4L9GA

Structure of ppsr n-q-pas1 from rb. sphaeroides
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
250
structure length
250
Chain Sequence
b'PSLAPDLVRDLIATAADISLLVSQEGVVREVMANPHHPSFGQLSEWEGRPLEEVLTAESVAKFRLRSEGLEPGRGSVAVELNHIDPRSFEFPIRYILHRLPADRSILMLGRDLRPIAEVQQQLVAAQLAMERDYETQREMETRYRVVLDVSRDPMVLVSMSTGRIVDLNSAAGLLLGGVRQDLLGAAIAQEFEGRRRGEFMETMTNLAATESAAPVEVLARRSQKRLLVVPRVFRAAGERLLLCQIDPAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, PpsR
publication title Multi-PAS domain-mediated protein oligomerization of PpsR from Rhodobacter sphaeroides.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Transcription
total genus 83
structure length 250
sequence length 250
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13188 PAS_8 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4l9gA02
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4l9gA01
4I5SA 2R78A 3UB9A 1XJ3A 3G6OA 2JN7A 3UB6A 4LRXC 1X0OA 1JNUA 1N9LA 5HD5A 4K08A 4KQDA 4LRYC 2PR5A 5HD3A 4HOIA 3HJKA 4EETB 1GSWA 2B02A 5F69A 1S67L 4GS9A 2VEAA 1LT0A 2VLGA 3F1PB 3H82A 4M4XA 4L9FA 1XJ4A 3KX0X 3LYXA 1EW0A 5G4YA 2KDKA 4DJ2A 3OLOA 1OT6A 2WKQA 4HIAA 3T50A 2V0UA 1F98A 4HNBA 3ZQ5A 1NWZA 4R6LA 3FC7A 4GHIB 3E4PA 4HH2A 4PKYA 4MN5A 3F1NA 3D72A 3H7WB 5HDDA 5TBMA 4HJ6A 3A0SA 2OWJA 5HDSA 4XT2B 3FG8A 2VV6A 3NOTC 4PKYG 3A0VA 4KUKA 2M1CA 3NOPC 4I3JA 2I9VA 1G28A 3LICA 3UMEA 1T1CA 5J7EA 4BBVA 2A24B 1XJ6A 4EERA 3GDIA 5F5YA 2K7SA 1UGUA 4WN5A 1KOUA 2JHEA 1T18A 3E4OA 4F3LA 3PYPA 3UMDA 4HP4A 1BYWA 3F1OA 5J4EA 3BY9A 2INWA 1XFQA 4H6JB 5IU1A 2YKFA 2PHYA 3LIFA 4I3AA 4WLAA 3BWLA 3K3DA 2P7JA 3MXQA 3LIAA 5F6AA 3C2WA 2Z6CA 5J3WA 5EFWA 2J80A 1MZUA 1XFNA 5I5LA 4EXOA 4L9EA 1VB6A 4WL9A 4I3IA 3UE6A 4HP9A 3B33A 5HSQA 3EWKA 3LI9A 3K3CA 4EEPA 3BY8A 2BASA 3F1NB 4HH3A 5TBMB 2W0NA 3MJQA 3ICYA 2PYRA 2ZOHA 2D01A 3NHQA 4B9OA 2CMNA 4BBTA 5KIZA 1OJ5A 3VE4A 5DJTA 2PD8A 4EW7A 1OTEA 5IS1A 1DP6A 4EESA 3IS2A 1T1BA 1Y28A 2HV1A 2EA9A 4F3LB 4MN6A 3PHYA 2KX6A 1S1YA 3E4QA 4HJ3A 3MQQA 1TS0A 2VV8A 1OTIA 3EEHA 2PD7A 3C8CA 1OJGA 2PYPA 1TS6A 5DKKA 4HJ4A 5DKLA 3MFXA 4BBUA 3CAXA 3P7NA 2L4RA 5AVEA 2W27A 1V9YA 4KUOA 1P97A 2V1BA 1N9NA 2Z6DA 3NOUC 1UWPX 2L1MA 3LUQA 4EEUA 4GCZA 4GS9B 4NXEA 4HQAA 2WKRA 1P0ZA 3H9WA 1OTDA 1S4RA 3H82B 1GSXA 2GJ3A 1DP8A 3LIBA 1ODVA 4L9GA 1LSXA 4NXGA 1S4SA 4HI4A 5A8BA 4YWZA 1GSVA 5HWVA 4R38A 4HHDA 5F68A 4I38A 1DP9A 2D02A 3ULFA 4XT2A 5G4ZA 2V1AA 2WKPA 5HDCA 2OWHA 3UB8A 2YKHA 3IS2B 2QJ7A 2A24A 2QJ5A 1OTBA 3IBRA 1D06A 2OOLA 2V0WA 4R70A 1T1AA 2V9AA 3LI8A 3LIDA 4NXFA 4WUJA 1S1ZA 4GW9A 1TS7A 3LIEA 4I39A 2H28A 5AVFA 3VOLA 5DJUA 2PR6A 1TS8A 1UWNX 3MR0A 3HJIA 2QHKA 4JGOA 3RTYA 4H6JA 3SW1A 4JGRA 5HZHA 1WA9A 1D7EA 3A0RA 4EQ1A 4LLOB 2L0WA 3NJAA 4R3AA 3F1OB 4LRZE 1DRMA 1F9IA 2PDRA 4JGQA 3MQOA 1T19A 3RH8B 3F1PA 2QWSA 3CLOA 4JGPA 1OT9A 5HWTA 2ZBBA 4RQ9A 1V9ZA 4DJ3A 1OTAA 1XJ2A 3UB7A 3VE3A 2VV7A 1LL8A 4E04A 1LSVA 1N9OA 3CWFA 3GECA 4GHIA 4HY8A 4NXBA 2QKPA 5HWWA 4WF0A 3H7WA 1S66L 1LSWA 4LPZA 2ZOIA
chains in the Genus database with same CATH superfamily
4FUWA 4UHUA 3VFFA 2R78A 1M6KA 1IKIA 2J9PA 3W4OA 3G6OA 1H8ZA 1RGZA 3L9KA 1BULA 2JN7A 3RXWA 3UB6A 4KZ6A 2HJ9C 5FASA 3O3VA 5DF7A 1YM1A 4HOIA 1JWPA 4R23A 3A3DA 5EVIA 2O99A 1IELA 4DDYA 5JYPA 4JBFA 3Q7ZA 1SDEA 3IX4A 4UQIS 3VP3A 3CPTB 1BSGA 4M4XA 3T4KA 4KZBA 1W7FA 3BLSA 2KDKA 3SH7A 4X56A 3OLOA 2J8YA 2WKQA 5DVAA 2XLNA 3SH9A 5DFXA 4HBTA 5CEDA 4HIAA 3V5MA 1HTZA 1S0WA 2NUPC 5HAPA 4PHTA 4GHIB 1ALQA 5AQBA 2PT7A 3VMAA 4PKYA 1ES5A 3TW8A 3G4PA 3IHBA 3F1NA 2O9CA 5HDDA 2Q9NA 2HDQA 2OWJA 3DWKA 5E2GA 4LCLA 3K2NA 5HDSA 1J3WA 3PAEA 4BL3A 3A0VA 4S2LA 4ARZA 4I3JA 2I9VA 3LICA 1ACFA 5A91A 4NKPA 1ZTUA 5FEFA 1CI9A 4NK3A 2A24B 3IWQA 4LCMA 2Y2QA 1FIKA 4Y15A 4G3WA 4Q0JA 3VSKA 2ZQ9A 3E4OA 3FV7A 4F3LA 1I2WA 1SHVA 3BFEA 2OSUA 3S4XA 3OPRA 2B95A 4EUVA 3F1OA 3D4FA 3B3XA 5FQMA 4JXWA 4FH2A 2JC7A 1YLYA 1BLPA 4B4XA 4GZBA 1BZAA 5FQKA 5TR7A 4PM6A 4I3AA 5E2HA 4ZTKA 2HP5A 2Z6CA 1PZOA 5EFWA 2JKFA 4KQQA 5I5LA 4KG2A 3KO6A 5KSCA 3LI9A 3M6HA 2Q0OA 2K31A 4O8GA 4IUKA 3U2AA 3ICYA 2XD5A 1ZC2A 1EWZA 3Q81A 2XFSA 3OOVA 5CEBA 3WWXA 5EUAA 3RFBA 4XUZA 3N8SA 1F5MA 3DWZA 3LEZA 1XPBA 2EX9A 5HPFA 5E2EA 1FR1A 1DP6A 4E6WA 4EESA 3G35A 2QYBA 4E3MA 1Y28A 2HV1A 4MCWA 3IX3A 2HDRA 3UE3A 3ZYTA 2HDUA 1MKIA 3LY4A 5CXWA 4JXVA 4KZ7A 5L2FA 3MKFA 2C6WB 2PD7A 1VETB 3C8CA 2G7UA 4RA7A 2PBYA 1NY0A 2XK1A 4ZDXA 2W1RA 3VP0A 3FZCA 3OCNA 2WZXA 5DKLA 4QPRA 2XGNA 2RCXA 1P97A 2V8CA 2EX6A 1LL5A 1N9NA 2EWWA 4GCZA 3KYEA 1P0ZA 1K6SA 4OONA 1DP8A 3LIBA 4P87A 1PYYA 1S4SA 4OPRA 4P6ZM 3WRTA 1A0KA 1FCOA 1P9WA 1GSVA 4R38A 4HHDA 2XFTA 3CZDA 3PBNA 4U0XA 3ULFA 4ZAMA 5G4ZA 3S7NA 2JBFA 3CMZA 3NDGA 1QMEA 3LO7A 4R3JA 1E3UD 2OWHA 3CITA 1WYCA 5K5BA 3D9YA 1GCEA 2A24A 4PPRA 3G31A 2WZZA 3HCYA 4S2NA 1K55A 5HPIA 2V9AA 3TJZC 2Y8HA 4X6TA 3LI8A 4NXFA 2WGWA 3HLDA 4IUHA 2ZMFA 3W2ZA 2Q9MA 4OOLA 3LIEA 3IF6B 1SCWA 4QJGA 1NLYA 5DJUA 2GDNA 2XDMA 1TS8A 4E3NA 1SDNA 5EVLA 2QHKA 2W3DA 4PM9A 2XD1A 3QP8A 3SW1A 4BMWA 5HZHA 1D7EA 2DCFA 2ZQ7A 3C38A 5U47A 5GHYA 2ZC3B 3BEBA 4R3AA 3OPHA 4DXBA 4DE0A 1FR6A 2O0YA 4ESPA 3MQOA 3RH8B 3F1PA 3KSHA 