2WZZA

Amp-c beta-lactamase (pseudomonas aeruginosa)in complex with compound m-03
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
360
structure length
360
Chain Sequence
APADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALTQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE
publication title Side Chain Sar of Bicyclic Beta-Lactamase Inhibitors (Blis). 1. Discovery of a Class C Bli for Combination with Imipinem.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 119
structure length 360
sequence length 360
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2009-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2wzzA00
1MWRA 3Q81A 1NY0A 1RGYA 3HUNA 3SOIA 4E3LA 5CHUA 5EOEA 1IYQA 1GA9A 1HD8A 2QPNA 5DF8A 5F82A 2EXBA 4ZAMA 3UNWA 1K6RA 4IEDA 4IVIA 4LV1A 3A3DA 2HP5A 3O87A 3UO9A 3MZFA 4S2NA 3V3RA 3VSKA 1PZPA 4S2IA 4B88A 4R4RA 4BENA 2Y2GA 1YMSA 3IQAA 1TVFA 3ZHHA 5CHJA 4H8RA 4CJNA 1K6SA 3P98A 5DTTA 3TSGA 3ZG7B 3BFFA 3UPOA 4GB7A 4UA7A 4PM8A 3E2KA 3G2ZA 1PWDA 4JBFA 3ITAA 3WRZA 2WYXA 1KE3A 3FKWA 1VQQA 5F83A 1NYMA 2H0YA 1Z6FA 2RL3A 1DY6A 3PBQA 4WEJA 2XDMA 2WGVA 2ZMAA 4KZ3A 1XA7A 4NK3A 3LO7A 3G31A 1KDWA 3PBRA 5AQAA 4OPQA 3WS1A 4QY6A 4GKUA 5TFQA 4OPYA 1W8QA 2XLNA 1K25A 4GNUA 3S22A 2XQZA 3OPPA 2WKEA 4P6BA 3TG9A 1H5XA 1HVBA 1S0WA 1YLZA 2EX8A 4QD4A 1Y54A 1EWZA 3C4PA 1I2SA 3WS5A 3M6BA 4HESA 2DNSA 1EI5A 2Y55A 4N1HA 1U60A 2IWCA 3ZVWA 1QMEA 1SHVA 3HLDA 1LI9A 1FCMA 3BYDA 3G30A 4EBNA 4OH0A 3IXDA 3HLWA 3TOIA 4QU3A 4Y7PA 2HP9A 4E3NA 1TDLA 1MWSA 2EFXA 3ISGA 4S2NC 5A90A 2Y4AA 4YFMA 1K54C 4GN2A 2ZQ8A 3SS3A 3UE1A 4DE1A 3DWKA 5HW3A 1E3UA 3UPPA 1YLPA 1ESIA 2VGKA 4KQRA 1L0GA 1FSYA 2Y2JA 2R9WA 3ZDJA 2PU4A 5AQBA 1JWZA 3V50A 3VMAA 4PM9A 5J8XA 5EVIC 3VFHA 2Y2IA 5U47A 1PI5A 5DF7A 4R4SA 4K0WA 2ZM8A 1XXMA 1KGFA 2PU2A 4X53A 5CTNA 2UWXA 3B3XA 3MZDA 1BLHA 4KZ6A 3EQUA 2WZZA 4R3JA 1PIOA 3IT9A 1MY8A 1MKIA 4DDYA 4OQGA 5GHYA 1YMXA 4KZAA 1I5QA 3HL9A 1IKGA 2JBFA 3GVBA 2ZLYA 3G34A 4JLFA 5AQ7A 3WWXA 4R23A 2V2FF 5CEDA 2Y2NA 2WADA 3DWZA 5E2EA 3D4FA 3VOZA 1GCEA 5KZHA 4OP8A 3MKEA 3Q1FA 1E25A 4OOLA 1YLTA 2Q9NA 3MFDA 1IEMA 3OCLA 4FD8A 4GOGA 1IKIA 3Q7VB 5F1GA 5GLBA 1WYCA 2Y2PA 2ZC5B 4UA9A 2HDUA 3RXXA 4QY5A 1MXOA 1ALQA 3OZHA 1BTLA 5EUAA 1PWCA 3FYZA 3ZNYA 3MXSA 3PTEA 2ZD8A 3O88A 5FAOA 4JPMA 4BL3A 5CTMA 3G4PA 3WRTA 5DVAA 1XKZA 2ZQCA 1YLWA 4OLGA 1S6RA 1JTGA 2EX6A 4HBUA 2HDRA 1BLCA 3FWLA 5M19A 2JCHA 2ZJ9A 3FKVA 1K56D 2OLUA 2ZQDA 3A3JA 3IH9A 4OQIA 3C5AA 3SH8A 3SH7A 3UE3A 4E6WA 3AGDA 4S2OA 2I72A 3M6HA 3ZFZA 4OPRA 1GA0A 2WGWA 1N9BA 1NJ4A 5IHVA 5TGFA 5GHXA 3AGEA 1K56A 4K0XA 2X02A 4U3TA 2DCFA 4BQMA 3A3EA 4N1XA 4LCLA 1M6KA 4S2KA 5EVIB 3PAEA 4FCFA 2C5WB 3OPHA 5HAIA 4RX3A 3VP3A 3GTCA 1JTDA 4GDBA 2BLSA 3N8LA 3Q82A 4UAAA 4Q8IA 2BG1A 4DE2A 1PWGA 4JF4A 1PW1A 3QNBA 4P0MA 4WZ5A 3NDGA 1ES4A 3IWQA 4N9KA 5GLAA 3NC8A 1KGGA 1H8ZA 2FFYA 5L2FA 3IXBA 4X55A 3HLFA 3S1YA 3DW0A 1AXBA 4KZ8A 4LV3A 4BJPA 3ZG8B 3IH8A 1RGZA 1N4OA 1ES3A 2FFFB 5TR7A 3UN7A 4KG5A 4N9LA 2WZXA 4MEZA 3BRMA 2CC1A 4X69A 3LY4A 1BLSA 2A3UA 1K38A 2V1ZA 2Y2QA 4FH2A 3VP4A 1O7EA 2R9XA 1J9MA 3W4OA 3HBRA 1G68A 5G18A 4JF5A 1MWUA 3IXHA 1CK3A 2ZQAA 4DDSA 4MBKA 1KVMA 2WKHA 1K55A 3HLEA 4LV2A 2HDSA 3W4QA 4Y0OA 4KZ5A 2VGJA 3JYIA 1K57A 3ZG5A 1BULA 3IF6A 4ZBEA 1XPBA 3OPLA 2XFSA 1SCWA 4WMCD 1YLJA 1DJCA 3C7UA 3LCEA 4QB8A 1H8YA 2JE5A 4S2LA 5HARA 3N6IA 5FQ9A 5HAQA 1KDSA 4OONA 3W4PA 3PAGA 3QHYA 2P74A 4KZ4A 5BOHA 2Q9MA 5HFOA 2Y2LA 4PPRA 1LI0A 4RA7A 4XUZA 3LEZA 3HLGA 2J9PA 4KZBA 3PBOA 1IYPA 1BLPA 3VOYA 2G2UA 3MKFA 3NY4A 5DTKA 4XXRA 4LENA 4OVDA 4EQIA 4UHUA 4RVAA 3NIAA 1PW8A 3G35A 3A3FA 4EUZA 1L0DA 2XEPA 1FR1A 4ID4A 1KVLA 4JF6A 2J7VA 1QMFA 3V39A 1NYYA 5E2HA 2WAEA 3IXGA 4S2JA 4WEKA 1LLBA 3S4XA 4NETA 4OKPA 4N92A 4IBRA 2ZQ9A 1NXYA 1ERMA 4KZ7A 4MLLA 4EV4A 5AQ9A 4JXWA 3AGFA 5FSRA 4E3MA 1FR6A 4QHCA 3UY6A 5F1FA 3QNCA 1NZOA 1ZC2A 3SS4A 4KQOA 4K91A 3EQVA 3W8KA 3E2LA 2B5RA 1K4EA 5CHMA 4C6YA 3UPNA 1O07A 4DE0A 2WGIA 2P9VB 3VSLA 3BECA 3Q07A 3ZG9B 1XGIA 1LL5A 2X71A 4HEFA 4X68A 3WS4A 2Y91A 5FA7A 1K57C 5EVLA 3IF6C 4ZJ3A 1SDNA 3GMWA 5CERA 1SKFA 1C3BA 3NDEA 1ONHA 3GSGA 2IWDA 4L0LA 3BM6A 3ZGAB 4E6XA 1JWVA 4BD0A 2PBYA 2WGWB 3OPRA 2DRWA 5FQMA 1BUEA 4OOMA 4YINA 3N7WA 5FQIA 4BL2A 2XK1A 5A93A 4U0XA 5KMWA 2GDNA 1IYSA 3N8SA 1BSGA 5EE8A 5GHZA 1EROA 1NZUA 4ZDXA 1XP4A 1FQGA 1HZOA 3OC2A 4BLMA 5FATA 1CI8A 1FCNA 2A49A 5HX9A 1PI4A 3VP2A 5GLCA 5CXWA 3BFCA 4D2OA 4ZJ2A 1FOFA 4PM7A 4B4ZA 1W7FA 2Y2KA 3GR2A 4OLDA 2EX9A 5CGSA 3ZNTA 5KSCA 1RCJA 4JKTA 1WE4A 3O3VA 3BLSA 2XD5A 4R1GA 1ERQA 5FQQA 4ZJ1A 4X56A 2EXAA 3N4IA 5CRFA 2WKIA 3G32A 2IWBA 4GD8A 4OQ0A 3CJMA 4PMAA 1DJAA 3NI9A 4OOYA 5CEBA 4M3KA 4UA6A 3GRJA 3P09A 5FAQA 5GL9A 4OQHA 5EOOA 4BD1A 1ZKJA 4LV0A 3C7VA 3LY3A 1YLYA 2Y2HA 5I94A 1XGJA 2HDQA 2XFTA 5JYPA 3VFFA 1GHIA 1E4DA 2G2WA 1YM1A 3BFGA 4E3IA 3HREA 4C75A 5EVID 3IF6B 2J9OA 4HBTA 2XD1A 4R0QA 3VP0A 4JXSA 1K54A 2Y2MA 4MBHA 3OCNA 1FSWA 5FAPA 4P87A 1L2SA 1SDEA 4OP5A 2WUQA 1ES5A 2Y2OA 2HP6A 4S2PA 5GLDA 2XGNA 2QZ6A 1RP5A 2E8IA 2H0TA 4KG6A 3IWIA 2OLVA 3IF5A 3SS5A 1Q2PA 2EFUA 2JC7A 5EVIA 1VM1A 2ZC7A 3BLMA 5KSHA 3SH9A 1M40A 1K4FA 2ZM2A 3G2YA 4OPZA 5E2FA 1XA1A 3ITBA 1CI9A 4PM5A 2Y59A 3CG5A 4EWFA 3C4OA 2ZQ7A 1HTZA 1KE0A 4P85A 4DKIA 3M2KA 2ZC6B 4WELA 3WS2A 4CPKA 1TDGA 3FZCA 4JXVA 1CEGA 3PBTA 3MXRA 3HLBA 1GHMA 3IWOA 4KQQA 4WYYA 3ZVTA 3WS0A 5CGWA 4B4XA 3NCKA 4E3KA 4WMCA 5CECA 2J8YA 4WZ5C 3HVFA 3BFDA 1PZOA 1TEMA 3UDFA 5FASA 1MWTA 3HUOA 1GHPA 4KG2A 4MNRA 1LHYA 1WYBA 1ZG4A 4FH4A 3RXWA 2WAFA 1YT4A 5E2GA 3IHAA 5FI7A 1I2WA 1E3UD 1IELA 4O7DA 1Q2QA 1L0EA 1W5DA 4WBGA 3ZG0A 4R3BA 1OMEA 2EX2A 4DE3A 4EBLA 3FV7A 3HLCA 1XX2A 3HUMA 5FI6A 1DJBA 1ES2A 5A91A 2ZM0A 4LCMA 2XR0A 2XF3A 4DXBA 4RYEA 3GV9A 3IHBA 1KGEA 3UE0A 4S2MA 3RJUA 2V20A 4U0TA 1JVJA 5M1AA 1G6AA 3Q7ZA 4ZTKA 1KE4A 4DF6A 3UDIA 1K55C 4C3QA 5E43A 2OV5A 4DXCA 5CGXA 3DTMA 3VP1A 5HL1A 2QMIA 2WK0A 3MZEA 2OSUA 3GQZA 4Y0TA 5M18A 3I7JA 2Z2LB 3ZCZA 4WM9A 2ZC3B 4Z9QA 4IBXA 1FCOA 4KZ9A 4F94A 5A92A 1NRFA 3MBZA 1PYYA 4RX2A 3BEBA 5FI2A 4DRTA 3UDXA 4PM6A 3O86A 1W8YA 3BFEA 1ESUA 1YQSA 3NBLA 1CEFA 3PBNA 4IVKA 1JWPA 1LL9A 3V3SA 1IYOA 5D3OA 4Y0UA 1BZAA 3N8RA 4KENB 1L0FA 5JYOA 3M2JA 1BT5A 4JXGA 4E3JA 1MPLA 4WZ4A 2P9VA 4A5RA 3V5MA 4FSFA 2H10A 2HPBA 5DF9A 4XUXA 5HAPA 3CMZA 3CZDA 2ZC4B 4E3OA 1W79A 3Q7VA 4MBFA 5FDHA 2X01A 5EECA 4GZBA 3A3IA 4EBPA 2Z2MB 4GD6A 2XH9A 5DTSA 1ZG6A 1ONGA 4QJGA 3PBSA 2C6WB 1MBLA 2RCXA 4GDNA 5FQJA 5EPHA 2H5SA 4X6TA 5FQKA
chains in the Genus database with same CATH superfamily
