4L9GA

Structure of ppsr n-q-pas1 from rb. sphaeroides
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
250
structure length
250
Chain Sequence
PSLAPDLVRDLIATAADISLLVSQEGVVREVMANPHHPSFGQLSEWEGRPLEEVLTAESVAKFRLRSEGLEPGRGSVAVELNHIDPRSFEFPIRYILHRLPADRSILMLGRDLRPIAEVQQQLVAAQLAMERDYETQREMETRYRVVLDVSRDPMVLVSMSTGRIVDLNSAAGLLLGGVRQDLLGAAIAQEFEGRRRGEFMETMTNLAATESAAPVEVLARRSQKRLLVVPRVFRAAGERLLLCQIDPAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, PpsR
publication title Multi-PAS domain-mediated protein oligomerization of PpsR from Rhodobacter sphaeroides.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Transcription
total genus 83
structure length 250
sequence length 250
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13188 PAS_8 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4l9gA02
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4l9gA01
1TS0A 1XJ4A 5IS1A 4KUOA 4R70A 1EW0A 3PHYA 5F69A 4F3LB 4GHIA 4RQ9A 2D01A 4EW7A 2A24A 1GSVA 2V0WA 2QKPA 1OTAA 4EQ1A 1LL8A 1T1CA 1OJGA 3MXQA 3B33A 3UE6A 2QJ7A 1OT6A 3LYXA 3LIFA 4WL9A 2JN7A 3HJKA 4GCZA 2R78A 4B9OA 3FG8A 4HJ4A 3GECA 1V9ZA 1JNUA 2W0NA 4LRZE 5F68A 5TBMB 4XT2B 1OTDA 1TS7A 3F1NB 1P0ZA 2VLGA 3E4OA 2QWSA 1T1AA 4PKYA 3FC7A 3CWFA 4NXFA 1DP8A 1UWNX 5HD3A 3T50A 4HP4A 2VV8A 1T1BA 2PDRA 3HJIA 1V9YA 3NOUC 2PHYA 2K7SA 1OJ5A 1X0OA 5KIZA 3H82B 5IU1A 1TS6A 3CLOA 5DKKA 4WLAA 3ZQ5A 5HZHA 4EERA 4XT2A 3LIAA 2OOLA 3UB9A 1T18A 2VV7A 4R3AA 4WUJA 3SW1A 2KDKA 2PR5A 1Y28A 4LRYC 4H6JA 3K3DA 4MN6A 3BY9A 3IS2A 4HI4A 3MFXA 4GW9A 4HJ3A 2ZOIA 4MN5A 1XFNA 1N9OA 3H82A 2PR6A 1BYWA 3UB8A 4K08A 5J4EA 4I5SA 2QHKA 3NJAA 1OTIA 5DJTA 3A0RA 3BY8A 3ULFA 4JGOA 3H9WA 3MQQA 4I3IA 5G4YA 1DP6A 4KUKA 3VOLA 5J3WA 3C8CA 3K3CA 3UB6A 1LSVA 2PYRA 1D06A 2WKRA 4NXBA 1GSXA 1S1YA 1S4SA 3D72A 1OTBA 4DJ2A 3F1OA 3ICYA 3KX0X 5G4ZA 1DP9A 4JGRA 3LIDA 4E04A 2CMNA 1LT0A 2V1BA 3A0SA 3GDIA 4HH2A 3LI9A 2OWHA 1GSWA 1LSXA 4H6JB 3F1PB 4HHDA 1LSWA 3IS2B 2BASA 2PD7A 1N9NA 3UMEA 3LIBA 4EETB 2WKPA 3BWLA 3IBRA 1XFQA 2OWJA 4KQDA 4LLOB 5F6AA 3P7NA 4I39A 4WN5A 3MQOA 2J80A 1WA9A 1OTEA 2VEAA 1S67L 1TS8A 4I3AA 5AVEA 5F5YA 4HQAA 3F1PA 4PKYG 3NHQA 1MZUA 3H7WA 2Z6DA 3F1OB 1D7EA 1XJ6A 4LRXC 5HSQA 3NOTC 1G28A 4HOIA 4I38A 5HDSA 4NXEA 2EA9A 3A0VA 2ZOHA 4BBTA 2P7JA 2VV6A 4BBUA 2PD8A 1UWPX 4GS9B 3LI8A 4EESA 2KX6A 5HD5A 1F98A 3LIEA 2PYPA 4R6LA 2W27A 4JGPA 3E4QA 4R38A 4L9GA 4DJ3A 5HWTA 4M4XA 1XJ3A 1F9IA 3MR0A 5HDDA 3E4PA 2L0WA 1VB6A 1P97A 2ZBBA 1ODVA 1S1ZA 4WF0A 2V9AA 2M1CA 1T19A 3OLOA 2L1MA 1NWZA 2L4RA 2YKFA 3EEHA 3EWKA 4LPZA 3VE3A 3MJQA 2V1AA 4GS9A 1S66L 3H7WB 5DJUA 4HP9A 4F3LA 3UMDA 2QJ5A 4EEUA 1XJ2A 4L9EA 3CAXA 1UGUA 4HJ6A 1OT9A 4HY8A 1N9LA 2YKHA 4YWZA 4HIAA 5HWWA 2B02A 2Z6CA 3C2WA 2D02A 4I3JA 3LUQA 2V0UA 4EXOA 3G6OA 1KOUA 4HNBA 1DRMA 4JGQA 4L9FA 1S4RA 4NXGA 2GJ3A 3RTYA 3RH8B 4HH3A 3LICA 5J7EA 3NOPC 4GHIB 5TBMA 4BBVA 2H28A 5EFWA 3F1NA 2A24B 5AVFA 2JHEA 3PYPA 2WKQA 3UB7A 5A8BA 2HV1A 4EEPA 5I5LA 2I9VA 3VE4A 5DKLA 2INWA 5HDCA 5HWVA
chains in the Genus database with same CATH superfamily
1XJ4A 4EUVA 1G6AA 4CJNA 3T4KA 4S2JA 3T1RA 3GVBA 1JTDA 1EW0A 3KO6A 3CUEC 3NC8A 1AWIA 3PHYA 5DF8A 4F3LB 4OP8A 4ETZA 3Q7VA 1MC0A 2BLSA 2PBDP 2XD5A 2PT7A 2QKPA 2XLNA 2AVXA 4IBRA 4KG2A 3S22A 3FWLA 3SH9A 5EVIB 4OVDA 1K55C 4O0PA 2Q0OA 3GR2A 2FH5A 1SKOB 4WL9A 3KSGA 1NRFA 1NLYA 3HJKA 5AJGA 2HJ9C 5AQAA 3ITBA 5HAPA 2XR0A 4GCZA 3UNWA 4CQHA 5GHXA 1JNUA 3OPPA 4UQIS 1CJFA 2Y2PA 3VOZA 2O9AA 4BJPA 4UQIM 5FI2A 1OTDA 5EM0A 4Q8IA 4DE3A 2XH9A 4OPRA 1P0ZA 1ZHHB 4UHUA 2VLGA 3A3DA 3C38A 3JYIA 4PKYA 1FCOA 3QNBA 4N92A 2WGIA 1WYBA 3GRJA 2Y79A 1NLZA 2VV8A 3ISGA 3SH8A 1G68A 1V9YA 3JVUA 5FQMA 2PHYA 1FCNA 4KZ9A 3S7PA 3B47A 3Q7ZA 2H5SA 1L0GA 1L0DA 3E2KA 4CLCA 1Q2QA 3N6IA 2R9WA 5J8XA 1T18A 2CC1A 1SZVA 5FSRA 4X1MA 3A3JA 4WUJA 5HARA 2NUTC 4OONA 2PU2A 2KDKA 4LRYC 4P0MA 1H5XA 2VA0A 1PW1A 5AQ9A 2R9XA 2V8CA 4KZBA 3UPOA 5EUAA 4DE1A 1NZUA 1YT4A 3IS2A 1N4OA 5CECA 3BM6A 4Q0HA 1M6KA 3MFXA 3UE1A 1LL5A 2ZOIA 4MN5A 3DTKA 1N9OA 2EX6A 3IWOA 3OPHA 3EQUA 5J4EA 1YKDA 4I5SA 3OPRA 4M3KA 1ES2A 2ZMFA 4QU3A 3NJAA 4K0WA 3A0RA 3R7WB 4E6WA 4JGOA 3H9WA 4I3IA 4KUKA 2BTFP 2Z2LB 3K3CA 3UB6A 1FIKA 1J3WA 5EM1A 2MJ6A 5D3OA 1D06A 2WKRA 1NJ4A 3G2ZA 5C5KA 5K5BA 1MBLA 4JXGA 1Y4OA 3RXXA 3MBZA 1S4SA 3NECA 1OTBA 4PM5A 3F1OA 3ICYA 2VJWA 2E8IA 2XEPA 1DP9A 5FAQA 2ZJ9A 4BENA 2XROA 4ZJ2A 5DF9A 4E04A 3UB5P 1ONHA 3K2NA 3SZTA 4ME4A 3LI9A 2OWHA 4QHCA 4D2OA 3O87A 4S2IA 4ZJ3A 3F1PB 5G18A 3MMHA 3A3IA 4WMCA 4R3JA 3GQZA 5L2FA 2OLUA 2WUQA 1FSWA 5E2EA 1N9NA 5A93A 5EV0A 2C6WB 4E3LA 2B18A 2WKPA 3TOIA 5CERA 3MKEA 2HJEA 4LLOB 4OQHA 3DTMA 4LV0A 1BLHA 4NG2A 2WKEA 3P7NA 3IQAA 3MQOA 1VEUA 1WA9A 2VEAA 1L3LA 1XXMA 3CITA 2VGKA 3IH9A 4DRTA 2JBFA 4HQAA 3I7JA 3UDXA 2P74A 3C5AA 2Y59A 4K91A 3FV7A 3G32A 2Z6DA 3UE3A 1ES3A 5E43A 1ALQA 3C7UA 3L7HA 1LHYA 3LEZA 3U4LP 3BRMA 4HOIA 3FPVA 2J3TD 1XPBA 3QP6A 1RGZA 4X69A 4X55A 4R3BA 4GS9B 4WZ5A 5HD5A 3KSIA 1F98A 1CEFA 2A49A 2PYPA 3BLSA 2K2NA 4KQOA 5FI7A 3D3OA 3UY6A 2A2LA 1YLJA 2L0WA 4FH2A 3QP4A 4LV3A 4C3QA 3LR0A 1VB6A 1ONGA 2FFFB 4Y5FA 2ZC5B 3RFBA 2ZBBA 1ODVA 2GX5A 1YLWA 