1ERQA 3Q7VA 3KSIA 4DF6A 3V50A 5HWTA 3LGOA 1MXOA 3QP1A 2ZBBA 4RQ9A 4S2NC 3DTEA 3NY4A 4S2MA 1K55C 3ZHHA 5HAQA 1JVJA 3VV4A 3KYQA 5FSRA 1OTAA 3VE3A 3BYDA 1BLSA 1J9MA 5E43A 3BLMA 3UDXA 1HD8A 4GDBA 4BWIA 1BUEA 4WEJA 2P9VB 1PRQA 2A3UA 4GLQA 4BQMA 4D60A 1LI9A 2ZM8A 1YLWA 3H7WA 4MBFA 4O7DA 2XH9A 1KE3A 3AGEA 3V3SA 4CJNA 2V1ZA 2Y2HA 3HREA 4GDNA 3UB9A 1I2SA 2DMWA 2X02A 4B4ZA 2VZWA 4LRXC 1JNUA 1N9LA 5HD5A 3FKWA 4K08A 5JYOA 3UN7A 1TF1A 2EX2A 2VGLM 3MF0A 4LGWA 2G2WA 3IF5A 3HJKA 5FI6A 1K0KA 3SS5A 4OQ0A 4JKTA 1N9BA 4OOYA 3T1RA 4K0XA 3QHYA 3KX0X 1GA9A 3LYXA 4HEFA 4H8RA 1L0FA 5FQ9A 2HZ5A 2XROA 4QY6A 4RYEA 1L0EA 5AQ7A 1IKGA 3T50A 3LEQA 2FFFB 3IHAA 1G6OA 1F98A 2O9BA 3EGDC 3JVVA 3PBTA 3ZQ5A 4EBPA 1W8YA 3G30A 5DTTA 5M1AA 3GR2A 4GD8A 2OAP1 5DTSA 3LR4A 2IA2A 1FOFA 1S6RA 2IWBA 4MN5A 2ZL1B 5EE8A 5L09A 1L2SA 4S2IA 3D72A 3P01A 1PWGA 5AQAA 3KYZA 4PKYG 3O87A 3IF6A 4IEDA 3O86A 5J7EA 2JKGA 4ZRRA 3MMHA 2GNXA 2WYXA 1FQGA 4RVAA 1G5UA 4BBVA 2PBDP 4EERA 4E3JA 2K7SA 1SKOB 1UGUA 3RJUA 4X55A 1KOUA 3BFGA 4JXSA 4KG6A 3HUOA 3QP2A 2H0YA 3ZVWA 2Y79A 1MWRA 2ZMAA 1ES4A 4GJ4A 3UDIA 4ETXA 1BYWA 1KE4A 5L8MA 2V2FF 1VM1A 3DAVA 2GZAA 1E3UA 3C5AA 2PHYA 2KOIA 3IXHA 3BWLA 3K3DA 4N9LA 3C2WA 3S22A 4N1XA 3VP1A 1NLZA 4KZAA 4CQHA 1D1JA 2J80A 5J8XA 4L9EA 2HDSA 1VB6A 4JF6A 2LB9A 3ZG7B 4I3IA 5EPHA 2J7VA 3IF6C 3BW6A 2KLIA 5EECA 1BLHA 5TBMB 5HAIA 1MY8A 5GL9A 3T4OA 2D01A 2ZLYA 2ZM0A 3HLWA 1SZVA 1KDWA 1FCMA 5AQ9A 5M18A 4IVIA 1JWVA 4Y5FA 2PD8A 4KG5A 4EW7A 3BQ8A 2LB5A 3PTEA 2MJ6A 4F94A 1T1BA 2HJEA 1NZUA 3O88A 4II7A 3S7QA 2P04A 3Q07A 4Y2FA 1LL9A 4G3KA 2WGIA 4MN6A 3ITAA 1S1YA 3E4QA 2Y2MA 2Y4AA 3G2YA 1C3BA 2Y2NA 3B47A 4HJ3A 3MQQA 5FQQA 5DF9A 4GKUA 2QZ6A 3EEHA 3N7WA 4X69A 2H0TA 2UWXA 5TFQA 3G2ZA 1OJGA 2PYPA 4HJ4A 4DMZA 1QMFA 2OLVA 4YOFA 2J3TC 2I72A 5CHMA 3P7NA 1YPRA 2L4RA 2W27A 3IXDA 1V9YA 3ZNYA 3VOZA 1ESUA 3GSGA 4G3VA 1UWPX 1W63M 2L1MA 2PU4A 4EEUA 1H8MA 2EX8A 4QU3A 3HUMA 5HFOA 1OTDA 1RCJA 1S4RA 3DTIA 4X53A 3HLBA 4UA6A 3H82B 1GSXA 1KVLA 4OQIA 3VP2A 5FAQA 4CPKA 3HLEA 4N92A 5FATA 4NXGA 2WGVA 4Z9QA 4HI4A 4HESA 5HWVA 4P85A 2D02A 5TJJA 4NETA 4X25A 3G32A 3P98A 2H5SA 3UB8A 2YKHA 3IS2B 1NRJA 5GLBA 1D06A 1XKZA 1SKOA 1W63Q 5IHVA 4Y3IA 2Y2JA 1H8YA 3LIDA 1S1ZA 1KDSA 1ONHA 1L3LA 1VQQA 3PBOA 2VK3A 3M2JA 3LR0A 4ZJ1A 4OLGA 3VOLA 2PR6A 3MR0A 2JKTI 4S2OA 1YMXA 1WA9A 2W3GA 4JXGA 2EFUA 3HUNA 4OLDA 2L0WA 2VA0A 5EOOA 1GHPA 4EBLA 1K4EA 2EXAA 1L0GA 1DRMA 1F9IA 3HL9A 3UNWA 3LY3A 1GHMA 1EROA 4JGQA 3CPTA 2WAEA 4UA9A 3JVUA 3UPPA 3IWIA 1G68A 1OT9A 3UPNA 1V9ZA 4OQHA 4A5RA 4XUXA 3O5YA 4GD6A 5KSHA 4DN0A 1M40A 4HBUA 4DXCA 1DJBA 1OMEA 3S1YA 5IT5A 4R0QA 4E04A 1LSVA 5CGSA 3N8LA 1ERMA 5F1FA 2DNSA 3UE1A 1NXYA 1FSWA 4GHIA 2E8IA 2JCHA 5FQJA 1NZOA 4GNUA 4DE2A 4WF0A 1K56D 3UB5P 3OCLA 5FI7A 1LSWA 4QHCA 2A2LA 3WS4A 2PRFA 2ZOIA 5TGFA 4ID4A 3JYIA 4Y0UA 1XJ3A 3UE0A 3CJMA 4KQDA 1W8QA 2E8JA 3IXBA 2PR5A 4CLCD 5L07A 4N9KA 3IH9A 1XXMA 4MLLA 5F69A 2VEAA 3ISGA 1NRFA 3GQZA 2VLGA 4BJPA 3H82A 4Y0TA 1MWUA 2J3TD 1XJ4A 3ZG8B 1ES3A 3MZFA 3PAGA 4RX3A 4K0WA 5G4YA 3VFHA 4DJ2A 3UDFA 1IYPA 3T12B 3A3FA 4C6YA 1G6AA 3VP4A 3MKEA 4PM8A 3WS5A 2XF3A 2RL3A 3FC7A 3E4PA 4HH2A 3VOYA 2Y2PA 3IH8A 2XSSA 3MXSA 3IXGA 5GHXA 3SZTA 5FEGA 4B93A 4MN7A 3NBLA 3V39A 4HJ6A 3TRCA 2ZJ9A 5I94A 2EWVA 2ZQAA 4IBXA 4CLCB 2W1TB 3FG8A 5EVEA 1YKDA 2VV6A 4LV2A 5E2FA 3R7WB 5HW3A 3NOTC 2W3HA 2UV0E 4KUKA 3NOPC 2XR0A 3MS6A 3UMEA 1T1CA 4IVKA 1XGIA 2ZM2A 4XXRA 2FZ0A 3GDIA 5F5YA 3WRZA 1K25A 5AJGA 3T4SA 3GRJA 5CX7A 3EQVA 3U4LP 2XEPA 1P9RA 1IYOA 1Q2QA 2J3WA 1PWCA 1VEUB 2VGKA 4S2PA 3A3IA 3PYPA 5EVIB 1W5DA 3VSLA 4OPQA 5J4EA 5HX9A 3TOIA 3S7OA 5CTMA 3BY9A 2INWA 1XFQA 5LBRA 4Z1WA 4R1GA 1XGJA 1VETA 4H6JB 2AVXA 2VGJA 3LIFA 3E2KA 4WLAA 5J3WA 3ZVTA 1XP4A 2P74A 3EEAA 4WMCA 3KSGA 3T4JA 3ITBA 4WL9A 4EQIA 1RGYA 5FAOA 4PMAA 4HP9A 1K38A 4ZBEA 3GTCA 2R9WA 2ACGA 4GB7A 3T4QA 1LLBA 1YT4A 3ZCZA 3BECA 3K3CA 4MNRA 3BY8A 3F1NB 3SH8A 2G2UA 4HH3A 3MJQA 2WKHA 4OP8A 2PYRA 2ZOHA 3HLCA 3NHQA 3FKVA 1DJAA 4B9OA 4ARZB 1BT5A 2CMNA 3EQUA 1HLUP 4BBTA 1BTLA 5KIZA 4ME4A 4JF4A 5DJTA 2Y91A 2FH5A 3QNCA 3ZDJA 4MBHA 3KSFA 5FDHA 3M2KA 4O01A 2VKSA 5CHUA 4F3LB 3DTKA 4E6XA 2QMIA 2A49A 3PHYA 3PBRA 1ZG4A 1TDGA 4YINA 2EFXA 3BJNA 3V67A 4Y0OA 3ZNTA 2VV8A 4GN2A 1OTIA 4KZ8A 3MFDA 1KVMA 4IBRA 5A93A 1TS6A 5CRFA 3MFXA 4BBUA 3CAXA 3E2LA 1YQSA 3GVBA 1AXBA 4R4SA 3HVFA 2ZC7A 2XA7M 1RP5A 4KUOA 1K56A 1KGFA 3N4IA 3LUQA 2J9OA 1FSYA 4GS9B 4NXEA 3H9WA 4OOMA 1PZPA 2GJ3A 1ODVA 3NULA 1TD5A 1LSXA 2K2NA 3NCKA 5GHZA 5A8BA 4YWZA 3SOIA 4FD8A 4WM9A 3LR5A 4X1LA 4I38A 1DP9A 4CLCA 4OPZA 4QB8A 3R7WA 1JTGA 1YLTA 1FILA 2WKPA 5BOHA 3LCEA 4UAAA 1GHIA 1PWDA 1OTBA 2OOLA 2V0WA 1IEMA 4R70A 1STZA 1T1AA 4DE1A 4Q8IA 4OH0A 3HBRA 4YNRA 5KMWA 4E3KA 4NG2A 4FCFA 2P9VA 4FTXA 1VEUA 3V3RA 3GV9A 2OV5A 3FPWA 2X71A 4I39A 3NDEA 1O07A 1DJCA 3OBFA 4E3IA 1LI0A 3CG5A 3C7UA 4K91A 4JGOA 4WEKA 4DRTA 4P6ZS 2BLSA 1ZKJA 3RTYA 2H10A 4H6JA 3EGXC 3MXRA 3NI9A 4JGRA 4P0MA 5CECA 2W3EA 4U3TA 1K54C 3Q82A 5MC7A 1CJFA 3CI6A 5A92A 1GA0A 4DKIA 4KZ3A 4OP5A 1NJ4A 2WKIA 4CLCE 4LLOB 4WBGA 5FAPA 1TDLA 3NJAA 1OPXA 2Y2GA 4CLCC 1K57A 2NUTC 4U0TA 2QWSA 4S2KA 3C4PA 1Z09A 3B42A 