1S4RA 3K3DA 1MWRA 3A0RA 1RGYA 3SOIA 1ODVA 1P0ZA 5CHUA 4BBUA 3PYPA 4FUWA 1K6RA 4EQ1A 4IVIA 3O87A 4MN7A 4S2NA 1YKDA 4I38A 2Y2GA 2D02A 2ZOIA 4EXOA 4HOIA 4GB7A 4UA7A 3RH8B 3ITAA 1XFQA 2RL3A 4WEJA 4WN5A 2XDMA 4KZ3A 3G31A 3T4KA 5AQAA 4OPQA 5TFQA 2BASA 1K25A 1VEUA 3OPPA 1XJ3A 1S0WA 5HD5A 1Y54A 4FTXA 1EWZA 1I2SA 4XT2A 2Y55A 2W1RA 1QMEA 3HLDA 1LI9A 3BYDA 4EBNA 4OH0A 4Y7PA 2R78A 1MWSA 5AVFA 2Y4AA 1SKOB 4GN2A 4HHDA 3MF0A 3UPPA 1YLPA 5HSQA 3VMAA 3VFHA 4ETXA 3VOLA 5DF7A 3TW8A 1KGFA 4X53A 5CTNA 2UWXA 1GSXA 4DDYA 1LT0A 5GHYA 1I5QA 2FZ0A 5AQ7A 2XRNA 3G34A 3MQQA 2QWSA 3VOZA 4OP8A 3Q1FA 1E25A 4GOGA 5F1GA 1IKIA 1WYCA 2Y2PA 4G3WA 4WLAA 2HDUA 4IUKA 2PDRA 4BL3A 2ZD8A 3D9YA 1XKZA 1T1BA 1OTIA 4HBUA 2HDRA 1BLCA 3FKVA 1K56D 4R70A 3SH8A 4E6WA 4OPRA 1N9BA 5IHVA 5F6AA 3QP4A 1Y28A 2X02A 2DCFA 4BQMA 4N1XA 4LCLA 1M6KA 2Z6CA 1JTDA 4DE2A 5TBMB 4JF4A 1AWIA 3QNBA 4WZ5A 3KO6A 4L9FA 3OOVA 1Y4OA 1H8ZA 3IXBA 4KZ8A 4LV3A 4BJPA 2VK3A 1RGZA 5TR7A 5DJUA 4N9LA 2WZXA 3BRMA 4XT2B 4LFUA 2A3UA 3LEQA 1K38A 1O7EA 3DTIA 2D01A 2ZQAA 4MBKA 3OBFA 4Y0OA 3LIAA 3KSGA 3OPLA 3C7UA 4QB8A 2JE5A 5HARA 3N6IA 5HAQA 1KDSA 2ZMFA 4BMWA 4OONA 1N9LA 2P74A 1CJFA 2Y2LA 3HLGA 4KZBA 2W27A 1IYPA 3T4TA 3NY4A 2W3EA 4OVDA 2J3WA 3NIAA 1TD5A 1FR1A 4Z1WA 1F98A 1NYYA 5E2HA 4WEKA 1LLBA 3LIEA 2K7SA 5HPFA 4HH3A 1ERMA 3D3OA 5FDSA 5FSRA 2O9CA 4EEUA 1FR6A 4QHCA 5F1FA 4KQOA 4NXFA 1PFLA 3EQVA 2B5RA 2KOIA 3O5YA 1XJ4A 4DE0A 2W3FA 2WGIA 3LICA 3VSLA 4LRXC 4NXGA 3BECA 4HEFA 2Y91A 5FA7A 2W3GA 5EVLA 4ZJ3A 3GMWA 5CERA 1PRQA 3UMDA 3NDEA 2VKSA 3GSGA 3ZGAB 1JWVA 4ETZA 4BD0A 2YKFA 3OPRA 1BUEA 4MMNA 5FQIA 3N7WA 2XK1A 2GDNA 1BSGA 4LRYC 2M7UA 5EE8A 2A24A 3C2WA 1NZUA 1XP4A 1FQGA 4BLMA 1T18A 5K5BA 3VP2A 5AJGA 3BFCA 4D2OA 4ZJ2A 4PM7A 2EX9A 4I3IA 3BLSA 1OJGA 4UQIS 1P9WA 4GD8A 4EERA 4HI4A 4M3KA 4BD1A 3UB9A 4HQAA 1ZTUA 4RQ9A 2Y2HA 3T50A 2HDQA 2XFTA 1XFNA 3SZTA 2O9BA 1YM1A 4C75A 4EETB 3KSIA 4HBTA 2XD1A 1K54A 4MBHA 4CLCC 4YWZA 1XJ2A 5GLDA 2XGNA 1RP5A 3IWIA 2OLVA 3VE4A 3CPTA 5EVIA 3FPWA 4OPZA 1XA1A 4PM5A 3R4KA 4Y13A 1MKMA 4EWFA 1ZHHB 4KUOA 3RFBA 3M2KA 2ZC6B 2WKRA 4MN5A 1N9NA 3IBJA 3HLBA 3JPUA 4B4XA 4ZRRA 1S4SA 3UDFA 1GHPA 3RXWA 1YT4A 2PD7A 2OAP1 1VHMA 1IELA 4O7DA 1L0EA 3ZG0A 5HDCA 1OMEA 3CI6A 1XX2A 3U2AA 2V8CA 3QP8A 2XF3A 4DXBA 1KGEA 3H82B 4S2MA 3UB6A 2V20A 1JVJA 1Z09A 1KE4A 1V9ZA 4DF6A 1K55C 2Y8HA 4C3QA 5E43A 5HWTA 2QMIA 4E04A 1DP8A 2NUPC 4L9GA 1X0OA 5A92A 1NRFA 3MBZA 3O86A 1J3WA 1LSVA 3RTYA 1ESUA 4X1LA 2VV7A 3PBNA 1LL9A 4Y0UA 2OOLA 4GS9B 4BBVA 3N8RA 4KENB 4B93A 1L0FA 3M2JA 1BT5A 4IJGA 2H10A 4XUXA 5HAPA 2HGVA 4G3VA 4QJGA 3PBSA 4GDNA 3F1NA 3CUEA 5EPHA 2H5SA 1P97A 5FQKA 2JKFA 3NOPC 4E3LA 3LIFA 4DMZA 4I39A 3CPTB 3R7WA 3U4LP 3MZFA 5HWWA 3NHQA 5CX7A 3V3RA 1IFQA 4CLCE 4H8RA 4CJNA 1BYWA 3ZG7B 3BFFA 3UPOA 4PM8A 2PAVP 3E2KA 3LYXA 3IX4A 2WYXA 5F83A 1Z6FA 2Y79A 1N9OA 2UV0E 3LO7A 3T1RA 1KDWA 3WS1A 4QY6A 3KX0X 4OPYA 2XLNA 3LUQA 2V9AA 1G6OA 4GNUA 3S22A 1HVBA 1YLZA 4QD4A 2JHEA 3F1PB 3M6BA 4HESA 1U60A 3ZVWA 3LR3A 3OLOA 2K2NA 3IX3A 3HLWA 4QU3A 2HP9A 5G4YA 4S2NC 5IT5A 4UQIM 3MS6A 3NJAA 4DE1A 4GLQA 4KQRA 1L0GA 3VE3A 2Y2JA 5AQBA 4PM9A 2QJ7A 1XXMA 2PU2A 4HNBA 3UB5P 4Y2FA 3B3XA 1BLHA 2PRFA 1PNEA 5I5LA 2VX8A 1YMXA 4KZAA 2JBFA 3WWXA 3D4FA 4OOLA 4BBTA 3EGDC 1IEMA 3OCLA 4FD8A 1OTAA 2ZC5B 4QY5A 1YPRA 1MXOA 3OZHA 3FYZA 2KLIA 3ZNYA 5EM1A 3F1NB 4JPMA 1TS0A 5DVAA 4OLGA 1S6RA 3LI9A 1F2KA 2JCHA 2ZJ9A 3E4PA 3R7WB 2OLUA 4OQIA 3C5AA 3SH7A 2JKTI 3AGDA 3ZFZA 4I3JA 3AGEA 4D60A 1W63Q 4Q0HA 1CF0A 2C5WB 3OPHA 4O8GA 5HAIA 4GDBA 4M4XA 2BG1A 1PW1A 4P6ZS 4P0MA 1FIKA 5L2FA 3DW0A 2EWWA 4DN0A 3B33A 4PAUA 3IH8A 2FFFB 4ME4A 3UN7A 4MEZA 4KQDA 4BWIA 3LY4A 1BLSA 3UE6A 5EFWA 2R9XA 2Z6DA 3HBRA 2VLGA 4JF5A 1MWUA 4DDSA 1KVMA 2HDSA 3JYIA 1K57A 4ZBEA 1XPBA 1H8YA 2J3TD 3PAGA 3QHYA 4L9EA 5BOHA 2Q9MA 4RA7A 3LEZA 2J9PA 3PBOA 1LSXA 1A0KA 1H8MA 3G35A 3A3FA 5AVEA 1L0DA 4HY8A 4GJ4A 2XA7M 5HDSA 3MR0A 2WAEA 3IXGA 3S4XA 4OKPA 4N92A 3KYZA 2ZQ9A 1NXYA 4EV4A 4JXWA 4E3MA 1ZC2A 3LI8A 3W8KA 3E2LA 1O07A 3Q07A 1LL5A 4X68A 3WS4A 2JN7A 5L8MA 1C3BA 3S7PA 2IWDA 3BM6A 2PBYA 1W63M 2DRWA 4YINA 2J3TC 5GHZA 3LR0A 4ZDXA 3OC2A 3KYQA 3DBAA 5FATA 1CI8A 2A49A 5J4EA 5CXWA 1FOFA 4B4ZA 5CGSA 3GR2A 3ZNTA 3O3VA 4R1GA 2EXAA 3N4IA 5CRFA 2WKIA 4JGRA 3QP1A 5CEBA 4PMAA 1DJAA 3NI9A 2W1TA 3GRJA 4UA6A 5EOOA 4LV0A 2HZ5A 2HJEA 1VEUB 2G2WA 2JKRM 5EVID 4R0QA 3VP0A 5FAPA 4Y3IA 2HP6A 2QZ6A 1S1ZA 1Q2PA 5L10A 2JC7A 5LBRA 3T1SA 5E2FA 2ZM2A 3ITBA 1CI9A 4HJ4A 3CG5A 4JGQA 5HL6A 3WS2A 4I3AA 3PBTA 3LIBA 3IWOA 2P04A 4E3KA 3WS0A 5CECA 3IBRA 1TEMA 1LHYA 4FH4A 1I2WA 1E3UD 1Q2QA 3MQOA 4MDZA 3BQAA 1JNUA 4DE3A 4EBLA 2K31A 1ES2A 2ZM0A 4LCMA 2HV1A 1G6AA 3Q7ZA 4Q0IA 4P6ZM 2ZOHA 3UDIA 4DXCA 4NG2A 2ZMVA 3MZEA 2OSUA 1YSPA 4HJ3A 5M18A 3I7JA 2OAQ1 2Z2LB 3S7NA 3ZCZA 4RX2A 2W3DA 1W8YA 3BFEA 4IVKA 5FEGA 1IYOA 5JYOA 4Y15A 4JXGA 2W1TB 3E0YA 3SW1A 1MPLA 2Q0OA 4WZ4A 2P9VA 3BJNA 4FSFA 1ACFA 3CMZA 4E3OA 2LB9A 4MBFA 3H9WA 4GZBA 4NEED 4EBPA 3UB8A 4LLOB 2B95A 4GD6A 4DJ3A 2PBDP 1ZG6A 2GJ3A 2C6WB 1MBLA 2RCXA 3PHYA 1NY0A 1G28A 3HUNA 5EOEA 3VV4A 2QPNA 5DF8A 5F82A 3UMEA 3UNWA 3A3DA 3F1OA 4G3KA 5EV0A 4S2IA 3VSKA 4B88A 3IQAA 1TVFA 2P08A 5CHJA 5DTTA 3TSGA 1NLYA 4JBFA 3WRZA 3NECA 1NYMA 2H0YA 1T1AA 2WGVA 1XA7A 3K3CA 5MC7A 1DRMA 1HLUP 3PBRA 1OPXA 1OTEA 2V0UA 3E98A 2ZBBA 2XQZA 4P6BA 1H5XA 2EX8A 3LR5A 1D06A 5HZHA 2DNSA 3CUEC 2V0WA 2IWCA 1SHVA 3MFXA 4O01A 1FCMA 4LGWA 4ARZA 3T1XA 4X25A 2EFXA 5A90A 4YFMA 3HJKA 2I9VA 2ZQ8A 3SS3A 2JKGA 1E3UA 2VZWA 3ZDJA 3V50A 2V1AA 5J8XA 3CLOA 2Y2IA 2O99A 4K0WA 1OT9A 3BY8A 3MZDA 4KZ6A 2A24B 3EQUA 4R3JA 2PD8A 3IT9A 1MKIA 2O0YA 4OQGA 4NXEA 4WL9A 1S1YA 3EOIA 2QHKA 1IKGA 3GVBA 2ZLYA 4JLFA 4R23A 5CEDA 5DFXA 5E2EA 4PHTA 5KZHA 2Q9NA 3MFDA 1WA9A 4UA9A 3RXXA 1OTBA 1BTLA 5EUAA 1PWCA 3O88A 5FAOA 3G4PA 3WRTA 5DJTA 2ZQCA 2PHYA 1JTGA 3GECA 2VGLM 4CLCA 2QYBA 2ZQDA 3IH9A 4S2OA 2I72A 2XA7S 3F1OB 1GA0A 2WGWA 4GHIA 3P7NA 1NJ4A 5TGFA 4EW7A 4U3TA 3A3EA 5EVIB 4FCFA 4RX3A 3VP3A 3N8LA 3Q82A 4UAAA 4Q8IA 1PWGA 3TRCA 1ES4A 5GLAA 3NC8A 1KGGA 3S1YA 1AXBA 1GSWA 2FH5A 3ZG8B 4X1MA 1N4OA 1ES3A 3QP2A 4KG5A 2CMNA 5F5YA 2CC1A 2A2LA 4X69A 3EEAA 3T4QA 1UGUA 2V1ZA 2Y2QA 4FH2A 5G18A 1CK3A 2WKHA 1K55A 3HLEA 1VB6A 4LV2A 3W4QA 3NULA 4KZ5A 2VGJA 4H6JA 1BULA 3IF6A 2XFSA 1SCWA 3T1QB 4LPZA 4KZ4A 5HFOA 4PPRA 4XUZA 1BLPA 3VOYA 2G2UA 3MKFA 1DP6A 4LENA 2V8FA 1LL8A 2VV6A 4EQIA 4UHUA 2M1CA 4PKYA 4ID4A 2J7VA 2B02A 4IBRA 3E4OA 4IHQA 5TJJA 4MLLA 5AQ9A 3UY6A 1NZOA 1K4EA 5CHMA 4C6YA 1TS7A 2M7VA 5EM0A 5L07A 3T12B 3ZG9B 1XGIA 2X71A 4B9OA 1K57C 2IA2A 1SDNA 1MC0A 1SKFA 3CWFA 4CLCB 2HJ9C 1L3LA 3NOUC 4L0LA 2WGWB 4GHIB 4BL2A 5A93A 4U0XA 5KMWA 1IYSA 3N8SA 1EROA 2ZL1A 1HZOA 3L7HA 3IS2A 3EGXC 3BQ8A 1FCNA 5HX9A 1PI4A 3FG8A 1UWPX 2Y2KA 4OLDA 3IX8A 1RCJA 1D7EA 4JKTA 2XD5A 5FQQA 2W0NA 4ZJ1A 5FEFA 2GZAA 3G32A 2IWBA 4OQ0A 4OOYA 1VETA 3E4QA 3L9KA 5FAQA 5GL9A 4GCZA 4DJ2A 4AFIA 1XGJA 3PR6A 1XJ6A 5JYPA 3PXPA 3CHWP 2DMWA 4H6JB 3KSFA 3IF6B 2J9OA 3OCNA 5G4ZA 1P9RA 4OP5A 2WUQA 1ES5A 2PYRA 2B18A 4KG6A 2E8IA 3SS5A 2G7UA 3IF5A 4MCWA 3CITA 1VM1A 2ZC7A 3S7OA 4HH2A 3SH9A 1M40A 1K4FA 2OWJA 3G2YA 3QP5A 5TBMA 1H3QA 5L09A 2ZQ7A 4P85A 1KE0A 4WELA 1TDGA 1CEGA 3MXRA 3NCKA 5IU1A 4UEYA 2V1BA 3ZYTA 4WZ5C 5DKLA 1PZOA 3GDIA 4KG2A 1WYBA 2WAFA 4Y5FA 3TE8A 