLC A;  1SDN A;  2Q0O A;  1T1B A;  4HBU A;  3TE8 A;  5EV0 A;  1H8Z A;  4ZBE A;  4FH4 A;  3MJQ A;  3MQ0 A;  4O7D A;  5TJJ A;  5KSC A;  1TDG A;  5FDS A;  2VV8 A;  1N9B A;  1F98 A;  4N9K A;  5EE8 A;  5EM1 A;  3OPR A;  4NG2 A;  4GB7 A;  3OPH A;  1O07 A;  1H5X A;  1HZO A;  1LL9 A;  1NJ4 A;  2WAF A;  1NYM A;  3MZE A;  4KQD A;  2Y2I A;  2JHE A;  3W4O A;  3MMH A;  3DWZ A;  3BRM A;  1SZV A;  5J3W A;  1Y54 A;  2VZW A;  3K2N A;  3UB7 A;  3U4L P;  2EXA A;  3UE0 A;  4LV1 A;  2Y55 A;  2ZC4 B;  1CI9 A;  3HBR A;  4H6J A;  1JTG A;  2Y2L A;  3TG9 A;  5HX9 A;  2A24 B;  1F2K A;  2HDU A;  3C8C A;  3B42 A;  1XPB A;  4RVA A;  2W3G A;  2ZQC A;  4Y7P A;  5EEC A;  4B4X A;  3NY4 A;  3C4P A;  2OAQ 1;  2PU2 A;  1NY0 A;  1X0O A;  1ZHH B;  2J3T C;  4N1H A;  3TSG A;  4JXS A;  5TR7 A;  1BT5 A;  4GW9 A;  5HD3 A;  3PAG A;  1XX2 A;  3CLO A;  4HP9 A;  2PBD P;  4MN5 A;  1SHV A;  2WZX A;  3W4P A;  3GEC A;  1E4D A;  4NXE A;  4ETZ A;  5EOO A;  2XFS A;  2B18 A;  1BSG A;  3PAE A;  3Q82 A;  5EVI C;  1ES4 A;  4LEN A;  1W79 A;  1XJ2 A;  2ZOH A;  2PDR A;  3BLS A;  2DMW A;  1TDL A;  3OPP A;  3UE3 A;  4QWO A;  3WS2 A;  3OC2 A;  4O01 A;  4DE2 A;  4M4X A;  1FCM A;  3E2K A;  5CHJ A;  3LYX A;  2G2W A;  1T18 A;  2EX9 A;  4H6J B;  1LI9 A;  2W1T B;  4B88 A;  1DJB A;  1BLS A;  4B4Z A;  4LGW A;  2V8F A;  3BFE A;  1PW1 A;  1S1Z A;  3EEA A;  2P04 A;  1MWU A;  3LEQ A;  4JGP A;  4R3J A;  4WLA A;  3A3I A;  1WYB A;  2W3D A;  3ZGA B;  2EWW A;  1SKF A;  2RCX A;  3HLF A;  3KYZ A;  2OAP 1;  4OQI A;  2V1B A;  1PZO A;  3RXX A;  1K6S A;  4LV2 A;  3LR5 A;  3KYQ A;  4NXG A;  3EOI A;  2VJW A;  2W3F A;  2ZJ9 A;  1K4E A;  1WE4 A;  3O86 A;  4I39 A;  3ZG8 B;  3LR0 A;  3LCE A;  3FKW A;  1PIO A;  4F3L A;  3T1Q B;  4JXG A;  1WYC A;  2VK3 A;  4KG2 A;  5E2E A;  2XDM A;  3T50 A;  2BTF P;  3FYZ A;  1BUL A;  2A49 A;  4X68 A;  2ZC6 B;  3DTI A;  3HUM A;  4N92 A;  5HAP A;  4DXC A;  1OTD A;  1JTD A;  4KZ9 A;  2VV7 A;  3T1R A;  2XD5 A;  2O0Y A;  5CX7 A;  3W4Q A;  4QPR A;  4WUJ A;  4S2L A;  5HAR A;  3RXW A;  3LGO A;  4QY6 A;  2V1Z A;  5DJU A;  2ZLY A;  4IVK A;  2EX2 A;  4II7 A;  5EFW A;  2CC1 A;  1NLY A;  5A90 A;  3B47 A;  1FIK A;  1BUE A;  2WKP A;  5HSQ A;  1VET A;  3S7Q A;  5DTS A;  5CHM A;  3GR2 A;  2P08 A;  5FQ9 A;  3ZFZ A;  5EVL A;  2HJ9 C;  3A0R A;  1DP6 A;  1MC0 A;  5F5Y A;  1J9M