4JGPA 1WE4A 4LENA 4LFUA 3AGFA 4R4RA 5DTKA 4WELA 2IWDA 1PNEA 4DJ3A 3G34A 2XQZA 3NIAA 2QPNA 1IFQA 3IQAA 3SS3A 3NECA 1K4FA 2HF6A 2BG1A 2VV7A 1LL8A 1ZG6A 4OPYA 4MMNA 2ZQDA 4O0PA 4Q0IA 4UEYA 2Y2IA 5EVIC 3S7PA 3CWFA 3WS2A 1KGGA 4QY5A 3GECA 3OPLA 4HY8A 3PBQA 4NXBA 2FFYA 3FWLA 1PFLA 2ZL1A 2WGWB 1U60A 3PXPA 3C30A 3N6IA 1S66L 2C5WB 3MBZA 3FPVA 1KE0A 4LPZA 1PI4A 4I5SA 2ZQCA 4ZJ3A 4OKPA 3MQ0A 1X0OA 4Q0HA 1HZOA 2ZC4B 5EV0A 4BL2A 1XA1A 4LRYC 1K57C 1BLCA 2JKTM 1YLPA 5HD3A 4WMCD 2P08A 4PM7A 1CI8A 4EETB 1H5XA 3BFFA 2Y2LA 1GSWA 3D3OA 2B02A 2Y2KA 3IT9A 5EM1A 1S67L 4GS9A 3HLGA 4P6BA 1LT0A 4DE3A 5F82A 3F1PB 2WUQA 3Q7VB 4L9FA 4GOGA 5DF8A 1EW0A 3WS0A 1OT6A 5GLDA 3OPPA 2Y59A 3W8KA 2V0UA 4KENB 4HNBA 1PW1A 2Y55A 4LV3A 1NWZA 4R6LA 3T4TA 4Y7PA 1YMSA 3L7HA 4BD1A 4ZJ2A 2VGLS 3T1SA 2Y2OA 4MEZA 1XA7A 4YFMA 3H7WB 3E0YA 4JPMA 5TBMA 3A0SA 4EUZA 1YSQA 1E4DA 4XT2B 2M7VA 3UO9A 2M1CA 1G28A 4S2JA 3AGDA 1EI5A 4R3BA 1W79A 1XJ6A 3QNBA 1CF0A 4WN5A 1KGEA 4UQIM 3LFVA 5HARA 4B88A 1LHYA 2JHEA 1T18A 4L0LA 1N4OA 1WYBA 3IWOA 3UMDA 4HP4A 5FI2A 4JLFA 1IYSA 4WYYA 3ZG0A 1PIOA 5IU1A 1CK3A 2YKFA 3LR3A 1NYMA 5CHJA 3HLFA 2P7JA 3MXQA 3LIAA 5F6AA 3M6BA 3OC2A 1DY6A 5GLAA 1MZUA 1XFNA 4EXOA 1ONGA 4LV0A 4C3QA 5CGXA 1CEFA 2ZMVA 2OLUA 3UE6A 3B33A 4N1HA 3RXXA 5HSQA 4FSFA 1MC0A 2HP6A 3EWKA 2JE5A 5CGWA 4EEPA 4KZ4A 3W4QA 2BASA 2XA7S 2W0NA 1IOUA 2B18A 3WS1A 4D2OA 2WADA 3DW0A 3C7VA 1TVFA 1NYYA 3FYZA 3BFDA 5EVID 3CHWP 5G18A 1IYQA 1PI5A 1OJ5A 3VE4A 4E3LA 1CQAA 2ZQ8A 3TSGA 2V20A 1OTEA 2EXBA 3QP5A 5IS1A 1MPLA 3I7JA 1I5QA 1Z6FA 5CERA 3IS2A 3UPOA 3QP6A 4KQOA 3PR6A 4Y17A 4EU0A 1FCNA 2EA9A 3GMWA 4ETZA 3A3EA 2PU2A 4UA7A 3CUEA 2KX6A 3QP4A 4QD4A 1L0DA 1PW8A 1JWZA 1MKMA 3ZGAB 1MBLA 1TS0A 3ZFZA 3MZDA 1XX2A 3EOIA 5A90A 5DKKA 3IX8A 3ZG5A 1MWSA 5AVEA 2ZC5B 5EM0A 3C4OA 4WZ5A 2WAFA 2V1BA 3MZEA 5FL3A 2Z6DA 3NOUC 4FH4A 4HQAA 2WKRA 2HGVA 1H0MA 4L9GA 3N8RA 1TEMA 3ZG9B 3E98A 1CEGA 4QWOA 4KZ9A 3T1XA 2WKEA 2IWCA 2ZC6B 3PBSA 5F68A 4XT2A 3T4LA 4BD0A 2V1AA 5FDSA 5M19A 3CUEC 4AFIA 1YLZA 3DTMA 5HDCA 3T1QB 3MSHA 3NC8A 1SKFA 2QJ7A 1ES2A 2QJ5A 3IBRA 4BENA 2JKRM 2R9XA 2Z2MB 5EOEA 5FA7A 4PM5A 1E25A 3W4PA 3UY6A 1Y54A 5C5KA 2XRNA 5FQIA 3R4KA 1JTDA 3BRMA 4EWFA 3DBAA 4WUJA 4GW9A 3IBJA 2X01A 1HVBA 3A3JA 1TS7A 3SS4A 2ZD8A 3BFCA 2JKRI 2H28A 1Q2PA 4X68A 2VJWA 1MWTA 5AVFA 4WZ5C 2B5RA 1UWNX 4X1MA 1K6RA 3HJIA 4E3OA 4MBKA 2PAVP 3TG9A 2DRWA 2WK0A 4PAUA 2O9AA 3A0RA 2V8FA 5HL6A 5DFYA 4EQ1A 4MDZA 5L10A 4Y13A 4DDSA 2Z2LB 3F1OB 4IHQA 4LRZE 3OZHA 1ZHHB 2PDRA 3Q1FA 4NEED 4KQRA 4OQGA 4EBNA 4OVDA 2HPBA 1T19A 3TE8A 1YSPA 3CLOA 1YAXA 4WZ4A 5D3OA 4RX2A 3P09A 4LV1A 2OAQ1 1O7EA 4EV4A 4JF5A 5GLCA 4BLMA 4KZ5A 1ESIA 5CTNA 1XJ2A 3UB7A 4C75A 1YLJA 2HP9A 1N9OA 5F83A 1K54A 1H3QA 2W3FA 1Y4OA 1AWIA 2VX8A 1F2KA 4M3KA 2QKPA 3BQAA 5HWWA 5KZHA 3BM6A 1VHMA 2BTFP 2W1TA 5F1GA 3JPUA 2GX5A 4FOFA 2M7UA 2CC1A 5HL1A 4IJGA
chains in the Genus database with same CATH topology
4I5SA 2R78A 3UB9A 2DMWA 1XJ3A 3G6OA 3MQ0A 2VZWA 2JN7A 3UB6A 4LRXC 1X0OA 1JNUA 4Q0HA 1N9LA 2HJ9C 4K08A 5HD5A 4KQDA 4LRYC 1TF1A 2PR5A 2VGLM 4CLCD 3MF0A 2JKTM 5HD3A 2P08A 4HOIA 3HJKA 4EETB 1GSWA 3D3OA 2B02A 5F69A 1S67L 2O99A 4GS9A 2VEAA 1LT0A 2VLGA 3F1PB 4UQIS 4BJPA 3H82A 4M4XA 2J3TD 4L9FA 3T4KA 1XJ4A 3KX0X 3LYXA 1EW0A 5G4YA 2KDKA 4DJ2A 3OLOA 1OT6A 2WKQA 2XROA 5DFXA 4HIAA 3T50A 2V0UA 1G6OA 1F98A 2O9BA 4HNBA 3EGDC 3JVVA 3PBTA 3ZQ5A 1NWZA 2NUPC 4R6LA 4PHTA 2OAP1 3T4TA 3FC7A 4GHIB 3LR4A 2PT7A 3E4PA 4HH2A 2IA2A 4PKYA 4MN5A 2XSSA 3TW8A 2VGLS 4B93A 4MN7A 3F1NA 2O9CA 3D72A 3H7WB 3E0YA 5HDDA 5TBMA 4HJ6A 3P01A 3TRCA 3A0SA 2OWJA 2EWVA 3K2NA 5HDSA 1YSQA 4CLCB 2W1TB 4XT2B 3FG8A 1YKDA 2VV6A 2M7VA 3R7WB 3NOTC 3KYZA 4PKYG 2W3HA 3A0VA 4KUKA 4ARZA 2M1CA 3NOPC 4I3JA 2I9VA 1G28A 3LICA 3UMEA 1T1CA 5J7EA 4ZRRA 3MMHA 4NKPA 2GNXA 1ZTUA 4BBVA 2A24B 1XJ6A 4EERA 2FZ0A 3GDIA 5F5YA 5AJGA 2K7SA 3T4SA 1UGUA 4WN5A 4UQIM 3LFVA 5CX7A 3EQVA 1KOUA 2JHEA 1P9RA 2J3WA 1T18A 4G3WA 4L0LA 4Q0JA 3E4OA 4F3LA 2Y79A 3PYPA 3UMDA 4GJ4A 4HP4A 4ETXA 4EUVA 1BYWA 3F1OA 5J4EA 3S7OA 5L8MA 3BY9A 2INWA 1XFQA 5LBRA 2GZAA 4Z1WA 4H6JB 5IU1A 2YKFA 2PHYA 2KOIA 3LIFA 4I3AA 3LR3A 4WLAA 3BWLA 3K3DA 2P7JA 3MXQA 3LIAA 5F6AA 3C2WA 2Z6CA 3OC2A 5J3WA 1NLZA 5EFWA 4CQHA 3EEAA 2J80A 1MZUA 1XFNA 5I5LA 4EXOA 3KSGA 3T4JA 4L9EA 1VB6A 4WL9A 2LB9A 2ZMVA 4I3IA 3UE6A 4HP9A 3B33A 3KO6A 5HSQA 4FSFA 3T4QA 1MC0A 3EWKA 3LI9A 3K3CA 4EEPA 3BW6A 2K31A 3BY8A 2KLIA 4O8GA 2BASA 3F1NB 4IUKA 2XA7S 4HH3A 5TBMB 2W0NA 3MJQA 3U2AA 3ICYA 1IOUA 2B18A 2PYRA 3T4OA 2ZOHA 2D01A 3NHQA 3OOVA 4B9OA 4ARZB 2CMNA 3RFBA 3EQUA 4BBTA 1F5MA 5KIZA 1OJ5A 3VE4A 4ME4A 5DJTA 4Y5FA 2PD8A 2FH5A 4EW7A 5HPFA 1OTEA 3BQ8A 3KSFA 5IS1A 2LB5A 1DP6A 4EESA 2MJ6A 3IS2A 2QYBA 4O01A 1T1BA 4KQOA 2HJEA 3PR6A 2VKSA 1Y28A 4II7A 2HV1A 3S7QA 4EU0A 2EA9A 2P04A 4Y2FA 4F3LB 4ETZA 4G3KA 4MN6A 3PHYA 3CUEA 2KX6A 1S1YA 3E4QA 4MCWA 3PBRA 3UE3A 3ZYTA 1MKMA 3B47A 4HJ3A 3MQQA 3BJNA 3V67A 1TS0A 2VV8A 1OTIA 5DF9A 3EEHA 2PD7A 3C8CA 2G7UA 1OJGA 2PYPA 3EOIA 2W1RA 1TS6A 5DKKA 3OCNA 4HJ4A 4DMZA 5DKLA 3MFXA 4BBUA 4YOFA 4QPRA 3CAXA 2J3TC 3P7NA 2L4RA 5AVEA 2W27A 2XA7M 1V9YA 4KUOA 1P97A 4G3VA 2V1BA 1N9NA 