4WBGA 2EX2A 2AVXA 2XSSA 3FV7A 5FI6A 1DJBA 5A91A 2XR0A 3ULFA 2YKHA 3GV9A 1TS6A 3RJUA 4U0TA 5HPIA 1OT6A 1STZA 3H7WA 4FOFA 2OV5A 3CAXA 5HL1A 3T4LA 4Y0TA 5IS1A 3LR4A 4WM9A 4JGPA 2ZC3B 2ZL1B 4F94A 3IS2B 3BEBA 2L0WA 3UDXA 1MZUA 3NBLA 1CEFA 5DFYA 1LSWA 1JWPA 4QWOA 3V3SA 2WKPA 1BZAA 1VETB 4E3JA 2HPBA 5DF9A 3CZDA 2ZC4B 3Q7VA 3C30A 5EECA 3A3IA 2Z2MB 1KOUA 2XH9A 1S66L 2PT7A 5FQJA 3Q81A 1IYQA 1GA9A 1HD8A 2EXBA 3DTKA 4ZAMA 5HDDA 4IEDA 4LV1A 2HP5A 3UO9A 1D1JA 1PZPA 4R4RA 4BENA 1NWZA 1YMSA 3ZHHA 1K6SA 3JVVA 3P98A 3BW6A 3G2ZA 1PWDA 3ZQ5A 1KE3A 3FKWA 1VQQA 1DY6A 3PBQA 2ZMAA 4NK3A 2J80A 4GKUA 1W8QA 2VGLS 2WKEA 3TG9A 3C4PA 3WS5A 1EI5A 1OTDA 3B42A 4N1HA 1NRJA 2MJ6A 3G30A 3IXDA 4II7A 3TOIA 4E3NA 3H7WB 1TDLA 3ISGA 3G6OA 2L4RA 3MMHA 1K54C 3UE1A 5HW3A 3DWKA 4KUKA 1ESIA 2VGKA 1FSYA 2R9WA 2PU4A 1JWZA 5EVIC 5U47A 1PI5A 4R4SA 2ZM8A 3LIDA 1YAXA 2WZZA 1PIOA 2JKTM 1MY8A 3HL9A 3T4JA 5C5KA 2V2FF 2Y2NA 2WADA 3DWZA 1GCEA 3MKEA 4GW9A 1YLTA 3LGOA 4CQHA 3A0SA 3Q7VB 5GLBA 4YOFA 4F3LA 4WUJA 1ALQA 4CLCD 3H82A 1K0KA 3MXSA 3PTEA 1UWNX 5CTMA 1YLWA 3W2ZA 2EX6A 3FWLA 5M19A 3JVUA 2VA0A 3A3JA 3UE3A 2XROA 3M6HA 5GHXA 1K56A 3FPVA 4K0XA 4S2KA 3PAEA 3GTCA 4GS9A 2BLSA 2L1MA 4R38A 4QPRA 3NDGA 3IWQA 4N9KA 2FFYA 4X55A 3HLFA 3MSHA 1FILA 1NLZA 3C38A 4HJ6A 2E8JA 1TF1A 2QJ5A 3VP4A 3W4OA 1J9MA 1G68A 3HCYA 3IXHA 3ZG5A 2KDKA 4WMCD 1YLJA 1DJCA 3LCEA 4S2LA 5FQ9A 2QKPA 4NKPA 3W4PA 1DP9A 4IUHA 3MJQA 3HJIA 4R6LA 1LI0A 3BWLA 3T4SA 5DTKA 4XXRA 2KX6A 4RVAA 1PW8A 4EUZA 2XEPA 1KVLA 4JF6A 1QMFA 3V39A 4S2JA 4EU0A 4NETA 2VV8A 4KZ7A 3F1PA 4R3AA 3AGFA 4F3LB 3QNCA 3SS4A 3MQ0A 4K91A 1CQAA 4NXBA 3UPNA 2P9VB 5A8BA 2INWA 5KIZA 1F5MA 3IF6C 1H0MA 1ONHA 1IOUA 3S7QA 4E6XA 3B47A 3UB7A 3BY9A 5FQMA 4OOMA 1V9YA 4HIAA 2VEAA 1T19A 3DAVA 3C8CA 2GX5A 1F9IA 5GLCA 2PYPA 1YSQA 5EVEA 4PKYG 1W7FA 5KSCA 2ACGA 1WE4A 3EWKA 1ERQA 4X56A 2O9AA 3CJMA 5HD3A 3P09A 2NUTC 4OQHA 1ZKJA 3KSHA 3C7VA 3LY3A 1YLYA 5I94A 2EWVA 4LRZE 3VFFA 1GHIA 1E4DA 5F68A 1TS8A 3BFGA 4E3IA 2P7JA 3HREA 2HF6A 4HP4A 3V67A 4JXSA 1T1CA 2Y2MA 1FSWA 4YNRA 4P87A 1L2SA 1SDEA 3NOTC 2Y2OA 4S2PA 4ARZB 2H0TA 3P01A 2EFUA 3BLMA 5KSHA 4EEPA 5J7EA 3LFVA 2Y59A 3C4OA 1HTZA 4DKIA 4K08A 4CPKA 3FZCA 4JXVA 2EA9A 1GHMA 4KQQA 4WYYA 3ZVTA 5CGWA 3MXQA 2BTFP 4WMCA 5J3WA 2PR5A 2J8YA 3HVFA 3BFDA 5FASA 1MWTA 3HUOA 5F69A 4WF0A 4MNRA 1ZG4A 2JKRI 5E2GA 3IHAA 2PR6A 5FI7A 4MN6A 3T4OA 3DTEA 4ESPA 1W5DA 4EESA 4R3BA 3HLCA 3EEHA 3D72A 3HUMA 4RYEA 3UE0A 3IHBA 3A0VA 5M1AA 4ZTKA 4Y17A 4I5SA 1G5UA 5CGXA 3DTMA 3VP1A 1SKOA 2WK0A 1GSVA 3GQZA 2VJWA 3QP6A 4HP9A 4Z9QA 4IBXA 1FCOA 4KZ9A 5HWVA 5FI2A 1PYYA 3TJZC 4DRTA 1EW0A 4O0PA 4PM6A 1YQSA 4Q0JA 4EUVA 4JGOA 5D3OA 1S67L 2GNXA 3ICYA 5FL3A 2LB5A 2OWHA 3K2NA 2W3HA 1OJ5A 4A5RA 3FC7A 3V5MA 5DKKA 2WKQA 1W79A 5FDHA 2X01A 1SZVA 2H28A 5DTSA 1ONGA 3KYEA 4X6TA
chains in the Genus database with same CATH topology
1MWRA 3Q81A 1NY0A 1RGYA 3HUNA 3SOIA 4E3LA 5CHUA 5EOEA 1IYQA 1GA9A 1HD8A 2QPNA 5DF8A 5F82A 2EXBA 4ZAMA 3UNWA 1K6RA 4IEDA 4IVIA 4LV1A 3A3DA 2HP5A 3O87A 3UO9A 3MZFA 4S2NA 3V3RA 3VSKA 1PZPA 4S2IA 4B88A 4R4RA 4BENA 2Y2GA 1YMSA 3IQAA 1TVFA 3ZHHA 5CHJA 4H8RA 4CJNA 1K6SA 3P98A 5DTTA 3TSGA 3ZG7B 3BFFA 3UPOA 4GB7A 4UA7A 4PM8A 3E2KA 3G2ZA 1PWDA 4JBFA 3ITAA 3WRZA 2WYXA 1KE3A 3FKWA 1VQQA 5F83A 1NYMA 2H0YA 1Z6FA 2RL3A 1DY6A 3PBQA 4WEJA 2XDMA 2WGVA 2ZMAA 4KZ3A 1XA7A 4NK3A 3LO7A 3G31A 1KDWA 3PBRA 5AQAA 4OPQA 3WS1A 4QY6A 4GKUA 5TFQA 4OPYA 1W8QA 2XLNA 1K25A 4GNUA 3S22A 2XQZA 3OPPA 2WKEA 4P6BA 3TG9A 1H5XA 1HVBA 1S0WA 1YLZA 2EX8A 4QD4A 1Y54A 1EWZA 3C4PA 1I2SA 3WS5A 3M6BA 4HESA 2DNSA 1EI5A 2Y55A 4N1HA 1U60A 2IWCA 3ZVWA 1QMEA 1SHVA 3HLDA 1LI9A 1FCMA 3BYDA 3G30A 4EBNA 4OH0A 3IXDA 3HLWA 3TOIA 4QU3A 4Y7PA 2HP9A 4E3NA 1TDLA 1MWSA 2EFXA 3ISGA 4S2NC 5A90A 2Y4AA 4YFMA 1K54C 4GN2A 2ZQ8A 3SS3A 3UE1A 4DE1A 3DWKA 5HW3A 1E3UA 3UPPA 1YLPA 1ESIA 2VGKA 4KQRA 1L0GA 1FSYA 2Y2JA 2R9WA 3ZDJA 2PU4A 5AQBA 1JWZA 3V50A 3VMAA 4PM9A 5J8XA 5EVIC 3VFHA 2Y2IA 5U47A 1PI5A 5DF7A 4R4SA 4K0WA 2ZM8A 1XXMA 1KGFA 2PU2A 4X53A 5CTNA 2UWXA 3B3XA 3MZDA 1BLHA 4KZ6A 3EQUA 2WZZA 4R3JA 1PIOA 3IT9A 1MY8A 1MKIA 4DDYA 4OQGA 5GHYA 1YMXA 4KZAA 1I5QA 3HL9A 1IKGA 2JBFA 3GVBA 2ZLYA 3G34A 4JLFA 5AQ7A 3WWXA 4R23A 2V2FF 5CEDA 2Y2NA 2WADA 3DWZA 5E2EA 3D4FA 3VOZA 1GCEA 5KZHA 4OP8A 3MKEA 3Q1FA 1E25A 4OOLA 1YLTA 2Q9NA 3MFDA 1IEMA 3OCLA 4FD8A 4GOGA 1IKIA 3Q7VB 5F1GA 5GLBA 1WYCA 2Y2PA 2ZC5B 4UA9A 2HDUA 3RXXA 4QY5A 1MXOA 1ALQA 3OZHA 1BTLA 5EUAA 1PWCA 3FYZA 3ZNYA 3MXSA 3PTEA 2ZD8A 3O88A 5FAOA 4JPMA 4BL3A 5CTMA 3G4PA 3WRTA 5DVAA 1XKZA 2ZQCA 1YLWA 4OLGA 1S6RA 1JTGA 2EX6A 4HBUA 2HDRA 1BLCA 3FWLA 5M19A 2JCHA 2ZJ9A 3FKVA 1K56D 2OLUA 2ZQDA 3A3JA 3IH9A 4OQIA 3C5AA 3SH8A 3SH7A 3UE3A 4E6WA 3AGDA 4S2OA 2I72A 3M6HA 3ZFZA 4OPRA 1GA0A 2WGWA 1N9BA 1NJ4A 5IHVA 5TGFA 5GHXA 3AGEA 1K56A 4K0XA 2X02A 4U3TA 2DCFA 4BQMA 3A3EA 4N1XA 4LCLA 1M6KA 4S2KA 5EVIB 3PAEA 4FCFA 2C5WB 3OPHA 5HAIA 4RX3A 3VP3A 3GTCA 1JTDA 4GDBA 2BLSA 3N8LA 3Q82A 4UAAA 4Q8IA 2BG1A 4DE2A 1PWGA 4JF4A 1PW1A 3QNBA 4P0MA 4WZ5A 3NDGA 1ES4A 3IWQA 4N9KA 5GLAA 3NC8A 1KGGA 1H8ZA 2FFYA 5L2FA 3IXBA 4X55A 3HLFA 3S1YA 3DW0A 1AXBA 4KZ8A 4LV3A 4BJPA 3ZG8B 3IH8A 1RGZA 1N4OA 1ES3A 2FFFB 5TR7A 3UN7A 4KG5A 4N9LA 2WZXA 4MEZA 3BRMA 2CC1A 4X69A 3LY4A 1BLSA 2A3UA 1K38A 2V1ZA 2Y2QA 4FH2A 3VP4A 1O7EA 2R9XA 1J9MA 3W4OA 3HBRA 1G68A 5G18A 4JF5A 1MWUA 3IXHA 1CK3A 2ZQAA 4DDSA 4MBKA 1KVMA 2WKHA 1K55A 3HLEA 4LV2A 2HDSA 3W4QA 4Y0OA 4KZ5A 2VGJA 3JYIA 1K57A 3ZG5A 1BULA 3IF6A 4ZBEA 1XPBA 3OPLA 2XFSA 1SCWA 4WMCD 1YLJA 1DJCA 3C7UA 3LCEA 4QB8A 1H8YA 2JE5A 4S2LA 5HARA 3N6IA 5FQ9A 5HAQA 1KDSA 4OONA 3W4PA 3PAGA 3QHYA 2P74A 4KZ4A 5BOHA 2Q9MA 5HFOA 2Y2LA 4PPRA 1LI0A 4RA7A 4XUZA 3LEZA 3HLGA 2J9PA 4KZBA 3PBOA 1IYPA 1BLPA 3VOYA 2G2UA 3MKFA 3NY4A 5DTKA 4XXRA 4LENA 4OVDA 4EQIA 4UHUA 4RVAA 3NIAA 1PW8A 3G35A 3A3FA 4EUZA 1L0DA 2XEPA 1FR1A 4ID4A 1KVLA 4JF6A 2J7VA 1QMFA 3V39A 1NYYA 5E2HA 2WAEA 3IXGA 4S2JA 4WEKA 1LLBA 3S4XA 4NETA 4OKPA 4N92A 4IBRA 2ZQ9A 1NXYA 1ERMA 4KZ7A 4MLLA 4EV4A 5AQ9A 4JXWA 3AGFA 5FSRA 4E3MA 1FR6A 4QHCA 3UY6A 5F1FA 3QNCA 1NZOA 1ZC2A 3SS4A 4KQOA 4K91A 3EQVA 3W8KA 3E2LA 2B5RA 1K4EA 5CHMA 4C6YA 3UPNA 1O07A 4DE0A 2WGIA 2P9VB 3VSLA 3BECA 3Q07A 3ZG9B 1XGIA 1LL5A 2X71A 4HEFA 4X68A 3WS4A 2Y91A 5FA7A 1K57C 5EVLA 3IF6C 4ZJ3A 1SDNA 3GMWA 5CERA 1SKFA 1C3BA 3NDEA 1ONHA 3GSGA 2IWDA 4L0LA 3BM6A 3ZGAB 4E6XA 1JWVA 4BD0A 2PBYA 2WGWB 3OPRA 2DRWA 5FQMA 1BUEA 4OOMA 4YINA 3N7WA 5FQIA 4BL2A 2XK1A 5A93A 4U0XA 5KMWA 2GDNA 1IYSA 3N8SA 1BSGA 5EE8A 5GHZA 1EROA 1NZUA 4ZDXA 1XP4A 1FQGA 1HZOA 3OC2A 4BLMA 5FATA 1CI8A 1FCNA 2A49A 5HX9A 1PI4A 3VP2A 5GLCA 5CXWA 3BFCA 4D2OA 4ZJ2A 1FOFA 4PM7A 4B4ZA 1W7FA 2Y2KA 3GR2A 4OLDA 2EX9A 5CGSA 3ZNTA 5KSCA 1RCJA 4JKTA 1WE4A 3O3VA 3BLSA 2XD5A 4R1GA 1ERQA 5FQQA 4ZJ1A 4X56A 2EXAA 3N4IA 5CRFA 2WKIA 3G32A 2IWBA 4GD8A 4OQ0A 3CJMA 4PMAA 1DJAA 3NI9A 4OOYA 5CEBA 4M3KA 4UA6A 3GRJA 3P09A 5FAQA 