1S1ZA 3PXPA 2P08A 3JVVA 1NXYA 4OPZA 4NK3A 1NWZA 2BG1A 3PBQA 3B3XA 3ZG7B 1PIOA 3MJQA 2V1AA 4HP9A 1TF1A 4WEKA 2HGVA 5DF7A 3E98A 2I72A 1UGUA 1OT9A 3EGDC 4HY8A 1N9LA 2YKHA 2IWCA 4HIAA 5EE8A 3IF6A 5IHVA 4DKIA 5EECA 1E25A 4H8RA 1ZKJA 2PBYA 3LUQA 4EXOA 3G6OA 1BLCA 3HUMA 1GA0A 2UWXA 1KVLA 3WRTA 4DF6A 4FTXA 4GD8A 4FH4A 3W4OA 5F82A 3N8LA 5TBMA 2ZL1A 2H28A 3Q7VB 3N4IA 3L9KA 5EFWA 4YFMA 4WELA 2JHEA 3T4QA 3PBOA 3OPLA 1ES4A 2JKRM 2IA2A 5A8BA 4OPQA 3ZNTA 1LL9A 1OPXA 3O88A 4Y0OA 4B93A 1PZPA 5FASA 3MF0A 3QNCA 3C30A 5HWVA 1TS0A 4ZTKA 4KUOA 4R70A 3C4OA 4E3KA 4PM7A 3MXRA 4X53A 4BD1A 1YLPA 5CX7A 2WK0A 3CI6A 3CMZA 3S4XA 3MSHA 2D01A 3ZG9B 2E8JA 2VX8A 1GSVA 1OTAA 4EQ1A 1T1CA 5M1AA 3B33A 1OT6A 4EQIA 4PM6A 4OQ0A 1MY8A 3BFEA 1H3QA 4DMZA 2R78A 4E3NA 3O86A 3GMWA 1V9ZA 4OQGA 3HUOA 5FDHA 5F68A 4CLCB 3GV9A 1MKIA 5GLBA 3ZVTA 1NYYA 2ZQ9A 1Y54A 4KZAA 4GDBA 3ZG0A 2WZXA 1GHPA 3FC7A 5FEFA 4NXFA 2W3EA 1DP8A 1UWNX 5CGWA 3VSKA 3T50A 2P9VA 2ZC7A 3O3VA 5A90A 4BQMA 4O7DA 5HAQA 3C7VA 5GLAA 5CRFA 3D9YA 2ZQ7A 3CLOA 1W63Q 3W8KA 3G34A 2XGNA 5FL3A 3CHWP 4NKPA 2OOLA 3LIAA 4CPKA 1MWSA 3KSFA 3UB9A 1E3UA 3FZCA 4BMWA 1MKMA 1BLPA 3HLCA 3QP2A 4KG5A 4R4RA 1M40A 4X68A 2ZQAA 2HPBA 3K3DA 4IBXA 2HP9A 2H0YA 3BY9A 4S2PA 5HL6A 3EEAA 1YSQA 1K57A 4OLGA 5CTMA 1K6SA 3IF5A 5FQJA 2XFSA 4HJ3A 5DTTA 1PRQA 3OOVA 4ID4A 1QMEA 1XFNA 4GD6A 3T4OA 4GNUA 3ZGAB 5DFYA 3H82A 4G3KA 4K08A 1PI4A 5DJTA 3ULFA 4Z1WA 4II7A 3SS5A 4Q0IA 5IT5A 4BWIA 2WYXA 3ZG5A 3C8CA 2Y2NA 2PYRA 2K31A 1K57C 4C75A 4NXBA 2ZD8A 4FUWA 5JYOA 4R4SA 2IWDA 3SOIA 5CEBA 3CPTA 5FDSA 3Q82A 5G4ZA 2ACGA 3IWQA 4JGRA 3VFHA 4MNRA 3BYDA 1L0FA 4B4XA 4S2KA 3BECA 1CI9A 1K54A 1LT0A 1BTLA 1VEUB 1YLTA 4HH2A 4GN2A 1S6RA 3V50A 4E3IA 3P98A 1LSXA 1XX2A 4H6JB 1JWZA 5EOOA 3CJMA 4K0XA 3Q07A 3T4JA 2JKTI 4ZRRA 1IYQA 5HPFA 3LIBA 2Q9NA 3BWLA 3IBRA 1XFQA 2X01A 4JBFA 2OWJA 3S7NA 2W3GA 2JCHA 3NY4A 1K54C 5F6AA 4DE0A 2P04A 1SDEA 3S1YA 4ZBEA 4GZBA 2JC7A 4PKYG 1ZTUA 1MZUA 2WKIA 3CZDA 4L0LA 2Y2MA 1GHIA 1VM1A 4B88A 4EU0A 2OLVA 3KYEA 3T4TA 2EFUA 4QPRA 1PWCA 1XJ6A 5FATA 4CLCC 3FKWA 5L10A 1XA1A 2XFTA 1W7FA 2A3UA 4MLLA 3WS1A 2J9OA 4MBFA 4I38A 4PPRA 1IOUA 2WZZA 3PBSA 5GLDA 3A0VA 2ZOHA 4BBTA 4DDSA 2Y2JA 3RXWA 4BBUA 1IELA 3LI8A 4QY5A 5EVID 3SS4A 4EESA 2KX6A 3ITAA 4WMCD 4N9KA 4JXSA 3OBFA 1BSGA 4HBUA 3E4QA 4R38A 4L9GA 3DWKA 4GOGA 3LR4A 1F9IA 3G30A 1SCWA 4MDZA 1XP4A 3E0YA 2KOIA 4LV1A 1P97A 4MN7A 5FQ9A 1CK3A 2RL3A 1BZAA 4IUHA 3T4LA 4P6BA 4WF0A 5U47A 2O9CA 2M1CA 1T19A 3OLOA 1VQQA 2ZL1B 2NUPC 3LR5A 3H7WB 1L0EA 5CTNA 4F3LA 3QHYA 2OSUA 1IYPA 4EEUA 2Q9MA 2WADA 4G3VA 1FOFA 3HLDA 2WGVA 4YWZA 3CG5A 5HWWA 3A3FA 2Z6CA 2D02A 4LV2A 3M2JA 2V0UA 3WS2A 4HNBA 5DFXA 3FPWA 1DRMA 4L9FA 4KQQA 2J8YA 3RTYA 3LO7A 1HTZA 1ESUA 1OMEA 4MBHA 3MQ0A 3RH8B 4HH3A 2Y2OA 1J9MA 2DRWA 1MWUA 1HZOA 1YAXA 2XQZA 3PTEA 3PAGA 2WKQA 2HDUA 4QJGA 3IT9A 3P01A 4S2MA 2WGWA 4Y15A 5HAIA 4ETXA 5GL9A 2XA7S 2XA7M 1YMXA 3LY3A 1EWZA 2ZMVA 3KYZA 4OPYA 1CI8A 1FSYA 4Y7PA 2OAQ1 1KE4A 3TJZC 5F69A 3LFVA 1JWVA 4GHIA 4IUKA 4B4ZA 5EVLA 5MC7A 2DNSA 1PWGA 2A24A 4DXBA 2V0WA 5E2GA 3BFDA 3BFCA 4Y2FA 4GB7A 1LL8A 1OJGA 3OC2A 2ZC4B 3WS4A 2P9VB 1KGFA 4FCFA 4P87A 3VSLA 2Y2LA 2XK1A 1QMFA 5TGFA 1SDNA 4RX2A 1KGGA 3PBTA 4HJ4A 2OV5A 2HDQA 4LRZE 4WZ5C 1K4EA 1PFLA 3Q1FA 2G2WA 3F1NB 1FR6A 3N8RA 3TRCA 1PYYA 5EVEA 2VGJA 2QWSA 2GZAA 1T1AA 4NETA 3V67A 3O5YA 3BFFA 1W8YA 5HD3A 3A3EA 3UDIA 1T1BA 2PDRA 4Y0UA 4Y13A 3EQVA 2K7SA 1OJ5A 3LY4A 5KIZA 3H82B 5TJJA 5IU1A 3HL9A 1TS6A 1RCJA 5DKKA 4UAAA 5HZHA 4EERA 4XT2A 2J3TC 2PU4A 3TSGA 1I5QA 1L2SA 3MS6A 1PI5A 4RYEA 1NYMA 4R3AA 4D60A 3V3RA 5CHMA 3IF6C 2M7UA 3SW1A 2PR5A 2C5WB 3MXSA 3IBJA 3T12B 3FKVA 1W8QA 1XGIA 1CF0A 1PZOA 4KZ7A 4XUXA 1K56D 5M19A 1DJCA 3GTCA 3CPTB 3DW0A 2V1ZA 3ZG8B 4S2OA 1NRJA 4KZ8A 3BLMA 2EWWA 3FYZA 2PR6A 1BYWA 3UB8A 3ZFZA 3NDEA 4UEYA 1OTIA 3DTEA 2ZQCA 3BY8A 2X02A 3NDGA 5FQIA 3BW6A 2HP5A 2Y91A 5BOHA 2J7VA 1TVFA 5J3WA 1FR1A 5L09A 1NZOA 2O99A 1SKFA 4OQIA 5KSCA 4X1LA 3V39A 4HBTA 3B42A 3IHAA 1FILA 2J9PA 4EV4A 2GDNA 1XGJA 5KSHA 3NIAA 1O7EA 3D72A 5JYPA 4R0QA 4DJ2A 5E2HA 4FSFA 4GDNA 4N1HA 1W5DA 2JE5A 4Y3IA 1K38A 2KLIA 5GHYA 1LI9A 2IWBA 2W1RA 3HUNA 3WWXA 2QPNA 2V1BA 1RGYA 4OOMA 3A0SA 5HPIA 4EWFA 2B5RA 4MMNA 1HLUP 5FAOA 1HVBA 3VOYA 2XF3A 3IS2B 1ES5A 3T1QB 2V8FA 3IWIA 3VP2A 3M2KA 4ARZA 1P9RA 2Y2KA 4JLFA 2HF6A 5FEGA 1DY6A 1WE4A 3P09A 4I39A 3VMAA 4GLQA 3C4PA 2J80A 1YM1A 4IEDA 4HEFA 1OTEA 4IVKA 1S67L 2LB9A 4FD8A 1TS8A 2PRFA 1IKGA 4I3AA 5AVEA 1Q2PA 3CUEA 3ZYTA 3NHQA 2B95A 4R23A 2QYBA 2VK3A 2W1TA 3PR6A 1GCEA 2UV0E 3F1OB 3HLGA 4ESPA 1D7EA 1U60A 4JF4A 3M6BA 3M6HA 4LRXC 5GHZA 3MKFA 2PAVP 1K55A 4MCWA 1NY0A 2EA9A 4BD0A 5FQKA 3OCNA 4KZ5A 2RCXA 1JVJA 3WS0A 1TEMA 3DTIA 2VV6A 4R1GA 2PD8A 4OOLA 1A0KA 3LIEA 4CLCE 1W63M 1XA7A 3VP1A 4ZAMA 1K0KA 3IX8A 4YINA 1VETA 4S2LA 5HWTA 4M4XA 3IH8A 3AGEA 5HFOA 1I2WA 1XJ3A 1LI0A 5F83A 3MR0A 5HDDA 3E4PA 2G2UA 4CLCD 3SH7A 2ZM0A 1MWTA 3LR3A 3Q81A 2Z2MB 3AGFA 3HLWA 2V9AA 5CGSA 4DN0A 3W4PA 3NCKA 2L4RA 3EEHA 3EWKA 4LPZA 3VE3A 1S66L 5DJUA 2ZQ8A 4JPMA 4Q0JA 1I2SA 4EBNA 3V3SA 3UMDA 5DTSA 5AQ7A 4L9EA 3CAXA 4OLDA 4BL3A 4HJ6A 2WGWB 1EI5A 3ZCZA 2B02A 3OZHA 2ZC6B 