A;  4Q8I A;  4S2N C;  4WZ4 A;  2W1R A;  1P9R A;  1OPX A;  1KDW A;  4P85 A;  5GHX A;  2VGL S;  1ZG6 A;  1JNU A;  1OME A;  5AJG A;  4JXW A;  4EW7 A;  3K3D A;  4HJ4 A;  4IVI A;  4UHU A;  1EWZ A;  4JXV A;  2XA7 S;  1MY8 A;  4OON A;  3T4K A;  4HOI A;  1BZA A;  4JBF A;  3PHY A;  1T1A A;  5M1A A;  3IF6 C;  1W8Y A;  4NKP A;  4DN0 A;  2KLI A;  4HH2 A;  2Y79 A;  3HRE A;  3V39 A;  3TRC A;  1KGE A;  1M6K A;  1U60 A;  4OP5 A;  3G31 A;  2ZBB A;  3FV7 A;  4LRZ E;  3UB9 A;  4CLC A;  3WRT A;  5KIZ A;  1C3B A;  1ZG4 A;  5A8B A;  1JVJ A;  3LIE A;  3MZD A;  1ES5 A;  5EVE A;  1K54 A;  3C2W A;  4KZ5 A;  2ZMA A;  1ONG A;  2ZC5 B;  4UEY A;  1E3U A;  3N8R A;  4D60 A;  3BEC A;  3E4Q A;  2Y91 A;  4WZ5 C;  4IBX A;  5JYO A;  1IKG A;  3PBO A;  1RGZ A;  1IYP A;  4EU0 A;  1TEM A;  5FI7 A;  1IOU A;  3S22 A;  4UA9 A;  1P97 A;  2M7V A;  5FQJ A;  4BMW A;  4HQA A;  1SDE A;  3Q1F A;  3DTM A;  3VOL A;  3N4I A;  5FQQ A;  4DXB A;  2B5R A;  2ZMF A;  1MWT A;  5AQ7 A;  1GA9 A;  2BLS A;  1YKD A;  4X1M A;  3GRJ A;  4Y13 A;  1LLB A;  3IWQ A;  4EUV A;  2EWV A;  2QKP A;  3CUE C;  4C75 A;  4EBN A;  4GHI A;  3IS2 A;  2WKR A;  1P0Z A;  4E3J A;  3ZDJ A;  4R23 A;  3HJK A;  1CK3 A;  2KOI A;  3NOP C;  3HL9 A;  4KG5 A;  1YT4 A;  3LID A;  4NK3 A;  1YPR A;  4I3I A;  1L0F A;  2L4R A;  1DY6 A;  1HVB A;  4OPY A;  4P87 A;  1N9N A;  1DP8 A;  3HLD A;  2ZQ9 A;  5HDD A;  4DF6 A;  3CI6 A;  1TF1 A;  4JF4 A;  2H0T A;  1MKI A;  3VP2 A;  1L0D A;  3O3V A;  3KYE A;  2XR0 A;  3C4O A;  4JF6 A;  3V3R A;  1K57 C;  4IJG A;  4JGO A;  4ZJ3 A;  3FZC A;  3V3S A;  2M1C A;  3H7W B;  3T4L A;  3QP2 A;  1LL5 A;  5IS1 A;  3JVU A;  5KZH A;  3MFX A;  4GS9 A;  3C30 A;  4ZDX A;  1XKZ A;  4BL2 A;  2YKF A;  3NHQ A;  1DJA A;  3ZNT A;  2GZA A;  4KZA A;  5CHU A;  4ID4 A;  4GNU A;  4U3T A;  4BL3 A;  1XFQ A;  1LI0 A;  1EI5 A;  4CLC D;  2G2U A;  3FWL A;  1QME A;  4O8G A;  3BJN A;  1PWD A;  4EQI A;  3DW0 A;  5GHZ A;  3MSH A;  3IH8 A;  4MLL A;  2WAD A;  2ACG A;  4EQ1 A;  3IS2 B;  4Y0O A;  1NZU A;  4GN2 A;  3F1N A;  1E3U D;  3BQA A;  2W3H A;  3DTK A;  3OCL A;  5HL1 A;  1T1C A;  3LO7 A;  4OPQ A;  3SH8 A;  3ZG9 B;  1XP4 A;  1H0M A;  4CPK A;  3VOY A;  5I5L A;  4L9G A;  2GJ3 A;  3EWK A;  4KZ4 A;  1TS7 A;  5I94 A;  4PKY A;  1VM1 A;  4IBR A;  3DTE A;  4P6B A;  3UE6 A;  2V1A A;  1S4R A;  4E04 A;  3NBL A;  