5GL9A 4OQHA 5EOOA 4BD1A 1ZKJA 4LV0A 3C7VA 3LY3A 1YLYA 2Y2HA 5I94A 1XGJA 2HDQA 2XFTA 5JYPA 3VFFA 1GHIA 1E4DA 2G2WA 1YM1A 3BFGA 4E3IA 3HREA 4C75A 5EVID 3IF6B 2J9OA 4HBTA 2XD1A 4R0QA 3VP0A 4JXSA 1K54A 2Y2MA 4MBHA 3OCNA 1FSWA 5FAPA 4P87A 1L2SA 1SDEA 4OP5A 2WUQA 1ES5A 2Y2OA 2HP6A 4S2PA 5GLDA 2XGNA 2QZ6A 1RP5A 2E8IA 2H0TA 4KG6A 3IWIA 2OLVA 3IF5A 3SS5A 1Q2PA 2EFUA 2JC7A 5EVIA 1VM1A 2ZC7A 3BLMA 5KSHA 3SH9A 1M40A 1K4FA 2ZM2A 3G2YA 4OPZA 5E2FA 1XA1A 3ITBA 1CI9A 4PM5A 2Y59A 3CG5A 4EWFA 3C4OA 2ZQ7A 1HTZA 1KE0A 4P85A 4DKIA 3M2KA 2ZC6B 4WELA 3WS2A 4CPKA 1TDGA 3FZCA 4JXVA 1CEGA 3PBTA 3MXRA 3HLBA 1GHMA 3IWOA 4KQQA 4WYYA 3ZVTA 3WS0A 5CGWA 4B4XA 3NCKA 4E3KA 4WMCA 5CECA 2J8YA 4WZ5C 3HVFA 3BFDA 1PZOA 1TEMA 3UDFA 5FASA 1MWTA 3HUOA 1GHPA 4KG2A 4MNRA 1LHYA 1WYBA 1ZG4A 4FH4A 3RXWA 2WAFA 1YT4A 5E2GA 3IHAA 5FI7A 1I2WA 1E3UD 1IELA 4O7DA 1Q2QA 1L0EA 1W5DA 4WBGA 3ZG0A 4R3BA 1OMEA 2EX2A 4DE3A 4EBLA 3FV7A 3HLCA 1XX2A 3HUMA 5FI6A 1DJBA 1ES2A 5A91A 2ZM0A 4LCMA 2XR0A 2XF3A 4DXBA 4RYEA 3GV9A 3IHBA 1KGEA 3UE0A 4S2MA 3RJUA 2V20A 4U0TA 1JVJA 5M1AA 1G6AA 3Q7ZA 4ZTKA 1KE4A 4DF6A 3UDIA 1K55C 4C3QA 5E43A 2OV5A 4DXCA 5CGXA 3DTMA 3VP1A 5HL1A 2QMIA 2WK0A 3MZEA 2OSUA 3GQZA 4Y0TA 5M18A 3I7JA 2Z2LB 3ZCZA 4WM9A 2ZC3B 4Z9QA 4IBXA 1FCOA 4KZ9A 4F94A 5A92A 1NRFA 3MBZA 1PYYA 4RX2A 3BEBA 5FI2A 4DRTA 3UDXA 4PM6A 3O86A 1W8YA 3BFEA 1ESUA 1YQSA 3NBLA 1CEFA 3PBNA 4IVKA 1JWPA 1LL9A 3V3SA 1IYOA 5D3OA 4Y0UA 1BZAA 3N8RA 4KENB 1L0FA 5JYOA 3M2JA 1BT5A 4JXGA 4E3JA 1MPLA 4WZ4A 2P9VA 4A5RA 3V5MA 4FSFA 2H10A 2HPBA 5DF9A 4XUXA 5HAPA 3CMZA 3CZDA 2ZC4B 4E3OA 1W79A 3Q7VA 4MBFA 5FDHA 2X01A 5EECA 4GZBA 3A3IA 4EBPA 2Z2MB 4GD6A 2XH9A 5DTSA 1ZG6A 1ONGA 4QJGA 3PBSA 2C6WB 1MBLA 2RCXA 4GDNA 5FQJA 5EPHA 2H5SA 4X6TA 5FQKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MWR A;  3Q81 A;  1NY0 A;  1RGY A;  3HUN A;  3SOI A;  4E3L A;  5CHU A;  5EOE A;  1IYQ A;  1GA9 A;  1HD8 A;  2QPN A;  5DF8 A;  5F82 A;  2EXB A;  4ZAM A;  3UNW A;  1K6R A;  4IED A;  4IVI A;  4LV1 A;  3A3D A;  2HP5 A;  3O87 A;  3UO9 A;  3MZF A;  4S2N A;  3V3R A;  3VSK A;  1PZP A;  4S2I A;  4B88 A;  4R4R A;  4BEN A;  2Y2G A;  1YMS A;  3IQA A;  1TVF A;  3ZHH A;  5CHJ A;  4H8R A;  4CJN A;  1K6S A;  3P98 A;  5DTT A;  3TSG A;  3ZG7 B;  3BFF A;  3UPO A;  4GB7 A;  4UA7 A;  4PM8 A;  3E2K A;  3G2Z A;  1PWD A;  4JBF A;  3ITA A;  3WRZ A;  2WYX A;  1KE3 A;  3FKW A;  1VQQ A;  5F83 A;  1NYM A;  2H0Y A;  1Z6F A;  2RL3 A;  1DY6 A;  3PBQ A;  4WEJ A;  2XDM A;  2WGV A;  2ZMA A;  4KZ3 A;  1XA7 A;  4NK3 A;  3LO7 A;  3G31 A;  1KDW A;  3PBR A;  5AQA A;  4OPQ A;  3WS1 A;  4QY6 A;  4GKU A;  5TFQ A;  4OPY A;  1W8Q A;  2XLN A;  1K25 A;  4GNU A;  3S22 A;  2XQZ A;  3OPP A;  2WKE A;  4P6B A;  3TG9 A;  1H5X A;  1HVB A;  1S0W A;  1YLZ A;  2EX8 A;  4QD4 A;  1Y54 A;  1EWZ A;  3C4P A;  1I2S A;  3WS5 A;  3M6B A;  4HES A;  2DNS A;  1EI5 A;  2Y55 A;  4N1H A;  1U60 A;  2IWC A;  3ZVW A;  1QME A;  1SHV A;  3HLD A;  1LI9 A;  1FCM A;  3BYD A;  3G30 A;  4EBN A;  4OH0 A;  3IXD A;  3HLW A;  3TOI A;  4QU3 A;  4Y7P A;  2HP9 A;  4E3N A;  1TDL A;  1MWS A;  2EFX A;  3ISG A;  4S2N C;  5A90 A;  2Y4A A;  4YFM A;  1K54 C;  4GN2 A;  2ZQ8 A;  3SS3 A;  3UE1 A;  4DE1 A;  3DWK A;  5HW3 A;  1E3U A;  3UPP A;  1YLP A;  1ESI A;  2VGK A;  4KQR A;  1L0G A;  1FSY A;  2Y2J A;  2R9W A;  3ZDJ A;  2PU4 A;  5AQB A;  1JWZ A;  3V50 A;  3VMA A;  4PM9 A;  5J8X A;  5EVI C;  3VFH A;  2Y2I A;  5U47 A;  1PI5 A;  5DF7 A;  4R4S A;  4K0W A;  2ZM8 A;  1XXM A;  1KGF A;  2PU2 A;  4X53 A;  5CTN A;  2UWX A;  3B3X A;  3MZD A;  1BLH A;  4KZ6 A;  3EQU A;  2WZZ A;  4R3J A;  1PIO A;  3IT9 A;  1MY8 A;  1MKI A;  4DDY A;  4OQG A;  5GHY A;  1YMX A;  4KZA A;  1I5Q A;  3HL9 A;  1IKG A;  2JBF A;  3GVB A;  2ZLY A;  3G34 A;  4JLF A;  5AQ7 A;  3WWX A;  4R23 A;  2V2F F;  5CED A;  2Y2N A;  2WAD A;  3DWZ A;  5E2E A;  3D4F A;  3VOZ A;  1GCE A;  5KZH A;  4OP8 A;  3MKE A;  3Q1F A;  1E25 A;  4OOL A;  1YLT A;  2Q9N A;  3MFD A;  1IEM A;  3OCL A;  4FD8 A;  4GOG A;  1IKI A;  3Q7V B;  5F1G A;  5GLB A;  1WYC A;  2Y2P A;  2ZC5 B;  4UA9 A;  2HDU A;  3RXX A;  4QY5 A;  1MXO A;  1ALQ A;  3OZH A;  1BTL A;  5EUA A;  1PWC A;  3FYZ A;  3ZNY A;  3MXS A;  3PTE A;  2ZD8 A;  3O88 A;  5FAO A;  4JPM A;  4BL3 A;  5CTM A;  3G4P A;  3WRT A;  5DVA A;  1XKZ A;  2ZQC A;  1YLW A;  4OLG A;  1S6R A;  1JTG A;  2EX6 A;  4HBU A;  2HDR A;  1BLC A;  3FWL A;  5M19 A;  2JCH A;  2ZJ9 A;  3FKV A;  1K56 D;  2OLU A;  2ZQD A;  3A3J A;  3IH9 A;  4OQI A;  3C5A A;  3SH8 A;  3SH7 A;  3UE3 A;  4E6W A;  3AGD A;  4S2O A;  2I72 A;  3M6H A;  3ZFZ A;  4OPR A;  1GA0 A;  2WGW A;  1N9B A;  1NJ4 A;  5IHV A;  5TGF A;  5GHX A;  3AGE A;  1K56 A;  4K0X A;  2X02 A;  4U3T A;  2DCF A;  4BQM A;  3A3E A;  4N1X A;  4LCL A;  1M6K A;  4S2K A;  5EVI B;  3PAE A;  4FCF A;  2C5W B;  3OPH A;  5HAI A;  4RX3 A;  3VP3 A;  3GTC A;  1JTD A;  4GDB A;  2BLS A;  3N8L A;  3Q82 A;  4UAA A;  4Q8I A;  2BG1 A;  4DE2 A;  1PWG A;  4JF4 A;  1PW1 A;  3QNB A;  4P0M A;  4WZ5 A;  3NDG A;  1ES4 A;  3IWQ A;  4N9K A;  5GLA A;  3NC8 A;  1KGG A;  1H8Z A;  2FFY A;  5L2F A;  3IXB A;  4X55 A;  3HLF A;  3S1Y A;  3DW0 A;  1AXB A;  4KZ8 A;  4LV3 A;  4BJP A;  3ZG8 B;  3IH8 A;  1RGZ A;  1N4O A;  1ES3 A;  2FFF B;  5TR7 A;  3UN7 A;  4KG5 A;  4N9L A;  2WZX A;  4MEZ A;  3BRM A;  2CC1 A;  4X69 A;  3LY4 A;  1BLS A;  2A3U A;  1K38 A;  2V1Z A;  2Y2Q A;  4FH2 A;  3VP4 A;  1O7E A;  2R9X A;  1J9M A;  3W4O A;  3HBR A;  1G68 A;  5G18 A;  4JF5 A;  1MWU A;  3IXH A;  1CK3 A;  2ZQA A;  4DDS A;  4MBK A;  1KVM A;  2WKH A;  1K55 A;  3HLE A;  4LV2 A;  2HDS A;  3W4Q A;  4Y0O A;  4KZ5 A;  2VGJ A;  3JYI A;  1K57 A;  3ZG5 A;  1BUL A;  3IF6 A;  4ZBE A;  1XPB A;  3OPL A;  2XFS A;  1SCW A;  4WMC D;  1YLJ A;  1DJC A;  3C7U A;  3LCE A;  4QB8 A;  1H8Y A;  2JE5 A;  4S2L A;  5HAR A;  3N6I A;  5FQ9 A;  5HAQ A;  1KDS A;  4OON A;  3W4P A;  3PAG A;  3QHY A;  2P74 A;  4KZ4 A;  5BOH A;  2Q9M A;  5HFO A;  2Y2L A;  4PPR A;  1LI0 A;  4RA7 A;  4XUZ A;  3LEZ A;  3HLG A;  2J9P A;  4KZB A;  3PBO A;  1IYP A;  1BLP A;  3VOY A;  2G2U A;  3MKF A;  3NY4 A;  5DTK A;  4XXR A;  4LEN A;  4OVD A;  4EQI A;  4UHU A;  4RVA A;  3NIA A;  1PW8 A;  3G35 A;  3A3F A;  4EUZ A;  1L0D A;  2XEP A;  1FR1 A;  4ID4 A;  1KVL A;  4JF6 A;  2J7V A;  1QMF A;  3V39 A;  1NYY A;  5E2H A;  2WAE A;  3IXG A;  4S2J A;  4WEK A;  1LLB A;  3S4X A;  4NET A;  4OKP A;  4N92 A;  4IBR A;  2ZQ9 A;  1NXY A;  1ERM A;  4KZ7 A;  4MLL A;  4EV4 A;  5AQ9 A;  4JXW A;  3AGF A;  5FSR A;  4E3M A;  1FR6 A;  4QHC A;  3UY6 A;  5F1F A;  3QNC A;  1NZO A;  1ZC2 A;  3SS4 A;  4KQO A;  4K91 A;  3EQV A;  3W8K A;  3E2L A;  2B5R A;  1K4E A;  5CHM A;  4C6Y A;  3UPN A;  1O07 A;  4DE0 A;  2WGI A;  2P9V B;  3VSL A;  3BEC A;  3Q07 A;  3ZG9 B;  1XGI A;  1LL5 A;  2X71 A;  4HEF A;  4X68 A;  3WS4 A;  2Y91 A;  5FA7 A;  1K57 C;  