3MZEA 4WYYA 2M7VA 1VHMA 3W2ZA 4YNRA 4E3MA 3LCEA 3MFDA 5EOEA 4P6ZS 3PBNA 4JGQA 4DDYA 4NXGA 2GJ3A 3UDFA 4P6ZM 4OKPA 5CGXA 5J7EA 2V2FF 4BBVA 4GHIB 1SHVA 2A24B 5AVFA 4LCMA 2LB5A 1D1JA 1F5MA 2HV1A 4EEPA 1YQSA 5I5LA 4RA7A 4NEED 3R4KA 1EROA 4E3JA 2ZC3B 4P85A 2FFYA 1WYCA 4IHQA 3UPPA 3HREA 3UN7A 1LLBA 2ZMAA 4PMAA 1K25A 3VFFA 4YOFA 3BQAA 5IS1A 1H8YA 4KG6A 1W79A 5A92A 4DXCA 3MZFA 4Y0TA 4MBKA 3NBLA 4QB8A 4OH0A 4RQ9A 2V20A 1YLYA 4U0XA 3G35A 4EW7A 5LBRA 1KGEA 1TDGA 2GNXA 3ZVWA 3MXQA 1JTGA 3IF6B 1BT5A 3N7WA 3UE6A 2QJ7A 4PHTA 1BLSA 3LIFA 3EGXC 3LYXA 4MEZA 3N8SA 1ZG4A 2JN7A 3U2AA 3T1XA 3DWZA 2W3HA 1CEGA 1FQGA 3V5MA 4B9OA 3FG8A 4XUZA 1H0MA 3GECA 3BJNA 2Y2GA 1G6OA 5CHUA 4X25A 2W0NA 5TBMB 4XT2B 1TS7A 4Z9QA 3BFGA 4BLMA 5EPHA 1KE0A 2G7UA 4S2NA 3S7QA 3E4OA 3BEBA 3G2YA 3KYQA 5CXWA 1ZC2A 5I94A 2O9BA 3CWFA 1GHMA 4EBPA 1PWDA 3IX4A 4HP4A 2OAP1 5EVIA 1IYSA 2Y8HA 3DBAA 5FQQA 3HJIA 1SKOA 1CQAA 3BQ8A 3NOUC 4IVIA 4Y17A 4E6XA 2EWVA 1X0OA 1MWRA 3S7OA 4WM9A 4N9LA 2JKTM 1H8MA 3E2LA 4WLAA 3ZQ5A 4S2NC 4HESA 2JKRI 1ERQA 3ZHHA 1ACFA 2VV7A 5E2FA 5TR7A 3W4QA 1GA9A 5EVIC 1Y28A 2X71A 2VGLS 1ZG6A 4H6JA 4MN6A 4O01A 2EX2A 2VGLM 3T4SA 2QMIA 2HP6A 1S0WA 4HI4A 2WAEA 3RJUA 3JPUA 4QY6A 4GW9A 1HD8A 2EFXA 1STZA 1Z09A 3D4FA 2QHKA 5KZHA 3MZDA 2DCFA 2H0TA 3G4PA 2HDSA 4OOYA 3MQQA 3QP8A 4JF6A 5G4YA 4LCLA 2Y2IA 3TW8A 4WBGA 4EBLA 1DP6A 1ERMA 2J3WA 3WS5A 4UA9A 3VOLA 4GKUA 3TE8A 3HLEA 1LSVA 3IXDA 1P9WA 5DTKA 3ZDJA 5L8MA 1GSXA 3LGOA 1S1YA 3IXBA 1DJBA 3QP5A 5FA7A 4ARZB 5HW3A 3KX0X 2EX8A 4OP5A 1K6RA 4O8GA 3LIDA 3DAVA 4E3OA 2CMNA 3HLFA 3PBRA 1TDLA 1YLZA 3HLBA 1H8ZA 2ZM8A 3R7WA 3EOIA 3GDIA 2W3DA 1GSWA 1C3BA 2EXBA 1G5UA 5AQBA 4HHDA 2ZLYA 1IKIA 5TFQA 1LSWA 3NULA 2W1TB 4JKTA 3HCYA 4U0TA 4UA7A 4U3TA 1FCMA 2BASA 4KZ6A 5F1GA 4FOFA 2PD7A 4JXWA 5M18A 2XDMA 1MXOA 3UMEA 4EETB 4JXVA 3UPNA 4IJGA 4KQDA 4EUZA 5GLCA 4AFIA 5HX9A 3OCLA 2WAFA 4LENA 3HBRA 1KVMA 2Y55A 4XXRA 4WN5A 2W3FA 3VP0A 3VP4A 4KZ4A 4F94A 2DMWA 5F5YA 4A5RA 3F1PA 4X56A 4LFUA 2ZM2A 3VP3A 4WEJA 2JKGA 3H7WA 1VETB 4PM8A 5L07A 4RVAA 1JWPA 1IYOA 3LEQA 5HSQA 4RX3A 1F2KA 4LGWA 3NOTC 1G28A 2WKHA 5FAPA 1KDSA 2FZ0A 4KENB 5HDSA 2Y4AA 4NXEA 1ESIA 3GSGA 2HZ5A 2P7JA 2XRNA 3TG9A 1BULA 1UWPX 4KZ3A 4R6LA 2W27A 4JGPA 3HVFA 4DJ3A 4DE2A 4WZ4A 4QD4A 5F1FA 1N9BA 1IFQA 3KSHA 2VKSA 3G31A 5CHJA 2VZWA 2EXAA 3WRZA 1YPRA 2O0YA 3ZNYA 3QP1A 2XSSA 4QWOA 1Z6FA 4C6YA 1E3UD 1K56A 1PNEA 1KE3A 4G3WA 1TD5A 2QZ6A 5CEDA 2L1MA 2YKFA 3IXHA 4UA6A 4ZDXA 4GJ4A 4GS9A 3UE0A 4KQRA 3IHBA 1PW8A 3IX3A 1YSPA 2QJ5A 1XJ2A 4N1XA 4X6TA 4PM9A 3C2WA 4I3JA 3PAEA 1DJAA 2XD1A 5KMWA 5HL1A 1AXBA 2H10A 1KOUA 1K4FA 4BL2A 4JF5A 1S4RA 1KDWA 1RP5A 2HDRA 3AGDA 3LICA 3NOPC 1IEMA 1MPLA 4PAUA 2Y2HA 3UO9A 1E4DA 3F1NA 3PYPA 2JKFA 1XKZA 2Y2QA 3UB7A 1BUEA 1YMSA 2EX9A 3VV4A 5DVAA 3T1SA 2I9VA 3NI9A 5FI6A 4ZJ1A 3VE4A 5DKLA 2INWA 2ZQDA 3IXGA 5HDCA 5A91A 3SS3A 1O07A
chains in the Genus database with same CATH topology
1TS0A 1XJ4A 4EUVA 4YOFA 3BQAA 3T4KA 5IS1A 4KUOA 4R70A 2ZMVA 3KYZA 1EW0A 3KO6A 3CUEC 5CX7A 3PHYA 2OAQ1 3CI6A 3TJZC 5F69A 3LFVA 4F3LB 4GHIA 4RQ9A 4ETZA 4IUKA 2D01A 1MC0A 4EW7A 5LBRA 5MC7A 2VX8A 2A24A 1GSVA 2PT7A 2V0WA 2QKPA 1OTAA 2GNXA 4EQ1A 4Y2FA 1LL8A 1T1CA 1OJGA 3MXQA 3B33A 3OC2A 4O0PA 3UE6A 2QJ7A 1OT6A 4PHTA 2FH5A 3LYXA 3LIFA 3EGXC 4WL9A 3KSGA 3U2AA 2JN7A 1NLYA 3HJKA 5AJGA 2HJ9C 2W3HA 1H3QA 4DMZA 4GCZA 2R78A 4B9OA 3FG8A 3PBTA 4HJ4A 3GECA 3BJNA 1V9ZA 4CQHA 1G6OA 1JNUA 4UQIS 2W0NA 4LRZE 2O9AA 5F68A 5TBMB 4BJPA 4UQIM 4XT2B 1OTDA 1TS7A 4CLCB 3F1NB 5HWVA 3TRCA 1P0ZA 2G7UA 1ZHHB 2VLGA 3S7QA 3C38A 3E4OA 2QWSA 2GZAA 1T1AA 4PKYA 3KYQA 3FC7A 3V67A 3O5YA 2O9BA 3CWFA 4NXFA 2W3EA 1DP8A 1UWNX 5HD3A 3T50A 2Y79A 1NLZA 4HP4A 2OAP1 2VV8A 1T1BA 2PDRA 2Y8HA 3DBAA 3HJIA 1V9YA 3JVUA 3EQVA 3BQ8A 2PHYA 3NOUC 2K7SA 2EWVA 1OJ5A 3S7PA 1X0OA 3B47A 3S7OA 5KIZA 3H82B 5TJJA 5IU1A 2JKTM 1H8MA 1TS6A 3CLOA 5DKKA 1W63Q 4WLAA 3ZQ5A 5HZHA 4EERA 5FL3A 4XT2A 2J3TC 4CLCA 4NKPA 3LIAA 2OOLA 3KSFA 2JKRI 3UB9A 1T18A 4BMWA 1MKMA 2VV7A 4R3AA 2M7UA 4WUJA 3SW1A 2NUTC 2KDKA 2PR5A 1Y28A 3IBJA 4LRYC 2VGLS 4H6JA 3K3DA 2VA0A 4MN6A 4O01A 2VGLM 3BY9A 5HL6A 3EEAA 1YSQA 3T4SA 3IS2A 4HI4A 4Q0HA 1NRJA 3MFXA 4GW9A 4HJ3A 2ZOIA 4MN5A 3OOVA 1XFNA 3T4OA 1N9OA 2EWWA 1STZA 5DFYA 3H82A 4G3KA 2PR6A 1BYWA 3UB8A 3EQUA 4K08A 5J4EA 1YKDA 2QHKA 4I5SA 2ZMFA 4UEYA 3NJAA 1OTIA 5DJTA 3A0RA 3R7WB 3BY8A 3ULFA 4JGOA 3H9WA 3MQQA 4I3IA 3BW6A 4Z1WA 5G4YA 3TW8A 4II7A 1DP6A 4Q0IA 5IT5A 2J3WA 4KUKA 4BWIA 3VOLA 5J3WA 3C8CA 3TE8A 2O99A 3K3CA 3UB6A 1LSVA 1P9WA 2MJ6A 2PYRA 2K31A 3B42A 1D06A 2WKRA 5L8MA 4NXBA 5C5KA 5K5BA 5KSHA 1GSXA 1S1YA 1S4SA 3D72A 1OTBA 4DJ2A 4FSFA 3F1OA 3ICYA 4ARZB 2VJWA 3KX0X 5G4ZA 4Y3IA 1DP9A 4JGRA 4O8GA 3LIDA 2XROA 5DF9A 4E04A 2KLIA 2CMNA 2W1RA 3PBRA 1LT0A 2V1BA 4OOMA 3R7WA 3EOIA 3A0SA 3GDIA 3K2NA 5HPIA 4HH2A 4ME4A 3LI9A 2W3DA 2OWHA 4MMNA 1GSWA 1LSXA 4H6JB 3F1PB 4HHDA 1LSWA 2W1TB 3MMHA 3HCYA 3IS2B 3T4JA 2BASA 4FOFA 2JKTI 2PD7A 4ZRRA 1N9NA 5HPFA 3UMEA 3LIBA 4EETB 2B18A 2WKPA 4IJGA 3BWLA 3IBRA 1XFQA 4ARZA 2OWJA 4KQDA 3S7NA 1P9RA 2W3GA 2HJEA 4LLOB 4AFIA 5F6AA 2P04A 2HF6A 3OCLA 3P7NA 4I39A 4GLQA 4WN5A 3MQOA 2J80A 