5FL3A 2Z6DA 3NOUC 1UWPX 1W63M 2EWWA 2L1MA 3LUQA 4EEUA 4GCZA 1H8MA 4GS9B 4HQAA 4NXEA 2WKRA 1P0ZA 3H9WA 1OTDA 1S4RA 2HGVA 4OOMA 3H82B 1GSXA 2GJ3A 1DP8A 3LIBA 1ODVA 4L9GA 1TD5A 1LSXA 4NXGA 1S4SA 3E98A 4P6ZM 4HI4A 2K2NA 5A8BA 1P9WA 4YWZA 1GSVA 3PBSA 4R38A 4HHDA 5HWVA 3LR5A 3PBNA 5F68A 4I38A 1DP9A 2D02A 3ULFA 4CLCA 4XT2A 3T4LA 5G4ZA 3S7NA 2V1AA 5TJJA 3R7WA 3CUEC 4AFIA 2WKPA 5HDCA 2OWHA 3UB8A 2YKHA 3CITA 3IS2B 2QJ7A 5K5BA 1NRJA 2A24A 2QJ5A 1OTBA 3HCYA 3IBRA 1D06A 2OOLA 2V0WA 2JKRM 1STZA 4R70A 1T1AA 5HPIA 2V9AA 3TJZC 2Y8HA 1W63Q 4Y3IA 5C5KA 2XRNA 4YNRA 3LI8A 3R4KA 3LIDA 4NXFA 3DBAA 4IUHA 4WUJA 1S1ZA 4GW9A 2ZMFA 3W2ZA 3IBJA 1TS7A 4OOLA 3FPWA 3LIEA 3PBOA 4I39A 2JKRI 2H28A 2VJWA 3LR0A 5AVFA 1NLYA 3OBFA 3VOLA 5DJUA 2PR6A 1TS8A 1UWNX 3MR0A 3HJIA 2JKTI 2QHKA 4JGOA 4WEKA 4P6ZS 2W3DA 3RTYA 4H6JA 3EGXC 3SW1A 4BMWA 4JGRA 5HZHA 2W3EA 1WA9A 5MC7A 3CI6A 2W3GA 1D7EA 4PAUA 2O9AA 3A0RA 5HL6A 5DFYA 3C38A 4CLCE 4EQ1A 4LLOB 4MDZA 2L0WA 2VA0A 3NJAA 4R3AA 3F1OB 4IHQA 4LRZE 1OPXA 1ZHHB 1DRMA 1F9IA 2PDRA 4NEED 4CLCC 2O0YA 4JGQA 2NUTC 3MQOA 1T19A 3RH8B 3F1PA 3TE8A 2QWSA 1YSPA 3CLOA 3KSHA 3JVUA 1YAXA 3B42A 4JGPA 3KSIA 1OT9A 5HWTA 2ZBBA 4RQ9A 4WELA 1V9ZA 4DJ3A 2OAQ1 3O5YA 3VV4A 3KYQA 5KSHA 1IFQA 4DN0A 1OTAA 2HF6A 1XJ2A 3UB7A 3VE3A 2VV7A 1LL8A 5IT5A 4MMNA 4E04A 1LSVA 1N9OA 4O0PA 4Q0IA 4UEYA 3S7PA 3CWFA 1H3QA 2W3FA 3GECA 4GHIA 4HY8A 3PBQA 4NXBA 4BWIA 4WEJA 2VX8A 2QKPA 3PXPA 4GLQA 3BQAA 5HWWA 4WF0A 3H7WA 3C30A 1S66L 3OCLA 3FPVA 1VHMA 2W1TA 1LSWA 4LPZA 2A2LA 2GX5A 4FOFA 2M7UA 2ZOIA 4IJGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I5S A;  2R78 A;  3UB9 A;  1XJ3 A;  3G6O A;  2JN7 A;  3UB6 A;  4LRX C;  1X0O A;  1JNU A;  1N9L A;  5HD5 A;  4K08 A;  4KQD A;  4LRY C;  2PR5 A;  5HD3 A;  4HOI A;  3HJK A;  4EET B;  1GSW A;  2B02 A;  5F69 A;  1S67 L;  4GS9 A;  2VEA A;  1LT0 A;  2VLG A;  3F1P B;  3H82 A;  4M4X A;  4L9F A;  1XJ4 A;  3KX0 X;  3LYX A;  1EW0 A;  5G4Y A;  2KDK A;  4DJ2 A;  3OLO A;  1OT6 A;  2WKQ A;  4HIA A;  3T50 A;  2V0U A;  1F98 A;  4HNB A;  3ZQ5 A;  1NWZ A;  4R6L A;  3FC7 A;  4GHI B;  3E4P A;  4HH2 A;  4PKY A;  4MN5 A;  3F1N A;  3D72 A;  3H7W B;  5HDD A;  5TBM A;  4HJ6 A;  3A0S A;  2OWJ A;  5HDS A;  4XT2 B;  3FG8 A;  2VV6 A;  3NOT C;  4PKY G;  3A0V A;  4KUK A;  2M1C A;  3NOP C;  4I3J A;  2I9V A;  1G28 A;  3LIC A;  3UME A;  1T1C A;  5J7E A;  4BBV A;  2A24 B;  1XJ6 A;  4EER A;  3GDI A;  5F5Y A;  2K7S A;  1UGU A;  4WN5 A;  1KOU A;  2JHE A;  1T18 A;  3E4O A;  4F3L A;  3PYP A;  3UMD A;  4HP4 A;  1BYW A;  3F1O A;  5J4E A;  3BY9 A;  2INW A;  1XFQ A;  4H6J B;  5IU1 A;  2YKF A;  2PHY A;  3LIF A;  4I3A A;  4WLA A;  3BWL A;  3K3D A;  2P7J A;  3MXQ A;  3LIA A;  5F6A A;  3C2W A;  2Z6C A;  5J3W A;  5EFW A;  2J80 A;  1MZU A;  1XFN A;  5I5L A;  4EXO A;  4L9E A;  1VB6 A;  4WL9 A;  4I3I A;  3UE6 A;  4HP9 A;  3B33 A;  5HSQ A;  3EWK A;  3LI9 A;  3K3C A;  4EEP A;  3BY8 A;  2BAS A;  3F1N B;  4HH3 A;  5TBM B;  2W0N A;  3MJQ A;  3ICY A;  2PYR A;  2ZOH A;  2D01 A;  3NHQ A;  4B9O A;  2CMN A;  4BBT A;  5KIZ A;  1OJ5 A;  3VE4 A;  5DJT A;  2PD8 A;  4EW7 A;  1OTE A;  5IS1 A;  1DP6 A;  4EES A;  3IS2 A;  1T1B A;  1Y28 A;  2HV1 A;  2EA9 A;  4F3L B;  4MN6 A;  3PHY A;  2KX6 A;  1S1Y A;  3E4Q A;  4HJ3 A;  3MQQ A;  1TS0 A;  2VV8 A;  1OTI A;  3EEH A;  2PD7 A;  3C8C A;  1OJG A;  2PYP A;  1TS6 A;  5DKK A;  4HJ4 A;  5DKL A;  3MFX A;  4BBU A;  3CAX A;  3P7N A;  2L4R A;  5AVE A;  2W27 A;  1V9Y A;  4KUO A;  1P97 A;  2V1B A;  1N9N A;  2Z6D A;  3NOU C;  1UWP X;  2L1M A;  3LUQ A;  4EEU A;  4GCZ A;  4GS9 B;  4NXE A;  4HQA A;  2WKR A;  1P0Z A;  3H9W A;  1OTD A;  1S4R A;  3H82 B;  1GSX A;  2GJ3 A;  1DP8 A;  3LIB A;  1ODV A;  4L9G A;  1LSX A;  4NXG A;  1S4S A;  4HI4 A;  5A8B A;  4YWZ A;  1GSV A;  5HWV A;  4R38 A;  4HHD A;  5F68 A;  4I38 A;  1DP9 A;  2D02 A;  3ULF A;  4XT2 A;  5G4Z A;  2V1A A;  2WKP A;  5HDC A;  2OWH A;  3UB8 A;  2YKH A;  3IS2 B;  2QJ7 A;  2A24 A;  2QJ5 A;  1OTB A;  3IBR A;  1D06 A;  2OOL A;  2V0W A;  4R70 A;  1T1A A;  2V9A A;  3LI8 A;  3LID A;  4NXF A;  4WUJ A;  1S1Z A;  4GW9 A;  1TS7 A;  3LIE A;  4I39 A;  2H28 A;  5AVF A;  3VOL A;  5DJU A;  2PR6 A;  1TS8 A;  1UWN X;  3MR0 A;  3HJI A;  2QHK A;  4JGO A;  3RTY A;  4H6J A;  3SW1 A;  4JGR A;  5HZH A;  1WA9 A;  1D7E A;  3A0R A;  4EQ1 A;  4LLO B;  2L0W A;  3NJA A;  4R3A A;  3F1O B;  4LRZ E;  1DRM A;  1F9I A;  2PDR A;  4JGQ A;  3MQO A;  1T19 A;  3RH8 B;  3F1P A;  2QWS A;  3CLO A;  4JGP A;  1OT9 A;  5HWT A;  2ZBB A;  4RQ9 A;  1V9Z A;  4DJ3 A;  1OTA A;  1XJ2 A;  3UB7 A;  3VE3 A;  2VV7 A;  1LL8 A;  4E04 A;  1LSV A;  1N9O A;  3CWF A;  3GEC A;  4GHI A;  4HY8 A;  4NXB A;  2QKP A;  5HWW A;  4WF0 A;  3H7W A;  1S66 L;  1LSW A;  4LPZ A;  2ZOI A; 
#chains in the Genus database with same CATH topology