5EVL A;  3IF6 C;  4ZJ3 A;  1SDN A;  3GMW A;  5CER A;  1SKF A;  1C3B A;  3NDE A;  1ONH A;  3GSG A;  2IWD A;  4L0L A;  3BM6 A;  3ZGA B;  4E6X A;  1JWV A;  4BD0 A;  2PBY A;  2WGW B;  3OPR A;  2DRW A;  5FQM A;  1BUE A;  4OOM A;  4YIN A;  3N7W A;  5FQI A;  4BL2 A;  2XK1 A;  5A93 A;  4U0X A;  5KMW A;  2GDN A;  1IYS A;  3N8S A;  1BSG A;  5EE8 A;  5GHZ A;  1ERO A;  1NZU A;  4ZDX A;  1XP4 A;  1FQG A;  1HZO A;  3OC2 A;  4BLM A;  5FAT A;  1CI8 A;  1FCN A;  2A49 A;  5HX9 A;  1PI4 A;  3VP2 A;  5GLC A;  5CXW A;  3BFC A;  4D2O A;  4ZJ2 A;  1FOF A;  4PM7 A;  4B4Z A;  1W7F A;  2Y2K A;  3GR2 A;  4OLD A;  2EX9 A;  5CGS A;  3ZNT A;  5KSC A;  1RCJ A;  4JKT A;  1WE4 A;  3O3V A;  3BLS A;  2XD5 A;  4R1G A;  1ERQ A;  5FQQ A;  4ZJ1 A;  4X56 A;  2EXA A;  3N4I A;  5CRF A;  2WKI A;  3G32 A;  2IWB A;  4GD8 A;  4OQ0 A;  3CJM A;  4PMA A;  1DJA A;  3NI9 A;  4OOY A;  5CEB A;  4M3K A;  4UA6 A;  3GRJ A;  3P09 A;  5FAQ A;  5GL9 A;  4OQH A;  5EOO A;  4BD1 A;  1ZKJ A;  4LV0 A;  3C7V A;  3LY3 A;  1YLY A;  2Y2H A;  5I94 A;  1XGJ A;  2HDQ A;  2XFT A;  5JYP A;  3VFF A;  1GHI A;  1E4D A;  2G2W A;  1YM1 A;  3BFG A;  4E3I A;  3HRE A;  4C75 A;  5EVI D;  3IF6 B;  2J9O A;  4HBT A;  2XD1 A;  4R0Q A;  3VP0 A;  4JXS A;  1K54 A;  2Y2M A;  4MBH A;  3OCN A;  1FSW A;  5FAP A;  4P87 A;  1L2S A;  1SDE A;  4OP5 A;  2WUQ A;  1ES5 A;  2Y2O A;  2HP6 A;  4S2P A;  5GLD A;  2XGN A;  2QZ6 A;  1RP5 A;  2E8I A;  2H0T A;  4KG6 A;  3IWI A;  2OLV A;  3IF5 A;  3SS5 A;  1Q2P A;  2EFU A;  2JC7 A;  5EVI A;  1VM1 A;  2ZC7 A;  3BLM A;  5KSH A;  3SH9 A;  1M40 A;  1K4F A;  2ZM2 A;  3G2Y A;  4OPZ A;  5E2F A;  1XA1 A;  3ITB A;  1CI9 A;  4PM5 A;  2Y59 A;  3CG5 A;  4EWF A;  3C4O A;  2ZQ7 A;  1HTZ A;  1KE0 A;  4P85 A;  4DKI A;  3M2K A;  2ZC6 B;  4WEL A;  3WS2 A;  4CPK A;  1TDG A;  3FZC A;  4JXV A;  1CEG A;  3PBT A;  3MXR A;  3HLB A;  1GHM A;  3IWO A;  4KQQ A;  4WYY A;  3ZVT A;  3WS0 A;  5CGW A;  4B4X A;  3NCK A;  4E3K A;  4WMC A;  5CEC A;  2J8Y A;  4WZ5 C;  3HVF A;  3BFD A;  1PZO A;  1TEM A;  3UDF A;  5FAS A;  1MWT A;  3HUO A;  1GHP A;  4KG2 A;  4MNR A;  1LHY A;  1WYB A;  1ZG4 A;  4FH4 A;  3RXW A;  2WAF A;  1YT4 A;  5E2G A;  3IHA A;  5FI7 A;  1I2W A;  1E3U D;  1IEL A;  4O7D A;  1Q2Q A;  1L0E A;  1W5D A;  4WBG A;  3ZG0 A;  4R3B A;  1OME A;  2EX2 A;  4DE3 A;  4EBL A;  3FV7 A;  3HLC A;  1XX2 A;  3HUM A;  5FI6 A;  1DJB A;  1ES2 A;  5A91 A;  2ZM0 A;  4LCM A;  2XR0 A;  2XF3 A;  4DXB A;  4RYE A;  3GV9 A;  3IHB A;  1KGE A;  3UE0 A;  4S2M A;  3RJU A;  2V20 A;  4U0T A;  1JVJ A;  5M1A A;  1G6A A;  3Q7Z A;  4ZTK A;  1KE4 A;  4DF6 A;  3UDI A;  1K55 C;  4C3Q A;  5E43 A;  2OV5 A;  4DXC A;  5CGX A;  3DTM A;  3VP1 A;  5HL1 A;  2QMI A;  2WK0 A;  3MZE A;  2OSU A;  3GQZ A;  4Y0T A;  5M18 A;  3I7J A;  2Z2L B;  3ZCZ A;  4WM9 A;  2ZC3 B;  4Z9Q A;  4IBX A;  1FCO A;  4KZ9 A;  4F94 A;  5A92 A;  1NRF A;  3MBZ A;  1PYY A;  4RX2 A;  3BEB A;  5FI2 A;  4DRT A;  3UDX A;  4PM6 A;  3O86 A;  1W8Y A;  3BFE A;  1ESU A;  1YQS A;  3NBL A;  1CEF A;  3PBN A;  4IVK A;  1JWP A;  1LL9 A;  3V3S A;  1IYO A;  5D3O A;  4Y0U A;  1BZA A;  3N8R A;  4KEN B;  1L0F A;  5JYO A;  3M2J A;  1BT5 A;  4JXG A;  4E3J A;  1MPL A;  4WZ4 A;  2P9V A;  4A5R A;  3V5M A;  4FSF A;  2H10 A;  2HPB A;  5DF9 A;  4XUX A;  5HAP A;  3CMZ A;  3CZD A;  2ZC4 B;  4E3O A;  1W79 A;  3Q7V A;  4MBF A;  5FDH A;  2X01 A;  5EEC A;  4GZB A;  3A3I A;  4EBP A;  2Z2M B;  4GD6 A;  2XH9 A;  5DTS A;  1ZG6 A;  1ONG A;  4QJG A;  3PBS A;  2C6W B;  1MBL A;  2RCX A;  4GDN A;  5FQJ A;  5EPH A;  2H5S A;  4X6T A;  5FQK A; 
#chains in the Genus database with same CATH topology
 1S4R A;  3K3D A;  1MWR A;  3A0R A;  1RGY A;  3SOI A;  1ODV A;  1P0Z A;  5CHU A;  4BBU A;  3PYP A;  4FUW A;  1K6R A;  4EQ1 A;  4IVI A;  3O87 A;  4MN7 A;  4S2N A;  1YKD A;  4I38 A;  2Y2G A;  2D02 A;  2ZOI A;  4EXO A;  4HOI A;  4GB7 A;  4UA7 A;  3RH8 B;  3ITA A;  1XFQ A;  2RL3 A;  4WEJ A;  4WN5 A;  2XDM A;  4KZ3 A;  3G31 A;  3T4K A;  5AQA A;  4OPQ A;  5TFQ A;  2BAS A;  1K25 A;  1VEU A;  3OPP A;  1XJ3 A;  1S0W A;  5HD5 A;  1Y54 A;  4FTX A;  1EWZ A;  1I2S A;  4XT2 A;  2Y55 A;  2W1R A;  1QME A;  3HLD A;  1LI9 A;  3BYD A;  4EBN A;  4OH0 A;  4Y7P A;  2R78 A;  1MWS A;  5AVF A;  2Y4A A;  1SKO B;  4GN2 A;  4HHD A;  3MF0 A;  3UPP A;  1YLP A;  5HSQ A;  3VMA A;  3VFH A;  4ETX A;  3VOL A;  5DF7 A;  3TW8 A;  1KGF A;  4X53 A;  5CTN A;  2UWX A;  1GSX A;  4DDY A;  1LT0 A;  5GHY A;  1I5Q A;  2FZ0 A;  5AQ7 A;  2XRN A;  3G34 A;  3MQQ A;  2QWS A;  3VOZ A;  4OP8 A;  3Q1F A;  1E25 A;  4GOG A;  5F1G A;  1IKI A;  1WYC A;  2Y2P A;  4G3W A;  4WLA A;  2HDU A;  4IUK A;  2PDR A;  4BL3 A;  2ZD8 A;  3D9Y A;  1XKZ A;  1T1B A;  1OTI A;  4HBU A;  2HDR A;  1BLC A;  3FKV A;  1K56 D;  4R70 A;  3SH8 A;  4E6W A;  4OPR A;  1N9B A;  5IHV A;  5F6A A;  3QP4 A;  1Y28 A;  2X02 A;  2DCF A;  4BQM A;  4N1X A;  4LCL A;  1M6K A;  2Z6C A;  1JTD A;  4DE2 A;  5TBM B;  4JF4 A;  1AWI A;  3QNB A;  4WZ5 A;  3KO6 A;  4L9F A;  3OOV A;  1Y4O A;  1H8Z A;  3IXB A;  4KZ8 A;  4LV3 A;  4BJP A;  2VK3 A;  1RGZ A;  5TR7 A;  5DJU A;  4N9L A;  2WZX A;  3BRM A;  4XT2 B;  4LFU A;  2A3U A;  3LEQ A;  1K38 A;  1O7E A;  3DTI A;  2D01 A;  2ZQA A;  4MBK A;  3OBF A;  4Y0O A;  3LIA A;  3KSG A;  3OPL A;  3C7U A;  4QB8 A;  2JE5 A;  5HAR A;  3N6I A;  5HAQ A;  1KDS A;  2ZMF A;  4BMW A;  4OON A;  1N9L A;  2P74 A;  1CJF A;  2Y2L A;  3HLG A;  4KZB A;  2W27 A;  1IYP A;  3T4T A;  3NY4 A;  2W3E A;  4OVD A;  2J3W A;  3NIA A;  1TD5 A;  1FR1 A;  4Z1W A;  1F98 A;  1NYY A;  5E2H A;  4WEK A;  1LLB A;  3LIE A;  2K7S A;  5HPF A;  4HH3 A;  1ERM A;  3D3O A;  5FDS A;  5FSR A;  2O9C A;  4EEU A;  1FR6 A;  4QHC A;  5F1F A;  4KQO A;  4NXF A;  1PFL A;  3EQV A;  2B5R A;  2KOI A;  3O5Y A;  1XJ4 A;  4DE0 A;  2W3F A;  2WGI A;  3LIC A;  3VSL A;  4LRX C;  4NXG A;  3BEC A;  4HEF A;  2Y91 A;  5FA7 A;  2W3G A;  5EVL A;  4ZJ3 A;  3GMW A;  5CER A;  1PRQ A;  3UMD A;  3NDE A;  2VKS A;  3GSG A;  3ZGA B;  1JWV A;  4ETZ A;  4BD0 A;  2YKF A;  3OPR A;  1BUE A;  4MMN A;  5FQI A;  3N7W A;  2XK1 A;  2GDN A;  1BSG A;  4LRY C;  2M7U A;  5EE8 A;  2A24 A;  3C2W A;  1NZU A;  1XP4 A;  1FQG A;  4BLM A;  1T18 A;  5K5B A;  3VP2 A;  5AJG A;  3BFC A;  4D2O A;  4ZJ2 A;  4PM7 A;  2EX9 A;  4I3I A;  3BLS A;  1OJG A;  4UQI S;  1P9W A;  4GD8 A;  4EER A;  4HI4 A;  4M3K A;  4BD1 A;  3UB9 A;  4HQA A;  1ZTU A;  4RQ9 A;  2Y2H A;  3T50 A;  2HDQ A;  2XFT A;  1XFN A;  3SZT A;  2O9B A;  1YM1 A;  4C75 A;  4EET B;  3KSI A;  4HBT A;  2XD1 A;  1K54 A;  4MBH A;  4CLC C;  4YWZ A;  1XJ2 A;  5GLD A;  2XGN A;  1RP5 A;  3IWI A;  2OLV A;  3VE4 A;  3CPT A;  5EVI A;  3FPW A;  4OPZ A;  1XA1 A;  4PM5 A;  3R4K A;  4Y13 A;  1MKM A;  4EWF A;  1ZHH B;  4KUO A;  3RFB A;  3M2K A;  2ZC6 B;  2WKR A;  4MN5 A;  1N9N A;  3IBJ A;  3HLB A;  3JPU A;  4B4X A;  4ZRR A;  1S4S