2W3FA 1WA9A 1OTEA 2VEAA 1S67L 2LB9A 1TS8A 3CITA 2DMWA 4I3AA 5AVEA 5F5YA 4HQAA 3CUEA 3F1PA 4PKYG 3ZYTA 3NHQA 1ZTUA 1MZUA 2QYBA 2W1TA 3H7WA 4L0LA 3PR6A 4WEJA 2Z6DA 3UE3A 3F1OB 4EU0A 3T4TA 1D7EA 4QPRA 1XJ6A 4CLCC 4LRXC 5HSQA 3NOTC 1G28A 4HOIA 2FZ0A 3FPVA 4MCWA 4I38A 1IOUA 5HDSA 2J3TD 4NXEA 2EA9A 3PBSA 3A0VA 3OCNA 2ZOHA 4BBTA 2P7JA 2XRNA 2VV6A 4BBUA 2PD8A 1UWPX 4GS9B 3LI8A 4OOLA 4EESA 2KX6A 5HD5A 3KSIA 1F98A 3LIEA 3OBFA 4CLCE 2PYPA 4R6LA 1W63M 2W27A 4JGPA 3E4QA 4R38A 2K2NA 4L9GA 4DJ3A 4KQOA 5HWTA 4M4XA 3D3OA 3LR4A 1XJ3A 2A2LA 1F9IA 1IFQA 3MR0A 3E4PA 5HDDA 2L0WA 3KSHA 2VKSA 2VZWA 4CLCD 3LR0A 4MDZA 2O0YA 1VB6A 3E0YA 2KOIA 2XSSA 4Y5FA 1P97A 4MN7A 3LR3A 3RFBA 2ZBBA 1ODVA 2GX5A 4IUHA 3T4LA 1S1ZA 4WF0A 3PXPA 4G3WA 2V9AA 1TD5A 2P08A 3JVVA 2O9CA 4DN0A 2M1CA 1T19A 3OLOA 2L1MA 1NWZA 2L4RA 2YKFA 3EEHA 3EWKA 3PBQA 4LPZA 2NUPC 3LR5A 3MJQA 3VE3A 4GJ4A 2V1AA 4GS9A 1S66L 3H7WB 5DJUA 4HP9A 1TF1A 4WEKA 4Q0JA 4F3LA 1YSPA 2HGVA 3UMDA 2QJ5A 3E98A 4EEUA 1XJ2A 4L9EA 3CAXA 4G3VA 1UGUA 4HJ6A 1OT9A 3EGDC 4HY8A 1N9LA 2YKHA 4YWZA 4HIAA 5HWWA 2B02A 2Z6CA 3C2WA 2D02A 4I3JA 2M7VA 1VHMA 3W2ZA 4YNRA 3LUQA 2V0UA 4EXOA 3G6OA 1KOUA 4HNBA 5DFXA 3FPWA 1DRMA 4P6ZS 3PBNA 4JGQA 4L9FA 1S4RA 4NXGA 2GJ3A 4P6ZM 3RTYA 3MQ0A 3RH8B 4HH3A 3LICA 5J7EA 3NOPC 4GHIB 5TBMA 4BBVA 2H28A 4PAUA 5EFWA 3F1NA 2A24B 5AVFA 4WELA 1YAXA 2JHEA 3T4QA 3PBOA 3PYPA 2WKQA 2LB5A 3UB7A 3VV4A 2JKRM 1F5MA 2IA2A 2HV1A 5A8BA 4EEPA 3P01A 5I5LA 2I9VA 4ETXA 4NEED 1OPXA 3R4KA 2XA7S 4IHQA 3VE4A 4B93A 5DKLA 2XA7M 2INWA 5HDCA 3MF0A 3C30A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TS0 A;  1XJ4 A;  5IS1 A;  4KUO A;  4R70 A;  1EW0 A;  3PHY A;  5F69 A;  4F3L B;  4GHI A;  4RQ9 A;  2D01 A;  4EW7 A;  2A24 A;  1GSV A;  2V0W A;  2QKP A;  1OTA A;  4EQ1 A;  1LL8 A;  1T1C A;  1OJG A;  3MXQ A;  3B33 A;  3UE6 A;  2QJ7 A;  1OT6 A;  3LYX A;  3LIF A;  4WL9 A;  2JN7 A;  3HJK A;  4GCZ A;  2R78 A;  4B9O A;  3FG8 A;  4HJ4 A;  3GEC A;  1V9Z A;  1JNU A;  2W0N A;  4LRZ E;  5F68 A;  5TBM B;  4XT2 B;  1OTD A;  1TS7 A;  3F1N B;  1P0Z A;  2VLG A;  3E4O A;  2QWS A;  1T1A A;  4PKY A;  3FC7 A;  3CWF A;  4NXF A;  1DP8 A;  1UWN X;  5HD3 A;  3T50 A;  4HP4 A;  2VV8 A;  1T1B A;  2PDR A;  3HJI A;  1V9Y A;  3NOU C;  2PHY A;  2K7S A;  1OJ5 A;  1X0O A;  5KIZ A;  3H82 B;  5IU1 A;  1TS6 A;  3CLO A;  5DKK A;  4WLA A;  3ZQ5 A;  5HZH A;  4EER A;  4XT2 A;  3LIA A;  2OOL A;  3UB9 A;  1T18 A;  2VV7 A;  4R3A A;  4WUJ A;  3SW1 A;  2KDK A;  2PR5 A;  1Y28 A;  4LRY C;  4H6J A;  3K3D A;  4MN6 A;  3BY9 A;  3IS2 A;  4HI4 A;  3MFX A;  4GW9 A;  4HJ3 A;  2ZOI A;  4MN5 A;  1XFN A;  1N9O A;  3H82 A;  2PR6 A;  1BYW A;  3UB8 A;  4K08 A;  5J4E A;  4I5S A;  2QHK A;  3NJA A;  1OTI A;  5DJT A;  3A0R A;  3BY8 A;  3ULF A;  4JGO A;  3H9W A;  3MQQ A;  4I3I A;  5G4Y A;  1DP6 A;  4KUK A;  3VOL A;  5J3W A;  3C8C A;  3K3C A;  3UB6 A;  1LSV A;  2PYR A;  1D06 A;  2WKR A;  4NXB A;  1GSX A;  1S1Y A;  1S4S A;  3D72 A;  1OTB A;  4DJ2 A;  3F1O A;  3ICY A;  3KX0 X;  5G4Z A;  1DP9 A;  4JGR A;  3LID A;  4E04 A;  2CMN A;  1LT0 A;  2V1B A;  3A0S A;  3GDI A;  4HH2 A;  3LI9 A;  2OWH A;  1GSW A;  1LSX A;  4H6J B;  3F1P B;  4HHD A;  1LSW A;  3IS2 B;  2BAS A;  2PD7 A;  1N9N A;  3UME A;  3LIB A;  4EET B;  2WKP A;  3BWL A;  3IBR A;  1XFQ A;  2OWJ A;  4KQD A;  4LLO B;  5F6A A;  3P7N A;  4I39 A;  4WN5 A;  3MQO A;  2J80 A;  1WA9 A;  1OTE A;  2VEA A;  1S67 L;  1TS8 A;  4I3A A;  5AVE A;  5F5Y A;  4HQA A;  3F1P A;  4PKY G;  3NHQ A;  1MZU A;  3H7W A;  2Z6D A;  3F1O B;  1D7E A;  1XJ6 A;  4LRX C;  5HSQ A;  3NOT C;  1G28 A;  4HOI A;  4I38 A;  5HDS A;  4NXE A;  2EA9 A;  3A0V A;  2ZOH A;  4BBT A;  2P7J A;  2VV6 A;  4BBU A;  2PD8 A;  1UWP X;  4GS9 B;  3LI8 A;  4EES A;  2KX6 A;  5HD5 A;  1F98 A;  3LIE A;  2PYP A;  4R6L A;  2W27 A;  4JGP A;  3E4Q A;  4R38 A;  4L9G A;  4DJ3 A;  5HWT A;  4M4X A;  1XJ3 A;  1F9I A;  3MR0 A;  5HDD A;  3E4P A;  2L0W A;  1VB6 A;  1P97 A;  2ZBB A;  1ODV A;  1S1Z A;  4WF0 A;  2V9A A;  2M1C A;  1T19 A;  3OLO A;  2L1M A;  1NWZ A;  2L4R A;  2YKF A;  3EEH A;  3EWK A;  4LPZ A;  3VE3 A;  3MJQ A;  2V1A A;  4GS9 A;  1S66 L;  3H7W B;  5DJU A;  4HP9 A;  4F3L A;  3UMD A;  2QJ5 A;  4EEU A;  1XJ2 A;  4L9E A;  3CAX A;  1UGU A;  4HJ6 A;  1OT9 A;  4HY8 A;  1N9L A;  2YKH A;  4YWZ A;  4HIA A;  5HWW A;  2B02 A;  2Z6C A;  3C2W A;  2D02 A;  4I3J A;  3LUQ A;  2V0U A;  4EXO A;  3G6O A;  1KOU A;  4HNB A;  1DRM A;  4JGQ A;  4L9F A;  1S4R A;  4NXG A;  2GJ3 A;  3RTY A;  3RH8 B;  4HH3 A;  3LIC A;  5J7E A;  3NOP C;  4GHI B;  5TBM A;  4BBV A;  2H28 A;  5EFW A;  3F1N A;  2A24 B;  5AVF A;  2JHE A;  3PYP A;  2WKQ A;  3UB7 A;  5A8B A;  2HV1 A;  4EEP A;  5I5L A;  2I9V A;  3VE4 A;  5DKL A;  2INW A;  5HDC A;  5HWV A; 
#chains in the Genus database with same CATH topology