4GS9 B;  3EEH A;  4KUO A;  2UV0 E;  2JKT M;  4FH2 A;  5FAS A;  4OOL A;  2WKI A;  3CHW P;  3RH8 B;  5L07 A;  2Y2Q A;  4S2M A;  3H9W A;  4QD4 A;  2PHY A;  5DJT A;  1FSY A;  3M2J A;  4FOF A;  2H28 A;  4WBG A;  3Q7V B;  4HEF A;  1G6A A;  4LV3 A;  5DFX A;  5DF8 A;  1MWS A;  1PI4 A;  4X1L A;  3BFD A;  4DDS A;  2WAE A;  1BLH A;  4PMA A;  2P74 A;  4XUX A;  2V9A A;  4HI4 A;  4MEZ A;  4N1X A;  2Y2O A;  3F1N B;  3NDG A;  3UDF A;  5E2F A;  4DJ3 A;  2XEP A;  2ZQ7 A;  1Z6F A;  4GZB A;  1XGJ A;  3E0Y A;  2W1T A;  4OOM A;  1LL8 A;  1Y4O A;  5EUA A;  1YLY A;  3VP3 A;  1LHY A;  2JBF A;  4LCL A;  4WEJ A;  5HWT A;  5F83 A;  1MKM A;  1ZTU A;  2W27 A;  3UDX A;  2A3U A;  1YLP A;  4BD1 A;  2LB9 A;  3CWF A;  3SOI A;  2K31 A;  3GV9 A;  1VHM A;  3JVV A;  1N9O A;  5CRF A;  1D06 A;  2Z2L B;  3E4P A;  4S2I A;  3TJZ C;  4EER A;  3QHY A;  4Q0H A;  3GQZ A;  5M18 A;  2D02 A;  3JYI A;  2FZ0 A;  1NWZ A;  2G7U A;  2O9C A;  1YLT A;  5EVI B;  3C5A A;  1OJ5 A;  1S4S A;  3HLC A;  5HDC A;  3ISG A;  1ESU A;  4MMN A;  4ZAM A;  3GTC A;  4EXO A;  4FSF A;  2J9O A;  4FD8 A;  4CLC E;  3O88 A;  4M3K A;  3MFD A;  1ONH A;  1RCJ A;  4Y0T A;  3E98 A;  1GSX A;  2GDN A;  4E3N A;  1IEL A;  2WGI A;  4BQM A;  2QMI A;  2PD8 A;  3NUL A;  5FL3 A;  4WMC A;  3VV4 A;  2WKQ A;  2ZC7 A;  2E8I A;  3G4P A; 
#chains in the Genus database with same CATH homology
 2J80 A;  3D72 A;  3K3C A;  2P08 A;  4EEP A;  5J7E A;  4HNB A;  4BJP A;  2HJ9 C;  3KO6 A;  4NXB A;  3A0R A;  2W3E A;  1DP6 A;  1MC0 A;  1LSX A;  5F5Y A;  2QYB A;  4CLC B;  5TBM B;  4EEU A;  4JGR A;  2W1R A;  1P9R A;  1BYW A;  1OPX A;  3OOV A;  4Y3I A;  4Q0I A;  1V9Z A;  3V67 A;  1OJG A;  2VGL S;  3FC7 A;  1JNU A;  5AJG A;  1UGU A;  4B9O A;  4LRX C;  3G6O A;  3PYP A;  3CIT A;  1TD5 A;  2PR6 A;  3K3D A;  4EW7 A;  4HJ4 A;  3T4S A;  4HP4 A;  2XA7 S;  3EGX C;  3BW6 A;  1YSP A;  1LSW A;  2GX5 A;  2HF6 A;  2HGV A;  1STZ A;  5G4Y A;  3T4K A;  4HOI A;  5J4E A;  2VEA A;  3R7W A;  3KX0 X;  5IT5 A;  5IU1 A;  1OT6 A;  3LUQ A;  2D01 A;  1T1A A;  2HJE A;  3PHY A;  3EGD C;  3A0S A;  2A2L A;  4Y5F A;  5HZH A;  4MN6 A;  4NKP A;  3FG8 A;  4DN0 A;  1S66 L;  4ME4 A;  2KLI A;  4HH2 A;  3BY9 A;  2Y79 A;  4KUK A;  4ZRR A;  3TRC A;  1OTB A;  3H82 B;  5L8M A;  1DP9 A;  3F1O B;  2MJ6 A;  2ZBB A;  2Y8H A;  5DKK A;  4MDZ A;  1ODV A;  