 4FUW A;  4UHU A;  3VFF A;  2R78 A;  1M6K A;  1IKI A;  2J9P A;  3W4O A;  3G6O A;  1H8Z A;  1RGZ A;  3L9K A;  1BUL A;  2JN7 A;  3RXW A;  3UB6 A;  4KZ6 A;  2HJ9 C;  5FAS A;  3O3V A;  5DF7 A;  1YM1 A;  4HOI A;  1JWP A;  4R23 A;  3A3D A;  5EVI A;  2O99 A;  1IEL A;  4DDY A;  5JYP A;  4JBF A;  3Q7Z A;  1SDE A;  3IX4 A;  4UQI S;  3VP3 A;  3CPT B;  1BSG A;  4M4X A;  3T4K A;  4KZB A;  1W7F A;  3BLS A;  2KDK A;  3SH7 A;  4X56 A;  3OLO A;  2J8Y A;  2WKQ A;  5DVA A;  2XLN A;  3SH9 A;  5DFX A;  4HBT A;  5CED A;  4HIA A;  3V5M A;  1HTZ A;  1S0W A;  2NUP C;  5HAP A;  4PHT A;  4GHI B;  1ALQ A;  5AQB A;  2PT7 A;  3VMA A;  4PKY A;  1ES5 A;  3TW8 A;  3G4P A;  3IHB A;  3F1N A;  2O9C A;  5HDD A;  2Q9N A;  2HDQ A;  2OWJ A;  3DWK A;  5E2G A;  4LCL A;  3K2N A;  5HDS A;  1J3W A;  3PAE A;  4BL3 A;  3A0V A;  4S2L A;  4ARZ A;  4I3J A;  2I9V A;  3LIC A;  1ACF A;  5A91 A;  4NKP A;  1ZTU A;  5FEF A;  1CI9 A;  4NK3 A;  2A24 B;  3IWQ A;  4LCM A;  2Y2Q A;  1FIK A;  4Y15 A;  4G3W A;  4Q0J A;  3VSK A;  2ZQ9 A;  3E4O A;  3FV7 A;  4F3L A;  1I2W A;  1SHV A;  3BFE A;  2OSU A;  3S4X A;  3OPR A;  2B95 A;  4EUV A;  3F1O A;  3D4F A;  3B3X A;  5FQM A;  4JXW A;  4FH2 A;  2JC7 A;  1YLY A;  1BLP A;  4B4X A;  4GZB A;  1BZA A;  5FQK A;  5TR7 A;  4PM6 A;  4I3A A;  5E2H A;  4ZTK A;  2HP5 A;  2Z6C A;  1PZO A;  5EFW A;  2JKF A;  4KQQ A;  5I5L A;  4KG2 A;  3KO6 A;  5KSC A;  3LI9 A;  3M6H A;  2Q0O A;  2K31 A;  4O8G A;  4IUK A;  3U2A A;  3ICY A;  2XD5 A;  1ZC2 A;  1EWZ A;  3Q81 A;  2XFS A;  3OOV A;  5CEB A;  3WWX A;  5EUA A;  3RFB A;  4XUZ A;  3N8S A;  1F5M A;  3DWZ A;  3LEZ A;  1XPB A;  2EX9 A;  5HPF A;  5E2E A;  1FR1 A;  1DP6 A;  4E6W A;  4EES A;  3G35 A;  2QYB A;  4E3M A;  1Y28 A;  2HV1 A;  4MCW A;  3IX3 A;  2HDR A;  3UE3 A;  3ZYT A;  2HDU A;  1MKI A;  3LY4 A;  5CXW A;  4JXV A;  4KZ7 A;  5L2F A;  3MKF A;  2C6W B;  2PD7 A;  1VET B;  3C8C A;  2G7U A;  4RA7 A;  2PBY A;  1NY0 A;  2XK1 A;  4ZDX A;  2W1R A;  3VP0 A;  3FZC A;  3OCN A;  2WZX A;  5DKL A;  4QPR A;  2XGN A;  2RCX A;  1P97 A;  2V8C A;  2EX6 A;  1LL5 A;  1N9N A;  2EWW A;  4GCZ A;  3KYE A;  1P0Z A;  1K6S A;  4OON A;  1DP8 A;  3LIB A;  4P87 A;  1PYY A;  1S4S A;  4OPR A;  4P6Z M;  3WRT A;  1A0K A;  1FCO A;  1P9W A;  1GSV A;  4R38 A;  4HHD A;  2XFT A;  3CZD A;  3PBN A;  4U0X A;  3ULF A;  4ZAM A;  5G4Z A;  3S7N A;  2JBF A;  3CMZ A;  3NDG A;  1QME A;  3LO7 A;  4R3J A;  1E3U D;  2OWH A;  3CIT A;  1WYC A;  5K5B A;  3D9Y A;  1GCE A;  2A24 A;  4PPR A;  3G31 A;  2WZZ A;  3HCY A;  4S2N A;  1K55 A;  5HPI A;  2V9A A;  3TJZ C;  2Y8H A;  4X6T A;  3LI8 A;  4NXF A;  2WGW A;  3HLD A;  4IUH A;  2ZMF A;  3W2Z A;  2Q9M A;  4OOL A;  3LIE A;  3IF6 B;  1SCW A;  4QJG A;  1NLY A;  5DJU A;  2GDN A;  2XDM A;  1TS8 A;  4E3N A;  1SDN A;  5EVL A;  2QHK A;  2W3D A;  4PM9 A;  2XD1 A;  3QP8 A;  3SW1 A;  4BMW A;  5HZH A;  1D7E A;  2DCF A;  2ZQ7 A;  3C38 A;  5U47 A;  5GHY A;  2ZC3 B;  3BEB A;  4R3A A;  3OPH A;  4DXB A;  4DE0 A;  1FR6 A;  2O0Y A;  4ESP A;  3MQO A;  3RH8 B;  3F1P A;  3KSH A;  1ERQ A;  3Q7V A;  3KSI A;  4DF6 A;  3V50 A;  5HWT A;  3LGO A;  1MXO A;  3QP1 A;  2ZBB A;  4RQ9 A;  4S2N C;  3DTE A;  3NY4 A;  4S2M A;  1K55 C;  3ZHH A;  5HAQ A;  1JVJ A;  3VV4 A;  3KYQ A;  5FSR A;  1OTA A;  3VE3 A;  3BYD A;  1BLS A;  1J9M A;  5E43 A;  3BLM A;  3UDX A;  1HD8 A;  4GDB A;  4BWI A;  1BUE A;  4WEJ A;  2P9V B;  1PRQ A;  2A3U A;  4GLQ A;  4BQM A;  4D60 A;  1LI9 A;  2ZM8 A;  1YLW A;  3H7W A;  4MBF A;  4O7D A;  2XH9 A;  1KE3 A;  3AGE A;  3V3S A;  4CJN A;  2V1Z A;  2Y2H A;  3HRE A;  4GDN A;  3UB9 A;  1I2S A;  2DMW A;  2X02 A;  4B4Z A;  2VZW A;  4LRX C;  1JNU A;  1N9L A;  5HD5 A;  3FKW A;  4K08 A;  5JYO A;  3UN7 A;  1TF1 A;  2EX2 A;  2VGL M;  3MF0 A;  4LGW A;  2G2W A;  3IF5 A;  3HJK A;  5FI6 A;  1K0K A;  3SS5 A;  4OQ0 A;  4JKT A;  1N9B A;  4OOY A;  3T1R A;  4K0X A;  3QHY A;  3KX0 X;  1GA9 A;  3LYX A;  4HEF A;  4H8R A;  1L0F A;  5FQ9 A;  2HZ5 A;  2XRO A;  4QY6 A;  4RYE A;  1L0E A;  5AQ7 A;  1IKG A;  3T50 A;  3LEQ A;  2FFF B;  3IHA A;  1G6O A;  1F98 A;  2O9B A;  3EGD C;  3JVV A;  3PBT A;  3ZQ5 A;  4EBP A;  1W8Y A;  3G30 A;  5DTT A;  5M1A A;  3GR2 A;  4GD8 A;  2OAP 1;  5DTS A;  3LR4 A;  2IA2 A;  1FOF A;  1S6R A;  2IWB A;  4MN5 A;  2ZL1 B;  5EE8 A;  5L09 A;  1L2S A;  4S2I A;  3D72 A;  3P01 A;  1PWG A;  5AQA A;  3KYZ A;  4PKY G;  3O87 A;  3IF6 A;  4IED A;  3O86 A;  5J7E A;  2JKG A;  4ZRR A;  3MMH A;  2GNX A;  2WYX A;  1FQG A;  4RVA A;  1G5U A;  4BBV A;  2PBD P;  4EER A;  4E3J A;  2K7S A;  1SKO B;  1UGU A;  3RJU A;  4X55 A;  1KOU A;  3BFG A;  4JXS A;  4KG6 A;  3HUO A;  3QP2 A;  2H0Y A;  3ZVW A;  2Y79 A;  1MWR A;  2ZMA A;  1ES4 A;  4GJ4 A;  3UDI A;  4ETX A;  1BYW A;  1KE4 A;  5L8M A;  2V2F F;  1VM1 A;  3DAV A;  2GZA A;  1E3U A;  3C5A A;  2PHY A;  2KOI A;  3IXH A;  3BWL A;  3K3D A;  4N9L A;  3C2W A;  3S22 A;  4N1X A;  3VP1 A;  1NLZ A;  4KZA A;  4CQH A;  1D1J A;  2J80 A;  5J8X A;  4L9E A;  2HDS A;  1VB6 A;  4JF6 A;  2LB9 A;  3ZG7 B;  4I3I A;  5EPH A;  2J7V A;  3IF6 C;  3BW6 A;  2KLI A;  5EEC A;  1BLH A;  5TBM B;  5HAI A;  1MY8 A;  5GL9 A;  3T4O A;  2D01 A;  2ZLY A;  2ZM0 A;  3HLW A;  1SZV A;  1KDW A;  1FCM A;  5AQ9 A;  5M18 A;  4IVI A;  1JWV A;  4Y5F A;  2PD8 A;  4KG5 A;  4EW7 A;  3BQ8 A;  2LB5 A;  3PTE A;  2MJ6 A;  4F94 A;  1T1B A;  2HJE A;  1NZU A;  3O88 A;  4II7 A;  3S7Q A;  2P04 A;  3Q07 A;  4Y2F A;  