 1XJ4 A;  4EUV A;  1G6A A;  4CJN A;  3T4K A;  4S2J A;  3T1R A;  3GVB A;  1JTD A;  1EW0 A;  3KO6 A;  3CUE C;  3NC8 A;  1AWI A;  3PHY A;  5DF8 A;  4F3L B;  4OP8 A;  4ETZ A;  3Q7V A;  1MC0 A;  2BLS A;  2PBD P;  2XD5 A;  2PT7 A;  2QKP A;  2XLN A;  2AVX A;  4IBR A;  4KG2 A;  3S22 A;  3FWL A;  3SH9 A;  5EVI B;  4OVD A;  1K55 C;  4O0P A;  2Q0O A;  3GR2 A;  2FH5 A;  1SKO B;  4WL9 A;  3KSG A;  1NRF A;  1NLY A;  3HJK A;  5AJG A;  2HJ9 C;  5AQA A;  3ITB A;  5HAP A;  2XR0 A;  4GCZ A;  3UNW A;  4CQH A;  5GHX A;  1JNU A;  3OPP A;  4UQI S;  1CJF A;  2Y2P A;  3VOZ A;  2O9A A;  4BJP A;  4UQI M;  5FI2 A;  1OTD A;  5EM0 A;  4Q8I A;  4DE3 A;  2XH9 A;  4OPR A;  1P0Z A;  1ZHH B;  4UHU A;  2VLG A;  3A3D A;  3C38 A;  3JYI A;  4PKY A;  1FCO A;  3QNB A;  4N92 A;  2WGI A;  1WYB A;  3GRJ A;  2Y79 A;  1NLZ A;  2VV8 A;  3ISG A;  3SH8 A;  1G68 A;  1V9Y A;  3JVU A;  5FQM A;  2PHY A;  1FCN A;  4KZ9 A;  3S7P A;  3B47 A;  3Q7Z A;  2H5S A;  1L0G A;  1L0D A;  3E2K A;  4CLC A;  1Q2Q A;  3N6I A;  2R9W A;  5J8X A;  1T18 A;  2CC1 A;  1SZV A;  5FSR A;  4X1M A;  3A3J A;  4WUJ A;  5HAR A;  2NUT C;  4OON A;  2PU2 A;  2KDK A;  4LRY C;  4P0M A;  1H5X A;  2VA0 A;  1PW1 A;  5AQ9 A;  2R9X A;  2V8C A;  4KZB A;  3UPO A;  5EUA A;  4DE1 A;  1NZU A;  1YT4 A;  3IS2 A;  1N4O A;  5CEC A;  3BM6 A;  4Q0H A;  1M6K A;  3MFX A;  3UE1 A;  1LL5 A;  2ZOI A;  4MN5 A;  3DTK A;  1N9O A;  2EX6 A;  3IWO A;  3OPH A;  3EQU A;  5J4E A;  1YKD A;  4I5S A;  3OPR A;  4M3K A;  1ES2 A;  2ZMF A;  4QU3 A;  3NJA A;  4K0W A;  3A0R A;  3R7W B;  4E6W A;  4JGO A;  3H9W A;  4I3I A;  4KUK A;  2BTF P;  2Z2L B;  3K3C A;  3UB6 A;  1FIK A;  1J3W A;  5EM1 A;  2MJ6 A;  5D3O A;  1D06 A;  2WKR A;  1NJ4 A;  3G2Z A;  5C5K A;  5K5B A;  1MBL A;  4JXG A;  1Y4O A;  3RXX A;  3MBZ A;  1S4S A;  3NEC A;  1OTB A;  4PM5 A;  3F1O A;  3ICY A;  2VJW A;  2E8I A;  2XEP A;  1DP9 A;  5FAQ A;  2ZJ9 A;  4BEN A;  2XRO A;  4ZJ2 A;  5DF9 A;  4E04 A;  3UB5 P;  1ONH A;  3K2N A;  3SZT A;  4ME4 A;  3LI9 A;  2OWH A;  4QHC A;  4D2O A;  3O87 A;  4S2I A;  4ZJ3 A;  3F1P B;  5G18 A;  3MMH A;  3A3I A;  4WMC A;  4R3J A;  3GQZ A;  5L2F A;  2OLU A;  2WUQ A;  1FSW A;  5E2E A;  1N9N A;  5A93 A;  5EV0 A;  2C6W B;  4E3L A;  2B18 A;  2WKP A;  3TOI A;  5CER A;  3MKE A;  2HJE A;  4LLO B;  4OQH A;  3DTM A;  4LV0 A;  1BLH A;  4NG2 A;  2WKE A;  3P7N A;  3IQA A;  3MQO A;  1VEU A;  1WA9 A;  2VEA A;  1L3L A;  1XXM A;  3CIT A;  2VGK A;  3IH9 A;  4DRT A;  2JBF A;  4HQA A;  3I7J A;  3UDX A;  2P74 A;  3C5A A;  2Y59 A;  4K91 A;  3FV7 A;  3G32 A;  2Z6D A;  3UE3 A;  1ES3 A;  5E43 A;  1ALQ A;  3C7U A;  3L7H A;  1LHY A;  3LEZ A;  3U4L P;  3BRM A;  4HOI A;  3FPV A;  2J3T D;  1XPB A;  3QP6 A;  1RGZ A;  4X69 A;  4X55 A;  4R3B A;  4GS9 B;  4WZ5 A;  5HD5 A;  3KSI A;  1F98 A;  1CEF A;  2A49 A;  2PYP A;  3BLS A;  2K2N A;  4KQO A;  5FI7 A;  3D3O A;  3UY6 A;  2A2L A;  1YLJ A;  2L0W A;  4FH2 A;  3QP4 A;  4LV3 A;  4C3Q A;  3LR0 A;  1VB6 A;  1ONG A;  2FFF B;  4Y5F A;  2ZC5 B;  3RFB A;  2ZBB A;  1ODV A;  2GX5 A;  1YLW A;  1S1Z A;  3PXP A;  2P08 A;  3JVV A;  1NXY A;  4OPZ A;  4NK3 A;  1NWZ A;  2BG1 A;  3PBQ A;  3B3X A;  3ZG7 B;  1PIO A;  3MJQ A;  2V1A A;  4HP9 A;  1TF1 A;  4WEK A;  2HGV A;  5DF7 A;  3E98 A;  2I72 A;  1UGU A;  1OT9 A;  3EGD C;  4HY8 A;  1N9L A;  2YKH A;  2IWC A;  4HIA A;  5EE8 A;  3IF6 A;  5IHV A;  4DKI A;  5EEC A;  1E25 A;  4H8R A;  1ZKJ A;  2PBY A;  3LUQ A;  4EXO A;  3G6O A;  1BLC A;  3HUM A;  1GA0 A;  2UWX A;  1KVL A;  3WRT A;  4DF6 A;  4FTX A;  4GD8 A;  4FH4 A;  3W4O A;  5F82 A;  3N8L A;  5TBM A;  2ZL1 A;  2H28 A;  3Q7V B;  3N4I A;  3L9K A;  5EFW A;  4YFM A;  4WEL A;  2JHE A;  3T4Q A;  3PBO A;  3OPL A;  1ES4 A;  2JKR M;  2IA2 A;  5A8B A;  4OPQ A;  3ZNT A;  1LL9 A;  1OPX A;  3O88 A;  4Y0O A;  4B93 A;  1PZP A;  5FAS A;  3MF0 A;  3QNC A;  3C30 A;  5HWV A;  1TS0 A;  4ZTK A;  4KUO A;  4R70 A;  3C4O A;  4E3K A;  4PM7 A;  3MXR A;  4X53 A;  4BD1 A;  1YLP A;  5CX7 A;  2WK0 A;  3CI6 A;  3CMZ A;  3S4X A;  3MSH A;  2D01 A;  3ZG9 B;  2E8J A;  2VX8 A;  1GSV A;  1OTA A;  4EQ1 A;  1T1C A;  5M1A A;  3B33 A;  1OT6 A;  4EQI A;  4PM6 A;  4OQ0 A;  1MY8 A;  3BFE A;  1H3Q A;  4DMZ A;  2R78 A;  4E3N A;  3O86 A;  3GMW A;  1V9Z A;  4OQG A;  3HUO A;  5FDH A;  5F68 A;  4CLC B;  3GV9 A;  1MKI A;  5GLB A;  3ZVT A;  1NYY A;  2ZQ9 A;  1Y54 A;  4KZA A;  4GDB A;  3ZG0 A;  2WZX A;  1GHP A;  3FC7 A;  5FEF A;  4NXF A;  2W3E A;  1DP8 A;  1UWN X;  5CGW A;  3VSK A;  3T50 A;  2P9V A;  2ZC7 A;  3O3V A;  5A90 A;  4BQM A;  4O7D A;  5HAQ A;  3C7V A;  5GLA A;  5CRF A;  3D9Y A;  2ZQ7 A;  3CLO A;  1W63 Q;  3W8K A;  3G34 A;  2XGN A;  5FL3 A;  3CHW P;  4NKP A;  2OOL A;  3LIA A;  4CPK A;  1MWS A;  3KSF A;  3UB9 A;  1E3U A;  3FZC A;  4BMW A;  1MKM A;  1BLP A;  3HLC A;  3QP2 A;  4KG5 A;  4R4R A;  1M40 A;  4X68 A;  2ZQA A;  2HPB A;  3K3D A;  4IBX A;  2HP9 A;  2H0Y A;  3BY9 A;  4S2P A;  5HL6 A;  3EEA A;  1YSQ A;  1K57 A;  4OLG A;  5CTM A;  1K6S A;  3IF5 A;  5FQJ A;  2XFS A;  4HJ3 A;  5DTT A;  1PRQ A;  3OOV A;  4ID4 A;  1QME A;  1XFN A;  4GD6 A;  3T4O A;  4GNU A;  3ZGA B;  5DFY A;  3H82 A;  4G3K A;  4K08 A;  1PI4 A;  5DJT A;  3ULF A;  4Z1W A;  4II7 A;  3SS5 A;  4Q0I A;  5IT5 A;  4BWI A;  2WYX A;  3ZG5 A;  3C8C A;  2Y2N A;  2PYR A;  2K31 A;  1K57 C;  4C75 A;  4NXB A;  2ZD8 A;  4FUW A;  5JYO A;  4R4S A;  2IWD A;  3SOI A;  5CEB A;  3CPT A;  5FDS A;  3Q82 A;  