A;  3UDF A;  1GHP A;  3RXW A;  1YT4 A;  2PD7 A;  2OAP 1;  1VHM A;  1IEL A;  4O7D A;  1L0E A;  3ZG0 A;  5HDC A;  1OME A;  3CI6 A;  1XX2 A;  3U2A A;  2V8C A;  3QP8 A;  2XF3 A;  4DXB A;  1KGE A;  3H82 B;  4S2M A;  3UB6 A;  2V20 A;  1JVJ A;  1Z09 A;  1KE4 A;  1V9Z A;  4DF6 A;  1K55 C;  2Y8H A;  4C3Q A;  5E43 A;  5HWT A;  2QMI A;  4E04 A;  1DP8 A;  2NUP C;  4L9G A;  1X0O A;  5A92 A;  1NRF A;  3MBZ A;  3O86 A;  1J3W A;  1LSV A;  3RTY A;  1ESU A;  4X1L A;  2VV7 A;  3PBN A;  1LL9 A;  4Y0U A;  2OOL A;  4GS9 B;  4BBV A;  3N8R A;  4KEN B;  4B93 A;  1L0F A;  3M2J A;  1BT5 A;  4IJG A;  2H10 A;  4XUX A;  5HAP A;  2HGV A;  4G3V A;  4QJG A;  3PBS A;  4GDN A;  3F1N A;  3CUE A;  5EPH A;  2H5S A;  1P97 A;  5FQK A;  2JKF A;  3NOP C;  4E3L A;  3LIF A;  4DMZ A;  4I39 A;  3CPT B;  3R7W A;  3U4L P;  3MZF A;  5HWW A;  3NHQ A;  5CX7 A;  3V3R A;  1IFQ A;  4CLC E;  4H8R A;  4CJN A;  1BYW A;  3ZG7 B;  3BFF A;  3UPO A;  4PM8 A;  2PAV P;  3E2K A;  3LYX A;  3IX4 A;  2WYX A;  5F83 A;  1Z6F A;  2Y79 A;  1N9O A;  2UV0 E;  3LO7 A;  3T1R A;  1KDW A;  3WS1 A;  4QY6 A;  3KX0 X;  4OPY A;  2XLN A;  3LUQ A;  2V9A A;  1G6O A;  4GNU A;  3S22 A;  1HVB A;  1YLZ A;  4QD4 A;  2JHE A;  3F1P B;  3M6B A;  4HES A;  1U60 A;  3ZVW A;  3LR3 A;  3OLO A;  2K2N A;  3IX3 A;  3HLW A;  4QU3 A;  2HP9 A;  5G4Y A;  4S2N C;  5IT5 A;  4UQI M;  3MS6 A;  3NJA A;  4DE1 A;  4GLQ A;  4KQR A;  1L0G A;  3VE3 A;  2Y2J A;  5AQB A;  4PM9 A;  2QJ7 A;  1XXM A;  2PU2 A;  4HNB A;  3UB5 P;  4Y2F A;  3B3X A;  1BLH A;  2PRF A;  1PNE A;  5I5L A;  2VX8 A;  1YMX A;  4KZA A;  2JBF A;  3WWX A;  3D4F A;  4OOL A;  4BBT A;  3EGD C;  1IEM A;  3OCL A;  4FD8 A;  1OTA A;  2ZC5 B;  4QY5 A;  1YPR A;  1MXO A;  3OZH A;  3FYZ A;  2KLI A;  3ZNY A;  5EM1 A;  3F1N B;  4JPM A;  1TS0 A;  5DVA A;  4OLG A;  1S6R A;  3LI9 A;  1F2K A;  2JCH A;  2ZJ9 A;  3E4P A;  3R7W B;  2OLU A;  4OQI A;  3C5A A;  3SH7 A;  2JKT I;  3AGD A;  3ZFZ A;  4I3J A;  3AGE A;  4D60 A;  1W63 Q;  4Q0H A;  1CF0 A;  2C5W B;  3OPH A;  4O8G A;  5HAI A;  4GDB A;  4M4X A;  2BG1 A;  1PW1 A;  4P6Z S;  4P0M A;  1FIK A;  5L2F A;  3DW0 A;  2EWW A;  4DN0 A;  3B33 A;  4PAU A;  3IH8 A;  2FFF B;  4ME4 A;  3UN7 A;  4MEZ A;  4KQD A;  4BWI A;  3LY4 A;  1BLS A;  3UE6 A;  5EFW A;  2R9X A;  2Z6D A;  3HBR A;  2VLG A;  4JF5 A;  1MWU A;  4DDS A;  1KVM A;  2HDS A;  3JYI A;  1K57 A;  4ZBE A;  1XPB A;  1H8Y A;  2J3T D;  3PAG A;  3QHY A;  4L9E A;  5BOH A;  2Q9M A;  4RA7 A;  3LEZ A;  2J9P A;  3PBO A;  1LSX A;  1A0K A;  1H8M A;  3G35 A;  3A3F A;  5AVE A;  1L0D A;  4HY8 A;  4GJ4 A;  2XA7 M;  5HDS A;  3MR0 A;  2WAE A;  3IXG A;  3S4X A;  4OKP A;  4N92 A;  3KYZ A;  2ZQ9 A;  1NXY A;  4EV4 A;  4JXW A;  4E3M A;  1ZC2 A;  3LI8 A;  3W8K A;  3E2L A;  1O07 A;  3Q07 A;  1LL5 A;  4X68 A;  3WS4 A;  2JN7 A;  5L8M A;  1C3B A;  3S7P A;  2IWD A;  3BM6 A;  2PBY A;  1W63 M;  2DRW A;  4YIN A;  2J3T C;  5GHZ A;  3LR0 A;  4ZDX A;  3OC2 A;  3KYQ A;  3DBA A;  5FAT A;  1CI8 A;  2A49 A;  5J4E A;  5CXW A;  1FOF A;  4B4Z A;  5CGS A;  3GR2 A;  3ZNT A;  3O3V A;  4R1G A;  2EXA A;  3N4I A;  5CRF A;  2WKI A;  4JGR A;  3QP1 A;  5CEB A;  4PMA A;  1DJA A;  3NI9 A;  2W1T A;  3GRJ A;  4UA6 A;  5EOO A;  4LV0 A;  2HZ5 A;  2HJE A;  1VEU B;  2G2W A;  2JKR M;  5EVI D;  4R0Q A;  3VP0 A;  5FAP A;  4Y3I A;  2HP6 A;  2QZ6 A;  1S1Z A;  1Q2P A;  5L10 A;  2JC7 A;  5LBR A;  3T1S A;  5E2F A;  2ZM2 A;  3ITB A;  1CI9 A;  4HJ4 A;  3CG5 A;  4JGQ A;  5HL6 A;  3WS2 A;  4I3A A;  3PBT A;  3LIB A;  3IWO A;  2P04 A;  4E3K A;  3WS0 A;  5CEC A;  3IBR A;  1TEM A;  1LHY A;  4FH4 A;  1I2W A;  1E3U D;  1Q2Q A;  3MQO A;  4MDZ A;  3BQA A;  1JNU A;  4DE3 A;  4EBL A;  2K31 A;  1ES2 A;  2ZM0 A;  4LCM A;  2HV1 A;  1G6A A;  3Q7Z A;  4Q0I A;  4P6Z M;  2ZOH A;  3UDI A;  4DXC A;  4NG2 A;  2ZMV A;  3MZE A;  2OSU A;  1YSP A;  4HJ3 A;  5M18 A;  3I7J A;  2OAQ 1;  2Z2L B;  3S7N A;  3ZCZ A;  4RX2 A;  2W3D A;  1W8Y A;  3BFE A;  4IVK A;  5FEG A;  1IYO A;  5JYO A;  4Y15 A;  4JXG A;  2W1T B;  3E0Y A;  3SW1 A;  1MPL A;  2Q0O A;  4WZ4 A;  2P9V A;  3BJN A;  4FSF A;  1ACF A;  3CMZ A;  4E3O A;  2LB9 A;  4MBF A;  3H9W A;  4GZB A;  4NEE D;  4EBP A;  3UB8 A;  4LLO B;  2B95 A;  4GD6 A;  4DJ3 A;  2PBD P;  1ZG6 A;  2GJ3 A;  2C6W B;  1MBL A;  2RCX A;  3PHY A;  1NY0 A;  1G28 A;  3HUN A;  5EOE A;  3VV4 A;  2QPN A;  5DF8 A;  5F82 A;  3UME A;  3UNW A;  3A3D A;  3F1O A;  4G3K A;  5EV0 A;  4S2I A;  3VSK A;  4B88 A;  3IQA A;  1TVF A;  2P08 A;  5CHJ A;  5DTT A;  3TSG A;  1NLY A;  4JBF A;  3WRZ A;  3NEC A;  1NYM A;  2H0Y A;  1T1A A;  2WGV A;  1XA7 A;  3K3C A;  5MC7 A;  1DRM A;  1HLU P;  3PBR A;  1OPX A;  1OTE A;  2V0U A;  3E98 A;  2ZBB A;  2XQZ A;  4P6B A;  1H5X A;  2EX8 A;  3LR5 A;  1D06 A;  5HZH A;  2DNS A;  3CUE C;  2V0W A;  2IWC A;  1SHV A;  3MFX A;  4O01 A;  1FCM A;  4LGW A;  4ARZ A;  3T1X A;  4X25 A;  2EFX A;  5A90 A;  4YFM A;  3HJK A;  2I9V A;  2ZQ8 A;  3SS3 A;  2JKG A;  1E3U A;  2VZW A;  3ZDJ A;  3V50 A;  2V1A A;  5J8X A;  3CLO A;  2Y2I A;  2O99 A;  4K0W A;  1OT9 A;  3BY8 A;  3MZD A;  4KZ6 A;  2A24 B;  3EQU A;  4R3J A;  2PD8 A;  3IT9 A;  1MKI A;  2O0Y A;  4OQG A;  4NXE A;  4WL9 A;  1S1Y A;  3EOI A;  2QHK A;  1IKG A;  3GVB A;  2ZLY A;  4JLF A;  4R23 A;  5CED A;  5DFX A;  5E2E A;  4PHT A;  5KZH A;  2Q9N A;  3MFD A;  1WA9 A;  4UA9 A;  3RXX A;  1OTB A;  1BTL A;  5EUA A;  1PWC A;  3O88 A;  5FAO A;  3G4P A;  3WRT A;  5DJT A;  2ZQC A;  2PHY A;  1JTG A;  3GEC A;  2VGL M;  4CLC A;  2QYB A;  2ZQD A;  3IH9 A;  4S2O A;  2I72 A;  2XA7 S;  3F1O B;  1GA0 A;  2WGW A;  4GHI A;  3P7N A;  1NJ4 A;  5TGF A;  4EW7 A;  4U3T A;  3A3E A;  5EVI B;  4FCF A;  4RX3 A;  3VP3 A;  3N8L A;  3Q82 A;  4UAA A;  4Q8I A;  1PWG A;  3TRC A;  1ES4 A;  5GLA A;  3NC8 A;  1KGG A;  3S1Y A;  1AXB A;  1GSW A;  2FH5 A;  3ZG8 B;  4X1M A;  1N4O A;  1ES3 A;  3QP2 A;  4KG5 A;  2CMN A;  5F5Y A;  2CC1 A;  2A2L A;  4X69 A;  3EEA A;  3T4Q A;  1UGU A;  2V1Z A;  2Y2Q A;  4FH2 A;  5G18 A;  1CK3 A;  2WKH A;  1K55 A;  3HLE A;  1VB6 A;  4LV2 A;  3W4Q A;  3NUL A;  4KZ5 A;  2VGJ A;  4H6J A;  1BUL A;  3IF6 A;  2XFS A;  1SCW A;  3T1Q B;  4LPZ A;  4KZ4 A;  5HFO A;  4PPR A;  4XUZ A;  1BLP A;  3VOY A;  2G2U A;  3MKF A;  1DP6 A;  4LEN A;  2V8F A;  1LL8 A;  2VV6 A;  4EQI A;  4UHU A;  2M1C A;  4PKY A;  4ID4 A;  2J7V A;  2B02 A;  4IBR A;  3E4O A;  4IHQ A;  5TJJ A;  4MLL A;  5AQ9 A;  3UY6 A;  1NZO A;  1K4E A;  5CHM A;  4C6Y A;  1TS7 A;  2M7V A;  5EM0 A;  5L07 A;  3T12 B;  3ZG9 B;  1XGI A;  2X71 A;  4B9O A;  1K57 C;  2IA2 A;  1SDN A;  1MC0 A;  1SKF A;  3CWF A;  4CLC B;  2HJ9 C;  1L3L A;  3NOU C;  4L0L A;  2WGW B;  4GHI B;  4BL2 A;  5A93 A;  4U0X A;  5KMW A;  1IYS A;  3N8S A;  1ERO A;  2ZL1 A;  1HZO A;  3L7H A;  3IS2 A;  3EGX C;  3BQ8 A;  1FCN A;  5HX9 A;  1PI4 A;  3FG8 A;  1UWP X;  2Y2K A;  4OLD A;  3IX8 A;  1RCJ A;  