4PAU A;  2V0W A;  4LRZ E;  3UB9 A;  4CLC A;  2W0N A;  4HHD A;  5KIZ A;  5HWV A;  5HL6 A;  3E4O A;  3UB6 A;  5A8B A;  2L1M A;  4KQO A;  1NLZ A;  3W2Z A;  3PBR A;  1GSW A;  3FPW A;  2Z6C A;  3LIE A;  2VGL M;  1OT9 A;  2YKH A;  4WEK A;  3IBJ A;  4G3V A;  1KOU A;  3C2W A;  3LR3 A;  2KDK A;  5HD5 A;  2XA7 M;  3LIF A;  4UEY A;  3ZQ5 A;  4L9F A;  4DJ2 A;  4WN5 A;  5G4Z A;  4HIA A;  3ULF A;  1XJ4 A;  4BBU A;  3E4Q A;  3D3O A;  4Z1W A;  2Z6D A;  4GHI B;  3PBO A;  1OTA A;  1EW0 A;  3KSI A;  1F5M A;  2VV6 A;  3A0V A;  3RTY A;  4EU0 A;  4G3W A;  1IOU A;  4RQ9 A;  4LRY C;  1V9Y A;  4YWZ A;  2P7J A;  1P97 A;  3EQV A;  5DFY A;  2M7V A;  4BMW A;  4HQA A;  4LLO B;  3T4J A;  4UQI M;  4YOF A;  3LI8 A;  3VE3 A;  3O5Y A;  3UME A;  3VOL A;  3R7W B;  4GJ4 A;  4O0P A;  4R38 A;  2R78 A;  3PBS A;  1Y28 A;  2BAS A;  2J3T D;  2PR5 A;  2ZMF A;  3GDI A;  3LI9 A;  4MN7 A;  4R3A A;  2A24 A;  3LR4 A;  4YNR A;  3BY8 A;  5K5B A;  1G6O A;  5DF9 A;  2O9A A;  3PBT A;  3OBF A;  3PR6 A;  1YKD A;  1TS0 A;  3ZYT A;  1T1B A;  3TE8 A;  4EUV A;  5KSH A;  2CMN A;  2EWV A;  2QKP A;  3MJQ A;  3CUE C;  3PBQ A;  3MQ0 A;  4GHI A;  3IS2 A;  5TJJ A;  2WKR A;  3P7N A;  4BBV A;  1P0Z A;  2VV8 A;  4P6Z S;  1OTI A;  1F98 A;  3HJK A;  2V0U A;  3NOP C;  2KOI A;  2HV1 A;  5F69 A;  3LID A;  3RFB A;  5DKL A;  4CQH A;  4I3I A;  2L4R A;  5HDS A;  1N9N A;  1DP8 A;  3LIC A;  3LIB A;  5HDD A;  3CI6 A;  1TF1 A;  2XRO A;  2PD7 A;  5HPF A;  3ICY A;  2PYP A;  4KQD A;  3IBR A;  2JHE A;  1UWP X;  3MMH A;  4IJG A;  4GCZ A;  4JGO A;  2ZOI A;  2M1C A;  1TS8 A;  5J3W A;  3H7W B;  3T4L A;  2VA0 A;  3DBA A;  2VZW A;  4XT2 B;  5IS1 A;  3K2N A;  3F1P A;  3HJI A;  3JVU A;  3MFX A;  2XSS A;  3C30 A;  4GS9 A;  3UB7 A;  4GLQ A;  3MQQ A;  1IFQ A;  4I3J A;  2YKF A;  4EES A;  3NHQ A;  2GZA A;  4Q0J A;  1LSV A;  4H6J A;  5LBR A;  1XFN A;  2B02 A;  2A24 B;  3KSG A;  1GSV A;  1XFQ A;  3HCY A;  1H8M A;  1MZU A;  2J3W A;  3B42 A;  3C8C A;  2W3G A;  1S1Y A;  4CLC D;  2OAQ 1;  2O99 A;  1UWN X;  3FPV A;  4O8G A;  3BJN A;  1X0O A;  3PXP A;  1ZHH B;  2J3T C;  1NRJ A;  3OLO A;  3MXQ A;  3S7P A;  4PKY G;  3UB8 A;  4HJ3 A;  4EQ1 A;  3IS2 B;  2L0W A;  1P9W A;  2VX8 A;  3F1N A;  2PYR A;  3H7W A;  3BQA A;  2W3H A;  3MR0 A;  3OCL A;  4GW9 A;  4WL9 A;  5HD3 A;  4XT2 A;  1T1C A;  1XJ3 A;  3C38 A;  