5G4Z A;  2ACG A;  3IWQ A;  4JGR A;  3VFH A;  4MNR A;  3BYD A;  1L0F A;  4B4X A;  4S2K A;  3BEC A;  1CI9 A;  1K54 A;  1LT0 A;  1BTL A;  1VEU B;  1YLT A;  4HH2 A;  4GN2 A;  1S6R A;  3V50 A;  4E3I A;  3P98 A;  1LSX A;  1XX2 A;  4H6J B;  1JWZ A;  5EOO A;  3CJM A;  4K0X A;  3Q07 A;  3T4J A;  2JKT I;  4ZRR A;  1IYQ A;  5HPF A;  3LIB A;  2Q9N A;  3BWL A;  3IBR A;  1XFQ A;  2X01 A;  4JBF A;  2OWJ A;  3S7N A;  2W3G A;  2JCH A;  3NY4 A;  1K54 C;  5F6A A;  4DE0 A;  2P04 A;  1SDE A;  3S1Y A;  4ZBE A;  4GZB A;  2JC7 A;  4PKY G;  1ZTU A;  1MZU A;  2WKI A;  3CZD A;  4L0L A;  2Y2M A;  1GHI A;  1VM1 A;  4B88 A;  4EU0 A;  2OLV A;  3KYE A;  3T4T A;  2EFU A;  4QPR A;  1PWC A;  1XJ6 A;  5FAT A;  4CLC C;  3FKW A;  5L10 A;  1XA1 A;  2XFT A;  1W7F A;  2A3U A;  4MLL A;  3WS1 A;  2J9O A;  4MBF A;  4I38 A;  4PPR A;  1IOU A;  2WZZ A;  3PBS A;  5GLD A;  3A0V A;  2ZOH A;  4BBT A;  4DDS A;  2Y2J A;  3RXW A;  4BBU A;  1IEL A;  3LI8 A;  4QY5 A;  5EVI D;  3SS4 A;  4EES A;  2KX6 A;  3ITA A;  4WMC D;  4N9K A;  4JXS A;  3OBF A;  1BSG A;  4HBU A;  3E4Q A;  4R38 A;  4L9G A;  3DWK A;  4GOG A;  3LR4 A;  1F9I A;  3G30 A;  1SCW A;  4MDZ A;  1XP4 A;  3E0Y A;  2KOI A;  4LV1 A;  1P97 A;  4MN7 A;  5FQ9 A;  1CK3 A;  2RL3 A;  1BZA A;  4IUH A;  3T4L A;  4P6B A;  4WF0 A;  5U47 A;  2O9C A;  2M1C A;  1T19 A;  3OLO A;  1VQQ A;  2ZL1 B;  2NUP C;  3LR5 A;  3H7W B;  1L0E A;  5CTN A;  4F3L A;  3QHY A;  2OSU A;  1IYP A;  4EEU A;  2Q9M A;  2WAD A;  4G3V A;  1FOF A;  3HLD A;  2WGV A;  4YWZ A;  3CG5 A;  5HWW A;  3A3F A;  2Z6C A;  2D02 A;  4LV2 A;  3M2J A;  2V0U A;  3WS2 A;  4HNB A;  5DFX A;  3FPW A;  1DRM A;  4L9F A;  4KQQ A;  2J8Y A;  3RTY A;  3LO7 A;  1HTZ A;  1ESU A;  1OME A;  4MBH A;  3MQ0 A;  3RH8 B;  4HH3 A;  2Y2O A;  1J9M A;  2DRW A;  1MWU A;  1HZO A;  1YAX A;  2XQZ A;  3PTE A;  3PAG A;  2WKQ A;  2HDU A;  4QJG A;  3IT9 A;  3P01 A;  4S2M A;  2WGW A;  4Y15 A;  5HAI A;  4ETX A;  5GL9 A;  2XA7 S;  2XA7 M;  1YMX A;  3LY3 A;  1EWZ A;  2ZMV A;  3KYZ A;  4OPY A;  1CI8 A;  1FSY A;  4Y7P A;  2OAQ 1;  1KE4 A;  3TJZ C;  5F69 A;  3LFV A;  1JWV A;  4GHI A;  4IUK A;  4B4Z A;  5EVL A;  5MC7 A;  2DNS A;  1PWG A;  2A24 A;  4DXB A;  2V0W A;  5E2G A;  3BFD A;  3BFC A;  4Y2F A;  4GB7 A;  1LL8 A;  1OJG A;  3OC2 A;  2ZC4 B;  3WS4 A;  2P9V B;  1KGF A;  4FCF A;  4P87 A;  3VSL A;  2Y2L A;  2XK1 A;  1QMF A;  5TGF A;  1SDN A;  4RX2 A;  1KGG A;  3PBT A;  4HJ4 A;  2OV5 A;  2HDQ A;  4LRZ E;  4WZ5 C;  1K4E A;  1PFL A;  3Q1F A;  2G2W A;  3F1N B;  1FR6 A;  3N8R A;  3TRC A;  1PYY A;  5EVE A;  2VGJ A;  2QWS A;  2GZA A;  1T1A A;  4NET A;  3V67 A;  3O5Y A;  3BFF A;  1W8Y A;  5HD3 A;  3A3E A;  3UDI A;  1T1B A;  2PDR A;  4Y0U A;  4Y13 A;  3EQV A;  2K7S A;  1OJ5 A;  3LY4 A;  5KIZ A;  3H82 B;  5TJJ A;  5IU1 A;  3HL9 A;  1TS6 A;  1RCJ A;  5DKK A;  4UAA A;  5HZH A;  4EER A;  4XT2 A;  2J3T C;  2PU4 A;  3TSG A;  1I5Q A;  1L2S A;  3MS6 A;  1PI5 A;  4RYE A;  1NYM A;  4R3A A;  4D60 A;  3V3R A;  5CHM A;  3IF6 C;  2M7U A;  3SW1 A;  2PR5 A;  2C5W B;  3MXS A;  3IBJ A;  3T12 B;  3FKV A;  1W8Q A;  1XGI A;  1CF0 A;  1PZO A;  4KZ7 A;  4XUX A;  1K56 D;  5M19 A;  1DJC A;  3GTC A;  3CPT B;  3DW0 A;  2V1Z A;  3ZG8 B;  4S2O A;  1NRJ A;  4KZ8 A;  3BLM A;  2EWW A;  3FYZ A;  2PR6 A;  1BYW A;  3UB8 A;  3ZFZ A;  3NDE A;  4UEY A;  1OTI A;  3DTE A;  2ZQC A;  3BY8 A;  2X02 A;  3NDG A;  5FQI A;  3BW6 A;  2HP5 A;  2Y91 A;  5BOH A;  2J7V A;  1TVF A;  5J3W A;  1FR1 A;  5L09 A;  1NZO A;  2O99 A;  1SKF A;  4OQI A;  5KSC A;  4X1L A;  3V39 A;  4HBT A;  3B42 A;  3IHA A;  1FIL A;  2J9P A;  4EV4 A;  2GDN A;  1XGJ A;  5KSH A;  3NIA A;  1O7E A;  3D72 A;  5JYP A;  4R0Q A;  4DJ2 A;  5E2H A;  4FSF A;  4GDN A;  4N1H A;  1W5D A;  2JE5 A;  4Y3I A;  1K38 A;  2KLI A;  5GHY A;  1LI9 A;  2IWB A;  2W1R A;  3HUN A;  3WWX A;  2QPN A;  2V1B A;  1RGY A;  4OOM A;  3A0S A;  5HPI A;  4EWF A;  2B5R A;  4MMN A;  1HLU P;  5FAO A;  1HVB A;  3VOY A;  2XF3 A;  3IS2 B;  1ES5 A;  3T1Q B;  2V8F A;  3IWI A;  3VP2 A;  3M2K A;  4ARZ A;  1P9R A;  2Y2K A;  4JLF A;  2HF6 A;  5FEG A;  1DY6 A;  1WE4 A;  3P09 A;  4I39 A;  3VMA A;  4GLQ A;  3C4P A;  2J80 A;  1YM1 A;  4IED A;  4HEF A;  1OTE A;  4IVK A;  1S67 L;  2LB9 A;  4FD8 A;  1TS8 A;  2PRF A;  1IKG A;  4I3A A;  5AVE A;  1Q2P A;  3CUE A;  3ZYT A;  3NHQ A;  2B95 A;  4R23 A;  2QYB A;  2VK3 A;  2W1T A;  3PR6 A;  1GCE A;  2UV0 E;  3F1O B;  3HLG A;  4ESP A;  1D7E A;  1U60 A;  4JF4 A;  3M6B A;  3M6H A;  4LRX C;  5GHZ A;  3MKF A;  2PAV P;  1K55 A;  4MCW A;  1NY0 A;  2EA9 A;  4BD0 A;  5FQK A;  3OCN A;  4KZ5 A;  2RCX A;  1JVJ A;  3WS0 A;  1TEM A;  3DTI A;  2VV6 A;  4R1G A;  2PD8 A;  4OOL A;  1A0K A;  3LIE A;  4CLC E;  1W63 M;  1XA7 A;  3VP1 A;  4ZAM A;  1K0K A;  3IX8 A;  4YIN A;  1VET A;  4S2L A;  5HWT A;  4M4X A;  3IH8 A;  3AGE A;  5HFO A;  1I2W A;  1XJ3 A;  1LI0 A;  5F83 A;  3MR0 A;  5HDD A;  3E4P A;  2G2U A;  4CLC D;  3SH7 A;  2ZM0 A;  1MWT A;  3LR3 A;  3Q81 A;  2Z2M B;  3AGF A;  3HLW A;  2V9A A;  5CGS A;  4DN0 A;  3W4P A;  3NCK A;  2L4R A;  3EEH A;  3EWK A;  4LPZ A;  3VE3 A;  1S66 L;  