1LL9 A;  4G3K A;  2WGI A;  4MN6 A;  3ITA A;  1S1Y A;  3E4Q A;  2Y2M A;  2Y4A A;  3G2Y A;  1C3B A;  2Y2N A;  3B47 A;  4HJ3 A;  3MQQ A;  5FQQ A;  5DF9 A;  4GKU A;  2QZ6 A;  3EEH A;  3N7W A;  4X69 A;  2H0T A;  2UWX A;  5TFQ A;  3G2Z A;  1OJG A;  2PYP A;  4HJ4 A;  4DMZ A;  1QMF A;  2OLV A;  4YOF A;  2J3T C;  2I72 A;  5CHM A;  3P7N A;  1YPR A;  2L4R A;  2W27 A;  3IXD A;  1V9Y A;  3ZNY A;  3VOZ A;  1ESU A;  3GSG A;  4G3V A;  1UWP X;  1W63 M;  2L1M A;  2PU4 A;  4EEU A;  1H8M A;  2EX8 A;  4QU3 A;  3HUM A;  5HFO A;  1OTD A;  1RCJ A;  1S4R A;  3DTI A;  4X53 A;  3HLB A;  4UA6 A;  3H82 B;  1GSX A;  1KVL A;  4OQI A;  3VP2 A;  5FAQ A;  4CPK A;  3HLE A;  4N92 A;  5FAT A;  4NXG A;  2WGV A;  4Z9Q A;  4HI4 A;  4HES A;  5HWV A;  4P85 A;  2D02 A;  5TJJ A;  4NET A;  4X25 A;  3G32 A;  3P98 A;  2H5S A;  3UB8 A;  2YKH A;  3IS2 B;  1NRJ A;  5GLB A;  1D06 A;  1XKZ A;  1SKO A;  1W63 Q;  5IHV A;  4Y3I A;  2Y2J A;  1H8Y A;  3LID A;  1S1Z A;  1KDS A;  1ONH A;  1L3L A;  1VQQ A;  3PBO A;  2VK3 A;  3M2J A;  3LR0 A;  4ZJ1 A;  4OLG A;  3VOL A;  2PR6 A;  3MR0 A;  2JKT I;  4S2O A;  1YMX A;  1WA9 A;  2W3G A;  4JXG A;  2EFU A;  3HUN A;  4OLD A;  2L0W A;  2VA0 A;  5EOO A;  1GHP A;  4EBL A;  1K4E A;  2EXA A;  1L0G A;  1DRM A;  1F9I A;  3HL9 A;  3UNW A;  3LY3 A;  1GHM A;  1ERO A;  4JGQ A;  3CPT A;  2WAE A;  4UA9 A;  3JVU A;  3UPP A;  3IWI A;  1G68 A;  1OT9 A;  3UPN A;  1V9Z A;  4OQH A;  4A5R A;  4XUX A;  3O5Y A;  4GD6 A;  5KSH A;  4DN0 A;  1M40 A;  4HBU A;  4DXC A;  1DJB A;  1OME A;  3S1Y A;  5IT5 A;  4R0Q A;  4E04 A;  1LSV A;  5CGS A;  3N8L A;  1ERM A;  5F1F A;  2DNS A;  3UE1 A;  1NXY A;  1FSW A;  4GHI A;  2E8I A;  2JCH A;  5FQJ A;  1NZO A;  4GNU A;  4DE2 A;  4WF0 A;  1K56 D;  3UB5 P;  3OCL A;  5FI7 A;  1LSW A;  4QHC A;  2A2L A;  3WS4 A;  2PRF A;  2ZOI A;  5TGF A;  4ID4 A;  3JYI A;  4Y0U A;  1XJ3 A;  3UE0 A;  3CJM A;  4KQD A;  1W8Q A;  2E8J A;  3IXB A;  2PR5 A;  4CLC D;  5L07 A;  4N9K A;  3IH9 A;  1XXM A;  4MLL A;  5F69 A;  2VEA A;  3ISG A;  1NRF A;  3GQZ A;  2VLG A;  4BJP A;  3H82 A;  4Y0T A;  1MWU A;  2J3T D;  1XJ4 A;  3ZG8 B;  1ES3 A;  3MZF A;  3PAG A;  4RX3 A;  4K0W A;  5G4Y A;  3VFH A;  4DJ2 A;  3UDF A;  1IYP A;  3T12 B;  3A3F A;  4C6Y A;  1G6A A;  3VP4 A;  3MKE A;  4PM8 A;  3WS5 A;  2XF3 A;  2RL3 A;  3FC7 A;  3E4P A;  4HH2 A;  3VOY A;  2Y2P A;  3IH8 A;  2XSS A;  3MXS A;  3IXG A;  5GHX A;  3SZT A;  5FEG A;  4B93 A;  4MN7 A;  3NBL A;  3V39 A;  4HJ6 A;  3TRC A;  2ZJ9 A;  5I94 A;  2EWV A;  2ZQA A;  4IBX A;  4CLC B;  2W1T B;  3FG8 A;  5EVE A;  1YKD A;  2VV6 A;  4LV2 A;  5E2F A;  3R7W B;  5HW3 A;  3NOT C;  2W3H A;  2UV0 E;  4KUK A;  3NOP C;  2XR0 A;  3MS6 A;  3UME A;  1T1C A;  4IVK A;  1XGI A;  2ZM2 A;  4XXR A;  2FZ0 A;  3GDI A;  5F5Y A;  3WRZ A;  1K25 A;  5AJG A;  3T4S A;  3GRJ A;  5CX7 A;  3EQV A;  3U4L P;  2XEP A;  1P9R A;  1IYO A;  1Q2Q A;  2J3W A;  1PWC A;  1VEU B;  2VGK A;  4S2P A;  3A3I A;  3PYP A;  5EVI B;  1W5D A;  3VSL A;  4OPQ A;  5J4E A;  5HX9 A;  3TOI A;  3S7O A;  5CTM A;  3BY9 A;  2INW A;  1XFQ A;  5LBR A;  4Z1W A;  4R1G A;  1XGJ A;  1VET A;  4H6J B;  2AVX A;  2VGJ A;  3LIF A;  3E2K A;  4WLA A;  5J3W A;  3ZVT A;  1XP4 A;  2P74 A;  3EEA A;  4WMC A;  3KSG A;  3T4J A;  3ITB A;  4WL9 A;  4EQI A;  1RGY A;  5FAO A;  4PMA A;  4HP9 A;  1K38 A;  4ZBE A;  3GTC A;  2R9W A;  2ACG A;  4GB7 A;  3T4Q A;  1LLB A;  1YT4 A;  3ZCZ A;  3BEC A;  3K3C A;  4MNR A;  3BY8 A;  3F1N B;  3SH8 A;  2G2U A;  4HH3 A;  3MJQ A;  2WKH A;  4OP8 A;  2PYR A;  2ZOH A;  3HLC A;  3NHQ A;  3FKV A;  1DJA A;  4B9O A;  4ARZ B;  1BT5 A;  2CMN A;  3EQU A;  1HLU P;  4BBT A;  1BTL A;  5KIZ A;  4ME4 A;  4JF4 A;  5DJT A;  2Y91 A;  2FH5 A;  3QNC A;  3ZDJ A;  4MBH A;  3KSF A;  5FDH A;  3M2K A;  4O01 A;  2VKS A;  5CHU A;  4F3L B;  3DTK A;  4E6X A;  2QMI A;  2A49 A;  3PHY A;  3PBR A;  1ZG4 A;  1TDG A;  4YIN A;  2EFX A;  3BJN A;  3V67 A;  4Y0O A;  3ZNT A;  2VV8 A;  4GN2 A;  1OTI A;  4KZ8 A;  3MFD A;  1KVM A;  4IBR A;  5A93 A;  1TS6 A;  5CRF A;  3MFX A;  4BBU A;  3CAX A;  3E2L A;  1YQS A;  3GVB A;  1AXB A;  4R4S A;  3HVF A;  2ZC7 A;  2XA7 M;  1RP5 A;  4KUO A;  1K56 A;  1KGF A;  3N4I A;  3LUQ A;  2J9O A;  1FSY A;  4GS9 B;  4NXE A;  3H9W A;  4OOM A;  1PZP A;  2GJ3 A;  1ODV A;  3NUL A;  1TD5 A;  1LSX A;  2K2N A;  3NCK A;  5GHZ A;  5A8B A;  4YWZ A;  3SOI A;  4FD8 A;  4WM9 A;  3LR5 A;  4X1L A;  4I38 A;  1DP9 A;  4CLC A;  4OPZ A;  4QB8 A;  3R7W A;  1JTG A;  1YLT A;  1FIL A;  2WKP A;  5BOH A;  3LCE A;  4UAA A;  1GHI A;  1PWD A;  1OTB A;  2OOL A;  2V0W A;  1IEM A;  4R70 A;  1STZ A;  1T1A A;  4DE1 A;  4Q8I A;  4OH0 A;  3HBR A;  4YNR A;  5KMW A;  4E3K A;  4NG2 A;  4FCF A;  2P9V A;  4FTX A;  1VEU A;  3V3R A;  3GV9 A;  2OV5 A;  3FPW A;  2X71 A;  4I39 A;  3NDE A;  1O07 A;  1DJC A;  3OBF A;  4E3I A;  1LI0 A;  3CG5 A;  3C7U A;  4K91 A;  4JGO A;  4WEK A;  4DRT A;  4P6Z S;  2BLS A;  1ZKJ A;  3RTY A;  2H10 A;  4H6J A;  3EGX C;  3MXR A;  3NI9 A;  4JGR A;  4P0M A;  5CEC A;  2W3E A;  4U3T A;  1K54 C;  3Q82 A;  5MC7 A;  1CJF A;  3CI6 A;  5A92 A;  1GA0 A;  4DKI A;  