3CLO A;  4HP9 A;  2JKR M;  4MN5 A;  3GEC A;  4NXE A;  5I5L A;  3VE4 A;  4ETZ A;  3T4O A;  4L9G A;  2B18 A;  4I38 A;  2GJ3 A;  2JN7 A;  3EWK A;  4L9E A;  4Y2F A;  2K7S A;  4L0L A;  4ARZ A;  1VB6 A;  1TS7 A;  3NOU C;  4PKY A;  1XJ2 A;  2ZOH A;  2PDR A;  2DMW A;  4HY8 A;  3MQO A;  3UE3 A;  4HH3 A;  5F68 A;  3OC2 A;  4O01 A;  3UMD A;  3F1P B;  2M7U A;  3UE6 A;  2IA2 A;  2V1A A;  1S4R A;  4E04 A;  1YSQ A;  4K08 A;  1H3Q A;  4GS9 B;  3EEH A;  4M4X A;  4KUO A;  2GNX A;  4DMZ A;  2JKT M;  3S7N A;  4OOL A;  3LYX A;  4G3K A;  1T18 A;  3NJA A;  3LFV A;  4H6J B;  3SW1 A;  1W63 M;  3RH8 B;  2W1T B;  2QJ7 A;  2QJ5 A;  3KSH A;  3H9W A;  4NXF A;  2PHY A;  2ZMV A;  2O9B A;  5DJT A;  4EET B;  4FOF A;  1S1Z A;  2H28 A;  4WEL A;  3EEA A;  4MCW A;  2P04 A;  1DRM A;  4JGP A;  4WF0 A;  5DFX A;  4F3L B;  5MC7 A;  4WLA A;  2W3D A;  4BBT A;  3PBN A;  1LT0 A;  2EWW A;  2INW A;  2V9A A;  4HI4 A;  4R6L A;  2QHK A;  4PHT A;  1F9I A;  3U2A A;  3T4T A;  4CLC C;  4I3A A;  3F1N B;  3TW8 A;  3KYZ A;  2OAP 1;  3CUE A;  3BWL A;  2V1B A;  1G28 A;  2LB5 A;  2KX6 A;  3NOT C;  2VKS A;  4I5S A;  3LR5 A;  4DJ3 A;  3KYQ A;  4NXG A;  3EOI A;  5HWW A;  4IUH A;  2VJW A;  1YAX A;  3EQU A;  2VLG A;  2W3F A;  3E0Y A;  2W1T A;  3B33 A;  4ARZ B;  4OOM A;  1LL8 A;  4P6Z M;  1TS6 A;  4JGQ A;  2QWS A;  5AVE A;  4I39 A;  4R70 A;  4WEJ A;  5HWT A;  3KSF A;  3LR0 A;  1MKM A;  2JKR I;  2XRN A;  4F3L A;  1ZTU A;  3MF0 A;  1OTE A;  4UQI S;  2W27 A;  5TBM A;  3T4Q A;  2LB9 A;  2EA9 A;  3CWF A;  2K31 A;  3P01 A;  3CAX A;  1VHM A;  3JVV A;  4B93 A;  3BQ8 A;  3T50 A;  1N9O A;  1T19 A;  1D06 A;  3E4P A;  4NEE D;  3TJZ C;  2NUP C;  4EER A;  1N9L A;  4Q0H A;  2OOL A;  2D02 A;  2FZ0 A;  1NWZ A;  2G7U A;  2O9C A;  5HPI A;  1OJ5 A;  3OCN A;  4IHQ A;  2OWJ A;  1S4S A;  2NUT C;  5HDC A;  2JKT I;  5F6A A;  4AFI A;  4MMN A;  4BWI A;  1XJ6 A;  1OTD A;  4LPZ A;  4EXO A;  2VV7 A;  4FSF A;  4CLC E;  2O0Y A;  5CX7 A;  4ETX A;  4QPR A;  4WUJ A;  4HJ6 A;  5C5K A;  3E98 A;  1WA9 A;  2I9V A;  3H82 A;  3F1O A;  3LIA A;  5DJU A;  3S7O A;  2OWH A;  1GSX A;  2FH5 A;  4II7 A;  5EFW A;  2K2N A;  1NLY A;  2PT7 A;  3B47 A;  1S67 L;  2PD8 A;  1W63 Q;  5FL3 A;  3VV4 A;  2WKQ A;  3R4K A;  5AVF A;  1D7E A;  2WKP A;  4IUK A;  5HSQ A;  3S7Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...