5DJU A;  2ZQ8 A;  4JPM A;  4Q0J A;  1I2S A;  4EBN A;  3V3S A;  3UMD A;  5DTS A;  5AQ7 A;  4L9E A;  3CAX A;  4OLD A;  4BL3 A;  4HJ6 A;  2WGW B;  1EI5 A;  3ZCZ A;  2B02 A;  3OZH A;  2ZC6 B;  3MZE A;  4WYY A;  2M7V A;  1VHM A;  3W2Z A;  4YNR A;  4E3M A;  3LCE A;  3MFD A;  5EOE A;  4P6Z S;  3PBN A;  4JGQ A;  4DDY A;  4NXG A;  2GJ3 A;  3UDF A;  4P6Z M;  4OKP A;  5CGX A;  5J7E A;  2V2F F;  4BBV A;  4GHI B;  1SHV A;  2A24 B;  5AVF A;  4LCM A;  2LB5 A;  1D1J A;  1F5M A;  2HV1 A;  4EEP A;  1YQS A;  5I5L A;  4RA7 A;  4NEE D;  3R4K A;  1ERO A;  4E3J A;  2ZC3 B;  4P85 A;  2FFY A;  1WYC A;  4IHQ A;  3UPP A;  3HRE A;  3UN7 A;  1LLB A;  2ZMA A;  4PMA A;  1K25 A;  3VFF A;  4YOF A;  3BQA A;  5IS1 A;  1H8Y A;  4KG6 A;  1W79 A;  5A92 A;  4DXC A;  3MZF A;  4Y0T A;  4MBK A;  3NBL A;  4QB8 A;  4OH0 A;  4RQ9 A;  2V20 A;  1YLY A;  4U0X A;  3G35 A;  4EW7 A;  5LBR A;  1KGE A;  1TDG A;  2GNX A;  3ZVW A;  3MXQ A;  1JTG A;  3IF6 B;  1BT5 A;  3N7W A;  3UE6 A;  2QJ7 A;  4PHT A;  1BLS A;  3LIF A;  3EGX C;  3LYX A;  4MEZ A;  3N8S A;  1ZG4 A;  2JN7 A;  3U2A A;  3T1X A;  3DWZ A;  2W3H A;  1CEG A;  1FQG A;  3V5M A;  4B9O A;  3FG8 A;  4XUZ A;  1H0M A;  3GEC A;  3BJN A;  2Y2G A;  1G6O A;  5CHU A;  4X25 A;  2W0N A;  5TBM B;  4XT2 B;  1TS7 A;  4Z9Q A;  3BFG A;  4BLM A;  5EPH A;  1KE0 A;  2G7U A;  4S2N A;  3S7Q A;  3E4O A;  3BEB A;  3G2Y A;  3KYQ A;  5CXW A;  1ZC2 A;  5I94 A;  2O9B A;  3CWF A;  1GHM A;  4EBP A;  1PWD A;  3IX4 A;  4HP4 A;  2OAP 1;  5EVI A;  1IYS A;  2Y8H A;  3DBA A;  5FQQ A;  3HJI A;  1SKO A;  1CQA A;  3BQ8 A;  3NOU C;  4IVI A;  4Y17 A;  4E6X A;  2EWV A;  1X0O A;  1MWR A;  3S7O A;  4WM9 A;  4N9L A;  2JKT M;  1H8M A;  3E2L A;  4WLA A;  3ZQ5 A;  4S2N C;  4HES A;  2JKR I;  1ERQ A;  3ZHH A;  1ACF A;  2VV7 A;  5E2F A;  5TR7 A;  3W4Q A;  1GA9 A;  5EVI C;  1Y28 A;  2X71 A;  2VGL S;  1ZG6 A;  4H6J A;  4MN6 A;  4O01 A;  2EX2 A;  2VGL M;  3T4S A;  2QMI A;  2HP6 A;  1S0W A;  4HI4 A;  2WAE A;  3RJU A;  3JPU A;  4QY6 A;  4GW9 A;  1HD8 A;  2EFX A;  1STZ A;  1Z09 A;  3D4F A;  2QHK A;  5KZH A;  3MZD A;  2DCF A;  2H0T A;  3G4P A;  2HDS A;  4OOY A;  3MQQ A;  3QP8 A;  4JF6 A;  5G4Y A;  4LCL A;  2Y2I A;  3TW8 A;  4WBG A;  4EBL A;  1DP6 A;  1ERM A;  2J3W A;  3WS5 A;  4UA9 A;  3VOL A;  4GKU A;  3TE8 A;  3HLE A;  1LSV A;  3IXD A;  1P9W A;  5DTK A;  3ZDJ A;  5L8M A;  1GSX A;  3LGO A;  1S1Y A;  3IXB A;  1DJB A;  3QP5 A;  5FA7 A;  4ARZ B;  5HW3 A;  3KX0 X;  2EX8 A;  4OP5 A;  1K6R A;  4O8G A;  3LID A;  3DAV A;  4E3O A;  2CMN A;  3HLF A;  3PBR A;  1TDL A;  1YLZ A;  3HLB A;  1H8Z A;  2ZM8 A;  3R7W A;  3EOI A;  3GDI A;  2W3D A;  1GSW A;  1C3B A;  2EXB A;  1G5U A;  5AQB A;  4HHD A;  2ZLY A;  1IKI A;  5TFQ A;  1LSW A;  3NUL A;  2W1T B;  4JKT A;  3HCY A;  4U0T A;  4UA7 A;  4U3T A;  1FCM A;  2BAS A;  4KZ6 A;  5F1G A;  4FOF A;  2PD7 A;  4JXW A;  5M18 A;  2XDM A;  1MXO A;  3UME A;  4EET B;  4JXV A;  3UPN A;  4IJG A;  4KQD A;  4EUZ A;  5GLC A;  4AFI A;  5HX9 A;  3OCL A;  2WAF A;  4LEN A;  3HBR A;  1KVM A;  2Y55 A;  4XXR A;  4WN5 A;  2W3F A;  3VP0 A;  3VP4 A;  4KZ4 A;  4F94 A;  2DMW A;  5F5Y A;  4A5R A;  3F1P A;  4X56 A;  4LFU A;  2ZM2 A;  3VP3 A;  4WEJ A;  2JKG A;  3H7W A;  1VET B;  4PM8 A;  5L07 A;  4RVA A;  1JWP A;  1IYO A;  3LEQ A;  5HSQ A;  4RX3 A;  1F2K A;  4LGW A;  3NOT C;  1G28 A;  2WKH A;  5FAP A;  1KDS A;  2FZ0 A;  4KEN B;  5HDS A;  2Y4A A;  4NXE A;  1ESI A;  3GSG A;  2HZ5 A;  2P7J A;  2XRN A;  3TG9 A;  1BUL A;  1UWP X;  4KZ3 A;  4R6L A;  2W27 A;  4JGP A;  3HVF A;  4DJ3 A;  4DE2 A;  4WZ4 A;  4QD4 A;  5F1F A;  1N9B A;  1IFQ A;  3KSH A;  2VKS A;  3G31 A;  5CHJ A;  2VZW A;  2EXA A;  3WRZ A;  1YPR A;  2O0Y A;  3ZNY A;  3QP1 A;  2XSS A;  4QWO A;  1Z6F A;  4C6Y A;  1E3U D;  1K56 A;  1PNE A;  1KE3 A;  4G3W A;  1TD5 A;  2QZ6 A;  5CED A;  2L1M A;  2YKF A;  3IXH A;  4UA6 A;  4ZDX A;  4GJ4 A;  4GS9 A;  3UE0 A;  4KQR A;  3IHB A;  1PW8 A;  3IX3 A;  1YSP A;  2QJ5 A;  1XJ2 A;  4N1X A;  4X6T A;  4PM9 A;  3C2W A;  4I3J A;  3PAE A;  1DJA A;  2XD1 A;  5KMW A;  5HL1 A;  1AXB A;  2H10 A;  1KOU A;  1K4F A;  4BL2 A;  4JF5 A;  1S4R A;  1KDW A;  1RP5 A;  2HDR A;  3AGD A;  3LIC A;  3NOP C;  1IEM A;  1MPL A;  4PAU A;  2Y2H A;  3UO9 A;  1E4D A;  3F1N A;  3PYP A;  2JKF A;  1XKZ A;  2Y2Q A;  3UB7 A;  1BUE A;  1YMS A;  2EX9 A;  3VV4 A;  5DVA A;  3T1S A;  2I9V A;  3NI9 A;  5FI6 A;  4ZJ1 A;  3VE4 A;  5DKL A;  2INW A;  2ZQD A;  3IXG A;  5HDC A;  5A91 A;  3SS3 A;  1O07 A; 
#chains in the Genus database with same CATH homology