4KZ3 A;  4OP5 A;  1NJ4 A;  2WKI A;  4CLC E;  4LLO B;  4WBG A;  5FAP A;  1TDL A;  3NJA A;  1OPX A;  2Y2G A;  4CLC C;  1K57 A;  2NUT C;  4U0T A;  2QWS A;  4S2K A;  3C4P A;  1Z09 A;  3B42 A;  4JGP A;  1WE4 A;  4LEN A;  4LFU A;  3AGF A;  4R4R A;  5DTK A;  4WEL A;  2IWD A;  1PNE A;  4DJ3 A;  3G34 A;  2XQZ A;  3NIA A;  2QPN A;  1IFQ A;  3IQA A;  3SS3 A;  3NEC A;  1K4F A;  2HF6 A;  2BG1 A;  2VV7 A;  1LL8 A;  1ZG6 A;  4OPY A;  4MMN A;  2ZQD A;  4O0P A;  4Q0I A;  4UEY A;  2Y2I A;  5EVI C;  3S7P A;  3CWF A;  3WS2 A;  1KGG A;  4QY5 A;  3GEC A;  3OPL A;  4HY8 A;  3PBQ A;  4NXB A;  2FFY A;  3FWL A;  1PFL A;  2ZL1 A;  2WGW B;  1U60 A;  3PXP A;  3C30 A;  3N6I A;  1S66 L;  2C5W B;  3MBZ A;  3FPV A;  1KE0 A;  4LPZ A;  1PI4 A;  4I5S A;  2ZQC A;  4ZJ3 A;  4OKP A;  3MQ0 A;  1X0O A;  4Q0H A;  1HZO A;  2ZC4 B;  5EV0 A;  4BL2 A;  1XA1 A;  4LRY C;  1K57 C;  1BLC A;  2JKT M;  1YLP A;  5HD3 A;  4WMC D;  2P08 A;  4PM7 A;  1CI8 A;  4EET B;  1H5X A;  3BFF A;  2Y2L A;  1GSW A;  3D3O A;  2B02 A;  2Y2K A;  3IT9 A;  5EM1 A;  1S67 L;  4GS9 A;  3HLG A;  4P6B A;  1LT0 A;  4DE3 A;  5F82 A;  3F1P B;  2WUQ A;  3Q7V B;  4L9F A;  4GOG A;  5DF8 A;  1EW0 A;  3WS0 A;  1OT6 A;  5GLD A;  3OPP A;  2Y59 A;  3W8K A;  2V0U A;  4KEN B;  4HNB A;  1PW1 A;  2Y55 A;  4LV3 A;  1NWZ A;  4R6L A;  3T4T A;  4Y7P A;  1YMS A;  3L7H A;  4BD1 A;  4ZJ2 A;  2VGL S;  3T1S A;  2Y2O A;  4MEZ A;  1XA7 A;  4YFM A;  3H7W B;  3E0Y A;  4JPM A;  5TBM A;  3A0S A;  4EUZ A;  1YSQ A;  1E4D A;  4XT2 B;  2M7V A;  3UO9 A;  2M1C A;  1G28 A;  4S2J A;  3AGD A;  1EI5 A;  4R3B A;  1W79 A;  1XJ6 A;  3QNB A;  1CF0 A;  4WN5 A;  1KGE A;  4UQI M;  3LFV A;  5HAR A;  4B88 A;  1LHY A;  2JHE A;  1T18 A;  4L0L A;  1N4O A;  1WYB A;  3IWO A;  3UMD A;  4HP4 A;  5FI2 A;  4JLF A;  1IYS A;  4WYY A;  3ZG0 A;  1PIO A;  5IU1 A;  1CK3 A;  2YKF A;  3LR3 A;  1NYM A;  5CHJ A;  3HLF A;  2P7J A;  3MXQ A;  3LIA A;  5F6A A;  3M6B A;  3OC2 A;  1DY6 A;  5GLA A;  1MZU A;  1XFN A;  4EXO A;  1ONG A;  4LV0 A;  4C3Q A;  5CGX A;  1CEF A;  2ZMV A;  2OLU A;  3UE6 A;  3B33 A;  4N1H A;  3RXX A;  5HSQ A;  4FSF A;  1MC0 A;  2HP6 A;  3EWK A;  2JE5 A;  5CGW A;  4EEP A;  4KZ4 A;  3W4Q A;  2BAS A;  2XA7 S;  2W0N A;  1IOU A;  2B18 A;  3WS1 A;  4D2O A;  2WAD A;  3DW0 A;  3C7V A;  1TVF A;  1NYY A;  3FYZ A;  3BFD A;  5EVI D;  3CHW P;  5G18 A;  1IYQ A;  1PI5 A;  1OJ5 A;  3VE4 A;  4E3L A;  1CQA A;  2ZQ8 A;  3TSG A;  2V20 A;  1OTE A;  2EXB A;  3QP5 A;  5IS1 A;  1MPL A;  3I7J A;  1I5Q A;  1Z6F A;  5CER A;  3IS2 A;  3UPO A;  3QP6 A;  4KQO A;  3PR6 A;  4Y17 A;  4EU0 A;  1FCN A;  2EA9 A;  3GMW A;  4ETZ A;  3A3E A;  2PU2 A;  4UA7 A;  3CUE A;  2KX6 A;  3QP4 A;  4QD4 A;  1L0D A;  1PW8 A;  1JWZ A;  1MKM A;  3ZGA B;  1MBL A;  1TS0 A;  3ZFZ A;  3MZD A;  1XX2 A;  3EOI A;  5A90 A;  5DKK A;  3IX8 A;  3ZG5 A;  1MWS A;  5AVE A;  2ZC5 B;  5EM0 A;  3C4O A;  4WZ5 A;  2WAF A;  2V1B A;  3MZE A;  5FL3 A;  2Z6D A;  3NOU C;  4FH4 A;  4HQA A;  2WKR A;  2HGV A;  1H0M A;  4L9G A;  3N8R A;  1TEM A;  3ZG9 B;  3E98 A;  1CEG A;  4QWO A;  4KZ9 A;  3T1X A;  2WKE A;  2IWC A;  2ZC6 B;  3PBS A;  5F68 A;  4XT2 A;  3T4L A;  4BD0 A;  2V1A A;  5FDS A;  5M19 A;  3CUE C;  4AFI A;  1YLZ A;  3DTM A;  5HDC A;  3T1Q B;  3MSH A;  3NC8 A;  1SKF A;  2QJ7 A;  1ES2 A;  2QJ5 A;  3IBR A;  4BEN A;  2JKR M;  2R9X A;  2Z2M B;  5EOE A;  5FA7 A;  4PM5 A;  1E25 A;  3W4P A;  3UY6 A;  1Y54 A;  5C5K A;  2XRN A;  5FQI A;  3R4K A;  1JTD A;  3BRM A;  4EWF A;  3DBA A;  4WUJ A;  4GW9 A;  3IBJ A;  2X01 A;  1HVB A;  3A3J A;  1TS7 A;  3SS4 A;  2ZD8 A;  3BFC A;  2JKR I;  2H28 A;  1Q2P A;  4X68 A;  2VJW A;  1MWT A;  5AVF A;  4WZ5 C;  2B5R A;  1UWN X;  4X1M A;  1K6R A;  3HJI A;  4E3O A;  4MBK A;  2PAV P;  3TG9 A;  2DRW A;  2WK0 A;  4PAU A;  2O9A A;  3A0R A;  2V8F A;  5HL6 A;  5DFY A;  4EQ1 A;  4MDZ A;  5L10 A;  4Y13 A;  4DDS A;  2Z2L B;  3F1O B;  4IHQ A;  4LRZ E;  3OZH A;  1ZHH B;  2PDR A;  3Q1F A;  4NEE D;  4KQR A;  4OQG A;  4EBN A;  4OVD A;  2HPB A;  1T19 A;  3TE8 A;  1YSP A;  3CLO A;  1YAX A;  4WZ4 A;  5D3O A;  4RX2 A;  3P09 A;  4LV1 A;  2OAQ 1;  1O7E A;  4EV4 A;  4JF5 A;  5GLC A;  4BLM A;  4KZ5 A;  1ESI A;  5CTN A;  1XJ2 A;  3UB7 A;  4C75 A;  1YLJ A;  2HP9 A;  1N9O A;  5F83 A;  1K54 A;  1H3Q A;  2W3F A;  1Y4O A;  1AWI A;  2VX8 A;  1F2K A;  4M3K A;  2QKP A;  3BQA A;  5HWW A;  5KZH A;  3BM6 A;  1VHM A;  2BTF P;  2W1T A;  5F1G A;  3JPU A;  2GX5 A;  4FOF A;  2M7U A;  2CC1 A;  5HL1 A;  4IJG A; 
#chains in the Genus database with same CATH homology