1D7E A;  4JKT A;  2XD5 A;  5FQQ A;  2W0N A;  4ZJ1 A;  5FEF A;  2GZA A;  3G32 A;  2IWB A;  4OQ0 A;  4OOY A;  1VET A;  3E4Q A;  3L9K A;  5FAQ A;  5GL9 A;  4GCZ A;  4DJ2 A;  4AFI A;  1XGJ A;  3PR6 A;  1XJ6 A;  5JYP A;  3PXP A;  3CHW P;  2DMW A;  4H6J B;  3KSF A;  3IF6 B;  2J9O A;  3OCN A;  5G4Z A;  1P9R A;  4OP5 A;  2WUQ A;  1ES5 A;  2PYR A;  2B18 A;  4KG6 A;  2E8I A;  3SS5 A;  2G7U A;  3IF5 A;  4MCW A;  3CIT A;  1VM1 A;  2ZC7 A;  3S7O A;  4HH2 A;  3SH9 A;  1M40 A;  1K4F A;  2OWJ A;  3G2Y A;  3QP5 A;  5TBM A;  1H3Q A;  5L09 A;  2ZQ7 A;  4P85 A;  1KE0 A;  4WEL A;  1TDG A;  1CEG A;  3MXR A;  3NCK A;  5IU1 A;  4UEY A;  2V1B A;  3ZYT A;  4WZ5 C;  5DKL A;  1PZO A;  3GDI A;  4KG2 A;  1WYB A;  2WAF A;  4Y5F A;  3TE8 A;  4WBG A;  2EX2 A;  2AVX A;  2XSS A;  3FV7 A;  5FI6 A;  1DJB A;  5A91 A;  2XR0 A;  3ULF A;  2YKH A;  3GV9 A;  1TS6 A;  3RJU A;  4U0T A;  5HPI A;  1OT6 A;  1STZ A;  3H7W A;  4FOF A;  2OV5 A;  3CAX A;  5HL1 A;  3T4L A;  4Y0T A;  5IS1 A;  3LR4 A;  4WM9 A;  4JGP A;  2ZC3 B;  2ZL1 B;  4F94 A;  3IS2 B;  3BEB A;  2L0W A;  3UDX A;  1MZU A;  3NBL A;  1CEF A;  5DFY A;  1LSW A;  1JWP A;  4QWO A;  3V3S A;  2WKP A;  1BZA A;  1VET B;  4E3J A;  2HPB A;  5DF9 A;  3CZD A;  2ZC4 B;  3Q7V A;  3C30 A;  5EEC A;  3A3I A;  2Z2M B;  1KOU A;  2XH9 A;  1S66 L;  2PT7 A;  5FQJ A;  3Q81 A;  1IYQ A;  1GA9 A;  1HD8 A;  2EXB A;  3DTK A;  4ZAM A;  5HDD A;  4IED A;  4LV1 A;  2HP5 A;  3UO9 A;  1D1J A;  1PZP A;  4R4R A;  4BEN A;  1NWZ A;  1YMS A;  3ZHH A;  1K6S A;  3JVV A;  3P98 A;  3BW6 A;  3G2Z A;  1PWD A;  3ZQ5 A;  1KE3 A;  3FKW A;  1VQQ A;  1DY6 A;  3PBQ A;  2ZMA A;  4NK3 A;  2J80 A;  4GKU A;  1W8Q A;  2VGL S;  2WKE A;  3TG9 A;  3C4P A;  3WS5 A;  1EI5 A;  1OTD A;  3B42 A;  4N1H A;  1NRJ A;  2MJ6 A;  3G30 A;  3IXD A;  4II7 A;  3TOI A;  4E3N A;  3H7W B;  1TDL A;  3ISG A;  3G6O A;  2L4R A;  3MMH A;  1K54 C;  3UE1 A;  5HW3 A;  3DWK A;  4KUK A;  1ESI A;  2VGK A;  1FSY A;  2R9W A;  2PU4 A;  1JWZ A;  5EVI C;  5U47 A;  1PI5 A;  4R4S A;  2ZM8 A;  3LID A;  1YAX A;  2WZZ A;  1PIO A;  2JKT M;  1MY8 A;  3HL9 A;  3T4J A;  5C5K A;  2V2F F;  2Y2N A;  2WAD A;  3DWZ A;  1GCE A;  3MKE A;  4GW9 A;  1YLT A;  3LGO A;  4CQH A;  3A0S A;  3Q7V B;  5GLB A;  4YOF A;  4F3L A;  4WUJ A;  1ALQ A;  4CLC D;  3H82 A;  1K0K A;  3MXS A;  3PTE A;  1UWN X;  5CTM A;  1YLW A;  3W2Z A;  2EX6 A;  3FWL A;  5M19 A;  3JVU A;  2VA0 A;  3A3J A;  3UE3 A;  2XRO A;  3M6H A;  5GHX A;  1K56 A;  3FPV A;  4K0X A;  4S2K A;  3PAE A;  3GTC A;  4GS9 A;  2BLS A;  2L1M A;  4R38 A;  4QPR A;  3NDG A;  3IWQ A;  4N9K A;  2FFY A;  4X55 A;  3HLF A;  3MSH A;  1FIL A;  1NLZ A;  3C38 A;  4HJ6 A;  2E8J A;  1TF1 A;  2QJ5 A;  3VP4 A;  3W4O A;  1J9M A;  1G68 A;  3HCY A;  3IXH A;  3ZG5 A;  2KDK A;  4WMC D;  1YLJ A;  1DJC A;  3LCE A;  4S2L A;  5FQ9 A;  2QKP A;  4NKP A;  3W4P A;  1DP9 A;  4IUH A;  3MJQ A;  3HJI A;  4R6L A;  1LI0 A;  3BWL A;  3T4S A;  5DTK A;  4XXR A;  2KX6 A;  4RVA A;  1PW8 A;  4EUZ A;  2XEP A;  1KVL A;  4JF6 A;  1QMF A;  3V39 A;  4S2J A;  4EU0 A;  4NET A;  2VV8 A;  4KZ7 A;  3F1P A;  4R3A A;  3AGF A;  4F3L B;  3QNC A;  3SS4 A;  3MQ0 A;  4K91 A;  1CQA A;  4NXB A;  3UPN A;  2P9V B;  5A8B A;  2INW A;  5KIZ A;  1F5M A;  3IF6 C;  1H0M A;  1ONH A;  1IOU A;  3S7Q A;  4E6X A;  3B47 A;  3UB7 A;  3BY9 A;  5FQM A;  4OOM A;  1V9Y A;  4HIA A;  2VEA A;  1T19 A;  3DAV A;  3C8C A;  2GX5 A;  1F9I A;  5GLC A;  2PYP A;  1YSQ A;  5EVE A;  4PKY G;  1W7F A;  5KSC A;  2ACG A;  1WE4 A;  3EWK A;  1ERQ A;  4X56 A;  2O9A A;  3CJM A;  5HD3 A;  3P09 A;  2NUT C;  4OQH A;  1ZKJ A;  3KSH A;  3C7V A;  3LY3 A;  1YLY A;  5I94 A;  2EWV A;  4LRZ E;  3VFF A;  1GHI A;  1E4D A;  5F68 A;  1TS8 A;  3BFG A;  4E3I A;  2P7J A;  3HRE A;  2HF6 A;  4HP4 A;  3V67 A;  4JXS A;  1T1C A;  2Y2M A;  1FSW A;  4YNR A;  4P87 A;  1L2S A;  1SDE A;  3NOT C;  2Y2O A;  4S2P A;  4ARZ B;  2H0T A;  3P01 A;  2EFU A;  3BLM A;  5KSH A;  4EEP A;  5J7E A;  3LFV A;  2Y59 A;  3C4O A;  1HTZ A;  4DKI A;  4K08 A;  4CPK A;  3FZC A;  4JXV A;  2EA9 A;  1GHM A;  4KQQ A;  4WYY A;  3ZVT A;  5CGW A;  3MXQ A;  2BTF P;  4WMC A;  5J3W A;  2PR5 A;  2J8Y A;  3HVF A;  3BFD A;  5FAS A;  1MWT A;  3HUO A;  5F69 A;  4WF0 A;  4MNR A;  1ZG4 A;  2JKR I;  5E2G A;  3IHA A;  2PR6 A;  5FI7 A;  4MN6 A;  3T4O A;  3DTE A;  4ESP A;  1W5D A;  4EES A;  4R3B A;  3HLC A;  3EEH A;  3D72 A;  3HUM A;  4RYE A;  3UE0 A;  3IHB A;  3A0V A;  5M1A A;  4ZTK A;  4Y17 A;  4I5S A;  1G5U A;  5CGX A;  3DTM A;  3VP1 A;  1SKO A;  2WK0 A;  1GSV A;  3GQZ A;  2VJW A;  3QP6 A;  4HP9 A;  4Z9Q A;  4IBX A;  1FCO A;  4KZ9 A;  5HWV A;  5FI2 A;  1PYY A;  3TJZ C;  4DRT A;  1EW0 A;  4O0P A;  4PM6 A;  1YQS A;  4Q0J A;  4EUV A;  4JGO A;  5D3O A;  1S67 L;  2GNX A;  3ICY A;  5FL3 A;  2LB5 A;  2OWH A;  3K2N A;  2W3H A;  1OJ5 A;  4A5R A;  3FC7 A;  3V5M A;  5DKK A;  2WKQ A;  1W79 A;  5FDH A;  2X01 A;  1SZV A;  2H28 A;  5DTS A;  1ONG A;  3KYE A;  4X6T A; 
#chains in the Genus database with same CATH homology
 1MWR A;  3Q81 A;  1NY0 A;  1RGY A;  3HUN A;  3SOI A;  4E3L A;  5CHU A;  5EOE A;  1IYQ A;  1GA9 A;  1HD8 A;  2QPN A;  5DF8 A;  5F82 A;  2EXB A;  4ZAM A;  3UNW A;  1K6R A;  4IED A;  4IVI A;  4LV1 A;  3A3D A;  2HP5 A;  3O87 A;  3UO9 A;  3MZF A;  4S2N A;  3V3R A;  3VSK A;  1PZP A;  4S2I A;  4B88 A;  4R4R A;  4BEN A;  2Y2G A;  1YMS A;  3IQA A;  1TVF A;  3ZHH A;  5CHJ A;  4H8R A;  4CJN A;  1K6S A;  3P98 A;  5DTT A;  3TSG A;  3ZG7 B;  3BFF A;  3UPO A;  4GB7 A;  4UA7 A;  4PM8 A;  3E2K A;  3G2Z A;  1PWD A;  4JBF A;  3ITA A;  3WRZ A;  2WYX A;  1KE3 A;  3FKW A;  1VQQ A;  5F83 A;  1NYM A;  2H0Y A;  1Z6F A;  2RL3 A;  1DY6 A;  3PBQ A;  4WEJ A;  2XDM A;  2WGV A;  2ZMA A;  4KZ3 A;  1XA7 A;  4NK3 A;  3LO7 A;  3G31 A;  1KDW A;  3PBR A;  5AQA A;  4OPQ A;  3WS1 A;  4QY6 A;  4GKU A;  5TFQ A;  4OPY A;  1W8Q A;  2XLN A;  1K25 A;  4GNU A;  3S22 A;  2XQZ A;  3OPP A;  2WKE A;  4P6B A;  3TG9 A;  1H5X A;  1HVB A;  1S0W A;  1YLZ A;  2EX8 A;  4QD4 A;  1Y54 A;  1EWZ A;  3C4P A;  1I2S A;  3WS5 A;  3M6B A;  4HES A;  2DNS A;  1EI5 A;  2Y55 A;  4N1H A;  1U60 A;  2IWC A;  3ZVW A;  1QME A;  1SHV A;  3HLD A;  1LI9 A;  1FCM A;  3BYD A;  3G30 A;  4EBN A;  4OH0 A;  3IXD A;  3HLW A;  3TOI A;  4QU3 A;  4Y7P A;  2HP9 A;  4E3N A;  1TDL A;  1MWS A;  2EFX A;  3ISG A;  4S2N C;  5A90 A;  2Y4A A;  4YFM A;  1K54 C;  4GN2 A;  2ZQ8 A;  3SS3 A;  3UE1 A;  4DE1 A;  3DWK A;  5HW3 A;  1E3U A;  3UPP A;  1YLP A;  1ESI A;  2VGK A;  4KQR A;  1L0G A;  1FSY A;  2Y2J A;  2R9W A;  3ZDJ A;  2PU4 A;  5AQB A;  1JWZ A;  3V50 A;  3VMA A;  4PM9 A;  5J8X A;  5EVI C;  3VFH A;  2Y2I A;  5U47 A;  1PI5 A;  5DF7 A;  4R4S A;  4K0W A;  2ZM8 A;  1XXM A;  1KGF A;  2PU2 A;  4X53 A;  5CTN A;  2UWX A;  3B3X A;  3MZD A;  1BLH A;  4KZ6 A;  3EQU A;  2WZZ A;  4R3J A;  1PIO A;  3IT9 A;  