 1TS0 A;  1XJ4 A;  4EUV A;  4YOF A;  3BQA A;  3T4K A;  5IS1 A;  4KUO A;  4R70 A;  2ZMV A;  3KYZ A;  1EW0 A;  3KO6 A;  3CUE C;  5CX7 A;  3PHY A;  2OAQ 1;  3CI6 A;  3TJZ C;  5F69 A;  3LFV A;  4F3L B;  4GHI A;  4RQ9 A;  4ETZ A;  4IUK A;  2D01 A;  1MC0 A;  4EW7 A;  5LBR A;  5MC7 A;  2VX8 A;  2A24 A;  1GSV A;  2PT7 A;  2V0W A;  2QKP A;  1OTA A;  2GNX A;  4EQ1 A;  4Y2F A;  1LL8 A;  1T1C A;  1OJG A;  3MXQ A;  3B33 A;  3OC2 A;  4O0P A;  3UE6 A;  2QJ7 A;  1OT6 A;  4PHT A;  2FH5 A;  3LYX A;  3LIF A;  3EGX C;  4WL9 A;  3KSG A;  3U2A A;  2JN7 A;  1NLY A;  3HJK A;  5AJG A;  2HJ9 C;  2W3H A;  1H3Q A;  4DMZ A;  4GCZ A;  2R78 A;  4B9O A;  3FG8 A;  3PBT A;  4HJ4 A;  3GEC A;  3BJN A;  1V9Z A;  4CQH A;  1G6O A;  1JNU A;  4UQI S;  2W0N A;  4LRZ E;  2O9A A;  5F68 A;  5TBM B;  4BJP A;  4UQI M;  4XT2 B;  1OTD A;  1TS7 A;  4CLC B;  3F1N B;  5HWV A;  3TRC A;  1P0Z A;  2G7U A;  1ZHH B;  2VLG A;  3S7Q A;  3C38 A;  3E4O A;  2QWS A;  2GZA A;  1T1A A;  4PKY A;  3KYQ A;  3FC7 A;  3V67 A;  3O5Y A;  2O9B A;  3CWF A;  4NXF A;  2W3E A;  1DP8 A;  1UWN X;  5HD3 A;  3T50 A;  2Y79 A;  1NLZ A;  4HP4 A;  2OAP 1;  2VV8 A;  1T1B A;  2PDR A;  2Y8H A;  3DBA A;  3HJI A;  1V9Y A;  3JVU A;  3EQV A;  3BQ8 A;  2PHY A;  3NOU C;  2K7S A;  2EWV A;  1OJ5 A;  3S7P A;  1X0O A;  3B47 A;  3S7O A;  5KIZ A;  3H82 B;  5TJJ A;  5IU1 A;  2JKT M;  1H8M A;  1TS6 A;  3CLO A;  5DKK A;  1W63 Q;  4WLA A;  3ZQ5 A;  5HZH A;  4EER A;  5FL3 A;  4XT2 A;  2J3T C;  4CLC A;  4NKP A;  3LIA A;  2OOL A;  3KSF A;  2JKR I;  3UB9 A;  1T18 A;  4BMW A;  1MKM A;  2VV7 A;  4R3A A;  2M7U A;  4WUJ A;  3SW1 A;  2NUT C;  2KDK A;  2PR5 A;  1Y28 A;  3IBJ A;  4LRY C;  2VGL S;  4H6J A;  3K3D A;  2VA0 A;  4MN6 A;  4O01 A;  2VGL M;  3BY9 A;  5HL6 A;  3EEA A;  1YSQ A;  3T4S A;  3IS2 A;  4HI4 A;  4Q0H A;  1NRJ A;  3MFX A;  4GW9 A;  4HJ3 A;  2ZOI A;  4MN5 A;  3OOV A;  1XFN A;  3T4O A;  1N9O A;  2EWW A;  1STZ A;  5DFY A;  3H82 A;  4G3K A;  2PR6 A;  1BYW A;  3UB8 A;  3EQU A;  4K08 A;  5J4E A;  1YKD A;  2QHK A;  4I5S A;  2ZMF A;  4UEY A;  3NJA A;  1OTI A;  5DJT A;  3A0R A;  3R7W B;  3BY8 A;  3ULF A;  4JGO A;  3H9W A;  3MQQ A;  4I3I A;  3BW6 A;  4Z1W A;  5G4Y A;  3TW8 A;  4II7 A;  1DP6 A;  4Q0I A;  5IT5 A;  2J3W A;  4KUK A;  4BWI A;  3VOL A;  5J3W A;  3C8C A;  3TE8 A;  2O99 A;  3K3C A;  3UB6 A;  1LSV A;  1P9W A;  2MJ6 A;  2PYR A;  2K31 A;  3B42 A;  1D06 A;  2WKR A;  5L8M A;  4NXB A;  5C5K A;  5K5B A;  5KSH A;  1GSX A;  1S1Y A;  1S4S A;  3D72 A;  1OTB A;  4DJ2 A;  4FSF A;  3F1O A;  3ICY A;  4ARZ B;  2VJW A;  3KX0 X;  5G4Z A;  4Y3I A;  1DP9 A;  4JGR A;  4O8G A;  3LID A;  2XRO A;  5DF9 A;  4E04 A;  2KLI A;  2CMN A;  2W1R A;  3PBR A;  1LT0 A;  2V1B A;  4OOM A;  3R7W A;  3EOI A;  3A0S A;  3GDI A;  3K2N A;  5HPI A;  4HH2 A;  4ME4 A;  3LI9 A;  2W3D A;  2OWH A;  4MMN A;  1GSW A;  1LSX A;  4H6J B;  3F1P B;  4HHD A;  1LSW A;  2W1T B;  3MMH A;  3HCY A;  3IS2 B;  3T4J A;  2BAS A;  4FOF A;  2JKT I;  2PD7 A;  4ZRR A;  1N9N A;  5HPF A;  3UME A;  3LIB A;  4EET B;  2B18 A;  2WKP A;  4IJG A;  3BWL A;  3IBR A;  1XFQ A;  4ARZ A;  2OWJ A;  4KQD A;  3S7N A;  1P9R A;  2W3G A;  2HJE A;  4LLO B;  4AFI A;  5F6A A;  2P04 A;  2HF6 A;  3OCL A;  3P7N A;  4I39 A;  4GLQ A;  4WN5 A;  3MQO A;  2J80 A;  2W3F A;  1WA9 A;  1OTE A;  2VEA A;  1S67 L;  2LB9 A;  1TS8 A;  3CIT A;  2DMW A;  4I3A A;  5AVE A;  5F5Y A;  4HQA A;  3CUE A;  3F1P A;  4PKY G;  3ZYT A;  3NHQ A;  1ZTU A;  1MZU A;  2QYB A;  2W1T A;  3H7W A;  4L0L A;  3PR6 A;  4WEJ A;  2Z6D A;  3UE3 A;  3F1O B;  4EU0 A;  3T4T A;  1D7E A;  4QPR A;  1XJ6 A;  4CLC C;  4LRX C;  5HSQ A;  3NOT C;  1G28 A;  4HOI A;  2FZ0 A;  3FPV A;  4MCW A;  4I38 A;  1IOU A;  5HDS A;  2J3T D;  4NXE A;  2EA9 A;  3PBS A;  3A0V A;  3OCN A;  2ZOH A;  4BBT A;  2P7J A;  2XRN A;  2VV6 A;  4BBU A;  2PD8 A;  1UWP X;  4GS9 B;  3LI8 A;  4OOL A;  4EES A;  2KX6 A;  5HD5 A;  3KSI A;  1F98 A;  3LIE A;  3OBF A;  4CLC E;  2PYP A;  4R6L A;  1W63 M;  2W27 A;  4JGP A;  3E4Q A;  4R38 A;  2K2N A;  4L9G A;  4DJ3 A;  4KQO A;  5HWT A;  4M4X A;  3D3O A;  3LR4 A;  1XJ3 A;  2A2L A;  1F9I A;  1IFQ A;  3MR0 A;  3E4P A;  5HDD A;  2L0W A;  3KSH A;  2VKS A;  2VZW A;  4CLC D;  3LR0 A;  4MDZ A;  2O0Y A;  1VB6 A;  3E0Y A;  2KOI A;  2XSS A;  4Y5F A;  1P97 A;  4MN7 A;  3LR3 A;  3RFB A;  2ZBB A;  1ODV A;  2GX5 A;  4IUH A;  3T4L A;  1S1Z A;  4WF0 A;  3PXP A;  4G3W A;  2V9A A;  1TD5 A;  2P08 A;  3JVV A;  2O9C A;  4DN0 A;  2M1C A;  1T19 A;  3OLO A;  2L1M A;  1NWZ A;  2L4R A;  2YKF A;  3EEH A;  3EWK A;  3PBQ A;  4LPZ A;  2NUP C;  3LR5 A;  3MJQ A;  3VE3 A;  4GJ4 A;  2V1A A;  4GS9 A;  1S66 L;  3H7W B;  5DJU A;  4HP9 A;  1TF1 A;  4WEK A;  4Q0J A;  4F3L A;  1YSP A;  2HGV A;  3UMD A;  2QJ5 A;  3E98 A;  4EEU A;  1XJ2 A;  4L9E A;  3CAX A;  4G3V A;  1UGU A;  4HJ6 A;  1OT9 A;  3EGD C;  4HY8 A;  1N9L A;  2YKH A;  4YWZ A;  4HIA A;  5HWW A;  2B02 A;  2Z6C A;  3C2W A;  2D02 A;  4I3J A;  2M7V A;  1VHM A;  3W2Z A;  4YNR A;  3LUQ A;  2V0U A;  4EXO A;  3G6O A;  1KOU A;  4HNB A;  5DFX A;  3FPW A;  1DRM A;  4P6Z S;  3PBN A;  4JGQ A;  4L9F A;  1S4R A;  4NXG A;  2GJ3 A;  4P6Z M;  3RTY A;  3MQ0 A;  3RH8 B;  4HH3 A;  3LIC A;  5J7E A;  3NOP C;  4GHI B;  5TBM A;  4BBV A;  2H28 A;  4PAU A;  5EFW A;  3F1N A;  2A24 B;  5AVF A;  4WEL A;  1YAX A;  2JHE A;  3T4Q A;  3PBO A;  3PYP A;  2WKQ A;  2LB5 A;  3UB7 A;  3VV4 A;  2JKR M;  1F5M A;  2IA2 A;  2HV1 A;  5A8B A;  4EEP A;  3P01 A;  5I5L A;  2I9V A;  4ETX A;  4NEE D;  1OPX A;  3R4K A;  2XA7 S;  4IHQ A;  3VE4 A;  4B93 A;  5DKL A;  2XA7 M;  2INW A;  5HDC A;  3MF0 A;  3C30 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...