 4I5S A;  2R78 A;  3UB9 A;  2DMW A;  1XJ3 A;  3G6O A;  3MQ0 A;  2VZW A;  2JN7 A;  3UB6 A;  4LRX C;  1X0O A;  1JNU A;  4Q0H A;  1N9L A;  2HJ9 C;  4K08 A;  5HD5 A;  4KQD A;  4LRY C;  1TF1 A;  2PR5 A;  2VGL M;  4CLC D;  3MF0 A;  2JKT M;  5HD3 A;  2P08 A;  4HOI A;  3HJK A;  4EET B;  1GSW A;  3D3O A;  2B02 A;  5F69 A;  1S67 L;  2O99 A;  4GS9 A;  2VEA A;  1LT0 A;  2VLG A;  3F1P B;  4UQI S;  4BJP A;  3H82 A;  4M4X A;  2J3T D;  4L9F A;  3T4K A;  1XJ4 A;  3KX0 X;  3LYX A;  1EW0 A;  5G4Y A;  2KDK A;  4DJ2 A;  3OLO A;  1OT6 A;  2WKQ A;  2XRO A;  5DFX A;  4HIA A;  3T50 A;  2V0U A;  1G6O A;  1F98 A;  2O9B A;  4HNB A;  3EGD C;  3JVV A;  3PBT A;  3ZQ5 A;  1NWZ A;  2NUP C;  4R6L A;  4PHT A;  2OAP 1;  3T4T A;  3FC7 A;  4GHI B;  3LR4 A;  2PT7 A;  3E4P A;  4HH2 A;  2IA2 A;  4PKY A;  4MN5 A;  2XSS A;  3TW8 A;  2VGL S;  4B93 A;  4MN7 A;  3F1N A;  2O9C A;  3D72 A;  3H7W B;  3E0Y A;  5HDD A;  5TBM A;  4HJ6 A;  3P01 A;  3TRC A;  3A0S A;  2OWJ A;  2EWV A;  3K2N A;  5HDS A;  1YSQ A;  4CLC B;  2W1T B;  4XT2 B;  3FG8 A;  1YKD A;  2VV6 A;  2M7V A;  3R7W B;  3NOT C;  3KYZ A;  4PKY G;  2W3H A;  3A0V A;  4KUK A;  4ARZ A;  2M1C A;  3NOP C;  4I3J A;  2I9V A;  1G28 A;  3LIC A;  3UME A;  1T1C A;  5J7E A;  4ZRR A;  3MMH A;  4NKP A;  2GNX A;  1ZTU A;  4BBV A;  2A24 B;  1XJ6 A;  4EER A;  2FZ0 A;  3GDI A;  5F5Y A;  5AJG A;  2K7S A;  3T4S A;  1UGU A;  4WN5 A;  4UQI M;  3LFV A;  5CX7 A;  3EQV A;  1KOU A;  2JHE A;  1P9R A;  2J3W A;  1T18 A;  4G3W A;  4L0L A;  4Q0J A;  3E4O A;  4F3L A;  2Y79 A;  3PYP A;  3UMD A;  4GJ4 A;  4HP4 A;  4ETX A;  4EUV A;  1BYW A;  3F1O A;  5J4E A;  3S7O A;  5L8M A;  3BY9 A;  2INW A;  1XFQ A;  5LBR A;  2GZA A;  4Z1W A;  4H6J B;  5IU1 A;  2YKF A;  2PHY A;  2KOI A;  3LIF A;  4I3A A;  3LR3 A;  4WLA A;  3BWL A;  3K3D A;  2P7J A;  3MXQ A;  3LIA A;  5F6A A;  3C2W A;  2Z6C A;  3OC2 A;  5J3W A;  1NLZ A;  5EFW A;  4CQH A;  3EEA A;  2J80 A;  1MZU A;  1XFN A;  5I5L A;  4EXO A;  3KSG A;  3T4J A;  4L9E A;  1VB6 A;  4WL9 A;  2LB9 A;  2ZMV A;  4I3I A;  3UE6 A;  4HP9 A;  3B33 A;  3KO6 A;  5HSQ A;  4FSF A;  3T4Q A;  1MC0 A;  3EWK A;  3LI9 A;  3K3C A;  4EEP A;  3BW6 A;  2K31 A;  3BY8 A;  2KLI A;  4O8G A;  2BAS A;  3F1N B;  4IUK A;  2XA7 S;  4HH3 A;  5TBM B;  2W0N A;  3MJQ A;  3U2A A;  3ICY A;  1IOU A;  2B18 A;  2PYR A;  3T4O A;  2ZOH A;  2D01 A;  3NHQ A;  3OOV A;  4B9O A;  4ARZ B;  2CMN A;  3RFB A;  3EQU A;  4BBT A;  1F5M A;  5KIZ A;  1OJ5 A;  3VE4 A;  4ME4 A;  5DJT A;  4Y5F A;  2PD8 A;  2FH5 A;  4EW7 A;  5HPF A;  1OTE A;  3BQ8 A;  3KSF A;  5IS1 A;  2LB5 A;  1DP6 A;  4EES A;  2MJ6 A;  3IS2 A;  2QYB A;  4O01 A;  1T1B A;  4KQO A;  2HJE A;  3PR6 A;  2VKS A;  1Y28 A;  4II7 A;  2HV1 A;  3S7Q A;  4EU0 A;  2EA9 A;  2P04 A;  4Y2F A;  4F3L B;  4ETZ A;  4G3K A;  4MN6 A;  3PHY A;  3CUE A;  2KX6 A;  1S1Y A;  3E4Q A;  4MCW A;  3PBR A;  3UE3 A;  3ZYT A;  1MKM A;  3B47 A;  4HJ3 A;  3MQQ A;  3BJN A;  3V67 A;  1TS0 A;  2VV8 A;  1OTI A;  5DF9 A;  3EEH A;  2PD7 A;  3C8C A;  2G7U A;  1OJG A;  2PYP A;  3EOI A;  2W1R A;  1TS6 A;  5DKK A;  3OCN A;  4HJ4 A;  4DMZ A;  5DKL A;  3MFX A;  4BBU A;  4YOF A;  4QPR A;  3CAX A;  2J3T C;  3P7N A;  2L4R A;  5AVE A;  2W27 A;  2XA7 M;  1V9Y A;  4KUO A;  1P97 A;  4G3V A;  2V1B A;  1N9N A;  5FL3 A;  2Z6D A;  3NOU C;  1UWP X;  1W63 M;  2EWW A;  2L1M A;  3LUQ A;  4EEU A;  4GCZ A;  1H8M A;  4GS9 B;  4HQA A;  4NXE A;  2WKR A;  1P0Z A;  3H9W A;  1OTD A;  1S4R A;  2HGV A;  4OOM A;  3H82 B;  1GSX A;  2GJ3 A;  1DP8 A;  3LIB A;  1ODV A;  4L9G A;  1TD5 A;  1LSX A;  4NXG A;  1S4S A;  3E98 A;  4P6Z M;  4HI4 A;  2K2N A;  5A8B A;  1P9W A;  4YWZ A;  1GSV A;  3PBS A;  4R38 A;  4HHD A;  5HWV A;  3LR5 A;  3PBN A;  5F68 A;  4I38 A;  1DP9 A;  2D02 A;  3ULF A;  4CLC A;  4XT2 A;  3T4L A;  5G4Z A;  3S7N A;  2V1A A;  5TJJ A;  3R7W A;  3CUE C;  4AFI A;  2WKP A;  5HDC A;  2OWH A;  3UB8 A;  2YKH A;  3CIT A;  3IS2 B;  2QJ7 A;  5K5B A;  1NRJ A;  2A24 A;  2QJ5 A;  1OTB A;  3HCY A;  3IBR A;  1D06 A;  2OOL A;  2V0W A;  2JKR M;  1STZ A;  4R70 A;  1T1A A;  5HPI A;  2V9A A;  3TJZ C;  2Y8H A;  1W63 Q;  4Y3I A;  5C5K A;  2XRN A;  4YNR A;  3LI8 A;  3R4K A;  3LID A;  4NXF A;  3DBA A;  4IUH A;  4WUJ A;  1S1Z A;  4GW9 A;  2ZMF A;  3W2Z A;  3IBJ A;  1TS7 A;  4OOL A;  3FPW A;  3LIE A;  3PBO A;  4I39 A;  2JKR I;  2H28 A;  2VJW A;  3LR0 A;  5AVF A;  1NLY A;  3OBF A;  3VOL A;  5DJU A;  2PR6 A;  1TS8 A;  1UWN X;  3MR0 A;  3HJI A;  2JKT I;  2QHK A;  4JGO A;  4WEK A;  4P6Z S;  2W3D A;  3RTY A;  4H6J A;  3EGX C;  3SW1 A;  4BMW A;  4JGR A;  5HZH A;  2W3E A;  1WA9 A;  5MC7 A;  3CI6 A;  2W3G A;  1D7E A;  4PAU A;  2O9A A;  3A0R A;  5HL6 A;  5DFY A;  3C38 A;  4CLC E;  4EQ1 A;  4LLO B;  4MDZ A;  2L0W A;  2VA0 A;  3NJA A;  4R3A A;  3F1O B;  4IHQ A;  4LRZ E;  1OPX A;  1ZHH B;  1DRM A;  1F9I A;  2PDR A;  4NEE D;  4CLC C;  2O0Y A;  4JGQ A;  2NUT C;  3MQO A;  1T19 A;  3RH8 B;  3F1P A;  3TE8 A;  2QWS A;  1YSP A;  3CLO A;  3KSH A;  3JVU A;  1YAX A;  3B42 A;  4JGP A;  3KSI A;  1OT9 A;  5HWT A;  2ZBB A;  4RQ9 A;  4WEL A;  1V9Z A;  4DJ3 A;  2OAQ 1;  3O5Y A;  3VV4 A;  3KYQ A;  5KSH A;  1IFQ A;  4DN0 A;  1OTA A;  2HF6 A;  1XJ2 A;  3UB7 A;  3VE3 A;  2VV7 A;  1LL8 A;  5IT5 A;  4MMN A;  4E04 A;  1LSV A;  1N9O A;  4O0P A;  4Q0I A;  4UEY A;  3S7P A;  3CWF A;  1H3Q A;  2W3F A;  3GEC A;  4GHI A;  4HY8 A;  3PBQ A;  4NXB A;  4BWI A;  4WEJ A;  2VX8 A;  2QKP A;  3PXP A;  4GLQ A;  3BQA A;  5HWW A;  4WF0 A;  3H7W A;  3C30 A;  1S66 L;  3OCL A;  3FPV A;  1VHM A;  2W1T A;  1LSW A;  4LPZ A;  2A2L A;  2GX5 A;  4FOF A;  2M7U A;  2ZOI A;  4IJG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...