1MY8 A;  1MKI A;  4DDY A;  4OQG A;  5GHY A;  1YMX A;  4KZA A;  1I5Q A;  3HL9 A;  1IKG A;  2JBF A;  3GVB A;  2ZLY A;  3G34 A;  4JLF A;  5AQ7 A;  3WWX A;  4R23 A;  2V2F F;  5CED A;  2Y2N A;  2WAD A;  3DWZ A;  5E2E A;  3D4F A;  3VOZ A;  1GCE A;  5KZH A;  4OP8 A;  3MKE A;  3Q1F A;  1E25 A;  4OOL A;  1YLT A;  2Q9N A;  3MFD A;  1IEM A;  3OCL A;  4FD8 A;  4GOG A;  1IKI A;  3Q7V B;  5F1G A;  5GLB A;  1WYC A;  2Y2P A;  2ZC5 B;  4UA9 A;  2HDU A;  3RXX A;  4QY5 A;  1MXO A;  1ALQ A;  3OZH A;  1BTL A;  5EUA A;  1PWC A;  3FYZ A;  3ZNY A;  3MXS A;  3PTE A;  2ZD8 A;  3O88 A;  5FAO A;  4JPM A;  4BL3 A;  5CTM A;  3G4P A;  3WRT A;  5DVA A;  1XKZ A;  2ZQC A;  1YLW A;  4OLG A;  1S6R A;  1JTG A;  2EX6 A;  4HBU A;  2HDR A;  1BLC A;  3FWL A;  5M19 A;  2JCH A;  2ZJ9 A;  3FKV A;  1K56 D;  2OLU A;  2ZQD A;  3A3J A;  3IH9 A;  4OQI A;  3C5A A;  3SH8 A;  3SH7 A;  3UE3 A;  4E6W A;  3AGD A;  4S2O A;  2I72 A;  3M6H A;  3ZFZ A;  4OPR A;  1GA0 A;  2WGW A;  1N9B A;  1NJ4 A;  5IHV A;  5TGF A;  5GHX A;  3AGE A;  1K56 A;  4K0X A;  2X02 A;  4U3T A;  2DCF A;  4BQM A;  3A3E A;  4N1X A;  4LCL A;  1M6K A;  4S2K A;  5EVI B;  3PAE A;  4FCF A;  2C5W B;  3OPH A;  5HAI A;  4RX3 A;  3VP3 A;  3GTC A;  1JTD A;  4GDB A;  2BLS A;  3N8L A;  3Q82 A;  4UAA A;  4Q8I A;  2BG1 A;  4DE2 A;  1PWG A;  4JF4 A;  1PW1 A;  3QNB A;  4P0M A;  4WZ5 A;  3NDG A;  1ES4 A;  3IWQ A;  4N9K A;  5GLA A;  3NC8 A;  1KGG A;  1H8Z A;  2FFY A;  5L2F A;  3IXB A;  4X55 A;  3HLF A;  3S1Y A;  3DW0 A;  1AXB A;  4KZ8 A;  4LV3 A;  4BJP A;  3ZG8 B;  3IH8 A;  1RGZ A;  1N4O A;  1ES3 A;  2FFF B;  5TR7 A;  3UN7 A;  4KG5 A;  4N9L A;  2WZX A;  4MEZ A;  3BRM A;  2CC1 A;  4X69 A;  3LY4 A;  1BLS A;  2A3U A;  1K38 A;  2V1Z A;  2Y2Q A;  4FH2 A;  3VP4 A;  1O7E A;  2R9X A;  1J9M A;  3W4O A;  3HBR A;  1G68 A;  5G18 A;  4JF5 A;  1MWU A;  3IXH A;  1CK3 A;  2ZQA A;  4DDS A;  4MBK A;  1KVM A;  2WKH A;  1K55 A;  3HLE A;  4LV2 A;  2HDS A;  3W4Q A;  4Y0O A;  4KZ5 A;  2VGJ A;  3JYI A;  1K57 A;  3ZG5 A;  1BUL A;  3IF6 A;  4ZBE A;  1XPB A;  3OPL A;  2XFS A;  1SCW A;  4WMC D;  1YLJ A;  1DJC A;  3C7U A;  3LCE A;  4QB8 A;  1H8Y A;  2JE5 A;  4S2L A;  5HAR A;  3N6I A;  5FQ9 A;  5HAQ A;  1KDS A;  4OON A;  3W4P A;  3PAG A;  3QHY A;  2P74 A;  4KZ4 A;  5BOH A;  2Q9M A;  5HFO A;  2Y2L A;  4PPR A;  1LI0 A;  4RA7 A;  4XUZ A;  3LEZ A;  3HLG A;  2J9P A;  4KZB A;  3PBO A;  1IYP A;  1BLP A;  3VOY A;  2G2U A;  3MKF A;  3NY4 A;  5DTK A;  4XXR A;  4LEN A;  4OVD A;  4EQI A;  4UHU A;  4RVA A;  3NIA A;  1PW8 A;  3G35 A;  3A3F A;  4EUZ A;  1L0D A;  2XEP A;  1FR1 A;  4ID4 A;  1KVL A;  4JF6 A;  2J7V A;  1QMF A;  3V39 A;  1NYY A;  5E2H A;  2WAE A;  3IXG A;  4S2J A;  4WEK A;  1LLB A;  3S4X A;  4NET A;  4OKP A;  4N92 A;  4IBR A;  2ZQ9 A;  1NXY A;  1ERM A;  4KZ7 A;  4MLL A;  4EV4 A;  5AQ9 A;  4JXW A;  3AGF A;  5FSR A;  4E3M A;  1FR6 A;  4QHC A;  3UY6 A;  5F1F A;  3QNC A;  1NZO A;  1ZC2 A;  3SS4 A;  4KQO A;  4K91 A;  3EQV A;  3W8K A;  3E2L A;  2B5R A;  1K4E A;  5CHM A;  4C6Y A;  3UPN A;  1O07 A;  4DE0 A;  2WGI A;  2P9V B;  3VSL A;  3BEC A;  3Q07 A;  3ZG9 B;  1XGI A;  1LL5 A;  2X71 A;  4HEF A;  4X68 A;  3WS4 A;  2Y91 A;  5FA7 A;  1K57 C;  5EVL A;  3IF6 C;  4ZJ3 A;  1SDN A;  3GMW A;  5CER A;  1SKF A;  1C3B A;  3NDE A;  1ONH A;  3GSG A;  2IWD A;  4L0L A;  3BM6 A;  3ZGA B;  4E6X A;  1JWV A;  4BD0 A;  2PBY A;  2WGW B;  3OPR A;  2DRW A;  5FQM A;  1BUE A;  4OOM A;  4YIN A;  3N7W A;  5FQI A;  4BL2 A;  2XK1 A;  5A93 A;  4U0X A;  5KMW A;  2GDN A;  1IYS A;  3N8S A;  1BSG A;  5EE8 A;  5GHZ A;  1ERO A;  1NZU A;  4ZDX A;  1XP4 A;  1FQG A;  1HZO A;  3OC2 A;  4BLM A;  5FAT A;  1CI8 A;  1FCN A;  2A49 A;  5HX9 A;  1PI4 A;  3VP2 A;  5GLC A;  5CXW A;  3BFC A;  4D2O A;  4ZJ2 A;  1FOF A;  4PM7 A;  4B4Z A;  1W7F A;  2Y2K A;  3GR2 A;  4OLD A;  2EX9 A;  5CGS A;  3ZNT A;  5KSC A;  1RCJ A;  4JKT A;  1WE4 A;  3O3V A;  3BLS A;  2XD5 A;  4R1G A;  1ERQ A;  5FQQ A;  4ZJ1 A;  4X56 A;  2EXA A;  3N4I A;  5CRF A;  2WKI A;  3G32 A;  2IWB A;  4GD8 A;  4OQ0 A;  3CJM A;  4PMA A;  1DJA A;  3NI9 A;  4OOY A;  5CEB A;  4M3K A;  4UA6 A;  3GRJ A;  3P09 A;  5FAQ A;  5GL9 A;  4OQH A;  5EOO A;  4BD1 A;  1ZKJ A;  4LV0 A;  3C7V A;  3LY3 A;  1YLY A;  2Y2H A;  5I94 A;  1XGJ A;  2HDQ A;  2XFT A;  5JYP A;  3VFF A;  1GHI A;  1E4D A;  2G2W A;  1YM1 A;  3BFG A;  4E3I A;  3HRE A;  4C75 A;  5EVI D;  3IF6 B;  2J9O A;  4HBT A;  2XD1 A;  4R0Q A;  3VP0 A;  4JXS A;  1K54 A;  2Y2M A;  4MBH A;  3OCN A;  1FSW A;  5FAP A;  4P87 A;  1L2S A;  1SDE A;  4OP5 A;  2WUQ A;  1ES5 A;  2Y2O A;  2HP6 A;  4S2P A;  5GLD A;  2XGN A;  2QZ6 A;  1RP5 A;  2E8I A;  2H0T A;  4KG6 A;  3IWI A;  2OLV A;  3IF5 A;  3SS5 A;  1Q2P A;  2EFU A;  2JC7 A;  5EVI A;  1VM1 A;  2ZC7 A;  3BLM A;  5KSH A;  3SH9 A;  1M40 A;  1K4F A;  2ZM2 A;  3G2Y A;  4OPZ A;  5E2F A;  1XA1 A;  3ITB A;  1CI9 A;  4PM5 A;  2Y59 A;  3CG5 A;  4EWF A;  3C4O A;  2ZQ7 A;  1HTZ A;  1KE0 A;  4P85 A;  4DKI A;  3M2K A;  2ZC6 B;  4WEL A;  3WS2 A;  4CPK A;  1TDG A;  3FZC A;  4JXV A;  1CEG A;  3PBT A;  3MXR A;  3HLB A;  1GHM A;  3IWO A;  4KQQ A;  4WYY A;  3ZVT A;  3WS0 A;  5CGW A;  4B4X A;  3NCK A;  4E3K A;  4WMC A;  5CEC A;  2J8Y A;  4WZ5 C;  3HVF A;  3BFD A;  1PZO A;  1TEM A;  3UDF A;  5FAS A;  1MWT A;  3HUO A;  1GHP A;  4KG2 A;  4MNR A;  1LHY A;  1WYB A;  1ZG4 A;  4FH4 A;  3RXW A;  2WAF A;  1YT4 A;  5E2G A;  3IHA A;  5FI7 A;  1I2W A;  1E3U D;  1IEL A;  4O7D A;  1Q2Q A;  1L0E A;  1W5D A;  4WBG A;  3ZG0 A;  4R3B A;  1OME A;  2EX2 A;  4DE3 A;  4EBL A;  3FV7 A;  3HLC A;  1XX2 A;  3HUM A;  5FI6 A;  1DJB A;  1ES2 A;  5A91 A;  2ZM0 A;  4LCM A;  2XR0 A;  2XF3 A;  4DXB A;  4RYE A;  3GV9 A;  3IHB A;  1KGE A;  3UE0 A;  4S2M A;  3RJU A;  2V20 A;  4U0T A;  1JVJ A;  5M1A A;  1G6A A;  3Q7Z A;  4ZTK A;  1KE4 A;  4DF6 A;  3UDI A;  1K55 C;  4C3Q A;  5E43 A;  2OV5 A;  4DXC A;  5CGX A;  3DTM A;  3VP1 A;  5HL1 A;  2QMI A;  2WK0 A;  3MZE A;  2OSU A;  3GQZ A;  4Y0T A;  5M18 A;  3I7J A;  2Z2L B;  3ZCZ A;  4WM9 A;  2ZC3 B;  4Z9Q A;  4IBX A;  1FCO A;  4KZ9 A;  4F94 A;  5A92 A;  1NRF A;  3MBZ A;  1PYY A;  4RX2 A;  3BEB A;  5FI2 A;  4DRT A;  3UDX A;  4PM6 A;  3O86 A;  1W8Y A;  3BFE A;  1ESU A;  1YQS A;  3NBL A;  1CEF A;  3PBN A;  4IVK A;  1JWP A;  1LL9 A;  3V3S A;  1IYO A;  5D3O A;  4Y0U A;  1BZA A;  3N8R A;  4KEN B;  1L0F A;  5JYO A;  3M2J A;  1BT5 A;  4JXG A;  4E3J A;  1MPL A;  4WZ4 A;  2P9V A;  4A5R A;  3V5M A;  4FSF A;  2H10 A;  2HPB A;  5DF9 A;  4XUX A;  5HAP A;  3CMZ A;  3CZD A;  2ZC4 B;  4E3O A;  1W79 A;  3Q7V A;  4MBF A;  5FDH A;  2X01 A;  5EEC A;  4GZB A;  3A3I A;  4EBP A;  2Z2M B;  4GD6 A;  2XH9 A;  5DTS A;  1ZG6 A;  1ONG A;  4QJG A;  3PBS A;  2C6W B;  1MBL A;  2RCX A;  4GDN A;  5FQJ A;  5EPH A;  2H5S A;  4X6T A;  5FQK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...